4CLHA

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
267
structure length
252
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQKSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PTERIDINE REDUCTASE 1
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
total genus 92
structure length 252
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4clhA00
2I6TA 4A73A 3KM0A 4RPGA 1QYCA 2ZB8A 3T4XA 1I2BA 5EESA 1PL8A 4ALKA 4HV4A 1KY4A 1Q1NA 1PTJA 4BS9A 5TS3A 4YCAA 3RUDA 4NU6A 4XX0A 3U4CA 4CMIA 4H3VA 4A26A 5DP1A 2GASA 1LRJA 1P9LA 1GZ6A 1MB4A 4AJNA 2VYVA 3GLQA 4PZCA 2ZJ0A 4RCVA 4TRRA 5ILOA 6ADHA 2O3RA 2YQ5A 2YY7A 4A5OA 1E6UA 4J1SA 2YHUA 2WJPA 3GDOA 5ER6A 2XAAA 4EITA 2WE8A 1U1IA 2ZK7A 3KVOA 4KMSA 4QFDA 1UZMA 5DOZA 1H0KA 1DFIA 4HWKA 5TIIA 3IIEA 1DJNA 4Y6RA 3S2FA 4LMRA 1U3TA 1E7SA 5L7WA 3ETGA 1LQTA 1GTMA 1LSSA 2DM6A 3DBLB 3L4BA 3V2UA 4YJDA 2XOXA 3L77A 2I3AA 1XCBA 3AI1A 1LC0A 1KEPA 2O2YA 2PR2A 4E3ZA 4W4TA 3GVPA 2P2SA 1QV7A 2OZPA 3JV7A 3ZWBA 4PN3A 1WW8A 2WE7A 3PJFA 4B79A 4RJTA 1ZK2A 2QYSA 2VNAA 1N1EA 3W4IA 4YQZA 4Z6KA 1GYRA 2CD9A 3B20A 1EVIA 4R54A 1E5QA 3I9NA 3GDGA 1FK8A 3BXXA 1YS4A 2Q2WA 5JAIA 4BKOA 2NU8A 3PLRA 1UDCA 4NNJA 3QRWA 2ZTVA 3NTRA 1LDYA 3Q1LA 4KDFA 4M1QA 2HMVA 2CDBA 4IPTA 4D0SA 2O23A 2TMGA 1MX3A 1BRMA 3EW7A 5HTOA 3ADPA 4BNZA 1EUCA 1QXSA 2Z1MA 4JBGA 3X2FA 4Z3DA 2FPGA 3OA2A 2RAFA 3W8EA 3OIGA 5F21A 1PZGA 4BNFA 7ADHA 2Q1SA 3OQBA 1QYXA 3CINA 3QE3A 4RF3A 4BGEA 4CM9A 3IAHA 3VH4A 4IDBA 3DBLA 4Q3CA 1D4FA 4GX5A 3HB5X 3HE3A 2VTDA 1IY8A 1NVMB 5AQ1A 1MV8A 1GV0A 3NAQA 5H82A 1I0ZA 1YQDA 4EUFA 5DBGA 2DLDA 5H81A 2J5KA 4PLGA 1ZH8A 5IAAA 2EXXA 2FR0A 4II2A 4ZICA 1E3EA 2E49A 4LCEA 4B4UA 1C0KA 3CKYA 1NHGA 4Q9NA 3UCEA 4GQAA 5BQFA 4B7CA 3DXFA 5CEEA 2HMSA 4FJ2A 1XELA 4RQTA 4CMCA 1OMOA 3DBHB 3DL2A 3HG7A 2FOIA 3JQAD 4CV3A 4MVJI 1DC5A 1PJSA 3BIOA 4MINA 2HUNA 1Q0HA 1IB6A 2C0CA 4FR5A 4Z3KA 3G49A 3CZMA 4KWIA 3UN1A 1UP4A 2C2YA 2W90A 4XYEA 1CRWG 1XU7A 1MLDA 4B8ZA 1I36A 4JX8A 3PWSA 5U1PA 5A04A 4WPGA 3F4BA 5JW6A 1DDOA 3WGZA 3RKRA 4CM1A 1ZNQO 4F6CA 4M89A 1GQYA 1U2GA 1UP7A 2PZMA 5JDCC 1U7TA 1ENZA 2B5WA 2PD3A 2Z95A 4ZQHA 3ZWXA 4G81A 3PHIA 1JKFA 3KRTA 3UICA 1KS9A 1ZEJA 2GN9A 1DOHA 4BNUA 3WIEA 1X1EA 2I99A 1ISJA 2FRDA 3DBHA 1OC2A 4N7RA 2RIRA 2X0IA 4DBVO 1VKOA 4TROA 3DB2A 1HEUA 3ZU4A 4N5MA 4YRAA 1T2CA 3Q6IA 1R12A 3COSA 3JCZA 2YFQA 2H5LA 4XYBA 4O5OA 1LA2A 3D1LA 4FDAA 3R3JA 1HZJA 1F8FA 1P0CA 5TLSA 5CG2A 3GUCA 1E7WA 4KTTE 5ES3A 1NR1A 3CTMA 4ALLA 2W2KB 1QORA 3G0OA 3TRIA 2BKAA 1IYZA 1MA0A 5KKCA 4RPJA 3EVTA 4P22A 4ZD6A 1ZO8A 2ZYGA 4RGBA 4KUGA 4A7PA 2X9VA 4FBGA 4K26A 4NPCA 4A27A 2UUPA 3RC1A 5IDWA 4W6ZA 3U4DA 4Q3AA 5BNTA 3P2YA 4MP6A 4S1VA 2DFDA 4GKVA 4Y6SA 4MVJP 2J5QA 1BDBA 5BSGA 3I9KA 3JQDA 1MXHA 3WLEA 2VHXA 1E1LA 2C82A 5U9CA 3AUSA 4BO7A 4BNIA 4XZ3A 4E21A 5MGBA 3GHHA 1KBZA 2NLOA 3FHLA 3S2GA 5DCYA 5FWNA 1B0AA 3H9GA 4YEDA 1LDGA 1RPNA 3WR5A 2YQ4A 3UFXA 3E5MA 1JKIA 2P9GA 4B3IA 2X5OA 1J6UA 4O63O 1BHSA 5C5IA 1PR9A 1PGQA 1ZXLA 4AJEA 4J9VA 2G82A 2HU2A 3OJLA 4J90A 2A94A 1HLPA 4JGBA 2DT5A 2W2KA 1J0XO 2EHDA 2OUIA 2DQ4A 5CDSA 3ETDA 1I2ZA 4TVOA 3GGPA 1HDRA 1R37A 1X7DA 1BWSA 1YBAA 1IPEA 3ZW9A 5JNLA 4QEDA 1I10A 4JJGA 4EUHA 4E5YA 3IKTA 1EUDA 1HE2A 1KEUA 2H6EA 1SB9A 1HWYA 2GN6A 2XXJA 2ZYAA 1NPTO 4CLOB 4WLFA 2YJZA 2PV7A 3RAJA 2ZJ1A 4U5QA 3NJ8A 3F1LA 3WIDA 2JCVA 3ICCA 2Q1UA 3GMSA 2VYND 3GN1A 4NFSA 4W7IA 3V1UA 2O3SA 4YAGA 4PLZA 3C85A 4IQ0A 1GEEA 4L73A 3JD1A 3R0IA 4E6PA 3P2OA 3D0OA 4CMKA 3FTNA 3LLSA 2RHRA 1GAEO 3NGXA 5B1YA 2VHYA 4JLWA 2PTGA 1CEQA 2AMFA 3D5TA 2H63A 3IMFA 3FRJA 4LRSB 3W4JA 3LVFO 2FR8A 4YBZA 4TZKA 2BGKA 5DF1A 2BH9A 4BHTA 3SJ7A 3GGGA 2NACA 2V6FA 4CQMD 3WGHA 5IDYA 3EAGA 3VPXA 1PSDA 1YONA 5JY6A 4PG8A 2AQIA 3VZRA 3BMOB 5K6AA 3OP4A 4DPKA 1FMCA 1N92A 3ROQA 4E32A 1UR5A 3GVCA 4CLOA 4D3FA 3CEAA 5JY1A 3AY6A 1JU9A 4BKUA 1Q7CA 4FFLA 1H6BA 2HRZA 3Q9NA 1ZSNA 4IJKA 3ZN2A 4GVLA 1T2EA 3EGOA 3DONA 4R01A 4ND2A 1C14A 3TQHA 5IZ4A 1BGVA 1WNTA 2IXBA 3RUHA 5GZ3A 4ND3A 4FS3A 1DRUA 3WGYA 1YL5A 2D2IA 1VL0A 3AUAA 2Q1WA 3H3FA 5HBRA 2JL1A 1JA9A 5C7OO 3PYLA 1ADBA 4BNNA 2QIOA 4E5NA 3PHLA 3ZWVA 4MO2A 3BMOA 4L4SA 3MJEA 5JLAA 4DGSA 5L95A 2AW5A 4U6SA 2ZCUA 4YAJA 1CDOA 1Y5RA 1H93A 1G0NA 1DJQA 1GUYA 1NFRA 2HK8A 1PL6A 2J8ZA 4E4YA 3U5TA 1DXYA 1B16A 3PJDA 4AJIA 4UVIA 2PY6A 1C0PA 2ILTA 1DAPA 1DLJA 1F8GA 1ID1A 1LSOA 4BB6A 2D8AA 1NQOA 2AEFA 1X7HA 2GRAA 3H65A 1KERA 1LSUA 2CSUA 3PHHA 4PLPA 4JBIA 3JQ6A 1WXDA 3ONDA 3QVXA 4J49A 1LLCA 4PLYA 7MDHA 5A03A 2B69A 4ID9A 3HJAA 1P1FA 4CM7A 4D3DA 2WD7B 1YJQA 1I24A 1YB4A 1B8UA 3K73O 3GF4A 2VZ8A 1MC4A 3V1YA 4CMJA 4BNVA 5JAMA 1ENOA 3ORFA 3GNSA 4K9DA 3AJRA 1HETA 4NQZA 2D4AA 3HADA 3UXYA 1ZSVA 2YDXA 4FFMA 1I2CA 3PIDA 1ZBQA 3OICA 2ZCVA 4NI5A 2YHIB 3GEDA 3Q9UA 4YT5A 4EI2A 1ML3A 2PWZA 4JJIA 2CUKA 3WG9A 1NFQA 1XDWA 1Y8QB 2SCUA 1ENPA 4FCCA 3ABIA 3I9MA 5KIAA 2JJYA 5B4UA 1V6AA 2EW2A 4BB5A 2W8ZA 1WDLA 1SMKA 1NHWA 2J3JA 2D5AA 2EW8A 5KNLA 1VJTA 3LC2O 2IEBA 3U09A 1UXKA 1NNUA 5JXWA 2Z5LA 3LC1O 5KVCA 4WCFC 4BO5A 1HF3A 1O94A 3GAZA 1EFKA 3W8DA 1XQ6A 4HADA 4GWKA 5CDUA 3TSCA 2BHLA 2WD7A 3H2ZA 2HDHA 1RM4A 3IC5A 4WEOA 4PG7A 2B0JA 2OOSA 3WYCA 3CZRA 1CQJA 2BLLA 2EP5A 2NVBA 2X8LA 4OQZA 4Y9DA 4BO1A 3IKVA 3OEWA 1ZKMA 3OJEA 3PLNA 3MJTA 1A4IA 3DMYA 2QRLA 4NMHA 3GFGA 1I3NA 5JE8A 2OORA 4C4OA 3WBBA 1HRDA 3C8MA 3R6DA 4YT8A 4AFNA 1FDWA 2YHIA 5G0UA 4P8RA 2NQ8A 3ETEA 2NVWA 4UUOA 3ZU2A 1U7HA 1Y8QA 3DHNA 5HM8A 3CSDA 1K89A 4N54A 4PLVA 3RBXA 5DZSA 4HY3A 2B36A 2VUTA 4CM9D 5TC4A 2DPHA 2VWGA 4XIJA 4UVEA 3H7AA 4YJGB 3SC6A 4ILKA 3E9QA 4J16A 1CERA 2GNAA 5I8ZA 2A92A 1HYGA 3JYOA 2D1YA 2PH5A 4M87A 4IXTA 4WLVA 3AK4A 1ZK0A 4RVUA 1MG0A 1PZHA 2ZB4A 3TZ6A 5L7TA 3H6KA 3W1VA 5ITWA 2ZATA 3KV3O 4M55A 5G0TA 4D46A 1KOLA 1YWGO 1W4ZA 1R0KA 3WTBA 4IDAA 3WMWA 3ROKA 1TXGA 4IQ8A 2VWQA 4CQLB 2FPPA 1PQWA 4L4RA 2FP4A 1QG6A 3ZV4A 4G5HA 3ULKA 2VWHA 1QMGA 2BFOA 4HX5A 4A03A 3FPCA 3DDNA 1C1XB 3RSHA 2QRJA 4BNLA 4CQMB 4KWHA 4F6LA 3UGKA 3QA9A 3WMXA 3ZNNA 3HSKA 4YJGA 1LNQA 1O8CA 4LW8A 2OFPA 2C29D 3JQBA 1RM5A 3DOCA 1E7RA 3BMCB 1DB3A 2PFGA 2P5UA 3JQFC 1I3MA 3ZWOA 4BVAA 4QX6A 4AJPA 1PIWA 1U8FO 1ISHA 4J1NA 2OBYA 4R5HA 3L07A 1EVJA 2OXIA 5KJFA 3DMTC 4BQPA 1LDMA 4J0EA 4IGFA 4GH5A 1LLDA 3QW2A 1ENYA 5IN4A 1QLJA 1YXMA 2EKQA 2Q2VA 5KWEA 3TDKA 1KEVA 2FSVA 1UXIA 4DC0A 1VSVA 3DWFA 4CQLA 1V3VA 3WGIA 1IOLA 5IF3A 4IJWA 5L4NA 5K0ZA 3D4PA 3RUAA 5IN5A 3QSGA 1ONPA 4M86A 1P33A 4NH4A 1Z6ZA 5FF9A 3ASUA 3VZQA 3KBOA 3VH3A 1C1XA 2Y0DA 1I33A 4MKXA 3F1KA 1GL3A 4K28A 3JTMA 1SC6A 3TWOA 4FOOA 1PJBA 1GYPA 1O5IA 5DBIA 1O6ZA 5B12A 4PG4A 4YA6A 1JWAB 1B26A 1G6KA 3IJRA 1GADO 1GEGA 1LI4A 3AOEA 3IP3A 3TL2A 5A9RA 5IZCC 1LX6A 1B14A 3RJ5A 1PQUA 2O2SA 2EGGA 4F45A 2YYYA 3BMCA 4DQXA 1RM0A 4TRJA 4W9NC 2Q2QA 3DZIA 4CR6A 3E03A 4RL6A 1DHRA 2NNLD 2IE0A 2E4AA 1VM6A 4C7KA 1N1GA 3RC2A 4MVJG 4AVYA 2ZTUA 3T7EA 1D8AA 5AXCA 4HXYA 2J3HA 3KO8A 2BELA 3HNPA 1ISFA 1C3VA 3FWZA 4AJLA 3H2SA 1ZZEA 5THKA 5LCXA 2WYUA 2Q45A 1HLDA 1Q7GA 5JYEA 4FGSA 4WUVA 1U3UA 3CXRA 1ZK4A 2EV9A 3PQEA 4U8GA 3MOIA 1B7GO 5EMHA 4DBZA 2W2LA 4PLCA 2BMAA 1XG5A 3CUKA 4RF5A 3MJCA 4XR9A 3HFSA 1W6UA 1PJQA 3JQ7B 3QHAA 3TZQA 4YT4A 1T26A 2C5EA 2RCYA 4XWYA 3V5NA 3O4RA 2FR1A 4OMUA 5T64A 4G65A 4TRNA 2AQ8A 3TPCA 3FTPA 1EEHA 1NWCA 4U0JA 4EDFA 2VN8A 3N58A 2XPCA 3GFBA 4K6CA 3GK3A 1WZEA 1Z7EA 2F00A 4PGFA 2GZ1A 3PP8A 3VVCA 3DZBA 4JQCA 1PEDA 4XQGA 4IY1A 3O8QB 2IZ0A 4W99A 1DO8A 2Y0EA 1DHTA 2Q3EA 4OXKA 4DLLA 1LRKA 1WPQA 3TZHA 2GYYA 2Q50A 1T1RA 2UAGA 5JC1A 4LISA 4PG6A 4BNKA 1BXZA 4R68A 4GWGA 4Y8VA 4B3HA 6LDHA 2C20A 4L76A 1LTHR 2VT3A 4AICA 5U4QA 3NTOA 2P68A 4AJKA 4IDFA 3BHIA 2OP1A 3WJAA 3HDHA 1MGOA 3NT5A 4CLRB 3A1NA 4XR4A 4GBJA 4DRYA 2IRWA 2JAPA 4HFMA 1E77A 4BO9A 1QYDA 2UUOA 4RVSA 4TVBA 1J49A 3L6EA 5IG2A 3UW3A 1LDNA 5TNXA 5DN9A 3TZKA 4CMGA 1ZXBA 3C1AA 5ENVA 2ZTMA 3JQ7A 4EJMA 3TF5A 2DBRA 1NBOA 2LDXA 5ILGA 4Z9FA 4B4VA 2CY0A 4Q3BA 1NAIA 1YH3A 4DMLA 3GN2A 1LRLA 1NQTA 1E0DA 4H16A 4NFYA 4MVJA 4XRRA 1UAGA 4MDHA 1UXHA 5KOIA 1VL6A 5BSEA 3O8QA 3KHUA 4CV1A 1MG5A 3AWDA 4D41A 1DRWA 4TSKA 2C07A 3MZ0A 3I1JA 3M6IA 3HWRA 2NU6A 5JPIA 5CAEA 4LK3A 4OIMA 5DT9A 4AJ1A 4CLDA 1ORRA 3RFTA 3OJFA 3V8BA 1X14A 4E5MA 4IDDA 2Q4BA 3WSWA 1PJ2A 1CETA 5G4KB 2JD0A 4FPXA 4YYZA 2I66A 4IZIA 3LF2A 1M75A 2G76A 5DULA 3E82A 2RHCA 3UVEA 2ZQYA 2JKVA 1JKJA 5I9MA 3STHA 3U62A 2OHXA 1RM3A 1HDXA 3A06A 5JO9A 2B4RO 4HFJA 4R1UA 4UUMA 5DCUA 2ZB7A 2Y0CA 3HHPA 3JD2A 3VHRA 5C3MA 2Y68A 3U3XA 4R41A 2PK3A 2C54A 1Y9AA 3H5RA 5CFZA 3AU8A 3GHYA 5T6BA 1P45A 3TZCA 4FB5A 3RU7A 1TA4A 1KC1A 2JHGA 1BMDA 3C7DB 4BO8A 4FJ1A 1F12A 1HZZA 3VOSA 2HKIA 3TOZA 3ZNQA 1NYTA 4OOFA 2JFGA 2PGDA 4BO3A 3GA0A 2Z1NA 1P3DA 1UZLA 3PWKA 1UDBA 2X86A 1NR7A 4DWVA 1C1DB 2VRCA 3DFUA 2O3UA 3EC7A 1ZW1A 3RUCA 3N74A 2NVUB 2JFHA 5C37A 3RROA 5I8WA 2HLPA 1NXQA 2A4KA 2PD6A 3ICPA 3PZRA 5G4KA 4CLEA 3A14A 3I5MA 5JDIC 1TT5B 3F47A 1K6IA 1EVYA 5JBIA 4A0SA 4UULA 1U3VA 5HRUA 1NASA 4ITUA 9LDTA 2W98A 3MEQA 4I9UA 2VNSA 3IDSA 5CPFA 3FR7A 3VKUA 2I67A 1EK5A 3WS7A 4QO8A 3QVOA 1I5RA 1PS0A 1NTOA 2CF5A 2Y1EA 2WTBA 3K9QO 2DPGA 2Y67A 3LSYA 2X0JA 2HSDA 4RO0A 3BMQB 4BNHA 4MVJF 5JS6A 1PJCA 2NADA 4LRTB 3B1JA 4CUKA 3PFFA 4Q39A 2DVMA 2LDBA 1V8BA 4PZDA 5A4DA 5COBA 1K5HA 2PZJA 4PVDA 2O3JA 1ZFNA 1T1SA 1DPGA 5A1TA 1A71A 1C1DA 1YQXA 3ZDFA 4EEZA 5G0WA 4KQWA 4IBOA 4NG5A 3TFQA 4YRBA 3IUSA 3RFXA 3D4OA 1RWBA 3RASA 3RBVA 4FC6A 1PJLA 4PG5A 4YQYA 2WDZA 2C5AA 2P4QA 3E9NA 2VCYA 4RDHA 4DPMA 1H9AA 2DTEA 5JMWA 4PCVA 1HDZA 4I9HA 1ZSYA 2HMTA 1GUZA 4OL9A 5CDGA 2O4UX 3GC6A 4HNGA 2R00A 1GPJA 3H3JA 5TQVA 3LT2A 1HDYA 1EE2A 2HO5A 4TMFA 4J9UE 3NDRA 1ZCJA 4MKZA 5JCJD 3GUYA 1B3RA 1NM5A 1QRRA 3QP9A 1KVTA 4J7UA 1LQUA 1JQBA 1BSVA 1X0XA 3SJUA 5GZ6A 4BGVA 1GR0A 1TT7A 3ZWNA 1A27A 4K1LA 4OKNA 1LLUA 3OFSA 4PRLA 1I8TA 4BMNA 3P19A 2D5CA 3VPHA 4XQCA 3F5SA 3EVNA 3HUDA 3PZBA 4NK5A 5DBFA 1U28A 2JAHA 4MKRA 1QP8A 3NKLA 1JLLA 3NT2A 2GF2A 3RFVA 5JC8A 4AJ2A 1UXGA 1LC3A 1OZAA 4J2OA 2DTDA 1XA0A 5AXAA 3QWHA 3PYXA 3LC7O 5JCXA 3JQ9A 3WQSB 4BNXA 1HYEA 2HAEA 2V6GA 1DSSG 3V2HA 2B4QA 4RORA 4X54A 4XGIA 4UUNA 2I9PA 2W4QA 3JQBC 2IEDA 3HDJA 2AEJA 4OXNA 3ZH2A 3ZI0A 3OM9A 1VL8A 4U6QA 1F06A 4XYLA 3OMLA 4XJTA 4M8SA 3VZPA 3GPDG 4J7CA 2FY8A 4FN4A 5ENDA 2R6JA 4GLLA 2P5YA 3AI3A 1YB5A 4PVCA 4PLHA 1DIHA 4RZHA 3E5RA 4I1IA 3WB9A 4GAEA 3RU9A 1YB1A 4TKMA 4D79A 1U9JA 1T4BA 4FOSA 5COAA 2P4HX 1YDEA 4HBGA 5GMOA 3QQPA 1HYHA 3F5QA 1G0OA 1GD1O 4BMSA 4BKPA 2ZKLA 4GLOA 1PX0A 1Y1PA 3WOHA 4CMEC 1EDOA 2BRUA 3JYNA 2O3QA 4KOAA 5I9NA 1LDEA 1A9YA 1WLYA 4D0RA 5K9ZA 2X0RA 2PLAA 1NPDA 4CM4B 5EIOA 2BI8A 3FBTA 5TT1A 4D42A 3U4HA 1X15A 2Q4EA 3TJRA 4DVJA 5A9TA 1SEPA 4OO3A 1M6HA 5ICMA 3LLVA 3ITDA 3EUWA 2P91A 5BR7A 3C1OA 4RLSA 3DAPA 4WLOA 4IDCA 1VPDA 2PD4A 2G1UA 1HDOA 2PZLA 3ASVA 3I9LA 2QW8A 1M2WA 3AW9A 4DLAA 2QYTA 3PGJA 3OETA 3BTOA 1E6EA 4NR0A 1E3JA 2PNFA 2R2GA 4E2ZA 2CVQA 3K30A 1N8KA 4GX1A 1LEHA 1RJWA 3PEFA 4R1TA 2B83A 2X23A 3K31A 4GI2A 3GDFA 4XDYA 4W7HA 5L9AA 4P4NA 3GVXA 4I5DA 1E92A 4NHEA 4E0BA 4Z0PA 1EUZA 4CM4A 2X5JO 2UDPA 2GN8A 4UUPA 3KLMX 1YRLA 4QUKA 4O6VA 5GY7A 4E2XA 3AUUA 5CDYA 1N9GB 4LGVA 2GUGA 5F1KA 2VWPA 1VRWA 2VOEA 3I4CA 3JQAB 3DZJA 4E30A 3OEYA 8ADHA 1RKXA 2A35A 3HN7A 1CYDA 4J6FA 3PDJA 2E37A 4OGWA 1HE3A 3G1TA 1DLIA 4BV8A 1IULA 1PS9A 3RQSA 5BSFA 3LU1A 2IDZA 1QYVA 2VOJA 3MJVA 3H4VA 4QTZA 3Q3CA 1E3SA 3MOGA 2Y99A 3T4EA 1K0UA 5CG1A 3AOGA 2EERA 5EQFA 2Q99A 3I83A 3QLJA 1PGNA 4YAEA 1VI2A 4UVDA 1B15A 3ON5A 3MJSA 3AM4A 4P38A 4CJXA 2ZYDA 4YDRA 1UJMA 1DC3A 2VQ3A 4YRDA 4NU5A 4TZTA 4CUJA 3P5SA 3L4BC 1YKFA 4CV0A 3OBBA 3DBVO 5AOVA 1E5LA 1LLQA 2Y66A 3CH6A 3SBOA 1X13A 3SEFA 4XYGA 2Y93A 3UKOA 3C7AA 5F1OA 3ADOA 4BNGA 3MWDB 1N9GA 1QLHA 2GN4A 4J4BA 4NFHA 4II3A 5DP2A 3JQAA 4HUJA 5L51A 3PFWO 1A7AA 3GMDA 5HWSA 4QT0A 5TJ9A 3GZ4A 4CM8B 5EERA 3FNGA 1DIRA 1DRVA 2PKQP 5BNIA 1BVRA 1EMDA 1KY5A 4BV9A 1PU2A 4R9SA 1LSJA 5F5NA 4YB8A 2VYVD 1IHYA 1CWUA 2EWMA 2X22A 4FFNA 1VJ0A 5EN4A 4QECA 3IQDB 3D5QA 4WEQA 5CP8A 5JAZA 4YVFA 3TL3A 4CMBA 1P1JA 2IYOA 3I4FA 4ZN6A 1YJ8A 3L6OO 3WNQA 2UVDA 3SC4A 1F14A 2GZ2A 2CFCA 3H9UA 1DAOA 1I3KA 3VVBA 3ROPA 2BGLA 4NBUA 1ADGA 1P1RA 1EBUA 4I5FA 1DFHA 2O4CA 4XQEA 1Y81A 4KP7A 2QQ5A 1WVGA 2V6BA 2XF8A 2JCYA 1BTOA 1PGOA 1SBYA 1UXJA 3KEOA 3LZ6A 4L4XA 1Z74A 2EJWA 3ZNPA 3CPSA 4PIVA 3FPLA 3BMNB 3EMKA 4CM8A 4ZQGA 4URFA 2PGJA 1YQGA 5AYVA 3KLPX 3M2TA 1PQPA 4A2CA 1BXKA 3AI2A 1RYEA 3ZV3A 1U5CA 1EK6A 2GGSA 5T57A 1FDUA 4YPOA 2CVZA 2FN7A 4GVXA 2C7VA 2E82A 3WQQA 2AE1A 3C1TA 1OI7A 4CLHA 3JD0A 4AJJA 3BTUA 1KYQA 5KCZA 3CMMA 2AG5A 1WDKA 3HZZA 2HMUA 3BTSA 5JSFA 1VKNA 3TN7A 4BNMA 1E7QA 2NTJA 3D64A 4FW8A 4XGKA 1DFGA 5H83A 3VPFA 3K2EA 1EQUA 2VZ9A 5JDCA 1QR6A 2I5PO 2NWQA 3L6DA 2BD0A 4IMPA 3H9EO 4QSMA 9LDBA 2FSSA 3RKUA 3A9WA 2B37A 1D3AA 3IOYA 2X0NA 2IYPA 4KQXA 1D1SA 1HDGO 1YL7A 3HB4X 1V3UA 1M6WA 4BQRA 4YR9A 1Q2XA 4IMRA 3BMNA 4JP2A 2FMUA 2NU7A 4DPLA 4O0LA 3GY0A 4B7UA 2HQ1A 3PYMA 4CM6A 1U4SA 1IPFA 5B4TA 4GKBA 3BTVA 4AJOA 2ET6A 2FZEA 4XB1A 2JD1A 4BO0A 1EDZA 3F6YA 3WGGA 3AU9A 2DC1A 4EJ6A 3F3SA 4EUEA 3U4IA 4D44A 3VH1A 1P1KA 4DIOA 2OGUA 2X58A 1IZ9A 3OF2A 1I3LA 5B37A 3PQFA 4ALMA 3NV9A 3PK0A 1L7DA 3GG2A 4J1TA 2DAPA 1U2DA 5F3RA 2GDZA 4ONEA 5IDXA 1JVSA 3HFGA 5JAQA 4FD3A 3AFNA 1NQAO 3I6QA 4H15A 4L74A 1UAYA 1AHIA 1HT0A 5C7LO 3UCFA 4I5EA 1EE9A 4MIYA 1A9ZA 4RZIA 4BMVA 4EEXA 2OO5A 1R0LA 3TOXA 5L4SA 5DOVA 3RC7A 2UV8A 2FHSA 2FPIA 3QJ5A 1MP0A 3FR8A 3ZU5A 3ZWCA 1BXGB 3AY3A 3U49A 4OHUA 1H6AA 4P4GA 4L0QA 1ONOA 1UUFA 2AXQA 2WSBA 1I01A 3IP1A 3JQGB 3QY9A 1KVSA 4JBHA 4BNYA 3VC7A 4CLXA 1N5DA 1V0JA 4PRKA 4IJUA 3CIFA 1B8PA 2I65A 1ISGA 2G0TA 1MFZA 3GPIA 4U7WA 2VYNA 2GERA 1FJHA 1VSUA 3PXXA 4HNHA 4JJFA 3ZNOA 4E31A 1O9BA 5F1PA 1E1MA 1NQ5A 1MUUA 2Y05A 1X1TA 4Q3EA 4ALIA 4I5GA 5C7IO 2YZ7A 1H6DA 1MFPA 1HSOA 2DFVA 2CZCA 5GZ1A 2NUAA 1E3LA 1Q7BA 2C7GA 2YUTA 3PTZA 4YJHB 2FZWA 3E8XA 3WDSA 4KUHA 4YXFA 2VZ0A 3EZYA 1CQIA 1LXCA 3BHMA 3L9XA 3NYWA 4IZHA 5B4VA 5TT0A 1JDJA 2PH3A 4WK6A 4CQMA 2HJSA 2PA3A 3PHJA 3R1IA 2G5CA 3OQ6A 4E2YA 1E6WA 5TJHA 3TNLA 1S6YA 1XEAA 1JW9B 5CPBA 3D3WB 1BXGA 4GSKA 1JTVA 4C7JA 4IXWA 3HDYA 3JQGA 4RF2A 4XA8A 5COQA 4DYDA 2QX7A 2C2XA 5IFLA 1B2LA 2HMWA 3LT4A 2X7HA 3ONFA 1D7OA 1JWBB 3H8VA 4WKGA 1Y7TA 3L9WA 4XD2A 3ONEA 2HK9A 2X5KO 3OIDA 1GZ3A 4HP8A 1E1KA 3GEGA 4E2WA 3R3SA 4IQGA 1K2WA 1RYDA 3AFMA 3G17A 1H9BA 3D4NA 4FFPA 1HDCA 2EIHA 3NRCA 3UAGA 3ZV5A 5AXDA 1FF9A 2J3IA 3WX0A 4CMIB 2RH4A 3DAFA 3WJ7A 4Y67A 1XLTA 2HCTA 4YJHA 3MJ4A 5FEUA 3RUFA 2DBQA 3H9JA 1NX6A 1R16A 4EYEA 3KEQA 4CM5A 1SB8A 4RDIA 3S2IA 1WZIA 1P77A 4GX2A 3RUIA 1T4DA 4DA9A 5CHEA 3ZHBA 3WYBA 4P4LA 1FDSA 2NTVA 3NJ4A 3D3WA 2GR9A 3GG9A 1UZNA 1ADFA 5KJ1A 1PWZA 1TVEA 3KYCB 1Y5MA 4K6FA 2VUSA 3BYZA 3INGA 5KJCA 3NX4A 3CMCO 3KB6A 4NDNE 4ZQFA 3ZHZA 4ZRMA 1ZIDA 1GPDG 2Q46A 2TMDA 5K6AC 5KTKA 1GCUA 4IINA 5L4LA 4XEHA 1WP4A 4NJMB 3EYWA 4JP3A 1FDTA 4J3FA 1XU9A 4MPDA 4R69A 3ROMA 1SZJG 3VDQA 2WWRA 1W8DA 1TI7A 4UREA 3B1FA 2J5RA 3WXBA 4D3SA 4XKJA 5KJ6A 1W73A 3JQ8B 2RBEA 4JCOA 3VZSA 3X2EA 5KJEA 4FGWA 1EVZA 3ZWMA 5CDTA 3O26A 5HA5A 4XQ9A 1ONNA 1IZ0A 5TX7A 1U4OA 3WQRA 2VUUA 4IJVA 3VH2A 3IL2A 2B4TO 4ZJUA 1R66A 4RVHA 5G2OA 3RBZA 3I3OA 4DTIA 2PKQO 4XRGA 4DXHA 3B1KA 2JHFA 4U0KA 4RVFA 5CEFA 1FXSA 4YAIA 4CMHA 4S3MA 3JYPA 3Q0EA 4E33A 4UAGA 2O7QA 2AG8A 1H94A 2AQHA 3KYCA 5TGDA 4WE3A 4N5NA 1XSEA 5KKAA 2NV6A 3RCBA 1EZ4A 4D43A 1E7MA 4JIGA 4LSWA 3K96A 1A5ZA 3LQFA 1YDWA 5ICSA 5KVQA 4EGFA 2EEZA 1BDMA 4NJMA 1T2FA 3KOUA 1QV6A 1YL6A 1CF2O 2V7PA 3RJ9A 1SOWA 4F46A 5JYDA 1P74A 4J2HA 3T7CA 1JN0A 3JQ8A 5BSHA 2IODA 1KVQA 4I8XA 2WD8A 4L9RA 2J6IA 4CLRA 3K5PA 4BKQA 4WCFB 1A4UA 4N18A 3C7CB 4BGIA 1Z82A 2AQKA 3S1LA 2C59A 2NU9A 2H1SA 1JAYA 1VLLA 3PWZA 2QZ9A 4TWRA 4DLBA 3DOJA 4NZ9A 3G1UA 3DHEA 1I30A 4YT2A 2E6UX 4ND1A 4PLFA 5ER9A 3FWNA 4OSPA 4JN6B 2I76A 5AXBA 5HS6A 3FSRA 4ZU3A 1CJCA 3ZWWA 4AJ4A 3WSVA 5IXSA 4DREA 4KTVE 4R5MA 4IIVA 3M1LA 3OJOA 2AEMA 5I7EA 3ITKA 4Q3NA 1ZMOA 1UP6A 3GQVA 4YJFB 2CF6A 3E6AA 3NDIA 1HXHA 4BIIA 4BOYA 2EP7A 1XGKA 4KDEA 4DL9A 1IHXA 2WYWA 2V6MA 2HJRA 4ZHSA 1AXEA 3I6IA 3NGLA 3GH3A 1E3WB 2X9GA 3V1TC 4UEKA 3JSAA 1AN9A 3DHYA 2CVOA 3WTCA 1XWFA 2PZKA 4RF4A 4WCFA 3FNEA 2Y1OA 1GU7A 1MXFA 3VDRA 1K6JA 4DIFA 3UUWA 1PJ3A 4G2NA 1T25A 1E7YA 1TLTA 4NBVA 5A06A 3H9QA 3KXDA 2NTNA 2QZZA 5BNFA 2DBVO 1YBVA 2AHRA 1QSGA 2J3KA 2JD2A 1XYGA 2GZ3A 3K92A 3RI3A 5TSDA 1PR3A 3FNFA 2BGMA 3I52A 1I32A 3UH1A 2HK7A 3DZGA 3B70A 4OJNA 3GGOA 1FDVA 4XJSA 4CM3A 2ZB3A 3GNTA 2IZZA 4UVHA 1EBFA 4YJFA 4WJZA 1U3WA 3DQPA 1ZEMA 3KSZO 3P7MA 1W0CA 5EQDA 8LDHA 3ST7A 2ZQZA 3DC2A 3OJ0A 1C0IA 3DBRB 2NVUA 4RV9A 1XHLA 2AE2A 4JK3A 1E3WA 4PLWA 2B5VA 4BKRA 3SVTA 1TT5A 2GSDA 4B4OA 2WMDA 5A5EA 5I7VA 4HKTA 3GT0A 4HFNA 4L8VA 4CL8A 3DTYA 5KVSA 3VPSA 4WOJA 1B8VA 2GD1O 3JYQA 4LVCA 5G0SA 5A02A 3AY7A 2IZ1A 4XB2A 3LK7A 1ARZA 1ADCA 1NVTA 1OOEA 3FNHA 5T67A 1IUKA 3MCVA 1HE5A 2CMDA 5MDHA 3RVDA 2BF7A 2Y1DA 1HKUA 4BO2A 2BFAA 3BMQA 1SCUA 1R4MB 5A05A 3PIIA 1NWHA 2D0IA 1E1NA 3PRJA 2O50A 1ZJZA 3FD8A 4WOKA 4ZA2A 1YE3A 4OSOA 1GCOA 5ITVA 5EJ2A 3DBRA 1T24A 4WLNA 4DC1A 4OAQA 3AM5A 3PPIA 1C0LA 4B7XA 4EW6A 1N7HA 3KSUA 3OH8A 1NAHA 1ZMTA 3Q2IA 3W6UA 1WMAA 4DQUA 3JQFA 1ULSA 3F9IA 2BI7A 1O95A 1R4NB 3PQDA 1AGNA 4J0FA 3FI9A 4MIOA 1KVUA 1OC4A 4GX0A 4E13A 3DMTA 4R9RA 1HE4A 1GDHA 4RVGA 5IDQA 3K2BA 5TF4A 4Y98A 3INTA 5A5FA 1UH5A 4IS2A 1ZJYA 4MP8A 3ZHYA 4Y6PA 4MVJH 2Y1FA 5F5LA 1HL3A 1JVBA 1SNYA 3PJEA 4MVJM 4RPLA 5JMPA 4DMMA 4DYVA 4BO4A 3A4VA 1R4MA 3PI7A 5L53A 3ZWYA 3PJGA 5FFFA 1J5PA 4D45A 1DBVO 4YTEA 2VTEA 1NP3A 2O7SA 3B6ZA 1UDAA 3NT4A 4GMFA 4R1NA 1SAYA 4QFCA 3DZFA 4RPKA 3PVZA 4Z9XA 1O89A 1J4AA 3GVHA 2CDCA 2EJVA 1NFFA 2EKPA 3QWBA 2EKLA 1WAMA 3LF1A 4YACA 5IZCA 4CODB 5G0VA 1GV1A 3AOEC 5LDHA 4W9NA 1DIGA 2AA3A 2HRBA 3DZKA 4O59O 4BNTA 1LJ8A 4WNIA 1R4NA 1V3TA 1GQQA 4AG3A 4FSHA 4ND4A 2P9CA 3BHJA 3GR6A 4J7XA 3SXPA 2EG9A 4MJLA 3DAGA 1DC4A 4FC7A 2OMEA 3NEPX 1E3IA 2GLXA 4FFRA 5T8KA 1MC5A 5A3VA 4EBFA 1SPXA 1TEHA 4ZVVA 3RC9A 3M1AA 2O3TA 5IJZA 4B4WA 2E48A 3DFZA 3HDQA 3QWAA 1Z73A 1G1AA 4BO6A 1PL7A 2YV3A 2GO1A 4WECA 1A72A 1QYWA 2H9IA 2QG4A 4I9NA 4IDGA 4E12A 4R1SA 5EL0A 4GPD1 3NUGA 4OH1A 1Q0LA 1H6CA 4GL4A 4WGGA 3EK2A 1KVRA 4JROA 4O1MA 1DIBA 1GQ2A 3O38A 1TB4A 1KC3A 3OQ1A 1F0YA 2YV1A 3SLKA 3KSDO 4NBWA 1GY8A 4OYRA 4RVDA 1X7GA 2OBNA 1M66A 2PGLA 1GFSA 4DQVA 3F46A 3MTJA 1HSZA 3W6ZA 4IGEA 3GVIA 2IXAA 4IS3A 4WASA 5I7FA 1L7EA 3GAFA 4FJ0A 2NM0A 3DTTA 1P44A 3WYEA 2DU8A 2G17A 4BNWA 1T2AA 1M67A 2V65A 4NIMA 1ZVMA 2VHVA 3TFOA 2BFPA 1NPYA 5L3ZA 3NDJA 1R6DA 4R51A 4UVGA 1BW9B 1YO6A 4GMGA 4Q3DA 4A10A 5A3JA 3GEMA 3JYLA 3UF0A 3WICA 1V35A 3S8MA 1PJTA 4EZBA 5LDGA 1YGYA 5L7YA 3KUXA 3S2EA 1GUFA 2JFFA 3L0DA 3WGTA 3SLGA 4NBTA 1K6XA 1R15A 1P31A 2YV2A 2W2LD 3JQCA 5L40A 1AHHA 4YAKA 3K8ZA 3RUEA 4AJHA 4F3YA 1N2SA 5TRTA 1BG6A 1JAXA 1KETA 3INRA 4HFRA 5FYDA 4XDZA 2Q1TA 3WWYA 4TKLA 5A9SB 2WM3A 2JCXA 2YFHA 2NQTA 1XQ1A 4J43A 3KZVA 1K3TA 5LC1A 2DUWA 1S7CA 3KTDA 2GCGA 3ANMA 1ISMA 1GZ4A 3OHSX 3WGOA 4XCVA 2ZIZA 1VJ1A 4WCDA 4WLEA 4Z9YA 2DKNA 4H7PA 3LT0A 3C24A 4M54A 1BW9A 3DO5A 5ADHA 5FI5A 1WWKA 1XIVA 4W82A 1CIVA 2CDAA 4OQYA 3WNVA 3ZV6A 5L45A 4J1QA 3FN4A 3JD4A 3ZW8A 3WWZA 3ZWAA 3G3EA 4FFOA 3BA1A 1KIFA 4XYMA 3KYDB 2YDYA 2X6TA 3E18A 1IE3A 3O9ZA 3EDMA 2I3GA 3IS3A 5I7SA 2VHWA 2EGHA 1P0FA 3VKVA 1H2BA 3MWEB 3PGXA 4TRMA 5A9SA 2Y1CA 4CMAA 5CEJA 1P1IA 5AVOA 3FF4A 3N7UA 3DR3A 4MVJD 1LDBA 4OOEA 3GZNB 4PLTA 2GPTA 3DEYX 4NJOA 3NTQA 1LBEA 3G79A 3EHEA 4R4JA 1U5AA 4MVJE 4XGNA 4MP3A 3AUTA 3V2GA 4LMPA 3CE6A 5JDIA 4LVUA 3VTZA 1WMBA 4NK4A 1DC6A 5HS4A 3H5NA 2EF1A 5EINA 2WYVA 5JCJA 3D7LA 3QVSA 2RH8A 3ZGYA 3VTFA 2DTXA 5THQA 3HQ4O 4RPHA 2VRBA 4R16A 3VAZA 4B8WA 5IXYA 3KETA 3DOOA 5BT9A 1LUAA 2BFMA 3VPGA 1R0SA 4QQRA 5EPOA 3LYLA 5G4LA 5T5QA 1Z45A 4GGPA 3QWIA 3KYDA 4J91A 5DCWA 4BGUA 1XR3A 2X1HA 4BL5A 2UYYA 4RQUA 5J23A 3HN2A 1N7GA 1OFGA 1Y6JA 1OBFO 4ND5A 4RLHA 1AE1A 1AXGA 4J4TA 2F1KA 1PZFA 4IUYA 4GGOA 3BAZA 3GZNA 3ZCXA 4WNCA 1PS8A 4IDEA 1V9LA 3M2PA 2B35A 4LN1A 3H5AA 4LSMA 4R3NA 1L1FA 2DUUA 2ZTLA 1Q0QA 3GNQA 4CPDA 3WLFA 3JD3A 4D7AA 3FCOA 1ZK3A 2VRCD 3C3XA 3EZLA 4KZPA 4R3WA 4E5KA 1SOVA 2O48X 1ZK1A 4OKIA 4ALNA 4CUZA 1PGJA 1PGPA 4TQGA 5KVVA 4CV2A 1OAAA 3PHGA 1BVUA 1WDMA 3QWFA 3U9LA 3E9MA 3RD5A 3GRKA 5JO0A 4UEOA 2R00C 1Y8RB 2P9EA 2VT2A 2Y1GA 4QXMA 5DDIP 4YWJA 1B3BA 3AM3A 2OP0A 4XIYA 3UCXA 2X9NA 1KEWA 2YW9A 4M49A 5DNAA 3ENKA 3ANLA 3BZUA 3SX2A 3FBGA 4GSLA 3IJPA 3Q2KA 1O0SA 1T2DA 3DZHA 4ROSA 1HTBA 3OECA 4UEJA 3ZU3A 3ZWPA 1AUPA 4BUCA 3O03A 1F17A 4OM8A 2POQX 3E48A 1X0VA 1VE9A 1YOVB 3S55A 3W4KA 4JNKA 3LT1A 4INAA 3JQEA 1SEVA 4CL3A 3RIHA 4JXKA 3JQ9C 5I9LA 4KUEA 1P1HA 2VHZA 2FWMX 3UOGA 4ZRNA 3K6JA 4PFJA 1VC2A 5JFOA 5FI3A 1DEHA 1ZUD1 4NBRA 3QVTA 3IUPA 3F4LA 1IL0A 3I9OA 4I08A 1H2HA 3W8FA 1Y8RA 2QRKA 2Q49A 1YBMA 4QO7A 4IIUA 3ZHXA 3E1KA 1XKQA 1Y9EA 3ZZNA 1M76A 2D59A 4E5PA 3QV1A 3UHAA 4Z0TA 4B3JA 2A9FA 3QVWA 4DIBA 1GYQA 4ZQBA 4PZEA 2CNBA 4CMEA 3GOHA 1EFLA 1H5QA 4ALJA 1PJ4A 1EQ2A 2X4GA 4LCJA 1LU9A 3RWBA 1SO8A 1YOVA 3OA0A 4MOWA 3L4SO 3WFIA 2OL4A 2WEKA 1U8XX 2PKRA 3WGQA 3EY4A 4MIEA 3QIVA 3KYBA 1PWXA 3ENNA 4IM7A 4FQ8A 4ZGWA 3Q11A 4ZQEA 4CR8A 3I23A 3I9JA 1Z7BA 4AL4A 1YVEI 3OSUA 3GRPA 3PDUA 1QKIA 2DBZA 4CR7A 1ISIA 4L75A 1ULUA 1A7KA 3D3EA 3U0BA 2QHXA 4Z0HO 4DUPA 1NVGA 4N5LA 2XXBA 1PZEA 1DIAA 3ANNA 3LDHA 4FIZA 4ESOA 1D1TA 3A28A 4OXYA 5T8KC 3WFJA 4J4HA 2D3TA 3OIFA 3WBFA 1Z75A 4WLUA 3MTGA 4EJ0A 4BNJA 2NSDA
chains in the Genus database with same CATH superfamily
2IH2A 2VDRB 2ZQ5A 2I6TA 3LD9A 2CMGA 4H6WA 1RZVA 1UADA 4IOMA 5CB4F 2OILA 4M9XA 2B2CA 3LGXA 1C9JA 4Q9JA 1JG7A 1K66A 4RPGA 4TXLA 3SN6A 3FCXA 1I2BA 1PL8A 3PXEA 4A6PA 4KN9S 1V4VA 2E4VA 2QW0X 1KY4A 1Q1NA 5BMVA 2AVDA 1KJWA 2Q4DA 3CBGA 3RS7A 1U1DA 3EZGA 1M54A 3T3HA 1X2EA 3WJ1A 1JZSA 4NU6A 4DLKA 2G1JA 3AB7A 1EP2B 1XA4A 2AZDA 2GASA 1GZ6A 2F64A 4AJNA 3NPAA 4S1OA 2I2BA 3RVQA 4BFUA 2VYVA 4JL5A 2JAWA 3MTEA 2NU8B 4TRRA 5ILOA 3C0KA 2AKYA 1H8HD 3BWMA 4V0RA 4OF4A 2BCEA 2GDJA 4J1SA 5C8ZA 5I9IA 1N33B 2NT4A 3W90A 4EITA 3G8AA 1JE1A 1JU3A 2HCRA 3EVCA 3LXXA 1U1IA 2ZK7A 4D0GA 1JLHA 2QTVB 4QFDA 1T8TA 1UZMA 2BJVA 4NC9A 3UHJA 3WL5A 1DFIA 4XJXA 5TIIA 4F5YA 3FCEA 3PXCX 3OT1B 1J8YF 5G02A 2ZXUA 1VA5A 4O4IA 1SHTX 3TMAA 3F6PA 4BC1A 5BO5A 1J23A 3BHNA 4NCJA 5L7WA 1ZIXA 4XDGA 1ODJA 5EUBA 3ZX4A 1XRNA 1L0BA 1ESDA 2PZGA 4OVKA 3PUIA 4TTVA 3T1NA 3L77A 1QF6A 4MYUA 5FBLB 1A82A 4LAFA 4EKGA 2PR2A 1RLOA 3C3BA 3QXXA 1SZDA 3VKFA 4PN3A 1QV7A 1S96A 1WW8A 3LQ1A 4L95C 3CJRA 3UV3A 4RJTA 4Y6OA 3WOVA 3C4QA 4ZZ0A 2F8TA 2Z98A 4M9CA 3FMVA 3EDRA 4DCSA 1EVIA 5EKUA 4ZANA 1T8UA 1XC7A 1FK8A 3B1VA 1ZOLA 3BXXA 2DP4E 3NBAA 5D3MB 1YS4A 2Q2WA 4D0NA 3D6FA 1D0SA 4BKOA 1BMFA 2J30A 4LX0A 3T5MA 4C78A 1W6RA 1UK8A 3NHBA 1N8TA 3LH5A 3WMGA 3DUFA 3V1KA 1L8AA 2X0FA 3K5HA 4D0SA 5HTOA 1FJXA 4ASUD 2M1ZA 4GZ5A 4LF8B 3RK4A 2WU4A 1FZQA 2JH8A 2GHIA 4MYCA 5LM3A 2FPGA 3T5AA 4PM4A 2FWRA 4I8DA 5GJBA 3OIGA 3ZOZA 1PZGA 7ADHA 2Q1SA 3BCUA 3C3MA 3OQBA 1NLZA 4C01A 2AYYA 1H4TA 1RI5A 5E6RA 2GF9A 3VH4A 2XWPA 4Z99A 2AXPA 2HPAA 5CCBA 2Z2YA 3QEJA 5TPZD 1D4FA 3IDQA 3IUBA 4P84A 2DFKB 4GX5A 5GPBA 4ZMRA 3NM4A 2QMOA 5AQ1A 1QH1A 5I48A 2H5IA 3PR1A 4URXR 3NAQA 2DPMA 2KW5A 5IKOA 4GQBA 4JH0A 5IHXA 3QYPA 3N0XA 4WN9A 4V0QA 5IAAA 3OPQA 3TGWA 1Y82A 4A2QA 4Q9NA 3N2LA 1NN0A 4O33A 4B7CA 5KTOA 3DXFA 4Y2XA 2HMSA 2JIZD 1DTEA 5GJCA 1OMOA 3I01A 4WINA 2FEXA 2PZAA 4QJIA 4AN4A 2WF5A 2FOIA 1R9MA 2EATA 1KJIA 4L57A 1ZM2A 1ACMA 4WNYA 1DI0A 2PH1A 4MVJI 5WRFA 2ZBFA 3LDUA 5CNKA 2IU3A 4MV9A 3L79A 4UBIA 5IW8A 4MINA 3B52X 1KRXA 4O29A 4KREA 2JFWA 1IB6A 5K1ZA 2C0CA 1AKEA 1GUDA 1UK9A 1XZDA 2ZXEA 3CW9A 3DDSA 4TSFD 4Z3KA 4PGGA 3QPDA 2W42A 4ENPA 1NDHA 3CU5A 4XYEA 5GONA 3O8RA 5DI9A 2W9XA 2UZ3A 1BE0A 5KYXA 5JTUA 1E2QA 3UATA 5FR1A 4O2LA 4JX8A 4ZQCB 1QYRA 3P32A 1OVMA 2BEUA 3DMHA 3F4BA 3LT5A 3K20A 4TSRA 3IV7A 3TZBA 4CM1A 1FW8A 4AZ3B 4L72A 2CVPA 1NE2A 4I50F 4RY2A 1L3BA 4GXNA 4P86A 2Z95A 1D5CA 3F2VA 1UKAA 1Q2UA 2CK3D 1JKFA 2A5DA 1O96B 1WS6A 1ZH2A 1GTJ1 1DKLA 1KS9A 3LKBA 3TQSA 2C1XA 4B3SB 1Z62A 1ZEJA 2PQMA 4YCBA 3QUQA 4BNUA 5C8VA 4L02A 3OEEA 4AJ9A 5AHXA 4UU8A 1OWMA 1WLSA 3IT1A 3DBHA 1OC2A 1UOEA 1R8XA 4TUYA 1OLUA 2X0IA 3LSTA 2YXDA 4M38A 3RHTA 5C32A 1DNPA 5EZSA 4B48A 2PS0A 2OB1A 4HT3B 1VP3A 2D0PB 3KELA 3ZGOA 1SC9A 1VLHA 2VBCA 3HGMA 4R2IA 3Q6IA 4MI3A 4L5YA 5F12A 3PT9A 4KACA 2WB2A 3COSA 3IJEB 3NBXX 3H87A 1SVNA 2YFQA 2H5LA 4R8SA 1MA3A 4YONB 4ZHQA 2R8OA 4AMYA 4QXAA 1T0JB 2JIOA 2WIAA 1HZJA 1P0CA 3DM5A 2G63A 1E96A 3IV9A 1G3RA 3WADA 2NTYC 1U2DC 3C3KA 2AN4A 1AKQA 3B3QA 2QE6A 1BCRA 1NR1A 3CTMA 3GRFA 4ALLA 4D9HA 1UINA 3EIUA 4Y30A 2CW5A 1JI3A 2W2KB 4TQ9A 3RR2A 2AUMA 5DNCA 3G0OA 1XTPA 2BKAA 1MA0A 1PFVA 4ZD6A 2F67A 1R6BX 2PWAA 3IVXA 4YRZA 2Q6TA 3NONA 4UZFA 4N8DA 5J2TB 3O0DA 4C7OB 2Q8PA 1DEKA 1VGVA 4MUEA 4MCIA 1MC1A 2OHGA 3FX2A 2RHWA 4W6ZA 1JALA 4Q3AA 2X2OA 2FXIA 2MSCB 4NZPA 4UJ5A 1EUDB 2YRFA 5AW9A 2DFDA 3DBOB 1C7IA 4MVXA 3SE7A 1QDUA 3G7SA 4PZYA 3DUWA 3T15A 4F12A 1MAHA 1Z6TA 2WWGA 5CXXA 1P17A 2VRNA 3E7WA 3FPHA 3ENZA 5EJMA 2VHXA 2W6CX 1C4WA 4URYR 3WLJA 3AUSA 1W96A 2GHQA 3Q8LA 2LCQA 2FLVA 4E21A 3QQ5A 4HYEA 1EYZA 2NLOA 4EARA 1DCMA 4XB6B 4HCJA 3S2GA 2VA9A 1E2PA 5B53A 4X8LA 3H9GA 4YEDA 1LDGA 1R4ZA 1UJNA 3EG5A 2H2DA 5EUQB 1R64A 4HXEB 1FNSA 2A88A 3RVSA 2QUIA 1YKGA 3FA2A 3NI2A 2OAGA 1PGQA 3C5HA 8GPBA 2JBHA 3MT8A 1T6BY 2HU2A 3OJLA 3LX8A 3X1DA 2R1ZA 1HLPA 1Q7TA 4DLUA 2DT5A 5F3DA 1KFJB 4G1CA 1I1QB 1KI9A 3CH5A 3JR7A 4QXRA 2C4VA 1AK2A 1H3EA 2OUIA 3RKSA 2CJYA 2DQ4A 4HQLA 3BN3A 4EVRA 1G1MA 1T5HX 1VBKA 2ID7A 5E2BA 3G8YA 4LYFA 3WRWA 4JLOA 1NI4B 4M3NA 1R37A 3A58B 5SZIA 1U7XA 2BWJA 1YBAA 2FCAA 4CDMA 1MMFB 3FPKA 3E53A 4EW2A 3Q3EA 5DB4A 2YIDA 1QNFA 4EUHA 1V71A 3IKTA 4I66A 5F3WB 1Y1SA 1LGYA 1I6MA 1WCYA 4EHIA 3G68A 1X19A 5E9QA 1NPTO 5FA8A 5KTYA 3RUPA 3I62A 2QMHA 3GYGA 2VHEA 3A2KA 2H4FA 2AFIB 4U5QA 3IDOA 3WIDA 5ALVA 4LFAB 2R6GA 2OXEA 1I0LA 2Q6IA 2Q1UA 2B61A 3GN1A 3O8NA 1XKTA 2XECA 4UDYX 3TQQA 4RHXA 4AZ0A 2O3SA 4YAGA 1QNLA 2ODQA 2ZDQA 4PLZA 5KX5F 4FWTA 1CUAA 2C0QA 4KQFA 4MWOA 4IQ0A 4XIIA 1HKHA 1CY2A 4L73A 4E6PA 4PE5B 4AWBA 3SHVA 4CG3A 3ID6C 2GEFA 3ISTA 3KXKA 3P2OA 4CMKA 3ACCA 1Z7YA 4NAHA 3R6GA 1KSGA 5F9FA 3GLGE 4JB0A 2EDAA 4IUCS 4HQKA 3QJGA 2VHYA 2PTGA 4RTNA 2JGJA 1GPH1 3K72B 4I55B 4HGRA 4FUTA 5FTNA 2H63A 4W5QA 3IMFA 3FRJA 1SUFA 3W4JA 3W5BA 1AHNA 1YS1X 2E4UA 4TZKA 4ZVRA 2QAGC 3O9MA 4NYMQ 4EHJA 3N87A 1A5SB 3O4VA 1EFRA 4WXMA 4BHTA 2NACA 2V6FA 3DDUA 3QGMA 3BJZA 3LBAA 3VPXA 3NC0C 1PSDA 1YONA 4KODA 4PG8A 5DLYA 3VZRA 4BTLA 1V39A 3Q8WA 4ZYZA 4CKZA 5JNTA 5IJ9A 1FMCA 5DSXA 1KS2A 2ZJ6A 4LJ5A 2Z8YA 1SXJD 3PEWA 4KG7A 2ZSBA 1UR5A 3CE9A 1FU7A 4HQOA 1MAAA 3ZHOA 3DWGA 4CLOA 3CEAA 1CS0A 1SXJE 2DFTA 2Q9AA 2VIIA 1JU9A 3A9SA 3I12A 1O54A 2M6RA 2O05A 3C87A 1HQCA 3DR5A 2YUIA 1JEAA 5HM6A 1HOTA 2C2MA 1FMLA 4FFLA 2WVGA 1W44A 4LHWA 4MJ7A 4XVHA 1FFWA 3KDAA 3VMFA 1IEQA 2HRZA 2GN1A 3NLLA 4XW2A 3W5VA 3WLNA 2YNMA 4IJKA 4HN4B 1RFGE 4CQJA 3MIZA 3R40A 3VOBA 4GPAA 2ZR9A 3VR6A 2HHHB 2GCNA 4WTOA 1QFJA 1WMDA 3TECE 4PPNA 1LF0A 3CX3A 3DONA 1T1JA 3B5IA 4LXTA 4BEVA 5AJWA 1JIXA 3V3KA 3V8PA 2VTBB 3TQHA 3M33A 5GM1A 2BUCA 2VO1A 3VR3A 2WZCA 2H1FA 4C0BA 5LYJF 5GZ3A 5DW3A 3QK7A 1KYWA 3D43A 4B80A 3RGGA 4TVSA 2PMWB 5KTMA 2X0DA 3RWOA 1P4SA 4YXWA 1FZTA 1W36C 3NTUA 4LXIA 5HGJA 1SKYB 2FZLA 3B3JA 3ZU6A 3ANSA 3O4JA 3AVTA 4F56A 2W6PA 1T8SA 4M22A 3PHLA 2NXJA 4QPPA 3JRNA 3ZWVA 4A4DA 5HE8A 1K4MA 5A4JA 5K5EA 1RC0A 3IBCA 4IJMA 2DJ5A 4U6SA 4NH0A 2BZ0A 2JLYA 2BGUA 4N6OA 2R11A 2ROQA 2FWAA 3VO9A 1GUYA 3OX4A 3ZS9A 4NQRA 4B6PA 4X66B 1DXYA 5IASA 4AJIA 1F8YA 3FVTA 4UVIA 1QHYA 2B1RA 2B7LA 1TRKA 3G85A 5IKEA 1LBTA 4M8NE 1DLJA 3QKTA 4M9SA 4OUKX 2C99A 1GTZA 1WHSA 1NLUA 2AEFA 2R5FA 2X4IA 1N57A 1X7HA 4MW0A 3IA7A 3KHKA 3BX1A 3H65A 1LSUA 1T5SA 2P3LA 3A6DA 4XX1A 4DDMA 1T5TA 4JBIA 1MVNA 2JJ1D 4Z3OA 4MEAA 5LVAA 3OZVA 1LLCA 4PLYA 7MDHA 1NXXA 2VPYA 3CLSD 2B69A 4ID9A 1B1AA 2OD9A 5PNTA 5C9ZA 4IIXA 3V7WA 5D5QA 5LU8A 1I24A 3D6JA 1E8NA 1YCDA 3EXHA 3GCWA 2OHHA 2DHQA 3GF4A 3FMPB 3K73O 1A88A 2WG2A 3G2PA 3OWHA 4L5IA 2QQGA 2R86A 1AX9A 4N5IX 4C3OB 3GGDA 5B57C 1S8AA 3MWYW 1Q1EA 5JAMA 3GNSA 5JY6A 2AZ4A 3UJDA 3BSWA 1HETA 2RI6A 3EWIA 3LW8A 3P45A 4PYNA 2NUBA 1PQ4A 4HPJB 4HEA1 3UXYA 3FBWA 4HAZA 4FFMA 2X19A 2WNIA 1J0EA 2ZCVA 5L3VA 1G7RA 1BWQA 4EWLA 1WZUA 1Z0UA 2NO9A 3RT9A 2YINC 3F7MA 3JQQA 1ML3A 4LPSA 4ENVA 4OQXA 1H42A 3R7BA 1NURA 1NFQA 2ODBA 1Y8QB 2CFIA 1EUQA 2HNAA 1TQ6A 3M9LA 3I9MA 2PX8A 3SOZA 1TQ4A 3NAZA 5B4UA 3LOUA 1MT3A 2W8ZA 1I3CA 4GMHA 2NPFA 4CKEA 1NHWA 1DXOA 1QQTA 1XTSA 3OM1A 1E60A 4RFVA 2IEBA 4JLPA 3MS4A 1WV1A 3BWEA 4FW9A 3NFYA 4X71A 1YFZA 2HYDA 3OE5A 2XZOA 4P83A 4KRGA 1HF3A 3V6LA 1EFKA 2NU7B 1JJAA 3CX6A 3E4DA 1E1QA 2H3HA 2VQ6A 4GWKA 3TSCA 5CDUA 2BHLA 3VC3A 2J3MA 4BU0A 5AKLA 3M5WA 1KRWA 4K0KB 2HOQA 3IC5A 4PG7A 3NYQA 1C4OA 5FUBA 3Q8MA 1CQJA 2EP5A 2VAXA 5ITZA 4Y9DA 4ZRDA 421PA 1BVHA 1KAMA 3PLNA 1RE0A 4R1QA 3LKZA 3DMYA 2ZROA 1W94A 2VDJA 3T7KA 2OY0A 3GFGA 3QXGA 4I3HA 3AFIA 4JI2B 3ND5A 5JE8A 3ICQB 2OORA 1HI9A 3WBBA 4C4OA 3UTCA 5B55A 2O8EA 3R6DA 3SC2A 3C45A 3EQ8A 2YHIA 1WABA 1T2VA 1LS6A 5G0UA 3FUXA 3SQWA 4F8EA 1TZKA 3QEKA 3HV0A 2YS7A 3VAAA 4YIHA 2EG5A 1U7HA 2CLLB 3DHNA 5HM8A 3CSDA 4A3SA 2JCGA 3RBXA 3OZCA 4RM3A 4HY3A 5DZSA 1R3DA 3DC7A 1XRLA 4LV6A 4U2CA 4BECA 4KMOA 4CM9D 3C6ZA 4LZAA 4UATA 2EFGA 4XIJA 4UVEA 4UPEA 1F3LA 3SC6A 2OAEA 3VKWA 3E9QA 4RFLA 4YMTA 1TJNA 4YRLA 3BORA 4MRNA 5I8ZA 1II8B 2A92A 5K09A 1Q1ZA 1YOBA 2P27A 1OTYA 3BCSA 3HA2A 4EG3A 4U2KA 4M87A 1ZESA 4PPFA 1R2QA 2BIFA 2OMKA 3N07A 4ETNA 1QIKA 3KXIA 1JIIA 1Q3HA 1PZHA 1V4NA 5JH7F 5L7TA 4Q9DA 4DY4A 3H6KA 5DSTA 2F59A 3BRSA 3VHLB 2Z3VA 1BS2A 4G0YA 3KKKA 1RLJA 3KV3O 5G0TA 3VKGA 2O8CA 1QK3A 3LDFA 5DX0A 2G4LA 3WTBA 3PC6A 4PBTA 3TJZA 1PTKA 3DP7A 4MQ6A 2XVZA 1RR6A 2DUJA 4JX9A 1QG6A 3ZV4A 2AN9A 3T0IA 1ZYUA 5DXJA 1CUIA 1TF5A 3ULKA 2RGUA 4HX5A 4A03A 3RG2A 3TPFA 4BYMA 1AB5A 3SX0A 4DMGA 1ZCAA 2WT8A 5AUNB 1PT8A 3Q6MA 3RJMA 1Y4AE 4DXAA 1II9A 3JYHA 1SUIA 1GG5A 1YE8A 5CK5A 3WMXA 4OHKA 2W43A 3RVNA 3ZNNA 1EGHA 1WETA 1XLVA 2F9LA 2HFJA 1X3SA 4M88A 1OXMA 3GLVA 2G9VA 4BASA 4F92B 2ZBEA 3I09A 3EEYA 4IEFB 2PG3A 3I30X 3IUYA 3VTKA 1O8CA 2CYCA 4LW8A 3OX1A 4ABTA 2C29D 3JQBA 2Q3CA 4ZCIA 3UJPA 2I91A 4POAA 3DOCA 2WVHA 3RAGA 1DB3A 2AUTA 5AM0A 2KBFA 4O8CA 3ZYZA 5B6JA 5I4IA 1AUVA 3IUQA 1I3MA 5DGDA 1S2NA 2QTCA 2VK1A 4QX6A 4AJPA 1O95C 4H7FA 4J1NA 2OXIA 5J4YA 4DIDA 1K5PA 5BWLA 3R44A 1BN6A 2F1HA 3P9XA 4ZAWA 1A8QA 4HAWA 2W8BB 3T52A 4GH5A 4ZOBA 1UJ4A 1ENYA 4L4ZA 1P8AA 3BSYA 3FPGA 4UBOA 2EKQA 3MWGA 2R87A 3HCRA 4R2HA 1UXIA 1R6TA 4GR4A 3L3BA 2E1RA 2A57A 1U2ZA 3AF0A 5K0ZA 4JMPA 3IIMA 4B3TB 1NZJA 4QYMA 3R5SA 1QRAA 3KBOA 4KR9A 3P9NA 3VH3A 4ENWA 1SU8A 1SK8A 3F1KA 2DB3A 3ANTA 3CEPB 3STUA 3RADC 3TWOA 1MR3F 3QE9Y 2ZRQA 4PYOA 5A6VA 1GYPA 1O5IA 2QAGB 4RH3A 5FTJA 2HV8A 4PG4A 4WQMA 4YA6A 4F85A 3SZLA 3GBPA 1QAOA 4KQHA 4BLOA 3IJRA 3NOXA 4ND7A 1QWSA 1LI4A 3IP3A 1LX6A 2I0FA 1COWD 4P3XA 2ZPAA 3VBEA 2G3YA 4FMDF 1PQUA 2Y27A 2EGGA 5GADl 1Z4LA 3O2NA 4RQAA 1RM0A 4GOND 3DFKA 4QHSA 4D57A 2QDKA 3BEDA 1OTHA 2LE0A 2OUKA 2R5WA 2V55B 4FLEA 5ALPA 5C5CA 2WFLA 2PM8A 4EL0A 2ZRJA 2XYPA 3MF4A 4NBNA 1TCBA 2W2NA 3L7OA 3IKJA 3U0VA 1IOWA 4KGDA 2QYOA 4AVYA 1D8AA 4QZVA 3SQMA 1PD1A 2VSNA 3FWZA 1O1YA 2AGVA 4UNPA 4AJLA 4BAZA 5ADVA 4JU9A 3QIAA 1ORHA 1ZM9A 1QBGA 1UZUA 2J45A 2OE2A 3ZBPA 1CK4A 1HLDA 1Q7GA 1OT5A 2WZQA 1U3UA 2AHOA 4WH0A 5HBGA 3PQEA 5BOVA 4RNCA 5AW7A 2P8JA 1UBGA 4RGVA 4M0UA 2R6R1 1HX7A 1CY6A 4X6LA 2ZYVX 1Z8NA 1WZNA 1RVDA 1XG5A 2YCBA 9GPBA 5CB8A 3VQTA 3GP3A 3RYCB 4YT4A 1T26A 4LYDA 3LW7A 4L8WB 3V5NA 3DWIA 3UMCA 1LY1A 2FR1A 5LMZA 1ZU4A 2QV0A 4G65A 4TRNA 4OYLA 5LZ9A 5B3AA 3KJNA 4WK0B 4LC0A 1DAHA 2QRHA 4EDFA 5U9CA 1GL7A 1TIBA 3AF5A 2XPCA 3GFBA 1OLSA 1NU6A 2E1PA 4PGFA 1I6KA 1U1FA 2AJBA 2QVZX 2RGYA 1NBMA 3MYYA 3PP8A 3BA6A 4FFVA 1T1EA 3BQMB 4IY1A 2FZCA 4JQCA 1P5JA 1YB2A 2IZ0A 3I73A 3O8QB 4N3GA 1ORWA 4W99A 5C1IA 2ODWA 4CU5A 4NS1A 2Q3EA 4KH1A 3X1ZA 1WPQA 2XV1A 3CUWA 5EZYA 3TZHA 1FX1A 1GZUA 1MDFA 1T1RA 5HOEA 5JC1A 1ZAKA 1IFXA 4LRXA 1BXZA 2ZITA 2BR3A 1YHZA 4K1XA 3THWA 1T3HA 5EA2A 1HYQA 1LTHR 2VT3A 1GNTA 1UKCA 2NUPA 4JVSB 3LUGA 4QPCA 4Y2QA 5A3QA 2HHJA 4EVQA 3WJAA 2J08A 2XMRA 3NVDA 1N5KA 5EKTA 4DRYA 4XR4A 2YNMC 1QHFA 1QYDA 2UUOA 5C51B 3KT6A 4F91B 4WHMA 1BDHA 2EFHB 1AXRA 2QR5A 3HO6A 2Q5HA 1YE5A 3DWEX 5I8PA 3ILVA 4EEKA 2CXXA 3KKQA 3IX7A 2ZTMA 5FIUA 3JQ7A 3EGXA 3V00A 1BX1A 3INYA 5A6SA 3MMXA 1NBOA 3RNOA 2D2FA 4Q4AB 2C2BA 1OBOA 1A97A 4RZUA 7AT1A 4L8YA 4Q3BA 4A8JB 2ECQA 3OCYA 2JLAA 5E3IA 3LCRA 4HDKB 3IOBA 4QBTA 1WR8A 3WWDA 2V7GA 4Z8XA 3LP6A 4KE8A 3K6SB 2B7BA 2OCGA 3BFPA 1VL6A 4Y9RA 3T12A 1Q17A 4X9XA 3GQBA 3KHUA 3PT5A 4CV1A 4NCXA 4DTCA 2NO6A 4CT0A 2WU0A 3GJTA 4YASA 1N0IA 2OK7A 3T5GA 4D41A 1DRWA 3ESDA 4TSKA 1KIMA 4UTNA 2FQQA 3CXUA 4W1QA 4K3UA 4DCUA 5AJTA 5DTRA 5DT9A 3DYIA 5DIFA 5U4XA 1P2UA 4RK5A 3EQ2A 3S8YA 1JFTA 1PEAA 4U7DA 1X14A 4E5MA 2PCLA 2GYVA 1SHZA 3OOWA 4GRAA 3VHXA 5L6MB 1CETA 3IT2A 5KBYA 2Z2KA 5JQGB 4D81A 4FPXA 3LVQE 1AKMA 1OI2A 3W8RA 4YYZA 1YQWA 4JLNA 3IE1A 4IZIA 3I0NA 1M75A 5JJIA 2MINA 3E82A 2HLNA 1JS1X 2JKVA 3CZAA 3KDPA 3IMGA 3U62A 2OHXA 1RYNA 2RGDA 4CIBA 1E4OA 4W1SA 4TT3D 3OFNA 2B4RO 1XQWA 4HFJA 2QN9A 4UOEA 1R0WA 3IAS1 2PIDA 5DCUA 1TVKA 2Y0CA 2XIJA 3HHPA 3ZJVA 4QICA 1VXOA 1OILA 4R41A 4YMIA 1Y9AA 4EHDA 3GFQA 3UUEA 3EFHA 1KJJA 1XXLA 1NUTA 2I87A 2MOKA 3VR2D 1Y5NA 1P45A 4ZVPA 4WNAA 4FB5A 2HXYA 4MCHA 3M49A 2JHGA 2MYUA 4BO8A 4MULA 2ZJ5A 3G8BA 3S68A 4BVBA 3PPYA 2GXSA 4HHEA 3EH1A 3NIFB 1JHOA 3H6HA 3ZNQA 1NYTA 4FONA 5K4HA 4BO3A 4MQBA 3GA0A 3SHQA 4B33A 2Z1NA 1QO9A 2RGRA 4LJRA 5LLSA 1SVSA 1ESEA 2O8FA 1UDBA 2ZVPX 1NR7A 4BWFB 5SY9A 1X74A 3CUSA 2NVUB 4B3GA 2JFHA 2IHUA 4XARA 3RROA 5TQ0B 4X7RA 1U11A 2KMLA 3QLUA 4YP1A 1NXQA 3PZRA 1F6WA 1UIMA 2HC9A 4CLEA 3H2JA 3F47A 4YV1A 2JHAA 2XQJA 1GZVA 4GOKA 4HXFB 3ACDA 1K6IA 3OQVA 5E8RA 1E6KA 4ZVQA 4F84A 2GH1A 3IEVA 4UM9D 4A0SA 3FXAA 2WINI 1RAHA 2P4UA 3HJBA 4Z86A 5FOWA 4ER7A 5JSZA 4AI6A 2QNRA 1KHHA 2PMBA 1A7JA 2IYTA 3MEQA 1O6GA 4FGUA 2VNSA 5CPFA 4AC9A 3FR7A 2G04A 1ZP6A 4KBYA 2QVYX 3RJTA 3A1EA 1JT2A 4QO8A 2NZ8A 3F7TA 2CF5A 2CCKA 5IJ0A 3NWOA 3H9CA 1DS6A 3FZEA 2NSHA 4JJ6A 5DLDA 2X0JA 1FFCA 3GEHA 4LI0A 4BNHA 3NJRA 4JB3A 4NNPA 4RD1A 4CUKA 3B1JA 2QJWA 3OKPA 2OORC 3LKDA 3R5XA 4BATA 1HNNA 3G2HA 2LDBA 1K5HA 1ISRA 1I7NA 2ONCA 1WEHA 1NLFA 2PZJA 2XTZA 3CLRC 3HWX1 3LX6A 4MS4B 1ZVQA 4MVCA 1ZFNA 3FAZA 4TV8B 1SUWA 3U3RA 1RKVA 3OUTA 4EEZA 5CNMA 1HORA 2GF0A 1HNZB 3U61B 5F2EA 3CISA 3TFQA 3WNZA 1Z4OA 5CYFA 1FXWA 3IMEA 4LJ7A 3D4OA 3WK9A 3D8SA 3DE5X 1CUBA 2WDZA 2HJWA 1VKHA 3E9NA 3ZHUA 2VCYA 5J47A 5FOQA 3MSXA 1ZN2A 5IM4F 2QTWB 1H9AA 4PCVA 2GBPA 1S2IA 1A2OA 4FHCA 4I9HA 4B6OA 1ZRSA 1NUHA 3NXKA 3U7IA 1ZUHA 2WA2A 3T3EA 1FXUA 1GPJA 1XP8A 5IKXA 2XMGA 1X7YA 1YR3A 5JCJD 3UQZA 3FZQA 2B21A 5TEWA 2P9YA 4EFMA 2QUBA 2W7TA 3KLBA 1RYHA 3SJUA 1X7XA 3FFTA 5KYTA 1E58A 1NZDA 3IPRA 2PZBA 3HKCA 1X7ZB 4K1LA 1JR3A 3U48A 5A1JA 2QF7A 2VEOA 3A4YA 4OKNA 5AW0A 1OKKD 2VP3A 3P19A 4C29A 3G0IA 3VPHA 5JSYA 1QCDA 1J1UA 3TE6A 1P2VA 2WUVA 3PZBA 1RI3A 4KQ1A 4M0LA 4XLLA 1U28A 2JAHA 3JWIA 3OC6A 5DBFA 2DY1A 3L01A 2GF2A 4B4DA 4AJ2A 1NV9A 1HC7A 1X77A 1RPJA 4OFBA 4XEUA 4F7WA 1LC3A 3H6GA 3LNCA 5AXAA 1YMQA 2A33A 3DXZA 2IP1A 3PYXA 2ZRHA 4CTKA 3LC7O 5DM70 4ARZB 2DFLA 3SMQA 3S2SA 2OHIA 4BNXA 2HJ9A 4LQLA 3V2HA 1P60A 2PEYA 2B4QA 2XE4A 3X44A 3D3NA 3E5NA 4ZAXA 3EWSA 2W4QA 3JQBC 1WCWA 4TXNA 3O8CA 2AEJA 2YXLA 4NS4A 3S81A 4Z1MD 3OM9A 3RSSA 4U6QA 3I37X 3U40A 5F2NA 4FUQA 4WZAA 3OMLA 3ONNA 1Y6FA 3ADBA 4GE3A 4XJTA 4JLKA 4OA5A 3O84A 2V45A 5CX1B 2LTAA 4M8SA 4LRYA 4EZEA 2POCA 3MGCA 5HR5A 4J7CA 1OPXA 2CJPA 2FY8A 4FN4A 1W1UA 2JNWA 4GLLA 2ORED 1YB5A 4PVCA 1G3UA 3L1UA 5F73A 4I1IA 2OCXA 4Z7NB 2A9JA 3HU5A 4TKMA 1QIFA 2P0YA 1UMKA 1BXRB 1WTAA 3E84A 1CIJA 3R0JA 4CZ2A 3RWMB 1YDEA 5AJXA 5INTA 1GG8A 4HBGA 4P4UA 1OZGA 2AZXA 2B2NA 5GMOA 2BAGA 3A7DA 4ZJZA 3U4QB 4NOLA 1M1NA 3K4HA 4JBYA 4BNDB 1G0OA 4IDOA 4BMSA 1KZGB 2ZKLA 4JZKA 3SIXA 4DBLC 1RC8A 4Y3UA 5B5SA 1DZ3A 2WAYA 3WOHA 5HQJA 3CTPA 3GPBA 5AW4A 1EDOA 4HMPA 4WBNB 1R74A 2XNCA 4KOAA 1EGMB 1ZJJA 1XNRB 2F9MA 3N76A 4LHXA 5CLFA 3ZDXB 4CM4B 1IK6A 4DMUB 2BI8A 3ZKAA 5TT1A 4P7GA 1KY2A 1B93A 3U4HA 5KNBA 3AUJB 3B6MA 1EWQA 1KK0A 3BS4A 2GZSA 4G0PA 3STWA 4YP5A 3OY2A 3HFRA 3AFGA 1E1YA 5E95A 5F5XA 5A9TA 3V4ZA 3KQYA 4EKIA 1PUJA 4UUBA 4AKSA 1PEYA 1WVMA 1JPUA 4ZZ1A 3HN6A 4RLSA 4GSYA 4IDCA 1SKAA 1SURA 1XKLA 3VYWA 2CB9A 2CNWD 5CA1A 2PD4A 1HDOA 2P7IA 2VSXA 3HBAA 4FDUA 4DLAA 4N7JA 1L5QA 1FMTA 4KV7A 3OETA 4C7XA 3R76A 3ZEAA 1ES9A 4HB3A 1E6EA 1HG1A 4EY8A 1THTA 1G4AE 3IUEA 4LKOA 2Q0SA 3IEIA 2A8YA 1ZX1A 3K31A 4GI2A 5DISB 3ZWQA 4G4IA 1N3BA 3D6MA 1N7JA 2AKAB 4XDYA 4QYIA 1JEYA 1JHDA 2FEAA 5K3SA 4MHTA 1YS2X 4RKYA 1U0SY 2EFEB 3ZCRA 3OIVA 4LOKA 1TTPB 1Q6YA 2UDPA 1Y8ZA 2PVPA 1W47A 4E2XA 2O54A 5CDYA 2GWHA 3RDPA 3NW9A 1Q1GA 2GUGA 2MIIA 5F1KA 1VRWA 2VOEA 3I4CA 5C80A 4FZRA 4IDHA 4WXPA 1Z2NX 4PO9A 2WTEA 2YMQA 4G8JA 2VI5A 4TTRA 2AMVA 2YIMA 1BVYF 4J6FA 4EMSA 2GB4A 4LBVA 5AKEA 1K9SA 2GLUA 1L7MA 1D07A 5FCDA 1IULA 1PS9A 3AI7A 3H0KA 3AVQA 1RYFA 3GJZA 5CFOA 2CYBA 2W58A 721PA 3VSAA 1QGZA 4MLCA 4L4XA 2GZMA 4QTZA 1N2GA 1WUJS 2RBKA 4BWVA 1E3SA 2P6MA 5BOSA 4FBMA 4RHFA 1K0UA 1YRYE 3T4EA 5M04A 4ZVMA 1R8SA 5CG1A 1V26A 2QXYA 2EERA 3VYUB 1NW9B 2ZFUA 1JBKA 5EMJA 4N8EA 4M76B 1EFPB 1W9HA 2HBYA 4UVDA 5AW2A 1ZD2P 3SXUA 1WVIA 3AM4A 5KOJB 4LXXA 5FBVB 3KKPA 1A3CA 3K5IA 4YRDA 3T3IA 1FS4A 2H7XA 3EFBA 3V42A 4RTJA 2IF0A 2WIGA 4NU5A 4CUJA 1Z0IA 1OIXA 3MG9A 3O1JC 3P5SA 1ZGZA 2EQ5A 2R68A 4JOCA 1FYVA 1YKFA 1KPGA 1T0BA 4Y2UA 4EJSB 1JH8A 2OESA 4WOCA 4WWHA 5AOVA 4MITA 3IKMB 1N3LA 1QK4A 4B09A 4EATA 3SEFA 4LZZA 4CIWA 2WMNB 1WTCA 1Q83A 1RMQA 1YDGA 4JJKA 4Q1BA 2Y93A 4RHCA 2AF3C 3C7AA 3ADOA 3EBPA 4XYGA 5F1OA 2H7VA 1E9VA 1NVFA 3KL2A 3MWDB 1HURA 1QLHA 4J4BA 4NZYA 1JR4A 5AVVA 1LNZA 3FWPA 2XA9A 1I4WA 1L5MA 3I04A 4KLZA 2JZCA 4P82A 2BGNA 2C2ZA 3GLTA 3FYUA 3NBUA 4WX2B 1MOSA 2BM9A 2PKQP 3I6BA 3X1XA 1XCPA 2EJCA 4ROTA 4A92A 3IQIX 2CNLA 4MV5A 5F5NA 4QAJA 4YB8A 2VYVD 3UM9A 1CWUA 3Q0IA 2UXDB 1O87A 3E0XA 2XRZA 3I53A 3S27A 1VJ0A 1WNFA 5J4LA 4G24A 1CUXA 1FRVA 4PZLA 1OROA 1QTIA 3OCZA 3PBKA 4WEQA 5CP8A 3AZQA 1SN7A 1YZYA 5ESRA 4CMBA 1G9SA 3GOQA 4U39A 1QQ6A 4P4SA 2E89A 2HBZA 3DEIA 4ZN6A 4L27A 2ZWIA 3WYGA 3SC4A 1F14A 4Y18A 1T15A 5KB3A 4ZZ3A 1N3YA 1PK9A 3MTDA 3D31A 4PINA 1I3KA 4G4GA 3VVBA 4RADA 5MN4A 5A4FS 1BA3A 1IUOA 3H1PA 1GU1A 5FAXA 1TLFA 2FW0A 3K0FA 3QJYA 5A7FA 4JJZA 4E94A 1JMVA 2YJ6A 4M6WA 2GBLC 4UU1A 4DV1B 4Q47A 1ZR4A 3BC1A 4G5QA 3G23A 3EQ9A 4D9GA 1VSBA 4MQFB 3Q10A 5EFZA 3AKEA 4CKWB 1SBYA 1U3DA 2EJWA 4TMYA 3NOOA 4KO4S 3HLKA 1OBVA 3KKEA 3L40A 3BMNB 3CM0A 3VI3B 2PQ0A 1P6QA 1EAMA 1GRNA 2A9QA 4YIKA 3N2EA 1YQGA 4X1OA 3KLPX 1C3OB 4A2CA 3ZV3A 2Q9UA 5T57A 4MGZR 3MAJA 4Q9AA 4L4YA 4RWZA 4YPOA 3P26A 1KYZA 2MSEB 4XTCS 4GVXA 2BF4A 2AE1A 1BMFD 3ETCA 2FN9A 1TYZA 3OM0A 2UYGA 3WWCA 4CLHA 3VC1A 1PDVA 3QF4A 3F71A 2Y77A 2IX3A 3FPFA 4MVWA 1P1CA 4B4KA 4PPGA 4EG4A 2AG5A 1DT3A 1QF7A 1WDKA 3QKUA 4K6GA 4B73A 1XMOB 4INPA 4KVFA 2AJDA 3TLAA 2NTJA 2PX2A 4FW8A 1KI1A 1E9SA 1CJSA 2OXCA 2F7SA 3F67A 3IQZA 4YJKA 1BE6A 4ZZIA 4X7BA 3EJ6A 3JWGA 3B8EA 3LCVB 4FU0A 2NWQA 2BGTA 4I0WB 5JG7A 2I22A 1F1BA 1RMTA 3OTGA 4IMPA 4BPBA 3H9EO 1DINA 9LDBA 4FYYA 4EHHA 4ACBA 2PIAA 2H1HA 2B34A 3IOYA 4YDSA 2PLFA 1V9CA 4N5HX 1D1SA 3ELYA 1WZ2A 1M6WA 2B3TA 3ZE0B 4HH4A 5K8LA 2B8JA 4OHOA 1CV2A 3OC0A 1XCJA 2PT5A 4IMRA 1SA0A 2FMUA 2IYYA 2VNHA 4TYQA 1J1IA 2D54A 1E62A 3CG0A 3DKVA 3K53A 3GY0A 3W04A 2HQ1A 1G98A 5BT8A 1M8JA 2ERYA 2ZDHA 3PYMA 2FRDC 2OV3A 4GKBA 1VKZA 2X0KA 3QMMA 2ET6A 2FZEA 1FLDA 3MLAA 3GLGB 2Q5EA 3F6YA 4MUGA 3AU9A 2C9YA 4W6QA 4EYSA 4MWTA 4D44A 1T4GA 3VH1A 4EAQA 4DIOA 4A36A 2X58A 3AEQB 1YIAA 1I3LA 3VSCA 3PQFA 3TI7A 3PK0A 4F7DA 1L7DA 5LKAA 1DX9A 2Q1YA 1GGVA 3H8JA 4ANFA 5IDXA 5F3RA 2DUNA 2RHBA 4TYYA 3UPUA 4L74A 1NQAO 2R1VB 1M5RA 1CQIB 1Z4IA 4QU9A 1HT0A 2WKRA 4DR5B 1IZ8A 1EE9A 4RZIA 4BRZA 4C0KA 1GG2A 5AIAA 1T4CA 2I6GA 2FE4A 3LYUA 3Q3VA 3TOXA 4D6XA 3UGJA 1V7QA 3RC7A 2UV8A 4ZV7A 3SS9X 1MP0A 3IA2A 2ERCA 2H00A 2I3BA 3HR4A 3S6JA 3U49A 1SXJB 3DE3X 1G21A 1XZCA 2XJ9A 1ONOA 2ECFA 2WSBA 1NVVQ 2JKZA 1JECA 1YJXA 2WJGA 3QY9A 4GF5A 4TMZA 2XDAA 4PRKA 1KDZA 3CIFA 1B8PA 3C3EA 5GGYA 2WG0A 3JAWA 4U7WA 5HQ3A 2I62A 3HBNA 1Q12A 1PUXA 2GERA 3ACBA 3PXXA 1GOTA 2CNOA 4HNHA 4I9GA 5AICA 5IK2D 1U9IA 2Q7OE 5FEMA 1FFXA 2C5SA 1T0PA 1VHLA 3EIEA 1E1MA 3OEED 3QHQA 4EYQA 1MEJA 4CYMA 1J2TA 4C4ZA 4EO9A 4OIFA 1H6DA 4TM8A 2CZCA 2NUAA 1TA9A 3K4QA 3O74A 5DW0A 1E3LA 2FTKE 3IBFA 3T8YA 3WLOA 3C6QA 3FOWA 2XQKA 2HTFA 2QOEA 3E8XA 2WU1A 4NONA 4KUHA 3P9PA 3UJ3X 4UASA 2RGXA 5JFTA 3F4KA 3EZYA 3NYWA 4IZHA 4MUIA 5EIEA 3FKSA 1JDJA 1F8UA 4JUDX 4WK6A 5EPEA 5C0OE 3AKYA 4DKJA 3R1IA 3PHJA 3OQ6A 4BB9A 1C8KA 4NFLA 3G5AA 4X97A 1O0BA 4IVNA 2O2CA 1UBLS 1S6YA 4OHPA 4PSUA 1JW9B 1UBJS 1A9XB 4XUGB 1MH9A 5EKSA 3SKVA 4JWTA 4R0MA 5IPFA 4GSKA