4CLHA

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
267
structure length
252
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGKTVETQVAELIGTNAIAPFLLTMSFAQRQKSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
molecule keywords PTERIDINE REDUCTASE 1
total genus 92
structure length 252
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4clhA00
1PR9A 1B7GO 5IZCC 1M2WA 5B12A 2IRWA 1XG5A 2Z95A 1NPYA 4J49A 3ANNA 1N8KA 1H6AA 2IXBA 3NT4A 4JLWA 4BNJA 5IAAA 3WGHA 4YRBA 1ZSYA 3PIIA 4E13A 4RPHA 4PLFA 1Q1NA 4WLFA 2QZ9A 1N2SA 3GN1A 1CYDA 1UDCA 2GYYA 5H81A 2NU7A 3E03A 1GUZA 4PVCA 4PLWA 2B4QA 3RC9A 5JYEA 2VCYA 4J1SA 4YQZA 2EKPA 2DAPA 4IDFA 1F8FA 1O89A 2IEDA 4FQ8A 1ZK0A 1EBFA 4FD3A 4R4JA 3WGGA 3MCVA 3QRWA 4NG5A 5B4UA 2FPPA 2XXBA 1E3JA 3LZ6A 1CJCA 4RVGA 4YAIA 3FNEA 1W4ZA 1DFGA 3AI1A 1Y5RA 5L7WA 4BMVA 1GTMA 2O4UX 2YQ4A 3IKTA 3D4OA 5BT9A 3V8BA 1PS8A 2IZ1A 5L4SA 4DIOA 3EMKA 5AYVA 2B83A 4FJ1A 1DSSG 3GFBA 4BNWA 1XHLA 2UDPA 2C59A 3ZNQA 1DLJA 2NU9A 4DMMA 3CMCO 4NJMB 4CPDA 1MX3A 3TZHA 3V2GA 1UH5A 3PHHA 1OC2A 2J3KA 3UN1A 5JAZA 4TQGA 4EUFA 3ITDA 3RAJA 4RF5A 3UCXA 2FMUA 1G0NA 4WLVA 2G5CA 2YFHA 4X54A 4Q3BA 1KETA 4CV0A 2GSDA 2I9PA 3EGOA 3G1UA 1DJNA 2GN9A 4ROSA 1YDEA 5JDCA 1FDUA 2AE1A 3FR8A 2C07A 1YS4A 2AEMA 1DIHA 2CVOA 1G0OA 1HDOA 2QX7A 1D7OA 4PLHA 1IZ0A 1UP6A 2O23A 4YJHA 1EK6A 4H16A 4HV4A 1FK8A 1OAAA 4HNHA 2J5QA 1UDBA 2I65A 3LT1A 4M89A 3MEQA 4DA9A 4BHTA 4CLDA 5COAA 1KIFA 2AMFA 3FNGA 1FMCA 2G82A 3LT2A 2AEJA 5B4VA 3PWKA 1JKIA 4EI2A 1E3IA 2PKQP 1RJWA 3VH3A 3P2YA 4CUKA 1ZEMA 1DLIA 1MC4A 2OGUA 1PL6A 2C0CA 2EGGA 2IYPA 3DHEA 4JQCA 4UVGA 1I3LA 2ZIZA 5JXWA 1CWUA 3VOSA 2C82A 1ZEJA 3WQQA 1F17A 1H9AA 4KQWA 3WLEA 4CMBA 4RQUA 4YDRA 4KWHA 2P4QA 4GX2A 4JGBA 3CZRA 2PA3A 3KYDA 4WASA 2VQ3A 3EVNA 1RWBA 4Z9FA 5F21A 4I5GA 3DMYA 1A7KA 4GWGA 3ZWXA 1H94A 1B3BA 1MC5A 1X1EA 3GAZA 3LVFO 3OFSA 4LVCA 3W6UA 4E31A 4BNXA 2QIOA 5K0ZA 1E92A 4MO2A 1V35A 2PLAA 5EERA 1PJCA 1RYDA 3O4RA 3GQVA 3O9ZA 1PQPA 1CERA 1HDCA 2ZKLA 3H5NA 4WPGA 3GG9A 5JO9A 3WLFA 4OOEA 2HKIA 1JWAB 4BMSA 4FGSA 3WFJA 4OMUA 1WP4A 4BGVA 3CPSA 5THQA 3KLMX 4XJSA 1LSSA 1QRRA 1LU9A 1GQQA 3JQFC 1S7CA 3Q1LA 4D0RA 4XKJA 4EEXA 4NQZA 5LDGA 1ISJA 2QQ5A 1XDWA 4W9NC 4B4WA 1WVGA 3JYQA 3U4IA 2JFGA 1YGYA 4BL5A 2FZEA 4Y8VA 2HCTA 4MP3A 2EGHA 2BD0A 1DAPA 2WSBA 4HWKA 4XR4A 5U4QA 4ZA2A 3VPXA 1YO6A 1YXMA 3GRKA 4FFNA 4YA6A 4GL4A 3ZU4A 2A9FA 4MIEA 3PJEA 1HYGA 3DAGA 4WECA 1LJ8A 2AA3A 2WYUA 1A9YA 3LF2A 4J4BA 3T7CA 3V1UA 1MV8A 1ISHA 1WDMA 4ALLA 1HL3A 2D0IA 1PGPA 2OXIA 3GLQA 4ITUA 1HSZA 1TT5B 2HDHA 5FWNA 1M67A 4NFYA 4W9NA 3RU7A 4PLZA 4ALNA 2Y1GA 3CZMA 5C7IO 3DOJA 1ADGA 3PRJA 2EG9A 5AOVA 5K6AC 2UUPA 4F3YA 4F46A 5H82A 4YB8A 1QXSA 3TZQA 3UF0A 4LK3A 1LEHA 2VTEA 4GGPA 1AUPA 3GC6A 4IJVA 3RKUA 4JIGA 4I5FA 4UEKA 4DVJA 3ENKA 2I3GA 3HDJA 2IEBA 3WGTA 2Y93A 1NPTO 5L3ZA 4Y9DA 5AXCA 4CM8A 3HB4X 2RBEA 2R6JA 2VUSA 4PFJA 4D79A 3OEYA 2D3TA 1I10A 4L9RA 4K28A 1ML3A 5LCXA 4IM7A 1YKFA 1Q2XA 5G0TA 4FPXA 3INTA 4E2WA 1LI4A 3MJSA 4CR8A 2QZZA 2DFDA 3VPSA 4E4YA 1NFFA 3HFSA 3FRJA 4OGWA 4NK4A 1GEEA 2VTDA 2P9GA 4XDZA 3ZWAA 2GASA 1E5LA 3HHPA 1X1TA 3QVTA 1ADBA 1HWYA 4URFA 3BIOA 1SEPA 2QHXA 3E5MA 3DMTC 5CPBA 3K2EA 4PZDA 4NZ9A 3VTZA 1CIVA 4CM8B 3FWZA 2E4AA 1K6XA 1ZVMA 1H6CA 1PTJA 1QV6A 4LRTB 2F00A 1O8CA 2RAFA 2D59A 2A35A 4PGFA 4HP8A 2PD6A 1U5AA 5KWEA 4XB2A 2CDBA 3TOXA 1NQTA 2VN8A 2JD1A 5KIAA 1YH3A 3RFTA 3EAGA 4DQUA 3GVCA 1H93A 3DDNA 3IKVA 1DHTA 2ZATA 4GPD1 3WQRA 3OQBA 4GX5A 3DONA 4FIZA 2VWPA 1N92A 4CMGA 1XA0A 5A3JA 5CEFA 2PNFA 3CINA 5JDCC 3AUUA 4AL4A 4EITA 4Y67A 1MA0A 4XIYA 5CEJA 4YWJA 1U3UA 3JSAA 5JNLA 2XXJA 3HB5X 5A1TA 2NTVA 2WYVA 3BYZA 1NR7A 1HZZA 3U3XA 4E32A 3KRTA 5L9AA 3KHUA 4RZHA 4LMPA 4IMPA 5DN9A 4XRRA 4QECA 1KERA 4JROA 4MVJE 4U7WA 3R3JA 4YT4A 4J1QA 1QYVA 4P4LA 1U5CA 4YYZA 3ETEA 1T4DA 1B15A 1Z82A 2X4GA 3KEOA 5DP2A 4NMHA 4NBWA 3X2FA 4RQTA 3Q0EA 2B5VA 4IIUA 3L07A 2OL4A 4E33A 2R00C 4CLOB 1E7SA 3FTPA 4LCJA 1UR5A 4ZQFA 3I23A 1NHWA 1TT5A 3IUPA 3TL2A 4MVJM 4CODB 1I3NA 3AOGA 3JTMA 1GUFA 3WGZA 2WE7A 4AJ4A 5KOIA 1YL7A 1B0AA 2GUGA 3TNLA 1LRLA 1UXKA 2PZKA 2IZ0A 1R15A 1T2FA 4UVIA 1DC6A 3TZCA 2VT2A 3H5AA 4I08A 2O4CA 4E6PA 4E5YA 3E9MA 4B8WA 2P4HX 3UAGA 1CEQA 3JQGB 4BNGA 3G49A 3KB6A 1B8UA 4A03A 1HE4A 7MDHA 2X23A 4RDHA 2FHSA 1PJ3A 2NTNA 2PGJA 5BR7A 4FFLA 3I6QA 2C2XA 4D43A 3WGQA 1R4MA 1D1SA 1EQ2A 2YW9A 2B4TO 4B3IA 5JDIC 2GN4A 5JCXA 1F0YA 2NLOA 1B8VA 1ULUA 3E1KA 2P5YA 3S2FA 5TLSA 1BTOA 2JFFA 2B35A 3HWRA 5EQDA 3ICPA 1LRKA 2VHVA 3SEFA 4Z3KA 4K9DA 5T64A 5G4KA 3OJ0A 3RUHA 2X22A 2EF1A 2VOJA 4BO1A 4DBZA 1V3TA 3JQ7B 3WG9A 3AWDA 4CM7A 1E6UA 3EC7A 3HFGA 4DWVA 1E7MA 1OOEA 4Y98A 3P5SA 2HAEA 4WNCA 4PLCA 1R6DA 3WMWA 3NYWA 3PK0A 9LDTA 2HK9A 3DO5A 2VYVD 4QTZA 5ITWA 1M75A 3I9LA 1WDLA 3LC7O 2O50A 4L75A 3B6ZA 3JQ7A 1P1HA 1P31A 4PN3A 3ZZNA 1NBOA 3V5NA 3GR6A 3TF5A 3DBLA 3QWFA 1FF9A 4DPMA 3VPHA 4F6CA 1ZH8A 3T4XA 3LT4A 2DLDA 3AI3A 1X15A 3F6YA 2WWRA 1I36A 3FBTA 4PVDA 4BGUA 3SVTA 4GKBA 2Y0EA 3MJEA 1Q7BA 2Y1FA 1V0JA 3LC2O 3QA9A 4EJ6A 2W8ZA 5HBRA 2BMAA 3BMNB 1BWSA 3O03A 1KVTA 3K92A 4DC1A 4P4NA 1LA2A 4XRGA 4EJ0A 3B1JA 4U6QA 3Q2KA 1GDHA 4ZQHA 1KEPA 3KM0A 4OXKA 1IE3A 3FSRA 3EZYA 1RM0A 3QWAA 1O95A 4GI2A 3DB2A 4BNTA 5F1KA 1OBFO 4H3VA 4OSOA 4B7UA 2X9GA 1P1IA 4Y6PA 1A4UA 2C7VA 3F9IA 3K30A 4AJPA 2EP5A 2O2SA 2AG5A 3PEFA 2P9EA 1HT0A 1F8GA 4FW8A 3JQAD 1YB4A 4Q3CA 1ONNA 2Q4BA 1NXQA 3KYBA 4R9SA 4DL9A 3S2EA 1GAEO 4UVEA 2ZB4A 5TQVA 2WJPA 1YJQA 3JQ9A 1HE3A 2YDXA 2Y68A 4AJLA 3IP3A 1D8AA 2PV7A 1EQUA 4DPKA 3DHNA 5G0VA 5I8ZA 1QLJA 5C5IA 1HEUA 5BSEA 2ZTLA 5CP8A 4AJ2A 4I9NA 3EW7A 5IFLA 2R2GA 3R1IA 1EVYA 3DWFA 4ZD6A 3GGPA 1PU2A 4A10A 2TMDA 3D3WB 3UGKA 3Q9UA 4YXFA 3KUXA 4IQ0A 4YAEA 3L4SO 3PHJA 4ALMA 4XZ3A 3WMXA 3H8VA 3RJ9A 4YTEA 3I5MA 3RCBA 1Y9AA 5DCUA 2CDCA 4R01A 1T2AA 5T5QA 5I9NA 3HG7A 1KBZA 2X86A 1RM5A 2CD9A 5JCJD 3OIDA 3BXXA 3TL3A 3NX4A 2OHXA 1OC4A 4E3ZA 5DF1A 2DM6A 2D1YA 1XSEA 4AJKA 3SJUA 3PYLA 4R1TA 1P1JA 2CMDA 4UVDA 3E9QA 3OIGA 4HBGA 2YZ7A 4JNKA 5IJZA 4Q3AA 4RPLA 1LQTA 1VE9A 3O8QB 3HUDA 4NI5A 1V9LA 3GHYA 4RL6A 3AW9A 3G3EA 3DZIA 2GGSA 3ROQA 2NM0A 1WXDA 5HTOA 1C1DA 4B3JA 1XWFA 2X0IA 4Y6SA 5T57A 1KEVA 3PWSA 4QFDA 2I66A 3NDJA 4CR6A 3IOYA 1DEHA 3D0OA 4WCDA 3IDSA 2C5AA 1XR3A 2AG8A 3V2HA 5I9LA 4JBHA 2G76A 4HFNA 4IPTA 4PG5A 2VZ9A 2WD7A 3UKOA 4CM5A 3SC6A 1NASA 2RH4A 3DBRB 2AQKA 4Q9NA 2DBZA 1PL7A 3S2GA 4MKZA 4RVSA 1EDOA 2BI8A 1QR6A 5A9TA 4DLBA 3KV3O 4BGEA 3U5TA 3E6AA 5A3VA 4R54A 1YOVB 3VZRA 1AHHA 4RGBA 2HSDA 1FDSA 1NAHA 3DBLB 4EYEA 3WWYA 4KMSA 3WSVA 2I6TA 4WEOA 1Z74A 5GY7A 4AJIA 3GK3A 3OJOA 1Y8RB 1R0LA 2GLXA 5EQFA 1DOHA 1VJ1A 2NACA 3H5RA 4YCAA 3TQHA 4NR0A 1ZCJA 2Q3EA 4PG7A 2ZTUA 1A9ZA 3BTVA 1EUZA 2VHZA 1L1FA 2VUTA 1K5HA 1DC4A 4Q39A 1NFQA 1PGOA 2H6EA 3NDIA 3DZHA 2P68A 3SLKA 2BH9A 4RJTA 4AJNA 3G17A 4EGFA 4FB5A 1HTBA 3PYXA 5ITVA 1AXEA 4UUPA 2QRLA 5TS3A 2TMGA 3GVIA 3I9OA 1DFHA 4GBJA 2JFHA 5JSFA 5LDHA 3ANLA 2LDBA 3AJRA 3MOIA 4WLOA 3JQDA 4GVLA 4BV8A 1EFKA 2BFAA 2I76A 2V65A 4MVJH 4TWRA 4J4TA 1YJ8A 2E6UX 5KCZA 3ZWPA 3S8MA 1SOWA 1ZKMA 1RM3A 2NV6A 3N7UA 4XB1A 1UZLA 3V1TC 3WBBA 4CUJA 2DC1A 2HLPA 4CMIA 1B16A 2CFCA 2R00A 1LLCA 2Q99A 3QWHA 4HNGA 1C1XA 5KJ6A 3L9WA 2FPIA 1WAMA 3K2BA 3QP9A 4G65A 2HMSA 2PZJA 3NUGA 1WNTA 3GVHA 5I9MA 5DZSA 3HN2A 2IZZA 3F47A 1U4OA 5IDWA 2EKQA 5TF4A 1SNYA 5ICSA 2H9IA 5EL0A 2HMVA 1I0ZA 1YQDA 4KUEA 2F1KA 3ZHZA 4AJJA 4J0FA 5G4LA 1ENYA 1K6JA 4GAEA 1G1AA 1I24A 3RD5A 1LLDA 5THKA 4BO7A 1PWXA 2IE0A 3ZI0A 4B7XA 2POQX 5J23A 4MJLA 5C3MA 2Y99A 4CM9A 4RPGA 4WLEA 5U9CA 1VI2A 2I5PO 3WNQA 1U7TA 2DT5A 3GZNB 1ZK3A 1WLYA 1U3WA 4R5HA 4OOFA 2V6FA 3WB9A 1GUYA 3HN7A 2Q4EA 2ZYAA 1H0KA 2DVMA 2W2LA 4NJMA 3EYWA 1LBEA 4R9RA 4UREA 1GFSA 1LRJA 2A4KA 2O3UA 4WE3A 1P0CA 4MIYA 1OFGA 3UICA 4YT2A 3JD3A 3KEQA 2EKLA 3KO8A 2PKRA 4Z0TA 1U7HA 1GY8A 1NWCA 4HFRA 5A03A 2GZ2A 3AOEA 4KQXA 3MJCA 1WZEA 1PIWA 1TXGA 1HYHA 3VKVA 3DZGA 1C1XB 4OYRA 1ZJYA 3CH6A 5KJEA 1VL0A 2OP1A 1PR3A 3WYCA 3P2OA 3QVWA 3L6DA 3SXPA 4CM4B 1M66A 3DMTA 4IDBA 5G4KB 5TNXA 2HK7A 4G2NA 4CLXA 2FRDA 2B69A 4M1QA 3BA1A 4TRNA 3KSUA 4RF4A 5JMPA 3AU8A 4KP7A 3A9WA 1KEUA 1W6UA 3Q3CA 4A27A 2PTGA 1SMKA 3N58A 1SO8A 3M2TA 4BKOA 1SOVA 4Z9YA 3FNHA 5TT0A 3PJGA 4OM8A 4M55A 2X1HA 3ZV3A 4CMEA 2FN7A 1PJLA 5JY1A 2QRKA 1VPDA 1EVZA 2AEFA 3ETGA 3KSDO 1JVSA 3OMLA 5ER6A 4DXHA 3JYPA 4L74A 2CNBA 3UH1A 4UAGA 1DIRA 3INRA 2XPCA 3RBVA 1P1KA 3H6KA 4BB6A 3K31A 4J4HA 2EW8A 1H2BA 3COSA 3RROA 5FFFA 1QYWA 4PZEA 4NH4A 3ROKA 2VNSA 4KTVE 5G0WA 5JO0A 1QSGA 5DBIA 1YQGA 1E77A 3VZSA 2GF2A 5GZ6A 1I32A 2HK8A 3H9EO 3JQBC 1ISGA 4YACA 1TVEA 3ZWWA 4IDDA 3RKRA 1ZIDA 3HJAA 1H6DA 2OZPA 2BI7A 4R3NA 3EK2A 3PDUA 4RDIA 5TT1A 4ZN6A 2Y05A 5I8WA 5JMWA 2CY0A 1OZAA 4RV9A 3GEMA 4YR9A 4Z6KA 1BXKA 1JKJA 2Q1UA 3CKYA 4IJKA 5BSHA 4QXMA 5EN4A 4WCFC 2DTEA 1ONOA 3F5SA 1O5IA 5G0UA 5A05A 3RC7A 1DC5A 1KC3A 1E3LA 2EP7A 4MVJP 3PVZA 2B4RO 2X58A 1D1TA 1JVBA 2IYOA 5F5NA 2ZB8A 4RLHA 4EUHA 4AJEA 3BMCB 2NNLD 5K9ZA 5KJ1A 2YV2A 1YBMA 4D41A 4CL3A 1PGQA 5GZ3A 1PZFA 3ROMA 4KZPA 4N5LA 1NM5A 2CF6A 1B2LA 1J49A 1B26A 2BFPA 2PGDA 1EBUA 3JQBA 3OJFA 4DLAA 3GDOA 1Q7GA 3OA2A 3JQEA 1A27A 2ZYGA 5IXSA 1BXZA 4CQMA 5IZ4A 2VHXA 4OAQA 1YB1A 3ZH2A 2BGMA 4DUPA 1N7GA 1QMGA 3E5RA 2JCVA 3I1JA 4GSKA 4JJIA 2I99A 3ZHBA 4OQYA 2BF7A 4QT0A 4BNLA 2ET6A 3M1AA 3WYEA 1VLLA 2CVQA 4L73A 3PGJA 3CUKA 1GCUA 3GMDA 4ALJA 4LW8A 2PD3A 1C0IA 3I9NA 4NFHA 3LU1A 3PFFA 5A02A 4ZVVA 4D7AA 3I9JA 3OJEA 4C7JA 4YRAA 4AG3A 4GGOA 3K73O 3KTDA 1ISIA 1LUAA 2O3TA 5KVQA 3WX0A 3MZ0A 4J7XA 3MOGA 1TT7A 3C1OA 2GCGA 3E48A 4QEDA 1EK5A 1PQUA 3WNVA 4KOAA 3BMNA 2DTDA 4IQ8A 3F1KA 5A4DA 4WNIA 2BKAA 1H5QA 3DR3A 1BXGB 1GV0A 1UZNA 1NPDA 4IMRA 4O5OA 4OSPA 4LSMA 2WDZA 5BNFA 3FD8A 3TZ6A 2BGKA 3IL2A 3DBVO 9LDBA 4U0KA 1E6WA 3RBZA 1LLUA 2G17A 3QE3A 2BLLA 2W2KA 3ZCXA 4XR9A 5H83A 4HX5A 1EVIA 1Q0LA 5KKCA 5IDQA 1GYPA 4C4OA 3U4CA 3RWBA 2CSUA 3CTMA 1ZNQO 3FN4A 5JPIA 4J90A 3WBFA 1FDVA 3ZWOA 3L6EA 3OBBA 2NU6A 5DNAA 2EV9A 3LC1O 3VZQA 1LSJA 3DFZA 1I5RA 4O6VA 4IUYA 1FDWA 3AM3A 1Q7CA 4CV1A 4OIMA 4XDYA 2OP0A 4CMHA 1P3DA 1PSDA 2NU8A 2PGLA 3BHIA 2CZCA 1YONA 2YV3A 1XYGA 3W8FA 1ENZA 2DUUA 3RUFA 4BNMA 3GGGA 5CDSA 1UXGA 2D5CA 1F06A 4JN6B 2VRCD 4IXTA 2AQHA 1YRLA 4JBIA 1CDOA 1LSOA 3DTTA 4M49A 3RFVA 4FFRA 3L6OO 2Y66A 3R3SA 2VZ0A 2X5OA 4WGGA 2O3SA 4BNIA 1LQUA 2GZ3A 3CEAA 4CV3A 5KJFA 1TLTA 3ASVA 3KYCB 5ILOA 1E3WA 4XYEA 4CQMD 3BHJA 2UV8A 1VL8A 1DFIA 4B4OA 1DBVO 1ZK2A 2C54A 1B3RA 1ZSNA 4PLPA 4QX6A 3RUEA 4BKPA 1SEVA 3H2SA 3GF4A 3INGA 4INAA 2PR2A 2PZMA 2RHCA 2FZWA 4II2A 4PCVA 4WK6A 1O0SA 4GKVA 3GY0A 2J3JA 1Y8RA 1TI7A 1Y1PA 3RUAA 5DP1A 3U4HA 3AUAA 1PEDA 1ZJZA 2D4AA 1I30A 4GMFA 3C24A 3C7CB 2UAGA 3NGLA 1NR1A 1GYRA 1LNQA 4XYMA 1XCBA 3GG2A 3WWZA 2IDZA 1PZEA 5GZ1A 2DKNA 5EPOA 3WQSB 1J6UA 2V6BA 1EDZA 4M87A 3U0BA 1A7AA 5IDXA 3IMFA 2JD0A 1T1RA 1PGJA 1VKOA 2DBQA 4EDFA 3K9QO 1DAOA 4BOYA 2HJSA 4ZJUA 1LDYA 2YV1A 1R12A 2ZB3A 4J43A 3ASUA 1VL6A 3DC2A 1C1DB 1HKUA 2X0NA 4RVUA 4ZQEA 5BSFA 5CDYA 2CUKA 1NFRA 2Q1WA 5DCYA 4P8RA 2X0JA 2C2YA 1HLPA 1ZUD1 3D5QA 1GV1A 1T26A 2J8ZA 5CG1A 1GU7A 4IGFA 2V6MA 3GZ4A 3ADPA 4HFJA 2HU2A 2FOIA 1XIVA 3O38A 3C1AA 3NT2A 1LC0A 1NQ5A 1PJ4A 1HDGO 1HSOA 2NWQA 4TKLA 4FJ2A 3RC2A 3L4BA 4OKNA 4RF2A 5ES3A 2XOXA 5L51A 4O63O 3AY3A 5CG2A 3U09A 1OMOA 3A14A 4D0SA 4A73A 3QWIA 1MG0A 1HLDA 2D2IA 2Q1SA 2ILTA 1IHYA 2JAHA 1DPGA 1N9GA 1BDBA 2E82A 3LSYA 3FR7A 4II3A 1QYXA 4XGIA 4BNUA 4CM1A 5KNLA 5CPFA 5CDUA 4DIBA 2QYTA 2ZB7A 3B1FA 2DPHA 2X5JO 1MB4A 1MFPA 1JN0A 3PXXA 5ENVA 5FI3A 3UUWA 3JCZA 3KZVA 4AVYA 4J1TA 5IF3A 1U3TA 3IC5A 3G1TA 3GUCA 4CLRA 3GPIA 3RSHA 1A71A 2FSVA 3ROPA 4YAKA 1RM4A 1SPXA 2RH8A 3BMOB 3KXDA 3ABIA 5A9RA 1WZIA 1N5DA 2FR0A 4N18A 1NAIA 3BTUA 3W8EA 3IP1A 5KKAA 4AFNA 5CHEA 5C7LO 5F1OA 4J2OA 3T7EA 3C85A 1KY4A 1ONPA 4Q3DA 4R3WA 2W2KB 1FDTA 4W4TA 5TSDA 3T4EA 3GH3A 3ZW8A 2B37A 4ONEA 4BO5A 2Q2WA 1BVUA 3IUSA 2EIHA 2FR8A 1DHRA 1Y6JA 4J9VA 1R4NB 4RPKA 4XA8A 3E9NA 3NTRA 5JC8A 3WJAA 5AQ1A 1Y8QB 3ETDA 3D4PA 3PLNA 1U4SA 1BRMA 3ZN2A 4K6CA 2H63A 4BB5A 1HYEA 2WTBA 3IIEA 3ONEA 1JW9B 1P44A 5JE8A 4UUOA 1N7HA 3CE6A 4J7CA 2ZTVA 4Z3DA 4FC7A 3SJ7A 4P38A 3B20A 3DFUA 3K5PA 1NTOA 3F1LA 3ZWYA 4J0EA 1LDGA 1G6KA 3NEPX 5EINA 3TOZA 1U2DA 4ND5A 5KTKA 4TZKA 1ZMOA 1BW9A 1NQAO 4LISA 3I9MA 2UUOA 4RCVA 3IJRA 2QYSA 4JK3A 4WUVA 2ZYDA 2RIRA 4NPCA 4XYGA 4YPOA 3ITKA 3L9XA 4R51A 4BO8A 5A9SA 2DFVA 4E30A 4A7PA 5I7VA 4YBZA 1PWZA 5JW6A 4PIVA 2DU8A 3CSDA 1QP8A 3TFOA 1BXGA 3A28A 1HDRA 4MVJG 4J3FA 3CIFA 2PFGA 3ORFA 4MINA 1PJBA 4BO0A 3PP8A 4DLLA 4O59O 1XGKA 1S6YA 2UVDA 2P9CA 1IPEA 3HADA 1TEHA 4GWKA 2NVBA 5HRUA 1XQ6A 1CQIA 1ENOA 1O94A 3AI2A 1T25A 1U9JA 4FOSA 1JU9A 2VYVA 4R16A 4KUHA 2P2SA 1YL5A 3EZLA 1KEWA 3LT0A 3ZHYA 5A9SB 3FBGA 2X8LA 4CLHA 3ZU2A 4BO2A 4CMAA 4YT5A 4Z0HO 4WJZA 2PY6A 1O9BA 4B4VA 3P19A 3DHYA 2HO5A 3Q2IA 5FYDA 1V8BA 2O3JA 3VPFA 1EEHA 3JQGA 3WIDA 2HUNA 5TRTA 4XD2A 3RFXA 3QVSA 5ADHA 3U9LA 3JYOA 2Q1TA 3QY9A 3PPIA 4D45A 2YYYA 1EUDA 2GR9A 4W82A 4DBVO 1IUKA 3OM9A 3F5QA 3Q9NA 5B37A 3LF1A 4Z9XA 3V2UA 3UFXA 2LDXA 5DBGA 5I7EA 3RASA 5GMOA 1FJHA 1P9LA 3QQPA 3BMOA 3JQAB 4ND2A 3MTGA 3DOCA 1LX6A 5F3RA 1VKNA 4IDCA 2BHLA 5C37A 1VSUA 1Z73A 3I52A 3DTYA 2JAPA 1GR0A 4NBRA 4BNYA 3WOHA 2DBVO 1KVSA 4PLYA 1GZ6A 4R41A 3GHHA 4S1VA 3RIHA 2QRJA 1YQXA 2O7QA 2BFMA 2W4QA 3C3XA 4ND4A 4NBTA 5TX7A 4UULA 3WDSA 2GRAA 1N9GB 1PGNA 1N1GA 3B70A 3C7AA 4MIOA 1PX0A 1C0KA 4D44A 1IHXA 5DT9A 3I3OA 1YVEI 1NWHA 4DQVA 4HXYA 4CM9D 5T6BA 3DXFA 4KUGA 3GVXA 4MKXA 4XYLA 2BGLA 5JFOA 2Q45A 2AE2A 5EESA 1U2GA 1YWGO 5JLAA 5L4LA 4QO8A 5BQFA 1WPQA 2VRCA 5ILGA 1K3TA 3RUDA 1PS0A 3VTFA 4U0JA 1EUCA 2IXAA 3TWOA 2BELA 3GRPA 3IAHA 3ZNNA 3DZBA 3GGOA 4O1MA 2X9NA 1I3MA 4Q3EA 4TRRA 4P22A 5F1PA 3LK7A 3ZNOA 4BNVA 5ICMA 1NVTA 2ZJ0A 4PRLA 4YJHB 3RI3A 5MDHA 1MGOA 1QYCA 4PG6A 2WM3A 3DZKA 4G81A 3EHEA 4TROA 5FF9A 2X5KO 4C7KA 3VH1A 3GNTA 1XLTA 3GAFA 2VYND 3SLGA 3VDQA 3HE3A 3ZV4A 1XKQA 5KVSA 3S2IA 1HDXA 3NT5A 1K6IA 3RQSA 1GZ3A 3WS7A 5HA5A 4FOOA 3ON5A 1QG6A 1ZXBA 1SB8A 2OMEA 4KDFA 1ZFNA 2Q2QA 2D8AA 1YBAA 4BNKA 1HE5A 3JQCA 1E1MA 1ZK1A 3O26A 3PFWO 4ND1A 5G0SA 4B3HA 1Y7TA 3FHLA 2PKQO 4Z0PA 2NQTA 4R1UA 3HDYA 3TN7A 3NDRA 3DZFA 2Y1EA 3WGOA 4UUNA 2H1SA 2VUUA 4F45A 5CDGA 5FEUA 5KVVA 3TRIA 4XYBA 1PJSA 4KDEA 5L7YA 3KSZO 4RZIA 4RO0A 3ZWNA 4BMNA 1JDJA 2EXXA 3TFQA 3QVOA 2W98A 3R6DA 2PK3A 5A06A 3PHLA 3C1TA 1NYTA 1SC6A 3UHAA 3EUWA 1H6BA 3Q11A 4CM6A 4MVJF 5CFZA 3D1LA 3PQEA 3ZV6A 1YE3A 4PG4A 3ZWCA 1GD1O 2ZQZA 1BGVA 5BNIA 2YFQA 3AU9A 1V3UA 3LLVA 2DQ4A 3WSWA 4R68A 1JKFA 1HZJA 4J7UA 4XGKA 4S3MA 1UXIA 4ZQGA 1JLLA 5A5FA 1I8TA 1WW8A 4IXWA 1GEGA 3ZWVA 3D3WA 4JJGA 1BDMA 3RVDA 4W6ZA 3JQAA 3L4BC 3ENNA 1IY8A 1I2BA 3A1NA 4IZHA 3U62A 5KJCA 1ZXLA 3LQFA 4UVHA 5AXBA 4L4SA 4MOWA 3C8MA 4D46A 5EIOA 4CLOA 3M6IA 2HRBA 2VNAA 3JQ8A 1JQBA 2OOSA 1E6EA 4B4UA 5A04A 4A2CA 4J6FA 4GMGA 3D64A 1OI7A 4MP6A 3PTZA 1A4IA 1AGNA 1UP4A 3RUCA 3KYDB 5IG2A 3AFMA 4FC6A 1NNUA 2PD4A 3BHMA 3OP4A 1V3VA 1PJTA 5IDYA 3NTOA 1AXGA 2A92A 1ORRA 5JY6A 3V1YA 2EEZA 3ULKA 2GZ1A 1I3KA 1UZMA 4WOKA 2PH5A 1E3SA 1UAGA 1B8PA 1N1EA 2NVUB 1C0LA 3JQ8B 4CQLA 5L7TA 3RBXA 3MJTA 3QIVA 3KOUA 1E7WA 1PQWA 5DOZA 4IQGA 2WEKA 3VKUA 4JJFA 3VDRA 4LCEA 5T67A 4MVJA 1ZSVA 4WLUA 5KVCA 1JWBB 3H4VA 4GX1A 3ST7A 4DYVA 1LSUA 3M1LA 1GADO 3H9UA 2GN8A 1KVRA 1SBYA 1MG5A 2YDYA 4BKRA 4DREA 8LDHA 3AUTA 5B4TA 1JTVA 3WJ7A 4HADA 2FWMX 4KWIA 3VZPA 4L0QA 5HS6A 3ZGYA 2X9VA 4CM3A 5HM8A 4QQRA 1P0FA 4TVBA 4LGVA 4TMFA 2Q50A 3NV9A 2B36A 1E7RA 3OF2A 5K6AA 3I4FA 4XQ9A 3GT0A 4BNZA 5I7SA 3HDHA 3ADOA 2UYYA 1TB4A 3MWDB 2NTJA 4W7IA 3D3EA 1Z45A 5F5LA 2P91A 4EBFA 3DEYX 4CUZA 1T2DA 2WMDA 4IDEA 3OECA 4RORA 4WCFA 4H7PA 1RPNA 2AQIA 2OORA 3PGXA 1W8DA 2RCYA 1DC3A 4DRYA 5DOVA 3L77A 1BHSA 1JAXA 1AN9A 1PZHA 2NVUA 3P7MA 3PYMA 1DRVA 4N5MA 4TKMA 4TRMA 4DIFA 3W8DA 3GNQA 5JAMA 4FR5A 2YQ5A 3FI9A 3OIFA 4E0BA 4FBGA 3F4LA 1ZZEA 4HKTA 2B5WA 1EFLA 3OJLA 2NUAA 1DRUA 4JBGA 2VWGA 2Z1NA 4R1NA 3JQFA 4IIVA 2C20A 2JD2A 2HMTA 4D3SA 2NADA 3W6ZA 3GMSA 3SX2A 4CLRB 4R1SA 4NDNE 2NVWA 3VVBA 1NVGA 1R0SA 3KBOA 3DAPA 5I7FA 3KYCA 3JD2A 1WDKA 3DZJA 2VWQA 4E2XA 3S1LA 2ZTMA 4RPJA 3GZNA 4YJDA 4AJOA 2YHIA 2HMUA 4CMEC 3GFGA 1L7EA 4J9UE 4IS2A 5JS6A 4JCOA 2ZQYA 4IDAA 4PG8A 3VAZA 1UXHA 3AY6A 2HQ1A 4NIMA 3GNSA 3ONFA 1T2CA 4L8VA 2QG4A 3H7AA 2ZCUA 4BNNA 1E7YA 2IODA 2OUIA 4I5DA 4BGIA 3QWBA 3G79A 3WGIA 3AUSA 1PJ2A 4BO6A 3GUYA 1YDWA 2Q49A 3OETA 4MDHA 4ZRNA 5TJHA 3UW3A 1F12A 1L7DA 2YHIB 2VYNA 1XEAA 3AOEC 5MGBA 1BMDA 1MXFA 4OO3A 3PZRA 3KVOA 2JJYA 4YJFA 4IJUA 1IULA 4AICA 1HDZA 2YY7A 4IDGA 3K6JA 1EMDA 2DPGA 4E5NA 4I8XA 3UOGA 2HMWA 3WIEA 4E2YA 4OQZA 4WOJA 4A0SA 2V7PA 4BUCA 4LSWA 4TSKA 3PZBA 4XGNA 2OO5A 3SC4A 1ULSA 3H65A 3O8QA 1X13A 4ID9A 3GDFA 4K26A 1SCUA 4YAGA 4WEQA 3LDHA 1NHGA 2G0TA 2EJVA 4OXYA 2NSDA 3OICA 1IZ9A 1R16A 3QLJA 1EVJA 4BQRA 1AE1A 4Q3NA 3VHRA 4FJ0A 1ARZA 1SB9A 3JYLA 3NJ4A 4ZRMA 1DO8A 4J1NA 2VRBA 2D5AA 2DUWA 1IOLA 3OQ1A 2VWHA 4DYDA 3STHA 1LXCA 5L40A 1X0XA 4YJGB 4BO3A 1U1IA 2J3IA 4YT8A 1HXHA 4GH5A 3Q6IA 5AVOA 1KS9A 4ND3A 1ZMTA 2BRUA 4BVAA 4JP3A 3BAZA 3K8ZA 3JYNA 4TVOA 3QVXA 3IJPA 1R37A 1HETA 3K96A 1E3WB 3ZU5A 3DBHB 4TRJA 2B0JA 2GD1O 1PL8A 3CXRA 5FI5A 3OHSX 2JCYA 3FTNA 4W99A 1XQ1A 4EZBA 3I9KA 3X2EA 4IZIA 4EJMA 1ADCA 4BS9A 3C7DB 1KVUA 3WYBA 1SAYA 1ZW1A 4IGEA 4B79A 2Y1DA 4M86A 3CMMA 3AY7A 4D42A 6LDHA 1DIBA 2WD7B 4NBVA 3D4NA 3ZW9A 5COBA 2PH3A 4GX0A 4NHEA 4MPDA 4ZICA 4JXKA 1Q0QA 5A5EA 3VVCA 1C14A 2VHWA 1B14A 1E5QA 3F3SA 1E1NA 2W2LD 3QW2A 5ENDA 1E1KA 3WFIA 3JD1A 1IB6A 3GPDG 1Q0HA 3S55A 4GVXA 2Y1CA 1Z6ZA 4YRDA 5BSGA 3ANMA 1YB5A 2XF8A 4CR7A 3DOOA 1QORA 2E49A 4FS3A 2Y1OA 4PRKA 1UJMA 4BO4A 4BO9A 1P74A 1NVMB 4XQCA 1P77A 5B1YA 3TJRA 1YBVA 3PWZA 5DULA 2J5KA 1ISMA 4JX8A 4R69A 1ZK4A 3PHIA 5IZCA 2G1UA 1VC2A 4ZGWA 4CMIB 5T8KC 1Z7EA 2QW8A 2Q2VA 1GQYA 3E82A 1E0DA 1M76A 2GO1A 4FCCA 3UXYA 5IN5A 1Y81A 3MWEB 4A26A 3ZWMA 3NKLA 2H5LA 3OH8A 1H9BA 2ZCVA 2J5RA 3UCEA 4O0LA 4M54A 3LYLA 4I5EA 4GQAA 2Z1MA 5CDTA 1WMBA 5AXAA 1DIAA 4IY1A 2Y0CA 3F46A 4IJWA 1YL6A 3WGYA 3BMQA 4XIJA 5TJ9A 1SZJG 4DGSA 4FN4A 1EE9A 1H2HA 3FPLA 3PDJA 4RVFA 4ALIA 5U1PA 4FGWA 4XX0A 2ZJ1A 1T1SA 1WMAA 2I67A 5C7OO 1R66A 1I01A 5DDIP 4QO7A 1HE2A 3B1KA 4XQGA 2O3QA 2EHDA 3AM4A 3AM5A 1DJQA 1MUUA 2E37A 3DL2A 3TDKA 3WR5A 4DTIA 2YUTA 1UXJA 3L0DA 1I2CA 1NQOA 5DCWA 7ADHA 2CDAA 2AHRA 5HWSA 4CMKA 3GDGA 4YAJA 4RF3A 1D3AA 4OKIA 3H3JA 3ZU3A 2AXQA 4RVDA 2A94A 1T4BA 2I3AA 3NAQA 4UUMA 3QHAA 1VSVA 5JYDA 4OHUA 4BQPA 1FXSA 1QKIA 4BNHA 1ADFA 2EWMA 4IS3A 4NBUA 4LMRA 3RC1A 2OBYA 4DMLA 1LC3A 1P45A 4ZQBA 1D4FA 3PJFA 4YVFA 3OSUA 1PS9A 1Z7BA 3FNFA 1MFZA 1M6WA 4GSLA 1BSVA 1KC1A 5JBIA 3TSCA 3KETA 2FY8A 1GL3A 3TPCA 3LLSA 4BIIA 3GEGA 2Y0DA 5JAQA 4NU5A 3OQ6A 4J2HA 1QV7A 1GZ4A 3GEDA 3IS3A 2YHUA 1DXYA 1U8XX 3FF4A 1K89A 3GN2A 3H9QA 2GN6A 4FSHA 2JHGA 1DRWA 5L53A 4Y6RA 2C7GA 3DAFA 4DC0A 1DDOA 3I6IA 1GPJA 1X0VA 1I2ZA 3HNPA 4UEOA 2DBRA 2FPGA 3JQ9C 4CMJA 1KVQA 2FP4A 4D3FA 4A5OA 2JKVA 2VHYA 4CM4A 1WWKA 1KYQA 1YOVA 2O2YA 4QSMA 3QJ5A 4OH1A 1KOLA 3MJVA 4XQEA 1CF2O 3RJ5A 5HS4A 2EJWA 2DTXA 2OFPA 1QYDA 2CF5A 5EJ2A 1X14A 4ZHSA 3AK4A 3HSKA 2Q46A 3GA0A 4YJGA 4GLOA 4AJ1A 1R0KA 4PLGA 2E48A 2VZ8A 1BW9B 1NP3A 2X0RA 1IL0A 4QUKA 3U49A 3DQPA 1XELA 4E5PA 2C29D 2Z5LA 2EW2A 4FDAA 4MP8A 2W90A 1P33A 4L4XA 1E3EA 3H9JA 4N7RA 1AHIA 2JHFA 4HFMA 4E5KA 1GQ2A 2GDZA 1C0PA 1MLDA 3BTOA 3MTJA 4HY3A 4L76A 1LDMA 4XWYA 3JD4A 1MXHA 2AW5A 4IBOA 1A5ZA 3PI7A 1V6AA 4DQXA 1JA9A 6ADHA 1LLQA 4LRSB 3NGXA 2FSSA 4YEDA 4QFCA 4ZU3A 3PLRA 3WTCA 5CAEA 3NJ8A 1X7DA 4MKRA 4G5HA 4E2ZA 2AQ8A 2JL1A 3N74A 4D3DA 4NFSA 1K0UA 2PZLA 3BMCA 4YQYA 4XCVA 1HRDA 3DBRA 3G0OA 4I9HA 3VH4A 1IYZA 3R0IA 3WICA 5JC1A 4J16A 3JV7A 3ZWBA 2WE8A 1VM6A 4P4GA 1CRWG 4BNFA 4XEHA 5JCJA 1VJ0A 4EUEA 1T2EA 3GVPA 3I83A 2VT3A 4M8SA 5G2OA 1PZGA 3OA0A 4FFPA 4ALKA 4N54A 3RU9A 1MP0A 1ISFA 5JAIA 3W4IA 3ZNPA 2SCUA 3FCOA 2WD8A 3VH2A 5TGDA 4WCFB 1I33A 2GNAA 1X7HA 4JP2A 1LDNA 4EEZA 1J0XO 3WXBA 4NU6A 4E5MA 1VRWA 1UAYA 3H9GA 4BKQA 5CEEA 2C5EA 3ZV5A 1M6HA 1J5PA 4NJOA 4PLTA 1U28A 3JD0A 1HF3A 4I1IA 4RLSA 1T24A 1O6ZA 1JAYA 4K1LA 1QLHA 4GLLA 1IPFA 1Y9EA 3H2ZA 1UUFA 1A72A 4NK5A 1HDYA 3JQ6A 3HQ4O 3HZZA 3QSGA 4CJXA 4TZTA 1NX6A 4RVHA 4UEJA 3A06A 3W4KA 3VC7A 3TZKA 5JDIA 4OJNA 2PWZA 4ESOA 3E18A 5AXDA 1TA4A 4YJFB 3BZUA 3ICCA 5DBFA 3H3FA 3BMQB 3ZDFA 4CQMB 5L45A 5COQA 3F4BA 3UCFA 2JCXA 2Y67A 1DIGA 2P5UA 5TIIA 1UP7A 4CL8A 2FR1A 2O7SA 4FFOA 1P1RA 4LN1A 3U4DA 4H15A 2EERA 1LTHR 4DPLA 5IXYA 4W7HA 3VPGA 3PHGA 3QV1A 4OL9A 3SBOA 3PQFA 3D5TA 1R4NA 4CV2A 1U8FO 4MVJI 2HRZA 5TC4A 1Y8QA 3ONDA 4BKUA 1PJQA 4B8ZA 3E8XA 3W1VA 1BVRA 1XU9A 3M2PA 4EW6A 1U3VA 3FWNA 3GOHA 4CMCA 1ID1A 2BFOA 3AFNA 4N5NA 3OEWA 3ZHXA 1UDAA 3KLPX 4CLEA 2X6TA 4E21A 3NRCA 5LC1A 1E7QA 3FPCA 3RUIA 2O48X 4HUJA 4LVUA 3DBHA 4U6SA 4CQLB 1XU7A 1GPDG 1W0CA 4U8GA 1K2WA 3IQDB 4WKGA 5L95A 3WTBA 4E12A 4XJTA 1LDBA 1C3VA 5ER9A 8ADHA 1J4AA 3W4JA 3EY4A 1EZ4A 1P1FA 3PJDA 4J91A 1W73A 2RHRA 2J3HA 4FFMA 2HJRA 4PLVA 2V6GA 4WLNA 3BTSA 1CQJA 4ILKA 2CVZA 3HDQA 4L4RA 1DB3A 1Y5MA 1ZBQA 1BG6A 1LDEA 3I4CA 2YJZA 2XAAA 4B7CA 3EVTA 1F14A 2J6IA 2WYWA 2X7HA 2O3RA 4AJHA 1KY5A 1ZO8A 2NQ8A 5EMHA 3NTQA 1EE2A 5BNTA 4IINA 4KTTE 1VJTA 1RYEA 4OXNA 4F6LA 3D7LA 2GPTA 3PQDA 3MJ4A 4R5MA 1GCOA 4U5QA 1ENPA 3A4VA 1GYQA 2VOEA 2OBNA 1R4MB 3UVEA 2ZK7A 4BV9A 1E1LA 4K6FA 3EDMA 3PIDA 1CETA 5L4NA 1X7GA 5IN4A 2GERA 4I9UA 1Z75A 4MVJD 4PZCA 5T8KA 4NNJA 1RKXA
chains in the Genus database with same CATH superfamily
2X19A 1B7GO 2ECPA 1LBHA 1U7XA 2C3YA 2A3RA 3A7EA 1YUBA 3G23A 4OP2A 4BDTA 4CDRA 1BDHA 3A1WA 4P4TA 2YWEA 2XZOA 1N7IA 4S24A 2X5XA 2Y3IA 4JLWA 2FG7C 3WGHA 3RSOA 3B82A 2NTEA 2BFFA 2VF5X 3PIIA 4E13A 3AONB 3GW8A 4XWGA 4NOJA 5EJEA 2P67A 1T9GR 2DWUA 2XDAA 5KNDA 2QZ9A 3GN1A 4K9MA 1UDCA 2GYYA 5H81A 1VI5A 1U2ZA 1GUZA 2JFYA 2C84A 3AFIA 2Z9DA 4PVCA 1JZQA 2J33A 2EQ5A 3OZDA 2NZJA 1YRQA 4KXXA 2XKJE 4PLWA 1RRFA 3IBFA 4WL0A 3RC9A 2OO3A 5JYEA 1SQ6A 3ERCA 2XUQA 4DMCA 2HXYA 1EGVB 5FOUA 2NV2B 2G9NA 2IEDA 4LEIA 3A1EA 4FQ8A 4G67A 3VO2A 1H85A 1WPGA 1VKHA 2VHUA 3PC6A 4F5ZA 1MRSA 2HF7A 3MCVA 2ADOA 2XMGA 3KWJA 4KQIA 4RK0A 3TLXA 2JKYA 3HBMA 5E2IA 4C7XA 3TKLA 2GI4A 1E3JA 1ZJ6A 2GLTA 1SUWA 4NS4A 4Q4HA 4QJIA 4UTNA 1XNRB 1GILA 4MLPA 4EY5A 2XB6A 2PUVA 3OCYA 1W4ZA 4TLEA 3LKZA 3LGSA 2K6GA 2H3EA 3B9BA 3QVKA 1KE1A 2ZPUA 1Y5RA 3AEQA 5IYZA 2JBWA 5L7WA 5LMZA 1Z0AA 2Q5OA 3TBHA 2PWYA 3PV0A 2FFAA 3RLFA 4MS3A 4PPQA 1EUYA 4L1KA 2VAPA 5K20A 1C7ZA 4RH0A 2ACEA 2WUEA 1NE7A 2G08A 5IBRA 2C9ZA 3T9AA 3TQCA 4KSYA 3TI7A 1JSZA 5AYVA 4FJ1A 1OLSB 2ODQA 3GFBA 3C48A 1HT2E 1A2KC 4TTSA 1UCFA 1QE5A 2GAOA 4WBNB 4NJMB 1K4YA 1QBGA 5DH9A 3FKQA 2OHVA 2XUHA 4QICA 4XJXA 3TZHA 4ER3A 1AURA 1SG9A 3QKUA 1T6BY 1ZESA 5JZBA 5K3FB 5E8RA 2P9YA 4X62B 4X63A 4EUFA 3EGVA 3RAJA 2FMUA 4Y9RA 3I2KA 3ZW7A 3TLBA 5C4IA 1MOSA 4X54A 1KETA 5AQEA 3F8TA 2HIAA 3BGIA 1E9BA 1ZC4A 3G1UA 2A1UA 2GN9A 3WA7A 4ROSA 2XDWA 5J9FA 1XLUA 5L3RA 3EWSA 3CNHA 4HDMA 1BN7A 1EZ1A 1JL3A 3JXEA 2C07A 1YS4A 2AEMA 2GCNA 2Y1KA 3DVAA 4D8WA 1CJMA 4BXOB 2DH5A 2P7HA 3DT8A 4PX2A 3WYNA 2R60A 3DEJA 1UP6A 2HJHA 5LUBA 4WY2A 5T4FA 3ZDAA 4LE2A 3T7IA 1WSBA 1EPUA 4M9UA 3E22A 1XROA 1FK8A 1MQSA 2GS9A 2FXVA 4HNHA 1IN8A 3HL4A 2GN1A 4M89A 2AMLA 4DA9A 4BCBA 1JBKA 4HRVA 5H80A 4GT1A 4WDQA 3VYVA 1BC5A 2DCMA 2I03A 1Q21A 3U7FB 2G82A 1PNQA 2HYDA 1H2ZA 2FNAA 2A7QA 2YS7A 4ZDWA 3RIEA 2O8BB 5CLQA 2XWBF 4UDNA 1JKIA 2Z0MA 5T7BA 2BGGA 3MUNA 3PD1A 4KITB 2ZUEA 5A5GA 4A36A 3ABZA 1RI3A 2PKQP 3D7KA 3P2YA 4FHFA 4CUKA 3FVWA 2EZ9A 5K09A 1NLUA 2ZSBA 3HVKA 1DLIA 2OGUA 2P2GA 3O3MB 1OA1A 1PL6A 2ZR0A 2IYPA 4IYJA 1L5GB 3VDMA 2ZITA 4UHKA 5JXWA 1CWUA 3C14C 5GV7A 1FXUA 1V8FA 3LCCA 2ZTSA 4GC9A 1F17A 4NENA 4UDOA 2QVCA 4RK7A 3BT7A 1CU1A 4NVRA 2P4QA 3HUFA 3DLIA 3R5SA 1E2JA 1NGSA 3GJXC 2AWOA 3CZRA 3GA7A 4JGBA 5BUZA 2CL7X 2VQ3A 5HRAA 4IJMA 5F21A 3M5DA 1J5XA 1A7KA 2IF0A 3DMYA 2EBWA 4GWGA 1B3BA 4LVCA 5CVDA 3TIVA 3LVFO 3W6UA 4E31A 4YRBA 5K0ZA 3D0RA 2RGXA 2H3HA 2F3SA 3C3BA 2ZS9A 4C2BA 1PJCA 1RYDA 2VSYA 3O4RA 1T2NA 2Q9UA 3MOSA 2H4HA 4D4IA 3TLZA 3BKXA 1NZDA 2ZKLA 4EY7A 4I8IA 3GG9A 3I37X 1MR3F 2HKIA 4W5HA 4BMSA 3RLIA 4FGSA 4DSOA 3GWZA 3IBGA 3FOAA 4CL2A 1QS0B 1U6KA 4X1KB 5EHNA 4BGVA 3R9WA 3ORSA 3CPSA 5THQA 1RNLA 4FS8A 2ZYTX 4GU5A 3ZCRA 5G1OA 4UQPA 1GQQA 1JUDA 1NXTA 3BE4A 1YR3A 2QVXX 1OYYA 2O8EA 2V58A 3D3JA 1E62A 2D2EA 2H1CA 3QMVA 4RVCA 3CS3A 4RKYA 4BFWA 1EZZA 4KH0A 4FMCB 1QLWA 4U7GA 4I6EA 3K72B 2Q9CA 5GQSA 3K4HA 1WVGA 2SKDA 2JFGA 3BQNB 5AIBA 2FZEA 4HDQB 4IKPA 4Y8VA 3GLGA 1BX3A 2EGHA 1AIPA 4AS2A 5U4QA 4WX2B 2UYGA 4XR4A 2XD9A 2J3LA 4YA6A 1QO0D 2D8MA 4GL4A 4N3CA 3KIPA 4F3KA 1T2UA 1Z8FA 3PJEA 1SBHA 4EHNA 2O54A 4KLCA 4H3HB 3VAYA 2OHIA 3BWEA 4AUNA 5A9SA 3RVNA 1ZOPA 3D7MA 4TSRA 4JC4A 5K4AA 3MM4A 1E2PA 2H11A 3UWDA 4MW6A 1ISHA 1WDMA 2P41A 3N8DA 5BRNA 1TIPA 3CVOA 2D0IA 1CUBA 1KEZA 1ZOIA 4OA8A 4RV5A 1PGPA 3GLQA 1TUEA 4ITUA 1KO8A 4IEFB 1TT5B 2HDHA 1X3SA 2WJHA 1T4CA 5FWNA 1E79A 2NSLA 3OFVA 4PLZA 4RACA 3CZMA 1XP5A 3FPKA 4N6GA 3ZI4A 2RD2A 3HPQA 1ADGA 4OY3A 1E89A 3PRJA 1Z6TA 2BP7A 5AOVA 3VR1A 4MB0A 4Y2YA 3LHFA 4KKXB 4F3YA 1UKZA 5C8YA 1VE5A 3O93A 3U16A 3UF0A 2Y1LA 1DDIA 1E1CA 1XD2A 1U0RA 2V8OA 2VTEA 3DEZA 1IVYA 1AUPA 3CLVA 2H07A 4P5DA 1ANKA 3RKUA 3NNDA 1A98A 3TIGA 1FFYA 1DG9A 1X70A 2I3GA 5MN6A 3E8MA 4UNPA 2ATIA 3DCJA 1J00A 2Y93A 1OWNA 4MQEA 1ECBA 1NPTO 2YMPA 5DHUA 4CM8A 1J2UA 4Y30A 2RBEA 2VUSA 1RQGA 4KNWA 3OEYA 4XM2A 4BRUA 4K28A 3DLBA 3LQYA 4IM7A 3MCAA 1N2GA 1YKFA 5DEOA 1Q2XA 5M3BA 2VI5A 1LS1A 2CMKA 2PMWB 1LI4A 3F9RA 1EFRA 4FPXA 4FYKA 2F8TA 2NV0A 1ZDMA 3HFSA 4YX9A 4TN1A 3RGGA 3QFTA 5J43A 1EEXB 5WRFA 3RJTA 1VE3A 2P9GA 2R66A 2VTDA 4L2IA 1E5LA 4XDZA 1KAGA 1HWYA 2D7CA 2QE7D 4FP9A 3Q7RA 2IYXA 2FRDC 5LA6A 2QHXA 3I12A 2L69A 1T1JA 1T0HB 5THXA 2OYCA 1FTQA 2HBZA 2QZPA 3K2EA 4NZ9A 5GGYA 1DBSA 2WF5A 5J5CA 3TMAA 5HKAA 5J5VA 3FWZA 4RCZA 3RYFB 5ECYA 2XJ4A 3B3FA 4JLDA 1SZPA 4JOSA 3THXA 2NMVA 1KZ7B 5EAIA 5IH3A 2I3BA 2VLBA 1GG5A 5JBNA 2D59A 2JZNA 4PGFA 4IXNA 5AW6A 4CEHA 1H05A 1VYTA 1LBTA 3I2FA 3PXBA 5D87A 4YP9A 1L3BA 5JH7B 1NA5A 3NOXA 2WFMA 4YP0A 5KTOA 1DCTA 3WRWA 4OP1A 2DMRA 4I7EA 1C9DB 5AIAA 1HYBA 7GPBA 1CIPA 2NAFA 1ZRHA 4INOA 4L16A 4MW4A 4UAJA 5UKDA 4H6PA 4LJLA 5BOVA 3NVDA 5K4HA 2ZAIA 1SCUB 4JJZA 3GVCA 3HRKA 1OCEA 3DUWA 3A9SA 4HUQB 1Z0ZA 1W94A 1TZCA 1XTIA 3IKVA 1IWOA 1DHTA 2OILA 2ZATA 2C2WA 4MUBA 3QEOA 4N65A 6CHYA 2BUBA 3OQBA 2PUDA 2VWPA 1P73A 5H4GA 4ZEOA 5CEFA 2Z8YM 1KAMA 5LZ4A 2PNFA 3CINA 2ZAMA 1YMUA 5FNZA 4EITA 1MA0A 5H3HA 3UT6A 1LWNA 3VHXA 2COUA 2JLZA 1ODJA 1U3UA 1J9EA 3KQVA 3P9ZA 3VNQA 4MPTA 4ZIRA 2WYVA 4YDQA 3BFJA 1HZZA 3U3XA 3R75A 1YDMA 3KRTA 4BNDA 1F0KA 1R9NA 3ZS9A 1T3TA 4IV0A 4RZHA 2PMFA 4LMPA 1DX4A 1KERA 4R1QA 2B78A 2C5LA 1DRKA 4U7WA 4PX5A 4C7MA 1QIDA 3KE8A 3OC6A 1Q74A 4YV1A 4Y2VA 3KPVA 2HIMA 3ETEA 4R6WA 2OCGA 4KFCA 4EL0A 3ZIAD 3U5ZB 2X4GA 1B15A 3JASB 1WUYA 1RKVA 4BVGA 2GVZC 1P5RA 1CW2B 3O94A 4IIUA 2OL4A 3GT3A 4KV7A 4ZVKA 4OG2A 1Z06A 1P5ZB 2QM0A 2XMBA 4K9SA 1L1EA 9ABPA 5I8PA 3I23A 2O8FB 1NHWA 1KIMA 3KELA 1EFUA 3KXPA 3O90A 4MVJM 1TEVA 3Q3GE 2PDAA 3RSSA 1AZTA 1I3NA 3AOGA 4BTLA 3WGZA 3I58A 1K08A 1IY0A 2WE7A 1H2EA 4LQCA 4TTVA 4X8LA 3KX2A 1KK0A 2IK8A 3TNLA 5JHHB 1IJFA 4Q7KA 3PU6A 4BU1A 4WGFA 4US0R 5KQPA 5HCNA 2DB3A 2PZ8A 4OLAA 1A5AB 5LA6F 2O4CA 3AEZA 4E5YA 3PNYA 4DLTA 3QPWA 5B36A 5JZ9A 1UF9A 1CEQA 1RAEA 3D8HA 4JLJA 1CS0B 4CT4B 2UU9B 1X80B 2A6PA 2KJQA 4YN3A 1KZHA 1KZ1A 2JGRA 1XN4A 3G2PA 3GX1A 4DDVA 2WD9A 2QMQA 4ZMSA 3CR8A 4A03A 2JC3A 1XPOA 2JJ2D 2WIFA 1HG1A 2FWPA 1JAIA 1X2EA 2XB9A 4AN0A 4Y1RA 1N2ZA 2NTNA 1QIHA 4Z53A 2DP4E 1J0BA 3I6QA 4MHSA 1AHPA 3FCSB 4HS9A 3BFKA 3A4LA 5I47A 4LV8B 3QXXA 4B3IA 2GN4A 5AUQA 4XPIA 5JDIC 2NLOA 5EXSA 2A30A 1ULUA 2JLVA 2P5YA 4UHEA 2JFFA 2B35A 2V1XA 1C30B 4QTYA 4HGOA 4Z3KA 3E7PA 5T64A 1HQCA 5G4KA 1N1DA 1G6Q1 4BFLA 4FYHA 4BLOA 5FBVB 3K0FA 3OJWA 3RVSA 2VOJA 3CPEA 3U4QB 2PSFA 1ZN2A 4HN2A 3V4SA 2QP9X 1GNSA 2RFLA 2Y1WA 4OJTA 2CXOA 1KSGA 3WKDA 1E2EA 1E7MA 4GS5A 4DRXA 4DWVA 2UZ4A 1T0BA 3I8XA 3V42A 2XJ9A 2H1LA 2B1RA 2FZCA 4HDSB 5CVUA 3WMWA 1D07A 5FJJA 3CZQA 4ZOLA 9LDTA 3R3ZA 2E5LB 3AB8A 5BW4A 1JQ3A 2VYVD 4M1EA 3W9UA 2ANBA 2FPUA 3PRHA 4QTZA 3ZE0B 5ITWA 4FNAA 4MUFA 4YRZA 2QQEA 1UWVA 1HEYA 2X77A 2ZUBA 2MSLA 2O50A 1RRGA 3UJBA 4PN3A 2O14A 1GGNA 2BGIA 4ZKDA 1NBOA 2C4UA 3GCDA 5KU7A 1PFQA 2FQWA 3UWMA 1N25A 2RK6A 5IVPA 2P11A 5ELLA 3S44A 3TF5A 3DBLA 1QTQA 3TSWA 4B6JA 3VPHA 621PA 1J25A 4RK1A 1BXRA 3NC0C 4TVSA 3WZMA 4B80A 1THTA 4TTTS 1P80A 1DQZA 3WLQA 1DCFA 1G19A 3KEMA 3AHCA 5KS2A 3T5DA 1I36A 1XQXA 4DR3B 2WAOA 1TM4E 2CUTA 1CPYA 3KQHA 2PVPA 2Y0EA 5HCIA 4CZ2A 2Y1FA 3IDZA 1V0JA 4EJ6A 5GM2A 1DG3A 1OWOA 2YZ2A 3QXJA 4G0NA 2PFSA 5GOTA 3QU2A 5HBRA 4B83A 3Q9LA 4XVCA 5LQNA 3GDHA 1S96A 3BFPA 1YS7A 1KVTA 3U7GA 4B17A 3OAAD 3QPVA 3R20A 1N2BA 4JI5B 3W8RA 3ZHOA 4DC1A 3I9FA 4CF3A 3FG9A 3B1JA 4U6QA 4PYQA 4IIYA 4OU5A 3IT3A 4UXJA 3SS7X 5ALNA 4PNEA 5CFRA 3Q2KA 4LHXA 1UPBA 1SUCA 3AX6A 3FMIA 4Q05A 4D2IA 1JHPA 3C8UA 4I99A 4BN0A 1ETHA 1O95A 3RWOA 5F9MA 2HJWA 4KQFA 1RRVA 2HW8A 5F1KA 5AW0A 3C6BA 2AXEA 4B7UA 1U3FA 2X9GA 5CNJA 2ZI3A 2HZ7A 4JJEA 4LQ4A 2EP5A 3PEFA 3U4MA 1HT0A 1F8GA 1LZLA 1YB4A 3JQAD 4S1PA 2BE9A 1ONNA 4W5WA 2J5XA 3KYBA 1DKNA 5J5AA 2OGWA 3NASA 4BY9E 1GAEO 2CKDA 2WJPA 3EXEA 1I4DD 3GYGA 3JQ9A 3CONA 4LDJA 1U9CA 4FHCA 1V26A 1GN9A 3CRRA 2FDCA 4V0OA 1C29B 3QJYA 4CIBA 2B94A 4Q1BA 5C5IA 3CCCA 3EXIA 4Q9KA 3V4ZA 4BEWA 4F92B 3KZ1E 4CN8A 4I9NA 4B3CA 1L7MA 4EMBA 3EW7A 5FPTA 1FXWF 5IFLA 2R2GA 1EVYA 1UKCA 1XDDA 3I01M 2HDWA 1BCSA 5G1PA 3VI4B 1SVWA 2ZAYA 3DXXA 5FUWA 5LIPA 4WTOA 3LP8A 5F33A 2IHTA 4D9IA 1E9FA 5FI1B 3D3WB 3ZCTA 1R4AA 1BJTA 3Q9UA 4YXFA 4K2AA 5B57C 3KUXA 4WOPA 1HR0B 4NULA 1QV9A 4US1R 4N9WA 1GQRA 3O7MA 4FYVA 3TCXB 1DAHA 3HFJA 2OQRA 4X1YB 3O31A 3NHZA 2FP4B 1T2AA 5SY6A 1ZOSA 1UAAA 5I9NA 3HG7A 1CY2A 4F97A 5IVHA 3EDQA 3TL3A 4AAYA 3NX4A 2WVAA 3AW8A 2VDOB 3HCWA 5IAKA 5BUCA 3L93A 3MTDA 5FTNA 1JJIA 1FJGB 1FFEA 4ZYVA 1T5HX 2BIFA 3PYLA 3W5VA 4R1TA 3NM6B 4UVDA 5B3JC 5HRCA 4H3KB 1ZIXA 4JLUA 3FB1A 3DTVD 1SK8A 4HNVA 3DV0B 3FWHA 3WI7A 6GPBA 1WV0A 1CZHA 4NYIR 3O8QB 5DK6A 4NI5A 4M22A 1L2TA 1GNRA 1I1QB 2RAVA 1UMBB 2VH5R 1V9LA 4J75A 2WPNA 4YWHA 3ZXYA 1BE0A 3WNCA 2NPFA 1CUUA 5DM0A 2EZ4A 3BKWA 4LFBB 3CKLA 4R2MA 3FHTA 1SN7A 3CZ5A 4P3XA 8ATCA 1W4LA 2NM0A 2EATA 4K9LA 4Y6OA 4EFNA 2P6UA 5HTOA 1O8BA 3EDOA 2HADA 1DXOA 4RZUA 4G8CA 5CW1A 2CNKA 3D59A 1HX7A 2PWAA 1IN6A 2Q5LA 3P9QA 4Y6SA 3VNVA 3PWSA 4CR6A 3OZSA 3HXOA 2B3DA 2XCQA 3NYQA 2C5AA 1X7XA 5KYUB 4M1KA 2JEYA 3V2HA 3KR0A 5JU6A 1OH5A 1ECLA 2FLKA 3S29A 4HFNA 4PG5A 4FDUA 1GPYA 2C3UA 2LVBA 2VZ9A 4YJ3A 2WD7A 3IESA 3AF6A 3QE9Y 1WULS 3UKOA 4CM5A 1M2VB 4OAPA 2R65A 2IOFA 3DD1A 4Q9NA 2QLLA 1PTKA 4RD6A 2NP7A 2PGAA 3PICA 1WCYA 4RVSA 3DKKA 2I2AA 2Z6QA 1JZTA 3KV3O 3WLTA 3MMSA 4BGEA 3E6AA 4WCVA 1XEXB 3GWGA 3W2HA 2VYFA 3VZRA 3PITA 3WB0A 4B7ZA 1JG6A 2D1RA 3L2OB 1AHHA 1QVAA 4N5IX 4OJMX 3TX2A 2KLHA 2E21A 1IEVA 4R3UC 3ZLJA 1W35A 3QKTA 1U3GA 2ARKA 2VNHA 3UB2A 4I1PA 2XB8A 4MUYA 1NBEA 1CUSA 1OGYA 2I6TA 2QTRA 3U17A 4A2PA 5A6VA 3G0DA 1KS2A 1QH1A 1U8YA 4MEAA 1Z34A 4QA9A 1Y8RB 2GLXA 4YROA 1B2RA 4ZVPA 2F9LA 5J59A 5JXJA 3IAAA 1GTZA 2DT8A 3FPHA 4DW8A 3N0VA 1ZCJA 3JZAA 3Q12A 4TKUB 2JFBA 1I9CA 4REOA 2GILA 2ZTUA 3RTDA 2PSEA 2XNJA 4D4MA 2VEOA 1DQSA 2VHZA 2VUTA 1RZUA 1C8KA 3MFYA 4Q39A 3U9TA 1NFQA 4H7IA 3CRMA 3NDIA 1VZ2A 3UV6A 2C8KA 2H2AA 3L1JA 3EPKA 4Q1AA 4KVAA 3M6XA 3G17A 4EGFA 2AOUB 1HTBA 5HXAA 4QHYA 4Q6BA 1JAZA 3LKBA 1AXEA 1GGJA 3ILHA 1PFKA 1ZH4A 3K9BA 5TS3A 3GVIA 1QMPA 1VCOA 3O74A 3A2KA 1DFHA 1W34A 2A5JA 3KJIA 3GJ6A 4RIEA 5JSFA 5YASA 5LDHA 3MOIA 4WLOA 3UUFA 4Y1GA 5CBKA 2FE4A 3O3CA 5EMKA 4ANFA 3L41A 1NVXQ 4BV8A 4EHLA 4X8OA 1Z6QA 1JPNA 1K7YA 4YIKA 4TTQA 4C0SA 3NMUF 2V65A 4TWRA 2BKVA 3DB1A 3FZEA 3QEBZ 4HQOA 4JD5A 3PE6A 4B09A 1HNXB 4NWIA 2HJ9A 5KCZA 4WWHA 3ETHA 2FEWB 1BOOA 3ZWPA 4DWJA 4ZDJA 1NN1A 4DUZB 1ZKMA 4KXYA 3V1TC 4E07A 4L6AA 2HLPA 2GOYA 3LECA 3QWHA 1C1XA 5DASA 2ZSHA 5AUOB 1PCXA 2FPIA 3HBAA 4L7VA 4TXHA 5SYMA 3RRYA 1RC1A 3TH5A 1A9PA 2LUOA 3NUGA 1WNTA 3R24A 4R2WA 5I9MA 3SZRA 2QX4A 4OMFG 4AKSA 3F47A 1U4OA 4U7FA 2EKQA 1ODIA 1SNYA 3IB6A 3MWLA 3P9IA 4LK2A 4B3BA 4C6TA 1FC0A 4C7BA 2JLUA 2F1KA 5BYKA 1TJYA 4MUAA 2MWMA 4UW9A 4GAEA 5DRYA 5G4LA 2UVQA 3VDXA 4YMLA 2IS2A 4RHUA 2ZRNA 2D54A 1EWVA 3K0BA 5ICCA 3IVCA 4CCAA 2JG3A 2VP4A 4MR7A 4ZVOA 1BO6A 1I1OA 1RW4A 5FPYA 1CDZA 3NOVA 1EFHA 1EYZA 3GUHA 4Z9BA 1ZRMA 2WV9A 2OXEA 2VDVE 2C92A 4Q1EA 3OHMA 4WSOA 4XM1A 5EVCA 1P8JA 5C3MA 4BVHA 3FKSA 4WLEA 4V0NA 4LOHA 5LWQA 5U9CA 1JEYB 5AKGA 3KPJA 1ZH0A 2I5PO 3B53X 2MCFA 3WNQA 2DT5A 4FEEA 5HF8A 2PUTA 1QQBA 2V3WA 3N2NA 1ZK3A 1M1XB 4M4SA 3TEJA 4FNOA 4OOFA 4OQMA 4U1RA 2OO5C 3SXUB 3U37A 3TLEA 2ZE6A 2P9JA 2H2WA 3JAMA 1LBEA 3D8BA 1GFSA 2A4KA 5EQJB 3KNZA 1OFGA 4HH0A 3ROTA 3KEQA 3MGGA 3H1TA 1AM4D 1N2HA 1OTYA 1XO1A 3NBZC 2H57A 3U81A 3U19A 4Z0TA 1U7HA 3HA5A 5G41A 3P0RA 3Q41A 4OHVA 4TM8A 1GOTA 2GZ2A 2JK1A 3A25A 3AOEA 3OOWA 3ESQA 1C5KA 3OQPA 4MRNA 3Q8WA 2EYQA 1HYHA 2W22A 4O33A 1OX6A 1ZCAA 3AWIA 3VKVA 4OYRA 1ZJYA 2MOKA 2NUPB 3CH6A 4GIBA 2C5HA 3PQ2A 1TCVA 4XIFA 2CLSA 2WJGA 3SXPA 5GJBA 1M66A 2QUKA 3SQXA 4G2NA 1PLLA 2FRDA 4Q7EA 4X71A 5JADA 2X8JB 2WYHA 5IJAA 4M1QA 1EGMB 5DM70 3HB0A 4KBGA 1KPHA 2YCLA 1E9DA 3KSUA 2P78A 3BH7A 3N6RA 3AL0C 3PEYA 3LGAA 4I1OA 1B0PA 1GSAA 4YY3B 3UWKA 1OZHA 4O25A 4KP7A 3QF4B 4LRQA 1W6UA 4TS4A 3RDPA 2PTGA 2WZQA 3RFCA 3N58A 3M2TA 1CFZA 4BKOA 4Z9YA 3BWXA 1EK0A 1HRKA 3I2JA 3OT5A 4ENQA 1Y3BE 4KGVA 3E61A 4FLMA 4JOBA 4OM8A 4AX4A 4FMDB 4CMEA 1PJLA 3PDIB 5ENZA 3L1VA 1SXPA 1GNTA 3QUCA 1C9JA 4AKIA 1R3UA 1KJIA 3UH1A 3G2OA 4BASA 1P1KA 1VGQA 2GZAA 4DKXA 3K31A 1U5BA 4P7GA 3COSA 2W2TA 5FFFA 1QYWA 5KNBH 1ATZA 1FUKA 2CNOA 9ATCA 3DLCA 3ROKA 2VNSA 3AQ4A 4KTVE 3W78A 2JGLA 4YXWD 1XJCA 2XIQA 4G56A 4M76B 1I32A 3H9EO 1CJTC 2AX3A 2HWKA 1GP2A 2GBGA 4PFSA 1B41A 5AM1A 3RKRA 4DR2B 1ZIDA 2LKDA 4HLQB 1QFJA 5K8CA 3NPAA 3PDUA 5GJVC 5I8WA 1OT5A 1I94B 1H2AS 3NTUA 2O5EA 4LVNA 3T34A 1OZAA 4LECA 4H0CA 4ZV9A 2YWBA 2WF8A 3BZBA 4YR9A 1B76A 1Z3IX 2B8NA 1P4HA 1XKLA 1BXKA 3IHTA 3LE8A 3NHWA 5KWJA 2GXAA 1JFFA 2AYZA 3CKYA 3IIIA 2HA5A 3QHPA 5BSHA 1X9GA 1Q84A 4WCFC 5HJ2A 4DLXA 3COVA 2XBMA 3ZC3A 3F5SA 1DC5A 3CKKA 3FRIA 3VMMA 3PKJA 3PVSA 4JXJA 4TMKA 1F5NA 4GYKA 521PA 1P3Y1 4HWTA 2X0DA 4BMDA 1PG0A 1R5OA 4M0LA 2IYOA 1FE8A 1YJ5A 3EH1A 2FVXA 5K9ZA 4TXMA 2PGNA 3A6FA 3ADKA 3QV2A 4OGFA 4U3JA 4B71A 1XZBA 1P0MA 4JHLA 4D41A 4K0KB 4HYEA 3DEFA 5JTUA 1PGQA 2XUAA 5GZ3A 5KEIA 1I5OA 2OOKA 4WZ6A 2HMAA 1JFFB 1L7BA 4N5LA 1NM5A 2SBTA 2D13A 1BOFA 4DMFA 1OLXA 2XUFA 3SSAA 1WZNA 2IS1A 2II6A 1YJBA 1EBUA 1KEEB 3M5PA 3TIXB 1UBSB 3VYTB 2WHYA 3MWEA 1YHYA 4F9GA 5LMCA 1Q7GA 1IIBA 2P9BA 4KXMA 4NX2A 4DCNA 2VTBB 3GLHB 4WNYA 5IJ9A 2L18A 3CY6A 2ZYGA 4FZ5A 1WUTA 3QPDA 2QD3A 3OZBA 1BXZA 4MYRA 1A7UA 3ACBA 2PZAA 1HDIA 5KSPA 5PGMA 4LI3X 3LHDA 2FSFA 2PBLA 3ZH2A 4C78A 2A1UB 2BGMA 2JAQA 3ZY5A 2WHEA 4L8LA 4O2BA 3OJCA 3Q2OA 4BN4A 1ZL0A 1RPTA 2ET6A 3M1AA 1XAIA 1YJCA 3LPMA 2G8LA 4M88A 4OB7A 1OV4A 3BRCA 3W3AD 4B31A 3PX2A 4ARCA 1GCUA 3GMDA 1AUQA 3LOQA 1OD6A 4KO8A 4LW8A 4G4GA 1C0IA 3CNNA 3I9NA 4NFHA 4RD3A 4Q4AB 4ZVVA 1N0UA 1C7QA 3OJEA 4B9EA 3H2KA 4R7ZA 2LNDA 3AKEA 5IULC 4D0NA 4YRAA 4O2AB 5JATA 2Z8XA 3OD5A 4WIAA 1EAMA 1ZW6A 1LW6E 2OV6A 3BH0A 4OHBA 4QBGB 2B8JA 4EABA 4EYOA 1ISIA 1T2VA 1LUAA 4M46A 1ZD2P 5FTJA 2PWPA 3NPMA 2DPXA 5K3BA 2C7PA 1G3IA 1JR2A 2Y9MB 4QEDA 5BOSB 5LOVB 1N6KA 1ZHFA 3EULA 3IIJA 4INPA 4K03A 5ED4A 1DKMA 3F1KA 1REQB 1DDGA 2BKAA 4Y2XA 4QTUB 4ZO4A 1L9XA 2IHZA 4IMRA 4O5OA 1RBQA 3FYSA 1GDDA 5BNFA 2H4FA 1G3UA 1WR8A 2J7PA 1SXJE 4C6TB 2ZS8A 5JWHA 3EC1A 5SZHB 3DBVO 3B1XA 2G17A 3QYAA 1NQVA 3DCNA 4H4CA 3IUQA 1O08A 4PXYA 5H83A 4HX5A 1Q0LA 4K46A 3USES 1CEEA 1P3JA 3VR4D 2JI9A 3H1GA 5ALRA 3R8CA 3U4CA 2CVFA 4V0KA 3RWBA 1J22A 1FQWA 2CSUA 4DZRA 4RMNA 1XDBA 1R8XA 2BPOA 2C98A 4IUCS 4J90A 4MS4B 3BCSA 4C4RA 3EF0A 3TW0A 3L6EA 4EYQA 4DV3B 3GEPA 4V0LA 4B2PA 4JP8A 2I22A 4YQEA 4O6VA 2ZXUA 3AM3A 4DXDA 3Q3IA 1O97C 4G1VA 4JS0A 2AC4A 2XMPA 3KKQA 4JT8A 2OP0A 4EPRA 1G1MA 1ZRSA 1FMJA 2NU8A 2X3YA 3OD1A 1RTTA 4NOKA 3ZX4A 4HNAA 1QH0A 4BUJA 3BHIA 3O47A 3RVOA 2CZCA 4NARA 2D74A 4R8LA 2A0KA 3UMBA 1JJAA 4N1AA 4NHOA 4E7OA 4BNMA 5EEHA 3KB1A 3TQIA 3P20A 3N7AA 2D5CA 4FB4A 1F06A 2OB2A 4JN6B 1M9NA 1BHO1 2VRCD 3GCGA 5D5QA 2R87A 4EX6A 1MH9A 2C03A 1YRLA 2NSYA 5AKLA 3OC0A 4M49A 4O4JB 4FFRA 3L4JA 3LX4A 1KO4A 2Q4RA 2VZ0A 3L8EA 2HF2A 2QJWA 1TF7A 1LQUA 2DQSA 2GZ3A 1TLTA 3KYCB 4XD7D 4RJLA 2VJAA 2RC5A 2UV8A 3TPFA 1SHJA 1VL8A 3TTXA 1VJGA 1GHTA 4JOCA 2P9QA 3A9TA 3GF4A 4PCVA 4AF6A 1KYZA 5K8VA 2A0YA 3VNBA 3A6ZA 4CE6A 4HLCA 4ZOQI 5BQ3A 1TI7A 3RUAA 4EFLA 4UFNA 4L3OA 5EIBD 1A8IA 1LTKA 3H5OA 5DP1A 1PEDA 3DMPA 1ZJZA 2WLSA 1YDGA 4CVNA 3C6XA 5EWJB 1ZGAA 5EXXA 3QITA 3VC1A 1WB9A 2WG0A 2XMZA 1N2EA 1XCBA 4LWPA 4Q3KA 3DW3X 4XYMA 4YMWA 5HVNA 3SQLA 3FFXA 3S2SA 2HSGA 3NKFA 5BW6B 3WWZA 1T15A 1OBOA 4Y2JA 2IXDA 3CG0A 2DKNA 4CYMA 1AQYA 2HLDA 2V6BA 1LNSA 1N0IA 4M87A 4QD3A 2YJ3A 1C2TA 2AK2A 2B1JA 2JD0A 1GTSA 1SR8A 1T1RA 1U2GC 3NIBA 3O9MA 4L5CA 3AJ8A 3WP1B 5JISA 3SX4A 3T3NA 1V3QE 2ADFA 1AJEA 2C5FA 1Z12A 1QNFA 1XZFA 1OWMA 3OTHA 4MDEA 2ZB3A 5I48A 1XZDA 3SIRA 4Q48A 5LP6A 4DEVA 1YR2A 2XCLA 4IFIA 1N2XA 3VJLA 3E9EA 5FUBA 3FPBA 1YQ9A 1YCGA 4LWOA 2QT0A 2J7PD 4RTJA 2EKBA 4H35A 3GPBA 4OLJA 1HLPA 4JKIA 3D5QA 1T26A 3HB9A 2J8ZA 1QQ5A 5CG1A 1U1GA 1GU7A 1GFZA 3F8SA 3JU3A 4MV7A 4B6OA 2ENWA 5FDFA 1E18A 5EFOA 4QM6A 3DT9A 4UZEA 5FUMA 3ADPA 4G3XA 2AFIE 1XWWA 4MX8A 4M8LA 2Y76A 3FA2A 2W70A 3NT2A 1NQ5A 4LC9A 4C0AC 4OYHA 2C94A 2HGSA 1S02A 1CP3A 3EJ6A 4H6WA 3C8HA 5T41A 3OPMA 2P6NA 1NUUA 3MMXA 4ER6A 1QQTA 2CL0X 2P75A 2J0VA 2WJVA 3EAFA 2XGJA 2BDEA 3GQBB 3C0KA 4LG1A 4DB4A 3DZ8A 4A73A 2W2NA 2AW3A 2D2IA 4OFXA 1IHYA 1EWRA 4CKCB 3PC3A 4EJSA 3EUFA 4FLFA 1VSTA 2QYTA 1N5JA 1E9SA 3OLXA 4G4IA 2ZRQA 1MFPA 4GZLA 2ZG6A 4OREX 5CRIA 5FI3A 3JCZA 2F90A 4N8DA 3IPCA 3IC5A 1B6SA 1XZKA 5JSZA 1R8JA 1HY3A 1FP6A 3P0EA 3ROPA 3X44A 4A5SA 4ND8A 2CNDA 1P6QA 1KXZA 3ACDA 3KXDA 3HY6A 1NYRA 2K7ZA 5TARA 1WZIA 1Z07A 2QQ0A 5TXGA 3VVLA 2FR0A 4N18A 4KODA 3GD5A 2AG1A 1P5JA 3PFBA 4BRZA 2CLIB 1YV9A 1XRSB 4PZ9A 1PR6A 2Q5HA 2VEDA 5C7LO 2J4CA 3C85A 1KY4A 4Q3DA 5IN4A 3QIAA 2W2KB 4XD7A 3T4EA 3PI6A 1JG4A 1Y3HA 4HD8A 4BO5A 5EUMA 1OYVA 1MH1A 2QXUA 1L5VA 4HDKA 4DV4B 1UQTA 1W25A 4IOJA 1R4NB 4BP1A 5CLJA 5BURA 3KZMA 3WJAA 1SRQA 1Y8QB 4KX5A 5EIHA 4BATA 4I4TB 4RL4A 1BRMA 4K6CA 4Q3OA 4G0VA 1C9MA 1NW8A 1L7VC 2W8BA 1A7JA 4DWWA 1EA5A 5MN4A 4E4RA 2GJAA 5HMLA 2QV7A 3F3KA 3PWTA 4QELA 4AZ0A 4BE9A 1ZH6A 3OZUA 4UUOA 3V3TA 1KJZA 3CE6A 3OE5A 2ZTVA 4LSGA 4FC7A 1W46A 4RV4A 4HRYA 4Z3DA 5IK2D 3T9EA 4DR1B 3HXQA 5H3LA 1L7RA 2AOXA 3D6AA 3DFUA 5HIJA 4KO3S 4AROA 5CK5A 1S0UA 4J0EA 4FUQA 2GWHA 4LYAA 2FQQA 3OTOB 3THYB 3NVKI 3B85A 5EINA 3S70A 1IZ8A 3C3AA 1NL3A 4F9TA 1X77A 1GLNA 3FDZA 4YASA 3QUAA 3EXAA 1ZVQA 4LISA 4D4LA 2BM1A 5DM1A 1FS5A 3F67A 4RAOA 2Z30A 2RIRA 2WSSA 5K3AA 1YACA 3PCRB 4QLBA 1CDEA 1Y63A 3OE1A 3KL4A 1A8PA 2ZR9A 2FN9A 3MS2A 4PIVA 3PUWA 1DEAA 1BXGA 1U28C 4LZJA 1HDRA 1UM9B 1DKUA 2IUFA 3CIFA 4B4DA 2GBCA 4NICA 3PP8A 1H9CA 3ZY2A 1ULZA 5DHQA 4R31A 4B8YA 1AKYA 1IUPA 2QGNA 5HRUA 3TGPA 4HYYA 1ENOA 3AI2A 1TCCA 4B76A 1QDEA 1RKBA 4CGYA 4E09A 3GRFA 2ORWA 4X61A 2C9OA 3HEAA 2P2SA 1YL5A 2PS9A 3H5IA 4R7TA 2X9QA 4TT8A 5KTSA 3LT0A 4E70A 1QRAA 1FL9A 1G8AA 2QN2A 2Z9BA 1XJ5A 5DMXA 5A9SB 3GH1A 5I9SA 2X0FA 4DJTA 4CMAA 4MRAA 2FEAA 3AF0A 3BCRA 4M9CA 3ZU2A 4BO2A 3EQ8A 4WJZA 1IAQA 4MLCA 3P19A 4BCDA 3Q2IA 4XLZA 1V8BA 4CW7A 4MJXA 4WBSA 4KXQA 3NHKA 1DWUA 4KMRA 4J1TC 4QDZA 2K5UA 4RIGA 3VPFA 1UADA 2V7TA 5ADHA 1FZTA 5CT6A 2Q5IA 1II9A 3QY9A 3PPIA 1UBEA 1EUDA 2GR9A 4W82A 4DBVO 3VNRA 2ZJOA 4U2CA 3GP3A 3ZDQA 2R1TB 1UBRS 1WXFA 2HX1A 3R2JA 4GNRA 4R2KA 2QN3A 3ILVA 3P52A 5FPHA 4E7PA 2QUZA 4Q5IA 5BSRA 2YJTD 1IOWA 3V1KA 2H4XA 3MT9A 4LHWA 1FJHA 5AOBA 3EMVA 4PR3A 4QG7A 5KBYA 4KMOA 1KGSA 1S3IA 3DE7X 3BMOA 3F2IA 2BFBA 3JQAB 3O5AA 4JDPA 3SZLA 4EHIA 1DZIA 1LX6A 2VJOA 1QO7A 2K4MA 3DOCA 4DA6A 4WT7A 3CF0A 5KQGA 5ALLA 1I9GA 1TVKA 3ZVLA 1HFKA 1UK8A 5ALDA 5MFZA 1PV2A 1KXJA 3Q3JB 3I52A 5I7AA 3MTEA 4ZDKA 3JATB 1RCUA 3W2EA 1X8JA 4BLVA 4HPXB 5G02A 3ITEA 2ZLBA 2QRJA 3DM9B 5I4IA 3ZKAA 5ILQA 3DPIA 3EE6A 1TYAE 4UULA 4HX9A 2BMJA 3B70A 4MWDA 4WW0A 4UTVA 2OM6A 3UMRA 5B6PA 2AFHE 1SU4A 3A6GA 1N5LA 2WM2A 5L6MB 1DQNA 2HHCA 4KQCA 1K3UB 3A6HA 2JZOA 1YVEI 2QAGA 5AVTA 4CM9D 5T6BA 1TUBA 2MSCB 5KHLB 3S68A 4KUGA 3BILA 3DNPA 4XYLA 1M0TA 5H70A 3P2KA 5I4BA 2DFNA 3DF9A 2Q45A 3MHPA 3KZKA 1TQDA 1U2GA 2H2DA 4EKIA 4QO8A 3K5IA 1Z2AA 3KD2A 4QQFA 5AM2A 2NZ2A 1SUSA 4ENSA 1ZJWA 3EGEA 2YV5A 1EUCA 1ZNXA 2IXAA 2WSLA 2CJWB 1EB9A 1KA9H 2BELA 3GRPA 3IAHA 5EG5A 4TRRA 5EMMA 4RD0A 5F1PA 1I3MA 2SHKA 2PZFA 2Z2ZA 4P22A 5FT9A 3ZNOA 2WMNB 4BNVA 2AZMA 2ZJ0A 3KEFA 2ODEA 3WRYA 5MDHA 2CN1A 4DUYB 3ZDCA 2HT1A 3E9CA 2VQEB 1MGOA 4F4CA 2VJYA 1C7RA 1PI3A 2CFTA 2V03A 4G81A 2VRNA 5FF9A 3SJBA 4C3OB 2X5KO