4C4XA

Crystal structure of human bifunctional epoxide hydroxylase 2 complexed with c9
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
313
structure length
313
Chain Sequence
SDMSHGYVTVKPRVRLHFVELGSGPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESSAPPEIEEYCMEVLCKEMVTFLDKLGLSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNTPFIPANPNMSPLESIKANPVFDYQLYFQEPGVAEAELEQNLSRTFKSLFRASDESVLSMHKVCEAGGLFVNSPEEPSLSRMVTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSLGRKILIPALMVTAEKDFVLVPQMSQHMEDWIPHLKRGHIEDCGHWTQMDKPTEVNQILIKWLDSDAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BIFUNCTIONAL EPOXIDE HYDROLASE 2
publication title A Combination of Spin Diffusion Methods for the Determination of Protein-Ligand Complex Structural Ensembles.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 106
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 3.1.3.76: Lipid-phosphate phosphatase.
pdb deposition date 2013-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4c4xA00
3WL5A 3H19A 4XVCA 5LZ2A 3DL4A 3WI7A 5HKBA 5JD5A 3A6ZA 3KD2A 1EI9A 3FSGD 3STTA 3PUHA 4I3FA 3UMJA 4DMKA 4PSDA 1L7RA 2OXEA 1GPNA 3E4DA 4KAAA 1ZIXA 5IVIA 3PUIA 3HSSA 1BCSA 4J7AA 1W4LA 5E4TA 5JAUA 1QE3A 2QUBA 1DINA 5KWIA 3R3UA 3DOIA 1C7JA 4E11A 4EY7A 1B41A 2CMFA 2BCEA 4Y9SA 2XI4A 3ICWA 3C6YA 3K2IA 2QJWA 3IUQA 3ZLUA 4BRSA 2OGSA 1WPRA 3QYJA 4QDZA 2WIGA 5HF8A 1Q0RA 3C6BA 5C8ZA 2IIVA 2HA6A 5A7GA 1ZD4A 2WIFA 3G9TA 3WZLA 4BE9A 4JH0A 4UHCA 5C8VA 3R3XA 1MX9A 1TCAA 4ROTA 1VA5A 4HS9A 4W1SA 1QJ4A 1PJAA 1MX1A 5HK8A 5JADA 3H2HA 1ZGBA 4GEGA 4PW0A 4KR0A 4Y7DA 2VTVA 2ACKA 2VF2A 2QTBA 3WZMA 4GWLA 4M0EA 1X2EA 1YB7A 4L3WA 3CCCA 2XQGA 5ALVA 2PUJA 3DKKA 4K2AA 4EB0A 2WIDA 1MX5A 3WWOA 1J07A 4FMPA 1E3QA 4B83A 5BV7A 1ZICA 4BE4A 4FFWA 5JAOA 1AZWA 2WU4A 4QLOA 3ZLTA 4W1QA 4LIPD 2D0DA 1XZHA 2XQJA 3OPMA 3ZV7A 3C70A 2DHCA 4ZI5A 1QTIA 2UZ0A 3LIIA 5K3FA 3VVMA 1Q83A 2HDWA 4UBLA 4BAGA 2WJ6A 2AJBA 3W04A 3L1IA 4ZGBA 2OCLA 1JKMA 4EY4A 4J0IA 2PU5A 4Q82A 1ZD2P 4W63A 2QJRA 2JGJA 1ZIYA 2GBFA 3A2LA 1QLWA 3QVMA 2CBGA 1XZKA 4U2BA 1BEEA 3IUNA 2VQ6A 2DR0A 5AOAA 5AM2A 3KWJA 3W9UA 3H1AA 2QMQA 2Z3WA 2QM0A 4FKBA 2WM2A 2XUOA 4NVRA 3IA2A 2B9VA 1LPBB 1ACLA 4CCWA 1KU6A 2K2QB 3B5EA 4H35A 4OUKX 3STXA 4QDUA 5CH3A 1RWQA 1AMNA 3STUA 1ORWA 1EXWA 2WSLA 4AB1A 3V1MA 5JYCA 1CPYA 4EA6A 3PF9A 4WJLA 1XLUA 3HXKA 5CXXA 4Y2JA 4OPMA 1AURA 3N0TA 2ES4A 1H22A 2OQVA 2JGMA 5ALEA 2PM8A 3WK5A 1G42A 2VAVA 5F4ZA 3DS8A 3BE8A 1UT6A 4B81A 2ZJ7A 2AJCA 4HXFB 3FLEA 5HCUA 3D2BA 5AI9A 5AKXA 1J2EA 5YASA 3FOBA 5JALA 1X2BA 4X6XA 5CMLA 2PPLA 4HAIA 2PVSA 5AHXA 3E0XA 3AZOA 2XE4A 3WL7A 1HKHA 5HF5A 4AO7A 3LS2A 4W1PA 4H7JA 1MAAA 3AIKA 4BDTA 3FVRA 3P2MA 3BIWA 2YASA 2HFKA 3B3QA 1R9MA 1PV1A 3F97A 3FNBA 5JZBA 5E4YA 1BN7A 3W2TA 1YR2A 5ALNA 2FUKA 5ALOA 3GFFA 1NU8A 3HJUA 1JJBA 3ANSA 1ZD3A 1U4NA 2Z5GA 4S0XA 1IZ8A 3WMRA 1R50A 4QEKA 1JMYA 1YAHA 4AMZA 1DWPA 1F0NA 3OTQA 4GDMA 2XLBA 2ECFA 4X00A 2XMRA 2VJDA 2P8SA 4X94A 5A62A 2XQFA 1CUCA 4HRYA 2HU5A 1ZI6A 4IH4A 1TIBA 2O2HA 2X76A 4YPVA 3V1LA 1EA5A 5CH5A 2XMCA 5ALJA 4H0CA 4YX9A 1Q84A 2WHPB 1R88A 4QA9A 4Y2UA 2WFLA 1GT6A 2W6CX 1AUOA 4UHEA 3QITA 1UKCA 3VVLA 4JYPA 3G9ZA 2PSHA 2WIKA 2DQZA 3WK4A 4JUIA 1CEXA 3FLAA 4XIIA 2HL6A 2OQIA 2PUHA 3HACA 2WUDA 3H0CA 4UHHA 4FFVA 4H7KA 1AGYA 4C4XA 1W1IA 4FBLA 5HF9A 5FV4A 2VATA 4AMYA 3GA7A 3NUZA 4NS4A 2GZSA 1UWCA 1ACJA 1N8SA 2WHPA 5JD6A 2J3DA 4DSZA 2WTMA 1G4HA 2H7XA 3I1YA 1XKLA 4DGQA 2QXUA 5ALHA 2IX9A 2GBIA 5SYNA 4UBMA 1QO9A 3DYIA 5CT8A 2HA3A 1ZJ4A 2H7YA 2XLCA 4B0OA 1CQWA 3G9XA 5ALIA 3OC0A 4GXNA 4WFIA 3FBWA 1EX9A 2J3QA 1OILA 3Q0TA 5CH8A 5DTIA 5T4BA 1LZKA 2QT9A 2WFMA 4Q3LA 4F0JA 2CJPA 3BF8A 3LCRA 3DYVA 3GBSA 5AM1A 5FPQA 1U2EA 3FWHA 4Q05A 4Q34A 4BAZA 2OCKA 4WFJA 2XUFA 4J0DA 2RGUA 1MNQA 4Y2YA 4H7FA 3WJ2A 4A5SA 1BRTA 1O6GA 3NWOA 3JWEA 4L0CA 1QIDA 1LGYA 4D9JA 2BUCA 2XT0A 4AQDA 2PSDA 4WY5A 3AJAA 4B9EA 1UKBA 5A2GA 4G9EA 4CCYB 3WYDA 4G4IA 4C4ZA 4GECA 4GHWA 5T4FA 2B20A 2XUQA 4CI9A 5AJHA 4INZA 5CW2A 1AQLA 1YAJA 1U65A 5HF6A 1P0QA 5FRDA 1XZFA 1W52X 5JASA 3IBTA 3TRDA 2QXTA 3AIOA 3I2KA 1WM1A 3IDAA 3R3ZA 1MO2A 3ESCA 2Y6UA 3E1GA 1G5FA 3ANTA 3D2AA 4LXGA 2JGLA 4BCCA 5C81A 1UK8A 1H2XA 4GW3A 3AUKA 2C58A 4LYEA 5EHXA 1QIFA 5JATA 4H18A 3F98A 2WG0A 5AKYA 2R11A 1ODSA 4PSUA 1ZD5A 4DNOA 3WL8A 2HM7A 4CCYA 1U8EA 3IURA 3LP5A 1UK7A 4P08A 1ZI8A 2Z8XA 4B0PA 4X91A 3VISA 1AX9A 2O7VA 4WFKA 5AKKA 3L1JA 4FDMA 1AKNA 4FOLA 3O9VA 4J0KA 5AM5A 4OU4A 1QIGA 4PQEA 3F9CA 4OYLA 2XQIA 3FCYA 4AZ3A 3FCXA 3H17A 3GROA 5CURA 3OOSA 5ALRA 5T4HA 4J0CA 5JD4A 3I1IA 1GKLA 4Q3OA 1OCEA 1THTA 2V96A 3STYA 1XZDA 1IUPA 4RNCA 4W9RA 4Y2XA 3FLBA 1CUFA 1QFSA 1N1MA 3R3YA 1YASA 4FLFA 5JANA 3IUMA 2AXEA 3DJYA 1EK1A 2VJBA 3WLAA 1EINA 4K6HA 4GI1A 1JU4A 3H1BA 5LZ5A 5EIEA 3G8YA 3C8HA 4KE9A 1CUIA 1N5MA 4BTVA 1JT2A 3V9AA 1SCKA 1RP1A 5ALLA 4P92A 2HIHA 3VKFA 1K8QA 4EY8A 5ALFA 3G02A 4LXHA 4MWTA 1FFAA 5JAPA 1C7IA 3RKSA 1BU8A 2QUAA 1TCCA 2BGNA 1QTRA 5ESRA 1XZJA 2VT7A 1EVQA 4O08A 3EIOA 4CIBA 4E15A 3I6ZA 5J3JA 1QFMA 4ZXFA 1J06A 3MUOA 2Z8ZA 2HA2A 1CUXA 4LYDA 2Z3ZA 1XRRA 4QDTA 3WK7A 1LPNA 2LIPA 4H77A 4JYMA 3O9MA 2DQYA 3EQ7A 3QH4A 2VJCA 5K3FB 4UBKA 1H2ZA 3NGMA 3SK0A 4J03A 4B7ZA 1YA8A 1XQWA 2HFJA 3TEJA 3K6KA 3DCNA 3DNMA 2G4LA 1M33A 1Y7IA 2WHQA 5IVHA 2ZSIA 2QS9A 3BWXA 4UUQA 4N8EA 4QDXA 3KXPA 3O0DA 1IUNA 5CRIA 4PV7A 1Q0ZA 1XFDA 4G8DA 2HU7A 1EHYA 2JBWA 1TKRA 1E5TA 4H7IA 1VKHA 1UK6A 2B4KA 3WKAA 1CUUA 4E46A 1FFEA 4MEBA 4U2DA 1ZOIA 5A7HA 1E8DA 3IIIA 4G4JA 3PFCA 4OCZA 4ARAA 2AJLI 4UFOA 3KDAA 2WHRA 1MAHA 3AIMA 4FLEA 4HRXA 4N5IX 3WWCA 5FOQA 1S8OA 5LIPA 4RGYA 4EY6A 5EFZA 4WY8A 5AK4A 3DKRA 1E8NA 1XRMA 5ALTA 5LYYA 4C01A 5I8PA 1P0MA 2V97A 4YASA 4KAFA 3S8YA 2XMQA 3D59A 1BN6A 5CT4A 2QKYA 3KWFA 5HKAA 4UBJA 4X3CA 4Y2VA 1GKKA 2VSQA 3DL7A 4PF1A 4MYSA 3O4HA 3QMVA 1QOZA 4HVTA 1W75A 3F8SA 2PBLA 3I2FA 3AINA 3QPCA 3A2MA 4UBOA 4UHBA 3H2GA 3JW8A 1GPKA 1CUVA 4HXGA 1TQHA 4TGLA 2G5PA 2C4HA 4LHEA 1DT3A 4BVLA 4B84A 4F5ZA 3GUUA 3WKDA 1OXMA 4A23A 1CUBA 1VXOA 4X71A 2RHWA 2DHEA 2J4CA 1TAHA 5EHNA 5AIBA 2HA0A 1XQYA 3D0KA 2H1IA 2CEKA 3M81A 1USWA 2O2GA 4HTAA 1SOMA 2BKLA 3C45A 2J4FA 3RARA 2JGFA 3WKBA 3D4LA 3RLIA 4OU5A 3Q8WA 3WKEA 2WFZA 1QIJA 5JAHA 2EEPA 5BOVA 3L1HA 4X93A 4PO3X 3G7NA 1T4MA 4XJVA 5ALYA 4QNNA 1F0PA 1WB5A 5CT6A 5HQ3B 2X5XA 4B6GA 3DDUA 4OSEA 1ZI9A 2ROQA 3R0VA 5K3EA 1THGA 2FX5A 3FYUB 5AIAA 1ORVA 3A2NA 3VXKA 3YASA 4DNFA 4ETWA 1CUJA 3DEAA 1XZBA 4LKOA 4DMHA 3WK9A 2WUEA 1W76A 2WFLB 1CQZA 1A8UA 2PU7A 1UOOA 1CRLA 5EGNA 2EDCA 5AKGA 4GBGA 1WB4A 2HRQA 3IB3A 5IH7A 5D7BA 3H04A 3R3WA 1A7UA 2WUFA 1UKAA 3AZPA 4V2IA 5K3DA 5HQ3A 5ISMA 2IITA 3IUJA 4XWGA 4IQ4A 4KE7A 5DYWA 2WUGA 2WIJA 2GYWA 5AK3A 3FYUA 4AN1A 4OB7A 5AKZA 1HDEA 4KE6A 4DIUA 3HLKA 4EBBA 1UZAA 3HABA 4J0JA 2XMBA 3VJMA 1ODTC 2XQKA 2JIDA 2XUJA 3PICA 4BC0A 4GLBA 5K3AA 1LPPA 2RIPA 1CUWA 3ZWQA 4QWMA 1KU0A 4NMWA 3I2JA 1TCBA 1QZ3A 5AM3A 1QIKA 2WU3A 4QZVA 5FDFA 4G9GA 2GBCA 3BXPA 3HEAA 4AO6A 2PX6A 4PNZA 2JGIA 4H7DA 1XRLA 2CUTA 1C4XA 1D07A 5ALUA 3SX4A 1EVEA 5AICA 5ALPA 5LLSA 5CTAA 1EDBA 1Z68A 1VXRA 5AK5A 4K5QA 2ZYIA 1GQSA 3WK8A 3AILA 1VE6A 4Y2PA 5DYYA 3WL6A 5EI5A 5ALZA 1WCYA 5CBKA 1FSSA 5DNVA 5JIBA 1LPMA 4WCVA 2O7RA 4P9NA 1XZAA 1K5PA 2OAEA 5BWBA 1KEZA 1R4ZA 4HXEB 4TPKA 2JGKA 4IO0A 4J0HA 1K4YA 4J3JA 2WJ3A 2BFNA 2ORYA 3UUFA 2VAXA 4ZV9A 2WKWA 4X6YA 5D3KA 5FXMA 2DSNA 3EF3A 2WLSA 1P0PA 5HK9A 5IVDA 4KACA 5KBYA 4X92A 3BF7A 5DYTA 4MYDA 3BDVA 1B6GA 1ZJ5A 1VLQA 5AI8A 3HC7A 1HQDA 3HRHA 2OPHA 4KYVA 4N8SA 1O6FA 3TGLA 2V9ZA 1UOPA 2OCIA 1XKTA 1E66A 1UK9A 1MN6A 2RI6A 4DLNA 2RAUA 2I03A 1BCRA 5LZ8A 5CXUA 4MWSA 5AK6A 4J0GA 3BJRA 4LXIA 4UHFA 3B12A 2H7CA 4X85A 4UBIA 1NU6A 3V48A 4TVKA 2Q0XA 4CG1A 1H2YA 3WWEA 5JZSA 2DHDA 1NX9A 1F8UA 4B9AA 2C5GA 2OLEA 1QIIA 3FSGA 1WHSA 4NZZA 5KREA 4E14A 2W22A 1I6WA 3HYSA 4CG3A 3O4JA 5SYMA 3V1KA 4AO8A 2XUKA 5EHZA 1H23A 3U1TA 5EIAA 1CLEA 1MTZA 3KOOA 3EQ8A 1SCIA 4C6HA 2HADA 5AI0A 1HBJA 2C7BA 5AKIA 4WDRA 1PFQA 2QR5A 3QMMA 4X97A 5AI5A 5AKEA 3ZLVA 4DMFA 3TJMA 4B85A 1VA4A 3WKCA 1FJ2A 2WILA 1Y7HA 3QM1A 1WOMA 4AN0A 4ZV7A 1CUDA 4OYYA 2VT6A 2ACEA 1JFRA 5A7FA 5FP0A 3VJKA 4Y2TA 2Y1KA 2PSJA 1LZLA 1G66A 1VE7A 3BIXA 4FLMA 3WWPA 4QLAA 1XLVA 3M3DA 4WDQA 4IH1A 2JEYA 4G1FA 2G5TA 1CUZA 1LBSA 4Y2RA 1DWQA 1SCQA 2ONCA 1JJIA 4G8CA 1XRPA 1Y37A 3G0GA 5CT9A 1EDDA 5LKRA 1YA4A 4QE3A 4PSCA 2PSEA 3G9UA 4MXDA 4KAJA 1XRNA 4OD0A 4ARBA 3R40A 2ZVDA 4P93A 2BUAA 4MQMA 4FBMA 4N5HX 5FPPA 3U0VA 3WQHA 1CUSA 2AJ8A 2CB9A 5CT5A 3RK4A 2C0QA 3DQZA 4EHBA 1XQXA 1BEZA 2BAGA 2WQZA 4QDOA 4Q1VA 2XUHA 1SFRA 2C0PA 2XMGA 3QBJA 1LLFA 3X3HA 5C7YA 5FLKA 1EB9A 2FJ0A 1A8SA 5DWDA 4XX1A 1XROA 4I4CA 4Y2SA 4M0MA 5E4JA 2PSFA 3NOXA 4UFPA 1ISPA 2E3JA 5JARA 2QOEA 4X90A 2YYSA 3ILSA 3ESAA 2ZSHA 4BP8A 1LPAB 2D5LA 4JEIA 4F21A 4DYHA 1VOTA 4BBZA 4K6GA 3SWWA 1BE0A 4BYMA 1EDEA 2XB6A 5A71A 3T52A 2R8BA 3G0BA 3AZQA 5ALGA 1VJ5A 5ALDA 3WJ1A 1YCDA 5DTJA 1WB6A 1LPSA 2OAGA 4U2CA 5EIHA 5AKHA 1DX6A 3I28A 1YS2X 3FAKA 1WPXA 2VEOA 1FFCA 3CN7A 4BVJA 2PKYX 4UHDA 4C88A 4KE8A 3ICVA 2GYVA 1XZCA 1VZ3A 5AI6A 4KRYA 1UOQA 2B61A 3WA7A 3WWDA 2XUPA 1DTEA 3O4IA 2H9YA 2JGEA 1MPXA 4BTLA 3C5WP 3VJLA 1JMKC 1E8MA 4HZGA 3MVEA 1QIEA 4BCDA 2QZPA 3H2JA 5FKJA 1TRHA 1GPLA 3LIPA 3N2ZB 2XMZA 1CUAA 1GXSA 2I3DA 2XUDA 4KJXA 5JZ9A 1LPOA 1IVYA 4ZRDA 2XUGA 3H2KA 5DNWA 3C43A 4IH9A 3H2IA 4L72A 5D6OA 4K6KA 4G8BA 1QIMA 4QWWA 1A88A 5AM4A 4X6UA 3W06A 4FNMA 1FFBA 3C5VA 3R41A 5K3BA 4BRZA 1ZGCA 3EQ9A 3WIBA 3GZJA 5K3CA 2V98A 3I6MA 4U2FA 4N8DA 4Q3KA 4RPCA 1ETHA 4DSAA 5ALSA 3ESBA 2OGZA 4CIAA 1T2NA 4B82A 5HZGA 3ZI7A 3WYNA 1WHTA 2DCMA 3M82A 3K9BA 3CXUA 4I19A 5BWCA 4OB8A 2CKMA 1HL7A 3DD5A 1LBTA 1XZLA 4FHZA 1BROA 5LKAA 4MQLA 3G0CA 3QPAA 2VJAA 1UXOA 3PDCA 4KEAA 3WA6A 3I2HA 3MGAA 4DNPA 1CUHA 2JEZA 3WK6A 2HHAA 5DNUA 3LLCA 1JI3A 3M83A 5DLPA 5HFAA 4UFNA 1XZEA 2FJPA 2GYUA 4BC1A 4B80A 2G63A 3ESDA 5AP9A 3D7RA 1GGVA 2XUAA 4AXBA 5D3ZA 1CR6A 1BS9A 4L9AA 3I2GA 2Y2UA 3IVMA 2ZYHA 3JYHA 2WG1A 1L7QA 2ZYRA 3IULA 5AH0A 5ALWA 3ZPXA 1ODCA 2VA9A 3EBLA 1YSCA 4H7HA 2RONA 3HZOA 5I9IA 5LP1A 1EB8A 1W6RA 2EDAA 2WTNA 1XRQA 1CV2A 2Y6VA 1A8QA 1CIJA 2HA4A 3H18A 5LZ4A 1QO7A 5IKXA 5LZ7A 2YH2A 5ALMA 3MUNA 1YS1X 4C89A 3QZUA 2NW6A 1RYYA 1QONA 5ALKA 2HA7A 2WG2A 3AFIA 1MJ5A 3W05A 2PL5A 5AOBA 3FYUC 3R3VA 4H7EA 4UBNA 1F6WA 3I6YA 5AM0A 1R9NA 1DWOA 2HU8A 4BVKA 3GELA 1HPLA 5A6VA 4AZ0A 4CFSA 4FTWA 3OURA 1FFDA 1MT3A 3F96A 1K6EA 6YASA 4MJ3A 3PE6A 1R1DA 4BZWA 5K5EA 2GZRA 1X70A 3C6XA 2HA5A 2AJDA 4U2GA 1R3DA 4EY5A 3BL8A 3KSRA 1DT5A 1H2WA 3BJMA 5KWJA 4MEAA 4A16A 3PFBA 1CUYA 3T4UA 1JU3A 2I78A 5FUMA 1UFOA 7YASA 2GBGA 1EK2A 1VZ2A 5AI4A 4BZZA 2WJ4A 2BGRA 2BJHA 2OCGA 2XDWA 4ZWNA 3FVTA 5T4EA 5ALQA 2JF0A 2QVBA 3C8DA 4X7BA 1L7AA 4DM7A 1GQRA 2YXPX 2ZJFA 4IHAA 2X8BA 4W1RA 1CFJA 3G0DA 1MU0A 1XZMA 2O2IA 4DTCA 2DFPA 1XZIA 4ITVA 4JNCA 3O4GA 1MNAA 3QPDA 4Y2QA 5IVKA 3I2IA 4F60A 5AKLA 1XQVA 3HI4A 1TK3A 1DX4A 3BDIA 4C4YA 1DQYA 3W9BA 1YB6A 5DJ5A 3STVA 4AX4A 4CG2A 4EUSA 2HRRA 2OG1A 4EZIA 4U2EA 1QGED 4OB6A 5C8XA 1N5RA 2ZYSA 3C87A 3ED1A 1EH5A 5AKJA 2ZJ6A 2XUIA 3D3NA 4BDSA 4DNQA 3A70A 1IZ7A 5E2IA 4BP9A 2XMSA 3SC2A 3PI6A 5I7UA 3D2CA 3DLTA 5AOCA 4ZREA 1IUOA 3OM8A 2QRUA 1JJFA 1AC5A 1CVLA 3RM3A 3QMWA 1LNSA 1GZ7A 4RE6A 1XZGA 1DU4A 4FNGA 4KRXA 1P0IA 5HFNA 3E3AA 1CUEA 3OG9A 4C87A 3VDXA 3S2ZA 1XLWA 3WIOA 1CUGA 2Y2VA 3FYTA 4FWBA 3PF8A 2RHTA 4RE5A 3F67A 3STWA 2CZQA 4X95A 5LZ9A 1J1IA 4BCBA 3CN9A 2BUBA 2OGTA 1K63A 4BATA 4YK7A 3D5EA 4BB0A 1SC9A 3V1NA 3DOHA 4G5XA 4BAUA 3G0IA 5H3HA 1DQZA 4DMCA 1E89A 5ALXA 5AO9A 1HLGA 3C6ZA 2I3ZA 3O95A 2XMDA 2C5FA 1QIHA 5EHQA 4Z49A 4UPDA 3CCBA 1IMJA 4G4GA 3UUEA 4M0FA
chains in the Genus database with same CATH superfamily
1K7XB 1KJ8A 1P5HA 1VCIA 3MJCA 1M6VB 1P45A 2WWFA 1P29A 4LE1A 3A4TA 5A4MS 2P3OA 3LUJA 3SE7A 4TKLA 1RHRA 5IT4A 4DUYB 2NO0A 3DL4A 1W19A 3WI7A 1FSFA 4NK5A 3LJKA 2ETVA 2RBEA 4URZR 1C9MA 1IH8A 1NHGA 4HLUA 3KD2A 3KL4A 4BB5A 2EWWA 3ZJ5A 1NP6A 4IDDA 3DM9B 2X6TA 1G2OA 4FWIB 5JNUA 3FZEA 4I3FA 4X45A 2JDIA 3UMJA 2HK7A 1JQ3A 3GFPA 5ESWA 2BC9A 2LIVA 3DA8A 3B1ZA 2H16A 1M7GA 2HHJA 5E7MA 4KPGA 3N6VA 1GPNA 5IVIA 1U2DC 1ZIXA 1MORA 4LI0A 1BQEA 4ON9A 4AU1A 2C2KA 2QR2A 1BCSA 1W59A 5JJIA 4F56A 2BZ1A 2PUEA 5BN5B 5B5SA 1W4LA 1Z5UA 1HV8A 5E4TA 5LQAA 2VZLA 5D51S 2QUBA 2Z09A 5IPFA 2P9CA 5JAUA 1TMOA 3HXOA 1DINA 4G5HA 5KWIA 1GFIA 3MNFA 1VG1A 3DOIA 1R0CA 4HZUB 4J75A 3FZNA 4BASA 3KOUA 3DULA 3M2PA 3W3AA 1QQBA 3C3BA 3WNBA 1B41A 1TJ4A 5IKEA 5HXAA 2TSYB 2G67A 2XI4A 3ZQJA 3SBDA 2ZE5A 2Q3DA 3GFRA 4KUEA 3COPA 1GJRA 3GX1A 2FW9A 3MCUA 3TTVA 3UENA 2VI5A 2QP4A 1YZQA 4X60A 3KNZA 4OX9B 1J9GA 1KF0A 3HKBB 3PFIA 3R5HA 2OGSA 1M6VA 1QH8A 4V1CI 2DECA 4QDZA 1WXEA 1O95C 3M6WA 1YBVA 1WVIA 3DCIA 3E27A 3WOHA 2VVTA 5L6LB 5CAEB 3VOSA 4EMBA 1M0SA 4QGSA 2C94A 3GQBB 1W9MA 2I7DA 1VCNA 4RM2A 1AQNA 4EABA 2JA1A 2MWMA 1NW3A 1N4AA 3ZW8A 2WIFA 3O03A 4HH3C 1E0DA 4U7HA 1GM5A 4A2WA 5IHXA 1NN1A 1TAGA 4NU5A 1UPFA 3RK0A 2NO5A 4BE9A 4JH0A 1SU4A 3LXRA 2MU1A 4IEFB 2H59A 4G25A 3IBGA 4WZAB 3PJRA 1B8NA 4RJJA 4LYJA 1L7BA 5C8VA 4L16A 3GEIA 4Q15A 1MX9A 4ROTA 3S70A 4RIFA 4DIOA 2QVYX 4F1WA 3C8MA 4HS9A 4MP8A 3ZGLA 1QJ4A 2ZSJA 3GEBA 1MX1A 1S8NA 2HR1A 1Y9AA 1BOFA 2ONKA 5ADWA 4RJ2A 5JADA 2P6PA 3DMTA 4S12A 3FMFA 5FUWA 3ZUGA 2EARA 2RGDA 1JTFA 5BR4A 4ND8B 1OFUA 3CR8A 1IWPB 4HZUA 2DRIA 2YXEA 2BZSA 2R8XA 1PQPA 1GSAA 2ZIVB 4E03A 5TMDA 2PX3A 4Y7DA 4HQFA 1M5TA 2VF2A 1JXQA 2QTBA 1QJCA 4M0EA 2REBA 4QT4A 2XRMA 1DCFA 1QZTA 4NSNA 1PCXA 2ZIZA 1MIHA 1N8TA 3HXTA 1T9DA 3GFQA 4L3WA 3I2YX 4BN4A 3A4YA 2XQGA 3BYZA 2AWOA 3HKBA 2ADFA 2A14A 2OQRA 1EP2B 4RY8A 3DKKA 1UDWA 4GRIA 3NGXA 5JO0A 5JAMA 4M6WB 5K2OA 3WWOA 5DB4A 1GPYA 3QE0A 1GFSA 3JZIA 2SNIE 4DV3B 1SHLA 1R37A 3FMVA 3IUYA 4K6FA 3RG8A 1R0BA 3MMXA 3SKXA 3PEEA 2B3TA 2VL7A 4D41A 3I6BA 4FFWA 4HNAB 2WU4A 5KNDA 5FEMA 5K0ZA 3N8KA 1RZUA 4BFVA 4O59O 2FW1A 1P33A 4LIPD 1W1UA 1LNQA 2BWJA 2XQJA 4FYYA 5FUBA 1EDOA 3B48A 3OZGA 2GJSA 4WZAA 3PFFA 1X92A 1QTIA 2GXQA 2SCUB 4WTOA 5FTWA 3ELYA 4I50B 1MO6A 2MR6A 3AUSA 4PZYA 4G1BA 1W7AA 4Q3EA 4CMKA 1GGKA 1D8AA 1HE5A 2P65A 4XEHA 4ZODA 2IZ6A 1AXGA 4RMJA 4DLSA 4EEXA 2AEFA 3GPLA 4Z4EA 2VZ9A 2OWDA 3SIXA 3U3KA 4DIKA 3E9CA 4V24A 2IHNA 3L7OA 2M1ZA 5FFFA 4JR0A 4IMJB 4BAGA 4RFSB 3R0IA 1XMPA 1MVNA 1UJ6A 2WJ6A 1T3ZA 3EIHA 3WJ7A 4EFLA 4RD3A 3IKTA 4EA7A 2GFIA 1HURA 1T5IA 3NIGB 1D9ZA 4MKXA 4YUAA 4YO8A 1Y7LA 4JL6A 4E32A 3SDZA 1MC1A 1TPZA 1Z13A 1I1QB 3FNIA 3ROPA 3EYAA 2QU8A 1GCIA 3W04A 4MLDA 2I2DA 4DL9A 4ZGBA 2J09A 3CBQA 3IT3A 3KEQA 1G20E 4EY4A 2R85A 5KSZA 2DKOA 1M3SA 4KQEA 4M4SA 1GG8A 1GDDA 5G53C 2BJVA 5T64A 2QLMA 3NUQA 3V7WA 5FLYA 1PD0A 1D7OA 3CU5A 4JB3A 3PUXA 4ZVOA 4L15A 4A8JB 1LDYA 4W63A 3SKYA 1NC1A 2QJRA 4HNAA 4K1LA 4HV4A 2JGJA 2BGMA 3VR4A 2OZPA 1IN1A 1VMDA 1VJ0A 1N2JA 2BD0A 3PNMA 4YJKA 3V8MA 4EP1A 2GBFA 1BDJA 1HOTA 2FLKA 3JU3A 1XZKA 3K9LA 4OTZA 4ASUD 1K0UA 3A1TA 2ZRNA 1GQYA 3EG5A 2XNDA 1HYGA 1N6PA 1E2MA 3SFTA 3AKYA 3WWZA 4ZU3A 5IUJC 1Q57A 3VVCA 1N6OA 2XUOA 1KIMA 4MX8A 2V7PA 1IHXA 2B9VA 2WWGA 2QRMA 2A94A 2O0KA 3QXJA 4JT9A 3LBAA 2BEKA 3N8HA 5TF4A 4BGDA 3SMQA 3OFJA 1ZYUA 3WGNA 3B5EA 4H35A 4OUKX 2D00A 3STXA 1RWOA 2HJGA 3THXB 3QW4B 3S6JA 3OU2A 1N9KA 2AD5A 1OYWA 5C3MA 1RJWA 1W0JA 3GBVA 2AMJA 1AU9A 4RQBA 2VHUA 1EXWA 1YC5A 1JB1A 3GJ3A 1U3TA 2NO9A 4TSFA 2WSLA 4G6ZA 3U0BA 2YNMC 3DP7A 1A2BA 1T9BA 1GNRA 4IZOA 1W88B 4WN9B 2G76A 3NEAA 2GZHA 3FTPA 2C9CA 3PEUA 4BKOA 1NR1A 5FOVA 1Z5VA 5FBHA 3QF4B 5LQDA 4FZJA 3AEZA 1XLUA 3HXKA 3KVNA 1P1IA 4PG5A 5CXXA 3UGJA 2JAPA 1DBPA 4OPMA 4U9IS 3F8WA 2VP0A 5G0TA 4HEA6 1AURA 5BVHB 1MX3A 3RD5A 4MQFB 4I14A 3BA1A 4FK8A 3TUJC 5EMHA 4PANA 5B2ZA 2XOKD 1ZM9A 3EGWA 2C7GA 4ZVTA 5AW5A 2J9FB 2OQVA 3ZQKA 3RRYA 3S1AB 5SZIA 1NQUA 4GXRA 4I4IA 3FGZA 3OCWA 4RNDB 3UMFA 2VNJA 2R6FA 3K16A 3KUCA 4DLWA 5LOVB 1QPBA 1D2HA 5L3SA 4IUBS 5HYVA 4R01A 3NP7A 1TK9A 1WMFA 1MLDA 2O0JA 5I01A 2NZJA 3HM2A 4JJZA 3ER6A 3NYWA 2AQ8A 2Y66A 3FVVA 3DS8A 3N53A 3JD1A 4JMPA 3AEXA 4BMNA 1YVPA 1MIOA 1RYFA 1TTHA 1UT6A 2R47A 2EJTA 3LOQA 3PUKA 2ZJ7A 3ON5A 1DKPA 1J56A 1W34A 5BYKA 3TRFA 3FLEA 4EHHA 1YE3A 1TMKA 4P3NA 2WR8A 4HLDA 5AI9A 2CXOA 5YASA 2FE1A 1P3DA 4EPVA 5F9FA 1X39A 3RS2A 4GPIB 1I2DA 6ABPA 3FOBA 1X38A 4XLZA 4GIBA 2BE7A 5I4BA 1X2BA 1ZPDA 3IXQA 3NDRA 4K3UA 1EFCA 2PPLA 3LFUA 3W8NA 1JA9A 1DWUA 1D6SA 1M1YE 1V8DA 3DQQA 2OECA 3AUJB 4BNWA 5LMUB 1W88A 2NXEA 4XJTA 1IQPA 3DNPA 1T9GS 1YS9A 4QX6A 4R1UA 4XYEA 4UD6A 1EESA 4IDEA 4KUGA 3AZOA 3HZHA 5EKUA 4LBZA 2GD1O 5A9SA 3AO0B 2HT1A 4K9LA 3UKOA 4G0OA 2WZCA 1NT2A 2J08A 3PC6A 2ZLBA 3LS2A 1TT5A 2EG9A 4W1PA 3R7NA 4LDAA 1U5BB 2P2ZA 4KLNA 3IR7A 3PGJA 4H7JA 2C96A 2X9NA 4AJPA 2I6XA 3BFVA 1P4AA 1ISJA 5J4KA 2IHVA 5DM2A 3JVVA 3Q7SA 2UUBB 2IKSA 4OFXA 1A9OA 3FD8A 2YHIB 3OD1A 3RIMA 3B3QA 2OO5C 3PEYA 1PV1A 2BSAA 4PG7A 1P9WA 4UCQA 3TVTA 3WB2A 4DWVA 2FP3A 4F3CA 1XTQA 4ML3A 5ALNA 3NRJA 5JBIA 4PNPA 3R7DA 4JCOA 1BH6A 1P31A 1JIUA 2RHLA 3VX4A 5ALOA 3RSSA 5JLJA 2V4ZA 3ADKA 5DT9A 1PF7E 3PXXA 3SXJA 5IS2A 1S3FA 2HUPA 2E7ZA 4MVJM 4YCSA 3PB3A 4OHRA 1I2ZA 2XGOA 4RZ2A 4CQLA 4D3XA 2JGNA 4NBTA 1U4NA 2Z5GA 3CPEA 1PLKA 2A5GA 4ZZ1A 5ITVA 3FRHA 3N0RA 2CCGA 4S0XA 4D4HA 2A0WA 1IZ8A 3DFMA 1OGIA 1UH5A 1GL7A 1YCHA 3MXOA 4IZIA 1Z5PA 4ZAVA 3WMRA 4A6DA 4I2NA 4LVOA 5E6SA 2Y1FA 4JP3A 1Q1NA 4V0MA 2ZULA 3T5MA 4Y6OA 5ADHA 1ETUA 2Y1GA 3UN1A 4ZIRB 3EVAA 1AQYA 1F0NA 4RBNA 5J4LA 4FWTA 1N8NA 3D6MA 2AOWA 3ODGA 4GDMA 2XLBA 3UXHA 4TT3A 2IPMA 4E30A 3ZHCA 2CNLA 5KOJA 4X00A 2XMRA 1U5BA 4B4UA 3QE3A 1HDCA 2P8SA 2Z8YM 2GPSA 3BBPA 4QATA 2H2DA 4R1LA 1CRPA 3ZHRA 2JLQA 1P8AA 3I9V1 3CH7A 4GXQA 4X94A 4P86A 3UB2A 5FB3A 2WYHA 2FUNB 4ZEMA 5JMTA 1ECFA 2XQFA 1WUTA 4HRYA 4YFYA 3RTCA 2WKQA 2YHIA 3NJ4A 3F73A 1V95A 2XZDA 3GDFA 1CETA 2B5OA 4RJIA 4D99A 2GM9A 2X76A 4M1EA 4RZIA 1C0KA 2PZBA 3ET4A 4EYEA 3LX6A 3AGQA 1MG5A 3V1LA 1YONA 2AEMA 4H2DA 5CU7A 1KO8A 3K9WA 3TQHA 1JQBA 3TDNA 3CRZA 2O2XA 2X23A 2WHPB 3OKAA 5I48A 1LSSA 1JKJB 1A1SA 1R88A 2ZSBA 2HZBA 2ABWA 3BMNB 3K0CC 1ZXLA 1WW2A 1ZIOA 4B4VA 1GT6A 2PZJA 2C9DA 3IAM6 1T13A 4GLLA 4CV1A 3RJ9A 1QV6A 5JNVA 2OLJA 4B3CA 4FJ1A 2FWMX 4UHEA 3OZ7A 3IEUA 2QD1A 3H9BA 1FTWA 5IAJA 1UKCA 1VLVA 5I8ZA 3SC3A 1BA3A 3VVLA 1Z2AA 2PSHA 4BGEA 1PQWA 4UQLA 3B3GA 4CM5A 2IW1A 3AXTA 1L5MA 4ZIRA 1F2VA 4Q93A 2OV4A 3EUFA 4F04A 5B2EA 1SEVA 3T0GA 4XIIA 1OH7A 4W7HA 4XD7D 1AE1A 4N0DA 5FWAA 1N32B 3HACA 1GSHA 4EI7A 4HYTA 2PLAA 1T1EA 2P3QA 1YB4A 1AHNA 1C4KA 1JR3E 4OMDA 1ZJ6A 4FFVA 3WWYA 5KJFA 4XARA 4H7KA 1AGYA 3PHJA 5BSKA 3AL2A 4M1ZA 2IVZA 4FE3A 4FBLA 4HH4A 4NIMA 4EY3A 4H4DA 5HF9A 3E3MA 3ZV5A 4F12A 1FYWA 1IEWA 1GPBA 2YIMA 4AMYA 1A7KA 1D2EA 2ZBDA 1W4AA 5LD2B 2H8KA 1E92A 1ZGAA 3FF1A 2Q4EA 3TIXB 4DIFA 4XQEA 5L45A 1N9GB 1B0PA 1RM3A 3QVOA 1IHUA 1DTSA 4J4HA 4KIJA 4PN3A 1Y5RA 5JZMA 3B7WA 1HSOA 2WHPA 3BHIA 2DG2A 3OP4A 1JKJA 1HF3A 1KZYC 4BFUA 5G0SA 1MAUA 3W1WA 1YNOA 1UPXA 4GVLA 4DSZA 3TFQA 2VRBA 1YJQA 1XJQA 5COBA 5TEVA 5TV2A 3EZXA 1U2TA 4YRDA 3EGDB 2ZU0C 4ILKA 4NYJR 1RIIA 2G40A 1KVQA 3ZWOA 4O4HA 4A0HA 1II9A 4CMCA 5HR5A 3WLTA 2ZUVA 1RRFA 4DEXA 2QXUA 5IN4A 1BGVA 1ECPA 1GNQA 1SOVA 2EJWA 2GN8A 5EIXA 3GGJA 2IX9A 1LRJA 5IP5A 2OV2A 1OASA 2PMBA 5C18A 2FPPA 2GBIA 5SYNA 3TBFA 1O0SA 2RAPA 1CRQA 2PKQO 2O9JA 1NNI1 3DZDA 4UBMA 4OLJA 4UNPA 3TL2A 3AB3A 2PJZA 4EHDA 1TM3E 4A6PA 3TKLA 3ORHA 2REXB 4A3SA 1M54A 3L0ZA 4EKGA 1XJ5A 1LI4A 3GEGA 4RPJA 4OM8A 4Q6WA 1QO9A 3RFCA 1Q50A 4MRMB 4MYTA 2X5KO 1ZJ4A 1ESMA 3F74A 2R4QA 1NJ5A 1Q44A 2AF3C 2XYPA 5I3CA 2P6NA 5J1SB 1FFYA 4ND3A 4GXNA 5ERYA 3F46A 3LT2A 4C3OB 5AVQA 3L0PA 4ZQIA 2QM3A 3H8SA 3Q0TA 2Y1EA 3LL4A 4IF4A 4KXLA 4N40A 4QPNA 3SMVA 5HUHA 4QREA 1DRUA 3QKUA 3LCVB 4J2HA 2EF0A 4C21A 1U3UA 4ARCA 1D3AA 4MTLA 1YZUA 1N9GA 2YFYA 3DEFA 3K73O 4AT1A 4H60A 3JQ8B 2B30A 4OQZA 4MV1A 3DYVA 4A9AA 2Y77A 1KBZA 3KFLA 1NMSA 2P2DA 3FPBA 1DKRA 3QLVC 2WJZB 3K1AA 4Q05A 3LKVA 4K9DA 4IEEA 4H1VA 5CGQB 3JZMA 2PNFA 3LI2A 3HCRA 4PE5B 1HY3A 3FR7A 2FMKA 1ZL2A 1GVHA 2CB0A 2NYAA 3C1AA 3KJEA 2PX0A 4NMHA 4O1MA 1OU4A 4OHXA 3HDVA 3I53A 1KMHB 2H7VA 2RMKA 4B5LA 4IIHA 4A5SA 2RD2A 2Q5CA 2QVCA 2JGDB 3MJFA 1BRTA 1K2WA 1UEXC 2OHIA 2REQA 4L8VA 1V3QE 1W29A 1K88A 4H27A 3D7MA 2WW8A 4UU0A 2LCIA 3DVAB 4UEWA 5KYWB 4CKEA 3RRMA 3ONWA 4AQDA 1Q1AA 5FD8A 4CL0A 4GP7A 3AJAA 3NRBA 4BQRA 1GUBA 3FBTA 3PKIA 3RU7A 4F92B 4MRMA 3OEEA 4Z6KA 3T0IA 3DR3A 4C5CA 3K0FB 1KAMA 4EO7A 3WBJA 4WNYA 2FSFA 4M76B 4DNXA 5EIFA 4GHWA 1ZNQO 2I65A 2B20A 3ZWBA 1Z7YA 5BQXA 2SKCA 4LBYA 2Y0DA 4IIYA 1CT9A 3W6PA 4INZA 1NY6A 4ZC8A 5HG0A 4WBNA 1XMJA 3P2EA 1V2GA 2X42A 4UU8A 3WX0A 3ZE1B 3CIOA 1U65A 1P0QA 2O54A 4MO2A 4WXMA 3U80A 3JQ8A 2SBTA 1NAHA 1PR0A 4HDMA 3FOEC 3VA7A 1YBHA 1L4UA 1KERA 3HY3A 4OP3A 4Q47A 3G7UA 3TRDA 1ZUIA 2IXTA 2QXTA 4G5SA 4KX3A 4EYQA 1SVOA 4BX2A 4RIHA 2NV6A 2ZDHA 3HLTA 3ND7A 4GX5A 4C2UA 4YAJA 4IX9A 4G5YA 3D2AA 1P1HA 3ASVA 3VR1A 2JGLA 1K6JA 1ZWKA 1E2JA 3GRPA 5C81A 5JCJD 2E87A 2JGDA 5LCXA 2WJYA 2H9AA 3TLYA 4XEUA 4OIMA 1Y8RB 3T61A 5IAOA 5KCZA 4ZYUA 1G3UA 4QVIA 1BJRE 5KYWA 3KKZA 2WICA 1J0EA 3AUKA 5EHXA 4G5GA 1QIFA 1XRJA 2OUKA 1PUIA 2OHFA 3QVUA 2DWPA 3I3SR 4FIZA 3W5VA 1DCTA 4PEVA 3NALA 2NM0A 1N2IA 2WG0A 3IKJA 3SEQA 5C4GB 1YK1A 1ODSA 3DBHB 4PSUA 3CX3A 1ZD5A 2AN5A 2Z5FA 4DNOA 1XPJA 1FC0A 3H8JA 1C3EA 2GJ9A 2GPTA 2H1VA 3T3GA 4I5DA 1F0KA 1TQ2A 1UK7A 5EWLB 2X0KA 4TXLA 1R4MA 5FAXA 1YRBA 3JQFC 4G5QA 3V4PB 3EPJA 5KC8A 2E4ZA 1NG9A 3VISA 3OE1A 3W77A 2P9GA 3C4VA 4JB2A 1E0JA 4KQ2A 4Q9HA 5FHQA 1U1EA 5KOIA 1CNMA 4OMUA 2JKVA 5AKKA 3Q8XB 2UVQA 1L4FA 3L1JA 3LYHA 2WAOA 4FDMA 4HNHA 5CB6A 1UAAA 3GCDA 3O26A 1P2GA 2OBXA 3JS5A 3QV2A 2XITA 3KK0A 4KO3S 4O2BF 4OU4A 4GT1A 5LB2A 3ADCA 5TE9A 3QSYA 1W4RA 2FG6C 3MQ2A 5A5GA 3VU0A 2XB8A 2H4FA 1USKA 1P5ZB 3KLOA 1G8MA 1WUHS 4C0SA 3K3PA 1SY7A 2W90A 2V7GA 1T9ZA 5BMVB 2DH5A 1ORDA 2QQGA 4IGEA 3WSTA 4M7WA 1Y8RA 4Q3OA 2BR5A 1SB9A 3B9BA 2Y99A 2GRUA 3L7CA 3PPVA 1XZDA 4TTJA 2Y71A 5ELMA 5FHRA 2I2CA 1XT6A 3C7AA 3AESB 1DEHA 1N2HA 4BLWA 4RY0A 1Y4DE 3DBHA 3JAKA 3N2KB 4FYVA 4JI3B 5C3UA 2VDVE 2ZRIA 1GU7A 3K94A 3TCXB 3M1YA 4TMFA 4YDSA 4Z1OA 4TTRA 1UWVA 4OH1A 4LOIA 3EXIB 3HN2A 5AJXA 2FWAA 3ZKAA 3MTEA 1OJ7A 1ACMA 5ESDA 4Q4CA 1HQCA 5CA1A 3ZGOA 2O1WA 3Q72A 4JA2A 1OWLA 1M5RA 1T8PA 3M5CA 4HNTA 5KYYB 3A6LA 5F98A 1SHZA 2OYRA 2H2AA 4DDUA 1F17A 2NX2A 3GNSA 5JCOC 3HFSA 2HDNB 3Q4GA 4IDFA 4TS3A 2G7MC 1WCWA 1CR1A 5FBLB 5DM0A 5CFQA 4ZQBA 4TLEA 1YZHA 3DC2A 5JFGA 4ZVQA 5HX7A 2IY8A 3ZW9A 2B21A 4W5WA 5DWQA 2QRZA 3G8YA 1E3SA 2PUVA 3FYCA 3ADBA 4KE9A 4AX8A 3EC7A 1N5MA 1SBNE 1DRVA 3DPUA 4BTVA 4CIXA 3IQXA 4QTTB 3TLCA 3ZTWA 1SVSA 2QPTA 2YVUA 4P92A 2QAGC 3NNSA 3TZLA 3W2EA 1UXJA 5BMVA 4EY8A 3BB4A 3NB0A 1ZEJA 4QFBA 1Z74A 3TH5A 3MOGA 5HS4A 4QHTA 3I8XA 4Q4AA 5DLQC 3W4JA 3GT4A 4A1FA 4DUGD 3GL9A 3EIUA 4KPUB 3T3DA 3CT6A 4Q21A 3RKSA 2QUAA 1S7GA 4HWTA 4KI7A 2GD6A 4PAMA 1VCMA 1CZNA 2RSLA 3CLSD 3FWZA 2IOQA 2Q29A 2WT9A 3N2KA 1ZZEA 3G13A 3R7SA 4ABTA 4CT4B 5BNIA 4MCHA 1EVQA 4TYWA 1OVGA 2R8PA 5GY7A 4AJ2A 4JP2A 4K46A 1U2ZA 1UBFA 1ZXBA 1TZCA 4WL0A 3DLAA 5CR9A 3TNDA 3OX1A 4L8FA 3V2UA 1Q92A 4K6OA 3MUOA 4KXFB 3QXSA 2Z8ZA 2HA2A 6Q21A 4QQRA 2R6JA 3CO5A 2ASVA 5J47A 2Z3ZA 4QVGA 4DLZA 4XVUA 1I14A 1Z3IX 2AD1A 1MENA 4E22A 3T8YA 3GJYA 2DQYA 4BQPA 4O5AA 1TF7A 2C95A 1GCAA 2ZBVA 3E0QA 1VSTA 4XXHA 3B6KA 5B7GA 3HV0A 2VJCA 1C9KA 3QH4A 5ANRB 2NTNA 1UIMA 3ZNPA 3UF0A 4OOEA 4UBKA 3U4IA 1PDVA 4MEJA 3C3YA 2DR2A 3AVTA 5BURA 3X2FA 4DV0B 3LG2A 3MFYA 1X87A 4OUDA 2R8OA 4J03A 5SZJA 3PI7A 3SJUA 1ZMBA 3W5UA 2H1CA 2CVQA 2HFJA 3OCUA 1QP7A 4L4UA 1EZZA 1A5AB 4LG1A 4PTYA 4KPUA 1SZPA 2JFXA 5AHRA 3IGFA 3K6KA 3TEJA 4ED9A 3CVVA 5MN5A 4M1WA 5TGTA 2WY2D 4HNUA 4UJ3A 3V3TA 2JEOA 1MFPA 4KO8A 2OXIA 4TRJA 1MD9A 2YYAA 1N2SA 3ESZA 1JKFA 1XC7A 5BR1A 1PD1A 3PXGA 4C04A 4BO6A 3QI7A 3CNOA 1O77A 1V4NA 1Y7IA 1ST3A 3W7BA 1K9SA 2EHJA 1B6TA 3LQFA 3P2KA 5F9HA 4BNHA 2V7XA 2ZRKA 3SXUB 1R6TA 2B34A 3UJBA 1ZY2A 4UAJA 2FN3A 5JJCA 2X6QA 2V54A 3OOJA 2FTKE 4GKAA 4PG4A 4PV7A 4B3FX 3FMGA 5JDCC 5B7QA 4DR1B 4OQDA 1YJXA 1UPCA 4IAOA 1ZVVA 3IVRA 1DJNA 3Q5EA 3H5TA 2JDID 4MR7B 1DELA 1FA9A 1HH4A 5C4IA 4NEQA 3HP1A 2LDBA 4GKKB 2JCBA 3VV3A 3EYWA 2C7PA 4LF5B 4IGAA 2Q1YA 4H7IA 2JGAA 2J45A 2VO1A 5IM5A 2B4KA 1CDDA 3A11A 2HSZA 4JJ7A 5FQNA 4XR4A 4IDQA 1CB0A 5HQJA 3TUZC 2ID9A 2Y1WA 3IP1A 3MMNA 1GGMA 4F2PA 4GX2A 121PA 3I45A 3CZQA 2QD5A 1DTWB 4J94A 5F2NA 2VTDA 3ZJTA 3QLTA 3X1XA 2HD4A 1YMUA 2ZJAA 3GH3A 4HYEA 5AYVA 2P7HA 4ARAA 4GX0A 2IHBA 2WHRA 4V0NA 3D3EA 2H1WA 3BGOS 3W3AD 3AEUB 3RU2A 3ST7A 3HA2A 3G23A 2O8FB 2V3CC 3NAQA 2SKEA 1G7SA 4JT2A 1XRMA 3AR9A 3FKSA 3R1IA 4ZCTA 5BQFA 4O3MA 5LYYA 3R9XB 1X9HA 6GPBA 2P1ZA 4IOLA 3IQIX 2CVOA 4ZI7F 3NBXX 1UJ5A 2EL9A 3SXUA 4UU1A 3O7MA 1YFJA 2VXCA 3BORA 1Q12A 1NFRA 3IDQA 4ENTA 1ECLA 2XMQA 2G07A 4U8GA 3SEFA 5KKNB 4RH0A 1BN6A 5CT4A 1C3VA 3COZA 2QKYA 4EKIA 2NTEA 1G5IA 3A2KA 2QV7A 3AY0A 4LF4B 3KWFA 4AKSA 2JI9A 3KKQA 4G86A 1F2TB 1K6XA 4MR7A 3ZNOA 4ECEA 5I5GA 4C2TA 4OYHA 4Y2VA 2OK8A 4ONEA 4WW0A 3C4JA 1TA4A 2WVAA 3GEDA 3T6KA 3U56A 3TVYA 3A3PA 5K51A 2I0FA 1LWNA 3ZH2A 2IGBA 4PLPA 4WKGA 2HBZA 4C2BA 1E6WA 3P0FA 4DVGA 3R5SA 1G0OA 1PJ2A 1IQRA 3EF1A 1TPYA 5AHKA 3W5CA 1X7YB 4L07A 2EW2A 3URKA 4JXJA 5EJFA 1DTWA 3Q1KA 1M8PA 1G20B 4MINA 1VHLA 4F97A 1P9OA 2VSYA 2X58A 1B00A 3MELA 2IYNA 3RFVA 3Q7PA 4HN4B 3JRWA 4HVTA 1E2GA 1E2FA 3NORA 1U5CA 1W75A 2AN3A 2CC2A 2PBLA 2X3YA 3EOBI 1WP4A 3RFTA 4ZK2A 5ARBA 3N9IA 4I08A 3QPCA 2JHPA 3UAVA 3NYIA 5F3WB 2I4TA 2ID8A 1H85A 3A0UA 4UHBA 3TGWA 4W5OA 1VRWA 3OECA 1MPTA 4JI8B 2P9EA 1AT1A 4A82A 1UBUS 4B7UA 3JSXA 2V9CA 3ZXXA 2KMLA 5L3QB 3R9XA 3LZ6A 2L17A 1JUDA 1NF3A 1YL5A 3MTQA 3NWEA 4KIFA 5GONB 3T9BA 2WABA 4ZN6A 2R48A 5J58A 1WU7A 4LHEA 3RIGA 2R7AA 4BUCA 4R84A 3B7PA 4A27A 5LIRA 3K4HA 3RU9A 4F5ZA 1VP3A 3BXFA 2RIRA 3GUUA 1XVTA 3W0LB 3VSBA 4BWVA 1O7JA 1NJ8A 5KNDD 3F0TA 3K4QA 5CJ2A 1AS3A 4LDNA 2ATCA 1TAHA 1F2TA 2XCLA 1USVA 2YWJA 4GKVA 4I66A 4PC7A 3IKVA 3GIDA 4NJOA 5AIBA 3U4HA 4FHEA 3B3FA 4BKQA 2HA0A 4CMAA 2Q2WA 1DS6A 4DQ0A 1SIUA 3EASA 3SQDA 4DF3A 3RBAA 2AOTB 2LKDA 5I9TA 1TIKA 3HBAA 5J2UF 1FSPA 2O2GA 3GD5A 4RKEA 3Q40A 4HTAA 5K0EA 1X7YA 3A04A 4LC9A 3RARA 1H5UA 1QCYA 2YIJA 3HJHA 4NBRA 3WKBA 3TBKA 1G20A 4E5PA 2GJKA 5B1DA 3IE2A 4HY3A 4GKJB 3RLIA 3V7NA 3QEAZ 4BQNA 4JI2B 3Q8WA 4MO9A 1JHMA 1YI0A 2FR8A 3CEJA 3QVVA 5T6MA 3TW8B 1DPFA 2XVZA 3HHPA 3W5DA 1UZUA 4LRQA 5D87A 1KYZA 3LT4A 5HJ2A 3CNQS 1U8CB 1VIYA 4N47A 5CXQA 4KO1S 2JIBA 3I3OA 4YP0A 3WLEA 4W4TA 3OT4A 3M6XA 1JEOA 3H2BA 1A95A 1GARA 3NT2A 5GONA 3FLMA 1JDNA 1J42A 5IT0A 1BXKA 1O4VA 1R5JA 3UG6A 1F0PA 4DB4A 3GT7A 1DC3A 1C8VB 5H83A 1RYBA 4JQOA 3TNYA 5TMPA 3KXKA 2X22A 3K96A 2F3TA 4ITUA 4UNIA 2LV8A 3EUAA 3LA8A 4L0QA 3OPYA 1W9HA 5AWFC 4V0LA 1M6WA 1VFPA 2AOXA 1HC7A 3BTUA 3KR0A 3R0VA 4RKWA 5EJ2A 5EQTA 5FWXB 3KR9A 5K3EA 4DYVA 2XNDD 5AXCA 2C2ZA 5C1BA 2AOTA 2CEAA 3A2NA 3ITKA 2FN8A 3F6PA 3UFXB 4E31A 4WLOA 1FLAA 2XY4A 1E7QA 1M1YB 1GR0A 1XZBA 4Y1RB 3U37A 4LKOA 3WGJA 5MHTA 3IAAA 1D6JA 4YECA 3RSOA 2PVPA 5AJWA 2FYTA 5CVJA 2WUEA 1X7DA 3HJFA 5T41A 1QG6A 2PRYA 3C5EA 3EVZA 1E6KA 3G88A 2K7FA 4JUAA 1T1SA 1QYWA 4M99A 4CM6A 5KYXB 2E6KA 4L7VA 1ODFA 4FCCA 4I5GA 3T5AA 4WZBB 2WOJA 1E4EB 2PU7A 2X0IA 3AOEC 3D7SA 4NCIA 4QGHA 1Q95A 2EDCA 2YDXA 3RE1A 5DNYB 5AKGA 4TSFD 4BFSA 5IDYA 3L7BA 2OCXA 1WB4A 5E0KB 4OI0A 1I0IA 1AO3A 2P6OA 3OO1A 5CYGA 3ZU4A 2VK8A 4UAGA 1G7RA 4X84A 3F2VA 1WQ1R 4PFQA 2ZTHA 1R4NB 1XXHE 3FCSB 2UZ1A 4OGKA 4RZUA 2WUFA 3AZPA 3ONNA 1GR1A 2EQBA 2YY6A 2FVXA 3VBEA 5ISMA 1DBSA 4OFWA 1YRHA 3GY0A 5E7QA 3IUJA 3NT5A 4FR5A 4HHEA 4TMYA 1KJ9A 1ORHA 3IQFA 3C3DA 1KRHA 3A3YA 1Y1TA 1NQ5A 1NT4A 1BE6A 2FWRA 1ND5A 1QH0A 2YWFA 3G9QA 4NWIA 1OXVA 3VM6A 4KE7A 5FOTA 4BUZA 2WIJA 5JBNA 2HMUA 2MOKA 1FDVA 3QFCA 4L4SA 4LMRA 4NECA 5FWXA 5KTSA 2GYWA 2HIAA 5AK3A 4CJXA 3Q41A 3KAJA 3UKJA 1LQUA 4J49A 2FEWB 4POAA 3PGLA 4W9MC 1OGJA 4DIUA 2CXNA 3HA5A 2ZYVX 2AK2A 2BHRA 4XCVA 3RSCA 1TFRA 3TTYA 3SICE 1UZAA 1Z6YA 2PZKA 3EMKA 4GGMX 3VJMA 1N34B 5FPKA 2D2XA 1DRKA 4REQB 4PXAA 4YCBA 4S2EA 4F3KA 1VL2A 3TLMA 1M1ZA 2IUEA 1UJNA 1M67A 3WDLA 5KYXA 2P2LA 1Q7BA 3CPJB 2FOXA 3A8TA 4WZBA 3SM3A 2KM1A 3FI0A 1K75A 4FHFA 3NTVA 2IS4A 2IBMA 3KUUA 4GNRA 2DBYA 3EMVA 3IMFA 4JBLA 1P9RA 3DVLA 2PMFA 1D1QA 1UPTA 2PQ0A 3OX4A 5EHIA 4BC0A 4IW3B 1II0A 1LPPA 1ISIA 3G0OA 4BJ6A 3TR5A 3ZWQA 3RG2A 4AJNA 2VCEA 5LFAA 3V2GA 3OTOB 2AYXA 3DE0X 2QW8A 1Z6PA 4OQNA 4ZOEA 1KU0A 4A8PA 2HIGA 4LRTB 4EFNA 4RIEA 2ZRPA 1KI9A 3OJWA 1TCBA 2IYEA 2P2CA 1YZFA 2ZETA 4YB8A 1OC4A 2FQQA 3ZWXA 3MJHA 1W5TA 2UZAA 2QGZA 4JR1A 4KN6A 4WXPA 4C3VA 3W5IA 9ABPA 3BWCA 4KWTA 4UXIA 8GPBA 1VBFA 1O94C 4GBJA 4XIYA 2KBEA 3IJPA 2DBRA 1KWGA 4G9GA 5EJGA 4KR9A 3C2QA 2GBCA 4UZSA 1CJCA 1T9HA 2Q4BA 1VHTA 5F76A 2O23A 4AO6A 3EWIA 4MKIA 4CM8A 5HHTA 1BVHA 3SJBA 3BN3A 4DXDA 3E7WA 1YR7A 2B4YA 5F2OA 4DCCA 4PNZA 4W7IA 4ZFNA 4AYWA 1D07A 5A4DA 3JD2A 5ALUA 3TG2A 1RLJA 1EVEA 2LR0A 4YS6A 4REQA 3AW8A 4ZJYA 2J3JA 3PGVA 1R5NA 4OHPA 1C14A 5E3IA 2QD3A 2H31A 2DFTA 1OIXA 4LFCB 3WK8A 2ZTSA 2GF0A 3W3AH 1VHDA 4TTTS 1PL0A 2PGAA 4ECAA 4EKYA 4XX0B 1RPJA 3GRFA 4JLNA 5HBGA 3BZBA 3B82A 3S3TA 1QV7A 5K6TA 1U80A 5AHOA 1QGDA 2RI1A 3QHAA 2X5NA 4L9WA 3U17A 4C4OA 5DYYA 1L7DA 1QZXA 3WL6A 5BR8B 3BK1A 2ZIWB 1SC6A 2WP8J 3DAOA 3WYBA 6AT1A 5K4HA 3I23A 1C29B 3UK0A 3IVGA 1XG5A 4TT3D 2YJ5A 4N01A 4GM1A 4OGLA 4ITRC 4ZZ3A 1LPMA 5JIBA 3G2PA 3WLRA 1LF0A 1L7XA 4LVNA 1J9ZA 1K5PA 2CN1A 1DZIA 2GCOB 2JLBA 4YQZA 3ZXUB 4B6RA 1KEZA 4WNIA 2WNIA 5JH7A 4PGHA 1SOWA 2PG3A 2BMEA 1C1YA 4FEEA 4CL8A 2GXSA 3RSZA 3G2LA 3KYDB 1IXSB 4AKHA 1POWA 1T15A 2Y1XA 4J43A 4J3JA 3ZBTA 1G38A 2HV9A 2PA3A 3U7RA 2PYIA 4WSOA 1KVUA 1QBGA 2JLCA 2JFPA 1R10A 1CX9B 1H1DA 3E84A 3TOCA 3VR5H 2ZZMA 3GN2A 3UUFA 2VAXA 5CCXA 3W8EA 2ZROA 2QJTA 4ENRA 2VHXA 2WMYA 3PE3A 4X6YA 2FA9A 3CYFA 1RZVA 3EF3A 2FDRA 2VDMB 3ROEA 1P0PA 5HIJA 3SHQA 5IVDA 5KJEA 3T7TA 4KACA 1VKOA 1TTTA 3UAWA 4X92A 2G3YA 1C41A 4DB2A 3WE7A 2FZCA 3KYJB 2ZTMA 3BF7A 4O4IF 3WIEA 3DTYA 1AUXA 3UAZA 5JG7A 3WGIA 3U1VA 1MF7A 1B6GA 1JQAA 4XDYA 2AH5A 2C1XA 4L5YA 3QOYA 3G5MA 5E6RB 3KJHA 3HC7A 3MCVA 1HQDA 1NNUA 3IO3A 2CJYA 3TGLA 3WB0A 3RV4A 1PGPA 1BNCA 2F17A 2QP9X 2XEXA 3T5PA 2OFWA 4HQKA 5KNDH 3I9MA 1G5RA 1U90A 3M1IA 1NY5A 3H11A 2B98A 2GCOA 1AK9A 2Q6TA 5BYJA 1E66A 1F9EA 2PEZA 4ZHSA 1YF3A 2RAUA 1BD3A 2I03A 3K7EA 5DX0A 1N92A 2C5AA 5CM2Z 2DTEA 5LUBA 3GAMA 3R0ZA 5T3UA 3LGXA 2A78A 4L4XA 1XQ1A 4AJOA 2YMQA 3OZAA 3PIDA 2REOA 4QJ4A 4CTOA 5CXUA 4XB2A 1I32A 2JIQA 1FDOA 4UULA 4Z53A 3CBGA 3B12A 1RBZA 3VUEA 2FRDC 1YACA 3ESYA 5F78A 4HQ0A 1E2UA 3V46A 2H3HA 2YQ5A 1C4OA 4C4PA 1EG7A 2YN2A 4ZCPA 1E18A 4YEDA 3LQRA 2VRWA 2XUZA 3VSAA 2IYVA 1H2YA 1SIBE 4ZOCA 4FSXA 1B8OA 2Q5JA 3BSSA 2I9KA 1CJMA 1NX9A 2KWIA 4PBRA 4WXHA 2ZJ1A 4B9AA 3H7IA 2C5GA 2OLEA 2QRVB 5HOQA 2J9RA 1VLHA 1Y80A 1I5EA 3KQWA 2Q4TA 1RQPA 3GI1A 4ARUA 3RHZA 4LJRA 3KQVA 3HYSA 3AB7A 4CG3A 4AO8A 4R2IA 2W6QA 1Y4AE 4HGZA 2QUKA 2WKSA 2XUKA 5TIIA 4UAVA 3UJAA 1XMOB 3AF3A 5CFNA 1IOVA 1H23A 4OKNA 4CV0A 5EIAA 4RYLA 2DP4E 4HDKB 3K5HA 1E1YA 5DHAA 1LBQA 1CZRA 1GPH1 3G2MA 3R4VA 4FYHA 2IZZA 2VNKA 3RASA 1TLLA 2ZR0A 3UFBA 1B0AA 2Q3LA 4RFLA 1YQ9A 5FOUA 4QNRA 1AGPA 4FOPA 4BKMA 2XSZA 2RK6A 3OIUA 1E64A 1HBJA 1GZVA 4GMXA 2C7BA 4PVCA 5CFRA 3UTCA 5LLTA 1PWHA 5H3CA 2P2GA 3K8YA 4X97A 2DGDA 4MYHA 5LMCA 1F0YA 5AKEA 2QTAA 3KLPX 2XVAA 4V3CA 4YT2A 2DERA 3JZDA 4JOBA 1XEWX 1GAJA 2IYYA 4QM6A 2XNSA 1NUAA 3CLUD 4KIUA 3OLYA 5DF1A 2X0JA 3IMKA 1Z5ZA 3LUPA 5L6MB 4DJEC 3KPUA 3GEEA 1EA7A 3U7JA 3V2IA 2VYNA 5LLDA 1JIXA 2VSNA 3UV6A 2DAPA 3UXMA 3V32A 1FRVA 3KBBA 1FJ2A 1VHQA 1B3RA 4JDUA 4MROA 1XKXA 2WILA 2VRCA 2RFLA 2C4NA 3BC1A 2Q8QA 1CUDA 4YWHA 3RT7A 2QRVA 3VZDA 2G5CA 1VL6A 2VT6A 3ZV4A 4MV9A 5M3BA 4ZARA 1BS2A 2V7UA 1XMQB 2I33A 5BOSA 1TL7C 5KYUA 1U2DA 4EUKA 1ID1A 3MOSA 5FP0A 3VJKA 3UA3A 3KELA 3AVYA 5DI3A 4AY2A 2FR1A 5MN4A 1LZLA 1NC3A 1V5GA 1D0VA 4G3XA 4OAQA 1ZMXA 2EZUA 2WJPA 3W2HA 4HDKA 5E1BA 3WWPA 4S05A 1YQEA 3UK7A 3WZ2A 3UPUA 4QLAA 3R7FA 1NSYA 1I7DA 4OJNA 1H9BA 3ENKA 4RWZA 3ZZNA 1QUFA 1W85B 3BTSA 2F4NA 2Q5QA 2ZS9A 1CUZA 3OEED 3QGMA 1IOZA 4G1FA 4I9FA 1OB5A 4BO8A 4HAWA 3RS9A 1U28C 5CBPB 4ZJPA 2GJAA 3OJCA 1HDIA 2A7QA 1OC2A 5L95A 5C5EA 3ZGZA 2BGUA 3CZ9A 1XRPA 2VUUA 3ETNA 3I76A 3LK7A 3AJ9A 4Q16A 2WT4A 2FW0A 2BMFA 2XRYA 3K0BA 4P4SB 5DGCA 2C2OA 2HPHA 3ZNNA 4F6RB 3QEBZ 1XPRA 3C3WA 1GPWB 2GK3A 3A32A 3IAXA 5CJPA 3FPJA 1KSHA 3IBFA 1PEDA 1D2GA 1DFIA 1O95A 2EFEB 4R7ZA 4Y6SA 2RH9B 3G5UA 3L8EA 4ZI7B 4KFCA 2QGFA 2R5WA 1IRXA 1RFGE 1ULAA 2AG8A 3I6IA 5EY5B 4JGBA 4MXDA 5EJEA 1ESDA 1UM9B 3PVSA 4OD0A 3ZE7A 3NIDB 2N3ZA 3M7IA 4KNWA 2R65A 4DA4A 1N25A 2VZEA 3L1KA 4DA8A 1QF7A 4HG2A 3O1IC 4XYBA 1SWVA 4XOUA 3FKQA 3NS7A 1QHEA 1Z17A 4JLSA 3RVDA 1OFTA 1TYCA 3HWX1 5HEKA 5C8YA 2EGUA 4HEA1 5AM3A 1JTVA 2H57A 2C0QA 4NYMR 1U9IC 2VBFA 3I32A 5SICE 4FFBA 4X1YA 3FHTA 4M21A 4DLBA 1JXOA 1XQXA 3NBUA 4NMMA 3IVCA 3P0IA 5F52A 1KDTA 2H2FA 4NOMA 1NW6A 4Q37A 4Y6GB 4LCBA 3IJEB 3OWOA 2F1JA 2XUHA 2C0PA 3P9RA 1GL9B 3AU9A 3QBJA 5C7YA 3K70C 5CA0F 1D03A 4GPZA 4CLOB 3HBFA 4XRRA 5DWDA 4E33A 1A8SA 3WLNA 3OWXA 1NNEA 3UV3A 4XX1A 3E05A 4F6RA 4P4SA 4TM7A 4HRVA 5EXXA 3UG7A 2YV4A 4HSEA 4YUVA 4E1VA 4A8HA 5EJ5A 1LX7A 4M0MA 4PR0A 1Y4SA 3GEHA 2P4SA 1JEAA 2F90A 3WOVA 3OHSX 4ZI7A 2CWDA 4ER7A 1QQ7A 5KAMA 2Y4OA 3L77A 2FKNA 4AWAA 5I45A 4YIKA 1T5SA 1QLJA 3NOXA 4BYGA 4UFPA 4G0UA 3R0QA 2QN9A 4IIEA 4UMDA 2RCYA 3OCYA 1DSSG 2QSYA 3QIAA 1VP9A 3AP2A 3PR1A 5HNKA 1H3EA 3KB6A 1JGTA 5DK6A 1Y89A 4ACBA 1YZVA 3ESAA 3O4VA 4IFTA 4OKSA 2Z2ZA 1E7SA 2A8YA 3F7TA 4RZHA 1DJQA 2UUAB 3GZNB 4QOIA 4BNUA 1AGNA 4C07A 3O73A 4B3GA 3L6UA 4BP8A 4JT8A 3E22B 2D5LA 5G3YA 3WC4A 4MA5A 4BNIA 4DCGA 2ERYA 1GTZA 2FSUA 5J2UB 3AYZB 2IPLA 3KOYA 3FROA 4NNPA 4JC5A 2FPUA 3OFSA 3HNRA 4RF4A 5B58C 4JLOA 3JQRA 5IYZF 1Z7GA 3LXMA 5DBFA 1QYIA 4E1BA 1BE0A 3BREA 3A3KA 1SBTA 4CLOA 1QQAA 1XNQB 4G89A 4TMZA 4BYMA 3OLZA 4DANA 2J0SA 2OK7A 1EBFA 2OC9A 3II6X 2GDJA 3K9HA 4I81A 4R69A 4RA9B 2QLTA 1L8AA 2Y4NA 5K2MA 5A71A 3RT1A 3IDOA 4FHCA 2I8LA 2QA5A 1Z2NX 3TS1A 3VNUA 1I01A 1NOKA 4BJ3A 1PR4A 2FRVA 4RF2A 2F3UA 2RGWA 4RZQA 1H6AA 4LWOA 4QRHA 4UE6A 3TFOA 1OY1A 1YCDA 4GU5A 4N0PA 4U2CA 4GM0A 4OLFA 2QMUA 4IJWA 5AKHA 3SEAA 2WA1A 1RYHA 1YS2X 1IB6A 2AOUB 3O8BA 3E9ZA 1FYXA 2OFPA 1GXSB 3QWIA 3F2IA 3F5SA 3I8OA 3FKJA 4D0RA 1IQ0A 2C2WA 3GT3A 4KLRA 3ABRB 4R0VA 5EKSA 3VMFA 2LPMA 2WYIA 4KE8A 1BHSA 1SKYB 2GYVA 2QIPA 2XTZA 1XZCA 2PLRA 3ICVA 5C31A 4D8YA 4D4GA 3MS2A 1RLIA 1ABBA 1CZLA 3BWBA 3N2YA 3VFDA 4DV6B 2PKCA 2NYRA 2AFIE 2B61A 3QLUC 4MI3A 3ZOZA 5K4GA 4MLPA 5J2UA 2GCGA 3WA7A 1TC1A 3N76A 3OIWA 3GRYA 2PMEA 2XUPA 3TMYA 2W0SA 1DTEA 2W2KA 4QECA 4YJDA 4PX3A 4NNOA 1FU7A 1UP4A 1HM5A 4NF2A 1RZ3A 2C84A 3KCQA 4D56A 16PKA 1V4BA 2JGEA 1COWA 4G5OA 3UEOA 4TYYA 1CLUA 4BTLA 3RVJA 2AG0A 2ZAGA 3PG5A 4RA9A 2QRNA 3LGAA 5U4QA 1OYVA 4PBSA 3PSHA 4KQWA 1SA0B 4JGIA 3RF6A 1RT9A 1QIEA 2E4WA 3ZNQA 3OMXA 4BCDA 1U1FA 1EM8A 4R81A 4EQ6B 4HDRB 3IAM1 1OXKB 1RQXA 1TRHA 2CJWB 3LIPA 2JW5A 3CPHA 1E4VA 3CZPA 3DBIA 4F9FA 4CTNA 1NXXA 4GOJA 3N2ZB 4QPCA 1Z47A 1VBKA 3NHUA 2AOUA 5TMEA 1YBAA 3ANYB 3JCZA 3FN4A 3BMOB 1GXSA 2X9LA 3SAJA 4OHVA 3W6UA 5EE1A 1SC1A 1NGSA 2BZ0A 4RF3A 2XUDA 1USGA 1LPOA 2VK4A 1CG6A 2N46A 4WT7A 3U48A 3JYOA 1HZZC 2A1IA 1NUSA 3CA8A 2NP6A 3JQ6A 2Q3BA 4LX0A 1B1CA 1ZSNA 3IR5A 4G56A 1NTRA 4MW1A 5F4BA 1UBHS 2OB2A 3MUEA 3FI9A 3H2IA 1KOLA 1I9GA 4K03A 1EAMA 1RVV1 4IDHA 3AF6A 5LDHA 4HPWA 4K6KA 2GM3A 5EXSA 2A0YA 5IW8A 1RPTA 1Z4IA 3HPQA 4B3JA 5IF9A 2JG3A 2EIHA 3C1UA 1QH1B 1QIMA 3HP7A 3IBSA 1DAHA 4OBEA 4DLPA 4PFKA 1G2IA 3BRCA 2QE7D 4R4JA 3VPXA 4IIUA 3LHFA 5AM4A 3BFJA 4YPOA 2YL2A 3GT0A 5AJTA 3ZZUA 4S1VA 4F4FA 1MMFB 2EWMA 1SBIA 2BFOA 4FNMA 3F5QA 2JI6A 2X0FA 3ZVNA 2D74A 4M0UA 1GRRA 5FT9A 3DBRB 4MZXA 4EAAA 1CJVC 1SVKA 3JAWB 4PSAA 4EF4A 1AGRA 3N7UA 4HDRA 3SR3A 2CJWA 3ORQA 4TWZA 1JI0A 4NV0A 3JQ7A 5B7PA 1UDAA 1L4BA 4D9BA 1N5KA 1WP9A 4TKVB 4AKEA 4AUMA 2I8AA 5IJXA 2ODPA 4JC0A 1WZNA 1BE1A 1Z0FA 3ROTA 3KE8A 2FX3A 3OOYA 3BMOA 3NHLA 4TXNA 2BIFA 3VPDA 2V7WA 4AUNA 4EA8A 5EQDA 1W44A 3I0NA 4P7JA 5F5LA 5IH3A 5DHPA 4CZ2A 5JS6A 2ZZNA 2I67A 1QU2A 2OO5A 5JYEA 2AV6A 2EFGA 1NBHA 2A33A 3VYSB 4GICA 1FXWF 3GC6A 1XHFA 5EAIA 1J97A 5CDFA 2LD4A 3UB3A 4G0VA 1I7LA 4D9GA 4N8DA 1Z07A 4J6FA 3F5MA 2PUDA 1QDUA 2VQEB 3DKVA 3COWA 1QRTA 3L84A 1A7JA 1MVOA 1Z16A 1GZHB 4I55F 4Z2AA 3LQ1A 1JH9A 1U11A 4IJKA 1PNRA 4L22A 4KQIA 4X65B 3FRJA 5CTJA 1OWPA 3RQSA 3ESBA 3ZEIA 1C9DB 1X3LA 1AJEA 1O6BA 2GARA 3FKSD 2HY7A 3I42A 5KQMA 1XEFA 2PGDA 5D84A 5KQGA 1ZN8A 1ESNA 1GU0A 1P2UA 3LSTA 4IGFA 4Y0VA 1N36B 1GA4A 1ONPA 2C3MA 4AROA 3VZQA 4CKCB 2OM6A 3WYNA 2ZAOA 1US8B 3PDIB 1WW8A 3NETA 2RB4A 1N3BA 3P9CA 5LXTF 4EHJA 4HMQA 2AFHE 2W6JA 2Z04A 3DD5A 1MJFA 1KKLA 3LUBA 3P94A 4N4AA 5IBPA 2O8EA 2B4TO 3KPJA 2B6NA 1LBTA 1XZLA 3EPPA 4HLQB 4TKVA 5C5CA 3LP6A 4INOA 4R6XA 4FHGA 3R8FA 2IYFA 3VAZA 1EVIA 2O3RA 3H5OA 3OP1A 3QNMA 4PX9A 5BRJA 5MDHA 1PBTA 1YQTA 1J09A 2P2NA 3UOWA 2VKTA 5K3OA 4LN1A 2VJAA 4BO2A 3UHFA 4B46A 1CS0B 4GI7A 5REQB 1YR9A 1K92A 4KEAA 4FIDA 1PK7A 4OEHA 1T25A 3H4IA 3FWYA 3NM4A 1VCHA 1RI2A 3P71T 3PHBE 3QU2A 2XB2A 3NTQA 3GLTA 4PYLA 4YRJA 3OX3A 4XUGB 5GJVC 4HVCA 5KVAA 2WV9A 3PD0A 2O05A 4LISA 4QUKA 2DLDA 3EDMA 3RRBA 2A9OA 3I1JA 3LGSA 2JEZA 3BOSA 3NVAA 3IAFA 3C0KA 3K0CA 1I3OA 4HN2A 1HNZB 2Q4RA 1JI3A 4WERA 5B55A 2B35A 3PR3A 2PANA 3QX8A 3CNHA 2JA2A 1O58A 5KVQA 5DLPA 4KI0A 5B3LA 1W2WB 4Z2YA 1KFCB 1UMCA 2RDMA 5KHAA 4MUYA 1IM5A 2ORIA 4O4IB 3SBXA 2FJPA 4BC1A 8ABPA 4GR5A 1M6NA 3L04A 1C1XB 3ZHYA 1US8A 1QUEA 5C1IA 2GCIA 4LK2A 3ROFA 1DFHA 4CKXA 1LTQA 3GJ5A 5AP9A 3V42A 3EZFA 2K87A 4CQMB 1TO1E 2MSEB 3W5SA 1N5LA 4I8XA 1GRNA 4PLCA 4AXBA 5J4YA 1XZQA 4LWPA 4MYRA 1QVWA 1N6RA 3AF0A 1TF2A 4L9AA 4B32A 4F5EA 1IVSA 3V8NA 3L3BA 1XO1A 3OZEA 4ER0A 2FWIA 5H5JA 1GAWA 5F77A 2EGHA 1W49A 2Z98A 4LQ4A 5LJLA 3WICA 1CS0A 4MPPA 4Q4HB 1BO6A 2FSPA 3PGA1 2BFCB 1JG3A 2I6TA 2PBZA 2Z4RA 4X44A 5REQA 5AH0A 4DQKA 4BNVA 5ALWA 2BF7A 2OPBA 2V6MA 3AIIA 4KXQA 5F7JA 1DAKA 4L5CA 1EMDA 2HPVA 2BFBA 2C8JA 3A4IA 5LQNA 3OI7A 1ODCA 3UQZA 1M2JA 2ZB8A 3FPHA 4R2MA 5CP8A 1CQXA 5DTMA 2QJFA 5LP1A 2XHZA 5JS2A 5KYTA 2AZTA 1ZMRA 1GTMA 1WZCA 1ZINA 4KK3A 3DW1X 2GRAA 2VDWB 5BSRA 2X9VA 2EDAA 4P34A 1BVRA 1T0HB 2C98A 2BFEB 4HB2A 1G18A 1QGOA 2WTNA 4CL3A 1BQ4A 3GJ8A 5BSWA 1YHYA 3THWB 5C1OA 4D02A 2P67A 1NONA 4JDPA 2Z95A 3MF4A 5EXPA 2V3WA 4P38A 1J2YA 4R6WA 4LC1A 5LP6C 1GNLA 4FYMA 3D2LA 4DARA 5THXA 5BW8A 1JWAB 3HP4A 4B7CA 1CQPA 2PUTA 3MUNA 3WIUA 1SVMA 1VPLA 1YS1X 4N65A 2AIRA 2P9TA 1X1EA 2NW6A 1OH5A 1MH9A 3ETDA 2NO7A 5ALKA 2D1YA 3AFNA 1M34E 2CLCX 2K2WA 3LT0A 3R6GA 4DT1A 3CHYA 2GTIA 2P79A 1S4QA 4IJMA 1E9EA 3EIXA 3M4XA 4XB1A 2GKGA 1R0KA 1TRKA 1UJCA 2WUVA 4RSMA 4UZFA 1RXWA 4URUR 1FRNA 6REQA 2HNKA 3I0MA 4LJYA 5AOBA 1WF6A 3FYUC 3N74A 3IR6A 1EFDN 1EUDB 2DJIA 5SV2A 3H5LA 4Q4HA 4C2AA 3RRZA 2EKDA 1HZJA 4FDTA 4JQCA 5A9TA 4C6SA 4CKBB 5LQCA 1BXRA 3NT4A 1F6WA 4LUCA 2M2IA 3MD9A 4UBNA 4GGOA 5FJJA 5GZ6A 1N78A 1R9NA 4JVLA 3GLFA 2A7XA 2HU8A 2JZOA 2Z0MA 3D81A 3NG1A 3U9TA 2WAAA 3FAZA 2P1RA 1KO5A 2ZATA 3D4IA 1GNPA 3I09A 4FFOA 3GELA 3OM1A 4LTNA 5TNXA 3RS7A 4BVKA 1U7DA 3CW2A 4QYXA 4R40A 4OA8A 2RJOA 4FTWA 3T3PB 3QLVA 5JVDF 2C2GA 3GMSA 3OURA 2C77A 3K09C 1CY6A 1AXEA 2FEKA 3BFPA 3QG1A 1JPUA 1MT3A 1K6EA 1PGQA 3DKIA 3F96A 3OKPA 3GGSA 4IHJF 3FIUA 1Y48E 2G09A 4P7GA 4QBHA 1V37A 3TKAA 3SVLA 4BZWA 3IP7A 2PUFA 2PR2A 1RCFA 2PH5A 4MDEA 1Z36A 2O8CB 2IYZA 4JAVC 2W6NA 2GZRA 3IOEA 1VPEA 3NEPX 1CJTC 3ULKA 1E2DA 3C6XA 4MGKR 1KYXA 1Y9ZA 4XLLA 3DFFA 1HDZA 1XL1A 3M6FA 4IBOA 4INPA 2ZSFA 3AKDA 4NULA 1DT5A 1W4ZA 2Q6LA 2KQUA 2ZRJA 3BJMA 1BCRB 2A2ZA 1C0LA 4Q3BA 4RXUA 3CKMA 1TZJA 3UGKA 4KQCA 3U5ZB 1VL0A 4LJ6A 1C50A 4MEAA 1X15A 4C22A 1P1JA 3AHJA 3LLVA 2OBMA 4TRNA 5FUMA 3WTCA 4EW6A 3GFTA 1XCJA 2GJ8A 3CLKA 5GM1A 3KSBC 2XCTB 4CKBA 1P5JA 2BGRA 2BJHA 2PRZA 4GYYA 3TE7A 2N1BA 1GZDA 1ZC3A 4X8LA 2XDWA 1GLGA 2GPNA 4B44A 3EGVA 3FVTA 4N3GA 1N5DA 2CYBA 2XDQA 1E63A 1KJYA 2PX5A 1WV1A 2PFSA 2QG6A 4BVEA 1MVLA 3LHKA 4PGAA 3S5UA 5B4VA 3ZGVA 5KEIA 1WHSB 2W8ZA 3NZEA 4GZLA 1U7PA 1WMDA 4NDNE 2AN1A 3G8CA 1ZITA 5AUNB 4HWGA 1RBYA 4IHAA 2X8BA 1M2EA 1JJVA 2VLIA 4IJ5A 1EWKA 4XSHA 4GMKA 3QBDA 3WGLA 4MI1A 4MVJA 3JPYA 4K6MA 1ZKMA 3ZKWB 3HKCB 1DO2A 4J0EA 4RWEA 2R5NA 3I39X 5IK2A 2LVBA 1IN5A 3ANLA 2DUUA 4FQ8A 3TPFA 2EX1A 3I2IA 2DUMA 4JT4A 4E5SA 3ELWA 3TMKA 2Q3HA 3PJGA 2PT7A 3IB6A 4KTTE 4G63A 3HG7A 5C1PA 3O31A 4EJMA 3UHJA 3PBKA 5DIZA 4KQKA 1JEDA 1OGYA 4QJBA 3QQ5A 2JCGA 3BDIA 4G8JA 4EDFA 1HK7A 2W4QA 4BNJA 3CZCA 1DQYA 3OLQA 4ADSG 2AFRA 5DJ5A 3PXDA 4G4SP 4UDXX 4KN9S 3JARB 3STVA 2WJGA 2NT3A 1DRJA 2X4LA 3I83A 4GMHA 3JQFA 4ZAFA 2PXHA 4RHXA 1IZYA 4BBPA 4EUSA 3ZDCA 4IXMA 4IDCA 2IHYA 3FFXA 1U4SA 4EZIA 5EZYA 4PFJA 2JJ2A 4HDNA 4KFRA 4OB6A 2GILA 2WU1A 3N2EA 1V7CA 5C8XA 4OMFG 1KYIA 4XYLA 1RTKA 3C48A 3PWSA 3LZCA 1XEWY 2ZYSA 3ED1A 1M73E 4R8SA 3ZY3A 3DPIA 3CTPA 3ZDRA 4N3NA 5J43A 2CNNA 4TSRA 1LKZA 2QTRA 2XUIA 4UPVA 5IF3A 4ZRNA 2FPXA 3PVCA 4Q03A 4CR6A 3CLRC 4JJ4A 1F14A 3PI6A 3SC2A 1AN9A 4WNCA 2QAGB 1JILA 3AHCA 3DLTA 4CMJA 2VT2A 4MKZA 4DBLC 4Z9FA 4NC9A 5CDHA 3TZCA 1G21E 1SUWA 3DMHA 1BG6A 3V4FA 1WDTA 2QRUA 1V8OA 2Y9PB 2YVQA 5LYJA 1XJCA 4C7XA 3UHPA 5BORA 1AC5A 4DZZA 3TPZA 1MC4A 1XDUA 4W5QA 1C7EA 1DO8A 1H0SA 1O97C 3Q2OA 5K0JA 1O1YA 4A6EA 1P7PA 1XZGA 5AVUA 4ZZ0A 1DU4A 4XQ0A 3JXEA 2JVIA 4B6JA 3LXUX 1KTVA 1LW6E 3IPYA 4JEMA 2DJ5A 3DHNA 3OZBA 3SSMA 4EJFA 1JA1A 3QPUA 4IX1A 4V1CA 1YR6A 1GTJ1 1CXZA 1W47A 2GZDA 1I2CA 2DHRA 1CUEA 3TW6A 3LLUA 3MJDA 4WECA 5IAKA 2NT4A 2IIQA 1NBIA 3AEKB 3P9IA 5T4FA 1OBCA 3S2ZA 5E3HA 1JVBA 1XDGA 2QNIA 4B75A 4CWAA 2YQ4A 5JCOA 3SN6A 2H0QA 3SJCA 5J4VA 2VJYA 2Y2VA 3FYTA 4NONA 2BLNA 4FWBA 3N1UA 2RHTA 5IXSA 3VOTA 2F7SA