4CLHA

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
267
structure length
252
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQKSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords PTERIDINE REDUCTASE 1
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
total genus 92
structure length 252
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4clhA00
1T25A 3FI9A 5JNLA 2FP4A 1PJQA 2OUIA 4XWYA 1DRUA 2LDBA 4OKNA 3I9OA 2D59A 1LDYA 3WLFA 4B3JA 1LDMA 3DMYA 3IUSA 2A9FA 4W7HA 4IDGA 3HHPA 3P5SA 2NADA 1N9GB 2CVQA 3EVNA 3ZW9A 4DL9A 1IHXA 1X7DA 4E5YA 3JQDA 3WGQA 2VTEA 5DOZA 4BKRA 4Z0PA 4DLAA 3CTMA 4HADA 2VYNA 3GMSA 3OIFA 2NU9A 1HRDA 3OEWA 1HYHA 4QFCA 5AYVA 5KJ6A 1PQUA 3R1IA 2DM6A 1DLJA 4XYGA 2EW8A 4OM8A 3I9MA 1MXFA 2RH4A 2O3JA 5U1PA 5TIIA 5FF9A 4R3WA 4TQGA 5EIOA 4IJWA 4YAJA 3R0IA 4OL9A 4YJDA 4MP3A 3R3JA 1GDHA 3LF1A 4GX1A 1ZKMA 3HG7A 2B35A 3WSWA 3LU1A 2AEJA 4IJUA 4ZGWA 4JXKA 4MVJM 4BS9A 1N92A 1NQ5A 1OFGA 2GF2A 3GPIA 2B5VA 3C7DB 5JE8A 1DAOA 1ULUA 5U4QA 1VE9A 3ABIA 5GY7A 3BTOA 1UXGA 4E5MA 3DQPA 1B8VA 1ID1A 2AG5A 4NPCA 2PA3A 1UR5A 1WWKA 3ANMA 4BV9A 4EI2A 1GCOA 2VWHA 4HFRA 5K6AC 3K8ZA 1XU7A 1QV6A 4J49A 3LT4A 1P1RA 1Y5RA 3U09A 5C5IA 2FOIA 4RQUA 1F17A 4IIVA 3WBFA 1MXHA 2BI8A 3E6AA 3ADPA 3MTJA 1C1DB 4WLVA 3GT0A 4JP3A 2IEDA 1F06A 2PFGA 1NVTA 4YEDA 3L6DA 1B26A 1FK8A 3S2FA 2FY8A 2X9VA 1SB8A 1YBVA 1YS4A 1R4NB 4E0BA 2JHFA 4IZIA 2W2KA 3GA0A 3RUHA 4ZN6A 5JCJA 1A7AA 1QYCA 1NNUA 3VKVA 4CMJA 4BO3A 3OQ1A 1F0YA 2XPCA 3PLNA 3ZH2A 4NJMA 4D46A 1IZ0A 4RJTA 1K6IA 2CNBA 5CHEA 1H6CA 3ZN2A 4BGIA 3PPIA 5B37A 1IPEA 5DOVA 4ND5A 3TPCA 2WDZA 2AG8A 3FN4A 1K0UA 4MVJE 3R3SA 2NVUB 2GNAA 3RUFA 3RFVA 3PDJA 4I9UA 4UVEA 1AUPA 5COBA 4RL6A 3DBHA 3P7MA 1GL3A 4H7PA 3ZWOA 1GV0A 1BTOA 4FOOA 3ROPA 4XQEA 2AQIA 1M2WA 3PHLA 2NWQA 2VNSA 3H2SA 3WX0A 3D1LA 1DC6A 3GG2A 2AE2A 2H9IA 4BB5A 5G0TA 4CMIA 3FTNA 3LF2A 1XKQA 2EGHA 5KKCA 2DBQA 2P91A 1MC4A 1KVTA 3DBRB 3OH8A 4P8RA 3WOHA 3ST7A 3I9NA 1U28A 5B1YA 4ZRMA 4GPD1 3BMCB 4RORA 3OIDA 1UAGA 3GNSA 1NTOA 3QSGA 3HZZA 1BG6A 1DXYA 5JXWA 4O63O 1ISJA 3E9QA 1SEVA 3OQBA 5TC4A 1AXEA 1I5RA 2DFVA 3FRJA 2BMAA 1HYEA 4PLPA 4Z0HO 4G81A 5KIAA 4M1QA 4E5PA 1TT7A 2NV6A 3U5TA 3BMOB 4ZJUA 5EQFA 2WMDA 4U6QA 3FSRA 3F46A 4IQ8A 2BI7A 3BZUA 3N7UA 1J4AA 3PWSA 1EVYA 3K92A 3DFZA 5GZ1A 4UUMA 3W8FA 1HDGO 4KDEA 2O3SA 4RZIA 3VH3A 3JQ8B 1LBEA 5JCJD 4JCOA 1H6AA 3M1LA 1JTVA 1PR9A 3PVZA 1OBFO 4IQ0A 4QQRA 1GPJA 3FR7A 2CMDA 3SLKA 5DN9A 1EFLA 4AJ1A 1EMDA 4RPLA 4BV8A 3JQAA 3VPFA 3AI3A 2VRBA 3NUGA 3DMTC 4AJLA 4BNIA 3H9QA 5L7TA 4ALIA 4J9UE 4W9NC 3D3EA 5AXCA 3UCXA 1RPNA 5ITWA 4F46A 3X2EA 4L0QA 5AVOA 3DONA 2GERA 5I8ZA 4O5OA 4BNXA 2JAPA 3U4HA 3OJFA 3KYCB 1U9JA 4J9VA 3INRA 3Q3CA 2EP5A 4A73A 1Q0QA 5ILOA 4GLLA 4N18A 7MDHA 3KRTA 3A1NA 3KSZO 1CERA 3LC2O 3WYBA 3GDFA 1E3LA 3DAGA 4YJGB 4JBGA 4BNHA 1HWYA 3ZWBA 1K6JA 3P2YA 1N9GA 5TGDA 2C07A 4BNVA 5JO9A 4AJPA 3W4IA 2PTGA 1JLLA 1C0PA 4FJ2A 5DF1A 4PFJA 3I23A 3ZU4A 4CLEA 4I1IA 5BNTA 1YB1A 2V7PA 2NTNA 4XYMA 3DWFA 1DBVO 1E0DA 1NWCA 4IGEA 3I9LA 3JQBC 5TT0A 5CDTA 3K73O 3NT5A 1YOVA 4GVLA 1ZK1A 1WMBA 1E3SA 4YT5A 3FD8A 1BWSA 3HJAA 4YA6A 4WEQA 3IS3A 4J90A 4URFA 2FPPA 2NUAA 1IPFA 1DIHA 1R16A 2BF7A 3ZZNA 2POQX 3WJAA 1ADFA 4BNNA 3PJDA 4F6LA 3KOUA 2J3KA 3W8DA 4PLHA 3I83A 1XSEA 3RUDA 2JHGA 4D3DA 1NXQA 2B4TO 1QP8A 4GAEA 1I33A 4TKMA 2VHZA 1OOEA 2DLDA 5FYDA 2VZ0A 4HY3A 5BSGA 5ILGA 1LU9A 2Y93A 2JD1A 1MB4A 1C1DA 1ISHA 4RDHA 1JDJA 1EVZA 1JA9A 4K6CA 1QYDA 1KVQA 3FF4A 4WNIA 4R69A 1DJQA 4WCFB 4I08A 1J49A 3RD5A 2O7QA 1LDEA 4EJMA 3F3SA 4PVDA 2Q1SA 1EVJA 1WXDA 1PIWA 4HP8A 2HAEA 3D0OA 1PJTA 2PKQP 3C24A 4JJGA 4WASA 1SOVA 1Y81A 4XB1A 4TZKA 4Y8VA 4J3FA 3PQFA 1HDOA 2Q99A 5COQA 5A3VA 2C5EA 1ENPA 3FBTA 5JDIC 4D79A 1QR6A 4GH5A 5T6BA 2X0RA 5MDHA 1A27A 1YB4A 1Y8RB 3PFWO 4LRSB 4CQMB 5F5NA 1ZK0A 4MKXA 3EC7A 1YQXA 1P0FA 2FR8A 2YV1A 3EGOA 3T4XA 3TZCA 2GLXA 3AY6A 5IG2A 3FHLA 4PLGA 4TVBA 1MP0A 4ALJA 1XU9A 2HMVA 4PLFA 5KJ1A 1NQOA 2O3RA 3OF2A 3RSHA 5G0SA 2ZTVA 1QYVA 2IYPA 3GZ4A 4D3SA 3IUPA 3CUKA 2H6EA 1NR7A 1IHYA 4TMFA 1HYGA 2AEFA 3T4EA 5G0UA 1Q2XA 4A26A 4YT8A 3RU7A 3H9GA 1K6XA 1CETA 5BSEA 3AW9A 1P31A 2FSSA 3TSCA 3WQQA 4Q3NA 1UDBA 3OICA 4O0LA 3IL2A 4KUGA 3ROKA 3DBVO 4B4WA 1NPDA 2WSBA 1X7HA 1R0KA 3DBRA 1IE3A 2DBVO 4J0FA 4BO4A 1NR1A 1YDWA 1LDGA 3H9EO 1TEHA 1FF9A 4O59O 3EYWA 3Q2IA 1HE4A 2O3TA 3BHJA 1KBZA 2UYYA 3GC6A 2NVBA 3BMCA 1NHWA 2GN6A 4E12A 3ICPA 4CL8A 4CLRB 1FDVA 4XX0A 1O6ZA 4B4OA 3WYCA 4E30A 2DAPA 1KY4A 1ZUD1 3NT4A 5CEJA 4PG8A 2HSDA 4IDAA 4ZQEA 3OBBA 1U7HA 4DIBA 4CMCA 3BMOA 1NQAO 2ZTUA 4CR6A 3FPCA 2TMGA 4PG6A 3W4KA 1RYDA 3S2EA 1L7DA 3PZRA 4BNYA 3G1UA 2W8ZA 5IDXA 4OIMA 3I3OA 3FWNA 3OM9A 4DXHA 1R4MA 2OFPA 4EW6A 2ZB7A 2WEKA 4JBIA 1E3IA 1T2AA 3DOCA 3O4RA 4AICA 1LQTA 1L1FA 5CFZA 1EE2A 4BGEA 4B4UA 4Q3DA 2C54A 1BSVA 1E92A 1ZBQA 3B1KA 3GHHA 3ONFA 4YJHB 4CR8A 4PLZA 3V2UA 5JAZA 1MA0A 3BMQB 2FRDA 4CM7A 3JQFA 2WYVA 3NDJA 1L7EA 5AOVA 5FFFA 3NGXA 1MV8A 1UJMA 2Y0EA 4UUNA 3WTCA 1GQ2A 4XQ9A 4I5GA 5BSHA 1KIFA 2WJPA 2J5KA 2YHIA 1E1MA 4E6PA 4WLOA 4XGKA 5GZ3A 2DTDA 2VRCA 5TLSA 5L4LA 1YGYA 3C7CB 1MUUA 5A06A 4YACA 1M75A 3EK2A 1LA2A 3KXDA 4JP2A 2Y68A 4E5NA 5A1TA 4FFNA 3RKUA 1VJ0A 3NRCA 4D0RA 2WE7A 4J1SA 1EE9A 4U8GA 4WCFC 1HSZA 1PQPA 1C1XB 3GH3A 2EKLA 5JAIA 3KO8A 1NAHA 1V8BA 2JD0A 3BA1A 4ILKA 5COAA 2CUKA 4L74A 1BGVA 1LSOA 5LDGA 3JTMA 3PGJA 3ZU5A 4ALMA 5FEUA 4FFRA 4FGSA 4IS3A 3WQSB 1DLIA 3ASUA 4J6FA 3AUAA 1ARZA 2XOXA 4CMHA 5EESA 2R2GA 2RHRA 2HLPA 2ZYGA 5TX7A 5A4DA 5HBRA 1ZXBA 5JYEA 4G5HA 4FFOA 4U7WA 2DVMA 2EXXA 2PGLA 3RC1A 3AU9A 1RWBA 3TN7A 3W1VA 1PGOA 2LDXA 4IQGA 5HM8A 1U4SA 2Q4EA 3U4IA 1BXGA 1PU2A 3ZV5A 4DC0A 4JJFA 1U8FO 1BXKA 1GAEO 4AJ4A 1E7WA 3LT1A 1ENOA 2Z1NA 3I9KA 4PLWA 1TA4A 1BXZA 3C7AA 2BFAA 4GI2A 4BMNA 3WNVA 1LXCA 1LX6A 3L6EA 1IB6A 2JCVA 4N54A 1NFQA 1I30A 2B36A 2YFHA 1H2BA 1Y8QA 4BQPA 1RM0A 1ZSYA 3Q0EA 4KTVE 2H63A 4HFJA 2PK3A 5ES3A 1I3LA 4J2OA 2A35A 3V1YA 2WD8A 1PZHA 3VDRA 1IY8A 2E37A 1ONPA 1TT5B 1JW9B 2YW9A 1ISIA 4CLDA 5C3MA 1TVEA 3AM5A 3OJ0A 1GU7A 3H9JA 3KHUA 1NVMB 4YT4A 4E32A 1VKNA 3WXBA 3UFXA 1JAYA 2O2YA 4M49A 2DC1A 2HDHA 2IE0A 3V5NA 2V6MA 1UZMA 2OHXA 3JQ9C 3ONDA 3LT2A 1R37A 1HLPA 2ZATA 4TVOA 4CQMA 5KKAA 1NHGA 4QFDA 3LSYA 3G79A 2VTDA 3ZDFA 2PGDA 4A10A 1PJBA 4L9RA 1XYGA 3F6YA 3PEFA 1DJNA 4Q3AA 5DCYA 4NBVA 3WFIA 4RVDA 3GVHA 2G1UA 3WWZA 3ZHZA 2D1YA 1P1IA 1LLDA 4Z3KA 4Q9NA 3SC6A 2GDZA 2QW8A 4FCCA 1KERA 2TMDA 1WW8A 5CEFA 1UP4A 3S55A 8LDHA 5JDCA 1RYEA 3DL2A 4JROA 1ADBA 5EL0A 3DC2A 2GN8A 1V9LA 3AFNA 5KOIA 2C59A 2OOSA 2Z1MA 2NVWA 3ZV3A 1T2CA 3WR5A 3QWIA 3IQDB 4EDFA 2BLLA 2I66A 3KEOA 2CDCA 3S8MA 1DC4A 3RU9A 3IP1A 1G0OA 2YQ5A 1BMDA 9LDBA 3JQGB 4NI5A 2BD0A 1K89A 1CF2O 5F1KA 3M2TA 2VN8A 3GVIA 1M67A 3TF5A 2PR2A 4MKRA 1XWFA 3MWEB 4QO8A 1EBUA 3GZNB 1VC2A 2PH5A 3NKLA 4BL5A 4GSKA 5AXAA 3UVEA 2PLAA 1QKIA 3PHJA 3AM4A 4L8VA 3PHIA 2D5CA 1H0KA 4M55A 5T8KC 1T4DA 4Z9XA 2OO5A 4LW8A 2Y67A 3Q9NA 3WIDA 1UDCA 2X7HA 1HTBA 1I36A 3A06A 1TB4A 2PD3A 1ZVMA 2Q2WA 5DCUA 1PJCA 3NEPX 4R1NA 4TROA 4D43A 2PD6A 1U3TA 3ITKA 3CSDA 3TDKA 4GGOA 3NDRA 4PLTA 1E3WB 3HWRA 3L4SO 4MVJP 3ULKA 5CDGA 2RBEA 3NV9A 4BKUA 3PIIA 4QEDA 1J0XO 1OC4A 2NQTA 1KEUA 1C0KA 1LRKA 1E7SA 2WTBA 2HJSA 1DIAA 3DOJA 4RVUA 3H6KA 4WLFA 5G4KB 4BNJA 2I6TA 3JQEA 1GYQA 2GZ3A 5CPFA 4YJHA 5LCXA 5IZCC 1VJ1A 3QHAA 5ADHA 2QYTA 1GR0A 2AQKA 3BMQA 4CQMD 4QUKA 4OXNA 2IDZA 2QZ9A 4I5DA 4ZQBA 2UDPA 2GCGA 3NGLA 1DRWA 3K96A 2HU2A 3H3JA 4J4HA 1Y6JA 4YDRA 2XF8A 2BHLA 3TL2A 3BHMA 3Q6IA 2Q50A 4C7JA 5IAAA 3GRPA 1EBFA 4FC7A 1B15A 5DNAA 2WYUA 1X0VA 3DTYA 1I3MA 3PJEA 1H9AA 3GEMA 1JVSA 3E9NA 4MVJG 5A9TA 2XAAA 4AJ2A 2Z5LA 3IJRA 5A9SB 4WLNA 2UUOA 1AE1A 4CM1A 2J6IA 4NBRA 3HSKA 2J5RA 3B20A 3L6OO 1JWBB 3ZV6A 4H16A 1UXKA 3JD3A 3K6JA 1C1XA 1JU9A 4Z6KA 4DC1A 4Y6SA 3KZVA 3HQ4O 4MO2A 5MGBA 3WGGA 5KTKA 3VZRA 1Z82A 1YL7A 2PNFA 3GGPA 2ZJ1A 1XDWA 4Z9FA 2FSVA 1R0SA 1A7KA 4D44A 3GRKA 3C8MA 1HE2A 2I9PA 4NU5A 4BKQA 3QWHA 4XCVA 5ICMA 1W6UA 1GYPA 3RJ5A 2X0NA 2JFFA 3HB4X 3U49A 1BVUA 1QXSA 1TXGA 1DAPA 2G17A 4LSWA 2P68A 1PL6A 1YJQA 3ADOA 4KMSA 4XR9A 3RUEA 3VOSA 1PJLA 4UEJA 4WOJA 2O23A 5FWNA 2FPIA 4DA9A 3N74A 4DQUA 3LLVA 4RPJA 3I4CA 3JYPA 2C7VA 3H7AA 1SPXA 3L4BC 1GTMA 1NWHA 3EAGA 2Y66A 2Q3EA 1N5DA 1CEQA 5BNFA 1NM5A 2ZIZA 4Q3BA 5L4NA 4J7UA 4FB5A 3ZCXA 1M76A 5KVQA 3SBOA 3ETDA 4CR7A 4BNMA 2VHYA 1NVGA 1NPYA 2XXJA 1Q7CA 2ZYDA 1PS0A 4YCAA 2HJRA 4XQGA 3ROMA 3UUWA 5JFOA 1NBOA 4ZA2A 4J1TA 1KEWA 4ZICA 4TRNA 4KDFA 1ISMA 4NJOA 3IC5A 4ESOA 1ZNQO 2VOJA 4RPKA 4YJFB 3RC7A 3SLGA 3RUIA 4YT2A 3KYDB 4BO9A 1QORA 4WOKA 4D42A 2WYWA 4NBUA 1GQQA 5T67A 4XIJA 1G1AA 4YB8A 3K31A 2YY7A 2E4AA 4AJEA 2X86A 1ONOA 3PQEA 4CUJA 2UVDA 5JS6A 3WBBA 2O4CA 2ZQYA 4FDAA 1WDMA 2IXBA 1RM4A 2W2LA 3IAHA 1JKIA 3ICCA 1O94A 3KTDA 3QVWA 1PGPA 1OAAA 4YTEA 3CE6A 1Z75A 1QMGA 3UW3A 3V8BA 3DHEA 4C7KA 4J7XA 4FJ1A 1YONA 2VNAA 3UH1A 2YHUA 2E6UX 1MG0A 2A4KA 3GFGA 1T2EA 1SMKA 2QRKA 4ZD6A 2FZWA 1D4FA 4CV3A 1PZFA 5KCZA 4LVCA 4NU6A 4YAKA 1KETA 1HDZA 3VHRA 1B0AA 1YE3A 3OECA 5DP2A 1MLDA 1EVIA 3STHA 2BFMA 4JQCA 4DYDA 1PZEA 4F45A 3MJTA 1PR3A 3U0BA 1DIBA 2EW2A 2UUPA 2JFGA 5CDSA 3B70A 3KB6A 1ZSNA 2CVOA 2I76A 4YYZA 2GGSA 4GX2A 1VM6A 2O4UX 1K2WA 3GZNA 4ITUA 4YVFA 3AU8A 1X14A 3C1TA 3E82A 2Y1EA 2Y1CA 4BIIA 3E48A 1NASA 1M6HA 1U1IA 2VWPA 2YDXA 5BT9A 4GKVA 1SZJG 3K5PA 2WM3A 1JKFA 5JMWA 4PRLA 1JN0A 4PIVA 1P33A 3WS7A 2G5CA 3RFTA 4ZQFA 3K30A 4J2HA 1LQUA 2Y99A 4R5MA 4CM8B 3DZHA 2P9CA 2X5JO 3PLRA 1SO8A 3C1AA 4G65A 4IXTA 3WTBA 2AHRA 3ZU3A 1HETA 4F3YA 3T7EA 1B7GO 3TZKA 1E3WA 2J3HA 3DTTA 4CM4B 2NU7A 4OYRA 3RI3A 1B8UA 4CMGA 1NAIA 3TOZA 2DKNA 4NNJA 4BO1A 1V3UA 3UAGA 2C2XA 4IDEA 3SC4A 2VUTA 1RJWA 5G4KA 4B7UA 1SAYA 3G1TA 4M87A 3IKVA 2NTJA 1K3TA 4KTTE 1JKJA 2VWGA 3D5TA 4U0JA 4FIZA 1IYZA 1XIVA 3IIEA 2VHVA 3JD0A 2GR9A 4OQYA 3GFBA 4K6FA 2BH9A 1GCUA 2W2LD 4IM7A 4ND2A 2PKQO 5C7LO 1KVUA 2YQ4A 4INAA 5KJCA 1GUFA 3NTOA 4R9RA 1H6BA 1EDZA 3HNPA 3Q9UA 4OXKA 4YAEA 2GPTA 3PIDA 5JYDA 5EINA 2OMEA 5JBIA 3ETGA 4CMEC 1ULSA 2FHSA 2NU6A 2GUGA 3LYLA 1HLDA 3EY4A 4WUVA 4AJIA 5A9SA 3B1FA 1WLYA 3PFFA 5KJFA 3M1AA 2ZK7A 4I9HA 4N5NA 1QLJA 1C3VA 3H2ZA 3D5QA 3TFQA 2IZ0A 3RBXA 5IDQA 2VZ8A 2AMFA 3UKOA 3GQVA 3ZU2A 2IZ1A 3AM3A 2V6GA 3PK0A 3UN1A 1SB9A 5AXBA 4D45A 4FGWA 2EG9A 4L76A 2OXIA 5IN5A 2GASA 4HKTA 3UCEA 4MVJI 3DBLB 4ZQGA 4DMMA 3DMTA 3RCBA 4AG3A 1PS8A 4DTIA 2YYYA 4W9NA 3MJCA 4DRYA 2PZJA 3MWDB 3GPDG 1I2ZA 3ZV4A 2C7GA 4RF4A 1Z6ZA 4HNHA 4YAGA 2FMUA 5KJEA 2Y1OA 1MX3A 3DZIA 3I52A 4KZPA 4RZHA 5T64A 2JL1A 2VZ9A 5FI3A 4KQXA 3VZPA 1EFKA 1LNQA 4UUPA 5I9LA 4R4JA 4I8XA 5I7VA 1Q7GA 1Z73A 4HBGA 3CMCO 3PI7A 1HZJA 4XKJA 3OHSX 4FFLA 4FS3A 4AJNA 3F9IA 4NFHA 1E6EA 3WG9A 1S6YA 2D0IA 2EEZA 1DSSG 1Z7EA 3EZYA 4Z9YA 1ML3A 1KYQA 5KVCA 1R4NA 3TFOA 5IXYA 2RCYA 4Q39A 2ZTMA 3RBVA 2OORA 3UF0A 3JSAA 3WJ7A 4A27A 2BGMA 3B6ZA 3HDQA 4IDBA 1ZXLA 4IDDA 4WGGA 4DPMA 3Q2KA 4NFSA 4PLCA 5DULA 4YJFA 5TF4A 2JCXA 3JQBA 2W90A 2HUNA 1GYRA 3OQ6A 2B37A 3SJ7A 3VZSA 2DUWA 4MDHA 5A05A 3F1KA 3NTQA 2P5YA 3G49A 5LC1A 2NVUA 5A3JA 1PWZA 1VL0A 1XHLA 4OOFA 4PZCA 1PJ4A 3OA2A 4ONEA 4R1TA 4FFPA 3VTFA 1GFSA 4JX8A 1EEHA 2NM0A 5FI5A 1YJ8A 5JC8A 3AOEC 1ONNA 3GDGA 3WWYA 1DC3A 1B3RA 3MJ4A 3T7CA 2QYSA 4NG5A 2AE1A 4TWRA 3N58A 3I6IA 2HK9A 1BRMA 3Q1LA 4FD3A 4RF2A 4BNUA 2Y0CA 2A92A 3JYNA 5HWSA 1AHIA 4QECA 3PXXA 3ZWPA 1QYXA 3DZGA 4RDIA 4A0SA 4O6VA 4CV2A 1S7CA 1SOWA 1LLCA 5GMOA 1LI4A 3BAZA 2X0IA 3JD2A 4PG5A 1I10A 1PZGA 1I3KA 5CDUA 1FDTA 5EPOA 4E2WA 1PWXA 2DQ4A 4II3A 1WZIA 3IJPA 1IZ9A 3SXPA 2BKAA 3WFJA 1ORRA 3ZWCA 3DZBA 5IFLA 5L7WA 2J8ZA 2VQ3A 3C85A 3WGYA 5L53A 2P9GA 2GN9A 4ZQHA 1LDNA 3LZ6A 1EZ4A 4CV0A 5TS3A 4BKOA 4E5KA 3ANNA 4E3ZA 2F1KA 1DFIA 4CLOB 5H81A 4XGNA 3VDQA 1NPTO 3JQ8A 3FR8A 4WE3A 2PZKA 5JY1A 4PGFA 5F21A 1E7MA 1JVBA 4MPDA 4R1SA 4R1UA 3JQ7B 4RO0A 4MIYA 4L75A 4I5FA 1X13A 3H5NA 1DB3A 4NR0A 1CJCA 1UZLA 1A5ZA 3QWAA 3RJ9A 3SVTA 3R6DA 2I3AA 3M2PA 2Q49A 2IXAA 5L40A 1J5PA 1X15A 3WICA 1JQBA 4J4TA 4XDYA 4JJIA 4P4GA 4CLXA 4OHUA 5B4VA 1GV1A 1PJSA 1F8GA 3S2IA 2P4HX 1BW9B 3KYCA 2EJVA 4IGFA 1K5HA 2BGKA 3TZQA 3RFXA 4AJHA 1HE5A 4LGVA 2XXBA 2DT5A 5KVVA 2UV8A 5DDIP 2D5AA 3G3EA 3WYEA 2YV3A 4R9SA 4YJGA 3V2GA 5A03A 1UXJA 2ZQZA 3RKRA 2VCYA 4MVJF 3FBGA 3VH2A 1CYDA 2GZ1A 2WE8A 5DCWA 3JD1A 2QQ5A 4I9NA 3ZWVA 2JD2A 2OL4A 1LJ8A 1XELA 1KEPA 4EZBA 1A4UA 2FZEA 3RUAA 3VPSA 3DZJA 4E33A 2H1SA 4DQVA 3K9QO 4IDFA 1UDAA 2CDAA 4FOSA 2EIHA 2VUSA 3L07A 3L77A 2CDBA 4AVYA 5EJ2A 5F1PA 5CP8A 1ZMOA 4RV9A 5ENVA 4H15A 4RLSA 2Q46A 3VPHA 5BR7A 5L4SA 3EMKA 4BNGA 5JCXA 5CPBA 4DBVO 1VKOA 4M89A 3GN2A 3NTRA 4E21A 3GLQA 1H93A 3ZGYA 3JD4A 1T1RA 3HADA 4PG7A 1EK5A 2I67A 3IOYA 1H5QA 2C20A 2PY6A 2O7SA 3DDNA 4GWGA 3IMFA 4GX5A 3TOXA 1TI7A 1P9LA 4ALNA 5A5EA 3AUSA 1CDOA 3P19A 3OSUA 1SC6A 2AA3A 3PHGA 5ER6A 1AXGA 3VH1A 4DVJA 1WMAA 4IS2A 4OXYA 3OJEA 4MVJH 1I0ZA 1PGQA 2O2SA 3GGGA 3KV3O 3QP9A 1R0LA 1VI2A 4OSOA 4WCFA 5L3ZA 2ZB4A 3W6UA 3NJ8A 4XYEA 5CEEA 4QX6A 4PN3A 2OBNA 5IZ4A 1Y1PA 1SCUA 3GR6A 3UXYA 3WNQA 3KVOA 3GK3A 4W4TA 4BMSA 4BMVA 7ADHA 3LDHA 1U2DA 5I7EA 1MGOA 3LQFA 3LK7A 4FPXA 3CXRA 3ZWNA 3U3XA 1Y8RA 4YBZA 4LMPA 1I8TA 2FR0A 4DLLA 1LRLA 4N7RA 2R6JA 2BELA 2OGUA 1W0CA 2G76A 4NJMB 4YXFA 3MCVA 4K26A 1IUKA 3GN1A 2BGLA 1FJHA 4Q3EA 5CAEA 3V1TC 1D1TA 4CMBA 2AQHA 2Y1DA 1XEAA 3QVTA 3D4OA 1ZW1A 3AWDA 4MVJA 2I99A 2CF5A 1O8CA 3D7LA 3BHIA 3DHYA 1NFFA 3EW7A 3PJGA 1IOLA 3ZHYA 3UGKA 5JPIA 2EKQA 1DO8A 1LLQA 4NBTA 3DBHB 3Q11A 2BFOA 5C37A 1T24A 3QWBA 1U3UA 4RVHA 2OBYA 4OMUA 4YRBA 2IZZA 4E2YA 1T4BA 4OOEA 1BHSA 1PTJA 1U5AA 5G0VA 2QHXA 2G0TA 4ALLA 4BNTA 3E03A 2Y05A 3W4JA 4BO2A 4M8SA 5G2OA 4QT0A 5JAQA 3TRIA 4IINA 1HKUA 3HDHA 4MJLA 2YZ7A 1MFPA 2VT3A 1A4IA 4FSHA 3FNEA 3TZHA 5ICSA 4W7IA 5B12A 2R00C 1U3VA 3FPLA 3HE3A 4JIGA 4XRRA 3ZWXA 1ZEMA 3MOGA 1LSSA 2UAGA 3GGOA 4CLRA 5HS4A 3V2HA 1LC3A 3QV1A 1Y9AA 4UULA 4B3IA 1P1HA 1EDOA 5CG2A 4MINA 3WLEA 4DUPA 1D8AA 2DUUA 4EGFA 4XJTA 4PRKA 3JQ9A 4WECA 1PGJA 1VL6A 4ZHSA 2AQ8A 3A28A 3BIOA 1R12A 5H83A 1E1LA 4KP7A 3S2GA 3E9MA 1FDWA 2YV2A 1V3TA 2HMWA 3CMMA 4UEOA 3PYXA 5TT1A 1U8XX 3HDJA 2B69A 3TQHA 4WJZA 4RGBA 3MOIA 2IEBA 5F3RA 4QSMA 1U5CA 4EEXA 3OFSA 4OQZA 4IJVA 3AY3A 4IBOA 5EN4A 5ER9A 1I32A 5CDYA 1P44A 2B4QA 1A71A 3HUDA 1QYWA 2HQ1A 4J4BA 2ZKLA 3I6QA 4D7AA 1DEHA 5IN4A 3EDMA 2VHXA 3ETEA 4XIYA 5I8WA 4E13A 1OZAA 4BO8A 3GDOA 3PTZA 5BQFA 4HFNA 3ZHXA 3ZNPA 4CM6A 1EUCA 3O38A 3MEQA 3PDUA 4NH4A 3JQAB 1I01A 4XB2A 2Q1TA 4TRMA 1BW9A 4FR5A 2EWMA 4MVJD 3F5QA 2NNLD 1UXHA 3E5MA 3IP3A 1MG5A 1WDKA 2AXQA 3RAJA 5BNIA 3VVCA 1GD1O 1V3VA 3QVOA 1ISFA 4Y6PA 5KNLA 4TRJA 3U4DA 5G4LA 2YUTA 4WNCA 4IMPA 3DZFA 1GUYA 3IKTA 3F4LA 4ND1A 5T8KA 3U62A 4QO7A 1HSOA 3JYLA 2RH8A 1LEHA 3QQPA 3GMDA 4J1NA 4IUYA 4B79A 2QZZA 5I9NA 4XR4A 1E3EA 2DBZA 4RF3A 3RQSA 2PZLA 1QSGA 1E7RA 2YDYA 2ZB3A 1P0CA 4RLHA 4Y98A 5DBFA 5TSDA 1ZSVA 3MJEA 4HUJA 4BGUA 2C0CA 3KM0A 1NYTA 4S3MA 1T2FA 2DPHA 4UVDA 2X9GA 1IL0A 2HRZA 1T26A 3I9JA 3GNTA 1YQGA 1VJTA 3MZ0A 3WGTA 3ZWAA 5JC1A 1XGKA 2ZB8A 1KEVA 4E4YA 1YH3A 2I3GA 4BO6A 1DFHA 1YOVB 4OH1A 1F8FA 4LCEA 3TWOA 3NDIA 4K9DA 5IZCA 1N7HA 4WLUA 3BMNB 5AQ1A 3PJFA 2PGJA 4NK5A 4PLVA 1XA0A 4GWKA 4LISA 3GAFA 4LCJA 4R5HA 1D1SA 1R66A 3G0OA 4F6CA 3ORFA 1JAXA 3DB2A 4OSPA 2Y1GA 3DR3A 3F5SA 4EBFA 2JJYA 1P1JA 1PJ2A 1YO6A 2Z95A 4U5QA 2O3UA 3GVPA 3QVXA 4AFNA 3E8XA 4Z3DA 2GN4A 4Z0TA 4PCVA 1PEDA 1GADO 4CMKA 3I4FA 4NFYA 2ZCUA 2ZTLA 4DGSA 2VWQA 4Y6RA 4CUZA 3ZI0A 4FFMA 2WWRA 3PRJA 4IIUA 4BNZA 4GX0A 1TT5A 4ND3A 4BOYA 2CZCA 4WKGA 1H2HA 1XG5A 2P2SA 3EZLA 1YQDA 1HF3A 4DQXA 1Q0HA 4JLWA 2VOEA 2X5KO 1DPGA 3WGHA 1R6DA 3O03A 1SEPA 4W6ZA 1EUDA 5IDYA 2QX7A 3P2OA 2D3TA 4J43A 4B3HA 1DOHA 4IXWA 3WSVA 4CQLB 4YRAA 3PWKA 1VSUA 4DWVA 3HN2A 1NFRA 1KC1A 1J6UA 1QV7A 3IDSA 3OMLA 3TL3A 1XR3A 2P9EA 3HN7A 4NBWA 2PD4A 2WD7B 3DOOA 1MC5A 3JYOA 4NQZA 4CM3A 3HB5X 3AUUA 3UHAA 4G2NA 4TRRA 3DO5A 3PP8A 4GSLA 2Y1FA 1N2SA 4ALKA 5K6AA 2EP7A 3L9XA 6ADHA 3KEQA 5K0ZA 1ZCJA 4W99A 1GZ3A 3RUCA 1PX0A 4U0KA 3VAZA 3NT2A 3PZBA 1Q0LA 4R16A 1JWAB 2JFHA 4ZU3A 4A03A 3WGIA 3PQDA 4IMRA 1VPDA 2DTEA 2CSUA 1M6WA 3SEFA 2PV7A 4GVXA 3L4BA 4J0EA 3WGZA 3JYQA 1ZK4A 5K9ZA 4XA8A 3KSUA 1GEGA 1W8DA 2GD1O 1CWUA 2VYND 1D7OA 3CPSA 3JQ6A 4J91A 3INTA 1WAMA 3I5MA 3ZWYA 2G82A 1RM3A 5L51A 1F12A 4BVAA 2V65A 1DIRA 3JQGA 3E1KA 1CQJA 2HK7A 1UAYA 4R54A 1KVRA 3CZRA 3QRWA 4NHEA 2EF1A 4BO7A 1VL8A 4YR9A 3KYBA 3WQRA 1U4OA 2VYVA 4DMLA 1XCBA 2E48A 5IDWA 3AOGA 2QIOA 1WPQA 4WLEA 3INGA 5ITVA 4RVGA 1P77A 1Y5MA 4GMFA 4YPOA 1X7GA 4FW8A 4B8ZA 1Y9EA 2JCYA 3H3FA 4QXMA 1F14A 3PWZA 4KUHA 2BRUA 3E18A 4W82A 4K28A 4DBZA 2DPGA 2X22A 3AK4A 1WDLA 2Q1UA 1I2BA 1ZJYA 3SJUA 4BO5A 3PYMA 3RIHA 3MTGA 1T2DA 4LRTB 3GUYA 3JV7A 3NX4A 3OETA 4LSMA 2X6TA 2A94A 4I5EA 4EEZA 1Z74A 4R3NA 4NZ9A 2C2YA 1TLTA 1YB5A 4HWKA 3RVDA 1R4MB 2BFPA 4L4RA 4R01A 4HXYA 5EERA 3CKYA 4BNWA 1ZFNA 1DC5A 5JMPA 4LK3A 3HFSA 4D0SA 2RIRA 1QLHA 1BDBA 2D4AA 4CJXA 4X54A 1FDUA 1HDYA 1Q1NA 1E3JA 1KS9A 4RVSA 2YHIB 4D41A 3O26A 1ADCA 3ZNQA 1NQTA 2CD9A 4ROSA 5C7OO 5AXDA 4A5OA 4BO0A 5DP1A 1W4ZA 4UUOA 4RPGA 3O9ZA 1Q7BA 5A9RA 1QG6A 5L7YA 1ZMTA 5THQA 5KVSA 1RM5A 1DRVA 2J3JA 3A14A 4UEKA 4EITA 4B7XA 4HNGA 1W73A 2DBRA 1B3BA 3A4VA 4MP8A 1P1FA 1PL7A 4JGBA 4Q3CA 3RC9A 3ENNA 3KBOA 2ILTA 5U9CA 1B16A 1E1NA 2AW5A 1O0SA 3E5RA 1HT0A 1C0IA 1O5IA 4Y9DA 2VYVD 2IODA 1ZEJA 1YL5A 1G0NA 1GPDG 2NLOA 2I5PO 4DREA 1C0LA 1SBYA 3KUXA 3GOHA 4II2A 1P1KA 3WB9A 4HV4A 5L95A 1FMCA 1OC2A 4B8WA 3QW2A 2J3IA 2EJWA 1UZNA 4PVCA 1LLUA 2CVZA 2GRAA 3BMNA 3LLSA 1A72A 3X2FA 1HDCA 2B0JA 3W6ZA 3BYZA 2DTXA 1U3WA 5JY6A 3FCOA 2JAHA 2PZMA 2X1HA 1UXIA 4LVUA 4J16A 1BXGB 1I2CA 1ADGA 1MFZA 3LC7O 4PLYA 1PS9A 1X1TA 4XJSA 5HS6A 2X9NA 2YJZA 4LMRA 3OJLA 5TRTA 1N8KA 2VUUA 1DIGA 3S1LA 4CMEA 2HCTA 3H8VA 3H5AA 4XQCA 3TZ6A 4BNKA 1EK6A 4XDZA 2W4QA 3AFMA 1KOLA 4GBJA 1Y8QB 3H65A 3H5RA 4RCVA 2VT2A 3RWBA 1LDBA 3GNQA 3KYDA 1ZH8A 4NDNE 1UUFA 3BTUA 3MJSA 3ITDA 3JQAD 2OZPA 3ZWWA 4KQWA 4A7PA 3D4NA 1LSUA 2GYYA 4JK3A 4GQAA 4N5MA 3ZW8A 1U7TA 4EYEA 2W98A 3O8QB 3RBZA 1HL3A 2DU8A 3TNLA 4GLOA 1PJ3A 3DAFA 4CQLA 4GMGA 4E2ZA 1A9ZA 5L9AA 2I65A 1LC0A 3EHEA 2C29D 2X5OA 2ZJ0A 4BNFA 2EERA 2FR1A 1YVEI 2WD7A 2GO1A 1OMOA 2X58A 1V35A 3GAZA 4ND4A 5T57A 2OP1A 4GGPA 3GY0A 1N7GA 3QJ5A 2X0JA 5HA5A 4FC6A 1A9YA 4XZ3A 3NAQA 3WIEA 2NQ8A 1AHHA 3CZMA 3WDSA 1EQ2A 4O1MA 4IPTA 5ENDA 3RROA 4YQYA 1ZJZA 3ROQA 3DEYX 3ASVA 3WMWA 1E7QA 1DFGA 4U6SA 3CH6A 1YBMA 4NMHA 3COSA 4RVFA 3TJRA 1CIVA 4L4SA 3VH4A 4YAIA 1EQUA 1YKFA 4WCDA 1WP4A 3L9WA 3JQFC 1HDXA 3B1JA 5DBGA 3BTVA 3AY7A 3FNHA 1NX6A 1V0JA 1Z7BA 2PH3A 3ON5A 4N5LA 2J5QA 1RKXA 5JDIA 1ENYA 2Q4BA 3DXFA 1GZ4A 2HMSA 2FN7A 2IYOA 3VZQA 4TZTA 2Q2QA 1BVRA 1WVGA 2ZYAA 4CM8A 4EJ6A 2NSDA 2SCUA 1X1EA 2EHDA 4MP6A 3D3WB 1D3AA 4CM9A 5DT9A 1Y7TA 4MIEA 4CM4A 3AI2A 4M86A 4QTZA 4BUCA 3AOEA 1HE3A 1E6UA 3C1OA 4MIOA 1CRWG 2JKVA 3FNGA 4P38A 4D3FA 3DZKA 2QRJA 2PWZA 2VHWA 3OP4A 1QRRA 4GL4A 3VPXA 2P5UA 5JAMA 1X0XA 2ZCVA 3LC1O 4BQRA 4DIFA 3VVBA 5DZSA 1ZIDA 1VSVA 1B8PA 1PL8A 2CF6A 1V6AA 1ZO8A 1YXMA 3DFUA 3ANLA 4OAQA 3KLPX 3D4PA 4CUKA 3FTPA 1AGNA 1O9BA 3LT0A 4NK4A 4UVGA 3BTSA 4WPGA 5F5LA 1PSDA 4L4XA 5JW6A 1EUZA 4KWHA 4DIOA 5CG1A 2EKPA 4CLHA 4CV1A 3UICA 5I7SA 3CEAA 4AJJA 2V6FA 1C14A 3OJOA 4L73A 5HTOA 3ZWMA 1CQIA 1ENZA 2YFQA 3PYLA 4WK6A 1SNYA 2OP0A 4RF5A 2B5WA 2IRWA 3GVCA 2QRLA 4CMAA 1N1GA 1VRWA 2QG4A 3WGOA 2B83A 1I24A 1E6WA 1PQWA 4IZHA 4EUFA 4BHTA 4JBHA 3VPGA 1LSJA 4J7CA 1HXHA 3D64A 4YQZA 1KY5A 5B4TA 4CPDA 2O50A 5JSFA 2H5LA 4TKLA 1O89A 4P4NA 4EJ0A 3DBLA 2NACA 4RPHA 4IY1A 1I3NA 1LUAA 2C5AA 1E5LA 3ZNNA 5IF3A 3GG9A 3DHNA 1WZEA 5KWEA 1B14A 1GQYA 4KUEA 4RQTA 1GEEA 4YRDA 4JN6B 4ID9A 5EQDA 3QY9A 3JQCA 4UREA 4CM9D 3H9UA 3MJVA 2NTVA 4S1VA 9LDTA 4IDCA 3KSDO 4B4VA 2EGGA 2CY0A 1LTHR 3H4VA 4FQ8A 3G17A 1UH5A 4IJKA 3VTZA 1DHTA 5TNXA 8ADHA 2D8AA 3OA0A 1KC3A 2HRBA 1OI7A 5TJ9A 3AUTA 4E2XA 2Y0DA 5I7FA 1GUZA 3GF4A 3KLMX 5JDCC 2X4GA 2HK8A 4CL3A 4OO3A 4XD2A 3VC7A 3EUWA 3RC2A 4LN1A 4UAGA 1DDOA 3ZNOA 2B4RO 1YL6A 5EMHA 1P74A 3FWZA 3M6IA 3U9LA 2AEMA 4DYVA 4XYLA 4HFMA 5B4UA 2NU8A 1P45A 2X23A 3ONEA 5L45A 2V6BA 4OGWA 4A2CA 4P4LA 4OJNA 2D2IA 4XYBA 4BB6A 2W2KB 4BNLA 1XLTA 2GSDA 1P3DA 4CODB 2ET6A 3CIFA 5IJZA 5HRUA 4GKBA 3QIVA 1E7YA 3AI1A 5IXSA 3VKUA 1E1KA 1IULA 2E49A 4ZRNA 3O8QA 2RHCA 2Q1WA 3JCZA 3K2EA 4FN4A 1UP6A 1BDMA 3PGXA 1ZK3A 2HMUA 4M54A 4K1LA 1HEUA 1YBAA 4XRGA 3ZHBA 1DHRA 2VRCD 4PZDA 2PKRA 1WNTA 4MOWA 2RAFA 3OEYA 4H3VA 4DPLA 3GHYA 5C7IO 3F47A 3NYWA 2CFCA 3WMXA 3LVFO 2HO5A 3KETA 5GZ6A 4PG4A 5A5FA 4EUHA 1NP3A 3UOGA 3W8EA 4B7CA 5JO0A 4C4OA 2C82A 5I9MA 1ISGA 1GY8A 4Y67A 1LRJA 1YDEA 4CMIB 3NJ4A 3OIGA 4AJKA 3FNFA 4R68A 4FJ0A 4KWIA 5DBIA 4EUEA 2EV9A 3F1LA 3AJRA 5A02A 4J1QA 4R51A 5J23A 6LDHA 4YWJA 3QWFA 1FXSA 5F1OA 2Q2VA 4BKPA 4R41A 2O48X 5TJHA 4MKZA 3SX2A 3UCFA 1UP7A 3C3XA 5G0WA 3GEGA 1VLLA 1ZK2A 4JNKA 5JLAA 1FDSA 4DLBA 1H6DA 4AJOA 3GUCA 5T5QA 4KOAA 2O3QA 1M66A 4E31A 3U4CA 4TSKA 4UVIA 3PHHA 4WEOA 5THKA 4PZEA 1G6KA 1N1EA 3EVTA 4CLOA 1XQ1A 5H82A 1E77A 1R15A 3ENKA 1E5QA 4NIMA 4P22A 3L0DA 4BGVA 1YRLA 3GEDA 1YWGO 3D3WA 4UVHA 3QLJA 1B2LA 1U2GA 2Q45A 5LDHA 3JQ7A 2HMTA 4XEHA 4AL4A 2P4QA 1GZ6A 3A9WA 4CM5A 3QA9A 4HX5A 1ZZEA 1PGNA 5BSFA 4FBGA 5A04A 5TQVA 3CINA 1H9BA 4OKIA 2F00A 1O95A 2HKIA 2E82A 3BXXA 2FWMX 1AN9A 4DPKA 1HDRA 2X8LA 3HFGA 2FPGA 3F4BA 3I1JA 3V1UA 3RASA 1H94A 3K2BA 1KVSA 1XQ6A 3QVSA 1HZZA 3HDYA 1Z45A 3DAPA 2GZ2A 3GVXA 3QE3A 4ZVVA 2R00A 1T1SA 4XGIA 2DFDA
chains in the Genus database with same CATH superfamily
1IQPA 2JC3A 1XTZA 2C2KA 3HA7A 3RPEA 5LKRA 4XWYA 3G2PA 4TS9A 1DRUA 2GXUA 4RJLA 3HN6A 2N0SA 1IN7A 2DSTA 3W9UA 4BV2A 4LE2A 2H18A 1NJGA 3DOFA 4IIYA 4GF5A 1U8ZA 1K97A 4BYMA 1C7FA 2D1QA 2Z83A 4A9AA 1YT5A 4PRYA 1COZA 1KF0A 3MS4A 5D2CA 4ZXPA 1ADJA 1SFRA 2NU6B 3ETNA 1QGOA 3EVNA 4IUDS 2GXAA 2GCOA 4J1TC 4BVEA 4EI7A 1ZJJA 1KI1A 4A1FA 4HYEA 3NC0C 4EZEA 2LIVA 4HI0E 4IRMA 3U44A 4MGKR 1RWXA 2H2WA 4GKKB 3CTMA 5DWDA 1WD5A 2VYNA 2YOFA 1V11A 2NU9A 2ZTHA 3HCRA 3K9GA 4DLLA 2C98A 2ORYA 1HYHA 2ID4A 5LQUA 1JA0A 2IZ6A 3VJLA 1T4CB 3R1IA 2CWDA 4MR7B 5I51A 4JLPA 1BDIA 4XYGA 1W88A 3PFGA 5EMMA 1EESA 2N46A 5JVDF 2RH4A 1T15A 2PU5A 5FF9A 5K3FB 3FI0A 3D0QA 4IJWA 3RT1A 3T94A 4YJDA 1HPLA 2ZSDA 4MP3A 1GDHA 3ISJA 4MV3A 1ZKMA 2PXXA 1VI5A 2B35A 2BOVA 3WMRA 3LU1A 4ZCIA 3EEOA 4S0XA 4B1FA 2J87A 4IJUA 2C5HA 3UA4A 4ZGWA 4JXKA 2XWSA 5FLKA 4TYWA 3BE8A 4BS9A 2I6UA 1NQ5A 1OFGA 3GPIA 1O94C 2B5VA 2EC5A 3HPQA 3NBZC 1CB7A 3OZIA 3LUFA 4KMOA 1DWOA 1X3LA 2VPXA 1DAMA 3P2JA 2VQDA 2A1UA 3DQPA 1B8VA 2OGTA 2AG5A 4YO7A 5ECDA 4BV9A 1WWKA 4PAOA 3EE6A 4EI2A 1ZCFA 4FFBA 1MHTA 1H9CA 1Y9DA 4FGLA 5AK4A 3OZVA 4CFZA 4J49A 1JIUA 3MQFA 4Q9DA 2E5LB 2P75A 3ZVLA 1LK0A 5C5IA 3B52X 1F17A 1O95D 3OJXA 1E5XA 4QJIA 3WBFA 4DBLE 1ZJWA 3ADPA 1C1DB 4RZUA 1ZNYA 2IEDA 1F06A 4LSGA 1QGED 3CG4A 4XAQA 1YZVA 2BEKA 2P2LA 3DHWC 3I0NA 1ZU4A 2MSDB 2ZSAA 4YEDA 3L6DA 4FZVA 1FK8A 5EYPA 3EF1A 3HBMA 1X7YB 2FY8A 3KE8A 3NHSA 3PDIA 1YS4A 5CLHA 4ARZB 3SDBA 5IHXA 2LXNA 2JHFA 4JXXA 3V6LA 4DA4A 2W2KA 1K98A 4ZN6A 4QSHA 1ISSA 3OOSA 1O03A 2RHJA 3VKVA 2AMLA 3HXPA 2ANCA 1WEHA 1WUHS 4UPDA 4FDMA 5EEGA 3OQ1A 1F0YA 2XPCA 1U9YA 3CB2A 3FVRA 2FRXA 4GW3A 3ZH2A 2D6FA 4YMSA 1SUAA 3H4IA 2YMPA 3ZN2A 1H6CA 4E5DA 4QXAA 2CLSA 4DV2B 4FZJA 3L40A 1IPEA 2WYOA 4JZYA 4KXUA 4Y1FA 1JT2A 5DOVA 2W6MA 4F4JA 3TFOA 3U4QB 3HH8A 1JQJC 1NATA 1Z4OA 4HEJA 3U1TA 1W0JA 3CVXA 3ZEAA 3R2JA 2JFOA 4N01A 4MJ3A 2DKOA 2NVUB 1G7TA 3RUFA 3RFVA 4U2GA 4B2IA 3DUWA 3Q41A 4B6QA 1TTTA 3Q5EA 3A3YA 4HXGA 4IHQA 5COBA 4RL6A 3DBHA 1Q20A 4LWOA 4C3VA 2J30A 3K0CA 1S96A 3QE4A 3E7WA 4M36A 2ZFUA 2AB0A 3TNJA 1Z88A 2B8EA 2OK8A 4FNOA 2YWXA 2B82A 4UQOA 4DG8A 3H2SA 4ZZIA 1CS0A 4L4YA 2XUFA 1ZHHA 2V7GA 3H42B 3LQRA 1RWKA 2Q29A 3GG2A 4UCXA 1VG8A 1GN8A 1EGVB 2H9IA 1C3OA 2X5NA 1JFSA 1CK4A 1UL1X 5CIYA 4RJIA 3N9IA 2J41A 2EGHA 1Z9BA 1UWKA 4JHLA 2P91A 3OMWA 4Q7KA 1BMTA 3OH8A 4TV9F 2WZCA 2DG2A 3A4YA 3DE5X 3TUIC 2WR8A 4LHWA 4YAOA 1WPGA 5TMEA 4F3TA 3ST7A 1U28A 1D0SA 2VBGA 2IS4A 1OU0A 1ZWKA 1X7WB 4RFVA 4CCSA 3BMCB 5DXFA 2SNIE 3CLTC 3IXLA 4RORA 4WFIA 2YJ5A 1X6VA 4HCJA 4C5CA 4F1JA 1ZUWA 3H2KA 5H9WA 1EK1A 3GNSA 2CB0A 2BE7A 3CXUA 4CBVA 5TEWA 1NTOA 2GDJA 1E3TA 1L5VA 2A88A 1KKMA 1Q77A 2H4HA 3MWGA 4R8KA 1ISJA 3DH0A 5FKJA 1B41A 1SEVA 4GPTA 2AZDA 1I6KA 4ME6A 5I3ZA 5H4HA 1MB2A 1IY2A 3K1ZA 4DZTA 3U6BA 4IJMA 5EJ8A 2AZXA 5KIAA 1ZPDA 1EI9A 4TUYA 5J2UB 2XRZA 1TT7A 4MEAA 2C9DA 2RFLA 5FWYB 3QU7A 2OPHA 1TOAA 2GHIA 4IQ8A 4YMHA 2BI7A 3JAWA 2OGWA 3QE2A 1J4AA 2ZBRA 2DHRA 3GJ8A 2E3JA 4N4AA 4RJJA 4MPPA 3MYRA 4UUMA 1TCUA 1N0HA 1G18A 4RZIA 4A1OA 1FPQA 4G1EB 3PEWA 4IKPA 1HNZB 4CKCA 3IDFA 2IEAA 5L3QB 2W93A 1H6AA 3M1LA 2ZPTX 2BAGA 3PVZA 3M7IA 2YIDA 2IDJA 5J4LA 1WBDA 3ZUGA 2ZSIA 3CN7A 2FOXA 1UJ5A 2ZBUA 2WI8A 3RVMA 1SZPA 4FFSA 1R8QA 4XVHA 4M98A 4RPLA 2FDCA 3MMPA 3AI3A 5ALWA 2VRBA 5EXEA 5BSVA 4BNIA 1ZJ4A 4FU0A 2GBPA 1JR3E 3BJRA 3O7WA 4J9UE 3UCXA 4DCJA 3U19A 2P3LA 1PSWA 4AZVA 4F46A 1R2QA 4LJAA 4M1MA 3K70C 2G4CA 4BNXA 1BX3A 3D7KA 3LM8A 1Q95A 5FQOA 3C8DA 5E95A 3U4HA 2XQJA 4ZZ2A 3H83A 4KPUA 1GTSA 3DE2X 1WZ2A 1WEKA 1NQUA 3Q3CA 1Q0QA 4NV0A 3SZ3A 3N75A 4GLLA 1GA4A 1JGTA 1P9NA 2XE7A 4L8LA 5HFJA 2P79A 4EHKA 4M1WA 1WDTA 1CERA 2CBGA 5FUBA 3FRIA 4W5HA 1E3LA 3KT6A 4MNTA 4YJGB 3R3UA 4MS1A 5SV2A 4DTCA 4TLEA 1ZMBA 1Z6QA 3QYJA 3ZWBA 4M0MA 4PU0A 3KLOA 3U56A 2QD5A 2UYCA 1N9GA 1H4SA 4K3VA 4Y6GB 1ZIPA 4RETA 1K86A 3W4IA 1ZGCA 4JD5A 1Y9JA 1JLLA 1C0PA 1TKCA 2LTAA 4PFJA 4AXBA 1VE6A 2C2OA 3ZU4A 1SIWA 2Q3JA 2O14A 4QKQA 1YB1A 3QKIA 2V7PA 5LA6A 1SUEA 4UD6A 1DBVO 1UKVY 4INJA 4IFTA 3SKYA 5JJIA 4I1OA 1CY4A 4C7OA 2V5AA 3DFMA 3ZQ4A 1E9SA 4YRPA 2PZAA 2IEYA 5CDTA 2JEOA 1U4NA 3K73O 3L8ZA 3MA0A 4GVLA 1N5LA 1Q3TA 1WMBA 2XDQB 4ND6A 1BWRA 3AEKA 3G7SA 3K9CA 3DKRA 2GF0A 4YT5A 3P26A 4CIVA 3K6SB 1ECGA 1P29A 2VHTA 3MPUA 4Y3UA 4O4IF 4FYIA 3KEFA 1NN5A 3FAZA 1IZ8A 3AHIA 1J8MF 3EAQA 3IS3A 2ZI9A 2G70A 2X8JA 1KO5A 2E4UA 3B7PA 3BXZA 3N5KA 4CU5A 5JWOA 3NHYA 4DSUA 1IBKB 1IPFA 2R7AA 3F3MA 5AP9A 1PKXA 4F6LA 2VSOA 3W8DA 1LBHA 3RR2A 2ZIGA 4NE9A 1XSEA 1JR2A 3IOBA 4ML3A 4WFKA 1F6WA 1RQ7A 5D1HA 4AN1A 2G67A 1PHPA 4BMPB 2B4TO 1QP8A 4GAEA 2ZZNA 1WA5A 3AP2A 2X8WA 3JARB 3LKVA 4HY3A 4MUBA 3BH7A 5EWLA 2MR6A 4KBFA 1MB4A 3HMQA 4BKMA 4J76A 1ISHA 4QOSA 1EVZA 1JA9A 5TGTA 3GLUA 3FKSA 1DDIA 3Q3JB 4M6WA 5BV0A 5DNCA 4A0RA 2JIPA 3ACCA 4QC2A 4K6CA 4MV6A 1QPBA 1KVQA 5AI9A 4AP5A 3G82C 3KP1A 4JY7A 3W2HA 1L5NA 3F90A 1TUBA 2TYSB 3M33A 4F8EA 3AF6A 3F3SA 2Q1SA 1TC2A 1EVJA 1UIRA 1H2ZA 1ZD2P 2F4NA 4YCJA 4CEJA 1GG5A 1HQDA 5FULA 1BE8A 3C24A 4JJGA 5HRAA 3DL7A 1Y81A 4ZI5A 3WI7A 1C8LA 1CS4C 1VLVA 1FFGA 3W78A 3PQFA 2XSZA 3C16C 5COQA 5DNYB 3DEFA 3FBTA 1V7QA 3LCJA 4RIHA 1QR6A 1FOEB 2QRNA 4WK4B 4ZDKA 4P4SB 5JDIC 2ATEA 5MDHA 1RBYA 1Y5LA 3CWCA 4MKXA 3EPHA 1J8QA 2LV8A 4JVMA 3ZLBA 1JHVA 4ZYYA 1MABA 3T4XA 2PMKA 1RWQA 3AY6A 2C2HA 2P9JA 3DDCA 3FLBA 3Q9SA 2AX4A 3KKLA 1A5AB 1KSJA 4PLGA 4XASA 4ALJA 1ECJA 4FVTA 2BBSA 4NULA 1RQPA 2Q7XA 3GJTA 2O3RA 2VJNA 4BCDA 4YALA 3IUPA 1M0TA 3WNCA 1NJ2A 5LYJF 1MAWA 1E8NA 1OXUA 1UBKS 1HYGA 4FFWA 4TMFA 3T4EA 3TUJC 3VJMA 4BCBA 5DK4A 8AT1A 3UQZA 4A26A 3CA8A 3MQ2A 3OLZA 4V24A 4QG3A 4YT8A 2G77B 2HWKA 3RU7A 5CYGA 4AI6A 1CETA 5BSEA 1D5CA 1P31A 3C74A 3ANXA 3Q88A 1UDBA 4P98A 3A04A 2A33A 3DT8A 1C3EA 4ARBA 1JDVA 4U5XA 1NPDA 2IL1A 3M6MD 1R0KA 4Y30A 5FQNA 1T1JA 1E9BA 4GNKA 4LY0A 4TLMB 5KWSA 3AL0C 5H9VA 1W48A 3S70A 1KO8A 4UM8B 4X71A 1KBZA 4EGJA 4UHCA 2OHJA 3T1OA 1XNQB 1EGHA 4Q9LA 1AHPA 4MRNA 2C8VA 3UBTA 1ESMA 2RHBA 1E66A 4CL8A 2BGRA 3PFHA 1O6ZA 2GH1A 4YRCA 5HILA 3Q7TA 5DK6A 4UMVA 4OUDB 1FMJA 5CEJA 2QRZA 3TPZA 3ESRA 3JAKA 4PFSA 4O4LF 4ZQEA 3OBBA 4AULA 1U7HA 3D8SA 4DIBA 3VPBA 2JFVA 4DR6B 4DWWA 4B6GA 3FKSD 5LWQA 1B6RA 4E4RA 3U1BA 1NQXA 2Z3ZA 1L7DA 4P93A 1W7AA 3KQHA 1O9GA 3C8ZA 2JAUA 3E9CA 2B25A 3I3OA 4JJ6A 5KSWB 2H3EA 3CBQA 4BX2A 1R4MA 1CYEA 4TN1A 4JUIA 4OHWA 2QVZX 2ZRQA 3QOWA 1GP2A 3LKDA 4RUKA 5KVAA 4KREA 2MYTA 2J0SA 3LDUA 3O4RA 4AICA 2HWYA 1LQTA 1XHFA 5CFZA 4FD2A 3N53A 3GBSA 2XSZD 2R1TB 2Y9MB 2C54A 3LPMA 4ZP1A 1BSVA 2P77A 3B1KA 3H05A 1O87A 3OWOA 5ECGC 2GNOA 1JQLB 4BNTA 2DLCX 3J7AC 3VDNB 1XDGA 1P2UA 2AFIE 3UT5A 3SNKA 1CVRA 2OFOA 3JQFA 5KAMA 4B4KA 4F3NA 3ORYA 4I81A 1UJMA 4UUBA 3RGGA 3GJQA 3I8XA 3PC4A 4RA9B 2O2GA 3RJMA 4HZUA 5BSHA 4I5GA 3TIVA 2HWWA 3JZAA 1J23A 2J5KA 2YHIA 5FPHA 4MS4B 3GFVA 4WLOA 3ZDBA 3QFRA 2R6R1 1USVA 1MKYA 1UCFA 2AK3A 4K3UA 1EP3B 1AKVA 4QELA 1YGYA 4QQKA 2HPAA 2L42A 5CX4A 2A7QA 2IZOA 3T1NA 5A06A 1M75A 4FHEA 1GQRA 1KFCB 1AGYA 1V1RB 4E5NA 3N76A 1JQEA 3EBOA 2JLVA 4B3BA 4FFNA 5FA5A 3LO5A 5CNMA 2REXB 1E20A 4IKEA 5KDLA 3RKUA 4DBLC 3NBKA 3OCYA 5E6RB 2F90A 3H97A 3BGOS 3Q5DA 4U8GA 1HSZA 1PKEA 2O59A 3DV0B 4UCFA 3EIHA 2C7OA 1WKBA 1B73A 1PQPA 3A9SA 3EEBA 3GH3A 2GPSA 3RIGA 1UMCB 3OU2A 3SY8A 1J0BA 1YR8A 4GXQA 3BA1A 2QJRA 3AR3A 4ILKA 2HDNB 3FVWA 1ZQ1A 3RYIB 3LWNA 3UKDA 2RB4A 1LH0A 3N8KA 2FMHA 1XNHA 5CNJA 1KRXA 3WMFA 4FFRA 1VYUA 1L4EA 2OSVA 1DLIA 2BR4A 1JV2B 4J6FA 4RGVA 5F4ZA 4KITB 2C4WA 5G41A 5AFSA 3LV8A 4HMQA 1ZLYA 1Y1TA 2R2GA 2ZIVB 2F6RA 3A4MA 2NO0A 2ZBFA 3LW8A 2QW1A 4LJ4A 1X92A 3T5CA 3BBLA 3HMKA 4EW1A 4YP9A 1A8IA 3RC1A 1NVFA 2PGLA 1IK6A 2XUQA 2BMEA 3LRPA 1QIIA 1Q16A 3NGMA 1PGOA 2I1VB 4Z9BA 2YWBA 2WFAA 3MSXA 4YXWA 1PI3A 1U0OC 5TV2A 3I34X 2O8EA 1BKYA 3O4HA 1RLTA 3OT5A 4JJFA 4KGDA 3UB3A 3OFKA 4YROA 1E7WA 2WUEA 5F2NA 3DD1A 3LT1A 4OHRA 1NONA 4MRSA 3KJQA 1BHQ1 2PGIA 1CVLA 1T8SA 4G26A 3L6EA 1IB6A 4WXRA 4WBSA 3IQFA 4X1YB 1I30A 2B36A 1UQTA 3H9BA 4GEKA 3CO5A 2HBZA 2QGNA 2VO1A 2NXJA 3Q0EA 3DOIA 1CR1A 2YWRA 4LF7B 3BCRA 4HFJA 1CUDA 2NT4A 3PIRA 1WXHA 2HDWA 5ES3A 3TNFA 3V1YA 2UZ1B 1KBOA 2TMKA 4ZAZA 4WINA 4AX4A 1FZTA 1IY8A 4J0DA 3DVQX 1ESNA 4LYYA 2ZZMA 4KNVA 2X8BA 3AHCA 1TK2A 5DTQA 4A6XA 3BAFA 4CLDA 3EXG2 1VFPA 5C3MA 3AM5A 2YN2A 3OJ0A 2OCAA 3E22A 4GMKA 3TM4A 3OAAA 1VHJA 1POXA 4FN5A 4LV6A 4FCTA 3UAVA 1ZINA 2NMVA 3OZTA 4CIDA 4LHXA 4ER3A 1B42A 4BMZA 1PAUA 2FSIA 2O2YA 3LBAA 1I6WA 3VU9B 2HDHA 1V5FA 3KJEA 1L9KA 2VQ6A 2V6MA 3TJZA 4XVUA 4HOYA 2OHXA 1VSBA 4R2HA 1RBMA 2NXWA 3MRTA 1ZN7A 5IBRA 5FPKA 1R37A 2YVUA 1HLPA 2Z43A 4DIKA 5KSYA 1Q7EA 4YRGA 2X42A 1Q92A 3DVLA 3TXAA 1WM1A 5AW3A 5HKAA 2R44A 3G79A 3ZDFA 5F9MA 1NW5A 3EPPA 2JATA 1GPNA 4YGYA 2P3OA 1PJBA 2E4VA 4MK4A 1XYGA 3F6YA 2NYVA 4PO1A 4EG5A 3MAGA 4DADA 4RV4A 4KYUA 5JD5A 3ND6A 4NBVA 5DCYA 1H8EA 2O1WA 4FYPA 4BQFA 3WWZA 1Y63A 3HHEA 1Z7GA 2D1YA 3RQIA 3U13A 3N2NA 4TVKA 2VPQA 4Z3KA 1USWA 2GDZA 3H1PA 5HKBA 1KERA 2TMDA 3GUVA 3LGXA 3BL5A 3Q7IA 5CEFA 8LDHA 3S55A 3SAJA 1RS0A 2HQBA 1AB6A 3V32A 5EL0A 3U7EB 1RMQA 2GN8A 1YB2A 1D6SA 5ALZA 3GP8A 2OOSA 1KJWA 4XEUA 2RGRA 5HUJA 2V7VA 5A4AA 2OO3A 4YJ2B 3P0IA 4MKHA 1T2CA 3WR5A 2V8BA 121PA 1RYZA 1FSGA 4EDFA 1H2EA 1NE2A 1UFOA 5AKXA 1V16B 4EA8A 4TWJA 4I55A 4X3PA 1DC4A 3RU9A 4BMXA 2EW1A 3KDPA 9LDBA 2MWMA 2B1QA 2J45A 2XMZA 4YXWD 1CF2O 1O0BA 3OQIB 1HQCA 3SOZA 1QRDA 2W42A 3RU2A 4RKWA 2DH6A 4QPPA 2Z1DA 3K71B 3V48A 4NMLA 1XWFA 3MWEB 4QO8A 9GPBA 3GZNB 1EM8A 4I1PA 1VC2A 1II8A 3TG8A 3NKLA 1DUSA 4GSKA 2FVXA 3R09A 3H8WA 3IULA 2PO7A 3AM4A 4L8VA 4RX1A 2LPMA 4I6GA 1H0KA 1XOIA 2BMJA 4M55A 4Y2YA 4A8PA 2GBGA 1RYBA 5JAOA 3UWOA 5HDBB 1FVXA 1VGRA 1Z0IA 3WIDA 1UDCA 1ZA2A 5DGDA 5HCUA 5D3ZA 1IWOA 4ZJYA 1I36A 4JYCA 2EAUA 2C03A 2G0AA 3C8UA 3IBYA 4LWQA 3PSAA 1N6LA 2GEFA 2IWHA 3QVJA 3U81A 1PJCA 3HYNA 3RVSA 2XDYA 1F51E 1GTRA 1N8TA 1GNRA 4DYHA 2PD6A 3BS4A 3R5KA 4F2PA 3U9TA 1X7XA 4FMBB 3TDKA 3IUMA 4PLTA 4OJTA 2IV3A 4MVJP 3L4SO 2NU7B 1SU7A 1K06A 1Z8NA 2IT1A 2RBEA 2ZBPA 3F7MA 3KPUA 3L1JA 3NETA 2OBBA 1T5BA 3OLCX 3PIIA 4GRAA 1OWPA 4MROA 2NQTA 3JRWA 5FJIA 5SZHB 3WWEA 4TKVA 1LRKA 4QBKA 1Z12A 5JR3A 3ZIUA 1VA5A 1DIAA 2HJSA 3LBHA 3ENWA 2ZWVA 3H6KA 1MN6A 4KSCA 3PJRA 1XU4A 1SHLA 2HHCA 3QVMA 1NN3A 2GZ3A 1QYRA 2DPYA 2VTVA 2BC9A 2Y1LA 2I71A 2QSUA 4YJHA 5IZCC 1BFUA 1MENA 5CHYA 5F73A 1GR0A 1FUIA 2AQKA 3LP6A 1EFTA 1SG0A 2HA2A 5FFFA 2IDZA 2OHGA 4I5DA 5K4GA 3TECE 3PCXA 2UDPA 2WZQA 2P7HA 1DRWA 2ALJA 3K96A 5LQNA 4XLZA 3WKDA 1YZGA 2WOOA 1XTRA 1NNEA 4KDRA 3B6IA 1B6TA 2AFIB 4ZAVA 1D2EA 3GJ4A 2IYNA 5IAAA 1G3QA 3G8YA 4MTCA 2WYUA 3W7VA 4BVJA 3VPCA 1X0VA 2QN9A 3DTYA 4LF6B 1I3MA 2QNBA 2VP6A 5KOJA 2AOUB 5A9TA 4YMLA 3A31A 4TLBA 5CLGA 3C3KA 3MT0A 1EBBA 4U9IS 1XLUA 4AJ2A 4C4RA 1SULA 2Z5LA 2G8NA 4F5DA 1OIWA 4F4FA 2HT1A 1JIVA 2NUTA 4DHEA 1BS2A 3U39A 4QRHA 4MB0A 4CM1A 8ABPA 4FFVA 5I7AA 3HSKA 1SZDA 1TEVA 2VXBA 1GGNA 2RHOA 1OV4A 3L6OO 4WQMA 4A2PA 3BWXA 3BRWD 3K6JA 3LUKA 1C1XA 1JU9A 4YO8A 1WO8A 2ZR9A 4C3OB 4DC1A 1I7QB 3JXEA 4H08A 1Y7HA 4LRWA 2WNHA 1L8LA 3A3OA 3OEED 4BP8A 2A3RA 3GUHA 4HDKB 4H9GA 4Q34A 4PNPA 2OPBA 1KXZA 2QN8A 4DDHA 1QC5A 2YJ6A 5AD1A 1YL7A 3E2IA 4GRDA 1IUNA 1TJ5A 2ZIXB 2ZJ1A 2X1LA 4PYOA 2ORVA 1A7KA 1F2UA 3E9ZA 4KR2A 4KK4A 1XTSA 5EXDA 4N0MA 2I9PA 3WDLA 4XM2A 2F3RA 3BHNA 2CW5A 4XVRA 3CZCA 1E4EA 1E4YA 2DT8A 1Z13A 2JFFA 3E81A 3HB4X 1J06A 1QXSA 2G17A 2WT8A 3N2KA 4MGEA 2I7XA 1E9DA 4BWVA 5BUCA 2C31A 4GR5A 1A97A 1DJLA 3GDWA 2AFVA 2A0KA 2W2QA 3ADOA 4OXRA 3C98A 2VTKA 4B17A 4UEJA 4KN5A 3ZY5A 4DY4A 4DA9A 4Z7OB 1IHPA 3I45A 4G5XA 4MULA 2I62A 3EGIA 4MKGA 3ZX4A 4W7SA 1E9AA 2G3YA 5DNEA 4JLBA 3JYPA 2C7VA 3GLGE 1JKMA 1GTMA 2J32A 2ST1A 1KJNA 1XZHA 4LWZA 5AUQA 2Q3EA 3ZXXA 1CEQA 3G2QA 5KYWB 1YCFA 1N6KA 3K8YA 1DXOA 4LJLA 2QS9A 3TI9A 1UDWA 5BQ3A 2VHYA 1S2NA 2X3FA 1VL1A 1Q7CA 2XXJA 4HSGA 1P3Y1 2HU5A 2WIDA 4OJMX 5ALSA 3WYGA 1NJ1A 2XRYA 1V7ZA 2DQKA 3ECSA 4DJTA 4EQZA 4Y2RA 4ZHQA 3THYA 3GWZA 4HBZA 1ZNQO 2C2GA 1Z56C 2VOJA 4J07A 4EO4A 3ZWKA 3RUIA 2FLVA 3AIOA 4Z54A 1JJIA 2Z2IA 2XGOA 4N8SA 3UMGA 1NOKA 3KKMA 3OTOB 2MT9A 1WXQA 4KJZA 3WP1B 1F60A 3F5FA 2WM2A 2CSXA 1G1AA 4YB8A 4ZVMA 2NO9A 5ICFA 3SXUB 1KMHB 4AJEA 5DRTA 4JEUA 5E6UA 4O2BF 5I7UA 5EHGA 4NARA 3RSLA 3PQEA 4RK1A 1A04A 2EFEB 4ZT7A 4ZT4A 2R6DA 4LOAA 2FEOA 1WB6A 5K3EA 4NCJA 2B0CA 3WBBA 2O4CA 3KKZA 3K0HA 5L8VA 3UJNA 1JZQA 1EAYA 1KSFX 5GTDA 1EK0A 3M9WA 1HLGA 1JKIA 2ETVA 1RIFA 1EIZA 2A0YA 2CLFB 1SK9A 1OAAA 4MA5A 821PA 5GQSA 3JWHA 4TV8B 3CE6A 5EKSA 1LS1A 3R0XA 1ZI6A 1JZSA 1M83A 2AG1A 4Z0NA 4C7KA 2PANA 1YUNA 1BH6A 1FSFA 1Z62A 3M5CA 3LS2A 4AT1A 2YHUA 4YCMA 1C3JA 1ZWLA 2NZUG 4P2BA 4ZD6A 3EASA 4O1IA 1OAOA 1RMTA 1L5GB 1JQDA 2E4ZA 3UO8B 1KETA 1B0AA 5EKTA 1YE3A 4DMRA 3P9CA 4DLWA 4QA9A 1MLDA 2FUCA 1EVIA 5DP2A 4RVCA 1NVXQ 1SGWA 2BFMA 2R8RA 3H5TA 3RFCA 4F45A 5JZOA 3CW8X 3MJTA 3R7SA 1PR3A 3BRCA 3U0BA 1NUPA 4ZIRB 1DIBA 2UUPA 1J7KA 1V5IA 3AUFA 2R6ZA 1HUQA 2PSFA 3FCCA 4JUAA 2CJFA 3OOJA 4D80A 4HVAA 4RHFA 5K0BA 2ZCJA 3SZUA 4K0KB 4JC0A 5CBPA 5H8WA 4GOND 4GX2A 2NN3C 4E14A 4LYGA 3TRJA 5HJ7A 5JFGA 1K2WA 1ZM2A 1OF1A 3DJYA 4ITUA 3SLRA 5GIOE 2CNLA 5JD6A 3CNBA 1EYZA 3C1TA 4TLAA 3ASYA 3FPBA 4KAJA 3K2IA 2WU8A 4WBNF 5JCPA 1UKAA 2OWDA 1SZJG 2PZGA 3LC0A 3QPBA 3WADA 5B5SA 3I0MA 2PM8A 4HN2A 4PIVA 2IHZA 1P33A 4WZAE 4LDJA 2XTNA 1E32A 4ZQFA 5AW9A 3UUFA 4J2HA 4DA6A 5JXJA 1NXWA 4YAWA 1Y1KE 2BI4A 1WUYA 5IAJA 3IBGA 4CM8B 2HMAA 2AG0A 4FLMA 2X5JO 2I6GA 3UJ7A 2VQEB 3C1AA 3KL4A 3AESA 1KR2A 4BU1A 1HETA 1JPVA 1PV2A 1HTTA 3T7EA 3KCQA 3O73A 4OUKX 4UW9A 4CM4B 4BZZA 2ZULA 5ALKA 1AV7A 3I04A 4K9SA 2J5BA 1SWWA 2XJ9A 1JDBC 1FVFA 1GTG1 2XNDD 3ESXA 3FOAA 3L8EA 4E94A 3GEHA 2PZ8A 3R7DA 3GCWA 2VUTA 1Z0UA 4YMUA 1RJWA 5G4KA 3VSAA 4B7UA 1U63A 1REQB 3G1TA 3Q7QA 3BXPA 4M87A 5JANA 4KTTE 2JK0A 4BVKA 1RXEA 1EQAA 4FIZA 3TRHA 3T1TA 2D06A 1XIVA 3REQB 2QUJA 4MGZR 3IIEA 4HGRA 5DHRA 2JZNA 3A7EA 4MEJA 2BH9A 4OF4A 4HWSA 1QRTA 4HQRA 2CKDA 1U11A 2ZI6A 3TK1A 3UK0A 4BFXA 4YCNA 2BFNA 2PKQO 5K0CA 2EBHX 5JJLA 4HNVA 2PUDA 1U2QA 1KVUA 4J16C 2FFBA 1NXXA 5HJ5A 4FEAA 4INAA 4MUXA 1CUZA 3MGAA 4EP1A 5KJCA 2QTMA 4Z4IA 1E60A 1RQNA 2ZJBA 4YAEA 4C0WA 4UE6A 5CGZA 4HXEB 4FMDB 2B30A 1VPEA 3ILHA 3L7MA 2OHFA 1S2GA 2VZEA 1ZKDA 1GZVA 3FUCA 3IIIA 1NF2A 5BURA 2ZT5A 1HLDA 3EY4A 4FEGA 3BSWA 1U2RA 2W6NA 5A9SA 3B1FA 1WLYA 3FLAA 4C89A 5KJFA 1FNMA 2YIJA 3QLVC 4WD3A 3TTXA 4I9HA 4HQLA 1Q44A 4N5NA 4A8TA 4DKJA 1JR6A 4L5JA 3H2ZA 4K7JA 3TFQA 1U9IA 5DU2A 2OK7A 5IDQA 2Z8YM 5FLYA 3UKOA 2OLEA 1RJEA 4JIMA 1S7GA 4M7RA 3V4PB 5A4MS 2JFPA 3B9RA 1PFWA 3DCIA 4H6XA 3OQOA 3UN1A 4QWMA 1WHTB 1WZNA 4AKIA 3IODA 2FX3A 2AVDA 2OXIA 1OXTA 2GASA 3UCEA 1A69A 1SZCA 1YK0A 3DBLB 3ZE0B 2H2GA 1QOPB 1VMEA 1DEKA 4HN9A 4GNRA 2WU4A 3DMTA 4TPKA 3RCBA 4KR0A 4AG3A 1PS8A 4DRYA 4GOKA 2PZJA 3GOQA 3VR6A 4A82A 2Q9BA 5E1DA 3DW3X 1GT6A 3RHSA 4HR7A 3MD9A 4FKBA 4O29A 1RCFA 4BE9A 4HNHA 1PDVA 4YAGA 2XKJE 2FMUA 1W29A 4ZVSA 4OFZA 1FNDA 5T64A 4ARVA 5JSHA 5JZVA 3KXPA 2VZ9A 2FUKA 3F5MA 4HVTA 3H18A 3HJGA 1JIQA 3PRHA 2Y8EA 4N7BA 2ZE6A 2HV8A 5FOTA 3CNOA 4WL0A 3ZD6A 5I7VA 2ZJOA 2OESA 3PBKA 1Z73A 3AINA 3A9TA 2ESRA 1RWVA 3PXGA 3CMCO 4ZVLA 1HZJA 4XWWA 5J4VA 3O8OB 3A6PC 4B76A 4AJNA 1W8IA 2CKMA 3F9IA 2V98A 2FDXA 2WJAA 3WDKA 3FWPA 2EEZA 2H51A 3JPYA 3MT7A 3PRKE 1GAWA 1ML3A 2GZMA 2VA8A 3LQQA 4UMEA 2MHCA 3GLGB 1R4NA 3AEQA 2ZJAA 4HNSA 5LNK6 1P7ZA 2OORA 3RBVA 3SF0A 3WJ7A 4AW9A 2CFTA 4A27A 1TFRA 2BGMA 3HDQA 1JFLA 1ZXLA 4IDDA 4J0HA 1N2XA 1N6PA 4OU5A 1KIMA 1SCUB 5E8RA 1Z4LA 1RPTA 4YJFA 4ECAA 1WNFA 2VHEA 4H3KB 4AZ0B 3EIOA 3ZZ1A 1L7BA 5BOSB 3CLUC 5GV7A 1C7JA 3G0DA 3SJCA 3RDPA 2R60A 2HUNA 3OQ6A 2B37A 2JIBA 4F5EA 5AESA 2WOJA 3ZBQA 3PHCA 5A3JA 4JA2A 3SI7A 4XD7D 3TO5A 1PWZA 1VL0A 5HQ3B 3QBJA 1A8SA 1TQ8A 5CAEB 5LLSA 1V4NA 1OI4A 1MZVA 5IM4A 2PWYA 2I4IA 4R1TA 2I6FA 4MV0A 3G8AA 2PPVA 3IV9A 4JDUA 4KRGA 4MRMB 3RAPR 3WLIA 4E09A 3PUIA 1GFSA 2GN2A 2WWFA 3RTCA 2HPZA 1KI7A 2NM0A 4QGGA 3PB3A 4XUCA 2VEDA 2FSFA 2A5FA 4XUGB 3JS5A 2BL4A 4JSYA 1HYBA 3HM2A 4GPIB 1EDEA 3FYUB 2OQIA 3RANA 3AB8A 3MJ4A 2EARA 3BICA 2QYSA 4WT7A 4B2PA 2JDIA 4OHOA 4DSOA 1PV1A 4CF6A 2O8NA 3FOCA 2ZS9A 2HK9A 1EZ1A 2I80A 4KIUA 4N40A 4RF2A 4H6PA 4ICIA 4YP1A 1LLFA 2P9FA 1V5EA 2HLNA 2NPOA 4DWOA 3IP6A 2A92A 2FWAA 4FCVA 3FPEA 1TMGE 4DEYA 3EODA 5HWSA 2XHEA 2QY6A 3PXXA 3QU9A 3BA6A 1PV4A 2DRIA 1UBRS 4JFAA 1CJUC 4RGYA 5ELMA 4D6PA 3LLCA 3E7DA 1XZMA 1RRPA 3VR6D 1CT9A 3TLXA 1GPH1 1ZOIA 2X0IA 2CB9A 4EGCB 5IYZA 1YR9A 3HA3A 2X41A 1BS1A 1FX0A 4PSUA 4D4HA 5CDUA 1H0RA 1K5DA 4E2WA 4II3A 3ZDAA 5K0LA 1Q3KA 4DA0A 3K05A 2XKBA 1JDNA 1IZ9A 3SXPA 4KKVA 4DIEA 1XXHA 4CTKA 1RLOA 3DW1X 3TEFA 1ULHA 4E5UA 3FROA 3C85A 2BM0A 5E2AA 4Z1MA 3SDSA 5IFLA 1CB0A 3WGYA 4X94A 5L53A 1OW3B 3HKCB 1V5WA 4UHBA 1RZ3A 1AO3A 5E4YA 2XQKA 2GN9A 2JIMA 4Y2GA 1FXUA 1OJLA 5DW3A 3L4JA 1WB5A 5EPEA 4CEHA 3D2CA 4NABA 1JHDA 4IWNA 4E5KA 2JFBA 2M1ZA 3AF0A 4L8YA 3LL4A 1DKQA 5H81A 1CP3A 4HDRB 1G2OA 5IVHA 1UBLS 4TV9B 1W5FA 3T9BA 2GPYA 3ZQJA 3OPYB 4QUBA 5HF6A 4WE3A 2FG6C 2MJLA 1QIFA 3CIOA 2YRWA 4P53A 4R1UA 4WZAB 4ZTUB 4H4CA 2D54A 3OD5A 4D8WA 2APJA 4REQB 4XPZA 3R9XA 1DB3A 2HH9A 2PLRA 3L0ZA 5DJ5A 5C5DA 4OXIA 3DWGA 3IUYA 2QENA 4F84A 5D00A 4JLMA 2HBRA 4R2KA 2OQVA 5CA0A 4AS2A 4AF6A 2IXAA 2W2MA 1YIAA 1X15A 2ACVA 2ZSBA 2ZUWA 1ZG3A 5JNWA 3NG1A 3DT6A 4W8HA 4EENA 1E6CA 1KPGA 1YHZA 4OHUA 3LXUX 4UU0A 1F8GA 2H1IA 2P4HX 2DHDA 1BW9B 5FTKA 5WRFA 2Z30A 4IGFA 2BGKA 2OG1A 4MMZB 3LUGA 4XFDA 2QTVA 3IRUA 4P4UA 1VBKA 3PNMA 1W49A 5K3AA 1KTVA 1L4BA 2FXVA 1Q1QA 2ODBA 3FYCA 3KUKA 4YK7A 3H2GA 5GJWC 3U61B 1STOA 2UV8A 4O33A 4C21A 4YPVA 1QAOA 2ONYA 4FR2A 1E5VA 1GSOA 3HZHA 4JP5A 4I3HA 1HNWB 5LB4A 2ZQZA 1DTWA 2VCYA 4YRRA 2W6ZA 2XA9A 4MVJF 3F98A 4P1ZA 4C43A 2XA1A 4F4UA 1ZH2A 2D2EA 3LPAA 4MW7A 3X1MA 3V9PA 1JHRA 1Z83A 3Q72A 3JD1A 4I9NA 4NYJR 3ZWVA 4YH1A 3BUSA 4CTNA 1Y34E 2ODNA 1KEPA 2WHRA 4YQEA 3W5UA 5CFNA 2VF2A 1TYCA 2CMHA 4E33A 4XCQA 2OZLA 4HNUA 1UDAA 2VUIB 4FOSA 2EIHA 5AJZA 3UWDA 2GCOB 2OCYC 3NH9A 4Q1FA 3U9SA 4AVYA 4I1RA 1NG9A 5CP8A 2EWVA 3U44B 4PHTA 3QYPA 3GJ7A 4ZVOA 3SHOA 3B9QA 3VKWA 1V11B 3MYYA 3PR1A 3MTEA 5LSAA 4QOIA 3SBEA 1TGYA 1I7NA 3B60A 1L1QA 2XVAA 1J9EA 1VXOA 2AD1A 4O4JA 3KPYA 3OM0A 3IJ5A 1VE3A 4DBVO 1LJLA 1K7EB 2EJBA 3GN2A 3RYHA 4MYUA 2QW0X 1T1RA 3L1KA 2ZETA 1UJNA 3O75A 3C5VA 3VR5A 4IDOA 2PYIA 3FYUC 3SR3A 3TGLA 1X9GA 1NC1A 4GMDA 3LGAA 3NHMA 4GX5A 1NXTA 1JTFA 4H7KA 3OIVA 4LDZA 4ALNA 4A0FA 3H0KA 1PVDA 4KVGA 2G63A 1CDOA 1QFZA 1TVKA 1U8TA 2A1UB 1KI3A 4KL8S 3P0RA 4ZCSA 3D02A 3LI2A 1T6ZA 1VLHA 2AA3A 4FFBB 3PHGA 1RP1A 4FGKA 2BTOA 4CKEA 3I3SR 1NBIA 5ALPA 4CDGA 3FLEA 3ED5A 2HF7A 1EP9A 2I03A 3IAS1 3KV3O 2BM9A 4R1MA 1SA0B 1VI2A 1Y6ZA 5HF9A 1AQ6A 1QR2A 5L3ZA 2X40A 1N34B 1S5PA 1FLAA 1EJBA 3DOHA 4LOLA 1Z2DA 4LSZA 5CEEA 4QX6A 1H42A 2Q9UA 1W4CA 3O4GA 1S3GA 1OYOA 1T3GA 1U9ZA 1K68A 2OB1A 4KJXA 3S2ZA 4AWAA 4TYNA 5KUTA 4Z49A 4N76A 2XMBA 1DINA 1BS9A 3UXYA 4DKXA 1MD9A 3B36A 4DCMA 4K6KA 4RTJA 3GK3A 5ALHA 4AK9A 4BMVA 1INLA 1TYZA 1Q11A 4I50F 3LDHA 1WTCA 2GD6A 4IV5A 5I7EA 2WQ7A 2RI1A 3B5IA 4G07A 1OWNA 4UDXX 2VYCA 5CVUA 3VI4B 2EFHB 3WWCA 5AI6A 1FA9A 1F0KA 4CNQA 1I8TA 2PEYA 4CDMA 1K7SN 2N3ZA 5BT8A 1W0CA 2G76A 1NTRA 4MHTA 1R8SA 4MUIA 2PJDA 3FMFA 2TSYB 4Q1BA 1IUKA 1IDN1 3GRCA 1FJHA 3QLUC 4ZO4A 1KH2A 3PRYA 4R1LA 3V1TC 3IUEA 2Z4SA 2AQHA 2Y1DA 3QVTA 1ZW1A 2I99A 1O58A 3D7LA 3G2NA 3EW7A 1NFFA 3KG2A 4QRDA 4RSRA 3OQMA 5KNCH 1TF2A 5JPIA 1L5RA 1DO8A 3L06A 4G8DA 4ZJZA 5KYKA 3D3KA 5AJWA 3BC1A 3DBHB 1GNTA 5KO2A 4EHHA 2I2FA 1FU4A