4C4XA

Crystal structure of human bifunctional epoxide hydroxylase 2 complexed with c9
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
313
structure length
313
Chain Sequence
SDMSHGYVTVKPRVRLHFVELGSGPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESSAPPEIEEYCMEVLCKEMVTFLDKLGLSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNTPFIPANPNMSPLESIKANPVFDYQLYFQEPGVAEAELEQNLSRTFKSLFRASDESVLSMHKVCEAGGLFVNSPEEPSLSRMVTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSLGRKILIPALMVTAEKDFVLVPQMSQHMEDWIPHLKRGHIEDCGHWTQMDKPTEVNQILIKWLDSDAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BIFUNCTIONAL EPOXIDE HYDROLASE 2
publication title A Combination of Spin Diffusion Methods for the Determination of Protein-Ligand Complex Structural Ensembles.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 106
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 3.1.3.76: Lipid-phosphate phosphatase.
pdb deposition date 2013-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4c4xA00
4GWLA 5AKZA 5E4TA 5HFNA 5A7FA 1UFOA 3WK6A 1SCIA 2OGZA 4UHDA 5ISMA 2GBGA 2QM0A 1THTA 3TGLA 1YCDA 3IA2A 3IULA 5K3BA 3KXPA 4ZRDA 3F96A 3ZLUA 1CUWA 3S2ZA 1WB5A 1ACLA 1QO9A 3BXPA 3ED1A 2CKMA 1EDEA 4DIUA 4EBBA 4WDQA 3WK4A 4EY6A 1MPXA 3HLKA 1W6RA 1YS1X 2HA4A 1XZGA 5IVDA 3WKCA 2DFPA 4X3CA 3H17A 3AINA 3OM8A 4KR0A 5CBKA 4L9AA 1XRLA 4WDRA 4XIIA 1VOTA 1XZEA 5LZ2A 6YASA 3GZJA 4QWWA 4DM7A 4BE9A 1JFRA 1CV2A 3C87A 1LPSA 5ALZA 3ESAA 1BE0A 2R8BA 1DU4A 1UOQA 1DWPA 1YASA 5D7BA 4FLMA 1A7UA 3L1IA 1AGYA 2XMQA 1QOZA 1CUGA 1JU4A 3DEAA 3WKAA 1HQDA 2QXUA 3C43A 1CUJA 1WM1A 3WL7A 5A7GA 4QWMA 4EA6A 5FPQA 2OXEA 5D3KA 4WFIA 2QUAA 4G4JA 5ALFA 5AKEA 3RK4A 3VVLA 2GBIA 4QDTA 3WIOA 3F9CA 4WCVA 1Q0ZA 1ZICA 2XUOA 4FMPA 5CXUA 1G4HA 4PSUA 3R40A 1CRLA 2R11A 3AZQA 1KU0A 3R0VA 3WWEA 1R50A 4DMHA 4FWBA 5DNUA 4J03A 1ZD4A 1JI3A 5CH8A 4FNMA 1XZKA 3FVRA 4UHCA 2XUKA 1YA4A 1AUOA 3GBSA 1Q0RA 1CUUA 5C8VA 4Y9SA 4DMFA 1CUYA 4ZWNA 3K9BA 2WLSA 1G42A 4FTWA 2Z8XA 5LZ9A 4B82A 1R1DA 1CQZA 2ZYHA 1XZHA 3H2IA 5AKHA 3C6ZA 3O4IA 4KJXA 2PPLA 3IIIA 3WIBA 1DT3A 1QTIA 1J07A 1XLUA 3LS2A 1QIEA 5FDFA 2DHEA 4Y2PA 3ICWA 3TEJA 1MN6A 3D4LA 2WFLB 1B41A 3IUJA 4OB7A 3H1BA 4FHZA 1J1IA 3K6KA 2ZYSA 5ALEA 5CURA 4C01A 1WHSA 2X8BA 4JYPA 3BDIA 2BJHA 2XUIA 2WIDA 1L7RA 2QR5A 5LKRA 2VJCA 3VVMA 3B5EA 5ALTA 4MQLA 1J06A 3FNBA 3U1TA 2AJCA 1I6WA 2WHPB 3BJRA 4RGYA 3B3QA 1MNAA 2XMGA 2I03A 1XZBA 1YSCA 3H2HA 3YASA 2JGEA 3G0DA 1E8DA 1YB7A 3DOIA 1EVQA 1BS9A 3STTA 1DX4A 3A2MA 1U8EA 4BDTA 3MUOA 4KE6A 3C45A 4LYDA 3CCBA 3NOXA 3G02A 5CT5A 2WJ3A 4F5ZA 1HBJA 5ALPA 3VXKA 2XMZA 4MEAA 2X76A 3A2LA 5AIAA 4YK7A 3FYUC 3AIMA 3G9XA 3W2TA 4AO6A 1W1IA 2BAGA 1L7AA 2E3JA 4OU5A 4UHFA 1DINA 5AO9A 3EIOA 3IUMA 1GGVA 1VXOA 4CI9A 4Z49A 4ETWA 3BF7A 3DJYA 2J3DA 3HACA 3OTQA 3I2GA 1EA5A 3I6ZA 3L1HA 3JW8A 4AQDA 5LKAA 2FX5A 4BVKA 4J0CA 1MNQA 1LPPA 3DKKA 7YASA 4EHBA 4Q05A 2WG0A 2D5LA 5I7UA 4C4YA 3L1JA 5K3AA 4P9NA 5JZSA 2VJBA 1NX9A 5SYNA 3ZPXA 5CT8A 3A6ZA 3QM1A 2CJPA 3A70A 1YA8A 3ZWQA 3BE8A 3LCRA 4MYSA 3DDUA 1ZI6A 1XZCA 1SCQA 2JGJA 2H1IA 4EB0A 4BTVA 4AMZA 2EEPA 1VE7A 1JJIA 3FSGD 4NVRA 5DJ5A 2FUKA 4H7IA 4IH9A 1H23A 2Q0XA 2I78A 2G4LA 3G9UA 3HSSA 2G5TA 4U2BA 2CBGA 4U2EA 2Y6VA 5KWJA 4CG2A 3AIOA 2NW6A 3WWPA 1Q84A 2J4CA 4V2IA 5A62A 4Y2JA 4K2AA 3PICA 1K6EA 1EK1A 5ALNA 2WUDA 4OCZA 4M0MA 1CIJA 5A2GA 4E11A 2J4FA 4DNQA 1CUZA 1Y7HA 5BOVA 1CUXA 4EZIA 4WY5A 4W9RA 2WUFA 3UMJA 2BFNA 1VE6A 5JARA 3D7RA 1ZD5A 5ALVA 3G0IA 4BZWA 2WSLA 1LLFA 4H7EA 3N2ZB 2OQIA 1VLQA 2QUBA 2RHTA 4OU4A 3HEAA 3SK0A 2HHAA 3GFFA 3T52A 4LXIA 4RE6A 4XWGA 2C58A 4I3FA 3V1NA 5J3JA 4MEBA 2K2QB 3LIPA 1BCRA 4WJLA 2D0DA 1IUOA 1WB4A 4JNCA 3VDXA 4LIPD 4OUKX 2XUDA 5EHXA 4CCYB 4K6GA 3E4DA 5HQ3A 3O95A 1U65A 5CRIA 3X3HA 2VEOA 4DSZA 1SCKA 5HKAA 3I28A 3N0TA 3Q8WA 3WL6A 3W04A 2ZSHA 3S8YA 5CT9A 4B9AA 1UOOA 2XUQA 1ORWA 5ALUA 1USWA 4MWSA 3R3WA 3DCNA 3V9AA 4FDMA 2HL6A 3O0DA 1JMYA 3G9ZA 4G8CA 2O2IA 2OG1A 4L72A 4TGLA 3UUFA 2HDWA 4BC0A 4UBNA 1QIJA 2WKWA 5CXXA 5AK4A 4BB0A 1IZ7A 1DX6A 3QMVA 1CVLA 4KE9A 2XQJA 5AI4A 4BAUA 2QT9A 3C5WP 2PSHA 1QLWA 4RPCA 4CIBA 1RYYA 2WUGA 3RLIA 5YASA 5FV4A 2EDAA 3DL7A 3G9TA 2GZSA 1XZFA 5CT4A 3RM3A 1QIGA 3QZUA 3DKRA 4UBLA 3FVTA 4OB6A 1R3DA 4FFWA 1FFCA 2ES4A 2HA7A 5CT6A 4MXDA 1CEXA 5AICA 2QJWA 1XZAA 3FSGA 4Q3LA 3D0KA 1A8UA 5AKXA 5AM4A 5HK8A 3HRHA 1MO2A 1LBTA 5LYYA 1JU3A 1N5MA 4DTCA 5E4YA 1IVYA 4INZA 4U2FA 5HFAA 5K3FB 1R4ZA 2HIHA 2I3DA 4AN1A 1DWQA 5IVHA 3ZI7A 3I6MA 5HF8A 1A8SA 3WJ1A 5DTIA 2C0PA 2W6CX 3QPDA 4Q3OA 2BCEA 4OPMA 1WPXA 1CUFA 4HXGA 4X7BA 2O2HA 4A16A 5FLKA 1W4LA 3DS8A 2AXEA 5A7HA 1UXOA 1UT6A 5AOBA 3DD5A 4CG1A 5AKYA 2HA0A 5A71A 5AM2A 1MAHA 3CCCA 4XVCA 4FKBA 2XLCA 1IMJA 4W63A 2FJ0A 1EI9A 5ALQA 3NGMA 1X2EA 2ZVDA 4A5SA 4BE4A 3WKBA 5DYWA 3H2GA 5HF6A 4FOLA 2VT6A 5AH0A 5AK6A 4W1RA 1N1MA 4PW0A 2B4KA 4KRXA 3GUUA 5FUMA 4G9GA 3M82A 1WHTA 3G8YA 4LKOA 4CIAA 1AMNA 2DR0A 4W1QA 3T4UA 4UHHA 5T4EA 4B83A 2XE4A 4PO3X 4BAZA 4DNOA 4QE3A 4X93A 4Q82A 4EUSA 4HS9A 1XZLA 4NZZA 3O4GA 5AJHA 3KWFA 2OGTA 2OPHA 1ZOIA 4BCBA 1ZJ5A 5JAPA 4DNPA 2XMSA 3FCYA 4HXFB 5ALHA 1EVEA 4ARBA 4ZREA 4BYMA 1LZLA 5AM0A 4QDUA 2XT0A 3FBWA 2WHRA 1QIFA 4U2GA 2XUAA 1N5RA 2ROQA 3RKSA 4J0DA 4G4IA 1K5PA 1QIIA 2WIJA 4G5XA 5T4HA 5DLPA 4GHWA 4Y2SA 4ZXFA 4BVLA 2C0QA 3STVA 4X00A 5AK5A 3V48A 2ZJFA 2GYUA 5E4JA 3HC7A 4M0FA 4C6HA 3O4HA 4AZ0A 3WK8A 5A6VA 1BEZA 2PSDA 3FAKA 1P0QA 1LPAB 1UK6A 2HFJA 3W9UA 4DYHA 1E8MA 3KD2A 3WLAA 3MGAA 3EQ9A 1TK3A 4LXGA 4QEKA 1XLWA 3VJMA 5HF5A 4G1FA 4X95A 3BF8A 4H7DA 3MVEA 1QIHA 5ALJA 2QMQA 2WQZA 1HLGA 5ALDA 3ICVA 2CUTA 5T4FA 1TRHA 1NU6A 3VJLA 5ALYA 5ALXA 5AOAA 5BWCA 5DWDA 3I2KA 1H22A 3WL8A 1TQHA 2PSFA 1XRRA 1XRNA 1QGED 3WJ2A 4Q34A 5ALSA 1GKLA 3D2CA 4NMWA 2ECFA 5T4BA 1YR2A 5JASA 4H77A 4YASA 3O4JA 3H19A 4AO7A 2CMFA 4S0XA 3HJUA 3V1KA 3W05A 5AI0A 2QOEA 4IO0A 1GZ7A 4OD0A 2RGUA 1THGA 4EY7A 4Y2TA 1EDBA 3A2NA 3BWXA 3V1LA 3V1MA 5LZ4A 2AJBA 2HU8A 1CUVA 4MWTA 1CUBA 4B0OA 4B85A 5D6OA 2WIGA 1GT6A 3R3XA 3FCXA 1ZD3A 3ANSA 4G8BA 1XRMA 1QTRA 4DMCA 4Q1VA 5EGNA 2XQGA 1XKLA 5HQ3B 4IHAA 2WTNA 4N5IX 1QIKA 3EBLA 1UK8A 4GW3A 3WKEA 1JMKC 4AXBA 3NUZA 1N8SA 1BN7A 1XQWA 2WIFA 1HPLA 4EY8A 5AM1A 2WJ4A 5JADA 3EQ7A 1OCEA 2AJLI 5K3EA 2V98A 2O7RA 4JH0A 3WK9A 5EFZA 5CTAA 4TVKA 3SC2A 4X94A 1XQYA 3D5EA 4Y2QA 1K8QA 2QZPA 4NS4A 3C5VA 5HCUA 1C7JA 4QA9A 2OCLA 5K5EA 1E66A 1QFMA 1VJ5A 2PSJA 3IVMA 1XZJA 3QMMA 4ZV9A 4BDSA 2DQZA 2XMBA 2Y2VA 2IIVA 1CFJA 3C6YA 2XQIA 5JAHA 3R41A 3WZMA 3DYIA 4X6UA 3GROA 4IQ4A 2P8SA 4WFKA 3FYUA 3HZOA 1O6FA 3GELA 2ZJ7A 4X92A 3IDAA 1MX5A 2HADA 5JIBA 1BRTA 1Q83A 4FLFA 4PNZA 5ALMA 3W9BA 3EF3A 5LZ7A 2JIDA 4J0IA 5C7YA 1X2BA 2C4HA 1SC9A 1UKBA 2HU7A 1UKCA 2WM2A 2Z5GA 2PM8A 4UBIA 4BZZA 4KYVA 5AKJA 5JAUA 1CR6A 1GQSA 1XROA 4BVJA 1YB6A 1L7QA 1GPLA 1KU6A 3QITA 2PL5A 3DL4A 1ZGBA 1QO7A 4UFPA 1XZIA 1OXMA 2ONCA 4PSDA 2WFLA 3FWHA 1PV1A 1MAAA 2GYVA 2Y1KA 4Y7DA 2XQFA 4C89A 4J0KA 1DQYA 5IH7A 3FLBA 3NWOA 4FNGA 5ALOA 3Q0TA 1W52X 4O08A 3SX4A 3DLTA 1Z68A 2CZQA 4DSAA 3BIWA 3PI6A 3ESBA 2WHQA 2WHPA 4WFJA 3PUIA 2JGKA 3I1IA 2JBWA 1XRPA 3STXA 3H2JA 2Y2UA 1LBSA 1WCYA 3I1YA 3QPAA 2Y6UA 3DYVA 1WOMA 1CUHA 2BUCA 3C6XA 2X5XA 5ALIA 3I6YA 4FBLA 4J0GA 5CMLA 1CUIA 2PVSA 2WJ6A 3AJAA 3OC0A 2C5FA 1LPMA 2HA3A 5AM5A 3IBTA 3D3NA 5AI8A 4Q3KA 4AMYA 5EI5A 2V96A 5K3DA 2IX9A 1P0PA 2CEKA 1FSSA 1F0NA 4MJ3A 5HZGA 3UUEA 2Z8ZA 4BBZA 1CUCA 3LIIA 2DSNA 5AP9A 2ZJ6A 5FP0A 5AKGA 1F8UA 1MX1A 4F60A 4N5HX 4C87A 2BUAA 4KEAA 4QLAA 3D59A 4D9JA 4KE8A 5E2IA 2W22A 3SWWA 5JYCA 2VJDA 3E3AA 4Y2RA 5JD4A 2GYWA 3G0GA 4AO8A 2XMRA 1GQRA 3G7NA 1FFEA 1ZIXA 3QVMA 1C7IA 4BP9A 2XDWA 3WA6A 1Y37A 1XZMA 2XMDA 4QDOA 2PKYX 2VTVA 2XUFA 3PF9A 1TCCA 4PF1A 3O9MA 1XZDA 3OOSA 4OB8A 2V97A 4PQEA 4F0JA 3WL5A 4I19A 4LXHA 1GXSA 2YASA 3R3VA 4ZV7A 1DTEA 2FJPA 1MTZA 4H7KA 3PUHA 4KRYA 1HL7A 4UBMA 1E8NA 1QJ4A 4B84A 3VISA 5EIHA 4QZVA 5CH3A 3ESCA 5AHXA 1FJ2A 1XKTA 2RONA 1EK2A 2WFZA 5JATA 4K5QA 2VAXA 3R3UA 5I8PA 2HU5A 4H18A 5DYTA 2JEYA 3D2BA 3PDCA 2OAGA 5JZ9A 3AILA 1C4XA 1SOMA 2HM7A 4L0CA 1LGYA 3FLAA 5BV7A 5DYYA 3STUA 2WG1A 2H7XA 4CFSA 1UKAA 1K4YA 1U4NA 2C5GA 4F21A 2GZRA 4M0EA 2RI6A 5LP1A 3VKFA 2QVBA 1A8QA 2V9ZA 4GXNA 1H2WA 3BJMA 1UK7A 2HRQA 4N8DA 4QNNA 5HK9A 5EIEA 2RAUA 2AJ8A 1TAHA 4C4ZA 3R3YA 2VA9A 3BIXA 4W1PA 3E1GA 2HA5A 3IB3A 3WZLA 2IITA 3ZLTA 4N8SA 1VA4A 1D07A 2HA6A 3O9VA 1W76A 4B80A 5LLSA 2XUPA 1P0MA 4BTLA 4IH4A 1B6GA 3RARA 1R9NA 2ORYA 2VJAA 1WPRA 5AKKA 1M33A 3PF8A 3F8SA 1ODCA 4CCYA 5ALRA 5IVIA 5JZBA 4BAGA 2JGMA 3DQZA 1E89A 3H1AA 5CW2A 5KWIA 2J3QA 1W75A 1H2YA 1XFDA 1YAHA 2XI4A 1CUEA 1EX9A 4LYEA 2PSEA 1QZ3A 4DNFA 1GKKA 1CUSA 2EDCA 4DGQA 2BUBA 4C88A 1ACJA 2PUJA 3DOHA 1LPOA 1R88A 2VT7A 5HKBA 4HAIA 2OCKA 3QBJA 1JKMA 1VA5A 1O6GA 1DWOA 4BCDA 2XUGA 4QLOA 1UOPA 3TRDA 2BGNA 3I2FA 1TKRA 3HI4A 1QIDA 4G9EA 4K6HA 1GPKA 1EB8A 4UPDA 1Y7IA 3C8HA 2DHCA 1F6WA 2WIKA 2PU7A 3ANTA 3FLEA 2WUEA 3AFIA 1HDEA 4WY8A 4YPVA 2B20A 2AJDA 3D2AA 1PJAA 3ZLVA 4GLBA 3QPCA 5C8XA 1XLVA 4FLEA 2VQ6A 4DMKA 1ISPA 3FYUB 2PX6A 4BRZA 4CCWA 2O7VA 2G5PA 1FFAA 1YAJA 3WWCA 1QIMA 2WU4A 1AC5A 3R3ZA 5FOQA 2ZYIA 5JANA 2ACEA 5DNVA 5K3FA 1BCSA 4I4CA 4UBOA 3STWA 2OCGA 5ESRA 2WG2A 1MT3A 3KSRA 2WTMA 2QJRA 5EHQA 5FRDA 4K6KA 3I2JA 1ODSA 4CG3A 4H7FA 2RIPA 3QMWA 2GBCA 4HRYA 1H2XA 2OAEA 2QXTA 1XRQA 3B12A 5ALWA 1UK9A 2JGLA 2H7CA 2GBFA 3P2MA 3IUNA 4YX9A 3C70A 1LZKA 5H3HA 4UBKA 3FYTA 3WQHA 2WFMA 5D3ZA 1CPYA 1EHYA 2OCIA 4KAFA 4OYLA 4KAAA 5JAOA 1ZI9A 2BKLA 2PUHA 3LLCA 4Y2YA 1SFRA 4P08A 2CB9A 1FFDA 5AI9A 1CUAA 1TCAA 2C7BA 4J0JA 5KREA 3JWEA 3WWDA 4ZGBA 3CN7A 1VZ3A 4UUQA 3W06A 4EY5A 3HABA 5C8ZA 3BL8A 5DNWA 4E46A 4C4XA 3WA7A 1CUDA 1WB6A 2VATA 2Z3WA 4AB1A 1EXWA 4QDZA 1GPNA 3H04A 4GBGA 3F98A 4G8DA 1ZJ4A 4KE7A 1IUNA 5AK3A 5K3CA 4ARAA 4GI1A 4P92A 1MU0A 1MX9A 1EDDA 1EINA 1PFQA 1LNSA 4EY4A 2B9VA 1QE3A 2OGSA 3WKDA 1QFSA 5AOCA 5ALKA 5AIBA 4X71A 1BN6A 1ODTC 3WYNA 4HZGA 4X97A 4UHEA 4Y2UA 3BDVA 4AZ3A 4BP8A 3M83A 1CQWA 1VXRA 1ETHA 2JGFA 5CH5A 4J7AA 4X85A 5FKJA 3HYSA 3I2HA 4X6XA 2DQYA 4JUIA 2H7YA 5FXMA 5IVKA 4B0PA 4ITVA 4L3WA 4HXEB 4H7HA 4ROTA 2YYSA 5HF9A 5AM3A 1JT2A 2YXPX 4U2CA 4PSCA 1TIBA 3AZPA 3I2IA 1BROA 5JD6A 5EHZA 4X6YA 3H2KA 5AKLA 1HKHA 5AI6A 1ZD2P 3WI7A 2ZSIA 5ALLA 2VSQA 1F0PA 2YH2A 2WILA 4TPKA 2WU3A 1T4MA 1AQLA 1G5FA 2UZ0A 2PU5A 2VF2A 2H9YA 1XQVA 4XX1A 3G0BA 3KOOA 4FFVA 4Y2XA 3OG9A 1J2EA 1TCBA 2LIPA 2B61A 3U0VA 5EHNA 3GA7A 5AKIA 5JALA 4X90A 4E14A 1K63A 4W1SA 4MYDA 1ZI8A 1FFBA 4E15A 1RP1A 1VKHA 2RHWA 3KWJA 2OQVA 4IH1A 3WWOA 2O2GA 3WYDA 2XQKA 4DLNA 4FBMA 3IURA 3H18A 1A88A 1E3QA 1QONA 3WK7A 2HFKA 3VJKA 1G66A 3STYA 1ORVA 4QDXA 3WMRA 4LHEA 4HRXA 1UWCA 1MJ5A 4JYMA 1EB9A 4X91A 3FOBA 4J0HA 4JEIA 5FPPA 4RNCA 3JYHA 4UBJA 3AIKA 1JJBA 3PFBA 4UFOA 3ZV7A 2DHDA 3ESDA 5I9IA 2HA2A 1X70A 1NU8A 4HVTA 4B7ZA 2QS9A 2JEZA 5DTJA 3F97A 3OPMA 1CLEA 1IUPA 2DCMA 3M3DA 3HXKA 1ZGCA 2XUJA 4AN0A 4GEGA 2BGRA 2I3ZA 2XB6A 1E5TA 1BU8A 1YS2X 4BCCA 3IUQA 2XMCA 1AKNA 1DQZA 3C8DA 4BRSA 1AURA 5ALGA 4J3JA 2XUHA 3K2IA 4N8EA 3G0CA 3TJMA 4OYYA 4MQMA 2XLBA 1R9MA 3C6BA 5AI5A 1DT5A 2ZYRA 1AX9A 3DNMA 4PV7A 4U2DA 4UFNA 4H35A 5JD5A 1S8OA 3ILSA 4A23A 3QH4A 1ZIYA 5LZ8A 1VZ2A 3AZOA 4HTAA 4G4GA 3CXUA 1H2ZA 3F67A 2JF0A 3PFCA 1JJFA 3MUNA 5EIAA 1LPBB 2JGIA 4UHBA 2Z3ZA 4RE5A 5SYMA 4OSEA 3E0XA 4KACA 3OURA 5KBYA 4B81A 2G63A 1LPNA 2OLEA 2HRRA 4AX4A 4H7JA 4Y2VA 3CN9A 1P0IA 2QKYA 4KAJA 4GDMA 5BWBA 3AUKA 3QYJA 4H0CA 3LP5A 1KEZA 2ACKA 3PE6A 3EQ8A 3WK5A 5IKXA 4BATA 1U2EA 4B9EA 2PBLA 1XQXA 4ZI5A 2QRUA 2VAVA 1IZ8A 3KDAA 1UZAA 3H0CA 1EH5A 4XJVA 1T2NA 1BEEA 2QTBA 5C81A 1AZWA 3M81A 4BC1A 5LZ5A 4GECA 4P93A 1RWQA 1OILA 4B6GA 5F4ZA 5LIPA
chains in the Genus database with same CATH superfamily
3AY3A 3JALB 2BZSA 2YINC 3LUGA 2NXNA 4XA8A 3VPAA 5A7FA 5I01A 2F2TA 1AT1A 1ISIA 1T2VA 1OBVA 2C84A 2IXAA 1KEEA 4YDSA 4DEYA 2GBGA 3PQDA 1ECLA 4ZPJA 4O5OA 3FRIA 3TGLA 2PR2A 4KN5A 2BEWA 2QMUA 1NY6A 4LGVA 3BHIA 2NGRA 1T5BA 3FNIA 3IA2A 4JMPA 3R0QA 4KW7A 3UK0A 1EWQA 3K8YA 3KXPA 2ZBGA 1R66A 4DZRA 1JSZA 3PB3A 1KBZA 1K0FA 1NPYA 3UMMA 1K08A 1UBTS 3JAKA 1P0FA 1PJLA 4D97A 1CUWA 1XJCA 1C41A 4KK4A 3U61B 4B35A 1QORA 3M6MD 1QO9A 4C0JA 4CMHA 2R7KA 1T2CA 3L6EA 4EVSA 3CT4A 3K6JA 1ZRNA 1JR3D 1K3TA 1MB4A 4M54A 1SXJD 2P7IA 3DPIA 1VJRA 1II8B 3U39A 4BFZA 5EJ7A 1RZRA 1X42A 3NJ4A 1T9KA 4TTIA 4NECA 1BXGA 3KVVA 2I62A 5FOSA 3RHTA 3WK4A 3ZU2A 4PR3A 4EY6A 4NENA 5L40A 3ZDDA 3A1VA 1NDHA 4I50F 3G8DA 2WVGA 1JU9A 2DFPA 5EUQB 4X3CA 4EHKA 2FW9A 5FF9A 3OM8A 1X1DA 4KR0A 5C32A 1XRLA 3RTDA 4R8SA 1CJSA 4M1EA 4Q9LA 4DWJA 3SHWA 4BNZA 3GZJA 4ZYWA 5K8CA 2A0WA 1JFRA 2VWQA 1SURA 3OX4A 4N7JA 3SC4A 4B8WA 2H4YA 3K2BA 4WNCA 3AU8A 2AR7A 2YWJA 2EYQA 3DTTA 3P96A 4DCTA 3SMVA 2N46A 3T5TA 2R6FA 3IMGA 3GA5A 3MWKA 3NFYA 1KQFA 5FNZA 2HBQA 1E9BA 1F60A 1GUBA 1FA9A 1JR3E 1N2IA 1ZVKA 2ERCA 1HDGO 2R6JA 2IDMA 3RR2A 3WB2A 1SXJE 1N0HA 5D7BA 5KQLA 1SG9A 1NW8A 1CT9A 3MCVA 2ZDGA 4EUNA 5BMVB 3EA0A 1UCFA 5AJZA 3V7FA 4IVRA 2ATCA 1AGYA 4YJHB 3R74A 1N2BA 1X7HA 2CUNA 4WMLA 4V0KA 4QRHA 3QQPA 1T43A 3GJ4A 5E1BA 4OI4A 5I5GA 1E64A 4XFKA 4YP0A 1AXEA 2QXUA 2J0EA 2F1JA 3DBRB 1N5LA 1X3LA 1THZA 4QWMA 1XTTA 2Q1XA 1M0SA 2RG1A 1ZVMA 3DFZA 4GP6A 2VP6A 3EIFA 4Q48A 3RAFC 3GDWA 1B0UA 1RI1A 3HBAA 3LL4A 4HH0A 4N01A 3GPCA 1AH2A 3A4NA 4B4WA 2DB3A 2AKAB 4KXXA 5I5EA 3KE8A 4Y1FA 2WAXA 2VH2A 3ONDA 3C3MA 3IEXA 3V34A 1FXWF 1A50B 1D6SA 2FSHA 5CBPB 1DADA 2BZ1A 3D4NA 2AEEA 1GU0A 1Q0ZA 2FPRA 3GAZA 1M6VA 1YRLA 2YY7A 1OOEA 3L05A 1ENPA 3P52A 3NWJA 1DIHA 1GOTA 1TPZA 3N6VA 2Z6UA 5BP7A 3AZQA 3K0SA 5LCXA 1QSGA 3R0VA 2F1HA 4OQZA 4R9UC 1Y9DA 4E07A 2H2HA 2JI7A 4DKXA 1I5OA 5DNUA 1O8BA 3H83A 3KQWA 1JJAA 4J03A 1CEEA 3WHKA 4M1YA 3AP2A 3QOYA 1L4KA 5LP6F 1WXWA 2I34A 2B6HA 2QM8A 2XRYA 4XGNA 4E0BA 2I8CA 3BE5A 1XZKA 3RNLA 1JEEA 3NNSA 3SXUA 4B47A 1PGJA 2IVFA 3O8QB 2EW1A 2XUKA 5KYVA 5KYXA 3AI7A 4U6SA 1MPTA 1Y5IA 2CL6X 7ABPA 1TYBE 2H00A 3CRMA 1ZRSA 1G3QA 4ME6A 3NBAA 3L3BA 1CDDA 1T3LA 4QECA 4R8KA 4RLQA 2QRLA 3E9RA 3PSAA 3EA5A 4Y9SA 3K9BA 2WLSA 1VL8A 3OQ6A 3I83A 4FFNA 5F76A 1VMKA 3T54A 1U28A 4FONA 3SQLA 2AK2A 4PQFA 2X5OA 3H3FA 4PYNA 4KXYA 3BORA 5EZQA 1R1DA 3BZWA 2IIPA 3TB4A 4H08A 3RG2A 3ZWVA 2ZYHA 4U7HA 1OTXA 2BHRA 4BHTA 4YRGA 2AGVA 3AOEA 5CNJA 4AN4A 5AKHA 3P2OA 3AESA 4P83A 2D1TA 3PRJA 3OPYA 4Q3AA 3SOZA 3Q2OA 1U0BB 1ZGAA 2P2LA 1VBMA 1DT3A 3NV7A 5HXAA 1EVZA 1ISGA 4U9UA 1E63A 1R4AA 3H1PA 1E99A 2YJ3A 3U6BA 3LS2A 3ADBA 2Z30A 4Z3DA 5BQXA 3CH5A 3ENNA 4LJ6A 2DHEA 2VF8A 3K7EA 4Y2PA 1VFNA 4M60A 2GXAA 5ABPA 1C7ZA 4B3RB 4NNOA 1SXJC 5CITA 5CDHA 2O3UA 1J0DA 1YRWA 3E9NA 3Q3GE 1JHOA 2E4VA 3FWKA 3D4LA 3JAWB 4YAOA 5IK2A 4U0JA 3C74A 1DNPA 4EGFA 3IUJA 4Y9DA 4M83A 2OYCA 3ZZUA 2UYGA 4EECA 5IXJA 3O2NA 3OJEA 3EZ9A 4FHZA 3PGLA 2BMEA 1M74A 3B9QA 2OO3A 2I2WA 3NAGA 3L2OB 3LRPA 3K6KA 4H0NA 5ALEA 3JQFC 5CURA 4ALLA 2HO4A 5B55A 1QH9A 3E2IA 3FVQA 3PCTA 2VAMA 4UE3S 2BJHA 2NX2A 3ABOB 2YVKA 4R3NA 3ZQKA 1A9ZA 3IBGA 4H9GA 3DE7X 1RJDA 4DQVA 5LKRA 2G9UA 3GT3A 1YIAA 3W8DA 2IV2X 3VVMA 4JN6B 3FNBA 4KLRA 3RBVA 3G1WA 5M34A 2NV0A 4P3OA 4IZIA 4MWCA 2DTEA 3VVCA 3GOHA 3AUTA 1I6WA 1V5EA 1LVGA 3BJRA 1KQ3A 4OAPA 1RIFA 1ZW1A 4WRRA 4DDTA 1W30A 3UAVA 4JMLA 5BSUA 4BO7A 4F8JA 3CBQA 4XQ0A 1KBOA 3YASA 1DEOA 4PGFA 3FPLA 1Z4MA 2CJWB 4F06A 1W9HA 4D02A 2ZUCA 3DOIA 1EVQA 4RHYA 3IAEA 4C4AA 3E8SA 4F92B 3UT5B 3KQKA 1Z7GA 2L0XA 5B58T 3OX2A 3FY4A 2ZIEA 2AI1A 4BFLA 4CLOA 4PZ0A 1HLPA 3A2MA 3H11B 4HRAA 4KIJA 1T0HB 1Y6QA 2YHAA 3EIHA 3LF2A 5F5XA 2REQA 5JVDA 4IPTA 3UJAA 3V7YA 1ZL0A 1TTHA 3RS2A 3E3OA 1LX6A 1G20B 3W1EA 3T1VA 4RZQA 1OUMA 4F5ZA 4UTNA 4O63O 2HKIA 3PQ8A 4QXOA 1S3GA 4P82A 3UHPA 1D1QA 4MEAA 1NBHA 2C83A 5TJHA 1IY2A 2Q1YA 2J45A 3FYUC 4B4DA 4QM6A 4ZU3A 2BHNA 4F5DA 1NVGA 1NVWQ 1RVV1 3BTSA 2NT3A 3G9XA 3PC2A 4KYTA 5TSDA 3OBIA 3VDQA 3W2TA 4NEHB 4R8RA 4U6QA 1DINA 2JEOA 3D6NB 2VOEA 2GD6A 5HHTA 4C2UA 3KOUA 1AVTA 2C2XA 2D7CA 2HCJB 4E2ZA 1A76A 5J4KA 1YRQA 3TLYA 5C7IO 4BO4A 2IWHA 2MSNA 1YQEA 4J3NA 3LXUX 4KGXA 3ZHOA 3EVTA 1Y4UA 3HACA 4FGSA 4I50A 1L7VC 2REOA 3SICE 5E38A 1MEJA 3MF4A 2RH8A 3PCRB 2ZJ2A 2EXXA 5JS2A 4EJSB 2F8SA 2PJUA 3T3GA 4HJXA 4MYHA 3QLJA 1AKRA 4RTMA 3Q87B 3WBFA 2HJHA 1ZBDA 3NUQA 4Z54A 3N7TA 3KEQA 1C3LA 3UAZA 4EB6B 1RADA 4IRMA 4ZXPA 1ULBA 1P77A 1Z5PA 3JW8A 3L1HA 1C1YA 4FS8A 4UTXA 4Q1BA 5LKAA 4GI5A 3I45A 2DT8A 3WOVA 3MMPA 1TYEB 4CL0A 4J0CA 4F3NA 1XVLA 1LPPA 1SQ6A 2E4AA 1ZUWA 2YX1A 3B48A 4DG8A 3QW2A 4JU8A 2GBLC 7YASA 4EHBA 1YZUA 2A5YB 3HA7A 4NZPA 4RIHA 2WAOA 3NBZC 1RHMA 4ZT6A 3S1LA 3BHMA 4IL5A 4C4YA 2V9CA 4CDGA 3EBOA 2LPMA 5JZSA 2VJBA 3E5HA 5DM60 5MFPA 1G3IA 2IHKA 1E58A 2CLIB 3NBQA 5KNDA 4IYRA 3JU3A 3B53X 2WKPA 5E3HA 4H16A 3KVOA 4EO7A 2VCHA 4TWAA 2FWIA 1TUBB 1JVNA 1YDFA 3G79A 2R7AA 3OZFA 1Z9BA 2CJPA 3QM1A 2IOHA 4LC1A 5HZKA 3P2JA 3ZWQA 1AK1A 1DRKA 2C98A 3KSBC 1XNRB 3CHYA 3RGWS 2J7PD 4K9QA 3ZCTA 4R1LA 3CUTA 2H1IA 1REQA 4V0OA 3WRWA 2X2EA 2VNJA 4DIDA 4BTVA 5J4LA 1XYGA 1N36B 3W3AD 3VDNB 2OP1A 1DMSA 4L5CA 7ADHA 4MP6A 1X1BA 1HNNA 2QL7A 1Y5NA 2MU1A 2DBZA 4HAWA 4Y30A 3WGOA 2Z8YM 1PX0A 3SSOA 5IKEA 4CFZA 2ZLBA 4XVUA 4D9KA 1QYRA 4K8RB 4H7IA 1HRKA 2WT4A 2E6KA 2FR1A 2A14A 2ZUDA 3NYWA 2Y0EA 2I78A 4UE6A 1KS2A 3G9UA 3RV4A 2ZI9A 1U2GA 4U2BA 1KIMA 1K75A 3N2GA 2CBGA 2IV3A 2AYYA 4U2EA 2CDAA 5FPHA 1E60A 1Z0JA 4A15A 3DYBA 2ATEA 4CG2A 3WWPA 1LA2A 1E92A 5DCLA 5K6TA 1JB1A 2J4CA 2RK3A 2X8WA 1QPZA 1RXEA 1Z06A 1R4NA 1ZGGA 3ODGA 3FOWA 3WO1A 3E8XA 4ENTA 2WD7A 3QUTA 5JFTA 1SCUB 3F6RA 2ZVQX 5LQAA 3ETGA 121PA 3QVLA 5K0NA 1W0JA 1K6EA 1B8UA 1GV0A 3NHUA 3QLVC 2PGJA 4U7PB 1WUYA 2F90A 3I3SR 3OZXA 4QOGA 1PYDA 1D2GA 1XVTA 1ISFA 1XNJA 4MHOA 1RBZA 1U8AA 3BCHA 1JDNA 2J4FA 2OP0A 1JR2A 3ANNA 3ZX5A 4BKRA 2ZRQA 3S5JA 3HDJA 3DVQX 5FX2A 2GYYA 4RPIA 1XMXA 2NVWA 2OMKA 2X8AA 3ZS8A 3ZIAD 3QJYA 2OLKA 5FI5A 1BKDR 3DOFA 3A4MA 4ML3A 4JB0A 5DULA 1VJ0A 3R0XA 2C7VA 4AMVA 2VP9A 1Q91A 2JJMA 3EZNA 1ZUNB 1RYEA 4ALNA 2EWVA 1R8XA 1M54A 2G82A 3ULKA 4R68A 2OHJA 1J2YA 4KMOA 4H7EA 3B6KA 4I5EA 3N2ZB 2I2DA 4B3HA 4U9IS 4WSOA 2FKAA 4G65A 1VLQA 5CPBA 3NOQA 4CIBA 4TKUA 4YT4A 4MGZR 3OEEA 2H48A 3BD8A 4IXWA 2V7PA 2YY5A 4OU4A 2GFQA 3DQQA 1FRZA 4HD8A 4RVDA 1LK0A 2X3YA 1S3FA 2PGOA 2WSYB 1OU0A 1TF7A 3OMXA 4ER6A 2COUA 3JQDA 1KZ7B 2EP7A 1V9CA 1QX4A 3GEEA 4PRYA 3W3AH 1AE1A 1ZAKA 3T52A 2XIJA 3QELB 3ILXA 3WLEA 4C4TA 2PRYA 4LXIA 4IBOA 5DHPA 1B73A 1JDZA 2I3BA 3IIMA 1XYYA 3WVNA 2IHTA 4F4JA 2C2KA 1ZN2A 2QI9F 3Q7IA 3CLKA 4MEBA 1E2IA 3VZCA 3PHIA 3WWYA 1BWRA 1XQ1A 2OHGA 2RH4A 4U02A 2O5EA 4JNCA 2BGTA 2IYNA 2XVYA 2VF5X 3NW9A 3QU5A 3OQJA 2HSEA 2ZRMA 3I01A 4OKNA 4PSAA 4R2MA 4ARZB 4C06A 4C4PA 5EHXA 1UPCA 4EOGA 1S3IA 4ER7A 2ALJA 1BQEA 4PY2A 1ANKA 3DBOB 1W35A 1ZFNA 4JJIA 3QVKA 4LXYA 5EJGA 4EGAA 2H1RA 3GLHE 5TLSA 1VDMA 2QYSA 5HQ3A 4FR2A 2VG8A 1AS0A 3O95A 1JXQA 3B3FA 3LT0A 3QENA 4JLOA 2C0CA 4YMWA 1CJKC 2QX6A 4UUAA 3D8BA 5HA5A 2I8AA 3ZHRA 4WASA 4S1WA 5CRIA 4DSZA 4WA8A 4DUPA 2V1XA 4KXWA 2X1VA 4MUFA 2JAXA 5EHIA 1TTPB 3OOHA 1N5DA 3LAWA 4CTKA 2WNIA 2MSWA 4KL8S 2IH4A 2WNHA 4LYJA 1IY9A 2B4YA 1UQUA 4UCQA 1F4VA 1JLKA 13PKA 1J00A 2EL9A 2FFQA 4I4IA 5ALUA 4ZAGA 4MV0A 1G6OA 4GLFA 4Q19A 1ZOLA 2FDXA 4R16A 3V9AA 4R83A 1TEVA 1HG0A 2BCGY 3CF2A 5BORA 1P2UA 1JLMA 1JMYA 3H7AA 3LPMA 4Q1AA 3TM4A 3KB1A 2ORIA 2OG1A 3DEKA 3LBHA 5IW8A 1FLDA 4Z8YA 4A6PA 2JJ1D 3SKYA 2P9FA 3BJIC 5KX5F 3K09A 1MW8X 4KWIA 2J9GA 2JIBA 4YYEA 4KH0A 3TXAA 3EGDB 1F38A 4O4JA 4G0ZA 4U9HS 5TJ9A 1IZ0A 4EYSA 4J90A 1EJ2A 3OPQA 4IGFA 1ZH4A 1PCXA 1Z08A 2IFTA 2WKWA 3FNFA 3S0JA 4DV7B 1CQIA 4I4TF 4PGHA 2ISCA 1WXHA 4BB0A 2IGTA 3VSEA 3CO5A 2PUAA 1GFIA 3QMVA 3WGVA 4FKZA 5KSZA 1I51A 5JYDA 2BJVA 4ZC8A 3DXYA 2F1IA 3DULA 4ITRC 1JYEA 4M98A 3LWNA 4S3MA 1ZJWA 1LUAA 3OX1A 1X14A 3GWGA 5CA1B 1GU1A 3U7EB 1Z7EA 3S1AB 2A5DA 1IM2A 1XMIA 1UQTA 2CXUA 5K8JB 5IJZA 1QFJA 1F9AA 2NYAA 2QT9A 5C37A 2I2BA 1FFGA 4EFLA 4IWNA 5IVPA 5FI3A 1NI5A 4P7FA 3H1EA 1HE2A 4LI0A 4NG5A 1N1EA 1EGVB 1YZFA 2ZJ3A 3KLMX 4FSHA 1FDVA 4OJMX 4RAQA 4JWKA 4QNMA 5EXTA 3SYKA 1GL9B 2ZR7A 3K0CC 5ECYA 3T4EA 4YRBA 5FV4A 3O8DA 1ZD1A 1A0OA 1OPRA 3DL7A 5IXYA 1EYZA 1I01A 2GZSA 2WSSD 3OIDA 4O59O 4WL0A 1RAIA 3VUFA 6NULA 3HNOA 3DZHA 5IHXA 2JGRA 3CPHA 1PSZA 1LU9A 2JG3A 3QZUA 4BVFA 4JP2A 1T1IA 4UBLA 4QOFA 5DX1A 2H2DA 3FVTA 2ZXUA 3FPCA 4OB6A 5CD9A 3TQTA 2OCAA 3M6FA 4HQRA 4WH0A 4HGQA 2HA7A 5CT6A 1E96A 1CEXA 1WTAA 3TTVA 3BMNB 3UF0A 2QJWA 1AA6A 2Y0PA 1QOQB 4HZUB 3MTJA 1JQ3A 1Z47A 5CLGA 3ZNPA 5IWAB 4KX3A 3V8BA 5BSEA 4HHEA 3CJTA 2YHSA 1K7XB 4JLWA 4B1FA 4HNQA 2AWNA 1PZXA 3OBBA 5AKXA 4MPPA 2QR2A 4N6NA 5JYEA 3TLMA 1TW2A 1NR1A 1UWLA 5DLPA 3KVRA 1JLSA 2EP5A 5G3ZA 4DVJA 2C2OA 1BA2A 3O03A 2WJHA 2Q2OA 1EUYA 4PRKA 4L6AA 1UODA 1VKRA 1YDEA 1ZCAA 2WMDA 5E4YA 1EDZA 2CVHA 3Q6NA 5CFQA 2R3SA 5J1SB 2DR3A 2G7ZA 1OBOA 2GT1A 4INZA 2Z04A 3ZE6A 5JSZB 5K3FB 2VZ8A 3SNKA 1UBJS 4NICA 5EKUA 2I3DA 3LUCA 2HSJA 3C24A 3P32A 4AN1A 3G2HA 1DWQA 4PYOA 1LTQA 2NO0A 3TE6A 5BPHA 4UD2A 2ZPUA 1A8SA 1A7KA 4HDRA 2BGIA 3LDGA 4RS4A 3KP1A 4IINA 1E2JA 2OY0A 2AFHE 3OT1A 3UWMA 1O6BA 1WSWA 2B0JA 2W6CX 4ZCIA 5E9QA 5K0GA 4XOIA 1X8XA 2ECQA 3NR2A 3O2JA 2J5RA 3IJRA 2MOKA 4OPMA 3PYXA 4EP1A 4YJFA 3REGA 4AK9A 2O05A 4EL5A 3KJQA 5KWVA 1AKEA 2O2HA 1H2FA 2B2XA 1ULHA 3LC7O 4F45A 2ERXA 4GC9A 5CDFE 1W4LA 4LDZA 3BXZA 3V3KA 3FNQA 4FMCF 4XJXA 2C4KA 1AKMA 4L51A 1NVVQ 2AXEA 1RRCA 1M34B 3BVPA 1UOEA 1V3VA 1NV9A 3DZIA 4EM6A 4DR3B 1GILA 2FXIA 1UIMA 1KAEA 3RC3A 2CMHA 2TMKA 3OJFA 4LDAA 4LJ8A 2CXPA 5SZHB 4CG1A 1LLDA 2GQ0A 5CAEB 5HMMA 1T8UA 3EK2A 1YD7A 3A36A 2A8YA 4F1KA 1HYGA 2WV7A 4U63A 3ROGA 2VQDA 5BXQC 2NU8B 2VSYA 3SY8A 4ZOLF 1Q7EA 3BRQA 4NU6A 4C6RA 2XLCA 3QKWA 1IMJA 4P33A 5DHFA 4L8VA 3T1TA 1XMOB 3KETA 4WLVA 4KQGA 4YHHB 5ALQA 1WHSB 4KX5A 4GE3A 2YJGA 4FT4A 2QTLA 2XTNA 2VDWA 2QD2A 4JJFA 2ZVDA 5EJ8A 1QAMA 2NN3C 2I22A 1N4DA 1ZCZA 3PGKA 4A5SA 2XDYA 2HV8A 3W79A 1ZM7A 3CMCO 1XELA 1U9JA 5FL7A 5DNCA 2Q4OA 2Q21A 1G8YA 1LQTA 3LU1A 3FDJA 2WUWE 4KDCA 3RVMA 1PR0A 3WNQA 2GM9A 2XV1A 3F47A 2GN4A 4G5OA 2VT6A 4FW8A 4KNWA 1JN0A 1Z7WA 1ZGZA 1V5WA 4D9EA 2EGUA 8LDHA 1KYIA 5IDVA 4KRXA 1OY1A 1OX5A 3D8SA 1WDKA 4DFDA 1RJWA 2BJWA 2PEYA 3N5KA 2BT4A 5LBUA 5AVWA 4G9GA 2O0HA 2IRWA 2NU6A 2CN1A 1H2AS 4HNSA 4ND6A 4AG3A 3M82A 1AKVA 5DGHA 4JR2A 5TPZA 1SK9A 3SBEA 2A78A 3G8YA 4ANFA 3D9QX 3RS4A 2HHLA 5IFLA 1AMNA 5I4CA 4NMMA 1KHTA 3LVFO 3T4UA 3DR5A 1LEHA 6AT1A 2ZI6A 5E0OA 2WJPA 3LC2O 4I8IA 1K86A 4DNOA 1NN0A 2H3EA 3HY3A 4NATA 4F9TA 1X9IA 2QRHA 2YXNA 3VPFA 3QPVA 3ND5A 4DZTA 3L41A 2XOEA 3FHLA 4FDTA 3ZHCA 1IJEA 2I2AA 2DY1A 5AJHA 4MYTA 3NH9A 1UAGA 4BVAA 3LLMA 3T7DA 3A3KA 4BLRA 4Q9NA 3PPWA 1V4NA 5C31A 2QUZA 4AJKA 4ENRA 4JLUA 3C1TA 2HEIA 3UBMA 2OPHA 3HRKA 1OWNA 4NE7A 1ZOIA 3EGXB 1MR3F 4RZUA 1N8NA 4MPDA 4F12A 4TLEA 2JGNA 2PH3A 5JAPA 1LW7A 3GEBA 3GH1A 2B8TA 3II6X 4GP7A 3HB1A 4IIUA 4ZJZA 4B2LA 1OXSC 1CJVC 2NO4A 3HWWA 5DNDA 2IYUA 4C0KA 3CB4A 4TQGA 3D6UA 1QP7A 3W2HA 4ARBA 5HZMA 1MC5A 3BIFA 3WADA 4W7SA 2PDAA 4BYMA 1LZLA 4N3NA 5KX5A 2P2DA 1BVUA 1V7PC 4RGBA 2XT0A 4H1TA 3TECE 1HEIA 4XSHA 4ZQGA 4U2GA 1T0UA 2HGZA 3U48A 3DBLA 1KI6B 1N5RA 3CZ9A 3Q5EA 3TSCA 5MDHA 4MW7A 2ROQA 3RKSA 4I4TA 2FPGA 2FP4B 4RA9A 3TUIC 3U80A 2PWYA 2JPDA 1KRXA 3P9IA 3L92A 3CURA 3KBOA 3PR2B 3H97A 3IHLA 3NMUF 3GUVA 2O1SA 2VT3A 2Q7OE 4M8NE 4MWDA 2D1RA 4H3KB 3ROPA 1ZEMA 3TZBA 2CLSA 3ORHA 2IIBA 3STVA 2QU8A 1T25A 1U9IA 5AK5A 3EPRA 2C1XA 3GH3A 5TGTA 4UTRA 4AS2A 2RBGA 1BXZA 1GU7A 4IG9A 2XXAA 3IAFA 4TYPA 1KJ9A 2JJYA 4ZN6A 3EWNA 4CMAA 2P2YA 3HC7A 5E95A 4QQRA 1H0RA 2G9NA 4NCKA 4US1R 1Y8RA 3HXTA 4AZ0A 2QSUA 5F73A 3WK8A 3OZEA 2P9QA 3JQPA 4RVNA 5A6VA 4PYIA 4OXXA 4R1PA 1ESDA 2Q49A 3KHUA 1V1JA 1WV1A 5F2OA 3COPA 4BNXA 4QO7A 5JXIA 1LPAB 3INYA 1U90A 1RMYA 4Z1OA 3RSOA 1GCOA 2Q6OA 3BREA 3EUFA 3FDZA 3L4EA 3W9UA 1SUSA 2NUPA 1KVRA 4GKVA 1V6SA 1E3WA 1WLSA 3ZN2A 2QVXX 2HJGA 3WLAA 3VDXA 3EQ9A 1A9OA 2X0EA 2R48A 1NKSA 1TK3A 3QUQA 1PDWA 2GNOA 1ONBA 4TXLA 4MVJG 5L3VA 4OYRA 1QKKA 3I53A 1RXVA 4LQDA 5JQWA 2BFOA 3H65A 1XLWA 3QHQA 4HAYA 5CIQA 3ZDYB 3HJHA 1G3MA 3D43A 2O1WA 2Q6IA 3DMRA 4M9QA 1DPGA 2O1XA 4BNLA 4CM1A 4KIFA 5IEJA 4G1BA 3C14C 1FP7A 4G36A 3M6UA 1QIHA 3MVEA 4J16A 4OHPA 4QUKA 1MEOA 1LVHA 5KVVA 4E3WA 5IN5A 5CEFA 3UJNA 1N0IA 4GYJA 3V4ZA 3EH2A 1HLGA 4M8SA 4MZXA 3T9FA 3ERCA 1YDMA 4YMSA 2WABA 2UZ4A 1AKQA 1T0JB 1X39A 5EC8A 2CXHA 1I13A 3ETHA 1BYUA 3DGEC 2CUTA 5T4FA 3DJFA 1TECE 3NANA 3S70A 3KOWA 4N3AA 1FP1D 4QTYA 1T4BA 3AYXB 3PWSA 3N9IA 1P4JA 4K28A 3A9RA 2NZYA 2VUTA 4FS3A 5ALXA 1QGDA 2EYUA 4ENUA 5BWCA 3ZVNA 4QUAA 5DWDA 4CV2A 2ONKA 5B1IA 3O94A 2QN1A 3CF4G 4DPKA 5JAMA 4RKEA 2PSFA 4RZXA 2IT1A 3EEBA 4HC4A 4JBHA 3B2NA 3RC9A 3WJ2A 1TZBA 4QVIA 1C1DA 1DLJA 4ND8B 4A82A 1DQRA 2P78A 2UVPA 1PR4A 2ARKA 2WWFA 1VBKA 1Q15A 2KMLA 4NMWA 4URXR 3M3PA 4FOOA 5EEGA 4H6XA 5T4BA 1PR6A 4D44A 4YJ3A 5JASA 1V39A 4H77A 1P1KA 5H9WA 3EIWA 3H19A 3O4JA 4MDEA 5EJEA 3W5SA 2CMFA 3QJ5A 4PIMA 3HKEA 3IIKA 3ET4A 2ZSBA 1ZG3A 5E3JA 3DT6A 1RWKA 3HJUA 4IR7A 2JI6A 4WI1A 2WAAA 1JMVA 5AUQA 3SMQA 3E1KA 3V1KA 2FF5A 3VV3A 2BKEA 3W05A 3OHSX 5F51A 3ZVKA 4ETNA 3P9ZA 1GAXA 2QOEA 4W7HA 5GZ3A 1MBZA 4OD0A 2LXNA 2R1TA 4MPTA 4ZOLA 4G4SO 2LW7A 4MRPA 1W8DA 1NX6A 2PYIA 1P45A 3E53A 1D2EA 1JRLA 3PQ5A 3QUBA 1THGA 3NX4A 3OU6A 1ZWLA 3FPGA 1T9HA 1BIFA 1S9HA 3ZXYA 1SBIA 2BHLA 3PFFA 2UYCA 2WKRA 3CVOA 3IVRA 4PCAA 4P4NA 1Q2XA 3DO5A 1RQPA 4K03A 2VHYA 3V1MA 4RY0A 3WLJA 4HDMB 3GRVA 2HU8A 1U3VA 4AU1A 3RTBA 2JGDA 2QTMA 1ATZA 4B6EA 1I2BA 4YUAA 2YJZA 4MV7A 4LWZA 1UBFA 3CX4A 1TLTA 4AQ7A 3Q7QA 3E9CA 3RTGA 4CLRA 1WF3A 1GT6A 3PEFA 4OKIA 4NU5A 1M8GA 2G1AA 1PW5A 3M4YA 2P3QA 3TIXB 1BFDA 1Y3BE 5CDTA 5LNK6 5EVCA 4BASA 3EZLA 1AO3A 2OUIA 1Z88A 3PFNA 2YIDA 2YWRA 5EPUA 1QQ7A 1U7ZA 3PR1A 3DVAB 2AB0A 3V00A 2Q1WA 1DAOA 1XRMA 2IVZA 4RTRA 1EWYA 1VP3A 1E9RA 1UBSB 2CCGA 2PFSA 2AS0A 5A3VA 1QOPB 4TQ9A 5FYDA 4DVGA 3LBNA 3ELBA 3IS3A 4FOPA 2SBTA 4S1TA 5GZ6A 4ZIRB 2I4NA 8ADHA 4GR9A 3TZ6A 4R69A 3UXYA 5IABA 1BD4A 1EUDB 3OJXA 1OW3B 4MS1A 4XSGA 4H7PA 2P2GA 1VIMA 5IT9A 1Z2NX 4I4LA 5DASA 4N5IX 4I81A 1QIKA 3KKPA 1EGMB 1A9TA 3K1ZA 1GQQA 6REQB 1RZ3A 1JMKC 2GARA 4PZZA 2JLZA 5EJ4A 2UYOA 2JFFA 1WKCA 1JEQB 1BVRA 2VYVD 3BXEA 3NUZA 3OQHA 5JWHA 3SQMA 1N8SA 3JTMA 3L4SO 3SNHA 4NF2A 2WIFA 4L28A 4NX2A 4NABA 5BUCA 1WEKA 2ZB2A 3GJ7A 4HGYA 1KMNA 4K9NA 4GXRA 2QIOA 2QMYA 4KBFA 4Z6KA 4KLAA 2WDPA 2OO7A 4UNPA 5ERGB 4LWOA 4EW6A 2WJ4A 2B92A 3LLVA 4W5OA 3C3AA 3GLIE 1RYNA 3UMSA 4HEA1 3X1WA 3ZZ1A 1IB6A 1OCEA 1U7DA 3W5BA 1OH6A 2HPVA 4JYZA 3R77A 4N7BA 4JJ7A 5KYUB 1TD9A 4JH0A 5DMXA 1YQTA 3OOWA 4KPYA 3LY8A 3LGXA 4HLCA 3KZXA 5EFZA 3AW8A 4Q47A 2YCBA 1ODKA 2HZ7A 5CTAA 1GG5A 3ZQJA 1QVAA 3CNNA 4LE1A 4BN4A 4LVNA 1IPFA 1E4YA 1DI0A 4MQ4A 5CXSA 1ZHOA 1YJCA 2CNWA 4G5SA 4YQYA 3TMKA 4HVLA 4JQZA 3FE2A 4JUCA 4D92A 1WDTA 3X1JA 3NWBA 3FCSB 3GDGA 1H69A 2OCLA 4QA9A 4X7RA 5DLYA 3T7KA 4AAYA 1E61A 3SYRA 1VYVA 3QE4A 1XEAA 4B34A 4YP1A 5A5VA 3IVMA 5A2QA 2ZG6A 4EPYA 2FI1A 3FG9A 1X19A 1XZJA 3K2QA 4CMCA 2HF8A 1WDLA 2BGUA 2PWAA 3HCEA 4MUXA 2IYRA 2CL7X 1LF0A 3TXXA 1T10A 5E6RA 4RZHA 3OOEA 2R6HA 1C7EA 4YRPA 2GTPA 4YAFA 2ZIAA 2Y2VA 1E2PA 3EDYA 2K7FA 1JILA 4MKHA 4X5OA 4CMJA 1D0VA 3USES 1XTVA 3PPXA 1E6CA 3C6YA 3MSXA 2QP4A 1GZVA 4DCJA 3P9PA 4S35A 2FX2A 1L4FA 2J5KA 1KE1A 4PANA 4HN2A 2BIFA 1E2HA 2OL4A 1MHTA 3UMRA 2DFVA 2CLKB 2ZT8A 4WFKA 5THKA 1FL9A 1NXQA 2O2JA 4DIOA 3IR6A 4X6LA 2G7MC 5ICFA 1MOPA 3MTQA 4JP8A 5FBWB 3T0IA 3NBFA 3LP6A 3EWIA 5DFAA 4Q7LA 1KAMA 4HAUA 4R8VA 2HTEA 4WN9B 4CT0A 1F48A 5REQA 4DQDA 1J5XA 3L04A 1D5CA 2V65A 4HVCA 5KQMA 1TC2A 3JVEA 3M6AA 5C3UA 2DQSA 1J5EB 5FI0B 5LU9A 3N53A 1EU1A 5ADWA 1H94A 2ZZNA 4CJXA 3Q3HA 3RIXA 5ALMA 2DXIA 3P26A 2P2NA 2RGDA 1H0HA 3IP1A 3Q3VA 5LZ7A 1RWBA 2YXDA 2IS6A 4CF5A 1YRBA 4CWAA 2FZLA 5A4KA 2YJTD 2Y4NA 1X2BA 1V0JA 4D9MA 2GD1O 3NG1A 4KIWA 3NAMA 4DB4A 1ZEJA 1YFKA 2HU7A 3QWHA 4G1MB 1C0PA 2JZOA 4R9NA 5ENVA 4TRRA 1CYDA 2DCUA 1Q1QA 1UKCA 1Z29A 1N6RA 2WM2A 4OQEA 2EC5A 5DN6A 3DV2A 1KZ9A 2PM8A 2X5KO 3WRXA 2JVKA 3OETA 4OAOA 3GCDA 5L3RA 5TT1A 1N1GA 3RSFA 3KAQA 3TINA 1BFUA 1U1CA 5KTMA 4LFAB 5JAUA 1TX4B 2ZE8A 5AJYA 3TYXA 2FOIA 5KQSA 3SFTA 5G0WA 5TC4A 5A5GA 3A1NA 4YAGA 1ADYA 1GPLA 1Q44A 3QITA 3SQWA 2VZ9A 1XTRA 3DEZA 4B6SA 1JV2B 1QDUA 1QO7A 1AS2A 2BI7A 2EFHB 2PKQO 3LKDA 4JJ4A 4QDKA 2WFLA 3MQ4A 1Z4IA 3HUFA 4MQEA 3SE7A 2PWBA 1H3EA 3EMVA 5GIOE 4NC9A 3Q98A 4NXMB 3L9WA 3M6LA 4FFBB 4ZVOA 3SYMA 1JZQA 2OMEA 4LHSA 4Y7DA 2VPXA 4W5RA 3P9CA 5LWQA 4O2AB 2PD3A 2X0FA 2J87A 4FNGA 3ZVMA 1H2BA 3PUKA 1E7MA 1PUXA 2HIGA 5DW0A 2WHEA 1YQ9A 2K2WA 5FI1B 2E1PA 1O89A 3RYFB 4M1QA 2ZZMA 3SX4A 3E61A 4RZSA 1N5OX 2NV2B 3VR6A 3S7TA 5I3ZA 4DJTA 5E7QA 5JNSA 1NUAA 5BNIA 1R6TA 4DJJA 3LOPA 1UP4A 2OQRA 2CZQA 3KJHA 4OMUA 3VNSA 3WNDA 2I9KA 4QFMA 3IAM1 2GAJA 4PO9A 4EO4A 3PI6A 4DSAA 5JISA 1SXHA 4YRFA 4AWAA 2R66A 2OGUA 1NW9B 1XVUA 1XV5A 2VUSA 4OFZA 5KMGA 2B35A 2Q4EA 3O1HB 4CODB 3AETB 3CEPB 4EPXA 3PUIA 2JGKA 4P2BA 5G4KB 5AW2A 1GSHA 2H0AA 5AW9A 4I55F 3STXA 1S2LA 1CQJB 1DUSA 1SG0A 4ZYVA 5EJ5A 1QHHA 1ESZA 1ULTA 3UB3A 3WSTA 4C5BA 4DRXB 3T3MB 2I6GA 2IDKA 3O8LA 3AGQA 3UT6A 4E7OA 3KL2A 3C3PA 5CYGA 4HEJA 4BFYA 3RVRA 1V48A 4ZU1X 4WBNA 1KEEB 1QP8A 4MKXA 1J2RA 1Q6YA 1W9MA 3KR9A 3N0RA 2A9OA 3SZRA 1PGOA 4NOJA 3HJNA 5JMWA 2BEWB 3HVKA 4DQXA 3MOGA 1UPBA 4FQ8A 5EUBA 3H5LA 4ZANA 2RKWA 4CQNA 1G8SA 1V35A 3MJEA 2W11A 3NDBB 4R8LA 1DOZA 1E1QA 2FSFA 5J59A 1CVRA 2FK8A 3OUUA 1L5LA 3ZK7A 4EARA 2ZAYA 5C1PA 3RV3A 1FDUA 3DE3X 4Q4JA 2APJA 3E2PA 3HCDA 3HU2A 2GCOA 3VZRA 5B3KA 1XK6A 3AL0C 2HSZA 4OV6B 2V7BA 2H11A 1BE8A 3C39A 1PYOA 4Q03A 5BO5A 1K9VF 4BLSA 4CM4A 2HA3A 1U7PA 1KJQA 2H31A 5SY4A 3VH3A 5HJ5A 3U44A 1WV0A 4I9GA 3GGOA 4AYTA 4DY4A 1BXGB 1O77A 4KXVA 3RSGA 2RH5A 3PHGA 3RGGA 1QVZA 4NENB 4AMYA 4A73A 1LB1B 5K3DA 4O02B 3N2YA 4I9FA 1P0PA 1KYWA 2IZ0A 4XQEA 4EHNA 3VHRA 3I09A 1DRJA 1GZ4A 3DP7A 3PU6A 4Q02A 2ANBA 3S8MA 4RJLA 4YAJA 3X1DA 3UUEA 2Z8ZA 5FFFA 5JLAA 4DIFA 5H4GA 1CUCA 4HQ0A 4C7MA 3DNPA 3K9CA 4C3UA 3B38A 1CY2A 4KU4A 1AV7A 3IV6A 4BV2A 2IPXA 5L7TA 3HCRA 2CKDA 2I87A 4LZOA 5IK2D 2A9FA 1ULAA 2HJVA 4LWQA 1XDBA 3SHFA 1Z0IA 3A3OA 1K7YA 2QNRA 2AA3A 3N28A 1CX9B 2IXFA 3OCYA 3HJBA 1IFXA 1OTYA 3DLAA 1FS6A 4TZKA 5KTKA 2HEGA 2QMZA 1XOIA 4KE8A 5AVRA 3NEYA 4R5HA 2W22A 2PK3A 1LQ2A 5JYCA 3LVQE 1BXRB 3GLFB 1XVIA 2A33A 3E3AA 1G16A 1ZH8A 2GF0A 2GYWA 3D8TA 3OSZA 1FFHA 4RJJA 3KKZA 4URUR 1AOXA 2X22A 2BM9A 3P27A 1GQRA 1TMGE 4RKYA 3KKKA 4KWCA 1XWWA 3BCSA 5IT5A 4E15A 3HVRA 1ZIXA 3ZYZA 1TTTA 4D1YA 1C7IA 2QYHA 3F4KA 1M1YB 1TIKA 2XDWA 5H7XA 5IC5A 1A96A 3FUWA 4BP9A 2IA5A 4HLNA 2JASA 3MZ0A 4MA4A 1Y37A 2Q3FA 2VDLB 2HCRA 2MYTA 2XMDA 2PVPA 2MWMA 1XMSA 2XUFA 4QQ8A 1GAJA 2PUCA 1WD7A 4X3OA 3O9MA 3OH8A 5FORA 3OOSA 4GX2A 1PNQA 1SKQA 2DWPA 3SFVA 3SJUA 2V97A 4D8VA 5EQFA 5CM2Z 2WYWA 1M6VB 2HGSA 3N39C 1Q17A 2EZTA 4C2BA 4G85A 4ZC1A 2Q5QA 1F3LA 2QGNA 4UDNA 4LXHA 1N6LA 3QVXA 1GXSA 2YASA 4INAA 4NQRA 4RWZA 4HGNA 2AEMA 2O6HA 1LK7A 1U63A 3PUHA 4DJAA 1K5DA 2GN0A 4QSMA 4KRYA 5JG7A 2CFRA 3ZUGA 2GZ2A 1HDYA 5AW8A 1A2KC 1UDBA 3OUTA 4QREA 3VPSA 4LVCA 3HI6A 3KJGA 4L5JA 1ESNA 5D86A 3V8VA 5AHXA 5KYXB 3O3MB 3FTNA 4BZPA 5JXWA 2F43A 2E55A 2B7LA 4WCFC 3IJEB 3G5MA 1LCIA 2FZGA 4OTZA 1B2LA 1EK2A 2G71A 1TNDA 4TKLA 4K5QA 2F9FA 3DF9A 1QRDA 2YOHA 2Q45A 2HU5A 3K8ZA 2EZUA 5FAXA 1NJSA 1LS6A 1JFVA 2ZJ0A 4HNUA 3ST7A 3EG9B 3V2GA 4ZTUB 2XGJA 1SPBS 4UOEA 4TSFA 1C7QA 2JEYA 1TLLA 3PDCA 2PX5A 1FVXA 4KIUA 5HKLA 5ITSA 2AHRA 3AESB 3HWSA 4Y1GA 4WINA 2RJOA 3OPYB 1TIPA 4Z7JA 3VKVA 3IKTA 3ZHXA 1G7RA 1JIIA 1JEYA 4BJ6A 5JZ9A 1XQ9A 1QO0D 1C4XA 1SOMA 3REOA 1SCNE 2IEGA 2ZSAA 2F4VB 3O8RA 1RHKA 2B69A 4NFYA 1H9AA 1KK2A 3PXXA 4LTDA 1FUYB 1GZ6A 2A67A 1M0EA 2H7XA 1AK2A 1IWBB 1QMPA 1O58A 1U8FO 2E48A 3UJCA 4Z9YA 2DY0A 2MCFA 4E5KA 4EK9A 3L0YA 1CRQA 2R00A 3KDSE 2OM6A 3ZCPA 3LLUA 1ESMA 1HSOA 1VSUA 3GDHA 5IEBA 3SF8A 4HX5A 3DB1A 4UVEA 2HMUA 4EIWA 4LJKA 1NY5A 4BUJA 2JKZA 4ZQEA 1GEEA 2RI6A 3JVDA 1P1JA 4RLFA 4LQLA 1MIHA 3RABA 2ZANA 4KR9A 3QHAA 5AVUA 1A8QA 2PY6A 4N6OA 5BQOA 2BBOA 2XYPA 2OFFA 2PRIA 2I6TA 2ORWA 1FCJA 3ANLA 3E7XA 3IPAA 4GXNA 2F17A 4LF8B 4PONA 1IK6A 5LYJA 2ZWVA 3EDOA 4PIVA 5EVJA 1L4GA 5EIEA 4PLHA 2ZWMA 3IQFA 3IUYA 3Q41A 4J76A 5D6NA 1TAHA 1VIDA 1KOGA 2VA9A 3OHPA 3FOFC 2D13A 3E1GA 4LBWA 4C05A 2C7OA 5K4GA 4CN9A 4MW9A 3X0DA 4K0KB 3A37A 3IAAA 1TEZA 2R6R1 3BFXA 1NG9A 2FKNA 2WD9A 1L4EA 4OQQA 2FN9A 4CR8A 2G1KA 5FPKA 3FAZA 1EFRD 1YDGA 3GEHA 2EBFX 3MG9A 5LWHA 3E35A 3IBYA 2XOKA 1QCYA 3PQ4A 4XM1A 2WB2A 1NHGA 1GTVA 1HE4A 3ZZNA 3L9XA 4MVJD 1G291 4KQKA 2PMEA 4ZT3A 5L7YA 3THRA 4M9ZA 2AMLA 1W93A 4I55A 2IXTA 5H68A 5KQRA 3WICA 3L8FA 2QLFA 4GZ6A 2HA6A 4EGJA 3S2YA 4W4TA 1YUNA 3QBEA 4DJDC 4OQDA 3AB3A 1VL2A 1P0MA 4CLOB 1N5JA 1B6GA 1KY2A 2O4CA 3P0RA 1Z5GA 1WPRA 3QXXA 4OL9A 3EPJA 3DMNA 1VPLA 5GOTA 5JVDB 3DBIA 3OU7A 4FYIA 4CCYA 5IVIA 4PCLA 4P54A 4GOKA 3A9CA 3N86A 2Q62A 1G0NA 2NM0A 3FNGA 3SVTA 3DQZA 1EVLA 1E89A 1KARA 2DH6A 1BHO1 4CV1A 3IIEA 1PTKA 2BKXA 4KXNA 4R1TA 3NHYA 1T9BA 1H2YA 4JB3A 3DDNA 4YRMA 4P4TA 2QMOA 2RHLA 2YVUA 3T15A 1Y5RA 1YAHA 4L15A 4RF3A 3S29A 1I5EA 1FMJA 3JZIA 4QX6A 4D3FA 2OCDA 3LGSA 3M34A 3MS2A 5JQGF 3EJ6A 3JZAA 3DC7A 1TL7C 1UDAA 4KI7A 4MVJE 5I4KA 1PWZA 3IT2A 4V1CI 4MLDA 3WGHA 1TYZA 4DNFA 1JXAA 3SBOA 1A5TA 2EDCA 2GEKA 3AJRA 5H8WA 1BSVA 5FUYA 2CZCA 3D6HA 1HUQA 1WNFA 1MABA 1PTJA 1BMTA 2ODQA 3ILYA 4GMGA 1E2BA 2PZAA 1H4TA 3CH7A 1QG2A 2IU4A 4KO3S 3CONA 3GF4A 5EWMA 4QBTA 5BN4A 2RKBA 2JHCA 4FGZA 5T6MA 4A1FA 4QTZA 3UWPA 4BO6A 4DCMA 3T99A 2PUJA 4I5GA 4MYCA 1NFQA 2DFKB 4LZNA 4PZ9A 5J63A 1ZXLA 5JUWA 4X65B 1WTCA 1ISHA 1U28C 3BB4A 2OWDA 3GRFA 3NDRA 4XYMA 5HKBA 3CW9A 5WRFA 2I3AA 1IBSA 3JD4A 3ROMA 5LPNA 1S96A 3TUZC 1WEHA 2HIAA 3LG2A 4AJNA 3NHJA 2X14A 1VA5A 3LRTA 2HO5A 2PGLA 1DWOA 1WMFA 3MWLA 4MCJA 3HVJA 1YJ5A 2AJTA 2JD2A 1PDVA 5FTLA 3RI3A 5JTUA 3THWA 2ENWA 2W6IA 3BFVA 3B1VA 4BO9A 4US0R 1X0VA 4E6EA 2I65A 4ZZ3A 5D2CA 3RSLA 4IDAA 2F59A 3KSMA 2YNMA 5CJPA 3HDYA 1N78A 5G1NA 1J0EA 3BS4A 2XKJE 3WLIA 3LO8A 2QTGA 4YUXA 5JI2E 2FAXA 4UULA 4FJ0A 4DDVA 4DC9A 1G98A 2FWJA 2WIKA 2WVJA 4WA7A 5IYZF 1IVNA 3BX1A 621PA 2PU7A 3FLEA 4WZAA 5JTTA 2QRVA 1EIWA 1VG0B 3KQSA 5AYVA 1HDEA 1HXHA 4PHGA 2B20A 2AJDA 3JWHA 4XQCA 1REQB 5CCXA 3GPDG 3H8JA 3RUIA 3NTVA 3MPOA 4RV9A 1H85A 1E9SA 3TBFA 5K4HA 5TNXA 2O3SA 3DDOA 1KFCB 3FI0A 4PGMA 2YICA 4EG6A 2AUTA 1KY4A 4URWR 4XDYA 5FBRB 1RAFA 3JV7A 2HQRA 1DXYA 5KWEA 1EZ1A 2RHOA 1ISPA 2VDMB 1X1SA 4LZJA 5EHGA 3TWOA 4DCCA 2PX6A 4BRZA 3ADPA 2NO1A 3E6AA 2B8JA 2G5PA 3B6IA 2CLDX 2X9GA 5AQEA 1YAJA 5ES3A 4IFEA 4W6QA 2E5WA 4UAVA 5E1OA 4ZHQA 4MB0A 3MTAA 2ZVPX 1QIMA 2KPOA 3O90A 4XVHA 3GUHA 4JC5A 3T9CA 4CM3A 4FYJA 1AC5A 3T06B 2DULA 2RJNA 3A6JA 3OTIA 5FOQA 1O5OA 2J33A 4G37A 4PLGA 2W71A 1R4NB 4S12A 2PA3A 3PLRA 3BN3A 4IEFB 3BQNB 2W2KA 2AC7A 4YJ2A 1PJ8A 1BCSA 1G38A 2VTBB 3MOIA 4I4CA 3HBMA 3UICA 2OCGA 4MLCA 5D3MA 2YL2A 4CHGA 4CF6A 4HB2A 1D2NA 4YDQA 1W0KD 3UXHA 1V1RA 4HUQA 5FRDA 4GH5A 1A69A 1ONOA 3E8MA 2QE7D 3CLRD 3NS7A 4NK4A 1FUEA 2FUG1 4HO1X 4TL9A 1E6KA 4TQAA 5LB2A 2EJBA 1ODSA 4CG3A 2BC9A 3P2YA 2WF6A 2ZIZA 4TWRA 3QMWA 1BC5A 2J0SA 2PZLA 4HRYA 3WXBA 4M0LA 1WVMA 3TN7A 4CDMA 4OP2A 4IDQA 1Y7LA 4KQFA 3CKLA 3NAQA 2GR9A 4R81A 1PFVA 3HN2A 4KUGA 1AGPA 5JBIA 1NW7A 4NZYA 1S01A 5J2TF 3UOWA 4BMZA 2GBFA 5KSOA 1U1DA 3DMFA 1N7IA 3M2PA 4JR1A 3IUNA 5AT1A 2P2SA 4QUDA 5DNAA 2DTDA 1B76A 4HB3A 4Q24A 2R62A 4ZI3A 4TKUB 2FCAA 2ID9A 1OLOA 4DLKA 1E3MA 2Z98A 5D3ZA 2ONJA 3W0LB 4QAQA 4X1YA 5B7PA 1EESA 2IWRA 2OHOA 3A6DA 4RIEA 3LT2A 4OXIA 4ZT2A 1Y9JA 1CPYA 3Q10A 4KP7A 4KAFA 4V39A 3NT4A 2VCYA 5J47A 1PT5A 4BMNA 2LCQA 1IZYA 2IYYA 2X3FA 3MWEA 4HQ6A 5A5FA 1L4YA 4JY7A 5BUZA 4MRVA 3U7RA 1JNXX 4YS6A 3V4VB 1T36A 5JWRA 4KLCA 4NV0A 4WNAA 5JSKA 1MVOA 4I1IA 1VRWA 2R8ZA 5DYGA 3V1TC 3P9YA 3DXFA 2Q2QA 3UJ3X 1HYQA 1KIAA 1K7FB 4LE0A 2B5OA 3NJ8A 2Z6VA 4OHYA 1HZJA 3KK0A 3NKLA 4DEXA 3TVYA 3L7NA 3QLUC 3GLGB 1GAQA 1CUAA 3UUWA 2BKAA 4RADA 4JI5B 5LSAA 5A02A 4HGRA 4RFLA 2C7BA 3BB3A 4J0JA 4LDJA 1DAGA 1LLUA 2PGIA 5KREA 1EGHA 3MGBA 1PL0A 2ZTSA 3OCWA 4IMIB 2CXTA 2LV8A 4ZGBA 1GJRA 3OCUA 4DV1B 3QE9Y 4EVQA 1D8AA 5KTOA 5FEMA 1Q92A 1RXIA 3WLSA 2C9BA 1BE6A 1ZVQA 3CRZA 3H1FA 3LD9A 2VNHA 3SJZA 1GNQA 1P29A 4JJAA 2PRSA 2PAFA 5J2UF 1RWVA 4R9SA 5K8UA 5LQRA 5DNWA 5B6JA 3KL4A 2QQGA 1NUQA 3QIVA 3K72B 2V5VA 2QPLA 1PL8A 3DHVA 1PBTA 4UUPA 4XDZA 2ZBDA 3SJAA 3QJGA 5A9TA 1CUDA 2J3EA 2RCYA 1ABFA 1WB6A 1C0IA 4RD0A 5DGIA 4X0EA 4JXZA 3M1YA 1ZD8A 1L5ZA 2H9IA 2Z3WA 5T6BA 1EXWA 4V0ME 5I47A 1WRBA 1G20E 5IAOA 3RC8A 4ZDIA 1F8GA 1M72A 1AHIA 1DCMA 1BDMA 1V41E 3BGVA 3F9RA 3PX3A 4QDZA 4L8FA 1EBFA 3MJDA 1VGRA 3H04A 4IDDA 5LP6C 1U7WA 2DUMA 5J2UB 4IIXA 1ZJ4A 3E9MA 1WSAA 4KE7A 4RZ3A 4URHA 4EFDA 1IUNA 1ZOPA 3OEHD 1CB0A 1GCUA 1B42A 4GI1A 2R8EA 2V4MA 3C7DB 1TMKA 1I10A 2P4HX 2ZRCA 4GI2A 4IVPA 4I8DA 3N5CA 3PKJA 4P92A 3UAXA 3BFJA 4E5PA 1FYEA 1MU0A 2W98A 4O4JB 3WMXA 1XA0A 5KC8A 1ZMXA 3V4SA 4EZEA 4LJ9A 5KSYA 1F0YA 4RIGA 4F72A 1ADFA 1P5FA 4I5FA 4LBVA 1CQIB 3K2EA 2XE8A 3QBVA 1P7CA 3IVXA 1NJFA 1S1MA 4D43A 5JCJD 1QFSA 4BKUA 2QT1A 3EAQA 4C3VA 4A0FA 2IYXA 1BMQA 2IY9A 3CLRC 4TV9B 5ALKA 2GEBA 1JLRA 1V16A 4P3KA 4GQIA 3C7CB 4GR5A 4UTZA 3GEMA 1BN6A 4QARA 1K88A 2AG8A 2E4UA 1Z2AA 4HLQB 4I1OA 4M7WA 3SE0A 3TW6A 4BZQA 5IZCA 4V0LA 2ZS8A 4UHEA 1PE0A 3BBPA 1BHQ1 4WV3A 4BJ5A 5BV8A 4CEJA 4TL7A 4O4LA 1KH2A 3NTRA 4ABYA 2ADMA 2BCJQ 5LQMA 1ZU4A 1B1AA 1OH5A 4BQEA 4QM7A 2A0FA 1HNZB 4U7DA 1L8OA 1NW5A 4LOKA 4JVSB 2DWCA 2UV8A 1B93A 5IYZA 3JQAA 2JKYA 1YQWA 2YWHA 4JBWA 1ZVVA 3QEJA 5FKJA 5F5NA 4QBKA 3TTTA 5JMPA 2YHIA 4MRRA 2YDYA 4XR9A 3SXPA 5BY2A 1NVUQ 3H99A 5JPDA 2Y67A 3PQ2A 4NAHA 2OGWA 4QUHA 2G28A 1HH4A 1VKNA 4DGSA 4QDJA 3EVNA 2J9ZB 4BFTA 2IBMA 3CZ4A 1COWA 4ROTA 4HDOB 1QF7A 2PZEA 5HF9A 4MX8A 2GX6A 5BSGA 2DUUA 1T4CA 2V6JA 1RM3A 2YXPX 4Y6SA 3C4JA 3D3QA 1TIBA 3LMKA 3FVVA 4XZ3A 2R87A 4GPZA 2BDEA 2IU0A 2YMLA 4X6YA 4DAOA 3KUKA 2SECE 3SS7X 2VQFB 1BDHA 3F5SA 1Z6YA 4PBTA 4FPXA 1L5NA 2NPFA 1IQUA 3C41J 5CGZA 2KW5A 3EGVA 5EXPA 1DC6A 1XF1A 3SEFA 4BQOA 4V3BA 3KUXA 2M6RA 2UVQA 2FEPA 4YXWA 1BH6A 3JX9A 4K9KA 2YYAA 4EYKA 1H8ED 2ZSIA 3O2SB 3OZRA 1IUKA 5PGMA 4EX7A 2BI8A 2OFOA 4GYYA 4XB2A 4Y2GA 4O4HF 3INRA 5ALLA 3PUWA 1RXWA 1QNLA 2GS9A 1ZGHA 2H3HA 2WILA 2YH2A 4GNKA 4Q7JB 4REMA 4TPKA 3V7UA 1T4MA 2VIIA 4G1EB 5EXDA 2TRSB 5E2AA 3VR5D 1U2PA 4TYQA 4DJFC 2UZ0A 4OBWA 2BFFA 3VGJA 4HYYA 4Y6GB 2VPWA 2I4LA 2ZJOA 3ENZA 3DZKA 4MW5A 1KY5A 2ZQ5A 1IBCA 5GV7A 5HBRA 1LI5A 1TVKA 3C3DA 1DCFA 1P4RA 1R37A 1SOAA 1XQVA 2Y0BA 4XX1A 4EKEA 3KOOA 5FFNA 3MB8A 4G6ZA 3AEXA 4IGIA 4YJFB 1G3RA 2VSOA 4DLUA 2V7TA 2B3TA 4Y2XA 1QGOA 3UK7A 4AY2A 3GYBA 4RGQA 5D84A 3CO0S 3ZGVA 4CTJA 4EATA 1Q0TA 3B52X 5EZYA 4ZYTA 5HW0A 5K6AA 3A06A 4L74A 4X20A 2HNKA 2LIPA 4FINA 3F5FA 3L0BA 4N54A 2MHCA 3U0VA 2V5AA 3MQFA 5EN4A 4NBSA 1NXVA 2TECE 4BNKA 5EIXA 1OHHA 3B8HA 4RCVA 3UHFA 5K8VA 4LXXA 1ZIOA 3NDIA 4LY0A 4D7AA 2DMRA 4V24A 3N70A 1TQ8A 5AHKA 2WK1A 4Z2YA 3F2IA 5U4XA 5M7EA 2O9JA 1O6ZA 4F9EA 1K63A 2HLDD 3I58A 5C1DA 3IEPA 1R5JA 1YDHA 4V2UA 2CFSA 4DLPA 2Q1TA 3MPUA 1XRSB 1SD5A 1QK3A 1Z28A 1Z5VA 2I0FA 2QSJA 3DUFA 3L0SA 2Y9MB 3CT6A 3AHHA 4ZQHA 1W59A 1ZJ6A 3VH1A 5E6SA 4Z4QA 2NXJA 4IH1A 3VX3A 5A4JA 5IU6A 4DLYA 3ELWA 1EVKA 3W5CA 5J40A 4ZVMA 1T1RA 2GEVA 4LV8B 3SQOA 4AP6A 3G5TA 4CM9A 1SVIA 3NQ41 4MW4A 3T7CA 3WK7A 4JK3A 5K51A 3JRWA 3EXG1 2AKEA 4DR2B 4MYRA 1NAHA 4ALJA 1DKOA 4RQTA 1S5PA 3AUUA 3G8CA 5B53A 3R3JA 2VHTA 4LHVA 4QDXA 5IDYA 1L7DA 3F6PA 1E0JA 4BP1A 2GPBA 2QRPA 3D7KA 3PQ6A 5CVJA 3I9V1 4Y6RA 2NPOA 4YJGB 4OQ4A 5DWVA 1PJZA 3WB1A 1NF8A 4URFA 1XMJA 4WX2B 4X91A 4ZDWA 4AICA 1FP4A 2P5SA 3EW7A 1B8VA 2PZJA 3QBDA 1W29A 2WAYA 4EFMA 2WSMA 4ZDJA 2OC9A 5JJ5A 5KTPA 4RTKA 2P9HA 1C0LA 1U3DA 2OVBA 2P6NA 2Q3LA 1X94A 3EPPA 1TFUA 1ZJJA 4K6MA 2XZLA 2QM7A 1YCGA 4AKGA 2B1RA 1KYTA 1JJBA 3V2IA 5E8JA 3EEFA 4UFOA 3IV7A 4X61A 3BL6A 3G8BA 3GFPA 2W4IA 4L95C 4LGMA 1LFAA 1TJ3A 4F4DA 1T8YA 2ATVA 2HA2A 2O5VA 2A5LA 2GK7A 4R41A 4KXFB 4O0MA 4N0MA 1ML3A 4A26A 2CV0A 2EFJA 3MTIA 4ZT7A 2EG9A 2AV6A 4WCDA 1E0DA 1UKZA 2JEZA 2YUTA 3I01M 4F2WA 4LWPA 5DTJA 1IL0A 3R9WA 4HN4B 4Q7QA 5AD1A 5ES4B 4PS1A 4PXSA 3R0JA 4MVWA 2C31A 2GN9A 4ND3A 2DCMA 5DOZA 4JL6A 3ZWPA 4E2WA 3G0HA 4BXOB 1VI5A 3UHAA 3DZGA 3AC0A 1DFIA 2G0TA 2VNAA 3G2KA 2V8OA 3HBFA 3HXKA 3QFCA 3OQBA 4XXHA 4FM9A 4WZ6A 1RRVA 1BVHA 4MPRA 1DC8A 4RK5A 1AZLA 3HP1A 5FTJA 2I3ZA 3UEOA 1XTKA 2XB6A 1E5TA 1RWMA 1XI2A 2VBFA 3B2EA 4O8ZA 3RWBA 2G1PA 4BCCA 3KYJB 2XMCA 5IPFA 4UMDA 4D9CA 1CW2B 2A0XA 1YVEI 1H3FA 2R8RA 1US8B 1DQZA 4RA9B 4A92A 2Z9DA 3C8DA 1K8XB 4WFQA 4DLRA 1XCJA 5AJUA 3S28A 3EVAA 3NOOA 1ZS9A 3TRHA 2O0MA 3TJMA 5KNBA 4Z8XA 3MILA 5HUHA 2I71A 3F0TA 3ROZA 1NVXQ 4UFPA 4QPPA 3K1AA 1FRNA 1NGSA 4KDRA 2DM6A 3SYLA 1I30A 5AJXA 1KK0A 1YJAA 1ABEA 3WLOA 1NVAA 4H6PA 5KTYA 4W5QA 1I1OA 3JR3A 2XXAB 3HO1A 1R9MA 3W2FA 4WIAA 4CYMA 4Q16A 2WVAA 4PZUA 1HK7A 3DE0X 1BJKA 2B2NA 3X1MA 3CUEF 2ZYRA 1P5RA 1YZGA 3DEIA 1QKJA 1UT5A 3RF7A 1PSDA 3H0KA 1WZIA 2OBLA 1AZSC 1FQOA 2JS7A 2JIPA 2WB4A 2B98A 3M6IA 1SBNE 3CEHA 1K5GA 1EWKA 3FDZB 3ILSA 5E6UA 5LB4A 3VUEA 5KYYB 2IXBA 5ADVA 5JDCA 2NUPB 4XTCS 3C85A 2XJ9A 4TRNA 3EXEA 2JGAA 5B4UA 1E3WB 4HTAA 1G6Q1 3MINA 1VSTA 4WXRA 4YECA 5ILGA 5BSTA 4KNYA 4KYUA 3DHWC 5DSXA 3IPRA 4GD3Q 4DCOA 3PFCA 4JASB 2JK1A 3MUNA 3RSZA 5JW6A 1XHFA 4WOJA 1U7UA 5GPBA 3QV2A 1FZQA 2O2CA 3G5AA 2REBA 1ICIA 1LPBB 2VTEA 1GPAA 3GAMA 3NU1A 4P84A 4ZFNA 3IMKA 4RE5A 4YMVA 3ZBTA 2WP8J 1R18A 3QXHA 4W8GA 4NESA 4C20A 3E0XA 3OVMA 3TPFA 1QYDA 1JB9A 1YU6A 2QI9C 3KJEA 4A8JC 4B81A 5E7MA 4DJEC 2G63A 1OZGA 1KSFX 4AECA 2A1TR 5AW6A 2HRRA 1TRKA 1V8BA 1L0BA 1L5QA 2ZAOA 3FYDA 1DV2A 1WW3A 4Z4FA 1NLMA 2IEZA 2GFIA 5CB0A 2A59A 4OOEA 4C0XA 1MHPA 3CN9A 3NIWA 1P0IA 3SJCA 2HLPA 2HLHA 3KSDO 3VR4A 3WBJA 3WV4A 1QYWA