4CLHA

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
267
structure length
252
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQKSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PTERIDINE REDUCTASE 1
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
total genus 92
structure length 252
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4clhA00
2RHCA 1UJMA 1PZHA 1PJCA 4KDFA 4ZVVA 1A4IA 1LJ8A 3CZMA 3VPXA 1XG5A 3GQVA 4RCVA 2GR9A 3UCFA 1RM0A 1PIWA 3GOHA 3JQ8A 1CDOA 4E5MA 3WGYA 4YJDA 4WKGA 1PJSA 3KSZO 4DGSA 1MUUA 2J3KA 2NU8A 3WJ7A 3WLFA 4FR5A 1BVRA 1LQUA 3NDIA 4II3A 3B1KA 4CR6A 4R51A 1CEQA 1XQ1A 4UUMA 4E5KA 2GYYA 3GVHA 5KIAA 3ETGA 4ND3A 4Z6KA 5KTKA 2QQ5A 3HFSA 2B5VA 2GASA 1MX3A 2NU6A 3FBGA 1NM5A 1V3VA 2QZZA 2Y1OA 4XYBA 5ENDA 5DCUA 1YE3A 4XQCA 5A06A 5U1PA 2EF1A 4CUZA 2VWPA 2X0IA 5EINA 2Y0CA 1H6CA 2BGLA 3N7UA 2NU9A 2XXBA 4NMHA 3TOXA 5CPFA 3T7EA 2YV2A 3HDQA 1N7GA 3HB5X 4CL3A 1WWKA 4PG6A 4J1SA 8ADHA 3CXRA 4BNGA 4YAJA 3RUIA 3RBXA 3JQ8B 4RDIA 4WLEA 4L9RA 4RVFA 4FJ2A 2WMDA 3LT4A 4JGBA 1YBMA 2Z95A 4URFA 3PXXA 5LDHA 3AI1A 1RM3A 4CM8A 1JWBB 2HJRA 3NYWA 4MKRA 2V6GA 2GZ1A 5T8KC 3WX0A 1YWGO 1QV6A 1Y81A 3RD5A 3ZWVA 2DKNA 2ZTMA 5DOVA 1KC3A 4BNFA 3AY7A 2IDZA 3TZKA 2C54A 1XR3A 3H5RA 4DYDA 4Z0HO 3C8MA 4E12A 4TWRA 3WQRA 4J43A 2ZQZA 1X1TA 1YOVA 1SNYA 2P2SA 3GC6A 3OJ0A 4WK6A 3V2UA 1AXGA 2X7HA 3K5PA 4FJ1A 1DFGA 4ZGWA 4BS9A 4XGKA 1TVEA 2H1SA 2ZB7A 4S1VA 4GX0A 1NASA 1YVEI 3CEAA 4EJMA 3DZKA 3H9UA 3UGKA 4AJ1A 5KJEA 3RROA 2Q4EA 3HFGA 4YAIA 1KEWA 3I6QA 4Q9NA 1LBEA 1DFHA 1YONA 3JTMA 4CM8B 3MWEB 1JVBA 5IN5A 4DTIA 1HDCA 2J6IA 4O5OA 3RJ9A 2Y0EA 5JW6A 4PGFA 4BGEA 1DPGA 2POQX 4Z9FA 3ICPA 1GY8A 3KYCA 2Z1MA 4B3HA 4LGVA 5LCXA 1VM6A 3TPCA 3F4BA 4GMFA 2GF2A 5ENVA 4LW8A 5EL0A 1ZNQO 1MG5A 5L51A 3UFXA 1YOVB 1U5CA 4W6ZA 4CM7A 3SEFA 1GUZA 1UZMA 3IUPA 1ZMTA 2DUUA 1KBZA 4QO7A 2PGLA 2Y1CA 2JCXA 1HE3A 2B4TO 2HMVA 2OO5A 2GPTA 2O7SA 5JAQA 3RASA 3F4LA 3QVOA 5I9MA 3WLEA 2PKQP 1P1IA 2Q2WA 1I3KA 2PD6A 3VDQA 2AQHA 2YV3A 1XCBA 3FRJA 3JQFC 1DHRA 2W2KA 4I5DA 3U62A 4I9UA 4MVJA 1ZK3A 3BHIA 5T8KA 1E0DA 4DUPA 2PR2A 2Y66A 4R1SA 4WLVA 5H82A 4W99A 1BG6A 2R6JA 4MVJG 4JP2A 3U4DA 4WLFA 4U0KA 4RPHA 2ZCUA 2VNSA 3PQDA 4WE3A 3SC4A 1JKFA 1HKUA 4BNYA 3OA2A 1I30A 2HMTA 1E3IA 3NTOA 2Q50A 2B36A 2HRBA 3PQFA 1BRMA 1P45A 3WIDA 4KMSA 3I4CA 3C7DB 3FNEA 3KHUA 3W6ZA 2Q49A 5L4NA 1F17A 1MP0A 4E5PA 4F3YA 4BGVA 2Y05A 3WGIA 2VYVD 1X14A 1O95A 1BXKA 1LXCA 3HQ4O 4LK3A 4CLRB 1VRWA 4YQZA 1LLCA 3MOGA 2P4QA 3TRIA 4GWGA 2VZ9A 4FPXA 4GH5A 1NHGA 1NTOA 5HTOA 1T24A 2FHSA 4J3FA 5G0VA 4XDZA 4YWJA 4KOAA 2JHGA 5TGDA 5B4VA 3ZHYA 3RFTA 2FSSA 2UUPA 2J3JA 4ZICA 5JFOA 1NFRA 3K30A 1OOEA 4NQZA 1E7WA 3I83A 3Q9UA 1GQQA 3GZNB 4AJHA 5IDYA 2Q2QA 3BTVA 2FY8A 2YHUA 3E6AA 3C7AA 2VWHA 3WWZA 3AWDA 4O6VA 1Y9AA 2R2GA 1I36A 3STHA 2ZYGA 2AEMA 4NZ9A 3AOEC 3MWDB 3ON5A 1X7DA 4GSLA 4QFCA 3RBZA 3W8FA 5U4QA 3BHJA 1FDWA 3ZI0A 2W8ZA 4OM8A 5C7OO 2QW8A 3H7AA 1I0ZA 1E7YA 1PR9A 2O4CA 4J1TA 1ISHA 3PFFA 3K31A 5TS3A 4BNXA 5CDGA 2BMAA 2CDAA 2VQ3A 1WZEA 3WR5A 4TVBA 3FNHA 3PJEA 1DAOA 1PGJA 2PZMA 4FCCA 1P74A 3I9MA 4DLAA 5TC4A 3GN1A 2PV7A 1WMAA 4RF3A 5ER6A 1X1EA 2DTEA 1B7GO 4B4WA 1EZ4A 3HDYA 3PIIA 3JD0A 5LC1A 5THKA 1SEPA 3L9WA 4NFHA 4C7JA 1I2ZA 3UHAA 5BSEA 3WSWA 3ASVA 4RVDA 3WTCA 1GEGA 5JPIA 5TJ9A 1CWUA 3UXYA 1HYEA 2C07A 1JKIA 1D1TA 4FOOA 3GY0A 4RPJA 2C5EA 1HZJA 2FWMX 1RM5A 2D59A 3TZ6A 3O03A 6LDHA 2X8LA 2VHZA 3EVNA 3ENNA 1E6EA 4D0SA 4PZDA 3CSDA 2O3JA 2B4QA 3TSCA 3NDRA 3L9XA 1I2CA 2NUAA 5IN4A 1X7GA 1LDMA 2Y1EA 3ONFA 4L76A 4ROSA 1BSVA 1G1AA 2AXQA 3GDFA 3S2IA 2RCYA 3TNLA 2WTBA 4LMPA 3RSHA 1UP4A 7MDHA 4U0JA 1A71A 4YACA 1BW9A 1XKQA 3GG2A 3HN7A 2AE2A 2G5CA 3E8XA 3JQ9C 3ZU2A 3GDOA 5JAMA 1DHTA 5DCYA 2I5PO 2AE1A 2BKAA 1UDCA 4BO8A 2FZEA 1T2DA 4I5GA 4XGNA 4YQYA 2RBEA 1ONPA 3NJ4A 4K9DA 4X54A 4DWVA 2JCVA 2V6MA 3DFZA 1EK5A 4Y9DA 4E3ZA 5CEEA 1Z75A 3WGTA 2EG9A 4BQPA 4E30A 1HXHA 4IGFA 4WUVA 4YJGA 3RJ5A 4WJZA 1LDEA 4G5HA 4A03A 5JCXA 3H9GA 3A06A 1PWXA 1HDOA 4I9HA 3QSGA 1RWBA 1IOLA 4I08A 1VL6A 4ZRMA 4GVXA 4N5NA 1U2GA 3OF2A 2NNLD 1JLLA 1Y8RB 1G0NA 1NVTA 3D7LA 4I8XA 3TZQA 4CQLA 1FDSA 3SBOA 3B1FA 3VZQA 4F6LA 5B4TA 1PJLA 1PJ2A 2B69A 5JC1A 6ADHA 2Y0DA 2ILTA 3KBOA 1E3LA 2AMFA 1XELA 5LDGA 5BSGA 1H6BA 3BA1A 1ZVMA 3QE3A 4BKQA 4R1NA 1D3AA 1TT7A 2YZ7A 1PGQA 4XRRA 3WSVA 1BW9B 1JU9A 5HS6A 2IE0A 1DJNA 1LA2A 3HHPA 3FHLA 4FGSA 4DPKA 1UXKA 3QVXA 3U4IA 4YT2A 2CZCA 1IUKA 4JNKA 4CMGA 2FRDA 3BIOA 1UXHA 5MDHA 4OKNA 1Q7GA 4M87A 3ZV5A 1YL6A 4MKZA 3ZCXA 2C7VA 3O26A 1LU9A 3Q3CA 1EMDA 3QIVA 2UDPA 2X5JO 3QRWA 4YJGB 3EYWA 3FWNA 4M89A 2B0JA 4J49A 1Q1NA 1ZXBA 1QLJA 1LQTA 1MV8A 5A9RA 3ZWOA 1HSZA 2WDZA 3AI3A 2VCYA 2VHYA 4BNIA 4FGWA 5A5EA 4A10A 5A02A 1T1SA 5KCZA 4NPCA 3VAZA 4CQMA 3A28A 3PDJA 8LDHA 3UVEA 4E31A 2BGMA 2AG5A 1VPDA 2DU8A 5TLSA 3NX4A 2D8AA 3JYOA 5A9TA 4CM5A 2WYVA 4PFJA 1EDZA 1P33A 3JQ9A 3KSDO 3M2TA 3U09A 4XB1A 1PU2A 1O9BA 4FDAA 5DBGA 1LEHA 2HO5A 4JK3A 1OBFO 3RQSA 1HLDA 4CM9A 3TDKA 1I3LA 1KC1A 1SCUA 2OP0A 2X58A 4PLFA 3ABIA 5J23A 1V9LA 2HUNA 3KSUA 4UUPA 1OMOA 2I76A 3TJRA 3B20A 1U9JA 4BV8A 1R15A 2O7QA 4GI2A 4GX5A 3JD4A 4EJ6A 5B1YA 4DIOA 2IZ1A 3QV1A 1Q0QA 5A1TA 1LC3A 2NADA 2ZJ0A 4KDEA 1GQ2A 4UULA 1YB4A 5GY7A 3V1YA 1HSOA 3EDMA 2B5WA 1GUFA 4Q3AA 4B4UA 1IL0A 2OFPA 3X2EA 4NBVA 2VTEA 1H9AA 5IDQA 1XIVA 3S55A 1GAEO 4R3NA 5KKCA 3IOYA 4IGEA 1EVYA 3I3OA 1WNTA 3WB9A 4RJTA 3M1LA 2ZK7A 1BHSA 3IKVA 2DBQA 1ADBA 3KLMX 3E18A 3W8DA 5I9NA 1GCUA 1KVSA 1C0IA 3IAHA 4OSOA 3T7CA 4KUEA 4PLCA 4BL5A 1QV7A 5A05A 1MXFA 1Q7CA 3DOOA 3FR7A 4YAKA 3JV7A 3CIFA 2IXAA 5JC8A 1W4ZA 1W73A 1SC6A 4YT5A 3Q11A 2GZ3A 3IL2A 2VHVA 1HYHA 1LUAA 1GU7A 4GKBA 3OIDA 5KVSA 1YDWA 2JAHA 4CMIA 3DO5A 5JMPA 5KJ6A 3MTGA 1ARZA 2ET6A 3U9LA 3BMNB 3MJ4A 4AJ4A 2JFHA 4PLHA 5BSHA 4IBOA 4LCEA 3QY9A 4J2OA 2GDZA 2PKRA 1GYPA 2G82A 2LDXA 4WPGA 1W0CA 2BELA 4B79A 4PLGA 5C3MA 4TSKA 3ROQA 1ZEMA 1YXMA 3K2EA 1MA0A 4XYGA 4PG8A 5JCJA 1EBUA 3P7MA 1F06A 3WGZA 5AYVA 4B7CA 4CM3A 4G81A 3PWZA 3UOGA 2C0CA 4J2HA 3UF0A 1DC3A 1UDAA 4PG4A 3CZRA 4PG7A 3OJLA 4IJVA 5G4KA 3KLPX 4N5MA 4OXNA 4CLXA 2OBYA 4CMIB 2DVMA 1LDGA 4J90A 3KEOA 1YQGA 3ADPA 3CMMA 1GEEA 4U6QA 4XJTA 5IZ4A 3F9IA 3GPIA 1YGYA 4KZPA 4DIBA 4DMLA 4EGFA 3SVTA 1C0LA 5DOZA 1GZ4A 4XJSA 3PWKA 3W4IA 3WS7A 3Q1LA 3TFOA 2I6TA 1FK8A 4Y98A 2O23A 1I32A 4Y67A 1K3TA 3ROMA 3WGGA 1ENOA 3JQAA 1N7HA 3VOSA 1ZKMA 2OBNA 1NPTO 1XHLA 1J49A 5G4LA 4D45A 4K6CA 3VKVA 1NAIA 4ZQFA 4MOWA 4ZN6A 5IDXA 3NJ8A 3OQBA 5K9ZA 3UAGA 1NP3A 3I9OA 3H5NA 4IDAA 3D5QA 3ZHZA 2E49A 4D3SA 1NX6A 3ZHBA 4S3MA 1PR3A 4ONEA 4AG3A 4YCAA 5TF4A 1U4OA 1ZIDA 1QYXA 3Q2IA 4GGPA 4FB5A 3BMOA 1S6YA 3VH4A 1L1FA 2OZPA 4R01A 5ADHA 3ITDA 2O2SA 4A5OA 3INRA 3IP1A 4HNHA 1E1KA 1UDBA 4FN4A 5AXAA 4GAEA 3PJGA 3KTDA 2NTVA 1ISJA 1NWCA 5CHEA 1T4BA 4P38A 2QYSA 4M86A 2VRBA 4J1QA 1IYZA 5JXWA 2OOSA 5FYDA 3TOZA 4W7HA 1PS0A 2HKIA 4TZTA 3JQAB 2BLLA 3FD8A 4IDCA 4ILKA 4J16A 4MVJI 2CFCA 4WGGA 4RVGA 4JQCA 4JBGA 4XWYA 5H81A 3OICA 3BTOA 1VC2A 3H9JA 1ZSVA 3S2FA 1N1EA 4FJ0A 4GX1A 2WSBA 4GLOA 3LYLA 4RVHA 3VPFA 3VPSA 2EERA 4BGIA 3RC7A 4GGOA 4EDFA 9LDTA 1T4DA 3D3WB 2P9CA 1DFIA 5CDSA 4PIVA 1NVGA 5I9LA 3QWFA 3BMOB 4HADA 4IDEA 1QKIA 3VH3A 2JD0A 1I2BA 1PL7A 4KQWA 5A03A 1GYQA 3WTBA 1DRWA 1KY4A 3ADOA 5G0WA 4BIIA 4BO5A 1LRKA 1RYDA 1R37A 1VL0A 3ICCA 4E2YA 1CERA 1ONNA 3LF1A 4E33A 1DBVO 2VNAA 1PTJA 3U5TA 4AJ2A 3BXXA 4BO4A 1CETA 3BAZA 1E7MA 3IDSA 4UEOA 4CR8A 3JQEA 1ONOA 1UH5A 1DC5A 3ETDA 3IJPA 3ONEA 1N9GB 1IE3A 2O3UA 2WYWA 3OMLA 4EUEA 4XRGA 4P4LA 4LN1A 4A26A 5DT9A 2X23A 5HWSA 3RC2A 3ZWNA 3A14A 3M1AA 1D1SA 4UUNA 5EERA 3PQEA 4J4HA 3WMWA 5COQA 4IZIA 2XPCA 3FI9A 3OETA 4E2ZA 4H15A 1DO8A 4FIZA 1HDZA 2CF5A 1DIBA 3EUWA 3JQGA 5KVQA 1RPNA 3NTRA 1QMGA 1LTHR 4CM6A 4EZBA 4BNNA 4MVJM 2EP5A 2J3HA 2BGKA 4RGBA 4FD3A 2BFMA 2X9GA 4IDDA 3Q0EA 3GF4A 2GUGA 1NQAO 1E6WA 1EFKA 3VC7A 1YB5A 4FFNA 2Q99A 3DBRA 2CF6A 4NBTA 5AQ1A 2HQ1A 2YUTA 3ANMA 4IINA 3OJEA 1X0XA 1UR5A 3D1LA 2QX7A 1E3JA 1B14A 2UAGA 3QLJA 3AM4A 1MFZA 4J4TA 4PVDA 4RL6A 3H8VA 2C2XA 2CUKA 1LLUA 3GNQA 1X13A 1M75A 4IJKA 4WLOA 1NYTA 4PZCA 5B12A 4F6CA 3C3XA 3DZIA 1LDBA 1XU7A 4OXKA 1SEVA 3I5MA 1LLQA 2RIRA 4FFPA 1B2LA 4GMGA 1IY8A 4RV9A 5I7FA 1PL6A 5G0TA 3LC7O 1LRLA 3KB6A 4A2CA 4XGIA 1U28A 3TZCA 5L45A 2FPIA 4PLPA 3VVBA 1G0OA 1VI2A 2PY6A 4OL9A 3PWSA 4XKJA 4XYMA 3OBBA 4QXMA 4MVJE 3DBRB 1LSUA 3GPDG 2V6FA 4K1LA 3IMFA 4R68A 4Q3EA 4ALKA 4AVYA 4GPD1 4EITA 3ZN2A 5JYDA 4OOEA 2PKQO 3GAZA 2B4RO 1FDTA 3ZNOA 4R4JA 3RFVA 1O0SA 2JKVA 3QVTA 3B1JA 4QT0A 1BXGA 1NPDA 1PGPA 5U9CA 4TRJA 3PJDA 3H6KA 4L74A 3ZU4A 4R5HA 1ISIA 3W8EA 4CUKA 4TRMA 5F5NA 4K6FA 5DN9A 1ZK4A 1AXEA 4J6FA 2OL4A 4XQGA 2GZ2A 3AOGA 2CSUA 1ISMA 3VKUA 4PCVA 1SBYA 4D41A 4RPKA 3CMCO 3PYMA 1LNQA 4MVJP 2QRLA 3BHMA 2ZATA 4WEQA 3SC6A 1Y1PA 2FR0A 1YQXA 2E82A 5AXBA 3LDHA 1EE9A 3VZPA 1V8BA 2Y93A 3T4EA 5L95A 4D46A 4CM9D 2GERA 4NDNE 2X4GA 2X9NA 3RFXA 4II2A 4I9NA 1IHXA 5JAIA 3JYLA 4DL9A 4RVSA 3JQ6A 3G17A 3LSYA 3FTPA 3OH8A 4AICA 1MG0A 4KUHA 4PLWA 4MJLA 3DZBA 3EZLA 5A3VA 3OECA 1BXGB 4QUKA 1F8FA 3ULKA 5JY6A 3G49A 5GZ3A 3RUDA 3ITKA 4AJPA 3DC2A 3KYCB 5IZCC 4Z3DA 5JDCC 2XF8A 3BMCA 1Y5MA 5F1PA 2VTDA 3VPGA 3HE3A 3FTNA 4LSWA 4Y6PA 3EC7A 2DPHA 1J0XO 4BV9A 4P22A 1GQYA 4CMHA 2EKPA 3KM0A 3E9MA 4K28A 5EQFA 1L7DA 3RU9A 2BI8A 2NVWA 3E5RA 4EI2A 3BTSA 1XQ6A 4FW8A 4WCFC 4IDFA 2A94A 4FC6A 1PL8A 1X7HA 1A4UA 3NT2A 2OORA 1B26A 2PNFA 1IPFA 2Q2VA 5T67A 1GUYA 4BB6A 2PWZA 1PJTA 4P4NA 4KTTE 4TROA 3R0IA 4ALLA 2W2KB 4MPDA 4O59O 1Y5RA 3UICA 1HWYA 4IY1A 3GAFA 1CQJA 2DPGA 4JCOA 3D0OA 3OA0A 2EJWA 4N18A 3W4JA 2D5CA 2NWQA 3PYXA 1SB8A 1Z7BA 1M67A 2C7GA 3GZ4A 4W7IA 1UXGA 4AJNA 3Q2KA 5EMHA 3SJUA 3PHGA 1CRWG 2C59A 1P1RA 3MJVA 3BMCB 5JBIA 1QP8A 4DVJA 5KWEA 4XB2A 1I01A 4D3DA 3TF5A 5IF3A 3ROKA 4DQXA 3LT2A 2H5LA 2JD2A 2V7PA 3AU9A 4LVUA 1IULA 3GUYA 5JCJD 2Y1GA 3PHLA 4B8ZA 2GN8A 3AU8A 4CV0A 3KZVA 1EE2A 1EQUA 3ZH2A 3VH1A 3ZDFA 4CJXA 1RM4A 1BWSA 2FZWA 3HSKA 1RJWA 3KUXA 4NR0A 4CODB 4NJOA 3LF2A 4E2XA 3JQFA 1E1NA 3K92A 2PZKA 4GL4A 4BNKA 3F5QA 3Q6IA 3I1JA 2RH4A 1B0AA 1HE2A 4IS2A 1LLDA 5DDIP 2C5AA 3FF4A 3RUHA 2OHXA 4GSKA 4MIEA 5TSDA 1I8TA 3UCEA 4ND1A 5THQA 2D2IA 3QWHA 2Y1DA 4DQUA 4YYZA 1DOHA 5L7TA 1N8KA 4IIUA 2W2LA 1KVUA 4W9NC 4KTVE 4CMKA 3F47A 1YDEA 1HLPA 2G1UA 3UH1A 1E3SA 1I3MA 1Y7TA 4ND5A 3LZ6A 4D3FA 2VZ8A 4Q39A 4DLBA 2PLAA 4B3JA 4RLHA 3EVTA 1GPJA 4WCFA 2FMUA 3BYZA 3JQAD 3JD3A 5HBRA 4Z3KA 4C4OA 3D4NA 4MINA 4IMPA 4PLYA 3WNQA 3D64A 1CQIA 4FBGA 5TT1A 2FR1A 4BMNA 3DBHA 3GFBA 5CDUA 1WVGA 5G0SA 3OSUA 1Q7BA 4CM1A 1MC4A 1U3WA 4HWKA 4CMCA 5CG1A 3EK2A 1LSOA 5FI5A 3C85A 1O94A 1OZAA 3K6JA 4BKRA 1E6UA 5ILOA 2W90A 4OYRA 4YJFA 2G76A 3L4SO 3ZV3A 3GN2A 3ST7A 3HG7A 5BNIA 4HFJA 4MIOA 1LSJA 2YJZA 1QXSA 2V65A 1UAGA 2W98A 3FNFA 2DBZA 1K0UA 1HL3A 1OAAA 4NI5A 4A0SA 1PGNA 3F1KA 5I7VA 4HKTA 3ZW9A 2FOIA 5DULA 3E03A 3E1KA 3C1OA 3IS3A 2V6BA 2YDXA 4IJWA 1O5IA 3PHJA 5AXCA 4BMSA 1M6WA 3LVFO 3UN1A 5A4DA 1QG6A 3BTUA 4RZIA 2HK7A 3AOEA 2DBRA 2P9GA 3G1TA 3RC1A 1C0KA 3ZWCA 4E5NA 3DZFA 4WCFB 4HX5A 5KJFA 1MB4A 3O8QA 1GPDG 4JROA 3PZBA 3KYBA 4GLLA 1IPEA 1JA9A 1ZBQA 1Q0HA 4J9VA 5COBA 3P5SA 4RZHA 3I23A 4IJUA 5AXDA 3OFSA 1OFGA 1VKNA 2Q45A 1XSEA 3F5SA 3FCOA 3DBHB 3HNPA 4R3WA 5CG2A 5CEJA 1MFPA 1Q2XA 1UZNA 1QR6A 2UVDA 2GSDA 3PK0A 3GRPA 1E3WA 5TIIA 4YBZA 3MZ0A 3DWFA 5BSFA 3MEQA 4M55A 5IXYA 4D42A 1X15A 3G0OA 2H6EA 4BNJA 3H2SA 4B4VA 2X0JA 2EGGA 1YL7A 4PRLA 2WWRA 3ZU5A 3R3JA 1U3VA 4W9NA 4IQ8A 4WOKA 2X9VA 4QECA 4UVDA 2HK9A 3C1TA 4DLLA 1ZEJA 3NRCA 3DMTC 4OMUA 5JAZA 3OEYA 3WGQA 2Z5LA 4DRYA 4LSMA 2PD4A 2PTGA 1ZK2A 2B83A 2O3SA 3VZRA 3W4KA 3LU1A 1AE1A 4G2NA 4MVJH 1DLJA 1EK6A 4UEJA 5ILGA 3WICA 4BKUA 2D3TA 3SLKA 4BKOA 1HETA 2VOJA 5I7EA 2QYTA 1ENZA 5L4SA 1I5RA 1PQUA 5T5QA 1C0PA 4WNIA 4QTZA 4YDRA 3OIGA 4XA8A 1U5AA 4CQLB 4OOFA 2ZCVA 4BNTA 4BO3A 5IFLA 4OJNA 2ZB3A 4N54A 4EYEA 5JLAA 4EUHA 5KOIA 1A7KA 1PX0A 3DTYA 3QA9A 4LRSB 4H16A 4LISA 1TEHA 4J91A 4BOYA 1MC5A 4JIGA 1MLDA 1B3BA 3PP8A 3L0DA 3HZZA 5FEUA 1PZFA 2X1HA 2WEKA 1AHIA 4WCDA 1HT0A 1T1RA 4CLEA 3DOJA 5TT0A 1DIGA 3WXBA 5CFZA 3PLNA 1SZJG 1B3RA 2NTJA 4EW6A 2NACA 1MGOA 2NTNA 5ITWA 1KOLA 3IUSA 1OC4A 4BGUA 1GADO 4FSHA 1DC4A 3TQHA 4ALIA 2QRKA 2YY7A 3NGXA 5DBFA 3U0BA 2GRAA 1JAYA 3CINA 4CQMB 1NXQA 1HE4A 1I24A 1XWFA 4D44A 1BGVA 1ML3A 4HY3A 1WPQA 1LSSA 5K6AC 2GN4A 1PS8A 4A73A 3P2OA 3RKRA 3OQ6A 1BDBA 3DHEA 3OHSX 4PG5A 4NIMA 3AI2A 3NT5A 1V6AA 3DMTA 1NQTA 5CAEA 1HZZA 1ZJYA 3ZWAA 2JL1A 2AG8A 5MGBA 1DRVA 3E5MA 2EV9A 3FR8A 4DYVA 3PPIA 5BQFA 4OQYA 3QP9A 1NR7A 1JWAB 3GGOA 2E48A 3V2HA 2BHLA 5COAA 1HDYA 4JJIA 3JSAA 4D7AA 1EUCA 5B37A 4AJIA 5ITVA 2NQ8A 4CV1A 3AK4A 2FPGA 4BVAA 2Q1SA 2BH9A 3UUWA 1PJBA 3ZNQA 4DREA 3GHYA 2VYVA 1PS9A 4I1IA 1K6JA 2BFPA 4BNHA 3QJ5A 2BFOA 4P4GA 4H7PA 4HBGA 3VTFA 4MKXA 4R5MA 3I4FA 2EIHA 3PJFA 4YJHA 3WFIA 1N5DA 3GK3A 4Y6RA 4CR7A 2DBVO 5FFFA 4QSMA 1KERA 2X22A 3IKTA 5IDWA 1EVJA 4TVOA 1ULUA 3DOCA 1SB9A 2HAEA 4J0FA 2TMDA 1NVMB 1YBAA 2EW8A 3AUSA 2AEFA 1HEUA 4OIMA 4YXFA 3PGJA 4J7UA 1Y6JA 4XYLA 2AQ8A 4CV3A 1O8CA 4NFSA 4PLTA 1VJ0A 2B35A 2EHDA 3G3EA 5JSFA 2QG4A 5F3RA 3NDJA 1T2FA 1FXSA 4ZQHA 4EBFA 2NVUA 3ZWYA 4MVJD 3JQDA 4B8WA 3K96A 3LC1O 4A27A 4D0RA 1Z82A 2WM3A 1JVSA 3DONA 1SOVA 3NEPX 4CLOA 5K6AA 4FS3A 4CUJA 2QIOA 1VSVA 1PSDA 4YJHB 4NHEA 1O89A 4R9RA 2GO1A 1Z45A 2NV6A 2P91A 3JQBC 5T64A 3INGA 2YHIA 4DA9A 1K2WA 3F3SA 3V1UA 1NFQA 2LDBA 3GMSA 2WD7A 4J4BA 3GUCA 2DUWA 1X0VA 2IEBA 1GV0A 2I3AA 3KO8A 3AFMA 3ZW8A 2GN6A 5G4KB 1NWHA 5IAAA 2CDCA 2AQIA 3H5AA 3ORFA 4Y8VA 3WYCA 4B7XA 1GR0A 4DBZA 1QYDA 4CMEC 3FN4A 1KVQA 1PZEA 4OO3A 1R66A 3G79A 1HRDA 2Y68A 3L07A 4INAA 4ZQEA 3WBFA 5F1KA 3SLGA 3UW3A 1VLLA 1DEHA 2I3GA 4HFMA 4JBIA 5JE8A 1CYDA 3GVIA 4CLOB 3GVPA 4AJLA 2X86A 1R4MA 3H65A 1ORRA 1H6DA 4ZQGA 5C37A 1QLHA 3BMQA 4IS3A 2JAPA 3GEGA 3SJ7A 1TI7A 4YRBA 3I9NA 5KKAA 1NFFA 4PRKA 4PLZA 4J9UE 1O6ZA 4QO8A 2WD7B 3GLQA 3PEFA 2HLPA 3CTMA 4WECA 5EJ2A 1C3VA 2JD1A 2A4KA 4FC7A 2AW5A 4J7XA 1ZSNA 1GZ3A 3QWBA 3KRTA 1P44A 4NK4A 4R69A 3MOIA 3DB2A 4FFMA 4J0EA 3VZSA 4L4SA 4CV2A 4L8VA 4QFDA 5JO0A 1EVZA 3GGPA 3PFWO 4CMBA 4MP8A 3HDJA 3LLVA 3DL2A 1A5ZA 1I10A 2J3IA 3INTA 1B8PA 2E4AA 2OXIA 3TWOA 2PGJA 2X6TA 3K9QO 2PK3A 2VRCA 2HSDA 2ZQYA 1R4MB 2J5RA 3RAJA 4ALJA 4DPMA 1HTBA 1DJQA 2HMWA 2W2LD 3F6YA 3JQBA 5L7WA 3DAGA 2GCGA 1QYVA 1H2HA 3BMQB 4GWKA 3ROPA 1Z74A 4Z9YA 3H9EO 4IIVA 2R00C 1ZJZA 3AY6A 4AJEA 5C5IA 1NQ5A 1NHWA 4XZ3A 5KVCA 1NNUA 4YRAA 3AM3A 4HXYA 1YS4A 4UREA 3FNGA 2ZIZA 1UUFA 3QVSA 2IYOA 2ZTVA 5H83A 5JMWA 3L6DA 3EGOA 4HFRA 4KP7A 2JJYA 4CMEA 1XGKA 3NT4A 3LC2O 2NM0A 2IRWA 1KEVA 3WMXA 1UP7A 1GV1A 5L7YA 1ENPA 2Q1TA 4O1MA 5CDTA 2A35A 3DHNA 2X5KO 1EVIA 1ZCJA 2NSDA 1UAYA 1UP6A 1ENYA 2NU7A 1VE9A 4XR9A 3MTJA 4JN6B 1M2WA 2QHXA 4RQUA 4NNJA 2OMEA 5JO9A 4BNVA 4XDYA 5I8WA 3GR6A 1JW9B 3L6OO 3I6IA 4XR4A 5JYEA 5HRUA 1EBFA 4RDHA 4J7CA 1DC6A 4R54A 4BNZA 4U8GA 1KY5A 1ADFA 3LT1A 1WMBA 1K6IA 3RU7A 4B7UA 3CUKA 3WYBA 2FN7A 4E4YA 4UVHA 3G1UA 3HWRA 5GZ6A 2AA3A 3QWIA 1LDYA 2J5QA 3NKLA 1FF9A 2I99A 4NK5A 1QSGA 2QRJA 2P5UA 5EESA 3N58A 3RUEA 1PQWA 4KWHA 2HCTA 3L77A 3PTZA 3D4OA 3RUCA 1JTVA 4BMVA 3I52A 1VL8A 4NJMA 3WGHA 4CLHA 2I9PA 1ZW1A 4UEKA 4E5YA 4ND2A 1U3TA 3JQGB 2Q1WA 4ID9A 4RF2A 3H3FA 2CVQA 1K6XA 1P1HA 1UXJA 2VT2A 3OP4A 4AL4A 1PZGA 1H93A 4TZKA 1C1XA 3KXDA 3T4XA 4RPGA 4JX8A 3EMKA 1U8FO 2R00A 1TB4A 3SXPA 1OC2A 4LCJA 3FPLA 4TMFA 1D7OA 1PEDA 5CDYA 5CEFA 4R9SA 1ZO8A 1EDOA 2DC1A 3V2GA 5L9AA 3KYDA 4L4XA 4IZHA 3DAPA 4ALNA 1H0KA 5TQVA 1C14A 3B6ZA 4BO0A 4ALMA 3DZHA 4LMRA 2O3QA 5IJZA 3FPCA 3HUDA 3KETA 2H63A 4YT4A 4DIFA 1GD1O 4CQMD 1UXIA 1E7QA 4NJMB 5F1OA 3WDSA 2B37A 2WJPA 1J4AA 1E3EA 4DBVO 2YYYA 4CM4A 1JKJA 1F8GA 4UVGA 5C7IO 4I5FA 4XIJA 2H9IA 3IJRA 1DRUA 1C1XB 5KJ1A 4FFRA 3WJAA 5BR7A 4Q3NA 1DDOA 4YA6A 4O63O 5CP8A 1YQDA 2AHRA 1FDUA 1QYCA 2P4HX 4OGWA 3LT0A 3O4RA 3GHHA 3RVDA 4OXYA 3ONDA 4RQTA 2P9EA 1SO8A 3ANLA 4L73A 3VH2A 3L6EA 4BNUA 1Y9EA 1KS9A 3KYDB 1RKXA 1ZK1A 5DZSA 3DBLA 4NG5A 1ZZEA 1IZ0A 1CJCA 1GYRA 2FPPA 4R1TA 4WASA 1U3UA 3IC5A 4IQGA 4XEHA 3E9QA 3RIHA 3WYEA 1E1LA 3R6DA 1H94A 2O48X 4KWIA 2EP7A 2AQKA 4L75A 4CL8A 4CLRA 1G6KA 3QQPA 1NAHA 1EFLA 2XXJA 2ZYDA 4MIYA 5G2OA 1ISFA 1W8DA 1DIRA 2VYNA 1ZUD1 4CM4B 3E9NA 1UZLA 2PFGA 4G65A 4R16A 3DZJA 3PLRA 1PWZA 2GN9A 3PVZA 4EEZA 2Q46A 4BNWA 1NBOA 2O2YA 1P1JA 4OAQA 5JS6A 2PH3A 4XQEA 4MDHA 2IZ0A 4YTEA 5JY1A 1WP4A 2YQ4A 3GZNA 3K2BA 4GBJA 1VJ1A 3JYQA 4CMJA 2O3RA 5A9SA 4Q3CA 3IP3A 3TZHA 1ZMOA 4BO1A 3GG9A 2YV1A 4XYEA 4DC1A 4YPOA 2CDBA 2BFAA 3E48A 1GL3A 5G0UA 2J8ZA 1CIVA 3EZYA 2DT5A 4BUCA 4AFNA 1EUZA 2Y99A 5A3JA 4IXTA 3GMDA 2JFFA 3I9LA 3DBLB 2C2YA 4MP3A 4UUOA 1HE5A 3R1IA 4LRTB 5F5LA 1T2EA 1P0FA 2EKLA 5HM8A 2PZJA 2I65A 3RWBA 1F14A 2O3TA 4P8RA 5TNXA 2BRUA 3GDGA 3QW2A 3RUFA 4NBRA 3DXFA 2SCUA 4F45A 3MJSA 3UKOA 5L4LA 1LDNA 3ETEA 4E21A 3ENKA 1WDLA 1R0LA 3C24A 2GD1O 3EAGA 1A9YA 3QVWA 5I7SA 1XU9A 2FP4A 4U5QA 4TKLA 1LRJA 2RHRA 3D5TA 3NUGA 2HK8A 2VZ0A 4UAGA 2WYUA 4F46A 1N2SA 1V3TA 3VTZA 3S2GA 4B3IA 4TKMA 4TQGA 3JQ7A 4L4RA 4MP6A 1J6UA 5DNAA 1FMCA 3DHYA 5TJHA 1AN9A 5A9SB 4M1QA 3ZV6A 4YRDA 1NPYA 1TLTA 4BNMA 1J5PA 1NR1A 2ZJ1A 1WDKA 4IQ0A 1WLYA 3FBTA 4AJOA 2ZKLA 3OIFA 5ER9A 1DSSG 1HF3A 3ZWBA 5IZCA 2VUSA 3RUAA 2DFDA 4IDGA 1A7AA 5JDCA 4JXKA 5F21A 1ZFNA 3GNSA 4QX6A 3KVOA 3WNVA 2JHFA 3KOUA 2C29D 5TX7A 3V8BA 3WG9A 1PGOA 4NBWA 1CF2O 3AUTA 4NH4A 5BNFA 2PD3A 1HDXA 2OP1A 1AUPA 2D4AA 4E6PA 4BB5A 1AHHA 1TXGA 1W6UA 1Q0LA 4JBHA 7ADHA 3DR3A 5DF1A 2NQTA 3K8ZA 1E1MA 1K5HA 4L0QA 4YVFA 2E37A 4E13A 2Q4BA 1A9ZA 1F0YA 1JDJA 3GRKA 1EQ2A 3JD1A 3JQ7B 4I5EA 2D1YA 5EN4A 1YO6A 1YJQA 3I9KA 2VUUA 4DC0A 1IZ9A 3W1VA 3GNTA 5JDIC 3R3SA 2Y1FA 1B8UA 1P9LA 3GGGA 4O0LA 4ESOA 2A92A 3OJFA 2GGSA 5BT9A 1OI7A 4N5LA 1YBVA 4OH1A 1M76A 3IIEA 1BMDA 3QHAA 3EY4A 2VWQA 3AY3A 3P19A 4LVCA 4NU6A 3GEMA 2CD9A 4BQRA 4CLDA 5KVVA 5T6BA 2EWMA 2TMGA 1NQOA 3LQFA 1Y8RA 3O38A 1BXZA 2F1KA 1B8VA 3ZZNA 3TL3A 4M49A 4M8SA 2D5AA 3W6UA 1YRLA 5L3ZA 1A27A 3KV3O 4IUYA 4PZEA 3DTTA 1GTMA 5B4UA 2DLDA 3EW7A 4XX0A 3AFNA 4WEOA 1U7HA 4FQ8A 4W82A 1SMKA 1XLTA 4NBUA 1DXYA 3L4BC 3ASUA 1U1IA 1U2DA 5A04A 1QRRA 4YJFB 4UVIA 1R4NA 3ANNA 2CVOA 3NTQA 2HJSA 3C1AA 5AOVA 1TT5A 2O50A 2ZYAA 4GKVA 2Q3EA 5HS4A 1LI4A 1B16A 3RI3A 2VT3A 4Q3BA 2BI7A 3ZWPA 3LLSA 4HP8A 1DAPA 3GEDA 1N1GA 2VRCD 1XEAA 5AVOA 3X2FA 1VJTA 1WDMA 3E82A 3COSA 1YKFA 4BO9A 1KVTA 1R12A 3JYNA 3O8QB 4RVUA 1ZH8A 5L40A 1DLIA 1BVUA 2D0IA 2ZTUA 4Z0TA 4FFOA 3V5NA 1I33A 1BDMA 4JJFA 1C1DA 2EGHA 4JP3A 3UCXA 3RCBA 3WQSB 2DTDA 2IODA 2IZZA 5GZ1A 4Z0PA 3IQDB 1ULSA 2OGUA 4GVLA 4WOJA 5JDIA 1E3WB 3U3XA 4D43A 4XQ9A 2IEDA 2X0NA 1XDWA 1EUDA 3LK7A 3H3JA 2CMDA 4PN3A 3MCVA 3WFJA 1P1FA 4W4TA 4QQRA 4E2WA 2Y67A 1L7EA 1R4NB 3DBVO 4CPDA 3Q9NA 1TT5B 1IB6A 2G17A 5KNLA 4WNCA 4AJKA 4ZU3A 1R0KA 3MJEA 5KJCA 1ADGA 3A1NA 4NU5A 5DP2A 1H9BA 4ZHSA 3JYPA 3WBBA 1KEUA 3V1TC 4Z9XA 4BO2A 1JAXA 1FDVA 1V35A 1D8AA 4RLSA 3PGXA 2ZTLA 4GX2A 4B4OA 1E7SA 3HJAA 3A9WA 3H2ZA 1Y8QA 3NV9A 1C1DB 2CY0A 3A4VA 2DAPA 4ITUA 1K89A 3L4BA 4A7PA 1E7RA 1M66A 1PJ4A 2X5OA 1HDGO 4FFLA 2HDHA 2X0RA 1YL5A 3GFGA 1B15A 4U6SA 1H6AA 1E77A 3QWAA 5IXSA 1SPXA 4TRNA 4EUFA 2PH5A 1LX6A 3ZWWA 1U8XX 1SAYA 3F1LA 2BD0A 1YH3A 3ZHXA 5C7LO 3AJRA 3B70A 3GT0A 1E92A 4AJJA 1ISGA 4HUJA 5IG2A 3BMNA 3WWYA 1HYGA 4DPLA 2I66A 3JCZA 4KUGA 3ZNNA 1P1KA 2HMSA 4BNLA 2GNAA 3PZRA 4OHUA 2C82A 2VN8A 4E32A 1PJ3A 3AUAA 4ZD6A 3NGLA 4IM7A 5BNTA 3P2YA 4JJGA 4XIYA 1FJHA 3JQCA 3U4CA 3PIDA 4DXHA 2RAFA 1Y8QB 3GVCA 1RYEA 4MVJF 3I9JA 4CMAA 5ICSA 1GDHA 3GH3A 4RF5A 4YR9A 3CPSA 2AEJA 1R16A 3GA0A 4DQVA 5K0ZA 3ZGYA 2O4UX 4UVEA 5DBIA 1WZIA 3WIEA 4IPTA 1U7TA 2CVZA 3PHIA 4EJ0A 2P5YA 1WXDA 3OQ1A 3D3EA 2CNBA 1TA4A 1V3UA 2DQ4A 2A9FA 2PZLA 2VOEA 3VPHA 4ZRNA 2UYYA 1XYGA 3MJTA 4YEDA 1AGNA 3C7CB 4ZJUA 4U7WA 3HDHA 2EJVA 2QZ9A 4RORA 3U4HA 3PDUA 3PHHA 2C20A 3JD2A 1Z6ZA 1PJQA 3DEYX 3PYLA 2NVBA 2VHWA 5CPBA 3VVCA 2IYPA 4NFYA 4JLWA 3WQQA 3SX2A 5T57A 1PQPA 1MXHA 1ZXLA 1YB1A 3S8MA 1U4SA 1JN0A 2EW2A 2J5KA 3MJCA 3S2EA 5DP1A 2XOXA 3VHRA 1HDRA 2HU2A 4YAGA 3ZWMA 2YFQA 3CH6A 1KETA 2VWGA 1ZK0A 2VUTA 3HB4X 3PRJA 1R0SA 2IXBA 1ADCA 1F12A 3FWZA 4WLUA 2E6UX 2PA3A 3HADA 1EEHA 3ZWXA 4C7KA 1KEPA 1KVRA 3DQPA 4XD2A 4EEXA 4YB8A 1P0CA 3M2PA 2G0TA 4BO7A 2JFGA 1GCOA 1T2CA 2WD8A 1V0JA 1GFSA 1LC0A 1YJ8A 4OQZA 1VKOA 4TRRA 1R6DA 4IMRA 4RO0A 4HV4A 2VYND 4KQXA 1T25A 4YT8A 1T26A 4YAEA 3ZU3A 4BHTA 2ZB8A 2P68A 4Q3DA 4XCVA 2BF7A 1T2AA 4ND4A 2YFHA 4HFNA 4DMMA 2HRZA 3TN7A 2I67A 2EKQA 4IDBA 3ZV4A 3AUUA 4BO6A 1WAMA 4J1NA 4R41A 1H2BA 5DCWA 1JQBA 5EQDA 1I3NA 1WW8A 3DAFA 1P77A 3TL2A 2DTXA 2OUIA 5ICMA 1GZ6A 1A72A 5L53A 2Z1NA 2FSVA 2NVUB 4RPLA 2UV8A 3KEQA 2NLOA 1ID1A 4H3VA 4OSPA 1DB3A 5ES3A 3RC9A 2YDYA 1E5LA 2HMUA 3O9ZA 4PVCA 3DMYA 2EEZA 3F46A 3OM9A 5A5FA 3D3WA 2F00A 5HA5A 3S1LA 1XA0A 1P31A 4R1UA 2Q1UA 2YHIB 3GVXA 3PI7A 5JNLA 1S7CA 2FR8A 2W4QA 5I8ZA 1KIFA 3TFQA 2ZB4A 3RKUA 3CKYA 2DFVA 3WOHA 2JCYA 4K26A 2XAAA 4GQAA 1E5QA 1QYWA 1QORA 1Z7EA 2YW9A 4M54A 5TRTA 1VSUA 5FWNA 1N92A 2UUOA 3CE6A 3H4VA 3HN2A 9LDBA 4IXWA 2WE8A 3FSRA 4HNGA 2DM6A 4RF4A 1H5QA 5FI3A 5EPOA 1DIHA 4E0BA 2RH8A 5EIOA 3D4PA 2EXXA 3NAQA 4N7RA 4Y6SA 1M6HA 1N9GA 4BKPA 3ZNPA 4QEDA 3H9QA 3OJOA 3EHEA 4ZA2A 1DIAA 2WE7A 3DZGA 2GLXA 3DDNA 3BZUA 4ZQBA 2YQ5A 3OEWA 4WLNA 1D4FA 3RBVA 1P3DA 1Z73A 5GMOA 1IHYA 1KYQA 4MO2A 4OKIA 3K73O 3VDRA 3WGOA 3AW9A 3M6IA 4PLVA 4D79A 1SOWA 3DFUA 3U49A 3N74A 1BTOA 2VHXA 1ZSYA 2PGDA 4FOSA 5FF9A 3AM5A
chains in the Genus database with same CATH superfamily
3AR8A 1UJMA 2JZNA 2N0SA 4J03A 5JCZA 5A0FA 1PJCA 2Y76A 3AR4A 3E2MA 3G88A 5EUCA 4ZVVA 2NYUA 1TGYA 1LJ8A 3CZMA 3K5HA 4I4NA 4N8DA 3VPXA 4FD2A 4PX9A 4I1UA 2Y92A 3RVRA 4EMTA 4Y7DA 1RM0A 2YNMC 4LZLA 4J29A 2WZCA 4QOFA 1WUTA 5FKJA 3T95A 4C06A 4F5EA 1M6NA 4YRIA 4V0SA 2XUJA 1DCTA 4TKZA 1PJSA 3KSZO 5SYNA 4EL0A 4N48A 4UU7A 3GV0A 3I3SR 3WLFA 1IUPA 1SVSA 4LRXA 3RIMA 1IXKA 2PBRA 1ABFA 2J3LA 1THMA 2XZDA 3IT0A 1O6GA 3I2YX 4JT2A 4KQMA 4R51A 4UUMA 4E5KA 4CWAA 5IT0A 3TBKA 3GVHA 3PPYA 4D9MA 1SQGA 4NCXA 4Z6KA 4LX0A 5KTKA 3KXIA 4E6EA 1N77A 2B5VA 4KO8A 5LMZA 2RHOA 3A4MA 2CEAA 3DMPA 2SICE 4FUTA 2E4VA 3PR3A 3DPIA 1OZ0A 4DLRA 3MAAC 1DBWA 4IG4A 2WZBA 2EYQA 2IS2A 2DERA 4C05A 1UL1X 1W93A 2X0IA 3D31A 4V2UA 4CUZA 1H6CA 1GITA 3GB9A 4WNAB 4ER5A 2XQGA 3IIIA 5EA2A 4L6AA 5CPFA 1NVVQ 4QRHA 5J2UF 1JEDA 4J1SA 8ADHA 3R24A 1WDTA 4YMUA 1N1DA 3AL3A 4BNGA 4XIIA 2WA2A 1SUIA 1K3UB 2B6NA 2G7ZA 3NFRA 2HV8A 3UMGA 3O2QB 3HCRA 1X1RA 5C31A 4Q37A 4P3NA 2FZ4A 2IZ7A 1C7ZA 4HAYA 1Z28A 3PXXA 4AX8A 1KMCA 1YZNA 1RM3A 1XVIA 3AI1A 2DHEA 3OSZA 4HDMB 3THRA 1H2FA 3PJRA 4MKRA 2JLWA 1QR2A 3N07A 3IQFA 3IR7A 3CZ4A 4IWXA 5C2JB 4K8OA 2CT8A 4MR7A 1WD5A 1CE8B 4HRYA 2CL0X 2DKNA 2VXOA 3RD5A 3ZWVA 2C58A 4HNRA 1KC3A 1FJ2A 1RPAA 2MR6A 1SRRA 2ZR7A 3KR9A 2DPMA 4M1WA 1MAAA 4W7SA 1XTBA 2QRHA 3TZKA 2AHOA 2AG6A 3L8CA 3H5RA 3U7GA 4Z0HO 4E12A 3BICA 4TWRA 3HGQA 4TGLA 3E53A 1AOXA 1UFQA 2C88A 1P62B 1T9GR 4J43A 4Q05A 1GRVA 2CFRA 1X1TA 2ZQZA 2P9FA 3GC6A 4WV3A 3SR4A 1PWEA 4QJ4A 1KFJB 3V2UA 3ZDAA 2WIAA 2ZYVX 4NONA 5KSPA 3WZ2A 4ZGWA 5HFJA 1LZKA 2ZB7A 3H1PA 2NU9B 5KSOA 2G67A 2DEUA 5J40A 4GX0A 1L7NA 3AEQA 5K01A 4A23A 2YNMA 4F6RB 3AVTA 4RK7A 1GP2A 5AI8A 3PQ6A 3AHDA 1KNQA 5B2ZA 1ZH0A 5KJEA 3VU3A 2Q4EA 3IPCA 1IK4A 3REOA 4AJ1A 4EW3A 1FQWA 2QNRA 1CEYA 1X80B 3TUJC 4E15A 2ZJ7A 4IOJA 5DO9A 5JMOA 3AILA 3JTMA 1N8NA 1Z4KA 1CJVC 4LF6B 1LPPA 4L9SA 3H19A 4RTQA 5K4AA 4O5OA 2IBSA 1YKGA 2HHJA 4KPGA 4P5DA 4L28A 2POQX 5DXAA 3F67A 4TSRA 3DS8A 1UBLS 2AOTB 4AZ3A 4YP6A 1VM6A 1VMIA 4N6OA 1V7CA 3F4BA 4GMFA 3TPCA 3RM3A 1C3JA 1CS0A 5C1IA 4YHHB 2EX4A 5E9AA 5EL0A 1MNQA 3T0FA 1E1CB 1RR6A 3FG9A 3IALA 3ISJA 3OO1A 2SKEA 5B1SA 5ICFA 2I71A 5L6LB 3R5FA 5FJJA 4GWLA 1GUZA 3MG9A 1UZMA 4OAPA 3ZWQA 3AJEA 5I4IA 1T6BY 5GQSA 5J5VA 3W9UA 1CRQA 2GZRA 3SZRA 1YUNA 1KBZA 3EXIB 3DA8A 4QO7A 3DT9A 3KQQA 2YJ3A 2Y1CA 2CMKA 2YZ2A 2WM8A 3DE6X 4JA2A 5F64A 1HE3A 3L46A 4YQEA 4F21A 3D7SA 2WJWA 2FW7A 4ZOAA 1XXHA 5ALHA 2G8NA 4YV1A 3WRYC 4BFYA 2YX1A 1FIUA 1LV8A 4XOIA 4TM8A 2RFLA 1CR2A 1JALA 4F4HA 3H0EA 1XCBA 1MB2A 2WYHA 2W2KA 4I5DA 1ZK3A 3D3QA 3OZBA 2PR2A 5KDOA 3IIJA 4WY5A 5ALIA 4LY9A 4R1SA 1R0WA 1YCHA 2OCDA 2ST1A 5H82A 2OMKA 1BG6A 2ADOA 4WESB 3TW8B 4RTKA 2VDNB 1P7ZA 4HWRA 1ORDA 1WQ3A 3VSBA 4ZK6A 2VP5A 4MVJG 3G23A 3FCUB 4TXMA 4DR4B 4LZJA 3DZDA 4U0KA 4HMQA 1VJGA 3ILVA 1I1HA 4QVIA 3QF7A 4BNYA 2BJHA 2EFDB 3OA2A 4KI7A 3UFXB 4S04A 1LNSA 1I30A 2HMTA 1E3IA 4Q7QA 2B36A 2E4YA 2WAAA 1P45A 2Q1XA 2XDQA 3TAHA 5T4FA 1KQFA 3R5KA 3HYRA 4UXHA 2GILA 3GU3A 3KHUA 4PNZA 3OI7A 2ORVA 3W6ZA 4PX5A 2A2ZA 3IB3A 4BGVA 2VYVD 1G55A 7GPBA 1ICEA 5C5EA 1BXKA 3AR3A 1XLUA 4JLSA 4C14A 2YR0A 3RRMA 5B36A 3TRIA 1IM8A 4FPXA 4ZKDA 5AH0A 1XCLA 1P2UA 1RRMA 3EEFA 4GH5A 4GZMA 4ESVA 4Y2XA 2HSEA 2IU0A 3BXPA 3D6JA 4LJ5A 4M0PA 3EPRA 2FSSA 1OA1A 1KRXA 1N9ZA 2GFQA 3LO8A 4LYHA 1NFRA 2IYQA 1FYDA 1E7WA 2PZGA 3I83A 1PP4A 1FP4A 1GQQA 4POOA 4NCHA 4QUBA 5DMXA 3FYDA 2FY8A 2B8TA 5GGXA 3RVBA 5HKLA 3IEIA 3AWDA 2PX3A 2ZQ5A 3E9DA 2XCSB 2ZYGA 3AF6A 2JANA 2NZ8A 2OSBA 2OLJA 1WVMA 2OM6A 3P0HA 3FUVA 5FLKA 4MTCA 1R3DA 2QD5A 2XB2A 3L1HA 2VLBA 3KVNA 2WB2A 3WRYA 5LQCA 3TLGA 1YZYA 3S2ZA 3NKFA 3H7AA 4JQOA 5FPHA 3FLBA 3RHTA 4EATA 3AEKB 5I6DA 5KNDA 5MFZA 4I4TA 1ECCA 2ZIXB 1PR9A 2C4MA 3OPQA 3UUGA 1ZJJA 1U0SY 2O4CA 1XTKA 2Q29A 3A4NA 3HFRA 4KXQA 2MINA 5TS3A 2BMAA 4MUAA 2BJVA 2WICA 1W88A 3WISA 3U7IA 3LP6A 5DW3A 3PUZA 5B2FA 4JL8A 3TX2A 3E27A 1DI0A 3G5AA 2Z2KA 3ZD6A 5TC4A 1MQ9A 2C78A 5FL3A 4N3BA 2C2ZA 5IWCA 1Q12A 2DTEA 1B7GO 4GNRA 4R1LA 1GPAA 3PIIA 4RHXA 4ZXPA 5EZYF 1JJVA 3JD0A 2PKCA 3GYBA 1P2GA 1VE7A 4Q5IA 1FSFA 1Q6YA 2BFWA 2X2OA 1I2ZA 4UEQA 4C7JA 1UM8A 3WSWA 2FOLA 2O1XA 4RVDA 1JHVA 3GD7A 4DG9A 5HRCA 5DM1A 3P71T 2QTHA 2JASA 1NOIA 3DOFA 1X9IA 3BH7A 4JHLA 4QOSA 1QHNA 4ESEA 1TCUA 1KI6A 1RM5A 4KN9S 5B3AA 3RUPA 3NP9A 3KT0A 1WKCA 2FEXA 1OASA 2DB3A 2AZMA 3HLYA 3EVNA 3K09C 1NJSA 3QFHA 2VC2B 1A9RA 1N5KA 4I6EA 3TGWA 4EHNA 4EG5A 2PX5A 1W4AA 2GB4A 3PUVA 5IN4A 3DOIA 1X7GA 1LDMA 3PFNA 2OBFA 1X1DA 2EDCA 3FZNA 4LJLA 1D0VA 3DB1A 3QFRA 4N3NA 2Y1EA 3I5XA 3DEKA 5K51A 2XQIA 1G1AA 3GDFA 2AXQA 3GJ6A 4EG8A 4DMUB 1FP6A 1KKMA 2RCYA 3ANSA 3TNLA 4HXFB 3RSHA 8ATCA 2Y77A 1QHHB 3R6WA 1A71A 4H0CA 3M4JA 3TLKA 4ENVA 3U3ZA 3OZRA 2QPTA 2AVNA 4R84A 2I1QA 2F3TA 2PVSA 2NW6A 3VJMA 2AE2A 4XD7A 2G5CA 4ZGBA 4C0AC 1N2JA 3GDOA 2K87A 5D1HA 5JD4A 2HSJA 5DCYA 2I5PO 2BKAA 5JWHA 1OE0A 4ERXA 2F4VB 3BF8A 1E5TA 2RBEA 2WWIA 1D6JA 2QM0A 3N8NA 1V41E 2V6MA 1J7JA 3DFZA 3DYIA 2QE7D 3WGTA 3ZI7A 4BQPA 4E30A 2VJQA 3R0JA 4BB5A 1U8EA 3AB7A 3A3PA 1RAGA 5DLDA 2HQBA 4M9XA 2BTEA 4G5HA 4BAUA 3FHJA 3DLIA 1GCIA 2C9ZA 4D8UA 5E1MA 4DDKA 1U3FA 3HWSA 4OQXA 5IKOA 3THSA 1ZD2P 3A05A 2A5JA 2NNLD 2IDJA 3OLCX 4IGKA 3TZQA 2H18A 2D0PB 3SBOA 3FCCA 3VZQA 1BVHA 1PJLA 1PJ2A 1QV9A 1M2KA 2B69A 5JC1A 4N3CA 2Y0DA 2LIPA 2AMFA 1XELA 1XHFA 4KQCA 4MRNA 5LDGA 4QDTA 2XTAA 5BSGA 3NM5A 2OHGA 2WTEA 4R1NA 2P30A 16PKA 2DQSA 3LQQA 1JU9A 4XX0B 2D00A 1SIOA 2LZ0A 2R6FA 2XAUA 2JIMA 1T3GA 3ANYB 4L5IA 3SXUB 4N76A 1BYIA 3QVXA 3G2NA 2C04A 3UUFA 4F5ZA 4FZVA 5HJEA 3AHFA 1RCUA 1IUKA 1TD1A 3G0DA 4UAUA 4YLEA 1UBOS 2EZ8A 4BX3A 4JP5A 1ZH2A 1Q7GA 1HG0A 4GZLA 4ID3A 4MKZA 4QLAA 3ZCXA 3O26A 3IILA 3NHAA 1DEOA 1GM5A 1K88A 4KO1S 3DKIA 3F5MA 4YJGB 2ZULA 2EL7A 3FWNA 2Q5JA 3K09A 2B0JA 1KIMA 2N46A 3H1GA 2H1LA 3PQ8A 2Q5IA 2R6CA 3VBCA 4J49A 4NZZA 3F3YA 1Q1NA 1Y4SA 1ZXBA 2WINI 3QM1A 5AIAA 1FU7A 3GLGB 2WDZA 2VCYA 4M7PA 1NW8A 1C3OB 1JLLB 5KCZA 5AVSA 5IFKA 3AF2A 4W5OA 4YUYA 1YF3A 5F98A 4IZ6A 4BLOA 1ELOA 4IIJF 1KFCB 2BEWB 2QORA 2Y71A 3E5NA 2B99A 4UHCA 2DU8A 3NX4A 2H06A 3A8TA 2JFUA 2D8AA 5GIOE 4QRIA 4XASA 4P3PA 2XVZA 3CGGA 2VSOA 4IFTA 3A11A 5ARDA 3R9KA 4BZPA 2HJHA 3R3HA 3M2TA 1AVTA 3U09A 1O97D 4JI1B 1PU2A 2P3OA 3DVAB 3OOJA 4FDAA 4LJKA 5SICE 3W2TA 5HJ5A 1J1IA 4G86A 1KZ4A 4CDMA 3RU2A 1Q83A 2ZUSA 2VCHA 2HO5A 2WJZB 5BV0A 1OBFO 3RQSA 1M8GA 2AI2A 3PXBA 3QBTA 1I3LA 3UYKA 1QP4A 1K7YA 3ABIA 3CV3A 4BB0A 3UV3A 2F1JA 2PSEA 5DWQA 3JR7A 2WVAA 1WEHA 3L1UA 3O9VA 3TJRA 4IX1A 4QARA 3WHLA 4ZAVA 3KKZA 3CO5A 1EFTA 5TMBA 5C8YF 1R15A 3J80A 2YRWA 5D3QA 2JJ1D 4EM6A 2O7QA 3THWA 2I34A 4GI2A 4GX5A 3WKCA 1QF7A 4EJ6A 5EJ5A 3V8RA 3EWSA 3CNHA 5JU6A 2IZ1A 1BOFA 2J3EA 2XRMA 3B85A 3NAZA 2OTCA 4PO8A 3DGEC 5BYAA 1B76A 2ZJ0A 4KV7A 4UULA 1GQ2A 5GY7A 1A9PA 3KQTA 5BQ3A 2A1UA 2B5WA 1QGDA 4HYTA 2C7OA 3H11A 3TOCA 1AS3A 2OBMA 4Q3AA 1IL0A 4BCDA 5JCOC 5IDQA 4MWBA 3T1HB 3E0QA 2GEDA 3DP9A 4YUWA 5A5DA 4QEDA 5JIBA 4MVCA 2ZIWB 2R8YA 2CXOA 1IEXA 2H1CA 2Z9CA 4K46A 3PE3A 3WB9A 1NRJB 5CNKA 4JGGA 4ETNA 3O0TA 2ZK7A 2FE1A 3IKVA 3OZIA 5ALSA 4DFDA 1ADBA 1PO7A 2KE5A 3E18A 3W8DA 4BIMA 4DM4A 2FJUA 1I7QB 4K0KB 5DE3A 1XZKA 4KUEA 2F9LA 4RZXA 2CXHA 1N5IA 2EC5A 1GTL1 1ZUWA 2WJGA 1YOBA 2WWXA 4GM0A 4BL5A 1U3GA 4V0OA 1U1EA 1X9HA 4FOTA 2VYCA 3WLLA 1W4ZA 1CUAA 2V7QD 1JX6A 1TZBA 4YT5A 5IBQA 2SNIE 4DM7A 5IK2A 1UWLA 2P3QA 1F51E 2FX2A 2N3ZA 4P9NA 1TPZA 1YDWA 4G63A 1RADA 2C9CA 2YICA 1IONA 4EY4A 4TKVA 2ZM5A 2LW7A 2Y1KA 4L7QA 4KE6A 3Q6MA 5ECYA 1ARZA 1T5OA 3R7NA 1KDZA 3U9LA 1N2XA 5K0CA 1XUOA 5TVKA 1G4UR 3LKZA 1DV1A 3UC9A 5EE9A 3IPYA 3BGOS 3ETNA 4MPRA 4KRYA 4NG4A 4LCEA 5CX4A 1BAPA 4YCSA 1EP2B 5BSHA 3MF4A 2V74B 3QY9A 5EIEA 1AH2A 2GDZA 3URKA 1HR0B 1P2VA 5K3AA 1JQDA 2I54A 1OI3A 5FI1B 1Z2NX 1Z4PX 4RTSA 2BELA 5C3MA 2HLDA 3KJGA 3NBFA 4JC4A 2H5JA 1MA0A 1JQJC 4XYGA 1SK9A 1MDBA 2EAUA 2FOXA 2TRSB 4YXWD 2J7PA 3P7MA 3WL8A 3ZPXA 4MUKA 4X6XA 2QQ0A 2LE0A 3PWZA 3TO5A 1EXMA 4NPHA 1PNVA 1UDAA 2JAWA 2JI9A 3D1VA 4QNRA 2JI7A 3F7MA 4PG4A 3MWLA 4LRUA 3TEFA 1KMHB 2CDNA 3LNCA 3A4LA 3T3GA 3ZE9A 4DMFA 5BNWA 3OG9A 1Z22A 3JZDA 3ND5A 2PGOA 1B6RA 1BDHA 3OZGA 4IJVA 4P6VF 4CCSA 3KLPX 2IUTA 3IVAA 2GEKA 1U7DA 2OBYA 4ZC1A 1LDGA 2I2AA 3KEOA 4UUQA 4AP9A 1MW8X 3OZSA 4JBXA 4ZDKA 4ARUA 1T5DX 3HO8A 5CM8B 3S5JA 2JPDA 5HF8A 4DIBA 1B0ZA 3KELA 2W6ID 4DMLA 5JCOA 1D7AA 1RJ9B 1V43A 3F7TA 3VDMA 2C5LA 4YK7A 2DCUA 2RG1A 3LHSA 2R6GA 1LVGA 3PWKA 4H35A 1L6IA 1N6PA 3BK2A 4LZAA 5LYYA 3WS7A 4RY0A 4BECA 5IKMA 4HLNA 4M9CA 1GNPA 2QDKA 1MRNA 1FNCA 1K3TA 4Y67A 3WGGA 4ENWA 2C7QA 3CQ9A 2CFSA 2APJA 3JQAA 3BB3A 3TLYA 1AJEA 5CMLA 3U56A 3KT6A 2IUSA 1EK2A 1S8NA 1Y5NA 1Y1SA 1NAIA 2DULA 1IOWA 4ZQFA 2ACWA 1WY5A 1UJNA 3HPQA 4CKWB 3H5NA 1F2UA 3D5QA 4IDAA 3SYNA 2HADA 2WWYA 3RHSA 2HF8A 3T35A 4ONEA 1UT6A 1YR1A 1J1UA 2ZAYA 1OTXA 2ZR8A 5E6RA 3UATA 4FB5A 4PHHA 4NESA 2O7RA 4V0QA 1S6YA 4DCOA 4OQMA 1L1FA 2OZPA 5JQGF 1PW5A 4R01A 3ITDA 4F3RA 2O2SA 1XVTA 3N6VA 5KCMA 4P3XA 3WP0A 1J0DA 4A5OA 4DUZB 2BT4A 5FPKA 2DE0X 1UJ2A 1H1LB 2HXSA 2YXPX 3OX3A 5AXAA 3SIWA 3ZXXA 1VMEA 4GAEA 3RYCB 1T91A 2JAUA 3KTDA 3PEVA 2NTVA 1RZRD 1NWCA 3UHOA 2AK2A 2MSNA 2VRBA 1K4KA 4IHJB 1IYZA 2OOSA 5FYDA 5FQNA 3RABA 3TOZA 3DE3X 3K9HA 4B6RA 3WRWA 3WLJA 2P2LA 2HKIA 3H16A 3ZUGA 4IDCA 2BLLA 1YR6A 4IDHA 1K5DA 4ILKA 5E1BA 5TS2A 4WGGA 1KO5A 1F6WA 3KVRA 4RVGA 1RJDA 4AF8A 4KGXA 1NVKA 4NBKA 4XSGA 3OICA 3UENA 2EWWA 5HE8A 1ZSVA 1OX4A 1N1EA 1QC5A 5AFSA 5K3FA 1MW9X 1TM4E 4KVGA 4RVHA 4JL6A 2QJOA 3JPWA 4H1WA 3VPSA 1NVUQ 3FGPA 5TARA 1ABEA 2ZVJA 5FWXA 5EZYA 3RC7A 3EXEB 4WNAA 2HRCA 4GGOA 4AYTA 5LP6C 5JISA 1CZUA 1QBGA 1NBAA 3EOZA 4DXDA 1PT9A 1T4DA 3D3WB 1QIGA 1DFIA 4ZALA 1GZDA 4PIVA 3T7TA 4EP1A 5CDSA 3GLFB 4Q19A 1KPHA 4HADA 2YRFA 1C50A 4DE5A 2JGFA 2JBWA 1SVKA 2TS1A 3KL2A 4WD3A 3CVVA 1GYQA 1CUYA 3IDOA 2QZPA 4OSEA 2AOWA 3WTBA 1KY4A 3CO0S 1UKVY 5G0WA 1A8SA 1I4WA 1JPNA 1FFBA 2JH3A 1RYDA 3NW9A 1R37A 1VL0A 1TO6A 2B7LA 2FEOA 3CNBA 3ICCA 3E8MA 1IBCA 2CHUA 4Q4AA 4TMWA 4U63A 3UWPA 4BPRA 2MYUA 2GETA 4Q18A 2JLYA 3ZE2B 3B7PA 2YBDA 1R8JA 3DDCA 1OGYA 4G5GA 3GARA 4EIWA 4MR8A 1V5FA 2HJ9A 1GUBA 3EARA 1CETA 1RW4A 1G8HA 1XZIA 1YJAA 2H4HA 3AP1A 3R3XA 4HNAA 3KB1A 1TAQA 1SHTX 4XLZA 3U3OA 1UH5A 3IMCA 3C3AA 3R7AA 1YRWA 1E69A 4Z3OA 4LRWA 4CF6A 1USKA 1IG0A 2WYWA 4EUEA 1Z3IX 2XZOA 5DT9A 3NV7A 2FETA 2Z2IA 5ULLA 3OUUA 1Y9ZA 3FE2A 3QXXA 3M1AA 4GC5A 2XA9A 3OOEA 2CNWD 1K4YA 3O2NA 3WMWA 1HC7A 2IC5A 4RIEA 1NUAA 2B20A 3FI9A 4HC4A 4MRPA 4B4DA 4Z4HA 3U7JA 3VA7A 2O1SA 3TIXB 3TTTA 1SPBS 4FIZA 3DV0B 4UHJA 1SHKA 3IP7A 3ML1A 2AUMA 2Q5CA 2WWTA 2BR4A 1K9SA 3DE7X 5CU7A 2F9FA 5EIAA 1RPNA 1TIKA 4F8EA 1QMGA 3HMQA 4M0CA 1GN9A 5CCDA 1D0SA 4BQIA 4EZBA 4RGVA 2P1RA 2FMKA 4LZZA 2EP5A 1PD1A 4EQ6B 1OB5A 1RYMA 2BFMA 2X9GA 4IDDA 3GF4A 4YCJA 1FXWF 1JU3A 1V71A 2SHKA 1S8AA 1QGUA 1NXTA 1H3NA 2XD4A 1L4BA 3B3JA 2Q99A 4FFNA 2CF6A 4IH4A 1VYTA 1WB5A 4LWPA 4QDZA 3ANMA 2EIXA 2H4ZA 4IINA 1CS4C 4FWIB 4YCBA 1UR5A 3WB1A 1K5GA 4KODA 1JS1X 1S8FA 4J4TA 1NJ1A 1R6VA 3C0KA 5LU9A 3NALA 4MB6A 3LWBA 3D3JA 3I45A 4AC9A 4DDWA 3CZ9A 4QGSA 3GNQA 2WWHA 1K6EA 2V7WA 2ZBFA 3RGWS 1V8DA 3F90A 1OBVA 3T5GA 4BMXA 1JG2A 2AMJA 1M2HA 4G0UA 3DZIA 4KREA 3QNWA 4HLUC 1GDDA 1XU7A 2Z58A 3I5MA 4OQDA 4FFPA 3FRIA 3H13A 1QH0A 2NO5A 3ZBPA 4RV9A 1IBKB 1GFZA 5I7FA 2EU8A 1PL6A 3KZNA 3T9AA 1LRLA 1QFZA 3GMIA 3I62A 1DCFA 3TZCA 5L45A 2FPIA 3N2GB 1C8BA 2PX2A 4PLPA 4XW2A 4M46A 1CY8A 5DIZA 4EFKA 4C20A 4RTNA 2PY6A 1IWBB 2AVDA 3PWSA 4Z2YA 3T5PA 3OBBA 4UE2A 4UTOA 4YH1A 2IP1A 4IIJA 2VDJA 2WV9A 3GPDG 1GGMA 2XUDA 4Q3EA 2WJIA 2RAVA 4AVYA 1Z16A 3T54A 3T9CA 1FFSA 4TMZA 1VIAA 3T99A 1APBA 1YTLA 4TQUS 3DL0A 3SN6A 1GQSA 1EWKA 3GAZA 3ZNOA 3W79A 3H2KA 4Z7JA 4NENA 1WKBA 2GBIA 4XUGB 3I2GA 1T6ZA 3P9CA 3Q2OA 3H6KA 2W70A 4AKIA 2WMOB 4MR7B 4ES6A 1C2TA 4JWTA 2DR0A 3O91A 4U7HA 1TUGA 3BEOA 1XK7A 4TRMA 4CUKA 1LCIA 3PSAA 1JPJA 1WUYA 1AXEA 1E2NA 2XMBA 3ILHA 4J6FA 5C8YA 3UJ6A 2PEZA 4GP9A 5KI6A 3AOGA 3OKPA 2A9OA 4U2KA 2O1EA 3VKUA 3DH0A 2BKUA 3CMCO 3GLFA 3RYIB 1J56A 3OWXA 1SUEA 1AD2A 1KHHA 3AZOA 5HJ2A 3R7FA 1ZJWA 1C7FA 3ZJUA 4C78A 2IYTA 5ALGA 2ZATA 4MX8A 1ESEA 4OA5A 1RLMA 3SC6A 2GBPA 1JE1A 3BHNA 1U8ZA 1YQXA 1RFLA 1AK1A 1VB3A 3IB6A 4NCKA 3WY9A 1KU6A 4CKCB 3WV5A 1YS2X 2F55A 2Y93A 1SHJA 1X7YA 3ZH9B 1Q1AA 4AURA 2G0NA 2IJGX 5IVDA 3HJNA 2CJWA 1PFYA 1CXZA 4II2A 1R8QA 3TXAA 2GO7A 4B35A 4PPQA 3LTNC 4RVSA 4FVTA 1G8JA 3JQ6A 5E3HA 1M1YB 2VPQA 4B84A 2HPZA 1M34B 4AICA 5JSZB 4MJLA 3EZLA 5F52A 3OECA 4JQSA 2H31A 2DXIA 4JC5A 3RTAA 2HREA 3N2KA 4QUKA 4UOQA 1GPMA 3RC8A 1I1OA 4CEJB 5KU7A 1QUEA 3G49A 5GZ3A 1Y42X 4X1IB 1SA0A 4ML3A 3TIVA 4B31A 3P9ZA 4AZ3B 2XF8A 3E22A 1I6KA 3L0PA 4RQBA 3ZDQA 4G4JA 3EG9A 3HE3A 3HJHA 4NV3A 4LSWA 4OQEA 4RUKA 3NXSA 1YS6A 2E0IA 1CS0B 3D4LA 3QELA 3V1LA 4P22A 1E2BA 1DQPA 1LK0A 2V55B 4XUCA 3VHQA 4DA6A 1SVMA 1T34A 3E5RA 1XL1A 5D01A 6PFKA 3PNKA 3BTSA 5K6TA 1EZ1A 3QVGB 3IEMA 1UBHS 1OV4A 1YRHA 2A94A 2C2WA 1PL8A 3HCWA 3OPXA 1GILA 1X7HA 1L5GB 1A4UA 1J25A 3S44A 3FOEC 3WWEA 2YVKA 5FPSA 5BVGB 2PNFA 2D8MA 4YUVA 1KJYA 1XDSA 2OA0A 1QDLB 2A0XA 4W5RA 1MJ5A 3K5WA 3DUWA 5EMKA 1E2IA 4X94A 3WA6A 2HW8A 3TRJA 4CG1A 1UMDB 4P4NA 2QENA 4TROA 3DQQA 3OPYB 4YI5A 1Q1BA 2QRZA 2W2KB 4IOLA 4J94A 4AYXA 3NNDA 4W8GA 4GE0A 3UICA 4IY1A 3GAFA 1OIVA 5F2KA 1IQ0A 3IKJA 2ZVDA 4JCOA 3G0GA 1J2RA 2EJWA 1QZUA 1L5OA 4NFLA 1QO0A 2R85A 1AZSC 1NI4A 4FDLA 1A0OA 2FWRA 3W3AH 4A2QA 1VBKA 4B3BA 4F71A 4ME6A 2C7GA 3EPJA 2YINC 5EMHA 3GT3A 4Q4DA 4MB0A 3FA2A 1I6MA 4JSTA 1UC5B 2XNDA 5JROA 1N5LA 2UZ1A 3EUEA 1F0NA 3PV0A 5JBIA 2ZJ3A 3W7VA 5MHTA 2R5NA 3KDAA 1L5HA 2IH4A 1UPXA 1NQXA 3JS5A 2JD2A 1SGWA 5DSZA 3Q7IA 1QFXA 2C0QA 1V7QA 2V7PA 1FTNA 1T29A 3LUKA 1KWGA 3TG2A 1RQ2A 2QA5A 1EG2A 2ABWA 4QTTB 1S3SA 5DI3B 4CCAA 4G37A 5BOSA 2GESA 4ZTBA 4PZ9A 5AM3A 1SKYE 1CUVA 5JH7F 2Y1GA 3VFDA 4NYJQ 4AM8A 1XRPA 4XLLA 4J3NA 4RSHA 1L4MA 2WU3A 3T9BA 4IFEA 4F9FA 2H8KA 3KZVA 3SSMA 4HVCA 4CJXA 2IYNA 4E51A 1L7PA 4A9AA 1RJWA 4CODB 1QYRA 10MHA 2PSHA 1E1YA 2XB8A 1MTOA 2DR3A 3RAGA 2RKWA 1NN3A 2IZ6A 2PZKA 4J0DA 5LNK6 3F5QA 3LUHA 2WIJA 1NONA 1B0AA 3I1JA 4GYYA 5DDIP 1LLDA 5LXTF 3RUHA 2QTZA 2OHXA 1TA9A 3LUGA 3D8NA 4ND1A 1V2HE 4Q24A 5THQA 5FLXA 2ZUTA 1L3BA 1PEYA 2ACVA 2CLKB 2OVBA 3QOFA 2Y1DA 4IRXA 3VZCA 7ABPA 3CUWA 2IY9A 2ODAA 3TW4A 2B78A 1ZGBA 521PA 4KTVE 1FP4B 5CCEA 1YDEA 4UBOA 1UBGA 4X7BA 3W90A 1J8YF 1ZD4A 1E3SA 1S2LA 1L4FA 1P5FA 1SG6A 1WY7A 2BTOA 3BCRA 3LZ6A 4IJ6A 2VZ8A 4D3FA 4YHBA 1U81A 4Q39A 1RHUA 2X15A 1TF5A 1FZQA 4R05A 4U7JA 4G0OA 1KFEB 4B3JA 1GPJA 1UK7A 2BFNA 2QX6A 2QW1A 3BYZA 3KDPA 5JQGA 4EMUA 1MT0A 2QJRA 3Q3VA 5AM1A 4Z3KA 2V3WA 1GUAA 2FN9A 3SWWA 5HSGA 2FSHA 4RLFA 3D7KA 4IMPA 4OTZA 2G63A 4ZT6A 2WHQA 1AUVA 1P72A 2H4JA 3TLGB 5IBCA 2GM3A 4ARVA 1NXXA 1NKVA 2FR1A 2WHYA 4KWCA 2GHRA 2IYSA 3DBHA 1WVGA 1Y9JA 3R9XA 1TUEA 1Q7BA 1O6BA 1UPFA 3IERA 1U3WA 3FYHA 3HSYA 4RA9B 4CMCA 1ZGAA 2RD2A 1NW6A 5CIYA 3BG5A 3VUFA 4CBVA 1A7JA 4JLJA 5HIJA 2RC5A 1AMUA 5H4HA 1XBTA 3ST7A 5KTSA 1I51A 5IS2A 2LKDA 3SQMA 1LSJA 2YJZA 2V65A 2FWNA 2W98A 3C43A 3FNFA 1LS6A 2WHEA 3GFFA 3O31A 5B3KA 4NI5A 3D6UA 3VO9A 1KXJA 3ACBA 4HGPA 2XI4A 4X97A 1SXJC 3QU7A 2AJ8A 3V80A 5DULA 3UT6A 2O59A 1XJCA 2IXEA 3E1KA 2C00A 4RKYA 2PSSA 2PEYA 2IEIA 2YDXA 4HQKA 1O5IA 2BMVA 3PHJA 4MYTA 4Y6GB 2W71A 3DEJA 1B4DA 3WNDA 3LVFO 2I87A 3BZWA 5HVNA 1C8VB 2EZTA 3BTUA 4QU5A 2DBRA 4QYWA 3RC1A 4DB4A 4NBSA 4E5NA 2W6ZA 4MRVA 5JI3E 5KJFA 1MB4A 2OQRA 1WPGA 3PZBA 3ZXUB 4R8RA 4RHCA 1KI6B 1S2IA 4J6EA 5F7XA 3CNQS 4KN6A 5HIAA 5COBA 1RBMA 1N33B 3P5SA 4NOKA 1Q16A 1Z56C 3I23A 4L6CA 5EWJA 4BEJA 1E1QD 3UA3A 4R3WA 2L82A 1MA3A 3K8OE 1K9VF 2F3UA 1KL7A 3LUPA 4N3GA 5FUXA 1QH9A 3K6KA 2UVDA 3QLVA 2GSDA 4IYRA 4RA6B 1XCGB 4Z0NA 1E5DA 1E3WA 1M0WA 3QEOA 2M6LA 2WV7A 5EXPA 3ZJ4A 5KHOC 3T9DA 4QM7A 1TGVA 2IY7A 3P94A 4TTIA 4F2PA 3AEXA 2P62A 5DLYA 3JASB 2P3LA 4BNJA 1KBOA 4FR2A 4IAOA 1GPWB 2X0JA 2UUAB 1OBHA 4MV3A 4PRLA 5AKEA 2VNIA 2XDYA 4QDXA 4FHCA 4YP0A 1RKBA 3ZU5A 4CHTA 2RGRA 4KYUA 1CJKC 3LE8A 4IP0A 2ZWPA 4F12A 5E2AA 4WOKA 1XA3A 4UVDA 1V8FA 2WUEA 3CX4A 4AZTA 2ZP1A 2WJVA 5EZQA 4OMUA 4JKIA 5ICEA 2CV1A 2CMGA 3G9ZA 3QXJA 2O2IA 3WGQA 3RRNA 2HA3A 3SZOA 3EZ2A 4XVQA 2PTGA 2O0MA 2C03A 4WXEA 4AS1A 4FYWA 1FQKA 2H4WA 3VZRA 1SIUA 4LYEA 4MVJH 3W4KA 1PTKA 2B34A 1XDDA 4KXYA 4MA0A 5ILGA 1MDFA 4KR2A 1RZVA 4BKUA 1U7PA 4G5YA 2VOJA 4UW9A 3SLKA 5CDHA 1FX0A 4JC0A 5L4SA 1STOA 3AERB 3AO0B 3SEQA 4RK4A 2GCOA 5T5QA 2JGNA 5K20A 2HA4A 1FXWA 1WPRA 2PXCA 1U5AA 2W0SA 4RU1A 5DEIA 2FZKA 3W6OA 2IXDA 1K8XB 1O1YA 3RRJA 3GNLA 4OOFA 1VKHA 2XT6A 3MTEA 2CVPA 3QVLA 3A6ZA 1IHUA 1ZD3A 4FHGA 4O8CA 3CVUA 1C9KA 2R6R1 1DQSA 4EYEA 4PC2A 5C8VA 2JFYA 4UUBA 1J97A 1FLDA 1DC8A 3LGAA 4BMPB 1Z0AA 4E7PA 4X20A 3RTCA 5KZMB 3SE0A 1JJBA 1R6UA 1PX0A 1S02A 2PT7A 3C6MA 3IJ5A 5A7FA 3R0XA 2UYCA 5DGIA 2WBLC 2PX8A 3O2JA 3ZZMA 2BZ0A 3ZHSA 3QEAZ 4DM3A 1J90A 1DBSA 3PP8A 4E46A 3OTOB 1BFKA 1PZFA 2D2XA 2ATEA 5EPUA 3EGIA 5I51A 2IS6A 1NKTA 1T1RA 4MROA 1ZRSA 5BRNA 5TR9A 3EGXA 2ADMA 3DOJA 3ZJ5A 1FNDA 2B21A 3CWQA 4CHGA 4CN8A 3D8UA 4PR0A 4DSZA 3CVXA 3WXBA 1SHUX 2PYIA 1H2YA 4X1KB 4MJ3A 4YO8A 1IN7A 1B3RA 4OJQA 4I19A 2FPUA 3E15A 3KD3A 3HSSA 1OC4A 1U8UA 2FUKA 1PCXA 1TQ4A 1GADO 1OXXK 4FFBB 3RFFA 3T61A 3TQHA 1TQ8A 4RK1A 5ERYA 3U26A 4F38A 5DBFA 3U0BA 2YV4A 1JAYA 3EWAA 3I6ZA 2F1OA 1FOEB 4LYGA 1Q92A 3R8FA 1KKLA 1FSGA 1HKHA 1XWFA 4EUKA 1PT8A 3CEHA 2C4UA 4HI0E 3UOAB 5BR1A 5K6AC 1TO1E 3KD2A 2AWOA 4OY3A 3G2MA 5JD6A 4P82A 1DDGA 2H1IA 4I4IA 4LECA 2R4UA 3Q3JB 4CKBB 2GTIA 4PG5A 3TAUA 3QPWA 4TV8B 1NQTA 1Y1TA 2NV2B 5TQ2B 4HVAA 1S9HA 3DGFC 1ZBDA 4QYXA 1HQDA 4QDKA 2ZRIA 4ENRA 4OQYA 3QP9A 1NR7A 3AHEA 2Q5EA 1JWAB 1XZFA 2E48A 3V2HA 1HDYA 1OVMA 4N9QA 3QOWA 2ZRLA 4S0ZA 3CW9A 3R3VA 4CTJA 1WX1A 2Q5OA 3GJZA 3ZD8A 5EHZA 3MJRA 3FPEA 2NQ8A 4MGZR 1ODJA 2KI5A 4ZARA 4CV1A 1RD4A 2P75A 2Z3ZA 2OM2A 3BKXA 1FFXA 1WR8A 2R1VB 3WBKA 5SY9A 3ZNQA 2VZLA 3WFZA 4BNDA 4DREA 2Q3MA 3B2NA 4CYMA 1K6JA 3CZPA 2BFPA 4YCDA 5A0VA 2XUAA 2CWWA 2ZB2A 4H7PA 4QLOA 1QMPA 2I78A 5BV8A 3I4FA 1P5ZB 4Q7LA 2IIPA 4BFUA 2ZM6B 1NVFA 3L7CA 3QKUA 3ZIAD 1N2OA 4PZ0A 3ZG6A 3GK3A 2BE9A 2ZE7A 4L27A 2DBVO 2AJBA 2QTMA 2KM1A 2VIIA 5LKRA 3SR0A 2OD7A 1O2DA 2X22A 5CAEB 4YDSA 1Y1QA 4HS4A 1FMJA 1ULUA 4TVOA 4FFSA 1P1CA 5DSTA 5J1TB 4EA7A 2TMDA 3KJFA 1YBAA 4ENSA 3SICE 4AAYA 1AUOA 2ZXUA 4PNHA 2ZAOA 2ZVQX 1RKQA 4QICA 4YXFA 3PGJA 5T3YA 2QRMA 1Z34A 4RE6A 1Y6JA 2LIVA 3UJDA 1ZN7A 1WXWA 4IZOA 5KQRA 1B6GA 2IIBA 4YUXA 2EHDA 2WILA 3C1UA 4L9WA 1EJ6A 3HZOA 1DAGA 3TIFA 2FPGB 3HEMA 3UFBA 1MJNA 5C34B 2ZPUA 3WYGA 4DNQA 4PFKA 1HT2E 2NVUA 3A9TA 3FVTA 3I01A 3CRW1 1CNEA 3JQDA 4JODA 4MEBA 4XWGA 2H59A 2XB4A 3HKEB 4BTLA 2NO6A 2H85A 4B9AA 1JSLA 1JVSA 3DE4X 4W6QA 3V6LA 3DONA 4KO3S 5K6AA 3MTBA 4ZI7B 1ZL0A 3BWXA 3KBBA 1RKVA 3CVYA 3Q72A 1E63A 4PXYA 4B76A 3S2UA 4AMBA 4R9RA 1K98A 2GO1A 3ZY5A 2NV6A 3JQBC 2PWAA 3INGA 2RH9B 1ULBA 1K2WA 3F3SA 3AYZB 3OTGA 1P7CA 1QONA 4JS0A 4MAFA 4PF1A 2LDBA 4UJ3A 4EPRA 5AJUA 3ED5A 3RVJA 1QRTA 3BWMA 3FPSA 4O2BF 3TSZA 4B45A 2DUWA 3DKRA 2PS0A 1EHYA 1SY7A 1T10A 1ZMBA 4O29A 4P32A 3KFVA 3PQ2A 3RS5A 1TDJA 4LBYA 2C4VA 2B7CA 1ZMXA 4GKJB 3KVVA 2FF7A 4DY4A 4Y8VA 1GHTA 2AC4A 1OFIA 1S5PA 5F77A 3WYCA 1SCAA 4RENA 3ETCA 1M3SA 1X74A 2F3RA 3BL5A 2GD0A 2ZUUA 3I53A 1EB8A 1T4MA 3PD7A 4M0MA 4ZVQA 1M0EA 2IBTA 3WBFA 3ABOB 4ZI5A 1GPH1 1R88A 5CA0B 5JH7A 1Q77A 3HB1A 5ALLA 2XKAA 2XMDA 3HL4A 2BGNA 3UW3A 2PZBA 4WZ6A 5PGMA 4HFMA 4WT7A 2ZSEA 1XZLA 3BC1A 1JR4A 3JRWA 5JE8A 3KQUA 2GM5A 1CYDA 2FFQA 3GVPA