4C4XA

Crystal structure of human bifunctional epoxide hydroxylase 2 complexed with c9
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
313
structure length
313
Chain Sequence
SDMSHGYVTVKPRVRLHFVELGSGPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESSAPPEIEEYCMEVLCKEMVTFLDKLGLSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNTPFIPANPNMSPLESIKANPVFDYQLYFQEPGVAEAELEQNLSRTFKSLFRASDESVLSMHKVCEAGGLFVNSPEEPSLSRMVTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSLGRKILIPALMVTAEKDFVLVPQMSQHMEDWIPHLKRGHIEDCGHWTQMDKPTEVNQILIKWLDSDAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BIFUNCTIONAL EPOXIDE HYDROLASE 2
publication title A Combination of Spin Diffusion Methods for the Determination of Protein-Ligand Complex Structural Ensembles.
pubmed doi rcsb
source organism Homo sapiens
total genus 106
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 3.1.3.76: Lipid-phosphate phosphatase.
pdb deposition date 2013-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4c4xA00
5ALMA 4OD0A 4XVCA 3KDAA 4WDQA 1C4XA 1EB8A 5EI5A 4B9AA 4XJVA 1CR6A 2V96A 4FMPA 3BDVA 5J3JA 5AM2A 4HTAA 2V98A 1FSSA 4L3WA 4DM7A 5JD4A 1CUIA 1Q0ZA 2XDWA 1OCEA 5DNUA 1MJ5A 2K2QB 5AK4A 4YK7A 3WQHA 5CBKA 1TQHA 2VF2A 3IUNA 1N5MA 5JAOA 1VXOA 4U2DA 1LNSA 4UBLA 5T4HA 1S8OA 4BVLA 3CCBA 1BRTA 1H2WA 5T4BA 4I4CA 4QE3A 1YAJA 3QMMA 5HFAA 3FVTA 2AXEA 1ZIXA 4B81A 2EDAA 4KRXA 1VOTA 3AZPA 4QDUA 1DWPA 2OPHA 5JAPA 4BC1A 3VVLA 3K9BA 1CUCA 5AI9A 3TJMA 4G9EA 4BRSA 1ZD2P 1CFJA 1ZI9A 3H1BA 3WL8A 2J4FA 1FFBA 4HXEB 4NS4A 1AX9A 3HLKA 4B82A 2HU5A 1SCQA 3HC7A 2ZYRA 5D6OA 2BJHA 2XUDA 4BAGA 2IX9A 3WJ1A 5K3CA 3K6KA 4ITVA 2RIPA 3N0TA 2GBFA 1JU4A 4GLBA 4W1QA 3R0VA 4AB1A 5ISMA 4UFNA 4A23A 2WHQA 3V1LA 5IVDA 3FLEA 1OILA 1EH5A 5ALVA 4QDTA 4B85A 5ALRA 4H7FA 2ACKA 3ANSA 4E14A 5AKGA 3O4GA 3SWWA 4OU5A 1MTZA 3V48A 5BWBA 3H2IA 1TIBA 5CH5A 5A7GA 1H2YA 2G4LA 3F98A 4MEAA 1JT2A 1XQXA 5DWDA 3C6YA 3QZUA 2DHDA 3OURA 3BF8A 3QYJA 3C45A 4J0JA 4H0CA 4W9RA 3WA6A 2Z8XA 4FLEA 2HFKA 3O4HA 4BP9A 2XUJA 2Z3ZA 1AZWA 2B4KA 3KXPA 5ALLA 2XUHA 4UBIA 3B12A 5JZBA 5AJHA 2VTVA 4WJLA 4UHBA 1AKNA 1XQVA 4Y2UA 1UK8A 3O4JA 3VJLA 4BDTA 2PX6A 2JBWA 1DQYA 2VA9A 1CIJA 4J0DA 4DNFA 1ISPA 2WG1A 3WKBA 1QO7A 4MQLA 1QJ4A 1J2EA 5AM3A 1KU6A 3WKCA 1CUHA 2XLBA 1CUFA 1QIMA 4BDSA 1FFCA 1LPMA 3WI7A 4PV7A 2HADA 5LZ5A 1GKKA 1JJIA 4G4GA 2EEPA 2WUGA 1H2ZA 1QTRA 1F0NA 1ORWA 3WK4A 1MX9A 1YB6A 2I3DA 4DLNA 3C6ZA 4Q82A 3ESDA 4Y2QA 4GXNA 1VKHA 2PUJA 1L7QA 1BEEA 1UWCA 3O9MA 1IZ7A 4C4ZA 1KEZA 4UBJA 3FNBA 2QR5A 4UBMA 3G0DA 2H1IA 4EY5A 3U0VA 5EIAA 1BU8A 3FYTA 4XX1A 1EDDA 3AINA 4JNCA 1MN6A 1R50A 1P0MA 3I2JA 3RK4A 2HA2A 2XT0A 5A7HA 5JANA 2HIHA 1CV2A 1MO2A 3WK6A 2JEYA 5ALWA 2XUFA 4FBLA 4NZZA 1HLGA 1QIEA 2G63A 3G9TA 3G0IA 2H9YA 1CEXA 1R1DA 3SX4A 1Q84A 5CURA 1CUDA 2XUGA 5ALTA 4H18A 3ZV7A 5F4ZA 5IVHA 2RI6A 1VZ2A 4UHFA 4G8DA 1CUAA 2XQFA 2GBCA 2VT7A 3QVMA 4KAAA 2WIJA 3I6MA 3ICWA 1ODSA 4UFPA 3EQ9A 3W06A 2ECFA 2VAVA 2HRRA 3P2MA 1YB7A 3OG9A 2Z8ZA 1MX1A 2PKYX 4X7BA 4EY4A 2D5LA 4G5XA 3OC0A 4BTLA 5C8ZA 4PQEA 5E2IA 3IUJA 3PE6A 4IQ4A 5AI6A 5LZ4A 1AURA 4AX4A 3W9UA 1NU6A 4CIAA 1XLUA 5ALOA 3STXA 1LGYA 2PM8A 4M0MA 4P9NA 1ZGBA 3ESCA 3WJ2A 1QE3A 1DT3A 5D7BA 4FNGA 4BVKA 5AOBA 2HL6A 2AJCA 1QIIA 4DIUA 2OGSA 3FOBA 5I9IA 4QWWA 4BB0A 4CCYB 5EHXA 2WQZA 4HVTA 5ALIA 4CCYA 3R3YA 2J3DA 5FP0A 3G9XA 4ZGBA 3KSRA 4U2EA 1MNAA 3R40A 3H1AA 3ZPXA 4BC0A 1DWOA 3M3DA 3H18A 5HK9A 4OB8A 3T4UA 2WIKA 3LLCA 2XUPA 5D3KA 2OGZA 4QEKA 3H2KA 3TRDA 3M83A 2FX5A 4C89A 1XZIA 4HXFB 3RLIA 4J0CA 1PV1A 3H17A 1TCBA 4B9EA 5CT9A 4OCZA 4EBBA 4KYVA 5E4TA 1RP1A 5AK5A 2DCMA 3MUNA 1UK6A 4BCBA 2H7CA 2R11A 3FCYA 3F9CA 1BROA 4UBOA 4FTWA 4N8SA 1M33A 2I3ZA 2RHTA 2GZRA 3V1NA 2WJ4A 1Y7IA 1IMJA 1K5PA 1GPNA 2ORYA 4WY8A 1CUBA 1XZDA 4ZWNA 3WKDA 4PSDA 1U4NA 3DD5A 3O95A 5C7YA 2HA0A 2VJBA 4WY5A 5ALZA 3WWPA 2WU4A 3OPMA 5ALNA 2G5TA 3ANTA 3GBSA 2AJDA 2DHCA 4QWMA 3C70A 3H04A 4ZRDA 3L1HA 1XQYA 3OTQA 4RE6A 5K3EA 1Y7HA 1E3QA 4AO8A 4Y7DA 2OQVA 1BS9A 1XZKA 4BBZA 2WUEA 4Y2VA 1N1MA 3IURA 2XUAA 1JJFA 4BZWA 4CG1A 3BDIA 1BCRA 1DQZA 1H2XA 1P0IA 1W1IA 2H7XA 3FCXA 1JKMA 1SC9A 2C5FA 3G9UA 5EHNA 1YCDA 5ALHA 5H3HA 2XLCA 3M82A 1WB5A 4QDZA 4Y2TA 5AKXA 5AIBA 2OCLA 4QA9A 1XZHA 3ZLUA 1XRNA 1VA4A 4AZ3A 4E11A 4J0GA 1DINA 2WFZA 4C87A 4DSZA 3D3NA 4H7JA 3A6ZA 5DNWA 5SYNA 1KU0A 3HYSA 3ED1A 3AIOA 3BWXA 4QLAA 3IIIA 1L7RA 4X95A 1N5RA 2GBIA 1WCYA 5AO9A 5LYYA 3WWEA 1XZMA 4KAFA 5AP9A 4BAZA 1VA5A 2CKMA 2CUTA 5HK8A 2WFMA 4Y2SA 4N5HX 3C6BA 5JIBA 4ETWA 4J3JA 3IVMA 1XZJA 4IHAA 5KWJA 5LZ8A 5SYMA 1R3DA 3D59A 4P93A 1LZLA 2HU8A 4TVKA 4F5ZA 1A88A 1GXSA 4W1RA 2HM7A 4OYLA 1JFRA 5ALGA 1F0PA 5AKEA 2IITA 3GUUA 5ALUA 1ZD4A 4DNOA 4ZREA 4AMZA 2Q0XA 3FLBA 5A7FA 3GROA 5IKXA 4DMKA 3C5VA 4IH4A 1HKHA 2PSHA 4A5SA 3NWOA 3ESBA 3KOOA 5JZSA 1G66A 3MVEA 4AN0A 4X6XA 2C58A 1XZGA 1FFDA 4AO6A 1J1IA 4MQMA 2PSFA 1ZOIA 1VE7A 1XRPA 4RGYA 5AKLA 2V9ZA 1WHTA 2VQ6A 4X85A 4WFIA 1XROA 1IZ8A 2ZVDA 3W04A 1F8UA 2WHRA 4FFVA 1DX6A 4BRZA 1QFSA 3C8HA 1LZKA 1QGED 2XMQA 1I6WA 3ILSA 4X97A 2XQJA 1GKLA 3MGAA 1ZJ5A 4BATA 2B61A 2O2HA 4K6KA 4HXGA 5AIAA 4MYDA 1UOOA 5LKRA 4M0EA 2BGNA 1Y37A 3E3AA 1CPYA 4EY8A 5ALJA 4QNNA 1EK2A 5K3FB 1XLWA 3VJKA 4Y2JA 5K3FA 2QJRA 1C7JA 5DJ5A 2QXUA 1T4MA 4KRYA 2X8BA 5K3AA 2Y2UA 3WWCA 4YASA 1P0PA 2OAEA 3CCCA 1MT3A 2DQZA 1IUPA 3I2KA 1D07A 4JYMA 4X91A 1CLEA 2HRQA 1YS2X 3HRHA 4J7AA 3C5WP 1CUYA 3DKKA 4TPKA 1QIFA 1L7AA 3WZLA 3E1GA 1B6GA 3UUEA 4ZV7A 2O2IA 5LP1A 4H7EA 2Y1KA 1UOQA 4HRXA 3MUOA 1CQZA 3VJMA 4H77A 4U2GA 1ACLA 3NUZA 3FWHA 3VISA 2VJDA 4L0CA 1AGYA 3RKSA 1C7IA 3G0BA 2ZYSA 4I3FA 4OSEA 2ZJ7A 4MYSA 2V97A 5EFZA 3WL6A 2VATA 1XRMA 1TCAA 3WK8A 5LZ9A 1EB9A 1FFAA 3F96A 4LXHA 4N8DA 4PNZA 1G5FA 2VAXA 2XQKA 4AZ0A 2XUOA 1U65A 5DLPA 1QFMA 2OQIA 2XMRA 2XMGA 2G5PA 4JEIA 5K5EA 1K4YA 3EIOA 1GGVA 4MWSA 5FPQA 3BXPA 3FYUB 2EDCA 4E15A 3A70A 2WSLA 3FYUA 3S2ZA 5EIHA 2R8BA 1YAHA 3BIWA 5CH3A 3I28A 1ODCA 4C01A 1WHSA 3WKAA 3IULA 1XZAA 3KD2A 3WZMA 3E0XA 2OLEA 5JZ9A 3WWOA 3DLTA 3DDUA 2HA3A 1WOMA 5BWCA 4MEBA 1K63A 1XRQA 2WKWA 5LZ7A 3LS2A 2RHWA 3WLAA 1WM1A 5HCUA 1X2EA 1E5TA 5CRIA 1THTA 2J3QA 5AI4A 2I03A 1DU4A 4W1PA 4OUKX 1TAHA 1GQRA 1XRRA 3GA7A 1QO9A 3ICVA 1YASA 2PBLA 1A8UA 5LZ2A 1Q83A 3DCNA 2PU5A 4G8BA 4WDRA 1U2EA 4K5QA 4KEAA 1ZICA 2XI4A 1J06A 3H2GA 3I2FA 1VZ3A 4AXBA 3O4IA 3WMRA 2C5GA 2WIDA 1AMNA 2CZQA 1EVQA 1CUXA 4N5IX 2XUIA 4K2AA 5T4FA 1VE6A 4B83A 2PL5A 1R4ZA 4PSUA 4INZA 4FWBA 2CEKA 4DSAA 4WFJA 5HQ3B 2VJCA 1LBTA 4CG2A 5HQ3A 5CXUA 4Y2RA 5AM4A 3AZQA 3WK9A 5DTIA 2VSQA 3AJAA 3D2AA 4HAIA 2XMSA 1EHYA 3H19A 4WFKA 5K3DA 3D0KA 1UKBA 4Q3KA 3HJUA 5FRDA 1QOZA 3NGMA 2Z3WA 5A62A 3KWJA 3Q0TA 3DOIA 3DYIA 4ZI5A 4X93A 5HKBA 1WPXA 4BVJA 5HF6A 4DTCA 2QM0A 1JMKC 2OCKA 5CT6A 2XUQA 4B84A 1GQSA 1QZ3A 4RPCA 2JGMA 5DNVA 3LCRA 2I78A 4DYHA 1BEZA 4UHDA 2PPLA 4JUIA 4Y2PA 4FKBA 4S0XA 4NVRA 2PVSA 2OXEA 5AH0A 4B7ZA 3ZLVA 3D5EA 1YS1X 4BP8A 2YASA 2HU7A 4N8EA 3SC2A 3D2BA 5D3ZA 2CB9A 4X92A 1O6GA 5C81A 2Y6UA 4LYDA 1ZI6A 4OYYA 1UZAA 1UFOA 1ZI8A 4GI1A 5AKHA 3DL7A 4ROTA 1BE0A 3DQZA 3X3HA 4DMFA 6YASA 3IUQA 4B6GA 3R3ZA 5FXMA 3JWEA 1EDEA 2FJ0A 4CG3A 2DSNA 2QTBA 1DX4A 3R41A 1O6FA 4M0FA 3PUIA 3O0DA 5JALA 3VXKA 4Z49A 3F8SA 3QPCA 4W1SA 2JGEA 3V1KA 3UMJA 4AN1A 1CUSA 4CCWA 2WFLB 1VJ5A 5JD6A 3L1IA 2PU7A 1IUNA 4FDMA 5HFNA 4GEGA 3G9ZA 2ROQA 3WA7A 3LIPA 2FUKA 1CUGA 4D9JA 2RAUA 3FYUC 3WIOA 3AILA 2BKLA 4HRYA 3HZOA 1ZJ4A 3JYHA 2W22A 2P8SA 5ALQA 2BCEA 4MXDA 5AOCA 2WM2A 3AFIA 1AUOA 2JGKA 5JAHA 3E4DA 1CVLA 2DR0A 1TCCA 4KR0A 3B5EA 4ZV9A 3CN9A 3F97A 4AQDA 7YASA 4J0KA 3G7NA 4BZZA 1WPRA 4KE6A 1Z68A 1XKLA 1UT6A 4L72A 4BE4A 5KWIA 5C8XA 2HA5A 5CTAA 1H23A 3V9AA 2NW6A 5AHXA 5AKKA 1LPPA 4EUSA 4UUQA 5AM1A 2QKYA 4B0PA 2WTNA 2XE4A 1FFEA 1PJAA 3GELA 4FNMA 1ORVA 1DWQA 4BYMA 5ALPA 5AI5A 2JF0A 2HDWA 1BN7A 1JJBA 5LIPA 3PFBA 4Q34A 2WIFA 5HF8A 5DYYA 4YX9A 5AOAA 5DYTA 4YPVA 3W05A 3R3UA 4C4XA 5CH8A 5IH7A 1AC5A 3I6YA 2BFNA 2WILA 3IB3A 3EF3A 2BUAA 2ZJFA 4XWGA 5HKAA 3GZJA 3R3WA 4EB0A 5AK3A 4UPDA 2D0DA 2ZJ6A 4B0OA 5AICA 1W75A 5E4JA 1W4LA 4LYEA 2ZSHA 5AKJA 4DMCA 4C88A 3I1IA 1LPSA 1VLQA 2GYWA 3RM3A 1HL7A 3FAKA 2GYVA 4L9AA 2WUDA 1XKTA 2QUAA 2QVBA 3WKEA 4BTVA 3SK0A 2OCGA 1RWQA 4Q05A 4UFOA 1YA8A 3BJMA 5I7UA 3PUHA 5EIEA 3LP5A 4V2IA 5CT5A 2ONCA 4QZVA 3IDAA 2RONA 2C0QA 3G02A 3I2HA 3QPAA 5DYWA 4LIPD 3I1YA 5A2GA 2O7VA 1X2BA 2RGUA 2VT6A 4RNCA 3EQ7A 5FKJA 4X71A 3N2ZB 2UZ0A 3STUA 4BAUA 1P0QA 3M81A 3BIXA 5HF5A 4F0JA 2WJ3A 2QS9A 1THGA 3HABA 1EX9A 5C8VA 1XLVA 4MWTA 1GPLA 4X6UA 3AIMA 1HPLA 4P08A 3WIBA 4EY7A 5EGNA 1QIGA 4JYPA 5A71A 3HEAA 4E46A 2PSJA 3PI6A 5E4YA 4EY6A 4Y2YA 5AM0A 1GT6A 5JD5A 4J03A 4PO3X 3EQ8A 1EI9A 3HACA 1G42A 3A2MA 4QDOA 1MPXA 1CQWA 1USWA 4X3CA 1EXWA 1SCKA 5ESRA 1H22A 3FBWA 1QIHA 4WCVA 3QM1A 1A7UA 4X90A 1VXRA 3WL5A 1HBJA 3Q8WA 4FLMA 3QMWA 3H2HA 2WG2A 1MX5A 3DL4A 1QIJA 4U2FA 3G0CA 5AKIA 1GPKA 3I2GA 2HA6A 2WTMA 5CT4A 3VKFA 2AJBA 4HS9A 3W2TA 1SOMA 1CRLA 2WLSA 4TGLA 2XMBA 5ALSA 1NU8A 4AO7A 5EHQA 3WWDA 1U8EA 2ES4A 5AK6A 1QIDA 4BCCA 1SFRA 1ETHA 2JGIA 4UBKA 4XIIA 3I2IA 4H7IA 1X70A 2WG0A 5ALKA 2XMZA 2X5XA 2PUHA 1R88A 4Q3OA 1EDBA 1CUJA 2PSDA 2Z5GA 2QRUA 5FV4A 2C4HA 1CUWA 1JI3A 1UXOA 3C8DA 2ZYHA 3D7RA 2WUFA 2JGJA 5AI0A 3AIKA 1XZBA 1QTIA 5AKYA 1XZEA 5I8PA 3H2JA 5BOVA 1W6RA 2QMQA 4H7DA 4C6HA 3CXUA 3A2LA 1A8SA 5IVIA 2B9VA 4H7KA 3CN7A 2E3JA 4DNPA 5KREA 1CUEA 2Y2VA 5JADA 5EHZA 2BUCA 1WB6A 1ZD5A 4KACA 2GYUA 2XQIA 1E8DA 5CW2A 2OG1A 3R3XA 3OOSA 5ALFA 3BE8A 5JASA 4CI9A 1CUZA 2ZYIA 5LKAA 1MU0A 4NMWA 4BE9A 4J0IA 3AZOA 3JW8A 5HF9A 1GZ7A 4FHZA 4LHEA 4K6GA 4LXIA 3DNMA 2WHPB 3K2IA 4Q3LA 4X00A 4KAJA 4EA6A 1JU3A 2WHPA 3WYNA 1E8NA 4U2BA 3LIIA 3QPDA 2O2GA 3EBLA 4A16A 4PSCA 1BN6A 1LPOA 2LIPA 1LBSA 2QXTA 1XZFA 3D4LA 4JH0A 3WK5A 4F60A 3ZLTA 4QLOA 1YR2A 4P92A 2YYSA 4QDXA 1JMYA 2VJAA 1ACJA 3U1TA 1ZD3A 5AKZA 4ZXFA 4UHCA 3BF7A 3W9BA 2DHEA 1T2NA 2XMCA 3PF8A 2HA7A 4UBNA 2ZSIA 3TEJA 1UKAA 2GZSA 3DEAA 5KBYA 2QZPA 3G0GA 4K6HA 3IA2A 1MNQA 2CMFA 1EINA 3G8YA 4X94A 3RARA 1UK9A 3DKRA 1BCSA 2C7BA 2BGRA 5A6VA 1YA4A 4F21A 1A8QA 5FDFA 3WK7A 4J0HA 2DFPA 1QIKA 2OAGA 2XUKA 1G4HA 2WIGA 1N8SA 1TK3A 3S8YA 1LPNA 2CJPA 4IH1A 4IH9A 5IVKA 1DTEA 3TGLA 2HHAA 5K3BA 2AJ8A 4B80A 3B3QA 1XZCA 1ODTC 5HZGA 3FSGA 1W76A 3STVA 4KJXA 1J07A 3YASA 3DOHA 5T4EA 3STTA 3O9VA 2HA4A 1HQDA 2QT9A 2BUBA 4UHHA 1TKRA 3R3VA 5ALXA 1XQWA 4LKOA 1F6WA 3FSGD 5ALDA 1QONA 2QJWA 4U2CA 1NX9A 3ESAA 4OB6A 4GW3A 1CUVA 4GBGA 2J4CA 2H7YA 2VEOA 4DGQA 3PDCA 3C87A 3FLAA 1LLFA 1UOPA 1XFDA 4W63A 1R9NA 3NOXA 1ZGCA 3VDXA 5CT8A 5JYCA 1K6EA 3OM8A 1UKCA 1Q0RA 2C0PA 4HZGA 2WFLA 2IIVA 4LXGA 5ALEA 1EVEA 3PICA 3ZWQA 1LPAB 4OB7A 2XMDA 3ZI7A 3QBJA 3A2NA 1FJ2A 3C6XA 5JAUA 5FPPA 2OGTA 1IUOA 4Y9SA 2AJLI 5FOQA 1YSCA 2ACEA 1ZIYA 1SCIA 3QH4A 4AMYA 4GDMA 4PW0A 4G1FA 2YH2A 3STWA 4KE9A 3FVRA 1WB4A 4I19A 3C43A 4G8CA 2PSEA 3IUMA 4G9GA 5BV7A 4FLFA 3AUKA 5AI8A 5AM5A 4FOLA 4ARAA 5DTJA 5JARA 3I6ZA 5ALYA 4OPMA 4C4YA 3GFFA 1XZLA 2W6CX 1B41A 4GECA 4OU4A 4ARBA 1TRHA 2CBGA 1IVYA 3WL7A 3HI4A 5YASA 3KWFA 3QMVA 3WYDA 4MJ3A 5CMLA 2FJPA 3DJYA 2DQYA 2HFJA 3VVMA 3HXKA 2JIDA 4DMHA 3BL8A 1E66A 4EZIA 3PF9A 1MAHA 2B20A 3BJRA 4H35A 2QUBA 1EA5A 3T52A 3IBTA 4IO0A 1LPBB 1R9MA 3DS8A 4BCDA 5CXXA 3PFCA 1RYYA 4DNQA 2XQGA 3HSSA 3L1JA 2WU3A 1W52X 1DT5A 4Y2XA 3F67A 5FUMA 1E8MA 4X6YA 5FLKA 2JGLA 2BAGA 4EHBA 5JATA 3STYA 1PFQA 4G4IA 2X76A 3QITA 2OCIA 4GHWA 1OXMA 4FFWA 3V1MA 1E89A 1AQLA 1EK1A 1UK7A 2XB6A 2YXPX 4FBMA 1QLWA 4G4JA 2O7RA 2JEZA 1K8QA 2Y6VA 4H7HA 4RE5A 1CUUA 4PF1A 1MAAA 3UUFA 4KE7A 4KE8A 3H0CA 4O08A 2WJ6A 4Q1VA 4CIBA 5LLSA 1XRLA 3D2CA 1HDEA 2QOEA 2JGFA 2GBGA 4GWLA 3DYVA 4CFSA 4UHEA
chains in the Genus database with same CATH superfamily
3MMXA 4MRSA 1FRQA 1VPEA 1FQOA 3WRXA 4OD0A 4KR3A 3M6FA 3MHTA 4OO3A 1C4XA 5HDBB 4HJXA 4YUVA 3IS3A 2FPUA 4EF6A 2XWJI 5IVPA 3QLJA 3SX0A 2IYQA 4PAGA 1T4DA 1DZIA 1GR0A 2JW5A 3OTOB 2O1SA 1C81A 3QJYA 1YUBA 4OFWA 3S2SA 1PYDA 2V96A 2A0WA 4ZVTA 1YTUA 1GCAA 3E7FA 1EVYA 3BDVA 4YIHA 3RLFA 4KO3S 5JS8A 5LP6F 2GFIA 3OZRA 5EWJB 4EJSA 3F7TA 3WIUA 3B1XA 4UTVA 2V98A 4BMXA 2QW8A 2QY9A 2IEAA 1FSSA 5K01A 3U7GA 4UE6A 1CNFA 1A9RA 1R0YA 4HI0E 3RTBA 1DAKA 1A76A 3OBBA 1MJGA 1LVGA 2D1TA 4ZCRA 3NHRA 4I6EA 3NPAA 1X87A 2AW3A 3OAAA 2M1ZA 2H92A 4JEMA 4RCZA 1A7JA 1GFSA 1OCEA 1YACA 3U2QA 2HLHA 1NFRA 1X1CA 1Z5VA 3V4PB 3WNVA 5JFTA 1G5PA 5AK4A 3U1VA 4CM4B 1WOYA 5K03A 3C6QA 1JLLA 4E4RA 3QUQA 3DDNA 1T5TA 3TH5A 5BWOA 3M7IA 1N5MA 5JAOA 3CW9A 4TV8A 4ITUA 4O1IA 3LQFA 2Z09A 3A1NA 2G1AA 1LNSA 4HGRA 1TVKA 4UBLA 5FOSA 1RYFA 3EW7A 3AEKB 3O8QA 1JQJC 4UQPA 5EJEA 1GZHB 1BRTA 4A6EA 1BG6A 4I4CA 1QGDA 2ESRA 1W49A 5T4BA 2D7DA 5HFAA 3FVTA 2WIBA 5LNK6 2PXAA 2Q5FA 2XTAA 5HIMA 4KXLA 4B81A 5BOSA 4RV5A 2BPOA 3A4VA 2TECE 1IPEA 4G01B 1QP0A 4MS3A 3RVPA 3WWYA 5D5PA 2EKLA 1VOTA 4QDUA 4YXWA 3C74A 4QOGA 1MW9X 2IU0A 2ENUA 2WWIA 3SDZA 3L8GA 4BC1A 1P5JA 2FXVA 1WX1A 3CV3A 4G5HA 3RRXA 3S5JA 3W3AH 3JALA 1G8KA 1O95C 4BRSA 1CC1S 1IQRA 4NESA 4DR5B 3O26A 4RDIA 4NS4A 1FFBA 1TT5A 1IVSA 1CIPA 3KYCA 4XGKA 4B5LA 5L53A 3DVQX 1X80A 3BIOA 3MB5A 4B82A 3JYQA 1SCQA 2B4AA 1P45A 1GRCA 3EQ6A 3UO8B 2ZYRA 4LTDA 5F51A 5D6OA 2JAWA 2PX2A 2BJHA 3HGQA 2HSDA 2BELA 1VL1A 3D6HA 2WF5A 4HX9A 2J5BA 4Q03A 4NK4A 4XSHA 1X15A 3K6KA 1KJQA 4WXHA 4EW2A 1FXWA 1YA6A 1JBEA 3Q7TA 1Z07A 1JU4A 4GLBA 2VJMA 4W1QA 4L9RA 4PFSA 1E6UA 3ZXYA 4AB1A 1GCUA 3DMDA 3IFSA 5GM1A 2ZB3A 3HYRA 4CHGA 2GPWA 4HTFA 4EQZA 3R3SA 3TEMA 3A1VA 4NJMA 1Z0AA 1AS2A 1OILA 2HF9A 3OEEA 4YI3A 4JL5A 2IIQA 3WO0A 1YVRA 4PBSA 1EH5A 4XJTA 4UDNA 3C7AA 5ALRA 2ACKA 3BMNA 3HUEA 3U40A 3UYLA 1DOZA 5LUAA 5DCUA 1E1MA 3SYNA 2ORED 4GOJA 3SWWA 4NZMA 3C3EA 3V48A 3DP7A 2PAFA 3G8CA 3HU1A 2X5KO 3RRZA 3KQPA 1O6ZA 2XIJA 2F62A 2J5RA 3EWIA 3FUWA 3LY7A 4Q4LA 3VPSA 1O9BA 4TKMA 4Z3OA 1Z0ZA 3I3SR 1NP3A 3VHQA 2UUAB 4I5GA 2IH4A 3HDTA 1CZKA 3AOEA 3F98A 1R8JA 4KTTE 5EEGA 3MIZA 2YVUA 4EF4A 4EI9A 2ORWA 4NCXA 1XSEA 4G81A 1E2NA 1FLNA 1XAJA 3BSFA 5EERA 3UMFA 5I48A 2I6XA 3OURA 4WNYA 2VYNA 5DM70 1O0CA 1DIBA 3BZWA 4LXTA 3ET4A 3RRFA 5GJBA 2RH5A 4Q1DA 1C7EA 4U5QA 3UJ8A 1OHHD 1BFKA 2BP7A 2QVGA 3HMKA 1EGHA 1K7FB 1RVDA 2H0QA 2IOHA 2YUIA 4AUKA 4BP9A 1FVFA 4DF3A 1AZWA 1RQ7A 1Z4MA 1M2HA 4DQ0A 1Z7YA 3MF4A 3N3BC 4ENUA 2OHIA 3BHNA 2AA3A 3Q7RA 3PSAA 3FHJA 3RI3A 1XVAA 1PR2A 1ETUA 1O77A 3RJTA 3URKA 3OE7D 1DKQA 3A1TA 3ZD6A 4JLUA 3ZIDA 2JRLA 3P0JA 3PQ4A 1JFVA 3AUSA 3GV0A 3NM4A 4Z99A 4CV2A 2VTVA 3MWEB 2W8BB 4FGZA 3NS7A 4Y2UA 4DMUB 2QRGA 3ZWMA 1XTRA 2BTQB 1UK8A 5CVDA 2G09A 1P4SA 3VZDA 4P83A 2JAHA 5CB8A 3AU9A 2WV7A 3JSAA 4B3CA 4PRLA 1VB5A 4CTOA 4UTRA 2J7PD 3LLSA 3MWFA 1EVKA 2NU7A 1ZNWA 3RVBA 4I4NA 1OXTA 2GETA 4YV0A 2VA9A 1EJ0A 3BA1A 4ZJZA 1RZ3A 1XNGA 5LU8A 3B2EA 2BGUA 4MGYR 2G36A 2RG7A 5CP8A 1UFRA 5H81A 5CPBA 2FPWA 2QB5A 4N6OA 1F8FA 2Q8PA 4AG5A 2UXCB 4RIGA 4MQLA 4W4TA 4E3WA 1Z4JA 3DBOB 3DFUA 2RBKA 4LZWA 4LBVA 3SS9X 3QLVA 3EAGA 5EIOA 3WGHA 3WKCA 4MHOA 5BQ5A 4AC9A 4C0LA 4C78A 2XLBA 2EJWA 3K4PA 1C2TA 2NNWB 3MTAA 5AHKA 4MW5A 4BRUA 2R9VA 3HLTA 3P1JA 5FO0A 2PJUA 3UT5B 1E99A 4TTRA 3SF0A 4HDNB 1BWRA 2HADA 1AE1A 1PR6A 1L5MA 5JG7A 3KS9A 1JJIA 4TUYB 4MGZR 1QWOA 2RGGA 4UXIA 4WN9A 5F5LA 4WUTA 3WNZA 2ZWAA 1BRMA 1F0NA 1XTZA 3D3JA 4MV9A 3K9CA 4OHRA 3D8NA 1YB6A 2I3DA 2HLDD 4Q82A 3KO8A 3ESDA 3QU5A 2WAOA 3QWHA 4L75A 3RC7A 2RBEA 1OH7A 1WXQA 4UKDA 3RSQA 4B4DA 2A5LA 3FWPA 1JDUA 2XOKD 3ND9A 4JX8A 1CJKC 3A9SA 2BM0A 2QYOA 5LP6A 3EIUA 1CFZA 1K06A 2PEZA 3NDBB 2C94A 1RYBA 1S3IA 1BW9B 1UDXA 1FDTA 1IZ7A 3GAFA 3O9MA 4UDXX 4AVYA 4BBJA 1QRSA 4DLYA 1G98A 2OV1A 1ZJZA 4HNHA 5FR1A 1T3LA 2ODWA 3ORQA 3AEQA 1E9BA 4WEOA 3V8EA 3VNRA 2MT9A 3QP9A 1YMUA 3A4LA 1TXGA 5PGMA 4CYMA 5KOIA 2ONJA 3ZU6A 1Z6QA 2WWXA 2XWSA 4YJFB 4Z4GA 1PJ4A 4LTNA 4TYPA 4EHAA 3OQIB 3EIXA 4J2TA 3NDRA 4P4SA 4UBMA 3PEVA 4GXQA 3VR4A 3HN7A 3GLFE 1ZNZA 1ZX1A 4LJ7A 4JJ6A 4WKNA 4PYIA 4AKTA 3W6UA 5DXJA 4FK8A 1H8EA 1CRWG 4NLLA 2IY9A 2ZB2A 3BOSA 3C6KA 4EFDA 2E49A 3H1FA 1XCGB 4O1HA 1EDDA 3IRVA 2SKEA 1UJ6A 2H0RA 2W6IA 4JNCA 1YXMA 1MN6A 1OAKA 2W2VA 3U9TA 1R50A 4GS5A 3LBAA 4EB8A 1P7CA 1QGOA 1KS9A 1NBOA 2PL1A 3T5GA 3UAYA 2WVGA 4D4JA 1W59A 4LJRA 4BMDA 4HUQA 5A7HA 3B9RA 1ISIA 2X1VA 1B42A 4GLJA 2HIHA 1AJEA 4UZEA 4YVFA 3PWZA 3WK6A 5IDXA 1ZFNA 3EFOA 4ZCSA 2XUFA 3QPWA 2CVFA 2A86A 2H2DA 2N1BA 2Q7XA 2VZLA 1OBHA 4L78A 5BQXA 2A4KA 2E7ZA 3E82A 3LKZA 1OH6A 1HLGA 2ZPTX 1L7MA 1QIEA 5KYXA 4KBFA 5BSRA 2OZEA 3G0IA 3RSLA 1REQA 3EVFA 3LT1A 2QVYX 4NMHA 2FQYA 4LCJA 3D0QA 4M1TA 3TLAA 3C3KA 4LZPA 4TMFA 1RMQA 3KLNA 3SX4A 5LB2A 3K3PA 3VHXB 2ORIA 4B45A 2QY6A 1X0XA 3FPSA 5ELMA 4BX3A 1PFKA 3QY9A 3R6TA 1TQ2A 3AHFA 1OYYA 2B30A 2XUGA 5ALTA 5CAEA 4N1AA 5EKUA 1NQVA 4WNCA 3MINA 3W1WA 5JROA 4NCBA 3Q1KA 4FYVA 5IBPA 1N2CB 3I04M 1LX6A 3B7GA 4IQFA 3NAGA 4KO2S 4UAVA 3Q3GE 2BFPA 4MR8A 4ZO7A 4PYRA 5HRAA 3B1FA 1YJCA 2M6RA 4RKWA 2D5IA 4F1JA 2JAQA 2J32A 1PE0A 1V5FA 2I7VA 5CYGA 4YJ3B 4JODA 3MT8A 1D2CA 1N3LA 2WIJA 4Z1MA 3VNBA 4D8YA 4O4JB 4KMRA 3IVXA 3EQ9A 1STOA 4R2WA 2O2ZA 3QELA 3IQXA 3K72B 4NFHA 5GGXA 1S2OA 1OIWA 4BEWA 2PKYX 5F7XA 3AJ9A 3TZBA 1RJGA 4NHOA 1GLNA 1U63A 3O4VA 3OC0A 3ZVLA 4HDSB 4IF6A 2PT7A 3DW3X 3EULA 1FMTA 2IHNA 3F3MA 3VC1A 2BTEA 1SCAA 4PQEA 2XCIA 1NLMA 1RYNA 4HRVA 2OORA 5J2UB 5K8LA 1ULTA 1SULA 1FPQA 4GPZA 5CNIA 2QQEA 1A4RA 2GPYA 4K6CA 2OO5C 4AICA 3SZMA 3SMVA 4FFMA 4CQMA 1PX0A 1FSZA 3ADPA 3MJ4A 3GO4A 3QI2A 4M7WA 3CPHA 4AX4A 4D5EA 2QR2A 1T2DA 3NNDA 1JPVA 2QMHA 3D31A 1IB0A 3WE7A 4BNMA 5A6SA 2ZYVX 1CRPA 1NYTA 1PUXA 3KKZA 4W7IA 3NYRA 1BVRA 1LGYA 4M0MA 2ZVQX 4D8UA 1VMKA 1W0JA 3LCCA 3MJFA 4JV5B 4TS9A 1NMSA 1ZGBA 2IUFA 2RGXA 1P0FA 3GJ8A 1QE3A 1I1NA 1DT3A 3HL0A 4HNSA 4OLHA 1M72A 2Q21A 4FNGA 5D7BA 4Q6WA 4BVKA 3LDAA 4H1UA 4MQEB 4PY2A 1W2GA 2J30A 5BUSA 2AJCA 2C9MA 4DIUA 2OGSA 4LZOA 3VKUA 2OB2A 1G21B 2ON6A 4QWWA 3EIQA 3OFVA 4B32A 2G8LA 2WLTA 3QMPA 4WESA 3WMGA 1OI3A 4XWAA 5I7EA 1DNPA 4H27A 3ZWXA 1KXZA 1X92A 1UPUA 5ALIA 4CCYA 1M6YA 5CEJA 5LQUA 3ML1A 6REQA 1MD9A 1XAIA 4QFCA 2I3GA 4J91A 1TYBE 2XF2A 2J3DA 1XQ6A 1AHHA 3B89A 1Q11A 1E2QA 1YDFA 3KJGA 2OE2A 1MNAA 1VPVA 1UPBA 4AIIA 2D0IA 3EZLA 5JRDS 1HYHA 1XE3A 2FUEA 4QHSA 1NIPA 1OI2A 5G2OA 3JCZA 5REQA 4CKCB 1CJBA 3W3AA 1V3VA 3BGOS 1GD1O 1WQ4A 3ONNA 1E98A 1QDUA 2MTBA 1DPGA 2REQB 2Z2KA 3I1FA 4IP0A 2LVBA 1LV7A 4N7JA 2RAPA 3TW0A 2W90A 4G1MB 4TZ0A 1JA0A 3R20A 5CNMA 1PEYA 2WIKA 2XTZA 3C48A 3H42B 3LLCA 4HAYA 1IBCA 5FL7A 2IHJA 3VNVA 2E85A 4QPDA 5D3KA 2D1SA 2DYKA 4QEKA 4CCSA 4PZ0A 4Y98A 4JR0A 3FDFA 5EXSA 1CEQA 3M83A 5G0SA 1BJKA 2FX5A 2V9PA 2ZCUA 4MCJA 2CMDA 3MCAA 4PC6A 1KP3A 1F4VA 4O4HB 4H1TA 2XKJE 1PV1A 4R9SA 1J2UA 4FQ8A 1GCIA 3WLSA 4P2BA 3SVZA 3FSEA 4RGVA 4HEHA 5CDTA 2NWQA 3VBCA 2W6PA 3AB8A 1CNMA 1OX5A 3L3BA 4B76A 1Z62A 3EDCA 5FADA 4GX5A 4NENB 1CB7A 4DDMA 2EP8A 3W2HA 5KWVA 1RP1A 3N7TA 4URZR 3OJCA 2FE1A 2UAGA 3PFFA 5AK5A 2DCMA 3FNIA 4IEFB 3R7LA 2X1LA 1FSFA 1D4AA 1KI8A 1NC3A 2WWTA 1R64A 1ZM4A 5AR1A 1S2NA 3W7AA 3F9CA 3VR2A 4EJMA 3JAWA 4FTWA 1XV5A 5KWSA 3L6EA 5HILA 4C7OB 2OXFA 4ZO4A 4J7CA 4OHVA 4ZVLA 2FSVA 1LU9A 2WJ4A 1KP2A 3TZEA 1ZVQA 1FRVA 5JJIA 1GPNA 2I33A 4EUKA 3L41A 2X8JB 2ZJ8A 1MG0A 5BRNA 4PSDA 4N03A 3IKTA 1Z5PA 4YMUA 1YR3A 3OMWA 3QBEA 2DFKB 3CZRA 5CFZA 2XE7A 3TZKA 2NG1A 2D8MA 4UCQA 3WWPA 2DGDA 3TTVA 1WXDA 3FIJA 4IOKA 5I4BA 4ZAYA 2P30A 3HJGA 2OBMA 1JAHA 3OPMA 4I55A 5KU7A 2HMVA 1HWYA 1M76A 1G4AE 4POAA 3EGOA 4IR7A 4EX7A 2J9FA 1QGYA 1WTAA 2CL6X 2FA9A 3A36A 4IJ5A 13PKA 1FTNA 3KL2A 2J4DA 4TRJA 1AQJA 4XRGA 1EXVA 1CQPA 3C70A 2A1UA 2GVDC 2W2NA 4FDVA 1OUMA 2ZS9A 4ZRDA 1N5IA 2Q4RA 4J75A 1HMYA 3UMRA 3CISA 1NNSA 1MB9A 3HXMA 3GLIE 2CXNA 4MVJA 2ZIEA 2IV7A 2A4MA 3A1EA 2GYYA 2GRJA 3LTEA 3WHKA 3UOGA 5K3EA 1MH9A 1EM6A 4CF4A 1Y7HA 1SIWA 3DZJA 4PONA 2NSHA 3I5AA 4AO8A 1PWYE 2CYCA 4QUKA 1P2VA 4Y7DA 2Q1SA 3M4XA 1N1EA 2VHZA 2JFVA 3W5CA 3HVKA 3ICOA 4BP3A 4ZVPA 1NIJA 4MK4A 3BIJA 4DNXA 5C46F 4AT1A 3ZQ6A 1DC7A 4RF4A 1HNWB 1GA4A 2LDXA 1XVVA 3RT9A 1N1MA 2GSDA 4C29A 1S7CA 1H3FA 3EDOA 5KNBD 2DQKA 5JS2A 3S99A 1EU1A 4BZWA 3TIGA 1Y4SA 3TZ6A 3PNSA 1KGSA 3EY4A 3QEMA 2FR8C 1ZUHA 3FHLA 4HWRA 3NMUF 1IVNA 2Q3DA 4C6TA 1GO2A 1FL9A 3DGEC 2F17A 1YB1A 4PYKA 3X1MA 2JJ8A 2JD2A 4IKPA 1G8MA 4WL0A 1SC9A 1LS1A 1YDHA 2C5FA 2D74A 3DVSX 5EHNA 1GZUA 1M0SA 3DAHA 4LDQA 5H3HA 2VRBA 1FLDA 2OV6A 1ODIA 3M82A 3RAPR 1M3SA 3AM5A 2A14A 3BREA 1VE1A 3L8HA 3M3PA 3ORSA 4B1FA 4D6YA 1FTQA 3IE2A 4RADA 5CITA 3V33A 1GNPA 1I2ZA 2OCLA 4NBWA 5FPSA 2QRMA 4KLCA 2NXEA 4EG3A 1ECJA 2VZ9A 2B37A 3O4FA 3PQ2A 2IC5A 1Q3HA 2EAUA 3LCVB 4PBRA 4RJJA 1KDVA 1XRNA 2I8AA 1KMHA 2SECE 2ZP1A 4RGBA 1NW6A 4ARZA 4DLLA 1YULA 5JIBA 4E11A 2G70A 2QDXA 4XGQA 3NWPA 3IT1A 1NW7A 2PMEA 1P6QA 2V6MA 1XVIA 3QA9A 4L6CA 1E3JA 3RWBA 1TI7A 4DV1B 1UBLS 3LP6A 4C87A 4DSZA 1QC5B 3GP3A 3A6ZA 4KREA 3FPKA 5CFPA 4QVIA 3UA4A 4BV8A 5T67A 1TUEA 1KU0A 2VF5X 4YGXB 5HPYB 3UGKA 4MRAA 1ZJ6A 4FZJA 4JDUA 2OLKA 2EBWA 3BWXA 3LQRA 5SZJA 3AEZA 1J8VA 1RNLA 1TK9A 3IOEA 1QBKC 4JLKA 3T4XA 4MW6A 4BLUA 3IIIA 4DJ5X 4QG3A 1L7RA 4L4XA 3N5CA 3HB0A 1N5RA 4BO4A 4E5VA 1Q1BA 2R4QA 1F9AA 5A4MS 2YBDA 2IK8A 3L8DA 4WVFA 3GJ0A 1N2XA 5AO9A 4OHKA 1FPMA 2WIAA 5JAQA 3VA7A 3ILHA 2VYFA 3MM4A 1B0PA 1UJNA 4U7WA 2XYQA 3JWIA 4Q15A 5AP9A 1VA5A 2W6QA 2CKMA 3SSAA 3T4PA 1C8KA 3BH6A 4DB4A 3PNLA 3UTDA 2QSYA 4NZNA 1C14A 3MNFA 4BASA 2DX7A 1Q0TA 4EG0A 1P3JA 1R74A 3GT4A 4ETWA 4BQSA 1SVWA 4RL4A 1VJGA 5BMVB 5ICEA 5JCXA 1PLLA 5J43A 2GM4A 2R00C 4EB6A 2X19A 1TIKA 4KAXA 4X41A 5EZYF 3KXIA 3OPNA 4KPGA 3K6RA 1R3DA 2ZJ2A 3SIPA 4XTRA 1ZGZA 4FMCF 1GXSB 3ZBTA 1M0EA 4FSXA 4F5ZA 5IU6A 1E62A 1CZHA 1GIAA 1HY3A 4OYLA 3GXOA 1JFRA 4BNLA 2JA1A 3UAXA 5BUCA 5AKEA 5IYZA 3LXUX 1DJNA 3ZQ4A 1UWKA 3OUUA 4Y6OA 2IITA 4RMIA 1M54A 3NTRA 4L16A 2SHKA 4B8ZA 4ZREA 4HNAA 2BI8A 3ASYA 3F9RA 1NM5C 1WDLA 3F7NA 2P4HX 2PWPA 5E9JA 5A7FA 3GROA 1LNQA 2JJ2D 4U7HA 1Z26A 1PR3A 2R1VA 3EXG2 3C5VA 4NV0A 4KIWA 2CHGA 1N77A 2EW1A 3L4SO 4CCAA 2Z1DA 5F73A 3EMVA 3R9XA 4WZBA 2DM6A 4A5SA 4CF6A 2FOXA 3B6IA 1QQ5A 1L9XA 2C92A 2IY7A 4X8LA 5L3ZA 4DLWA 3U56A 1GPH1 1HZZC 3DA8A 1HE2A 2FPPB 2IDMA 3QJGA 4ILKA 2AN9A 2UYYA 4D8TA 1BMQA 3F7MA 1I9CA 6AT1A 3ESBA 4I1RA 1BU5A 3KOOA 1US8A 5EJ8A 5JZSA 3E9RA 2R62A 3MVEA 2OVFA 3GL9A 3PVCA 4J29A 2O8FA 4ZC1A 3SZLA 4AN0A 4CMHA 5BURA 2R60A 2JJQA 2A9JA 4H9GA 1LH0A 1ZEMA 5G0UA 1LBQA 4ONEA 4CLOB 2F4NA 5C5IA 3MPUA 3B1WA 2HSWA 4RF5A 5JNSA 3GQBA 1FFDA 2Y68A 2PX8A 3ZNPA 1A5AB 2AFIB 1TPZA 1P2UA 2B9EA 4MQMA 1BQ3A 2PSFA 4HEA1 3HO6A 3C2QA 4JYZA 2VEDA 4K0KB 3WGLA 4Y0VA 3QX8A 1X42A 3K2EA 4XCVA 3OETA 2NV0A 1LLDA 4I9UA 3ISVA 1WHTA 2H08A 4O3FA 4DBVO 1P7YA 1A9XB 1PDWA 1WCIA 4OQDA 3RSZA 3WGZA 3I5YA 1X1QA 4FFVA 4IG9A 1TYDE 5KYWA 5IX8A 3TX2A 4JLAA 2OCPA 1UKZA 3KYDA 5EE9A 1YGYA 1QFSA 3RQIA 1J5PA 4LC1A 2G04A 1T1IA 4I0WB 2B92A 1LZKA 1W0KA 2XCLA 2QTLA 3IDQA 2AHRA 4BQRA 4DUZB 3THXB 4AG6A 2DG2A 3CPSA 1UBGA 2I6QA 1AHNA 3EGIA 2ZRAA 1R6TA 3H1EA 4IHJF 2OKCA 5JLJA 2IYEA 3TR0A 3IR7A 5JSFA 2B61A 2GJSA 3VOTA 4RPGA 4IDDA 1UXGA 1BNCA 3QFCA 4TKZA 3TO5A 3LUKA 1WV1A 4C9BA 1XEWY 1I7LA 4HX2A 5EWMA 1Z7GA 4KXQA 1W5FA 2NUAB 1UOOA 4I36A 4DGSA 1EK5A 5LKRA 1D0VA 3S2GA 4K40A 1KVQA 3HJRA 5ENVA 2CV2A 5JJLA 2PWAA 3BGVA 4MZXA 1RM0A 3PYXA 3R6DA 4EY8A 5L45A 3RC8A 3L7IA 4AM8A 2FDCA 1XCMA 3N70A 5FPYA 4GRDA 2HWWA 2Q49A 1KZ9A 5KKAA 3VJKA 3W5IA 3BRCA 3ND8A 5IDYA 5I51A 3KPVA 2F1JA 1AS3A 4P7BA 1YDMA 3C8ZA 1JYEA 1BDHA 2QXUA 1BMFA 2V6IA 1T4MA 2XB8A 3BKXA 4LJAA 4YJGA 3UUGA 3VRHA 5K3AA 4DLTA 1PZFA 2QJTA 1V1MB 2EQ5A 1CBUA 2O3QA 3P19A 1JDNA 1JJVA 1UZMA 2ATXA 2O5RA 4EEXA 2BGWA 4G0WA 4GM0A 1KOFA 1EP3B 2HF2A 2WZDA 1B8VA 2DQZA 1ZMTA 1X7GA 1VFNA 3HCOA 3BXXA 4KQMA 2IDZA 1ECPA 4G36A 2R2GA 4OHWA 3E03A 3TQIA 5A2QA 3K9QO 3PQDA 4P4NA 3A1CA 4X1KB 4OXQA 1ZNXA 3ZJYA 4H59A 5D51S 3GZNB 4EB3A 4II2A 2J0UA 3C5WP 3QI7A 3S2FA 2HYDA 1EPUA 1WUYA 1Z39A 3NGXA 1U3WA 3EJWA 3DKKA 4LYFA 4CM1A 1K3TA 1UMKA 3K4QA 4M88A 3RVMA 3L4BC 1IONA 4F3KA 3E1GA 4CTNA 1KYYA 2GEDA 2P5TB 2ZBQA 1T4GA 1PFGA 5H4HA 3LUCA 4BO3A 5B36A 5FQNA 2O2YA 3LQYA 1GVHA 1IFXA 1ECCA 2Y1KA 4QSMA 3IL2A 4HRXA 1F5NA 5GZ6A 4UEOA 4D41A 1L8LA 4M8NE 3PB3A 3AVUA 1E1NA 4YJ2B 4DAOA 3U4MA 1CQZA 4QBIA 2WJJA 5D1NA 4ESOA 5ILQA 1R9JA 2OHFA 3NV9A 4H77A 2FSGA 4DV5B 4P4TA 4GOXA 1RABA 4U2GA 1A95A 5F77A 3L7BA 1Y7TA 5T3YA 1R0RE 4B6OA 4UTPA 1KZ4A 1FP4B 2WKSA 2WINI 3GUVA 4EJ6A 2VJDA 1L4HA 3JVDA 3JAMA 3B2NA 2FKNA 4II7A 1LRLA 4PINA 1K66A 4N3CA 5FX2A 4EATA 1WQ1R 2QEQA 4ZEVA 3MHPA 3H9QA 5BNZA 1KK2A 1QYWA 1P1FA 3FGOA 2XKAA 3KOUA 1LRJA 2B8JA 5H82A 3MCVA 4OSEA 1I7SB 3OD5A 4HCJA 4LQCA 5FH9A 2O8DA 1E61A 2ZJ7A 3DE0X 2FW0A 5DK6A 2EGUA 1U8UA 2WUVA 3HCWA 4MCIA 4MYSA 4TMTA 1TJPB 2JHPA 3T4EA 3AF6A 2C7RA 2V97A 4ZYYA 2WJAA 4F93B 3AVTA 3FNHA 2V7QD 2FEWB 3LRTA 3VSBA 1S4QA 5JVDF 1E59A 5TEVA 2BH2A 2GKGA 4Y8VA 4MJ7A 3WK8A 4XWKA 3Q8MA 1EB9A 5LM3A 2IWRA 4B44A 2ZIVB 4YV1A 3VYRB 1EFPA 4LXHA 1KE1A 5I7RA 3O8CA 3E0QA 4AZ0B 2QJOA 1K2WA 4PNZA 3T7SA 1N9GA 2OSBA 2XQKA 2OYCA 5C18A 3KIPA 2AZMA 2XUOA 2BFBA 1U65A 4ZOLF 1CQIA 3BORA 2CV0A 1QX4A 2O2XA 2NUTA 1E1QD 1UMCA 1NXWA 3M33A 1KP9A 2QTNA 1DTSA 3GYBA 5CJ2A 5F35A 2XCRB 2C8KA 1DVRA 3PQCA 3D5TA 3UPUA 1JHAA 1YBMA 1ZO8A 4XVHA 1Z0DA 4RACA 2G9NA 4JFRA 3SYLA 3A28A 4CLRB 3IAFA 4LFCB 1NNLA 5K6AA 1LSJA 4MWSA 1KJ8A 2BH9A 4MO2A 1WBDA 2RC6A 1LS6A 2IL1A 3IP3A 3L05A 1G2IA 2P6NA 1BAPA 2V0CA 2YZ7A 1VSVA 3WAGA 2W0SA 5DGIA 1TO1E 2UUBB 1PS8A 1UMDB 4L07A 4YP0A 3QXCA 1XJQA 4RF3A 1A77A 4E15A 4X62B 5KWEA 3AY6A 3KB6A 3FYUA 3TFQA 1USIA 3OTWA 2GK7A 3JQGB 5DHSA 4MW1A 2XV1A 3PRKE 1DAHA 4LVCA 3EZYA 4ZHQF 2B99A 3JASA 4I1YA 4EA9A 3EARA 2IBSA 5DOZA 3N2YA 4ZQFA 4JLBA 4JMPA 4L8WB 3FPEA 2E4VA 3L7YA 1UP4A 4PN3A 4A0FA 4IXNA 1JTFA 4DR1B 2ZBPA 3IULA 1F6DA 1SUSA 2WU1A 3H5NA 4OIFA 2JFOA 2VWGA 3KD2A 5JZ9A 2VDRB 3DPUA 5H3LA 1JAZA 3EZGA 4IAOA 4QFMA 3U49A 4UNNA 3WWOA 4B3RB 4UU7A 7MDHA 3MIIA 1J22A 3MILA 3R3JA 3DLTA 3H2YA 1QE0A 3E22A 4N6GA 4GMDA 3DWGA 3SQLA 4PWYA 5KJCA 6ABPA 1F8XA 3RROA 4MEBA 5IH3A 4Q0MA 2FF5A 1SOVA 1LI4A 4RIIA 1APBA 5G53C 3THRA 3VKGA 3M9XA 4G5SA 1DDGA 3JV7A 1DBVO 4KYIB 3UOAB 1OZHA 2Z4RA 1E2HA 5BNIA 5EJFA 4NAHA 2WY2D 1O94D 1QLHA 1D7OA 2WMDA 4YRKA 2RHWA 4RSMA 1MJFA 4IGAA 3WFIA 3WLAA 1OX6A 3FD8A 2V7WA 1DAPA 1Q0PA 2DP4E 2VQSA 1ONPA 3S1AA 2BTOA 3KQVA 2N9UA 4TTSA 3RVQA 3NIGB 4BO2A 2G07A 3FVWA 3F5FA 3V6LA 1QHIA 4ODIA 4L1KA 1IE3A 2C2WA 1DU4A 1BZYA 1T36A 2OAQ1 3SEAA 2O54A 3IAAA 5FQOA 5GONF 2VH1A 1FUEA 4NI5A 3BDAA 3GA7A 3GDOA 1ECGA 3R9WA 2OFFA 3ICVA 2BZSA 2GPNA 5EC8A 3EA5A 3TPCA 2JFQA 1A8UA 5LZ2A 3QYPA 5D86A 2I4LA 5KYYB 1U6KA 2NUBA 4YRSA 3WQQA 5JZVA 4DR4B 1WY5A 2CZGA 3QKTA 5ADWA 2GESA 1ZICA 5JXGA 3H2GA 3AI1A 5HJ5A 5JSZB 4HLUC 3ADOA 4G0NA 1OU4A 4JBNA 3ZS9A 3O4IA 3L7MA 3ONFA 5F76A 3WMRA 5B12A 1D4FA 2C5GA 2HDHA 2HRDA 2NX2A 2XNSA 5A0TA 5LQJA 2W6ZA 1ZH2A 4I1IA 4A27A 4LC0A 2IH2A 1EVQA 2ZIWB 4LCEA 3F5SA 3CNBA 2MJLA 4EO7A 1Y9AA 3OPYI 3REGA 1LK0A 1OFUA 2XB4A 3E35A 4B4OA 1IHXA 1VE6A 2A0UA 1LBIA 3GFPA 3NBQA 1N5KA 3KSUA 3OJEA 4J1TC 5AJVB 1R4ZA 1QQ7A 3I4CA 1DFIA 1D6JA 2CKDA 5KO2A 1MV5A 4FWBA 4DSAA 2TRSB 2WHEA 3H0KA 5SZIA 3EPKA 3ROPA 2NVBA 5BR4A 5KTKA 5D2CA 2IX3A 2QBYA 1VSBA 4ZYTA 5HQ3A 3EVDA 4MGKR 5F7OA 2FR1A 2ZTHA 3P9NA 5AM4A 4NMXB 2HMAA 4JBHA 2XSZA 2IXGA 4XCQA 4EFMA 3Q6NA 2RGEA 3DBLB 1WLYA 2VTBA 5HHTA 3WIVA 3M49A 4JBIA 4K2HA 3F73A 3D2AA 2KI5A 4BAZA 2HMWA 4FEEA 4DCNA 2BFWA 5CX4A 3W5AA 1X1DA 1Z73A 1DQNA 4C0HA 4KYTA 1UCFA 4PLPA 4EYSA 5FTLA 3DEYX 1ZINA 3DF9A 3DR3A 3E4CA 4QJIA 4DR3B 2P78A 1K0FA 1NVAA 1U9IA 1G5IA 3A6LA 4NU8X 4XA8A 5K3DA 3RVNA 4ZIRB 4PHHA 4DG8A 2HQBA 1J20A 4Q3KA 5BUZA 5F1PA 3ZKWB 3CVUA 1WSBA 3T3OA 2PMBA 5BNWA 2WF8A 1E1DA 3QWFA 1LUAA 4P5DA 4NSNA 1XPUA 3KWJA 1XU9A 3Q0TA 1E3EA 4MVJM 4NC9A 1BXRB 4HD8A 3WSTA 2A0YA 4OSOA 5AK0A 4A92A 1O9HA 4EUFA 1CDZA 3LKDA 5KSYA 4W5OA 4U00A 2GFHA 4ZI5A 1W88B 4L8FA 5A4DA 4YRZA 3EK2A 4IOLA 3EPLA 3A9VA 2ZSEA 4WOKA 5KCMA 3QVGA 3MCTA 4FQ7A 1PKXA 1V16B 1Y9DA 2OCKA 2Z1MA 1USGA 4HLCA 2XUQA 3U60B 1CEYA 2C4VA 3L8CA 4B84A 2AVNA 2H3EA 1UUFA 3AHDA 3DL0A 1Z8NA 4KN5A 2QZ4A 4RPCA 3PUVA 1W8DA 3LC1O 2HPHA 2I78A 4RANA 4DC0A 4DYHA 4RTQA 1HDRA 4JUIA 1VRVA 3MYYA 3VBEA 1RWVA 4NVRA 2H2HA 3IHLA 4OHCA 3MC1A 1D7AA 5AH0A 4XE5A 1YU9A 3TKLA 3BFXA 1YS1X 3D5EA 3VUEA 2GTPA 2EKZA 2RHOA 3ZLVA 5JVDA 1NW4A 3NZEA 4Y30A 1JSXA 3SC2B 4KI7A 4N8EA 4DR2B 4BFWA 3QHPA 5BW4A 5ITZA 1ZA2A 4D3ZA 5E2BA 4CKEA 3ND7A 4DSTA 3ZQKA 4WXYB 1D4OA 3DR5A 4J4TA 5JZOA 4EYQA 1ORHA 2O3JA 5DNDA 1O6GA 5C81A 3G2HA 4ZOLA 4R51A 3V8MA 4W5TA 2ZEJA 3S2IA 2PKQO 3C3PA 3J7TA 1ZI6A 2EF1A 4OYYA 2HQRA 1ZI8A 4GI1A 3RKSA 4DMFA 4ROTA 2IPXA 3TD9A 3N0RA 3E3OA 4AF8A 1TZCA 2WD7A 5JNTA 2VDWA 2AG0A 2EYUA 2Q9UA 2ZRIA 5FXMA 4CODB 2FJ0A 5KTTA 2FCAA 5DGTA 5FWDA 5I9SA 2QTBA 4RKQA 3U80A 1DX4A 1M2KA 4XOIA 4Z4IA 2HNKA 1T8PA 1IK4A 4WBNF 4CEIB 4J07A 1UANA 2AOUA 1UFVA 2C2BA 2OZLB 3PQ6A 3USZA 5JALA 1PJCA 221PA 3VXKA 4DMRA 3KT6A 4NHEA 3OVMA 2XGJA 5JS1A 1RKXA 3QPCA 1JVBA 4MJLA 3V1KA 5KAMA 1J9ZA 2PUGA 1FOEB 2ZLBA 3C39A 3Q2IA 1M2EA 1CUSA 3F78A 4DA0A 4D97A 2YJ4A 2VXCA 4EIWA 3MWLA 1K6IA 3TMKA 1FUYB 2WJZB 2WPDA 3K5PA 5IDQA 1A1VA 1RHJA 4ZHQA 1RC0A 2ZRLA 3A6EA 2WYVA 2PU7A 2XH8A 2FYTA 5CM8B 3HQ4O 4Z9AA 1KYWA 2K7ZA 3LDHA 4Z86A 1CQXA 1G8HA 3HZHA 3GT3A 1A50B 1CR0A 3ROZA 3G9ZA 4UHKA 4YUWA 2F9MA 2B1JA 2CB0A 1TMGE 2XADA 3D1VA 4WW0A 3RS0A 4IIEA 3CMCO 4ER0A 2Z5FA 1GG9A 4LV6A 4ZT7A 4NH0A 4RPIA 4TKVA 1YF3A 3HMQA 1VG0B 1T2FA 2CHUA 3U4QA 2WEKA 1JTEA 3ON5A 1BHQ1 2AMVA 3UJBA 2GF0A 4BPRA 5BR1A 1KOGA 2PUDA 5ALQA 2I6GA 2BCEA 4YAIA 2A35A 4MDHA 4WZAE 2VLBA 3AEUB 3QU7A 5DGDA 1CY4A 2PUTA 2FFBA 4Y3UA 3GU3A 3WQBA 3EGXA 3AJEA 3G2PA 2SICE 1LDNA 3AFIA 3CF2A 3VSCA 1AUOA 2JGKA 3I8OA 1R5JA 2NPIA 3BSYA 2OFOA 2DR0A 4A4DA 1KK1A 4K86A 3BA6A 1LV8A 5DTMA 4ZV9A 4YR7A 2FPXA 5E6RA 2FSHA 1C29B 1CJTC 1XELA 3UAOA 3F97A 4DUGD 1U9CA 3BHMA 4R05A 3KQSA 7YASA 2PA3A 2POCA 5C32A 2IYOA 3W5JA 3PE3A 5HTOA 4ZDWA 2MSEB 1Z68A 1KO7A 4EI2A 3JQPA 1U9YA 2WMOB 1EDOA 1QXSA 1UT6A 4WFQA 4HR7A 1W4RA 3AVPA 4QTXA 2I4TA 3NC0C 5C8XA 2WSYB 5LOVF 4O6VA 4TLDA 4YHBA 2PSSA 1H23A 1E32A 3QIVA 5CTAA 1OB2A 1HX7A 2NU6A 4C6SA 1OXUA 2X8AA 1M8FA 2FX3A 5DBEX 2FX2A 4C43A 4EUSA 1V8BA 4KSBA 1PR5A 3HY3A 2AYZA 5LMNB 1HSZA 2BFFB 4S0ZA 4DIBA 2XBMA 3U7RA 2VRWA 1PS9A 1SVKA 1ODJA 2YQ5A 3K8YA 2RK6A 3SFTA 1YE3A 1B74A 4FMDF 4OK6A 4QULA 2OR3A 2AD1A 1V9LA 1FU8A 2JF0A 1PO7A 3QU9A 2FJUA 3GFVA 4G4SO 1I4LD 4EHFA 1PNRA 1VMAA 3HTXA 3HVIA 2VH5R 1T8YA 1K1EA 1Z0SA 2CXTA 2O3SA 1UMBA 3RV3A 3VR5H 3F6RA 1DZ3A 3PFBA 4GP9A 3ST7A 5E6UA 3I37X 4Y2GA 5DYYA 2LTAA 1XVLA 2P35A 3CSDA 3Q7EA 4QTTB 3E2IA 2OVBA 4PQFA 3DMTA 3D6VA 5CYFA 5AOAA 1EUCA 4CMKA 4CUZA 4UM5A 1OFTA 1I1QB 4WJKB 4EYKA 3EG9A 1SK8A 3V1TC 1J5EB 3QHQA 3OM0A 1YMQA 1LTQA 3EWSA 3FRIA 4NYJQ 4OMFG 4WBXC 4EHIA 1J2TA 1JS1X 1MQ9A 3MMPA 4EFKA 1AC5A 1RVV1 3VDNB 3I6YA 3RSGA 1V8ZA 1G60A 1OLXA 1V5EA 2W2KB 2BFNA 1Q15A 4NFLA 3IB3A 3WYCA 5TPWA 4IO1A 3DNFA 2EW2A 2ZK7A 3AR8A 2XXAA 3D1LA 2X5NA 4KN8A 4L5BA 4B6RA 2JIZD 2VPQA 3QXGA 3W90A 3PPYA 1CZRA 5KPJA 5AVXA 4L7VA 1TC2A 2JLAA 1OFUX 4G26A 4BVEA 5A02A 1K88A 3BK2A 3P4UA 4QT4A 2EFGA 4KH0A 3DB1A 2YICA 4L9SA 4KIJA 2DTXA 2JLBA 5AK3A 1X1AA 4DM3A 1E7WA 1P4RA 1DQPA 2QR3A 3DWEX 1Z2NX 2ZJ6A 3FB4A 3SFZA 1YCFA 2IYZA 3MK31 1KZ1A 2P8JA 2NO4A 3VZCA 3FCCA 2PVPA 2ZSHA 3LUAA 2XWQA 4KUEA 4O2AB 5AKJA 3WL4A 3LXRA 4A0GA 2H2FA 1L7BA 3MFQA 4K28A 5JD6A 1PT5A 3UY4A 2VBGA 3GDFA 4Y18A 4JJKA 1DXYA 2OY0A 4KHZA 5CX1A 5H3CA 1HGXA 1X94A 4N49A 3RJZA 2FQ1A 2REBA 1JHQA 3R0ZA 4FHEA 3KB2A 4KQ6A 4UTZA 2WT8A 3DE7X 4GKAA 2CMKA 4HAWA 5GIPE 4R4JA 5KYUB 1ZK4A 3UWOA 2GYVA 3CLTD 4D8XA 4F9FA 3NC1C 3JQFA 1OGIA 1VPDA 2X0KA 3CX4A 3L84A 5L6MB 1FP2A 2AQHA 2GLTA 3KHSA 2A67A 4URWR 2X6TA 3KKLA 1JSRA 2WSBA 3PA6A 1OVMA 1GU7A 4B3SB 4F9TA 1JG1A 4RLHA 4ZYWA 5I9NA 1SG9A 2F2TA 5L3SB 1T5LA 4O2BA 3RHFA 5EE5B 1VE5A 5CNKA 3SE7A 1FCJA 3GLHA 4UFOA 2XKKA 2B6HA 2VI5A 3BJMA 2GNAA 3LT4A 4LNUB 1TUIA 1YJ8A 3TNLA 5JH7F 1EFVA 1XDBA 4C3OB 3I64A 5I7HA 1NXPA 1UKVY 2CNKA 3IP6A 4WCFB 3PQEA 3SBEA 3VR6A 1UM9B 2QN3A 2Q3HA 2RMKA 2C0QA 1UOEA 4M9UA 4UU8A 3CT6A 3DPIA 3I2HA 1SUAA 1XDWA 4QUIA 2RH9B 5IBQA 3RYFB 1SD5A 3P52A 2ZULA 3B1KA 3R8XA 1VBMA 2JLXA 2C5SA 2GOYA 2O7VA 1TM3E 2W48A 2ZROA 2VT6A 2IP1A 4DV6B 1NX6A 4TTJA 3TKAA 1P72A 2BHNA 2GN2A 3AXSA 1N7IA 1T8SA 2J67A 3JWGA 4JS0A 4RHFA 3I42A 2Q9CA 5G4KB 2UZ0A 1GT91 3KOXA 2POQX 3QYFA 4EAQA 4U2KA 5KSZA 1HM5A 5HG0A 3EB9A 3RVOA 3DMHA 4WNAB 3M81A 4P6VF 3H9BA 5HF5A 3DFFA 3O90A 1WD7A 4LN1A 4M54A 1H1TA 2VP0A 3AR4A 3OHMA 1JG6A 3DBRA 2R47A 4TS4A 1LLQA 1THGA 1R6BX 1UAGA 3HABA 3KU1A 4BGVA 2O8EA 4QSHA 1YVUA 2Z8YA 5BYJA 3LL4A 2JFZA 3IAM6 1YONA 5C8VA 5ESWA 3L8YA 4ZYXA 3JQRA 1VPWA 5LSAA 1XOIA 1EWYA 1NUHA 2P3SA 4YT8A 1SUIA 4FZ3A 1UINA 1LVUA 3K0CA 3LKBA 4WAUA 2ZITA 4X6UA 2GXQA 3WIBA 3K16A 3QXJA 4EY7A 2VTDA 4KPUB 5EGNA 1P9RA 3ZUPA 1Z75A 4JYPA 5TPZA 3ZTWA 4DR6B 3JYLA 1L5GB 1PUJA 5KIAA 3AQIA 1JKXA 3NT5A 1HV8A 3R0JA 4DRXA 4IXTA 3MFYA 4QRDA 3D8HA 4EY6A 2YX1A 2UVDA 1EGVB 1J9GA 4JOCA 2YWBA 2XCQA 3WGJA 1EX6A 3MWDA 3LDUA 1I2CA 1X1SA 2Q3MA 2Y71A 4QJ5A 3SC3A 4ECEA 1LDMA 2VDMB 4Z3KA 4YFVA 4CN9A 3FOWA 3LVFO 2CXSA 3P96A 4LY0A 1P2GA 4E2XA 1Q57A 4B43A 2O2SA 4MIYA 4CM5A 3A2MA 3NWBA 1HLPA 4ND8A 1GLGA 1L5HB 3WSWA 2D3TA 3OEHA 2DMRA 3AG5A 1USWA 3OWXA 5F4BA 3MT9A 4PGFA 1EXWA 4X3CA 4RTLA 2E4XA 2NU9B 2FCRA 2WB4A 3E8XA 4PICA 3EW9A 3L79A 3SJZA 4EA7A 2FPRA 2D8AA 1H22A 3AL0C 3N86A 1M67A 1SIUA 1HL3A 1UC4B 3SYTA 2DU8A 3A25A 1E94E 1OLSB 3ZNOA 2RGYA 5BSWA 3P9QA 4WCVA 5LOVA 4C4TA 3KTAA 4M83A 4ZK2A 2D4HA 4ZTUB 3L4EA 1NVGA 2Q3LA 3DWIA 4PVDA 1KGDA 1PYGA 2FHPA 4G23A 3MUEA 2N46A 2RI1A 4Z4QA 1N6KA 2PD4A 3BMCB 4URHA 3FOZA 1RZRD 1YKSA 2E9SA 3HU5A 3T5TA 4DEVA 4RULA 1NKTA 4C03A 1N36B 2W8ZA 2FZKA 1VXRA 2P6OA 3M9LA 5T6BA 4ENQA 1VLVA 3I9JA 2QLFA 3L49A 3Q8WA 4RD4A 1KARA 4LF7B 3FPJA 2VQEB 2J7KA 3K1TA 3QEBZ 4JJGA 1UEIA 1V1RA 3DL4A 2C3MA 1LB1B 3RK1A 4ACBA 1VLJA 5HW0A 1F5SA 1HYEA 1K92A 4NCHA 1XRSB 3B8HA 2AB0A 4W9NC 4LZZA 5F1KA 4BY9E 4I9FA 4IMPA 2CLFB 4ICIA 3F47A 4HH0A 3DV0A 4IFBA 4R16A 3WDKA 3WGKA 3LUPA 1GPKA 3WRVA 5DULA 1R0SA 3W9YA 5K3SA 1T4CA 3K2BA 4DA9A 2HA6A 2XDYA 3KEMA 5BV2P 4ZOAA 1W9HA 3VKFA 2H3HA 1LWOA 2IUYA 4XR4A 2AJBA 3MQ2A 4HHEA 1KH2A 1P5RA 3L7CA 4GC9A 2H1VA 4TYWA 3R5SA 1ODFA 4RYLA 4EPYA 4KR7A 1Y8RA 1E5LA 2H4YA 3L06A 1CR1A 4AO7A 4PPYA 2IUUA 1FVHA 3KV3O 1U8EA 3W34A 2PLRA 4XFJA 1RQ2A 4Q1FA 1FYXA 3UAZA 1QIDA 1NMXA 2PD3A 2YFHA 4HDMA 2JGIA 3HU2A 3HDJA 4UBKA 3JRWA 4WGGA 2IZ7A 1GGNA 1MIOA 5C8YB 1KKMA 4XIIA 5BSMA 4H7IA 6NULA 1IPFA 1U7XA 1X70A 3HFJA 2JZCA 2M6LA 2WZBA 4TMWA 1MOZA 1E4YA 2XMZA 2PUHA 1R88A 3JRXA 3ZI4A 1PJSA 2YOFA 4QYWA 3SHOA 3VPDA 1MVNA 4H6PA 4KP7A 2IVZA 4EELA 1U5CA 2R5WA 2Z5GA 1SK9A 1I3CA 2D5BA 4QJ3A 1O89A 1TKAA 3WOHA 3CLTC 1ULZA 3GLRA 2QRVA 3WG9A 1ZHFA 4YMHA 4MB6A 2JGJA 3JSXA 4KQHA 4HNGA 5DX0A 3PR1A 4YMTA 4JR1A 1QK4A 2I80A 4C1NA 1JXMA 5JISA 3AIKA 3NKLA 3S81A 3FR8A 1SKYB 3MRTA 3ADKA 4EEKA 1Z36A 5BN1A 2J45A 1ZMRA 1JP7A 4TXHA 2Z9BA 1X3LA 1PIWA 1P1JA 2CLIB 2WT9A 3H2JA 1T35A 4NEGA 3VKVA 4CM8B 5IASA 2W2LA 4H7DA 4C6HA 2JI8A 3UK2A 1D6MA 4QPNA 2WUWE 2HT1A 4DEYA 3QK7A 3A2LA 2FFHA 3RH0A 2LGJA 4NYMQ 2J41A 1ADJA 2WABA 2ETVA 4DY4A 4DNPA 1XZNA 5JH7A 4KQKA 3K1ZA 4LAFA 1CT9A 3N2LA 4P22A 5ER6A 4EGAA 4IDQA 4J9UE 4JP3A 3TLKA 1VI6A 1ULHA 4BZXA 4V0MA 3A1DA 2BUCA 3SG0A 1UODA 3O1IC 1N4DA 1G6KA 3WBBA 1RLUA 1W5AA 1ZAKA 5EJ4A 5LQNA 3EVEA 2G77B 1D9XA 1PEKE 4PN7A 2WICA 1I9GA 1BHO1 3OPYB 1ESZA 3SYKA 2G5CA 2C9DA 1O97C 2ZAOA 3E48A 3LM8A 2C95A 3QENA 5DKFA 3PG5A 3V4FA 1U02A 4DQLA 2IF0A 5F23A 3E8MA 1EWTA 2P4SA 2YS6A 2GJ9A 3GNTA 4PYNA 2AC4A 5C37A 4GL2A 1AUQA 2Y0CA 4X66B 3SEZA 2QP4A 1Y1KE 2DWOA 3VR5A 1ZCAA 2YXDA 2W9XA 2PBFA 1Q7TA 1ZUNB 4JVLA 4Q93A 3VPGA 1T4BA 3JPYA 2GJ4A 4YRLA 4YXFA 4JQCA 2CBXA 4K6GA 2REXB 1BOFA 2ZOSA 1VL8A 5EJAA 3DBVO 4MTLA 1BE6A 1EG7A 2GHTA 1LLCA 4FW9A 2WHPA 3I2YX 1I32A 4XI9A 5IK2D 5H80A 2GEKA 2IPOA 4G0OA 4Q21A 4FDLA 5DRYA 5G0WA 1EE1A 1E96A 2CDNA 2RFLA 4CMEA 2HMSA 1WXWA 3NP9A 3CO0S 3WS7A 2W2OA 3PKJA 3ETEA 2PZMA 3JWHA 1S2GA 2FW6A 4EZEA 2GN6A 1R6VA 1YCGA 3Q85A 4GR9A 4RVOA 1BN6A 2ZE7A 1Y80A 3UGTA 1LPOA 4OMDA 4ZAGA 4IXDA 4NP6A 5M29A 2QE6A 3I9FA 1U98A 2ZFUA 1NR1A 4KQJA 1Q0LA 4Q9HA 2QYSA 3D4LA 4DQUA 4NS1A 3CLRD 1B8PA 1IEXA 1P4AA 4BP1A 2ZPUA 1Z16A 1Z6AA 3IEVA 2JATA 2UUOA 1H0KA 5JY1A 3E70C 4JC0A 4GP7A 4NDAA 1B76A 3OT1B 1L3IA 1D0SA 2GZ1A 2Z08A 4JL8A 3SXJA 1KDZA 1RIFA 1VL6A 1E3MA 3PUZA 3NU1A 4MHSA 1GA1A 2Q29A 4NG4A 4PG7A 2ASVA 3A3YA 1XZPA 2YYSA 4QDXA 1JF8A 4DILA 3HBLA 2VJAA 1GLVA 1PNVA 1TYEB 4I6GA 1I51A 2IFTA 3QVXA 4FGWA 4DR7B 3LC7O 1G3IA 4CEJA 1GTZA 3DUFB 1XQ9A 2QRHA 1GPDG 1RPTA 3EOZA 3W9BA 4MDEA 4G86A 4YB8A 4M98A 1M5UA 1MZVA 2QLJA 4AJ9A 2IU4A 3BQ9A 4RZUA 5EEHA 4M1QA 4XGNA 2XMCA 1QZUA 1BXGA 2HA7A 3W8NA 4IIFA 4K03A 4E09A 5ABPA 5BV0A 5KOYA 3DEFA 1UKAA 1RAIA 3A37A 4ZT2A 2QM8A 1ML3A 2VHVA 3RTGA 5KBYA 5GOTA 1GPJA 4RJTA 3L04A 2B5WA 2CD9A 2CMFA 5A3VA 2B7BA 3GG2A 4U6QA 4H17A 3RQSA 3AG6A 5JOQA 2ZIFA 1YFKA 4MV1A 3QEOA 1WL8A 3CUWA 3VO1A 3KJFA 4GPEA 1K3FA 1EK6A 1A8QA 4KMSA 3HL4A 10MHA 3KQUA 3LAWA 2EOAA 4UTOA 4D9GA 5JJKA 4XEUA 3RS5A 3WK7A 1R5NA 1QH9A 1VDZA 5CFMA 2DFPA 2NPOA 3FETA 1QIKA 2CNLA 4I1UA 4LBZA 5KKCA 3R7AA 1KI4A 1N1GA 3D7KA 2C99A 4ZI7F 4IDPA 1ZU4A 4EHDA 1DL5A 1TK3A 3BCUA 1ILWA 4R9UC 3UGJA 1E6MA 3KPWA 5KHOC 2G1JA 2Q6VA 1VL5A 3UV7A 3DEHA 1P31A 4IH9A 5KTRA 5E38A 3V7UA 1JEYA 3I72A 4OLFA 4OYHA 3ADBA 1PW5A 4ES6A 4RTNA 2ZJ5A 2VBCA 2A59A 3ZWAA 4F3TA 2JGDA 1TM5E 2RHRA 1PJZA 3NJ4A 3U7EB 1X77A 4OF4A 2C2YA 1JSZA 3DPSA 3IOBA 1KSJA 1EMDA 1F14A 2YJ3A 3WHPA 5IARA 3PQ5A 3RYCA 3RSOA 1G7TA 4MKXA 5HZGA 2IV3A 1L7EA 2W70A 4YT5A 1QHHB 4GRIA 2R8YA 3STVA 1TF2A 5EP3A 4YCLA 2P3OA 3AMVA 4RESA 3SIRA 1L1QA 2ZVPX 1U4SA 1CP3A 2B4YA 5JDIA 2G71A 2Y1WA 4PLWA 3AL3A 1HE3A 2VSFA 1CJVC 3IQGX 1NDUA 2HO4A 4UNIA 4X1YA 3R7SA 4YJDA 4HFMA 2IPAB 1HQDA 4IZOA 4XM0A 2L82A 2PQMA 4TKLA 4WLNA 3ZCUA 2VHJA 3ZX4A 4D81A 4UHHA 1TKRA 1VMEA 3IKLA 1U5BB 4M9XA 3S1SA 2TMGA 2QPLA 3DDCA 3DL2A 4D79A 1P6XA 1Q0SA 5BYBA 3U3XA 3ZH9B 1NMZA 2CEAA 4PZYA 2ECQA 3KZKA 1ZS9A 2R8XA 3TR6A 3WY9A 2HSGA 1COWA 2XODA 3FSGD 4J1SA 1DRJA 3PC8C 2Z4SA 4QPZA 1N0IA 3THYB 4U2CA 2P5SA 1NQWA 1Z6YA 3ESAA 1Q7BA 2HJHA 1HH4A 3HZRA 3PX2A 3D6JA 3FZGA 2RGDA 4AJOA 1H4VB 1WLSA 2V3CC 2PZKA 4GW3A 1CUVA 4JY7A 1FFYA 2QGNA 3HHEA 3SQDA 1NWHA 2H7YA 2WHXA 2ZRCA 4DT1A 1BX3A 3NTLA 1BVYF 1GFIA 5MFPA 5TQ2A 1XCBA 2C3PA 5T41A 2OM6A 3F6PA 3QW4B 1RTKA 2C07A 1VGQA 5A4KA 2IPMA 3O8BA 2JGRA 4PIVA 3LT5A 3UF0A 1A4XA 1OZGA 3PHIA 3PDCA 3C87A 4JU8A 4MS1A 2IU3A 1CJCA 1MOPA 3CZAA 4G67A 3C14C 2XEXA 1XD9A 1EQAA 2HT6A 3ZZNA 4Q3DA 3IT3A 1Q3KA 4BO0A 4PS1A 2VBIA 3BB3A 3BL6A 3O3MB 1CY7A 3FZEA 1YI0A 4PZUA 5FNZA 4B6SA 4C3VA 5ELXA 1J00A 1RWPA 1C80A 3L07A 1Y3FE 5JYCA 4TTQA 2AN4A 4ADSG 1DKRA 1UKCA 3CLUD 1IHDA 3AUAA 4BGDA 1Q0RA 3H84A 4XB1A 5BT9A 4WK0B 2WFLA 2XAUA 1V5WA 1FDIA 4JLJA 1AGRA 2Y77A 2VP5A 4LXGA 5ALEA 4OJTA 5GP1A 4LJKA 3SSOA 3ZWQA 2ZIGA 3KKPA 4D6XA 4F2DA 2YIJA 5E0KB 1NI4A 4K9OA 5GPBA 3R0IA 1SBCA 3HU3A 4R69A 3GMIA 3RS3A 1IHOA 5DLEA 3A1WA 4LVUA 5LXTB 1A7KA 1DJQA 4HT3B 5CD1A 4NU6A 5JAUA 4CFZA 1JDSA 3UM9A 2G1KA 4JASB 1YC5A 1ZN9A 1IUOA 4QBGB 2QVZX 4UCWA 2VVTA 4UEKA 1YSCA 3LFTA 2ZIZA 5FJIA 1ZK0A 2QX6A 4PHGA 3G8AA 4RZ2A 4B2IA 2O8BB 7ADHA 4RXTA 1FS6A 4ND5A 2QNBA 5JV5A 1DKUA 3CLRC 4J0QA 5IAJA 3UFXA 2BEKA 1ZJWA 1D1PA 3VQTA 4GDMA 4MKHA 2F59A 3GIDA 2GPJA 4R1PA 4C5AA 5DF1A 2VH2A 2ZYAA 3WYGA 4XFDA 3AYZB 3KKEA 2IS4A 4MUMA 2GPSA 3G2KA 4C0KA 4PPNA 3BGWA 3VPAA 4AJ2A 1SXGA 4I19A 3UHOA 1QF9A 1PEAA 5FEMA 3KHTA 2GBPA 3LA8A 4FS8A 2MWMA 1KJNA 1KDYA 4D4IA 3CUSA 4OVKA 2P9YA 1GN8A 4UPVA 5H70A 2Z9CA 5LDHA 2A1TR 3ZWCA 1NZFA 3KVOA 1JX6A 1HOXA 4RKEA 1D04A 2WJIA 1W44A 4OHMA 3AUKA 1I01A 3K2QA 1BQEA 1S2DA 3EVTA 3N8KA 3C3CA 1XEXB 1Q95A 1TNDA 3FHOA 5G0VA 3I6ZA 4QOEA 1UBRS 2NYRA 4LYGA 4HZUB 4N4AA 4CIWA 4DCCA 3JS5A 4C4YA 2YIMA 1FK8A 3B7PA 1GNTA 5BPHA 2P1ZA 3AHEA 3GEIA 4LMRA 5GMOA 1ORDA 1B41A 1T9GS 2H65A 4OHFA 2GVZC 4ENWA 4UJ5A 4OU4A 1L7NA 3N74A 4OK3A 4RD6A 1RMTA 2JD0A 4RPLA 4UHJA 4IHQA 1I2AA 2XCTB 1TRHA 4ETMA 5CIYA 1OW3B 2YDYA 4RM2A 3CZ5A 1X7XA 1MLDA 5FA6A 3HI4A 3ZHOA 4X24A 1W581 3LE8A 5FBZA 5YASA 4G07A 4IUCS 1DCMA 1MAVA 3HBJA 5AJYA 1PEDA 4LVNA 2IPLA 5A3SA 2YZNA 3N05A 2XVXA 5CJJA 1SVOA 2FZVA 2Q4DA 3A9WA 3DBIA 2BT4A 2QGZA 1X13A 1V3UA 3DJYA 2DQYA 3F74A 4RELA 1D3AA 2IYYA 4AY3A 1E3WB 2Z8YM 3D6FA 4DMHA 3QY0A 1WIWA 2EFCB 2CNBA 4WY2A 4DZZA 3GRCA 2JHCA 4TXLA 3N2EA 1Y34E 4Z8YA 2BLLA 1L9KA 1PQYA 2CLSA 1NUSA 2IJGX 3B52X 3HN6A 3JWJA 4ZQHA 5IF9A 4H35A 1IJFA 3VGPA 2V3WA 1FNCA 2EZ9A 2UYCA 4CQJA 1KJ9A 9ABPA 2RHDA 2G6TA 2C2KA 2XUZA 4IO0A 3WC4A 4ZI7A 4YO8A 1R9MA 3PXAA 3EZNA 4ID9A 1NKVA 1WW2A 4OQYA 3PFCA 1QMGA 5DP1A 3BULA 3OI7A 4FGKA 5DB4A 4ZCTA 1QVVA 1DS6A 2XQGA 2GDJA 2IDKA 3GLTA 3PXEA 2TS1A 1A69A 3IMEA 4QPCA 2WU3A 2XITA 1PL8A 1U2QA 5FFMA 1PFWA 4HATA 4WZAA 3SJCA 1J8FA 1G6OA 1OC4A 4MR9A 3KX2A 4MP3A 3VZPA 3I8XA 1VYTA 3WDSA 5B5SA 1DMRA 4G0QA 3ACBA 1PLKA 5DMHA 1LA2A 1K5DA 2JFHA 2KLHA 4WH0A 1JKJA 4QUEA 4AIRA 4BVGA 4U9IS 1YZYA 4ZDJA 4OXRA 5JFOA 1VLLA 3CR8A 1OKKD 5FCDA 2ZIUB 1QMPA 2P7HA 3FPBA 5FLKA 3DZHA 5F5XA 3U39A 3UJ3X 4CDMA 2O4CA 4X9XA 5SZHB 4G4IA 4IQ8A 1ZCBA 3OT5A 3QITA 4GH5A 4L6AA 2FSPA 4MVJI 1YU6A 4GHWA 4N48A 1V9SA 3DMGA 5EVCA 4MRRA 1AQLA 1R0CA 2II6A 3GVIA 4B09A 1E2EA 3PGXA 4BNWA 1SOAA 2OXCA 1VSUA 2YXPX 2IYXA 3D2LA 3NBAA 3NM5A 3MTEA 4MQBA 1P33A 2ILTA 2UV8A 4JI7B 1CUUA 3T3DA 4FCWA 1YQWA 1W1UA 4WADA 3BEOA 2BRUC 3UUFA 2Y76A 3BCHA 3Q3VA 2RKBA 1MRSA 2FPSA 2I4RA 3L93A 2Y0DA 5EIXA 1CF4A 2HWUA 3H0CA 4K87A 2C77A 3ZW9A 4C3UA 1OV4A 1Q77A 2XJ4A 2ZXFA 3OA0A 5C8DA 5C7OO 1QKKA 2JI9A 4B3GA 2CDRA 1RKUA 1X7YA 2JJ1A 4CIBA 2J3IA 4J0EA 1CRQA 4UULA 4RFSB 4GKKB 1BDJA