4CLHA

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
267
structure length
252
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQKSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
molecule keywords PTERIDINE REDUCTASE 1
total genus 92
structure length 252
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4clhA00
4ZQEA 4I5EA 4YAIA 1V9LA 2Y99A 3L4SO 3PQFA 3V1YA 4DC1A 4YTEA 3OA2A 5T57A 1X13A 4LGVA 1P77A 4E6PA 4EGFA 3K30A 1AN9A 5EIOA 2V65A 3I6QA 4XYBA 1QYCA 3GPIA 1E3EA 5A03A 1NTOA 3G49A 1EZ4A 2DFDA 3AM5A 1B26A 2HDHA 1UXIA 3KSUA 3GN1A 3ONEA 4CQMA 4TVBA 3ZWAA 4CQLB 2CDBA 2UV8A 2BGLA 3OQ1A 5GMOA 4GWKA 4N5MA 2VHWA 1ZK0A 4ZHSA 1JKIA 2DTXA 3GG9A 4HNGA 5C37A 3RD5A 5JSFA 1R0SA 3JQFA 2C0CA 1MGOA 3WGIA 1ZKMA 3E8XA 2ZJ1A 3I3OA 2HMTA 3W6ZA 2ZTMA 2IYOA 2VYND 4ILKA 3PJEA 3NT4A 1HT0A 4II2A 1PGOA 1H6AA 2X9VA 3F1LA 4IQ0A 3OECA 4N18A 1K6JA 4CV0A 4BNXA 2Q2WA 1Z82A 3D5QA 3GA0A 4IDBA 4IMPA 3DHYA 5JS6A 1UH5A 1QYDA 2C29D 4BO5A 1U3VA 2HMUA 3G1UA 3IUPA 3PI7A 2FY8A 1QLJA 3LQFA 1R0LA 4GQAA 4YQZA 1KEVA 1XSEA 5ILOA 1J49A 1PJSA 2EG9A 2AE1A 3LYLA 5MGBA 3KLPX 5H82A 3WFIA 3RFXA 3PHGA 1UJMA 1JAYA 1XEAA 2AEMA 3DBRB 1P0CA 4BL5A 2HCTA 1J4AA 4Y98A 1EUDA 2B4TO 3COSA 3HG7A 2O3RA 2B36A 4CMEA 1G6KA 3KO8A 4W9NA 2VZ0A 4OYRA 4DIBA 1B8VA 2BLLA 4TROA 5H81A 3CMMA 4PLGA 2H5LA 2IE0A 4XYMA 4CM4B 2PZKA 3VVCA 3ZNNA 1E6EA 1OMOA 3C8MA 3QY9A 4DLAA 4PZEA 4PLTA 1NAHA 4GLOA 4WPGA 1DPGA 1LLDA 3GAZA 1Y5MA 4GX5A 3U3XA 2A94A 2W90A 4JBHA 4PFJA 3DHNA 2VNAA 5A06A 2PGLA 2VCYA 5LC1A 4RLSA 2C82A 1HWYA 2BMAA 4N7RA 4HV4A 2D2IA 3QWAA 1D8AA 2AEFA 2NWQA 3F5SA 4JBGA 5JLAA 2D5CA 2J6IA 2P2SA 5DT9A 4KQWA 2NLOA 1E1MA 3DHEA 3O26A 5CP8A 1RYDA 1ZVMA 4UVIA 2NACA 1N7HA 1E6UA 1DIBA 2JD0A 3EVTA 1EDZA 4Z0TA 4MOWA 1V35A 4NH4A 4B4UA 1GYPA 3B1JA 4ALJA 4GL4A 1VL8A 4DPMA 4LK3A 2BGKA 2UYYA 2X8LA 4J1TA 4JP3A 3DMTA 2J5QA 4GAEA 1Y9EA 1WVGA 3FTNA 1ONPA 1SEPA 4YBZA 5CDTA 3AU9A 4YDRA 1U1IA 2Y93A 2NQTA 3NTRA 3LT1A 4XEHA 2XAAA 3GR6A 2BRUA 3WYBA 2BFAA 3JQGB 1LXCA 4NFHA 3ZV4A 2VHYA 1BSVA 1NBOA 4OSOA 2DAPA 3HQ4O 3I1JA 3O8QB 3KUXA 4JIGA 5F5NA 2XXJA 2WMDA 4A26A 4BKPA 5JW6A 1IZ0A 5TT1A 5A1TA 4YT5A 3W4JA 3F5QA 4BKQA 1P0FA 4ZRNA 2DTEA 1YOVB 1ZNQO 5DF1A 3DFZA 1LBEA 2O3QA 3C7AA 4FOOA 4ALIA 3D0OA 2Y1OA 3T4EA 3OETA 4JNKA 3TSCA 1ULSA 1DFHA 3DOCA 4QQRA 4CUZA 4FC6A 4ZQFA 3NAQA 3FR8A 3ZV3A 1ISJA 4XYEA 4CM8B 1WZIA 4E2YA 2X0JA 4ALNA 3JQBA 5A3JA 2CDCA 4AG3A 2YUTA 5BSHA 2GR9A 1PWZA 4S1VA 1ZSYA 3NKLA 3HB5X 2DC1A 5CDUA 5FI3A 3RUEA 4CMJA 5G4KA 1GQ2A 1XIVA 3GNTA 2VT2A 3P2OA 3UH1A 3WIEA 4E0BA 4F6LA 3F9IA 1DHTA 5CDGA 3RUCA 4QO7A 1ONOA 1C3VA 3NEPX 5AQ1A 4JROA 4B7CA 2OOSA 3ZH2A 1LSJA 2BH9A 5DDIP 5BSEA 1E7RA 2Z1MA 2OMEA 4EJ6A 3ONDA 1P3DA 1LSUA 3ITDA 1IE3A 3MJSA 1XKQA 1UZNA 4OH1A 2Q45A 5TS3A 4DIOA 1WDKA 4NJMB 4Z0HO 2WE7A 3JSAA 4U6SA 2OZPA 2PLAA 3VAZA 1I30A 1NAIA 1IPEA 4E4YA 4QSMA 3G1TA 4WNCA 5B12A 4IBOA 1HSOA 1PL8A 1JVSA 1F17A 3BIOA 1VJ1A 1ZFNA 3QIVA 4ZQHA 1O95A 4PZDA 1XU7A 3VKVA 3JQ7A 3NUGA 3DMTC 3OICA 5L51A 3PHJA 3RUFA 3TFOA 4B3IA 1EFLA 1GDHA 3OIGA 2BHLA 2NSDA 2RIRA 3UN1A 4CLEA 1VL0A 3ENNA 3GQVA 3GEGA 4F45A 2WJPA 2X5JO 4HBGA 4WEQA 3AJRA 1Q0HA 4FW8A 2OFPA 4IDCA 4XR9A 4WE3A 4WGGA 3V1UA 2AW5A 1PL6A 1C0KA 3ZWCA 2G82A 2X9GA 1IYZA 1T24A 1GUZA 3CPSA 3NJ4A 4MIYA 4NBTA 4O6VA 5HS6A 1U7HA 4BNZA 5DCUA 3E18A 3CXRA 1ZEJA 2E48A 5JFOA 3GVPA 3FRJA 5IDXA 1JQBA 4R3WA 4QECA 4MP8A 2EKPA 1VKOA 1I32A 3GFGA 1BTOA 2EV9A 3I83A 4TQGA 5CHEA 1UDAA 3DBRA 2V6FA 3H9EO 4J90A 3UOGA 3WYCA 3DDNA 1Z73A 4RQUA 3ZGYA 2H9IA 2ZB4A 4H7PA 4Z3DA 4WOKA 1WLYA 4TZKA 1O0SA 1YKFA 1QYXA 3ROPA 1EK6A 1X7DA 1PS8A 4H16A 1NASA 2EP7A 3I4CA 3EMKA 4RF5A 5BSFA 3R3JA 1WPQA 2PD4A 2JAPA 5DP1A 3HSKA 1E5QA 1UAGA 2G5CA 4R5HA 3WGOA 1ID1A 3GNSA 3I9LA 3U5TA 3IC5A 1GCOA 3BMNA 3DFUA 4BV8A 3RVDA 5TT0A 4KUHA 3NT2A 1TT7A 1EE9A 4M86A 1N1GA 2NUAA 3I9JA 3QP9A 2E6UX 1NQ5A 4XD2A 3PJGA 3HFGA 3JQ8B 4IQ8A 2HAEA 4BO9A 3E9NA 2Q1WA 4TRNA 4NIMA 3CTMA 1GADO 3E82A 1P1IA 3K2EA 4RDHA 1BHSA 1XR3A 1M76A 4MKRA 2P9CA 5JDIA 4RZIA 3EVNA 3I23A 4XQEA 5KJFA 2AQHA 1TB4A 5BNIA 2UAGA 3ZU5A 2C7VA 5L3ZA 4R1UA 5K9ZA 3CE6A 2PKRA 2J5RA 3LSYA 4WKGA 4JLWA 4ND2A 3WBBA 4R1TA 3QW2A 1NFQA 4ZQBA 2DUWA 5KVVA 4BO3A 2Q3EA 1M2WA 3CEAA 1F8GA 4FFOA 3KLMX 4FSHA 2CVQA 4YQYA 5LDGA 3JQGA 2QRKA 1ZK4A 2D1YA 2HQ1A 4RVUA 3RJ5A 1JKJA 3RKRA 3WQRA 4RL6A 4PG7A 2Q1SA 4U0JA 1C0IA 5TIIA 2CDAA 3GDFA 4RPKA 3L6OO 3F3SA 5EN4A 3WJ7A 5I8WA 1X7HA 2WYWA 3PK0A 4D42A 1HZJA 1HLPA 1OFGA 2VOEA 2IEDA 1DFGA 1ADFA 2H1SA 4LN1A 4PLVA 1TEHA 1LA2A 5U4QA 1FMCA 4ROSA 4YAEA 3WMWA 2QG4A 1MXHA 2HU2A 4CV3A 2CF5A 5T8KA 3Q11A 2JL1A 4RVDA 3S2EA 3G17A 1M6WA 4JGBA 3W4KA 1P1RA 5G4KB 5L7YA 5IF3A 4BNJA 4NQZA 4NNJA 1I3MA 5AXCA 3ZNPA 5KNLA 3JD1A 2I99A 3PLRA 1SEVA 1WZEA 3GH3A 4CMEC 5KJ6A 4DRYA 1LTHR 1VJTA 4F3YA 2FPGA 3WWZA 4M55A 3GC6A 2HK9A 4OXYA 4XX0A 4B8WA 3JD0A 1HXHA 2HRZA 3QWFA 4XRGA 5CPBA 5ILGA 2WM3A 3DR3A 3TF5A 1PQUA 1GFSA 1CETA 3PWZA 2YZ7A 5G2OA 3MTGA 4L0QA 4PG5A 3WQQA 4E30A 2FR8A 2O3TA 2R6JA 1I01A 1W73A 4NJMA 3ZWMA 2NTNA 1B15A 1GQYA 2CD9A 1ZO8A 3UXYA 4GX1A 1MG0A 2X22A 1DIGA 2GERA 4EJ0A 4RF3A 1CQIA 1P45A 2UUPA 4CLRA 3P5SA 3VH2A 1DO8A 3HUDA 4MO2A 3LF2A 1ISFA 2BFPA 2IXAA 2NVWA 3KRTA 4KQXA 4BO8A 4FGSA 4YRAA 5A5EA 3E03A 4ALKA 4G81A 5COAA 4AJJA 3ZWBA 4TMFA 2G0TA 5DOZA 3JQ7B 2OXIA 1JW9B 2VWHA 3SXPA 1FXSA 1W6UA 1LNQA 1JLLA 1O5IA 4NPCA 3AUUA 3CH6A 1LRKA 3D1LA 3EC7A 4KTVE 4II3A 3TZHA 3Q9NA 3L9XA 1A4IA 4YJHA 3VH4A 3GGPA 2W8ZA 5DZSA 2NU6A 4M54A 2E49A 3MEQA 2PD3A 4LCEA 3DZFA 3WWYA 3Q1LA 4MVJH 2EF1A 5KVCA 2GNAA 4YWJA 1LRLA 1QG6A 4U7WA 3IKTA 1B0AA 2GRAA 1EVYA 5AOVA 4EUEA 5MDHA 1UP7A 5IAAA 1XHLA 4FJ0A 1PWXA 5IZ4A 1BRMA 4K6CA 4J4TA 3OEYA 5ENVA 2Q4BA 3STHA 2VWPA 3EZLA 3TJRA 4YJFB 2HSDA 5IFLA 3WS7A 1F0YA 2PZJA 1JVBA 3H65A 4LVUA 1U3WA 4MKXA 4P4LA 1LLCA 3NDIA 5JXWA 3MJCA 5GZ1A 4UUMA 2J3KA 3ST7A 1N5DA 1L7DA 4S3MA 3IP3A 2I3AA 2EP5A 1E3JA 3S2FA 5DULA 3GY0A 4BO2A 4WASA 4OQZA 4YR9A 3DAFA 1R15A 2OUIA 2YDYA 2GDZA 2VZ8A 3GHYA 4YVFA 4HXYA 1MG5A 3UCFA 2Q1TA 3BMNB 4GLLA 3QA9A 3VZRA 2AQKA 2DPGA 4OL9A 4A5OA 3PGJA 1QSGA 3D4NA 3TOZA 4UVEA 3ICPA 4Q3BA 1H93A 1HDXA 3AUAA 3BHJA 3WDSA 4IJUA 4XRRA 3JQ8A 4XCVA 4DLBA 3F6YA 5JAIA 3JD3A 4WCFC 4W6ZA 1OC4A 3WGZA 3K2BA 1FDWA 1X1TA 2X7HA 3ZWWA 3VDQA 3L6DA 4B4VA 5ER9A 2VHZA 5JAZA 1KERA 4E21A 2ZTLA 4FR5A 4PG6A 1W4ZA 4YT8A 1IULA 4R3NA 2X9NA 4QXMA 1IB6A 3KYCB 4Q9NA 1UXKA 2J3JA 3UCEA 1H6BA 2WEKA 3C85A 5I8ZA 4YYZA 5KTKA 3IS3A 4R16A 2VOJA 1FK8A 3KSZO 1PGJA 2OGUA 5L40A 1H2HA 1GD1O 1H2BA 1ARZA 1OAAA 3IKVA 5EERA 2ZCVA 2X1HA 2AG5A 1S6YA 3IDSA 2GD1O 7ADHA 2ZYGA 1EVZA 1L7EA 1E7MA 1H9AA 1ZBQA 2BFOA 1R0KA 2EW2A 2FR0A 3IUSA 4QO8A 3BXXA 3MJTA 2Z1NA 3PEFA 4M49A 5EESA 5G0WA 3WGTA 5GZ3A 1XWFA 3VPGA 1SAYA 2X0RA 3BMOA 4ND4A 4CUJA 5L4NA 4EUFA 4KMSA 3PFWO 4K1LA 3CSDA 2Y0CA 3RWBA 4NJOA 3VTFA 1HRDA 1QRRA 2HUNA 5A4DA 2FZWA 4E3ZA 4FOSA 1EE2A 3OQBA 3D5TA 2FRDA 3O03A 3BTVA 1LSSA 1DLIA 2Q1UA 3GHHA 4JN6B 1R6DA 3V8BA 3WOHA 5U1PA 2PGJA 4K26A 2FZEA 4BOYA 3TFQA 1CERA 5K6AA 3T4XA 4FJ2A 4BNTA 3LZ6A 4TVOA 4UEKA 3KVOA 1HYHA 2GO1A 4FFMA 4ZVVA 3I52A 3QVTA 1NM5A 4MP3A 1MC5A 3ENKA 1KVUA 3A1NA 4J9UE 3OIDA 3R3SA 1ZK2A 1FDTA 1JN0A 4RPLA 3MOGA 5TJHA 1J6UA 2P68A 2CZCA 3PDUA 1HE3A 1ZUD1 3LF1A 4W99A 4BGUA 1C1DA 2WWRA 4DPLA 1NPYA 1Q2XA 1KVSA 2IZZA 3F46A 4E2ZA 2WD8A 5IN5A 4RF4A 3PGXA 4GVLA 2Z95A 4CJXA 3P2YA 2YDXA 4XYLA 4J49A 4J9VA 4YAKA 1QP8A 5ES3A 3GFBA 1HDZA 1VKNA 4DC0A 1YL7A 2X58A 3ANNA 2D59A 3H9GA 2ZB7A 1PZHA 4QUKA 4B8ZA 4CLRB 2EEZA 1HLDA 4Z6KA 1XLTA 2A9FA 4NBWA 3WMXA 4E31A 4D41A 5AXAA 4R1SA 1QV7A 2YV2A 2HKIA 1NQOA 4A7PA 2VYVA 3UUWA 5EQDA 4Z9FA 1E7SA 2YFQA 3G3EA 3LC1O 4MVJG 3C7DB 1B3BA 3U4HA 2B0JA 1Y1PA 1ZW1A 1A4UA 2CF6A 2Q2QA 2VHVA 2D3TA 4UEOA 3ROMA 3KZVA 4OXKA 1I36A 3OJOA 4XR4A 3D64A 2EGGA 1U2DA 1YRLA 2Q99A 4YJHB 1YONA 2FWMX 4OAQA 5F3RA 5ITWA 4LSWA 3F4BA 5JCJA 1PU2A 1U7TA 1GUYA 2E82A 2BKAA 2BGMA 3A14A 1C0PA 1NVTA 3DMYA 1RM3A 3AY7A 2RH4A 4Y6PA 2IZ1A 3PIDA 2HRBA 1PJ2A 3OH8A 3OIFA 1D1SA 4R51A 4WLVA 1T1SA 3RASA 1PIWA 3VDRA 4PGFA 2Y68A 2EJVA 3PJDA 4D79A 4M87A 3C1TA 3FI9A 4W9NC 4P4GA 3VPSA 1EVJA 4E32A 3SLGA 5HTOA 3V2HA 1LI4A 3AY6A 4BQRA 1ZMOA 3WG9A 4YJFA 4BMVA 3GZNB 3NT5A 4Z9XA 4ONEA 4E2WA 3ZU4A 4AJKA 1DC6A 1FDUA 4KWHA 4W7HA 4CR6A 4D0SA 1EUCA 4XQ9A 5HBRA 4CUKA 1IL0A 2JD1A 3CINA 3K96A 3WX0A 4B4OA 1H0KA 1IUKA 1DC3A 4NZ9A 1BWSA 5DN9A 4OIMA 1WDMA 3HFSA 2VNSA 1A9ZA 4L9RA 2IDZA 1YB4A 4XZ3A 5TRTA 3Q2KA 2G17A 3D3WB 4BGEA 4NDNE 5L4SA 3GVXA 4IINA 2NQ8A 3WGGA 3MJVA 1PTJA 2YY7A 4YAJA 5G4LA 2EGHA 3A06A 2DKNA 2I65A 4R68A 1AGNA 1EQ2A 1Q0QA 5BT9A 1RJWA 4TRRA 4ZA2A 4DYVA 7MDHA 5T6BA 3BHMA 3ZU3A 3MZ0A 1Y8RA 1B14A 3K31A 4W4TA 5FWNA 2JCVA 2EKQA 5JC8A 1ISMA 4I5DA 2YYYA 4UVGA 5JDCC 1PS9A 2OL4A 3AW9A 1GV1A 2IYPA 1E6WA 1XELA 5ICMA 5BNFA 4MVJA 4WLOA 1QR6A 4IJKA 4RPHA 1M75A 4J16A 5BNTA 3C24A 3ZWNA 2DBVO 5JMPA 3ZV5A 4BMNA 3O9ZA 3KYCA 4BB6A 3RU7A 3I4FA 1WMBA 4MPDA 4RVGA 4UUNA 4C7JA 1E3SA 3LC7O 2IEBA 1PJ3A 2GN8A 4BQPA 3M6IA 6ADHA 3W1VA 2GN9A 4CMIB 2NU8A 1O9BA 2XXBA 4HFNA 4JBIA 4R1NA 1GPDG 4BGIA 5I7FA 2SCUA 3IIEA 1LU9A 4AJLA 4W7IA 3UHAA 3OM9A 1P9LA 1QV6A 1BMDA 1GZ4A 1R4MB 2QQ5A 1T26A 5T67A 3SJUA 2CVOA 3PFFA 4ALLA 1P44A 5IJZA 1EEHA 1LLUA 1H9BA 3FF4A 1X0VA 3UKOA 3QVXA 4GSLA 4Z9YA 3T7CA 3GGOA 4NBVA 5AXDA 2VUSA 1WXDA 3BMOB 3PJFA 2BF7A 2Y66A 3S2IA 4DYDA 2Y1CA 2TMGA 5JCJD 1X1EA 3FPLA 3WR5A 4RF2A 2JAHA 4WCDA 1DIRA 1MFZA 4UREA 4ND1A 5TGDA 1RM5A 3FTPA 2DLDA 1DIAA 1P1KA 4I9NA 3MJEA 4KUGA 2YV3A 3KHUA 3U9LA 4AJEA 3DQPA 4OMUA 3JYPA 4K6FA 4J7CA 3AM3A 4DXHA 1A71A 3DAPA 3H5RA 5B4VA 4ID9A 2AHRA 3VPFA 3PPIA 3GRKA 3VC7A 3ZU2A 1YB5A 4XIJA 3RROA 3WGQA 4IDEA 3ZWOA 3U4DA 1RM4A 3K8ZA 6LDHA 5A9TA 2HLPA 8LDHA 2BD0A 1QLHA 2OBNA 1I3LA 4R9SA 4GGPA 3UVEA 2B35A 1UR5A 9LDTA 2IZ0A 4MVJD 1ISGA 2DQ4A 3DZIA 4IGEA 3VTZA 1HDRA 2O3SA 3FD8A 2JJYA 2XPCA 1C1DB 1SPXA 3WNQA 3HDYA 5KJCA 4DMLA 1LRJA 5T5QA 1J0XO 5CEJA 3PHIA 3OEWA 3ZI0A 9LDBA 1PJ4A 5TX7A 3OJ0A 2DPHA 1F06A 5I7SA 1R4NB 4DBVO 3M1AA 2PA3A 3H6KA 4M8SA 4XGNA 5JAMA 3WGYA 1SBYA 3FN4A 5L7WA 1I24A 2NV6A 1NVMB 1PJLA 1T2DA 3KXDA 2CVZA 3RU9A 1EFKA 1EVIA 1LDNA 1B8PA 1P1JA 1QYWA 2I76A 1GL3A 3JD2A 3WFJA 1ENPA 1AUPA 3PVZA 5A3VA 4CMKA 4EYEA 1PQPA 3GF4A 4PG4A 1BVRA 5JO0A 4LISA 1XGKA 2ET6A 3DBVO 1MX3A 5GY7A 2YV1A 2DTDA 2ZYAA 2UVDA 3EZYA 4BO7A 1P74A 2YQ5A 1PL7A 1E5LA 2Y1DA 4AJPA 5AVOA 3DOOA 3E5MA 4I5GA 3HN7A 4XJSA 1G0NA 4CL8A 3L4BA 1JU9A 3NDRA 1WAMA 3JTMA 4UAGA 1CIVA 4IIVA 5JYDA 1D4FA 2PGDA 2O48X 2FPIA 3H5AA 4HUJA 3LLVA 1FJHA 5TNXA 3L4BC 4YT2A 1JDJA 3NGLA 5CG1A 2NTVA 3ETEA 5EL0A 2PH3A 3D3EA 4AJNA 2HJRA 3WSWA 5FFFA 2B5WA 1PR9A 3B70A 3HNPA 4A27A 1A27A 1O8CA 3S55A 5HA5A 3UW3A 2NU7A 2ZYDA 2D8AA 3ZW8A 2FSVA 3GZNA 5CDYA 1YBAA 3CIFA 2B5VA 4QFDA 2VT3A 2O4UX 1VJ0A 1Q0LA 3DBLB 4DGSA 1LUAA 4RQTA 2JKVA 3AI1A 4CMBA 3H5NA 1M6HA 1YS4A 1ZXLA 1ZZEA 2AE2A 2TMDA 3L07A 3NV9A 3RC1A 1ZCJA 1QORA 3GN2A 3DO5A 1JTVA 4RPGA 3D3WA 5I9NA 2QW8A 4BO4A 4P4NA 3HE3A 1JWAB 4HP8A 1AXEA 1CJCA 1YXMA 4XWYA 2F00A 5J23A 3TL3A 2OP1A 2C54A 1ZK1A 1DDOA 3TZCA 1E0DA 3TQHA 2JHGA 4IIUA 1VRWA 5JNLA 1T2AA 3NRCA 4PG8A 1DHRA 3PP8A 1HDOA 1NNUA 1BGVA 4FDAA 4MIOA 4BNNA 5I9MA 3FBGA 1Y8RB 2EWMA 1BXKA 1T4BA 3QWHA 2RCYA 1IOLA 5EPOA 4FGWA 3JD4A 4AVYA 4MVJI 1O89A 3ZN2A 1U8XX 3RUDA 5BQFA 2VN8A 5EJ2A 3FNEA 2X0IA 1Q7GA 5KKAA 2IXBA 3WB9A 4J1SA 4AJOA 2CNBA 3H3JA 2WSBA 1C1XB 4RVHA 3AU8A 3EDMA 1IHYA 1IHXA 4BNVA 4CV2A 3IJPA 5A04A 2I5PO 4IJWA 3F1KA 1LEHA 4KWIA 5LDHA 2D4AA 4RGBA 2R00A 3U4CA 5G0VA 2QZ9A 3GUYA 2BELA 2NVUA 3QLJA 3VH3A 5DOVA 4D44A 5L9AA 4CMIA 1B2LA 3Q2IA 4XQGA 2WTBA 1AXGA 1V8BA 4WUVA 3AFNA 3CUKA 1EK5A 3NTOA 2FHSA 4NG5A 1R4MA 5TF4A 3X2FA 5ER6A 2FSSA 1LSOA 4ZGWA 5EINA 2GUGA 1Y8QB 2BFMA 2V6BA 3ZWXA 3N58A 3ZNOA 4L8VA 1E3LA 3I9OA 5A9RA 3DZGA 5KOIA 1HSZA 5COQA 1T2CA 3DB2A 1EBUA 4ND5A 4JCOA 3WICA 4ITUA 3JYOA 2ZTVA 3FWNA 3UAGA 2O7QA 3CKYA 4BNYA 2J3HA 1EMDA 1YL5A 1T2EA 3KSDO 5EQFA 5JDIC 3BHIA 1E1KA 3BAZA 4IZIA 3NDJA 4JXKA 1G0OA 1DSSG 2GN6A 3DEYX 4NHEA 1ENOA 2DFVA 2DT5A 3B1FA 2YW9A 2A92A 2DBRA 3VZPA 3KV3O 3G79A 4WJZA 1Z45A 3OP4A 1H94A 2JFGA 1R12A 4GMGA 1NPTO 1A7AA 4RV9A 5KIAA 1F12A 1X14A 1I10A 3W8DA 3VOSA 3S1LA 3RBXA 2IODA 1C0LA 1Q7BA 2GASA 2G76A 2HMSA 1CRWG 2XF8A 3HHPA 3WQSB 1ISIA 4LSMA 4O63O 1HDGO 4INAA 1HEUA 3M1LA 3DBHB 2RBEA 4YACA 3K5PA 1R4NA 5ITVA 4NMHA 2X5OA 2O2SA 4Y67A 5U9CA 1PJQA 3AUTA 3PDJA 1V3UA 1NXQA 1SOVA 4P8RA 4M1QA 2GCGA 4JJFA 4E33A 2GYYA 3ETDA 3M2PA 4DTIA 2VUTA 2PZLA 2G1UA 3K73O 3RUAA 4IMRA 1EDOA 3E6AA 4RCVA 4XQCA 2FN7A 4Q3AA 4IUYA 4CLHA 3AUSA 1SOWA 1N9GA 2AEJA 3Q0EA 3DZJA 4XB2A 4L4XA 3GZ4A 1VM6A 3CZMA 3TL2A 3VPHA 3JQFC 3I9KA 4E12A 1XG5A 1YJ8A 3OJEA 3H4VA 1KEPA 2B69A 2C07A 5DP2A 4JK3A 1YH3A 2DBQA 4DQUA 2ZJ0A 4NK4A 2VYVD 1MA0A 4Q3DA 1W8DA 5L7TA 2PTGA 1A72A 3CZRA 3LT0A 2AQ8A 5IN4A 1SMKA 3K9QO 5K6AC 2ZCUA 3ASUA 1XYGA 4X54A 4CMHA 2WYVA 5IZCA 4PVDA 2ZIZA 4CM9D 4LW8A 1ZEMA 1KEWA 4XGIA 2Y67A 1TLTA 1MC4A 3BYZA 3R1IA 3P19A 5IZCC 3WYEA 4HX5A 3OHSX 3EAGA 4J43A 1YB1A 5L53A 1H6CA 1HYGA 4A0SA 3AOEC 4CM1A 4O5OA 3RJ9A 3MOIA 4WCFB 3SBOA 3DBLA 3ZHBA 1RM0A 3PRJA 3G0OA 1ADGA 2YQ4A 1GYQA 3ZWPA 1XCBA 4BB5A 1GY8A 2Y1EA 5I9LA 1I2ZA 1ZSNA 3JQEA 4UVHA 5TSDA 3TNLA 4HY3A 3TWOA 1JAXA 2I6TA 4HADA 5JPIA 1HYEA 1T1RA 1CWUA 3ANLA 3C7CB 3QV1A 4FD3A 2Y05A 5G0TA 4GPD1 1DJQA 4D0RA 4TKLA 2GF2A 3OJFA 4IXTA 4QT0A 2ZB8A 3JQ9A 5LCXA 4RLHA 4D3DA 1UUFA 2VWQA 2GPTA 3L9WA 4GMFA 2B4RO 3RI3A 1UDBA 3UGKA 4RJTA 3DWFA 2CFCA 4BNGA 5C7IO 2WYUA 4IJVA 1SNYA 3QVWA 3PWSA 1K89A 1Y5RA 1I2BA 1KETA 1RKXA 2WDZA 4DMMA 1DAOA 4GBJA 3GT0A 2QIOA 2DVMA 2WD7B 4MDHA 5FI5A 2FPPA 3GMDA 1CYDA 2BI7A 1T25A 1KY4A 4KTTE 3NX4A 2D5AA 3UFXA 3OA0A 1C1XA 1HDYA 4CM6A 1HZZA 4IM7A 5HM8A 1ENZA 3OSUA 4K9DA 4YJDA 3L0DA 4U0KA 5JBIA 5JO9A 2V6MA 1HF3A 1WP4A 5L45A 3RIHA 1MFPA 2ZQZA 5CPFA 4E2XA 4RO0A 2VTEA 1XQ1A 2I9PA 4CM3A 2NVUB 4L74A 3HJAA 2XOXA 2I66A 3Q3CA 1YL6A 4XB1A 1I0ZA 4CMGA 4LRSB 5DBIA 1YQGA 1Z7BA 4J2OA 3QSGA 3SC4A 5JDCA 4PLFA 1P31A 3JQAD 4ZQGA 1E92A 1PR3A 1Y7TA 1BG6A 2QYSA 1ZK3A 2VHXA 5GZ6A 1ZXBA 3ZCXA 5KJ1A 3GK3A 2D0IA 1Y8QA 4BNFA 3MCVA 3ZHZA 3ZZNA 4CR7A 1SB8A 4O59O 5JMWA 4L75A 5KCZA 3GOHA 4QTZA 2Y1GA 4Q39A 1CF2O 3JYNA 3BTUA 2J3IA 2HO5A 4PIVA 1X15A 2JD2A 3GG2A 4TRJA 1WWKA 1YBMA 2X0NA 5B4TA 1BVUA 4GX2A 1QMGA 4HWKA 1ZJYA 5KKCA 1H6DA 4IDGA 2NADA 5TQVA 1V6AA 5C5IA 3C3XA 4L76A 2R2GA 4GSKA 3H3FA 3GNQA 4GWGA 3JYLA 4PN3A 3MWDB 4TKMA 2PNFA 5T64A 3AOGA 3KTDA 4JJIA 3IMFA 4H3VA 3FWZA 4WOJA 3ORFA 4WLUA 2O3JA 3ZWYA 4WLFA 3ON5A 1E3WA 4N5LA 1PJTA 4D3SA 3TPCA 4FS3A 4FC7A 2NNLD 3WTCA 3I5MA 1OC2A 1A7KA 3HN2A 1K6IA 3VVBA 2LDBA 3FR7A 2JFHA 2AXQA 3KYDA 5KWEA 1ZIDA 3DBHA 4BIIA 3UICA 4AJIA 1WNTA 2ZK7A 4GI2A 4MVJE 4IY1A 1AHIA 1OZAA 3GVCA 3BTSA 2LDXA 1E1NA 1V3VA 2Z5LA 1GU7A 4LRTB 3OMLA 1Y81A 3RKUA 4Q3CA 1LQUA 1PQWA 1GCUA 2GZ1A 1KVTA 2P5YA 2Q50A 3W8EA 5IDQA 1GAEO 1LX6A 4NR0A 3JQBC 3WLFA 3DZKA 1VPDA 1YBVA 4M89A 3W6UA 3KOUA 2A35A 2VTDA 3DC2A 2C7GA 1I3KA 3HWRA 1AHHA 3V2UA 3EHEA 1Q7CA 1N9GB 1IPFA 4NU5A 1MXFA 2EIHA 2FP4A 5EMHA 5IDYA 4AJ4A 3KETA 1DRWA 1ORRA 2CSUA 1DOHA 4AJ2A 4WLNA 5JE8A 3B1KA 3EGOA 1M67A 2R00C 4HFMA 1T2FA 4J2HA 5AYVA 4E5NA 2ILTA 3ICCA 2CY0A 3AM4A 4ZN6A 1U3UA 5DNAA 1EQUA 5HWSA 3BMCB 4UVDA 3JQ6A 5B4UA 1KBZA 1XDWA 1U4SA 1X7GA 3GUCA 4CM5A 2ZKLA 4EW6A 4DL9A 1TA4A 3MTJA 4E5KA 3JYQA 3OJLA 3SJ7A 1I5RA 5THKA 3RAJA 4IS3A 4AFNA 1IZ9A 3FBTA 2QX7A 4R01A 2DM6A 3ADOA 4NFYA 3TOXA 3K92A 4WCFA 4YXFA 2O2YA 4PLCA 1VSUA 1DXYA 3TZ6A 5I7VA 3ADPA 4BNHA 3TZKA 1P33A 3PIIA 2F1KA 3QRWA 4TZTA 5A9SA 3TDKA 8ADHA 4DQXA 3IL2A 1NWHA 2C20A 4QX6A 4PLPA 4U6QA 2EW8A 4J4BA 1N2SA 3QHAA 2O7SA 4ND3A 3H8VA 2EXXA 3ZWVA 4CPDA 3LT2A 4MVJP 1NQAO 2VRCA 1BW9A 3SVTA 2OORA 2QYTA 3KYBA 4HFJA 4OKIA 1DAPA 4BO1A 1N8KA 1UP6A 5CFZA 2Y0DA 5H83A 4D46A 3WSVA 4G2NA 1OOEA 2QRLA 2GN4A 4J3FA 1NYTA 1KVQA 5A5FA 1PX0A 4D45A 1MP0A 3I6IA 4JX8A 4A73A 3AFMA 4HNHA 3L6EA 3PWKA 3ULKA 4WNIA 1NFRA 5L95A 2Y0EA 2PZMA 3PLNA 4I1IA 2WD7A 4J1QA 2E37A 2OP0A 1A5ZA 4A10A 1P1FA 3EYWA 4J6FA 2PD6A 3LU1A 4TSKA 1I3NA 3PQEA 4AJHA 1HDCA 2YHUA 4ESOA 4BNWA 1BXGB 3PZBA 4ALMA 2C5AA 4FB5A 4FFNA 4Q3NA 4DQVA 4BHTA 1OBFO 1ZJZA 4YRDA 1UXJA 2FMUA 4MP6A 4Z3KA 1HETA 3F47A 4RZHA 4BO0A 4NBUA 4I08A 4EEXA 1KC3A 1ML3A 4OM8A 1NQTA 1YO6A 3E48A 4FFRA 3VHRA 2HMVA 4YCAA 3H2SA 1AE1A 1PZEA 2Q49A 4CV1A 3AY3A 4IQGA 1GV0A 1B16A 4OOEA 3TN7A 1O6ZA 1U3TA 3BTOA 2JHFA 3K6JA 4IS2A 2VWGA 3PTZA 1YDWA 4BNLA 5COBA 1A9YA 3GPDG 4RORA 4BUCA 2J5KA 3SLKA 4BKOA 4BKRA 2VYNA 3QWBA 1XA0A 4BGVA 5F5LA 4GGOA 4PLYA 4J7UA 1I33A 5T8KC 1ULUA 2O50A 5IXSA 5TJ9A 3A9WA 4NU6A 1XQ6A 4DA9A 1L1FA 1WW8A 3RUIA 4YRBA 2AG8A 5AXBA 3VKUA 5CEFA 2Q46A 2O4CA 2W2KA 4CODB 3H2ZA 3O4RA 1E77A 1MB4A 3KBOA 4UUPA 1PSDA 3OQ6A 4IDFA 3P7MA 4GX0A 3H7AA 1KYQA 4FIZA 4FJ1A 1GZ3A 4PLZA 2NU9A 1EBFA 1PGPA 1Z74A 2EJWA 3QJ5A 5ENDA 1LC0A 3JQAB 1OI7A 2E4AA 4TWRA 3RCBA 1VE9A 4PRKA 3IP1A 4HFRA 4R5MA 2O23A 1GEGA 3NTQA 4MINA 2EERA 1E3WB 2PY6A 4CLOA 3ANMA 4CMCA 3U62A 4EEZA 3PZRA 4Y6SA 3DZBA 3ITKA 3F4LA 3HB4X 3RFTA 4BNMA 4DUPA 1LC3A 3WNVA 1PJCA 4CM9A 3KYDB 3HDHA 4G5HA 2UDPA 1K6XA 3B6ZA 5IG2A 1RPNA 4KUEA 1NHGA 3IAHA 4J91A 5KVQA 1U2GA 4MVJF 4NI5A 3RC9A 3OF2A 4EI2A 4MKZA 4PRLA 4EUHA 3E9MA 5F1OA 1YQXA 2EKLA 1DB3A 2JCXA 3EY4A 1RWBA 2RHCA 3ROQA 4JP2A 2P91A 4W82A 4YPOA 4PCVA 1LJ8A 1V0JA 1HTBA 1Q1NA 1YGYA 1N92A 2C2YA 3EW7A 2CMDA 1UXGA 2CUKA 2PR2A 4XKJA 5B1YA 2W4QA 1DC4A 1PZFA 1S7CA 2A4KA 5CDSA 4P22A 1BXZA 3ABIA 2QHXA 3LK7A 4FFLA 3S8MA 2RH8A 1U5CA 4MJLA 3H9JA 4IGFA 5K0ZA 1CEQA 3ZV6A 1V3TA 1YQDA 2OBYA 4BO6A 1GYRA 4BNUA 4B3HA 1JWBB 1U4OA 1P1HA 1HE4A 4RVSA 3RC7A 3BMCA 4R54A 4BV9A 1FF9A 1UDCA 3IOYA 1U5AA 4OQYA 4GKBA 3UF0A 4N54A 2ZQYA 3NGXA 3FNHA 1W0CA 2GZ2A 3RC2A 1NVGA 3V2GA 2YHIB 2P9GA 1IY8A 1KIFA 5DCYA 5CEEA 4U8GA 3RSHA 3WXBA 4KDFA 4AJ1A 2V7PA 5G0UA 4UULA 4RDIA 1UZLA 3HADA 1DBVO 1ADCA 3GGGA 5JYEA 2QZZA 1NWCA 3U49A 1HL3A 4C4OA 3WJAA 4DLLA 5A9SB 1T4DA 5BSGA 3WTBA 4ZU3A 3FNFA 3ZW9A 1E7WA 5TC4A 5F1KA 3HDJA 5JCXA 5KVSA 4DVJA 3BA1A 3IJRA 1I8TA 1BW9B 1M66A 1TT5A 3QWIA 4IDDA 1TXGA 1NR7A 5JY6A 1J5PA 4BNIA 1HE2A 3B20A 1K5HA 4J7XA 1K0UA 4O0LA 3INRA 4FCCA 1GTMA 4F46A 5ICSA 3QQPA 5C7OO 4KP7A 4YAGA 4KDEA 2JFFA 5DBFA 1HE5A 2PFGA 1U9JA 4CL3A 3QE3A 3PYMA 3DZHA 3GVHA 2I67A 3GRPA 4AL4A 3DONA 2B37A 1N1EA 3MWEB 3M2TA 3KEQA 1UXHA 3U0BA 3BMQA 5BR7A 1NX6A 1LLQA 4NBRA 4IPTA 4EBFA 1D1TA 3KEOA 3L77A 1BXGA 2B4QA 3JQ9C 4UEJA 4Z0PA 1DFIA 3UCXA 2Q4EA 3ROKA 3JV7A 3HZZA 3R6DA 1R37A 4O1MA 1LDGA 3ETGA 4ZRMA 4GVXA 4Y8VA 1UAYA 5JC1A 4B4WA 4BMSA 3ZHYA 4B79A 3A28A 4CM7A 4F6CA 3FSRA 3E9QA 2Q2VA 2RAFA 4UUOA 3GVIA 5DBGA 3PYXA 4L73A 5KJEA 3GAFA 1BDBA 2C2XA 1YJQA 2PKQP 1GR0A 3NJ8A 4AICA 1B8UA 1K3TA 1U8FO 3MJ4A 1HKUA 3AOEA 1F8FA 3FPCA 4FBGA 2C5EA 1Y9AA 4OHUA 4RPJA 1D7OA 1R66A 1MLDA 4BS9A 4MIEA 3I9NA 2BI8A 3OBBA 1RYEA 4KZPA 1KC1A 3D7LA 4CMAA 4EDFA 3LT4A 5L4LA 4J0EA 4NK5A 4YB8A 4XYGA 1JKFA 1SCUA 2RHRA 3X2EA 4YJGB 4Y6RA 4D43A 4L4RA 4J0FA 3RFVA 3C1OA 3JQDA 2AQIA 3CMCO 3GEDA 4A2CA 4B7XA 1WMAA 2W2KB 3TZQA 2B83A 4DBZA 1R16A 5JAQA 2OO5A 4I9UA 1U28A 2I3GA 3QVSA 1UZMA 2W2LD 3O38A 1GUFA 2HK7A 1QYVA 3IQDB 5FF9A 2P4QA 5IXYA 3A4VA 4DREA 1PS0A 1QXSA 3DL2A 1C14A 5IDWA 3DXFA 4WECA 2PKQO 4XA8A 2Y1FA 3JQAA 2IRWA 1BDMA 4PLWA 4R9RA 2DBZA 2W98A 1X0XA 4XIYA 3EUWA 3Q6IA 2VRBA 2X6TA 4CQMB 3LC2O 4JJGA 4CQLA 2W2LA 4CLDA 3FHLA 4CLOB 4K28A 4HKTA 3PHLA 2HK8A 4CR8A 1KY5A 1FDSA 3ASVA 4L4SA 1SO8A 2OHXA 1K2WA 3SC6A 1VLLA 2X4GA 4XDYA 1EUZA 5G0SA 3GDOA 3RBZA 2GSDA 4J1NA 1PEDA 2VZ9A 5ADHA 2X23A 1CDOA 2VRCD 4EJMA 4OJNA 3EK2A 5F1PA 3VZSA 4BKUA 4A03A 1I2CA 1SB9A 4OO3A 5CAEA 3V1TC 1YE3A 2QRJA 4DIFA 4TRMA 2X5KO 3KB6A 1Z6ZA 3WIDA 1MV8A 1DRVA 4B3JA 1ZSVA 2JCYA 4RVFA 1DJNA 3HDQA 3JCZA 1DLJA 2P5UA 3GDGA 4MVJM 5I7EA 5THQA 1E7YA 3PXXA 4IZHA 1PGNA 4I8XA 2J8ZA 4WEOA 3LLSA 1KVRA 3WGHA 1KEUA 3BZUA 1KOLA 5F21A 5B37A 2AMFA 4CLXA 2FR1A 4YEDA 2VQ3A 3SEFA 4G65A 1DC5A 3H9UA 2PK3A 3OFSA 1DRUA 1NP3A 1KS9A 2DU8A 3ZNQA 2C59A 4PVCA 1ADBA 1MUUA 3I9MA 4CM4A 2HJSA 4CQMD 3N7UA 1LDEA 1ZMTA 4GH5A 4WK6A 4GKVA 3DTTA 5FEUA 2NVBA 1UP4A 4FFPA 4R69A 4PLHA 2GZ3A 4OGWA 4Y9DA 4DPKA 4U5QA 2YJZA 3S2GA 1E7QA 3GEMA 1SC6A 1H5QA 4FN4A 4URFA 2YHIA 3INTA 1LQTA 5CG2A 3DOJA 4PZCA 2DUUA 1VL6A 2UUOA 4DWVA 3U4IA 3DTYA 2PH5A 1LDYA 4ZJUA 4E5PA 2PWZA 3D4PA 3SX2A 4QFCA 2V6GA 2AA3A 3PYLA 4XGKA 4R41A 2WE8A 2PV7A 4D3FA 4KOAA 1PZGA 2HMWA 2EHDA 4IXWA 2ZATA 4ZD6A 1LDMA 2ZB3A 1E1LA 1NPDA 5DCWA 4XJTA 3GMSA 3E5RA 3DAGA 4J4HA 5C7LO 1TT5B 1VSVA 3E1KA 4LMRA 4E5YA 3AI3A 3D4OA 1YDEA 4FQ8A 4OKNA 1SZJG 3N74A 3WBFA 4OOFA 5JY1A 2X86A 4OSPA 1NR1A 2POQX 4P38A 2P4HX 1QKIA 1PGQA 2H63A 2P9EA 2H6EA 1D3AA 1G1AA 1CQJA 3LDHA 4IDAA 3W4IA 3LVFO 4R4JA 4YT4A 1VI2A 5A02A 3O8QA 2GLXA 4FPXA 3FNGA 1DEHA 3WLEA 1GPJA 3BMQB 3VPXA 1JA9A 2NM0A 1Z7EA 3INGA 4EITA 5TLSA 3AK4A 1O94A 2ZTUA 1B7GO 1NHWA 4H15A 4EZBA 3AWDA 5A05A 1YOVA 1FDVA 3AI2A 3NYWA 4E5MA 4I9HA 4BVAA 3TRIA 1GQQA 1Z75A 3ZDFA 4NFSA 1F14A 3ONFA 2YFHA 4D7AA 3PHHA 1TVEA 4Q3EA 3VH1A 3U09A 2VUUA 4E13A 5FYDA 3VZQA 2FOIA 3C1AA 1YWGO 3FCOA 1TI7A 4LCJA 4C7KA 3Q9UA 3PQDA 4CM8A 3GLQA 1WDLA 4XDZA 4BNKA 1Y6JA 5HS4A 1GEEA 4I5FA 3T7EA 4LMPA 4JQCA 4YA6A 1LDBA 1ONNA 4LVCA 4B7UA 4OXNA 1ZH8A 1N7GA 1E3IA 3RQSA 3RBVA 1GZ6A 3RUHA 1VC2A 3KM0A 5HRUA 1ISHA 1B3RA 3W8FA 4WLEA 3V5NA 4N5NA 4ZICA 1XU9A 4QEDA 1PJBA 3H9QA 4YJGA 1DIHA 5C3MA 3R0IA 3QVOA 1ENYA 2GGSA 3ZHXA 1NFFA 2NTJA 2O3UA 1YVEI 3JQCA
chains in the Genus database with same CATH superfamily
4D4KA 2AJTA 2HGSA 4ZI2A 3IPCA 3L4SO 4HH3C 1FTNA 2XYRA 5LD2B 4JI1B 3PFIA 4KJZA 4G5SA 4YTEA 4DC1A 3W3ZB 4E6PA 2XMCA 3EJ6A 1JR3D 3V8NA 3AR7A 4UM9B 1T2UA 1WX1A 4PC1A 3L04A 1IWBB 3GP8A 2HZ7A 1SCBA 3QOWA 3G49A 1USVA 5L3RA 4EG3A 5JNTA 2DFDA 1SQ5A 3KSUA 4JU9A 1KJQA 4DLWA 1F6DA 1FRVA 5JLJA 1OVGA 4WACA 3UXHA 3QPAA 2QSZA 3I8SA 3PFKA 4TVBA 4KXFB 4UDYX 4Z4FA 2BGLA 5E6UB 2JVKA 5GMOA 3UMSA 2XNSA 1DEKA 2NN3C 3L0IB 1TJ5A 3L6RA 1Q17A 1JKIA 2DTXA 3GG9A 4ZHSA 1E9VA 4ZO9A 3BKXA 3IIMA 3RD5A 4TLAA 3L46A 4I55B 1KBOA 4B3TB 2ZP1A 2CMFA 2JASA 2OCDA 3HMKA 4RQBA 3UK2A 3SZ3A 3HYNA 3WGIA 1ZKMA 3B7WA 3E8XA 1WHSB 4JLOA 4BN0A 4G0VA 3CUTA 4LY0A 3CZQA 2AN5A 2IYOA 4TS1A 2OHHA 4JODA 2JVJA 5KYKA 1DGQA 5HX7A 4IUBS 5FWDA 4ZZ0A 4HGRA 2ECFA 5IKOA 4U7HA 1P0MA 4ZV9A 4ER0A 5BY2A 3F1LA 1CB0A 4QPJC 1UBUS 721PA 2OORC 4CV0A 1FMJA 2Q2WA 4BNXA 3QEBZ 2MJLA 1M8FA 4IDBA 3GA0A 4IMPA 2YWFA 3NBZC 1QE0A 2VJLA 4QYMA 3WK8A 3M82A 3O1HB 4FEYA 3V4OA 3FNBA 1MO6A 2HMUA 3PI7A 1GKIA 1TCVA 5F76A 1KEVA 4NZPA 2QQGA 2X5XA 2H4JA 4DMFA 5J47A 1YRBA 4PAQA 3GJ7A 1UJMA 5DGTA 1KO5A 4NCIA 1JAYA 1XEAA 2J6HA 2BY4A 3DBRB 3LUHA 3KTFA 4KDRA 4X41A 5EZYB 5JNSA 3K1YA 4Y98A 2B4TO 3D6VA 3COSA 3FWHA 4YROA 2XZTA 4AMVA 1K8RA 1UKEA 2WP8J 4L85A 1G6KA 4OREX 4W9NA 2VZ0A 4GF5A 3K15A 1RBQA 4WSOA 2CXOA 3N59A 3UAYA 5CW1A 2NUTB 4PWZA 2PZKA 3VVCA 4B3CA 2XA1A 2FPOA 1BS9A 3EXHC 3KSRA 3CNQS 4GXQA 2PXHA 1PUJA 4I4TB 2BFBB 2GJ9A 3P9XA 3L7IA 5D00A 4YUAA 3H87A 4RY9A 2J0UB 1P6QA 2PSSA 4FGKA 3A9TA 3RSFA 1P4SA 4NBKA 4LYGA 5IYZB 1LCIA 2G5TA 1TTQB 3EPPA 4E1BA 2H7CA 1GNSA 3VA7A 1AUOA 4N65A 3LPLA 3ZJYA 4W8HA 5CGQB 4COOA 2HDNB 5A5VA 1OXUA 2P0YA 5LC1A 4U7PB 5MN6A 5MHTA 1IWPB 1XCLA 1KFEB 1T1GA 1Y6GA 5BN4B 2BMAA 4H1VA 4N7RA 4HV4A 5DHQA 1N3IA 4EB8A 1QBGA 3ZCPA 2G28A 2IY7A 4GMXA 1IQUA 3MSXA 2FMKA 4OTZA 4WQMA 4X45A 5ALZA 4JI8B 1Y6ZA 1YZVA 3GEPA 4S35A 4KQWA 3EVDA 4MAFA 4XH9B 3G68A 3U5ZB 3K1AA 3H5WA 1U0JA 2NACA 3DE3X 2FEPA 4BMDA 1DBQA 5I4IA 1XK6A 1QHYA 2XV1A 1RFGE 4FMDF 5ALPA 4ROTA 3WLSA 5BPFA 5HZMA 2K7FA 1QK3A 2QB5A 2QGZA 2QMOA 4ZVMA 2FPWA 1FUIA 4ALJA 4DPMA 4CTMA 4LK3A 2BGKA 2UYYA 4YC7A 1RRFA 3DA8A 4HAUA 3UMRA 3WK4A 1A9QA 1SC1A 3DMTA 1AO0A 2I8AA 1Y9EA 4OJQA 1WMSA 2WD9A 5E9JA 4N7JA 4G0XA 1V1MB 1ZMRA 2P9YA 5CDTA 2XB9A 4IKPA 4J16C 2QUIA 4EP1A 1U1IA 1TU0A 3B13B 2E21A 4KO1S 1XZMA 3JQGB 3ML1A 3LQQA 4NOJA 5K1ZA 2XNDD 2QAIA 4KCGA 5KEIA 1WB4A 1BSVA 4D4LA 1E2MA 1UMDB 4UU7A 5EIEA 4MDEA 5FOVA 3USES 2PX6A 1CR1A 4WADA 2EQBA 3N0XA 5I47A 4OK5A 1JSZA 2PL3A 1QBKC 4YT5A 2G9QA 4BKQA 1LK7A 3KOZA 1P0FA 2WIKA 3OIVA 2JGDB 4Y7DA 3SZMA 1Y1QA 2JGJA 2WJ6A 3ILXA 3LE8A 1C2TA 1IU9A 2O3QA 3THXA 1Q7TA 1XI2A 5KZMB 3GLIE 4L7VA 1GHTA 3DOCA 1WLSA 1Y34E 2WHPB 5JPDA 2JCSA 4FC6A 4ZQFA 4YP1A 1WZIA 1JH9A 2X0JA 5T6MA 5A3JA 2YUTA 2ENUA 2H7VA 1Z47A 1H5UA 1ZSYA 4ED9A 2DMRA 2DC1A 2ZBQA 4PXSA 5FI3A 1L5HB 3RUEA 1GQ2A 3IHKA 3ZOKA 2PE5A 5TS2A 2WWWA 5I4BA 3HEMA 3T7IA 3WNBA 1TUBA 3SM9A 1UBNA 2A5FA 2XZDA 4BTEA 4YJ3F 4E0BA 3ANSA 4F6LA 3G9UA 5JAHA 2AG1A 3SXUA 3RYCA 5KU7A 1WUYA 2H1HA 1NXVA 1C3VA 1YDFA 2EWVA 4YQEA 3TZLA 1CRPA 3IEXA 1G2IA 2HPZA 2X1VA 4LDZA 4CN9A 2ZZMA 4QYXA 4QSHA 1LBHA 1NUSA 1D2MA 2Z3VA 1IE3A 1L8OA 4H3HB 4GZ5A 4BQNA 1UZNA 3E05A 3TNJA 3VO1A 2CWDA 5JXGA 3JSXA 4YRNA 1G4AE 4NJMB 4GP9A 2WE7A 3FVTA 2OZPA 2PLAA 4ZU6X 1YZNA 3MMNA 5LZ7A 1CE8B 3H2GA 4QSMA 2TSYB 5BR1A 1TJ3A 2FFHA 1NKSA 1PL8A 1JVSA 1E5DA 4QFMA 3MF4A 2QD4A 2IXDA 5H4GA 1VJ1A 1CRZA 3HBAA 2FOXA 1W8IA 1ZFNA 2CCJA 1E8MA 2OGTA 2XR1A 3QIVA 4NZYA 4PAWA 5CHYA 3RGWS 3ZW7A 1O97C 1SHTX 1XU7A 4BFSA 4B5KA 4D8XA 1KSHA 2PBRA 1OFVA 3MWFA 5ARCA 3T1HB 3PA8A 2PGNA 3P9IA 2H7YA 4G4JA 1ICIA 5EZ6B 3RUFA 3TFOA 1EFLA 2Z98A 4RHXA 4LXIA 4QLOA 3RRJA 1EJ6A 3ZXXA 1S2IA 1VFPA 2WPNA 3IAM6 3HB9A 5K3BA 4EMSA 4KLCA 1VL0A 1EGAA 3U7QB 3K53A 3ZGNA 4AXBA 3GQVA 8OHMA 3ZDDA 3O75A 2ZBUA 4F45A 4GKKB 2JAUA 2X5JO 2I1VB 1I6LA 3L7YA 5HXAA 3HCBA 2PBZA 3FTCA 1L9XA 2YZKA 4LY3A 3EGWA 1Q5PA 4WEQA 2D0PB 4CIYA 3VMMA 4FW8A 4G0YA 1YCDA 5IDVA 3ZE7A 2G4CA 4BVFA 1M3SA 1XZFA 6NULA 2XGMA 5TQ0B 3SJBA 1TRKA 4P54A 4V3BA 3AERB 4WGGA 2FFRA 1JU3A 5J2UF 1PL6A 2E4XA 3L0YA 5CITA 1ZR4A 1TFRA 2OEPA 4CHTA 2Q4OA 2X9GA 1IYZA 3CPSA 1GUZA 3MQ4A 2DPYA 2B8TA 3AQ4A 2HJGA 3IR5A 5FHQA 2E48A 5HZKA 1QGZA 1E2UA 2Z6AA 3T1TA 1ZCBA 5DGHA 1KO7A 4BFTA 1JQBA 5IDXA 4R3WA 3DLTA 2BFCA 4TS9A 2PU7A 4XM2A 3B51X 3CLHA 1W0JD 3A31A 1D9ZA 3AR9A 1JBKA 5AOBA 3FDZA 4D8VA 4R05A 2V6FA 1Z4OA 4DIUA 3HCRA 2O5EA 3WYCA 3RYFA 1Z83A 2HCJB 2ZB4A 3CW2A 1JA1A 4Z3DA 1DQSA 1ABFA 1M5UA 4TZKA 4A2QA 1UOPA 1SIBE 3NTXA 5AW6A 2JIDA 3CGGA 1EK6A 3G0BA 3BIWA 4M37A 4LNUB 3I4CA 1EVEA 3EMKA 3CRRA 1WPQA 2R6AA 1C7QA 5KWJA 3DMGA 4YP7A 1QQBA 1MRSA 4QG3A 2ZI5A 4IOKA 4NDAA 5EG5A 4PXYA 5JR3A 2RHHA 4KXNA 4IIJB 4FZRA 4RX1A 3GNSA 3I9LA 3S27A 1FU4A 1ZG3A 2YWCA 3IC5A 3U5TA 1SULA 1GCOA 4FE7A 4BV8A 1KMQA 1U0FA 1XMSA 1ZC4A 5BO5A 2ZM5A 2FPRA 3EX7C 3NT2A 4Y2HA 1TT7A 1E89A 1QHHB 3UJ6A 4LTDA 2NUAA 1FNCA 3QP9A 5KBYA 1AG9A 1NQ5A 4FILA 3PJGA 3PLAE 1UFKA 4TTPA 4YK7A 2V1XA 3UATA 1VCHA 3R7WA 2VQEB 3HKEA 2VK8A 1UC5B 4Z1MA 3A8TA 4DHWA 3SJCA 1HKHA 4WX2B 1LTQA 4C07A 1T0HB 1GADO 5JZOA 2YRFA 4KRGA 3ZEAA 4LJLA 3PQ8A 1V41E 4RDHA 3UB3A 4Y0AA 2VPXA 3WDKA 4RZIA 1K66A 3I23A 3OF3A 1V5IA 3MD0A 1OWLA 2AQHA 4F2PA 4P31A 1TB4A 3BIFA 5HUHA 3D2CA 2AYZA 5EA2A 2UAGA 5BOSA 4EKYA 4QNNA 3CVOA 2P1DA 1NXOA 5HRCA 4I36A 3I8XA 5GGXA 2SNIE 4UMEA 4WKGA 3V6MA 3RJMA 3WBBA 3BORA 5FOQA 1L5OA 2JBHA 4ZQBA 2H51A 2FPUA 4EAQA 2QY6A 4BFYA 3H18A 3MYYA 4YUVA 4ZT6A 2PT9A 4C6TB 3KLMX 4Q05A 3HUFA 1QQAA 4L28A 4YQYA 1RJGA 2ZJ7A 4NJEA 5EJ5A 1XJ5A 1QX4A 4JI3B 3RJ5A 2WLTA 4PONA 2A1IA 4EGQA 4XWGA 1I3OA 5EKUA 1N6LA 4WKNA 4B3MB 4UEWA 1G5QA 3KR2A 5E1DA 1AGYA 3B53X 5ALGA 4U0JA 1C0IA 1MJGA 1SHUX 1X6VA 2ATCA 3P8ZA 1JLHA 2PRIA 4KQHA 1P3JA 1QK4A 4QTTB 4RPKA 2CL6X 5AKGA 3B85A 3BWYA 3L6OO 4DFDA 4ENTA 5C35A 1XTTA 1D5CA 3EGDB 3PK0A 4D42A 1RXWA 1K08A 4H6XA 1EX1A 3IHLA 2XUFA 5D8DA 1QFSA 3L1VA 1IN1A 3R4VA 1DFGA 1QMPA 3QENA 1ISRA 1Z4NA 3MAAC 5IVHA 4PLVA 1TEHA 2A2ZA 5U4QA 2CLOB 3CVJA 1K1EA 1NSFA 1YB2A 4IZOA 1D9XA 4MB6A 3REQB 1EXMA 3AUXA 1AQUA 4MUNA 1MB2A 4CV3A 5T8KA 3Q11A 5JPCA 1Q14A 4N3NA 4Y2QA 2G88A 2PL5A 3ENWA 4JGBA 1KTIA 4F8YA 1R5BA 2EOAA 2XHEA 1EUYA 4XFDA 5L7YA 4XIFA 3MGKA 1I3MA 4MS3B 4MLDA 2ZR7A 5KNLA 3AF0A 3O93A 1U0OC 1SEVA 1NYLA 1QO7A 1W49A 4EDHA 2QMUA 3IUYA 1LTHR 3QITA 5J2TB 2VP3A 4YAUA 1OHHA 2CJPA 3KFLA 4ZCSA 4M55A 5B7QA 2O2EA 3H8SA 1NF2A 5EUQB 3U1TA 2HK9A 3W0LB 5FPTA 3OKFA 3SG0A 5ALLA 3W7VA 4XRGA 1M83A 4UTOA 2C1XA 1W7AA 3DR3A 2ZLBA 4LZAA 2KS6A 4EX6A 2XSZD 2FX5A 4LGCA 2HW8A 4HDKA 5B2EA 3PWZA 2NYRA 5K51A 4KG7A 4PG5A 5DHAA 4E30A 1WA5A 2O3TA 4NJMA 2WNSA 1W73A 4BLPA 2F55A 4ZYUA 4ZCQA 3TIGA 5EPEA 2R44A 3SIWA 5JI3E 2X22A 1ESNA 3AYXB 1CQIA 1OXMA 1P45A 2PZ8A 3C6KA 3OY2A 3KPYA 4H7IA 1MVNA 3P45A 1SU6A 4XX1A 1E0SA 3HUDA 5DSZA 2D06A 1CY6A 1ISFA 3VH2A 3IPAA 4EENA 4F8EA 4YRAA 2GJAA 3V32A 4BP9A 3ECAA 1QZXA 1V96A 3LHFA 3T1QA 4AJJA 1XA4A 1KS2A 1GNLA 3TW8A 2ZSFA 4AMBA 5BWMA 5CVJA 2J0VA 4N3BA 4WXYB 1Y7IA 1JW9B 2VWHA 1NE7A 2OFOA 2XB6A 3AUUA 2NUBA 3F2IA 1FE8A 4EFKA 1SM4A 2WILA 1I2AA 4IG4A 3RVOA 1RJ9A 1B1CA 1CUBA 4YJHA 1FFAA 1P2DA 4XWKA 2XWSA 3GGPA 4ENWA 2ZU6A 3CBQA 3KQMA 5DZSA 3WNCA 4C4YA 4HVTA 3R75A 3N2IA 4F4HA 1XXHE 2E49A 2O54A 2QTWB 1VPVA 1P6XA 3CUEF 2H00A 3DZFA 4EYGA 4W5QA 4M88A 2IH2A 4KFUA 4YRSA 5HZGA 1E6CA 5TQ0A 2GNAA 3KJFA 4YWJA 2Y1WA 4U7WA 1VLVA 1Y5IA 3I42A 2QXTA 1LV7A 5EMLA 3B5IA 1EVYA 1YA8A 3L5KA 3OSZA 1XZGA 4V02A 5AOVA 3GJRA 1GPMA 5IAAA 4FJ0A 5IX8A 3AF6A 3ZIDA 5LNK6 1NOIA 4K6CA 2QZPA 4J4TA 1ZGJA 3TW0A 2QRVB 2W6JD 2W42A 5ENVA 1D6NA 1RLJA 2C88A 1LF5A 3UB2A 3ZE8A 1X7WA 4BDTA 2Q0QA 5KINB 4U5XA 3HY4A 3SFVA 3QYFA 2AR7A 3HGTA 4L8LA 4F56A 4GOXA 1JVBA 2HYDA 2P41A 2LWIA 5KI6A 3BREA 1KYZA 3VGJA 1R50A 4PPGA 2ZPTX 5DYYA 4P4TA 1F4PA 4MKXA 2QMYA 4YLGA 3NDIA 2R9VA 3H5VA 1OF1A 3W05A 1GCGA 3RVNA 4TVSA 4EFDA 5B55A 1HNZB 3TDMA 2LCFA 4ZAXA 1L7DA 1XZKA 2DH6A 4L5IA 1TEVA 1P2FA 3ZXIA 3IP3A 2WT9A 3PDIB 4DN6A 3D8BA 1VB3A 1Q6ZA 2BZSA 2F17A 5LKAA 3DAFA 1G5PA 1MAUA 1R15A 2QN3A 4UPDA 3LRXA 3ZDYB 2OUIA 1Y48E 1CLEA 3N5KA 5EWJA 3SR3A 4F5DA 5B58C 3C1UA 3GHYA 4KMRA 4YVFA 4HXYA 3UCFA 1JG6A 1H0SA 1N57A 1E2FA 1CR6A 1T0PA 1Y3BE 2JARA 2NPOA 2ORIA 3B3GA 3JWHA 2DPGA 3QA9A 4QOEA 3VZRA 5JHHB 4CT0A 2HLDD 4A5OA 2BR3A 1JLKA 1KDRA 4HGZA 1GG5A 1Q6YA 4Q3BA 1ZGGA 3OUTA 4AW9A 1D04A 2I7VA 4P35A 5F3DA 5PGMA 2FMFA 3B38A 2OBMA 2ZW9A 1AZTA 1JRLA 4XCVA 4JWTA 4DLBA 1TAUA 4ETNA 1IBMB 5JU6A 2CEAA 1CR4A 2B5OA 2YX1A 4W6ZA 5JTTA 1G5RA 4YAOA 3WGZA 4RULA 2X7HA 3NM6B 1SCJA 3R23A 4MCHA 2A1TS 3L6DA 4HHEA 3VDQA 4KFCA 2JLUA 3QF4A 2EJCA 3DV0A 2QQEA 5DM0A 5JAZA 1ORDA 2BN4A 3QVLA 3SFZA 1RIFA 2ZTLA 3PC7A 3QU5A 3KB8A 4FR5A 4B6OA 1TJYA 2YVUA 4R3NA 1QRTA 3VO9A 1DWPA 2LBPA 3H17A 4QHTA 4Q9JA 1IB6A 4NV3A 4PTZA 4X1KB 3ICVA 4PIMA 1C9JA 3MMZA 1U9IC 1H6BA 4YYZA 4R16A 1BKDR 4FW9A 1GRQA 4MWOA 4I1PA 4M1ZA 1FK8A 4U2KA 3QEJA 2OGUA 4DDMA 4GE3A 1H2HA 5CBPA 5L40A 3MINA 1H2BA 3RANA 5B3KA 1U2EA 3OZVA 5EERA 2X1HA 1F8YA 3PRHA 5DWDA 3HJFA 1JIIA 1G8YA 4QQ8A 5GTDA 1GPH1 3KWJA 1S6YA 4AY3A 3IDSA 2Q0SA 4RS4A 1AU9A 1M1UA 2H2AA 3B1VA 2FUG1 2ZYGA 3VUFA 3INYA 2YYAA 1AX9A 3V8VA 4DZTA 2VPIA 3EWIA 1JKJB 2D0DA 1ZBQA 1AKVA 5EXDA 5IWCA 1R0KA 2EW2A 2FR0A 3TSCA 3WIOA 6YASA 2I2FA 2Z1NA 3PEFA 5G0WA 1O3YA 4G01B 4RETA 1GPKA 3ZDBA 4HAXA 1YV9A 4BN4A 4ND4A 2WSSA 4WFIA 1OFUA 2F64A 1MABA 4TT8A 1KPIA 2Y0CA 2H4YA 3HVHA 3NASA 3RWBA 3VTFA 4JJ6A 1HRDA 2X6QA 1RWKA 2D1RA 1SXHA 1YAHA 2H2WA 1CHNA 4J07A 2ZI4A 5B2FA 1P3Y1 2YS7A 1S2MA 3CH4B 1UMCB 1WXWA 2ZBDA 1YR9A 4FOSA 4E3ZA 3D5TA 4KXUA 3SS8A 5D5QA 1FTWA 2HF2A 2PL9A 5DNYB 1ZD4A 3BTVA 4JN6B 4BPRA 4GR5A 3LPDA 3GJYA 2PGJA 5I51A 3MFYA 1GTG1 1V6CA 3A9UA 1A5SB 2FK7A 3E22B 3T4XA 4FJ2A 4BNTA 3BD9A 1MVOA 1PK9A 3JR7A 4TVOA 4UEKA 2WSYB 4FFMA 2C3OA 2IPNA 2QAJA 3AGQA 4I99A 1UK7A 2C61A 2ERXA 4WY2A 5HIAA 1W5TA 3N05A 3AJEA 1B42A 3MBIA 1V7CA 4DNOA 3LWZA 3PUIA 4KRXA 3A1NA 1QS0A 4PPYA 3F3KA 2HRCA 1ZK2A 1HBJA 1JN0A 3VR2A 3GJZA 2VNIA 1ZUIA 1EP9A 1J6UA 1P7WA 1P39A 2NTEA 5FAXA 4C0HA 1M8GA 2CZCA 1TVKB 1DARA 3PDUA 4L15A 5K8TA 2VHJA 1FSGA 1RQLA 1JU4A 3U3MA 3MAGA 2WJJA 1DE0A 3WYNA 4AN1A 4QPNA 2AG0A 2IPMA 4HN4B 2WD8A 2Q9UA 4L5CA 4RF4A 1LB1B 1NTRA 3VNSA 4H7DA 2YDXA 3W2IA 3K1ZA 4YAKA 3G5UA 1QNLA 1QP8A 4AT1A 2E18A 2OCKA 1YL7A 5HILA 2W11A 2X58A 3T12A 2GT1A 2YOFA 3OU6A 4DC9A 3B12A 3H9GA 2XH8A 1PFYA 1PZHA 2XAUA 3AR8A 4K46A 3CKLA 5DGIA 1HLDA 5ALYA 4BWFB 4Z6KA 3CLSD 5KNCD 4WZ6A 1WB5A 3GEHA 5B64A 1G8FA 2BGRA 3AF2A 4FGLA 4P08A 1QV7A 2YV2A 3G7NA 1NQOA 4WKPA 4EHAA 5DGDA 3IQEA 4MCIA 3L8CA 2OLJA 4N8SA 2BMEA 4BV2A 3A6EA 2W48A 5KYYB 2XRYA 3G3EA 3LC1O 3HLTA 1OW3B 2WJAA 2CXPA 3NHRA 1GFIA 1XWIA 3RW9A 4AF8A 2B0JA 3MGBA 1G18A 1A4UA 2JLBA 3RUPA 4QKQA 1OWOA 4UEOA 3UMCA 1ZJ4A 3KZVA 1NU8A 1O95D 4OXKA 1DELA 3BIJA 4WV3A 1MORA 5JATA 1U2DA 1YRLA 4NECA 5ITWA 4LSWA 4CTJA 4NYIQ 3F4BA 3LCRA 3HVRA 2OYCA 2VKQA 1TKCA 3QFRA 4JC4A 3NHUA 4MMYB 3WZMA 2BKAA 5I8PA 3D7RA 1NVTA 3DMYA 2XQFA 1DDIA 1XZCA 4Y6PA 2IZ1A 1I7QB 3R9WA 5JXHA 1KQ3A 4D8TA 5KSPA 5IF9A 1T1SA 5HKLA 2R1VB 3EZ2A 3FI9A 1H22A 4W9NC 5C2JB 3AVWA 4PZPA 2Y0PA 1XLVA 2GESA 1IOZA 4GOND 4Q12A 3AY6A 1UC4B 3UK0A 1X7WB 2YNMC 5F7ZA 3WG9A 4DV3B 5AHOA 1AKNA 3GZNB 2GEKA 3CPHA 4ONEA 4U2BA 3CU5A 1I7LA 4CIWA 2C1ZA 1W2HA 1SWVA 4JWKA 4MV3A 1EUCA 1BGXT 2G1AA 1C4WA 5HBRA 1IL0A 4A15A 1M2GA 1WXQA 1FLAA 4R40A 3WX0A 1L5QA 4B4OA 2AOWA 1H0KA 3CLRC 1IUKA 1DC3A 3BUSA 1PEYA 4NZ9A 5G1NA 3UOAB 1T1JA 3UT6A 4YPVA 1NONA 2F9MA 2OD9A 5BN5B 1QF6A 2QLJA 4BBAA 1C50A 2FSHA 2FQWA 2IDZA 3DE5X 3I64A 1UWCA 4WA7A 5ALOA 1XVTA 1LJUA 3D3WB 4EKEA 3HVKA 4WI1A 3WWCA 3L92A 1KI6B 1NW4A 2IHBA 4H7EA 1T8WA 4O4HB 1L5SA 1RMYA 3QKRB 1PTJA 2YY7A 1Z0FA 3ZU6A 3OZCA 5DGXA 5JOQA 1GARA 4U1RA 3EQ7A 2D3WA 3OCVA 3VDXA 5KQGA 3NEYA 1MAWA 1J5XA 3E2MA 2H0QA 2F1IA 4TKZA 5BT9A 4EHIA 4KYVA 1P2BA 4RGVA 4DYVA 1VP9A 7MDHA 1O58A 1XZQA 3B89A 5IAOA 2Q5JA 1Y8RA 2Z83A 4WXRA 2PAAA 2YVKA 3ER6A 4W4TA 1NBMA 2JCVA 2EKQA 3K9CA 3BXGA 2VT6A 5EVJA 3Q85A 5F7JA 4W5RA 2O8FA 5IBCA 1FQJA 1Y9JA 2HA4A 4UVGA 3AW9A 4EMBA 2J7PA 4QQNA 3BCHA 2IYFA 1X7ZB 3EZXA 3C8UA 2YXBA 3LX8A 4Z3OA 4LF7B 1XAGA 1LNZA 1CJUC 4L8GA 5EFOA 3UJDA 2W6ZA 5HCNA 3DCNA 3E2PA 2VSYA 5JMPA 4X1KA 1YR1A 1G38A 5D1NA 3FTFA 4UUNA 2XNKA 4RJLA 4AK9A 5C8YB 4M1EA 4G9GA 3LC7O 3M1YA 4BBZA 3AFOA 4MRMB 5K0EA 2W4MA 3B60A 2Q4RA 2BEJA 1QB8A 5DO9A 2GN9A 4NCHA 3WLKX 2XXBA 1JP7A 4BGIA 3T3IA 3E9EA 1GLVA 4RGYA 5JQGF 1K3UB 3L1UA 1KP9A 4TVKA 4B73A 4EGCB 4KVZA 4AJLA 4RTSA 1Y82A 3NWJA 4WUTA 1VE5A 1UMKA 3WKDA 3ZCTA 5T67A 2UU9B 3SJUA 2R96A 3NM5A 5AM0A 5SICE 4ALLA 3TLAA 1THMA 1EEHA 2NO7A 4B3FX 4NZMA 1BIFA 3FTQA 5DNCA 4LBZA 2PUHA 3O7WA 1H9BA 3HV0A 3FF4A 3FB1A 2E5WA 3EXEA 3UKOA 4ZAYA 4Z9YA 5FPSA 1KI2A 4QDTA 3REGA 3SYRA 4US2R 2XOKD 1Y8CA 5AXDA 5LOVF 3FH0A 1V71A 4DOMA 3SR0A 4DYDA 3QZUA 4FX5A 2BFEB 2TMGA 1OXBB 3FSJX 3MC1A 1MFZA 4WCDA 2QBYA 2XADA 1H3EA 1NNI1 2YJTD 4G24A 4JXXA 2YY5A 4I9NA 3U9LA 3OOEA 1BMQA 2YV3A 3KHUA 3U81A 4AJEA 4EABA 3A36A 2V0CA 1RLUA 2O9JA 3HVIA 3JYPA 4K6FA 4OMUA 3G8CA 1JILA 4TLEA 5SZHB 4GL2A 3H5RA 5B4VA 4LWOA 3VPFA 4ZDJA 1K8QA 3PPIA 1VYTA 3GLKA 3WIBA 4A6PA 4C7BA 1CVIA 2PVCA 2X4IA 1BXRA 4N3GA 2HGZA 2RJNA 1B6RA 4FP9A 4PICA 3VC7A 1XDDA 1DS6A 3ZU2A 4DDUA 1QIMA 3OZBA 2JFZA 3QXCA 3HXMA 4AZ0B 2WFMA 2I4LA 2HLPA 5A9TA 4XDGA 3OPQA 2OBNA 4RELA 2J32A 5GONB 3QK7A 5I4CA 3E8MA 2XA9A 2NGRA 4KE6A 9LDTA 4NXMB 4PZLA 2MMCA 2R7AA 4KPYA 3ZCSA 1IN6A 2DQ4A 3VTZA 1HDRA 1T5TA 3AHEA 3ITEA 2JJYA 1CUGA 2XPCA 1SPXA 1JJIA 3ZHTA 1VYVA 1E2LA 1MC8A 2XE8A 1UC8A 3ENQA 3F96A 1J0XO 1CUXA 1GUAA 4C0LA 1C7ZA 3HDVA 3ZI0A 1CB7A 3P0IA 3F67A 3HJTA 5BRJA 2BHNA 5TY0A 3T1YB 1Z8FA 1F06A 4C5BA 5I7SA 3BFJA 2BTEA 2HFKA 4L3OA 1CW2B 1QZZA 4XGNA 3WGYA 1CKEA 2G72A 4WL0A 5A5DA 4QM7A 2C58A 2Q3BA 3FN4A 4C4ZA 3EXG2 1I5OA 2ZSAA 1N6HA 2FPKA 1T2DA 4L50A 1KK0A 1WZUA 5DN6A 2WJYA 1IPHA 1EVIA 2O0HA 3M70A 4CU5A 2UXCB 2WKQA 4LXHA 2I76A 2V7BA 3V1NA 5KYWB 5A3VA 3OD5A 3NJRA 1PQPA 4CMKA 1XAJA 4UAJA 1DU4A 1XKXA 3G0GA 4UTPA 4LISA 4RHFA 5FA5A 1O6FA 1KJ8A 2KMLA 3K9WA 3W5BA 2CNLA 3ZHOA 2UVDA 2ZITA 4OHMA 4XUEA 1P74A 2X2FA 2YQ5A 3UWPA 2WJHA 1E5LA 2Y1DA 1KXJA 3NONA 1PKXA 1H8EA 3E5MA 1A9XA 3VC2A 4FK8A 4CL8A 3L4BA 3VJLA 1D2EA 1YZ3A 5AJTA 2EKZA 2VI5A 5C52B 4WJLA 1WMEA 2FG6C 4ZVKA 2FPIA 5EHZA 3D8RA 4D02A 2I7XA 1NVEA 3E1SA 4RD1A 1U8UA 3L4BC 5AVXA 5CG1A 3NGLA 3EXIA 4URHA 2NTVA 4K8RB 1Z4IA 5EL0A 2PH3A 4ZDIA 4LMBA 1CEYA 1JQLB 2RKWA 1RYFA 1ODTC 4J6EA 5GADl 1IHUA 5DN6D 2R8PA 1A27A 3N6RA 1O8CA 1CVRA 1Z2CA 4I50F 4M8IA 3CW9A 2X3FA 3CF4G 4UHKA 3S55A 3SCZA 5M29A 5A7HA 3IP5A 1KMNA 1X7YA 2FUEA 5F7XA 1V7ZA 4LHEA 3GYBA 3JATA 5HJEA 3UW3A 4MDYA 1FMFA 2A3RA 3GZNA 1CUJA 3MS7A 1WQ1R 5L3QB 4JT2A 2MU1A 3KKKA 3KKZA 4KI0A 1PV4A 3DV9A 2FWBA 5LMNB 1EUCB 1U3GA 1N8NA 1RQPA 3OT5A 4RK6A 4ARZB 1ZOSA 4DM7A 4H9GA 5K3EA 1T36A 1F2UB 3O3CA 1TF2A 1MRZA 1M6HA 3KOWA 1DQRA 3O7MA 2AE2A 4M4SA 1X86B 4DR5B 1JDSA 2QN9A 3DZDA 2QWXA 4RAOA 3D3WA 2GA8A 1Y3IA 3KOXA 4O4IF 4BO4A 4DJJA 2WR8A 4F1JA 1CJCA 3TVYA 2D2FA 4GMHA 3OESA 5IC5A 1YZFA 1G7TA 4PSAA 4YDQA 4LTMA 5IP5A 2EKDA 1JQDA 1JHOA 2OP1A 4OBWA 2C54A 4EHBA 1ZK1A 4C0WA 1DJLA 4CKCB 1E0DA 1KR2A 2JHGA 1IOWA 3TQHA 1T2AA 3GFTA 4B0OA 4DJTA 1RADA 3PP8A 2OA0A 2RK4A 3M6XA 3Q4GA 5KHLB 2EJBA 4EY7A 5I9MA 2IHVA 3LC0A 1EFCA 1HLGA 4MUKA 1BXKA 3QKWA 3QWHA 5HTKA 4BX3A 2IEAA 1IOLA 3P97A 5EPOA 3LPNA 3HKBB 3JD4A 3HGQA 4MVJI 4B6RA 1W59A 1FJXA 5KTPA 1MB0A 3GNLA 1LWOA 2JI9A 1VMAA 2H59A 3RUDA 1LPPA 4C3UA 3DD1A 4GP7A 3FNEA 5EJ2A 3STXA 3VR4D 3WB9A 2DXIA 4J1SA 1G2OA 4NYIR 1XTKA 2WSBA 4C29A 1YTUA 2F3QA 3PX3A 4KE7A 2JGEA 3N9IA 3WAGA 3UGQA 2AMLA 2FPLA 2Z3WA 1DEXA 4CYMA 3IJPA 1FP4A 1DWOA 1RXSA 3IHTA 1JIVA 3FPBA 1QTNA 2Q8NA 1L3IA 1SQGA 2WRZA 4MRMA 1A9OA 3HB0A 1V7PC 4PINA 1D2CA 1KZ1A 2BELA 3KFVA 1J42A 1NIPA 3CUSA 1ZH4A 3C41J 5DOVA 4XUDA 3VH3A 1B2LA 3Q2IA 4O4IB 4WDRA 2NO5A 5FX2A 1V8BA 2J46A 2VTKA 4TZ0A 5IBQA 3AFNA 1EK5A 2AFIE 3C98A 1CJSA 1FB5A 1XLWA 2L69A 3K1TA 4HNQA 4LXGA 4NG5A 4LOHA 5KNDD 3HP4A 1EM6A 4ZT3A 3FW1A 4EZIA 4JJ4A 1Z2EA 5K0GA 4GI5A 2MIIA 2GFQA 5CA1A 2FSSA 1E9BA 1IY9A 4KIJA 4YP5A 1LSOA 3DT6A 4GG1A 4ZGWA 3AVUA 5IMBA 1SOAA 1TGVA 2WV7A 3ZWXA 3ZNOA 1VHTA 2EATA 1ZQ1A 3O4FA 1SJ9A 4Q4AB 4WH0A 5CYOA 5A9RA 5KOIA 2O2HA 4UAVA 1MIOB 3V1KA 3CF6R 2Z9BA 1T2CA 2AF4C 3DB2A 1EBUA 3JAKB 3TLKA 2HUPA 1Z29A 1R0WA 2ZGVA 1N3YA 1N9ZA 2GBLC 2GKOA 3GQBB 4ITUA 1VPWA 4CCAA 1C4XA 4D57A 4G09A 4TTJA 4TT3D 3CKYA 3Q5DA 4N5IX 1ZKDA 2PX4A 3C5EA 5A5GA 1ICEA 1YL5A 4F11A 2TMYA 2OFXA 3OQIB 3DJYA 4Q37A 3WK6A 2VAWA 3AEUB 3A2MA 3C74A 3IPYA 4B8YA 3BHIA 1IJKA 1E1KA 4RNCA 3A2NA 4NULA 3C6XA 1RYYA 2PL1A 4RCYA 1Z63A 1Q3KA 2GN6A 2YCLA 3B1FA 3DDZX 3LLMA 4PSKA 1Q1EA 2HM7A 3K9FC 3H1AA 3I58A 2DBRA 4BJ5A 2AK2A 1SR8A 1Z45A 2K5UA 3OP4A 3HYTA 4LC9A 2JFGA 1P91A 4GOLD 1PYGA 1OXVA 4MW2A 5LQRA 3ZOZA 3BK1A 3HPRA 2YMMA 4QGSA 1V8DA 3DW3X 3LDGA 1KP3A 1SQ6A 2ATVA 3FZEA 4H77A 4MQ6A 3S1LA 1XB2A 2GQ0A 1W1IA 3B1YA 3JAWA 1G20A 4OG2A 1IY0A 5JEEA 1TCCA 4MI3A 4M9RA 1QP4A 2C4KA 3FWKA 4X8MA 2HYIC 4JUIA 1BEEA 3ZY3A 2ANCA 4LSMA 3GJTA 3PC2A 4L9WA 1D1QA 2FPSA 3KD3A 3QOYA 5F3WB 4R84A 3R7AA 5LOVA 3ZLBA 5A4MS 3K5PA 5E2BA 1YB6A 3C3YA 3O4VA 5EI5A 2ZBFA 2X5OA 2P9HA 3ZE0B 4ZKDA 4KHPB 4Y67A 5U9CA 3C87A 4Q4JA 4PRYA 4MW0A 3V8PA 1NNSA 1NXQA 4X7BA 3T61A 3U26A 4EELA 3HWWA 3ZE9A 2V8BA 4M1QA 1E1CA 2JPDA 3ZLUA 3ZV7A 3M2PA 3ETDA 4CBVA 4RTMA 3COWA 2YH2A 4DTIA 1XQWA 3L5OA 3NCTA 4EFMA 5CVTA 3RUAA 4LI0A 3WWDA 3DGEC 3IB6A 3LVBA 5F9FA 5FLYA 1C80A 1MDBA 1WSWA 3NEJA 2Q7OE 3H8WA 3SVLA 3SGLA 2FN7A 1YFJA 1S01A 4Q3AA 1T6XA 4CLHA 3IAEA 4MGIR 4DV0B 2I1WA 2VH1A 3I9V6 1MOQA 3LL7A 1G5FA 2ACWA 3Q0EA 1OXXK 1SBIA 5ILQA 2QE7D 5I3CA 2PZFA 3O5AA 3IUEA 1YVUA 2XQVA 3JQFC 3PL5A 1YJ8A 1W9HA 2Z5FA 1J8MF 3H4VA 2IHUA 3O8LA 3SICE 4P3YA 4CE6A 4B6EA 3U6BA 2ZS7A 2IXEA 2DBQA 4G1VA 4X24A 4DQUA 3R7BA 3OWHA 2JDIA 1FFXB 3V34A 1MA0A 4P0PB 1W8DA 3WVNA 5HKAA 1A72A 4YJ2A 3BK2A 3IOBA 1P6UA 4J7AA 3JARA 3AZPA 4KO2S 5IN4A 2P6RA 2ZKIA 3K9QO 4RXMA 1XC7A 4YRGA 5K6AC 3ASUA 1P5FA 1NN5A 2WYVA 3DHWC 4CM9D 1GGJA 2ZYTX 1X7YB 3PUKA 4HQLA 3OLVA 2QTBA 3J7TA 1ZEMA 3VR6A 1X1SA 2H1RA 2NU7B 4XGIA 4AIIA 3DAYA 3I32A 2J45A 4HC4A 4KDCA 5SYNA 3KZXA 3OHSX 1E96A 4I8IA 4WOPA 3R8CA 3COVA 2EL9A 3EAGA 4J43A 5LQAA 5L53A 3EOAI 4A0SA 3MCZA 3I53A 4EF6A 3RJ9A 4WCFB 4RKRA 3DBLA 4K86A 5EJGA 1RM0A 1T36B 4UU1A 2XRZA 1TU4A 1YD7A 3VOTA 2QN1A 4HYYA 4BVGA 3U31A 2Q3HA 4OD0A 5DK4A 1T9HA 3DWGA 4GZMA 3V00A 4BB5A 3J80A 4V0MA 5FBHA 2QT0A 1IY1A 2XA2A 2AG6A 1JEAA 1LPBB 3FKSD 3ETLA 4GVPA 1RCFA 4UQLA 1VI5A 3TTWA 1CIJA 1BS1A 1XVUA 2I6TA 1QH8A 3DMDA 4HADA 1HYEA 3M8KA 1CWUA 2P3LA 3QV1A 1I4OA 3ER8A 4ENPA 2IYWA 4E51A 3IQGX 2YXNA 2AZDA 4PNZA 3CKMA 4CKCA 2FJUA 2ZUUA 1QRSA 4K0RA 4QT0A 3OZXA 4JLSA 1LBSA 4URZR 1TJ4A 3FCUB 3TTTA 1OROA 2NNWB 3LGSA 2GPTA 3L9WA 1WHTB 3D54D 4ILEA 3AZQA 4PQGA 1OASA 5CNMA 2HV9A 2ZG6A 5AJWA 1Z5GA 2WYUA 3L1KA 1K5DA 3BK7A 2QR3A 3T7JA 5C7IO 2Q3JA 4I14A 4ZZIA 3SY8A 2J3DA 3G7UA 1ZL0A 3HKBA 4I9FA 4I4CA 5LP6B 1P2UA 3AHHA 2DFPA 3DEHA 3KKLA 2JAOA 4UNIA 3QYJA 4DMMA 2KM1A 3KPWA 4PWYA 3GT0A 3BRQA 1JX6A 3K0HA 4QJ3A 2FPPA 2IOFA 3ETJA 3OOSA 3SQNA 3EW9A 2WM8A 2YIJA 3X1JA 4LX0A 4C2BA 4EGSA 1HDYA 1SWWA 2ZR8A 1ZN8A 2N46A 3V55A 4JL5A 3IHWA 3TXAA 1N0IA 1VBMA 3W5HA 4RIGA 3L0DA 2P27A 1FP4B 3D6TB 4DILA 2FYTA 2JCGA 1WP4A 5L45A 5GAJA 1EWRA 1KDPA 2FOLA 1CJTC 4B3GA 4MR9B 2P40A 5CPFA 4E2XA 3EXFA 1S2GA 2XUDA 2UYGA 1EHYA 2XOXA 4I3GA 4UARA 5A3SA 5AW4A