1J23A

Crystal structure of archaeal xpf/mus81 homolog, hef from pyrococcus furiosus, nuclease domain
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
131
structure length
131
Chain Sequence
VKVVVDSRELRSEVVKRLKLLGVKLEVKTLDVGDYIISEDVAIERKSANDLIQSIIDGGLFDQVKRLKEAYSRPIMIVEGSLYGIRNVHPNAIRGAIAAVTVDFGVPIIFSSTPEETAQYIFLIAKREQEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-Ray and Biochemical Anatomy of an Archaeal XPF/Rad1/Mus81 Family Nuclease. Similarity between Its Endonuclease Domain and Restriction Enzymes
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
molecule keywords ATP-dependent RNA helicase, putative
total genus 47
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2002-12-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02732 ERCC4 ERCC4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10130 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1j23A00
2BHNA 2ZIXA 2ZIUB 2BGWA 1J25A 1J22A 1J23A 2JPDA 4P0QB 1J24A 2A1IA 4P0PB 2ZIWB 4M6WA 4M6WB 4BXOB 2JNWA 4BXOA 2M9MA 2ZIVB
chains in the Genus database with same CATH superfamily
3ABRB 3FYDA 1ZSYA 4L9RA 4QPPA 4R8KA 5AIAA 2CLKB 4C2AA 5ADHA 1EGQA 4E5PA 4C7BA 1GNTA 4I9HA 1B8OA 2NQ2C 5INTA 1UM9B 3A1CA 2CDBA 3J80A 3G0HA 2C1EA 4I3FA 3EXFB 4ZCTA 2JLCA 1SIWA 2CFSA 1ZESA 4L08A 3DG9A 2HBZA 3UWSA 3B12A 3W3AH 4MWOA 3F5QA 2ZRLA 1BU5A 2D74A 2EYUA 1P9OA 1T1EA 1PL6A 3NC1C 2H2FA 2QU7A 1XIVA 4KXWA 5DCWA 4O33A 4FEYA 5B3JA 5IXYA 4RGVA 3SDBA 3FKSD 4P6VF 1QHGA 3M33A 4ZHQA 3NPAA 4ND4A 4URFA 3RSGA 1XSEA 1OAOC 4GXTA 1QLHA 3L18A 3BJZA 2O8CA 1CJTC 1UBFA 1U8YA 2X7HA 1DOHA 3K94A 4MW9A 3LIPA 4EB6A 2ZBEA 4KUGA 1QRRA 1PGOA 2KSQA 1QB7A 3R7NA 5AM0A 3ZWCA 1M1ZA 2FNAA 3RFTA 4H7HA 3GMDA 1Q1NA 3D6TB 3CH5A 4K8RB 4FN5A 4XLZA 8ATCA 1WIWA 2H59A 1H65A 2PUAA 1U94A 4KEAA 4HYEA 3ZHBA 2OO7A 2WFAA 5JROA 2XMDA 3MINA 2O6LA 2YNMC 3QYJA 2FG6C 1DRWA 3BHIA 1QZXA 1SHUX 5ITZB 3ZWPA 1P7PA 4E5DA 5FYQA 1ESCA 3ZG6A 4BKOA 2XWQA 2JZNA 1L4NA 4TZTA 1M7HA 2IOHA 3L7OA 1JECA 1IBRA 5IBPA 4RVSA 4FYKA 3S5UA 2O5VA 5K6AA 4JYZA 4DC1A 1YVRA 2JW5A 1GG2A 4MJ3A 4LPSA 4H08A 2HHCA 3PNSA 4A16A 1C81A 1IZZA 1T9GR 2PWYA 4L4SA 1VECA 3OFJA 4O8ZA 4RKWA 1NMYA 1ORDA 1EFCA 1ZKDA 2F3UA 3O8OA 2Z6QA 1B14A 1QE3A 1XNGA 3PA8A 4M8NE 2JA2A 1KDOA 1Y8CA 3FPHA 3O9VA 1BXKA 2OGWA 1IZ7A 4LY6A 1XDDA 2ATIA 2PL1A 2YCLA 4ZOLF 2IELA 5DHUA 4COOA 2ZYHA 1T9DA 4BVGA 1QYRA 2YV2A 4IG4A 2QTFA 16PKA 3H5WA 3MXOA 4J16A 3U2QA 1A27A 1L1QA 1O5OA 2AB0A 4PW0A 3S1AA 2WVJA 2YW9A 1WU8A 3V8VA 1AZLA 1B0AA 2QSYA 1ZJ6A 5CD9A 5JNVA 1SXJD 3UJ3X 1JTVA 3HY6A 4O4HF 3RAFC 2O9JA 1PJSA 1RWNA 1I13A 1G8JA 1W0CA 4GR4A 4JA0A 3M2PA 4UHDA 3T0FA 5T3YA 2JS7A 1GYQA 1DXOA 3ZH9B 4BBAA 1HFWA 4LYGA 5IJWA 2HL6A 4CN8A 1N3IA 1UXJA 2BR5A 4QRDA 4JC5A 1FRZA 2ZCUA 2KI5A 5CNJA 1D4ZA 4DA0A 3NHSA 5AW4A 5IKEA 3FXAA 2RSLA 1O7JA 3FDFA 4BVEA 1X8LA 2IEDA 2JFGA 2YOHA 2YXBA 2ZOSA 5EZYA 2PX0A 3HU2A 5THXA 4ZDKA 2QGZA 2ZRBA 2XQKA 5DXAA 3BA6A 4RTJA 4EKNB 1DBWA 4J75A 4MQMA 2CV0A 4KWEA 3FVRA 4GT1A 2FE1A 5BW5A 2D6FA 2XLCA 3JYPA 3M6LA 3PXUA 4LJ7A 1NW7A 2AN5A 4GPEA 1YIDA 4EL5A 2QLMA 2AWOA 4QLAA 3Q7IA 3IUEA 5G3YA 4MGYR 1JDSA 3ZZNA 3HB1A 2RGUA 3NVAA 2W43A 1Y3AA 4L3WA 3OT5A 4DIKA 4RF3A 4X63A 5IT4A 3D5TA 1L5WA 4L4RA 3REQB 3RI3A 2FW9A 3PJDA 1GITA 2VXCA 2CD9A 4P4SA 3MS2A 4DF3A 4GMGA 1EDEA 3EQ2A 2Q5EA 1XU4A 3CZQA 4Q03A 5AI8A 3WGGA 5CFPA 1OBFO 5TPWB 1C1YA 1GRQA 4HH1A 4BO2A 3PC8C 2PAAA 3TQTA 2B0CA 2BDUA 4LRXA 1RAGA 3EOAI 5JZSA 1JMKC 4B3XA 4A4DA 5LFAA 1PR1A 2VJKA 3S2EA 2C9BA 1X7WB 4L22A 4Q3NA 4UBJA 3DXYA 3MAJA 3KXPA 2BFEA 4FMCF 4BV8A 1X39A 5D00A 3L9XA 4EZIA 1VL0A 4G0UA 5IMBA 3BJRA 2UZ4A 1OAOA 3O6VA 4GM4A 3U44A 2JEOA 4DG5A 3HR7A 1HXHA 4D41A 3S3TA 4BZQA 3WL4A 4C21A 5TMBA 3DZFA 1DAKA 1M8KA 1R0KA 3QVMA 3RS2A 2IIBA 4M9UA 5KYUB 3HRKA 4B6PA 2GI4A 4DMHA 2OCBA 4II2A 4LGMA 1YRHA 1J24A 1UMDB 1VE9A 2QDXA 4BLRA 4CMKA 4QYWA 2VPYA 4P53A 3K6KA 1RHKA 2ODTX 3RTBA 1U8AA 4B7AA 3HABA 3RF7A 1Z5NA 2FMHA 2JFNA 1SPXA 4UCWA 3CLKA 2AN9A 2FW0A 2XVYA 2ZBUA 4R2IA 3UYLA 4EJSC 5ER9A 4MQBA 5JXGA 1ZHFA 2HIHA 1LW6E 2AN3A 2OK7A 1XZGA 4JKOA 4LHSA 4P4UA 4Z0NA 5J2UB 3W6UA 4EI8A 2QD1A 3SX4A 4BFVA 1QOPB 1M1YA 1M73E 2V7GA 2ZRKA 5AK6A 3LOQA 4E30A 5LLSA 5AICA 5K7SA 5B7NA 1UBTS 3BGVA 4I4CA 2WJGA 1YBMA 4I5EA 1BWRA 2LDXA 2XBMA 2EL9A 4MRMA 5I9LA 1KY5A 5FLXA 4FNAA 5FUMA 2HIMA 3R41A 1A72A 1HWYA 2Y93A 2PSFA 3IH5A 2QKYA 2BUBA 4PNEA 5CX4A 4NDAA 5A0FA 3FSGD 3VNQA 1DG1G 4RVFA 1OZFA 2BZ1A 4OJMX 3BJMA 2QN2A 3HDVA 4WT7A 1W85A 4L4UA 2ECKA 2FFAA 3EMBA 3QPDA 4MICA 5JJ5A 3U7GA 4W99A 1TOAA 2D2FA 2XQGA 4JKIA 5B1EA 2R7MA 1R4ZA 2JFVA 3K1JA 3IBGA 1QV6A 2ILTA 1QC5A 4IOKA 4EL0A 5KJ1A 5HDBB 3JYQA 5AVVA 3I4LA 2NZWA 3GARA 4Q19A 3EGXB 4BPBA 1S9HA 4QUIA 4MVJG 3UGTA 1DBRA 1B8NA 1S8NA 2YYSA 3L8HA 4NDZA 4PICA 2C2YA 3T7TA 1X80B 2C4MA 3DE3X 4JP8A 3MJDA 2PIDA 5LBIA 3K6SA 1KZ1A 3W9YA 3NDBB 4NJMA 1U7WA 2Q6IA 5IS2A 4FNOA 5DP1A 3FAKA 3I5UA 3Q88A 3DB2A 3LPMA 4BAZA 5FTNA 3PDUA 1T8YA 2PUJA 4WMLA 4XYEA 4O4IB 3RC2A 5JSUA 3ONEA 1ULUA 3T9CA 1EESA 4WHMA 3GJ8A 2C3MA 3L93A 3MG9A 4V0QA 1DO8A 3PPWA 4GUAA 4E6EA 3F9CA 1IBCA 1Q2UA 3KYCA 3GLKA 4PU0A 2QRZA 4JXKA 2HB6A 4EHBA 4HMOA 2H4JA 3C8MA 4IWXA 3KB2A 3WZMA 1I32A 3A3KA 1SCQA 1NRJB 2YZMA 3CWCA 5AXCA 4G07A 5JR3A 1A69A 3PNMA 3E9NA 3KQWA 3KQTA 1M0SA 4AS2A 4PXYA 3T7IA 4KODA 4CV3A 3A3OA 5JFGA 4WKNA 5GV7A 2PMKA 1JJVA 5DNCA 1VCNA 1NZJA 3ISVA 4US1R 4F46A 2VZ8A 3OQBA 3IR7A 4BQPA 5JMOA 2CBZA 4N48A 3PC4A 5BUSA 1SD2A 3BAFA 2ZAMA 3UTDA 4EHIA 1JQ5A 2VH5R 1OWPA 3B5EA 2RGNA 3EEFA 1F3OA 2RBGA 4GQIA 3IBCA 2IFTA 1J33A 3QEMB 4B0OA 5AVXA 3T1HB 3KUKA 2JJMA 4QBKA 1RKVA 1RBZA 3DBHA 2PO7A 3DMNA 4LJAA 4TQUS 1D9ZA 3NM5A 3TINA 5I7HA 2Y1EA 2R2GA 3T5CA 1C80A 2P2LA 3DC2A 4LS3A 5HBRA 5AH0A 1EZ1A 1V11A 4HF7A 4X7PA 1L5RA 2JLUA 2CUNA 5IM4A 4JWKA 5E7MA 4Q18A 2O7RA 4OAOA 1BOOA 4LX0A 1AD2A 2QTZA 1XYVA 2YV1A 4D3SA 3SBXA 1N3YA 4RAOA 2WD8A 2AYZA 2WNHA 3DHYA 4MVJI 5DLPA 3RUIA 5LQAA 2VRWA 2P7HA 3RFVA 4ASUA 4OX9B 3FVTA 2XB2A 2VXBA 3Q2IA 1KI2A 1RQLA 3Q3EA 4JAVC 2B5OA 4WKOA 1NI4A 5J9FA 1P5RA 4AY3A 1TTHA 4XR9A 4TWJA 4DIUA 4L73A 1WXFA 4U3JB 2NWQA 4BHTA 4NBRA 1BH2A 5FNVA 1GG9A 4QBHA 2V45A 5FA5A 3MMZA 4L0CA 4EPXA 2V3WA 1T0BA 2YN4A 4IDBA 2C1XA 5FUBA 1GAWA 2EJUA 3RRYA 4A8JC 3OSZA 4LISA 2EEPA 2HBRA 1FB5A 2JI9A 2W8BB 3AK4A 1NAIA 2PGNA 1LPAB 4UTPA 2VSYA 3LRPA 1DIOB 2OHXA 3HYTA 4CFSA 2XMSA 1JT2A 2XSZA 5K0LA 5BW6B 2DPGA 6AT1A 1M1NA 5ED4A 4DV4B 1D6JA 3GRZA 3R23A 2J3LA 5DGTA 1KE2A 1K1EA 4E11A 2F8MA 2IYNA 2IA5A 2WTAA 1O94A 3RG2A 1JU3A 3LHDA 1OFUX 1V9LA 1VE1A 2Y9MB 2CLMB 3AIOA 1XJ0A 1AQLA 3K1ZA 3CCCA 5JSYA 3SXJA 3JW8A 2P65A 2BMAA 2QRVA 1L8XA 5K0JA 3UKOA 3SE0A 4IXMA 2HDWA 1MRZA 4OFBA 3H3XA 1BQEA 1PK8A 2PZAA 4EQ6A 2C8LA 3AVVA 3WYBA 5LQMA 5F78A 1A4UA 2GAAA 4ALKA 3VAYA 2GCNA 1C30B 1KDZA 1LFAA 1AGXA 5BR4A 2O4CA 5CEJA 5IK2D 2GESA 2JLRA 3LGSA 3RK1A 4EPTA 4UPEA 4ZO8A 4DRZA 2HN9A 3B9PA 3RU3A 1X15A 3E5RA 4G24A 1L5HB 4W1QA 4V39A 1ZSVA 3PJEA 1GG8A 2ZJ7A 4JB3A 1QFJA 1I7NA 3TRJA 1B6SA 1NBHA 2R8YA 3MIZA 3G23A 1LRKA 4ADSG 3LXUX 1NVKA 2ZZKA 4NU8X 4ZREA 5KKNB 4K3UA 3EIOA 2HSGA 2UVQA 4HEA6 4ZCPA 1ESZA 3KT6A 1KC1A 1OZGA 2X8JA 4RM2A 3DMPA 1CNFA 1NP6A 2JIQA 5DHRA 3DT6A 1UMBB 2OC9A 4YTEA 3V46A 4DV3B 2Z04A 1PT5A 2GD1O 5AVUA 4A82A 2CC2A 3TNYA 2JGLA 3LVQE 1U6KA 1R88A 1UZMA 2PU7A 2YV5A 4HPXB 3LFUA 5DT2A 1I7QB 1G4AE 4KUEA 5IABA 3ISTA 4OIMA 5IJAA 1GFSA 2J0EA 2P77A 4NOJA 4J0HA 2AWNA 2R5NA 3LHKA 5KYWB 5CFZA 3QWAA 2PZFA 3AHDA 3CLUD 4ZQFA 3SQXA 3M34A 3NDRA 4QDUA 4DCUA 1SH7A 1G7CA 4ZCMA 4BO6A 1IEWA 1BVUA 4KN6A 3IJPA 3A8TA 3LW7A 3LWBA 2F48A 3EHEA 1NYRA 3JWPA 1XL0A 1CY8A 3LHIA 4HADA 5A7GA 4F91B 1L7RA 4YRTA 1RWQA 1LTKA 3GBPA 2GPYA 3IEIA 4N65A 3UF0A 3LNTA 2G06A 3EH1A 1VOTA 2L17A 3PIRA 2HKIA 3CY6A 4F56A 1ZI9A 2Z3VA 1IG0A 1JLRA 2BHLA 1CHDA 2CF5A 1V8ZA 4YRCA 5EMNA 5HIIA 4HI0E 4QECA 1OVMA 1WUHS 2H65A 2FF5A 3MD9A 4AJPA 1NFRA 2O6HA 5ECGC 3ZCPA 2QM7A 3L9WA 3GLHB 3LT2A 4KPGA 1ZRSA 2QY9A 4Y2VA 521PA 4EJSA 4QXRA 4PYLA 3CBQA 1ZXBA 5IW8A 3T1QA 1TT7A 1T5OA 2G5PA 4QLBA 2RG7A 2G5CA 4ILKA 5AJVB 5F5XA 2FPIA 4KBGA 2G0TA 1ST3A 1DEHA 2CHEA 4W7HA 3WDMA 2XF8A 4OJKA 2IE0A 4K86A 3GIDA 5K0NA 1ZX1A 2WU8A 3QSGA 3GV0A 3QFHA 4Z9YA 3JRWA 3HBAA 1HH4A 3GJXC 5I7RA 1E4OA 2LBPA 3N6XA 3F71A 1Z4MA 2O1WA 1GIAA 5FWXB 1AURA 3K5WA 2P3OA 1O9BA 1PR6A 2LWIA 3UA3A 3WE7A 3HJNA 2HUPA 2P6RA 1H3FA 3B7WA 4GVXA 5B36A 3I92A 3I6YA 3OY7A 3FVVA 3GY0A 3LTNC 5LA6A 5BV8A 4R3UC 1NKTA 3KTDA 1U9ZA 1QMGA 3M4YA 1GTG1 1XTVA 2H1CA 1GXSA 3TRDA 3WQQA 1X9GA 1UP7A 3ONWA 5FV7A 4UBNA 4Y2TA 1LDGA 5DCUA 4DAEA 3P9IA 5JPIA 4BX0A 4BX9A 3CWQA 3WSWA 3GLGA 3BHNA 2X4GA 3E9DA 3GHYA 2WNIA 4UBLA 4Q4AA 2IITA 1A7KA 4C4ZA 5JSZA 3EA4A 1SKAA 2DR2A 2RHWA 3HS3A 4G86A 1K2WA 4BVFA 2GILA 2EC5A 3WGVA 4GFDA 1GPMA 2H6EA 3Q7TA 2F3PA 5BY2A 3NATA 2AN1A 4KE7A 2HMSA 2A59A 4PSKA 3RVNA 1JAHA 3K72B 5L3SA 5K9ZA 3ELBA 3PUWA 5FUYA 3DTTA 3OQPA 1WY7A 5ALPA 4J3JA 2Q0HA 2WDZA 3OJFA 4GOND 3TG2A 3LLCA 5JSQA 3GFGA 1XXHA 2HGSA 3IP8A 4QUEA 1T5BA 4X3PA 2QGFA 3VR5D 3EQ7A 3VVBA 2X7JA 1VGQA 1J06A 4Q1EA 2OBYA 3DWFA 5C4GB 3ZWDA 1Z35A 1GLNA 2OWEA 4CDMA 2B37A 5HUJA 1ZGAA 2ETXA 3MRXA 4OYRA 3ZQKA 4ZMSA 5ILOA 5BVGB 1WB9A 3ZDAA 3CB2A 1L5ZA 1EQ2A 1GGVA 3OAAD 1WHTB 1JU9A 2I3DA 3SS8A 1XMSA 2IUEA 4BDSA 5FEMA 3LVFO 3Q2OA 3AFNA 4RQUA 1AZWA 1IWOA 3IJRA 2IEBA 3L7DA 5KQPA 4QYSA 4WZAB 3ZK8A 3DZIA 1HDGO 2NO6A 3S2YA 3P9ZA 5F9FA 1CJBA 1RQ2A 1OFGA 1H6CA 4YAFA 4WWHA 3HV2A 1VKNA 4K81B 1NNLA 1X7ZB 1PL7A 2A7XA 1J9GA 2HCTA 5H80A 2COUA 3IX7A 2H5EA 3UT6A 3WGNA 1DAPA 3ZY4A 2CL7X 4FCVA 4ZAXA 4YRAA 3R4CA 5KVCA 3ZGZA 2C04A 2WM2A 3AKDA 4QYTA 3HVHA 2CZQA 5D3ZA 4Z9XA 4ZAWA 1BMFD 1CR1A 1SQFA 4HNRA 5DCYA 1TJPB 5BSRA 3QEBZ 3QTTA 5KUTA 2HF7A 1FBTA 3BSYA 3DDHA 3UG6A 3VU9A 5JCZA 2OP0A 3TSWA 2QQ0A 5IAGA 4TYWA 4CM8A 2JJ2A 1CW2B 3GD7A 1UMDA 3KAPA 4FFSA 4R1QA 4AN4A 2V74B 1QP8A 2ZUUA 3HU1A 3CW2A 2FB9A 4M3NA 3T5GA 4KI7A 5EP3A 4PS0A 1VKOA 2IQIA 3P9SA 5C5CA 2WP8J 3COZA 4IIXA 3S4YA 1XCPA 3ICPA 3HDQA 1XEWX 2FETA 2FVXA 2NZVG 3A58B 2M6LA 4PCAA 3VAZA 1G7SA 1RXIA 2VJDA 1ZGHA 3HBMA 2VDKB 4CMAA 4FWBA 4PG8A 1MEJA 1LLDA 1TU4A 3C14C 4YLGA 3AXSA 2QA5A 2G09A 2WJPA 4N6GA 4WY2A 1XF1A 4XPIB 3NJ8A 4C4RA 3AU9A 3VR2A 1G60A 4EPVA 1UAGA 2BGKA 2WT8A 4CM3A 3H1PA 2NUPA 2Q4TA 2QTLA 2WKQA 3EAGA 3WNCA 3AU8A 4ILEA 3WLHA 1AA9A 4D6YA 1XQXA 5KKCA 3NKVA 2GJSA 5FCDA 2X0FA 2OSBA 4DG9A 4B0PA 4QJBA 4GZ6A 1PCXA 1OXBB 1XP8A 1HUQA 3C3CA 2AQ8A 3DAGA 3NEPX 4B4KA 1QHSA 3MLBA 2H31A 3VSCA 1FQJA 1WOMA 5B2FA 4UNSA 5ILGA 3W1EA 4WASA 1EGVB 4TLEA 3OP1A 2OTCA 2ZWVA 3IE0A 3HGTA 4J2TA 4BFWA 1O8CA 5LZ2A 1ABBA 2L2QA 4EKDA 1SC9A 3I28A 3O1HB 4A8TA 2JFHA 4ZAYA 1QH8B 3IALA 1G20E 4GBGA 4JMPA 1SKMA 1ZD9A 4ZJZA 2W6ID 4M8KA 1QO0D 2OKGA 1HX7A 4D4KA 1OLSA 3FVWA 3ET4A 2ZIUB 4BC0A 4EK9A 4JU8A 3OO1A 1Z5ZA 2RC5A 2R96A 1L4UA 1JSZA 2I3BA 3D7RA 3VDQA 1I9GA 1GPJA 3HSSA 4MAMA 3VZBA 3TTYA 4BATA 3KJHA 4NFHA 2WFZA 4E2WA 4YXWA 1QIKA 4EYOA 1AKNA 2A1TS 3UV3A 5A2QA 2HHLA 1VKJA 2BJHA 5B58C 3K70C 1LTQA 4LRWA 5KREA 1NNUA 1DZIA 3BFPA 3TDMA 2KHZA 3MILA 4BNFA 1QCCA 3LSTA 2GQ0A 3VKGA 4NEGA 3I76A 5KQRA 1AKTA 2FOLA 4KAJA 3WS7A 1F1BA 3WWEA 2ODAA 3U4QB 2NGRA 5BSUA 2I2DA 3FVQA 3OOSA 4U6QA 1AQ6A 2YS7A 4DXDA 1CR2A 1U5BA 2SCUB 4RZQA 4YYZA 1D2AA 2R8ZA 2V8OA 1Y37A 3RW9A 4AROA 1A8UA 3OVMA 2WIAA 5CD1A 1A04A 5SYMA 3AEXA 2FPXA 2G9QA 2H4YA 3P5BA 4FEAA 3ROXA 4AZ0A 4L4ZA 1C7ZA 1ONNA 1QGED 4AJLA 3T0IA 1ISFA 2GCPA 4DAOA 2VQFB 3F7MA 2A5LA 3HBLA 1PFYA 3B1KA 1OT5A 3G2KA 4GQAA 1A4IA 1KU6A 3PT9A 2HMWA 2L42A 2G9UA 2Y3IA 1MORA 3NV9A 1JA0A 5CDFA 1P4AA 3KRTA 3C6YA 4XWTA 3C3PA 1ISMA 2WG0A 2WHRA 3MB8A 2ZIWB 1YJBA 5C5EA 2WFLA 2A3NA 3UQZA 3HPRA 1C5KA 3Q2KA 1AUXA 5LQNA 1MRSA 5B53A 4EO7A 1A71A 4JEMA 5H9WA 3DLHA 4YQZA 2FPUA 1DX4A 3JASB 1UBJS 5FBVB 1MENA 5SICE 1E99A 2HK8A 3KQSA 1CUVA 1H4VB 2NSDA 2AKEA 3RUDA 2P3LA 3R9XA 2OOKA 1GPDG 1YE5A 3FOEC 2GBLC 1DAEA 4RHCA 2MHCA 4EGQA 1KWKA 1LJ8A 4LDAA 3IHWA 1N5LA 4WNYA 4YCBA 3Q4GA 2WJ4A 2AFHB 4JITA 3LT4A 1O95C 1JRLA 1VDMA 2HHAA 4F60A 3LFHA 3TLJA 4HNUA 4NE7A 2P9CA 5JD6A 1OJLA 1X7HA 4W5NA 3G0OA 1K9VF 1ZM4A 3ERCA 4LTNA 1R0RE 3OX4A 4AMUA 4DANA 4FZ3A 1HYGA 1V48A 1FS6A 3SQDA 4F04A 3IP9A 1FFEA 1M2OA 2HA3A 3H5TA 1G17A 5FI0B 4LYAA 4YWHA 2VPQA 3WLEA 1NWHA 3BSSA 5EIEA 2YQZA 4AFNA 1OXTA 2EBWA 3UJPA 4MVJF 3VGJA 3GVIA 3IQIX 3JALB 1RJFA 4OHCA 1MX3A 4WNAB 5ESWA 3BWDD 3ZS9A 3TX2A 1E1RA 1CR4A 2QMUA 3LOUA 4I5GA 1SVKA 1OLXA 4OU5A 3IT1A 2FSSA 3AESB 4GLFA 4ZN6A 3HA5A 1B0UA 2I4OA 1V47A 3TZBA 4JJIA 4JI2B 4FIDA 2Z9CA 1T6BY 1CUXA 2ECPA 5KTYA 5JJKA 3OE7D 4L95C 1M2VB 4OAPA 4CMEC 8AT1A 2GBLA 3GC6A 3IVRA 1W0JA 2H9YA 4UZSA 1E18A 2JFUA 3AM4A 4IMPA 2BFAA 3OP4A 1N8KA 4WZBB 4D9KA 4O25A 3ROTA 1ZDMA 2QNBA 2BL4A 2W2KB 3KLNA 2L0XA 3GH3A 3PZBA 3X1YA 4HAYA 2F8SA 2OG1A 3E48A 3N8HA 2Q3EA 3BXXA 4ND6A 1CS0A 4WQMA 2CNWD 2GLUA 2FMXA 1OBVA 1E2FA 2XYRA 2QPAA 3HJUA 3T99A 3V4OA 3VAAA 1K5GA 2H3EA 2J87A 4LMBA 3BK1A 3PEWA 1A2QA 1JL3A 1XLUA 5B58T 3VOTA 3I2FA 4KWHA 3ESRA 2BP7A 3W6OA 1VPVA 2J0VA 2GK4A 3KYDA 1XCGB 1NVGA 2GKGA 4LYDA 3LT1A 4B35A 4D1YA 4AKIA 3WLJA 5EUCA 2JAXA 5IUJC 1TVMA 1JR2A 3CEMA 4W5JA 4GYWA 2YXPX 1GDDA 3JAMA 3G2PA 3UB3A 3RSSA 1DEXA 1NVDA 1OWOA 1VXRA 2X4IA 5FOVA 2NUTB 3G5AA 1IU9A 1MTOA 4MB2A 3ZW9A 2PX6A 2C8KA 1B6GA 4RAQA 1ZXLA 2XB6A 3EASA 2JCYA 2RBEA 3ELYA 4HR7A 4LVUA 3KOUA 3UHFA 4S2UA 3WGUA 1V1JA 4S1TA 3EZLA 4E2FA 4YONB 3OJXA 5LNK6 3CTPA 3GO4A 4MIKA 1KMIY 1QFMA 2TSYB 2H0AA 3BWXA 3GA0A 3MWEB 3S0JA 4DSAA 5BPFA 3GZNB 1QX4A 3TH5A 1P9LA 4DLRA 2TS1A 5AKXA 1N75A 4BRUA 1ZK4A 1AO3A 4PV7A 4UHFA 3R3WA 3UFXB 4C07A 5J4HA 4RXUA 1XTQA 1T9ZA 3AP1A 1BCRA 1J2EA 1KFCB 2OHJA 1GR1A 4YALA 3V48A 4G0QA 4N54A 4QE3A 1QHIA 1X42A 1O97D 4YDQA 4PHFA 5ARDA 1D1TA 3AB7A 3M4ZA 3Q5GA 1R6DA 1U4OA 1N3BA 2CCKA 2QAGC 1Z5WA 2OFPA 3PJFA 4H7PA 4MQ5A 3EIHA 3DNMA 4W4TA 4X90A 3HJGA 1BGWA 1SQ0A 4AYWA 1K68A 2OXCA 4BLQA 4BN0A 1I4EB 1W75A 3JZMA 3BK2A 3QWFA 4MWGA 4UMDA 4IGIA 5HS6A 1BD4A 1VG9B 1LBEA 4CKYA 2CFOA 2Q1SA 3LX8A 4CF6A 1X94A 2R6JA 3I30X 3BXZA 4RIIA 4Y6RA 3W4JA 4JJZA 4CQMB 5BN5A 5DI3B 3JQBC 3T3PB 1M2FA 4P5EA 4ROTA 3DDZX 4IW3B 2IRWA 1SBCA 1CD5A 1NMXA 3HADA 1NM5C 2FGKA 3B89A 2JASA 4CFZA 2NUBA 4RENA 1PJZA 3IBFA 3AI3A 3UJ8A 1Z4PX 2JZOA 5F21A 3DEJA 4D96A 4O4HB 4PPYA 10MHA 2HBQA 4W5RA 8GPBA 3TNLA 3FETA 2UXBB 3VTAA 1UT6A 1KVQA 4W9NC 3R9WA 1FPMA 1FZTA 3V7NA 1WKCA 1EUDB 4HQNA 4MJLA 1J22A 2N46A 4ITRC 4M1EA 4OQDA 4Q7EA 1U7OA 1Z5UA 1RHQA 4DV7B 5JS6A 1WP4A 1YQTA 2X22A 4LW8A 3QKSB 5ALEA 1PZEA 5LP6A 4QXMA 5HP4A 2E18A 5HJ7A 5DTEA 3EAFA 3NTXA 1NW4A 3PNQA 4AO7A 1P0PA 1M74A 2FW1A 2QMHA 3AUFA 4IH4A 2EIHA 4RHTA 3VPHA 2PUGA 3KKLA 1WLYA 3ICEA 3JVDA 1IQRA 1B2LA 2WYIA 3LY9A 4K88A 3UKJA 1KIMA 2VA8A 2W2MA 4OHWA 2ERXA 1SM4A 2GZHA 1EHYA 2VG8A 3A1EA 2V3CC 2GOYA 2BZ0A 3LUKA 3GROA 4NCHA 5FPKA 4B81A 5K0EA 1QQBA 2YHUA 5JTTA 4JVNA 4V1CA 3PICA 2I4RA 3VYSB 4XW2A 2BONA 2O5EA 4EBBA 3KV1A 1KDTA 1W49A 4OJYA 4R9SA 2ZG6A 2A9OA 4H31A 3DE7X 5AJUA 2C9DA 2C92A 3MAAC 3TECE 1QYVA 2B1RA 4K6KA 1IB6A 3L4JA 5HMMA 1F8YA 4M76B 4BB5A 4LQ4A 2AJTA 2PT5A 2O2JA 3B5IA 3QPBA 5CAEB 1G9TA 5E1DA 2FQQA 5AI4A 3KZVA 5DIZA 3TSAA 2EKQA 1SB8A 4Q9NA 1DIAA 4D79A 1AMNA 5DNDA 4PC2A 3S44A 1CY2A 3PJGA 1W6RA 2PKWA 4E5UA 2V7BA 1EIWA 1U3DA 3O74A 4NIMA 1SVOA 3O83A 4I3GA 3QQ5A 4ZCQA 5F7OA 4JJ7A 3EVAA 3THWA 2XXBA 1KRXA 1EM8B 1MA3A 1V4BA 1ZM3A 4JL5A 1PKEA 2G07A 4UULA 2BHRA 4WY5A 4Y30A 3GGOA 3U3MA 1KVSA 4PNPA 4EECA 3NVKI 4Z4IA 3VKFA 1Z4LA 1LDMA 1G8PA 1ZJJA 2DM6A 2NU7A 3B3GA 3D4BA 3ELDA 3O8OB 4G5SA 5AKEA 1CUEA 5EUBA 3ITEA 4CMGA 4P2BA 3NOXA 4PTZA 4RF2A 3N70A 1TECE 4KMMA 9LDBA 2C2MA 5CDTA 1YRAA 2BTQA 3LKDA 3M7IA 3TJZA 4CKWA 1KWGA 1MEEA 2F2TA 2ONZA 2X42A 2F9FA 2ZTVA 4PG5A 1KPIA 4QG7A 4QU0A 1DPFA 1Y3FE 2DP4E 4AP6A 3L77A 3CPSA 3AHIA 2B2CA 2BIFA 5C7YA 1EFRA 1FFWA 1MC4A 2FEPA 4LZAA 4OI2A 4R41A 3QYAA 4FFDA 3UK0A 1KGDA 3DFUA 4YQYA 4MMXB 3E4DA 2JI7A 3T5BA 4BMVA 3T4XA 1ORWA 4P58A 3T3GA 4PX3A 2RGCA 3HN2A 4N01A 5ALKA 3HO1A 3PPVA 3KPUA 4TXJA 2DECA 5F64A 5B55A 3CX7A 3GXBA 3OMXA 3T0GA 4QHSA 4C4TA 1KO5A 3TAHA 1UDWA 4L8VA 4BX8A 4UUMA 3PL5A 4BGUA 4DARA 4AY6A 3I62A 4JT9A 3E5MA 3A2MA 1YA4A 3BYZA 5A6SB 1NJFA 2JJ8A 3CF2A 4R8RA 1N57A 3AQ4A 5IH7A 1LD3A 1T1GA 3I4FA 3OAAA 1E79A 2FOXA 4PZ0A 2FZVA 1QCDA 4DCJA 3D4OA 4M1YA 3NBUA 3TL2A 3A6FA 2C7GA 2ZITA 1VCMA 2BI7A 1G6HA 3PNKA 4FP9A 4QYIA 4I36A 4KPYA 4J6EA 4MP6A 4GP7A 1JS1X 2VDJA 1VL8A 4CM4B 2A88A 3SYTA 4PYKA 1C0IA 4CGZA 2E48A 3IPLA 4TV9A 4RA9B 1N2CA 1J8DA 2C0PA 4AJOA 1VJGA 2G67A 1YFKA 4FFLA 1XHLA 3OZGA 2RGNC 3QVSA 1GKUB 2ZT8A 2A57A 1NBMA 2VWHA 3MZ0A 2YH2A 3WYDA 3FBGA 4C4OA 3I37X 4RJLA 2VRCD 3G9XA 4A2CA 1TJYA 5TQVA 1NW3A 4XRGA 4R31A 1PQWA 4ACAA 4BQQA 4TVSA 1P62B 2R7KA 3TKAA 2NN3C 2P91A 4R4JA 2CV2A 1QWOA 1XNHA 2QX6A 1G3QA 3B6IA 3A70A 3JRXA 4LE1A 1NJ8A 4N82A 5AHRA 5AJHA 3STTA 5HJ5A 3ADKA 1N77A 3CXUA 5DOVA 5A0TA 4UHBA 1G9SA 2MMCA 5AOAA 2QN6A 3KSBC 1TJNA 3KDSE 4I6GA 4MROA 3BMOB 4OX9Y 1L1FA 1CUYA 4NH4A 1L6RA 1SXJB 3EDCA 4E88A 4WGFA 2BGWA 1M8FA 2N47A 3HCPA 3GP3A 1N0VC 1X7YB 4G1FA 4MEBA 1F9EA 1UKVY 2NZUG 1RT9A 4AX8A 3T1VA 4E51A 5F2EA 1N36B 2I6FA 1ISSA 4E5KA 1L7MA 1LX6A 4B44A 3OJEA 3OZFA 3GOQA 2QJOA 1ZH2A 5ESXA 2OCLA 3TW8B 2W2QA 3N2GB 1LI7A 4HQ0A 3SHTA 5GZ6A 4OA8A 2IUFA 3HN7A 1XJCA 3H1GA 2RHDA 1PFGA 5F4ZA 5HQ3A 3UK2A 1N5MA 1VJTA 3FZNA 1YJCA 2BMEA 1KFEB 4Y2RA 3J81k 1USGA 1UXGA 2Q45A 3KP1A 3OEED 2UUOA 2RHOA 3ZGLA 4BQSA 3MOGA 4EJFA 3DMRA 3QU2A 2IY8A 5A05A 2MYPA 3AEQA 1QU3A 1L0BA 5GAJA 1S1CA 1WZUA 1P39A 2V6BA 3OCYA 4HSEA 3T5TA 3R5TA 2NV6A 2J3KA 3TKLA 1A9YA 3VA7A 4AXBA 4PQGA 4JCCA 4E2YA 1C0KA 3DXZA 2M1XA 5E2IA 5BNWA 3A1TA 1TJ4A 4RQAA 1CY6A 1T1IA 5J59A 2I4LA 2ZKIA 4BWGA 3CJTA 4Y2YA 2G7ZA 4BJ5A 4CV0A 1U2ZA 4EB6B 3NNDA 3RRNA 4EX7A 3ADCA 4LWQA 4R9VA 2F8LA 2P6NA 4JGBA 3ZIUA 4URUR 5HX7A 3NNSA 4AJ4A 1Y81A 2O8DB 1MQ9A 1G18A 4IO1A 1ADBA 1VCHA 2ASEA 2FZKA 2NYRA 5EHNA 1XCLA 2FQWA 1RPNA 2MSKA 3TE6A 3ZW7A 2MR6A 2VTEA 1OWNA 5HZGA 1TADA 2H52A 3D0KA 4Y9UA 2HRRA 1GZ4A 2ZR8A 1J09A 4RLHA 4ZQIA 2IDZA 2A1IA 2VK1A 5A04A 2QE7A 3HEMA 3OCJA 1H42A 3CF6R 5EN4A 1E7YA 3KQKA 4BLOA 3ABIA 3QVWA 5FDFA 3K6SB 4WEOA 1QGOA 1JIUA 1A9XA 2B6NA 2BR4A 1WCYA 4JK3A 4Q4JA 1NASA 1RR6A 3A28A 4PFJA 5EUQB 2ZI6A 4DMGA 1K6XA 3PD1A 4JT8A 3TZLA 3DUFB 4RABA 3SFTA 1UMKA 2CF6A 2X2OA 2XUJA 3EOBI 2E37A 3PQ2A 4I2VA 5G0VA 4BU0A 3VZRA 1ZUHA 1WDTA 1RIIA 3CURA 1U0BB 3FPGA 3E7WA 1V3QE 1Z2PX 2E1PA 3I3OA 3TRFA 1HKUA 3E22A 4RFLA 4DL9A 5IJ0A 4DBZA 1YR9A 5TPWA 1MGPA 3VYRB 2PH3A 3DR3A 4FYVA 4JJEA 1QFZA 2FPOA 4HLCA 2MYNA 5EQJB 2XKKA 5ALGA 4KLNA 3QNWA 2XCSB 1BEZA 3T12A 1X7WA 1FOEB 1OB2A 1E4EA 3PLAE 1W35A 5DMXA 3RYTC 5J47A 1BHQ1 1BDJA 4MO9A 4F1KA 1QVWA 1M0EA 3VYUB 1SEPA 2W6NA 1FLNA 5IN4A 5E2AA 3VOAA 2JB9A 1EBUA 5HOQA 1RKUA 1WUJS 3MTGA 4FGWA 2J31A 1WPRA 3L1HA 3IA7A 4PQYA 3C8HA 2DLDA 2J46A 2QVZX 4R2HA 5E4FA 3VNBA 5TSDA 2H1HA 3L84A 4IKEA 4MW6A 4YCLA 3TXYA 1IRIA 1YQWA 4NV0A 3YASA 1XALA 5AI0A 4MV0A 4F7WA 3DFFA 4KXNA 5E6SB 2I2XB 3I2IA 1A3CA 2DQYA 1EVJA 2YWCA 2OCPA 2ZSHA 2ZVPX 2FPWA 1XVLA 3K0FA 5F3RA 1LBSA 2Q50A 2MSLA 3KHKA 4V0ME 4G0WA 4Z4HA 3M5WA 1PX2A 2NV0A 2R00A 3JQ7B 1P61B 2Q21A 3GT4A 4FXPA 2ZXFA 4RSMA 3MOSA 4D8VA 3G0BA 1HSOA 5BWCA 2DSTA 1AKUA 1CLEA 1MXHA 4MCHA 5KWSA 3PD7A 2E89A 2O05A 5HRCA 1YT5A 3DEIA 5DHFA 1BX1A 1DXQA 3DL2A 1JB9A 2EKLA 3N8DA 3N74A 3EUFA 2NO5A 2HQ1A 1R0XA 3O1IC 5CDFE 2YZNA 1M6VA 2AG0A 2HPZA 2ZRMA 3GB9A 4QXQA 4YGYA 3J81A 1A2KC 3O4RA 4HLUA 3STWA 1J1UA 4HNTA 3K0SA 1QFXA 1YL5A 3IP1A 4KUHA 3CZ4A 2IHZA 3I1YA 4CT0A 2VJQA 1ZVKA 3ZGOA 3WRVA 1T9AA 4UKDA 4PN7A 3LCMA 4IJMA 5HE9A 1IXRC 4AZ3A 3I9V6 1CQXA 3MWEA 3QY9A 4OUDB 1P9RA 2PQMA 1FLAA 3RYIB 4CL8A 1GTRA 4OYLA 4D9EA 1H4TA 1T2FA 1UPTA 4AF8A 1KY2A 1E5QA 4IEEA 1VM6A 2EJBA 1KDYA 3VKHA 4YCAA 2QF7A 1VA5A 1OGJA 1UZNA 1W96A 1LI4A 1XXHE 1ZD8A 1QHEA 4B33A 2B61A 3E7FA 3LYHA 4BB6A 3KHSA 4KOEC 1EP2B 1ULHA 1KQPA 4ZT5A 2JAHA 4CI9A 2BBOA 4XLTA 1GR0A 1HNXB 4UVDA 2W6OA 4DV2B 1H4QA 4G37A 3WMXA 4YUYA 1SUIA 1NN5A 1TM2A 3DTYA 4JLDA 3GJ4A 2OD9A 4L7VA 3Q5DA 4XX0A 3L6DA 4DDHA 2DU8A 3USCS 2ZP1A 4BQOA 1GPYA 4R8VA 1EVLA 3FR7A 3O4VA 3EGCA 2Q9UA 4QPNA 3BGWA 3Q9NA 5LYJA 5A5FA 1THGA 1TE2A 2W6PA 4B73A 2LDBA 2CNBA 1E1YA 4DQUA 1G41A 1EX9A 3CKKA 1WUYA 2QRHA 1TZMA 3BWYA 4TWIA 4Q21A 2WJIA 2PYZA 4K6MA 3PX3A 1J7JA 2OORA 2NYUA 4GOOD 1Q44A 1KY3A 5DXJA 3ZNNA 3CJQA 4YCJA 2FPPB 1GYRA 4F5EA 1B2RA 1J0DA 3VPAA 4F3KA 1C1XB 4FFMA 3NDPA 2AA3A 3DMYA 1HDOA 1R5NA 2HA5A 1S3GA 2PLNA 4BLSA 1QZTA 5EJ8A 2CV1A 4MRMB 4QWWA 3NH9A 3GVHA 2GZ3A 4TYPA 1VFPA 3RS9A 1I33A 2YR0A 3H3JA 1IZ8A 4FGZA 4JLNA 4FHDA 4LWPA 5FR1A 5IZCA 3EPJA 5FI1B 3IIKA 4N5LA 2W42A 1NNEA 1PP4A 3PXBA 4PO9A 4JQZA 5EJIA 1EBFA 3RCBA 2X6RA 5FA6A 2B8WA 2QROA 3I9MA 4FYXA 4UOZA 3FF1A 3CN7A 2PX4A 5HJ2A 1PF7E 1EVQA 1N1DA 3QOWA 5JHGB 5BXQC 4Q3LA 1JPNA 2X15A 4OHPA 1Y48E 1FFGA 3BMQB 1BMQA 1Y9AA 3IQEA 3LC1O 4FD3A 1RLTA 2OVBA 4GHWA 2CB9A 1ZGCA 4I2NA 3WDKA 3D4NA 3H83A 3K9QO 4G36A 3BFJA 2E55A 2JFPA 4JODA 3DBRA 4LDQA 5EZYF 3SVZA 2QD2A 3C1UA 5ICGA 2WFLB 2BKXA 2Z56A 4LHYA 3V6MA 5CVVA 4ZVRA 3NHAA 3ZXSA 1G291 3M1AA 1FRNA 2ZGVA 2CLOB 4O4LA 1KIFA 5CEFA 3RC7A 1FTSA 4G5OA 3ZHYA 4DJFC 2AW3A 3W0LB 3TF5A 4W8GA 2W8ZA 2HQBA 4XARA 4XXHA 5IASA 4WN3A 2D2VA 5AYVA 1YJQA 3MLAA 3BKWA 4PAGA 4LCJA 3FF4A 1GL9B 1APBA 1LK0A 4B80A 1NVFA 3OT1B 3TFOA 4GE0A 3F67A 4FDLA 1SU4A 2IDJA 4BNMA 4CF3A 2ZIEA 1SXIA 3D7MA 4R2MA 3MB5A 3OZ7A 5EQTA 1RKBA 4ZZ2A 4UTVA 4OL9A 1R50A 3IRUA 1TD1A 4PPNA 2NUAA 5E6RB 4X8HA 5FLYA 4Y1GA 2G4CA 5KWVA 1Z06A 2JATA 4ENVA 3PQ4A 3NUGA 4MAAA 2DUNA 3ZTYA 1DC5A 1O8BA 4D6XA 3W5VA 1C9KA 2IZZA 2RBKA 3GAFA 3OFKA 1PK9A 2CLCX 3GLSA 1KZYC 2QZ4A 1BQ3A 5DWVA 5I7SA 1RC1A 2RKWA 2NAPA 1P7CA 3BE4A 1VHJA 4YUWA 1X6VA 4ZGWA 4K0RA 4QQRA 3HBJA 5K3BA 4I4IA 1LBTA 2B99A 2CEAA 1M1NB 5C1OA 4OA5A 2PA0A 5BOSA 4QPJC 3NJ4A 5LOVA 3S8EA 2K7ZA 1Q22A 2Q1YA 5CDUA 3ER9A 3ZJUA 2OV3A 3JAWB 2FQYA 1ZIDA 4HHEA 1PTKA 1X0XA 1QP0A 3B9RA 2HLDA 4M1SA 2WQZA 5DHQA 2Q99A 3OTHA 2A30A 1RWKA 1I2CA 1IBSA 4TROA 1TVKB 2J41A 2C3UA 3M9XA 4ICIA 4RIFA 5DSXA 1NUHA 3QVGA 2IYQA 1EK5A 4UHKA 5KZMB 4G0YA 5CHEA 4GBJA 1OIXA 3VPCA 2Q7DA 1Z2OX 3QYPA 3H84A 2YXLA 3WJ7A 3RS4A 4YRNA 1SWWA 2PZKA 4HAXA 1T43A 4HK4A 1BZYA 3DZBA 3NHPA 5DJ5A 4TYYA 3ORQA 1PJ8A 4N9WA 1F9AA 2WRZA 1KDPA 1HZZC 2JLZA 4DR2B 2IS4A 4MHTA 3NTOA 4C0KA 2GCGA 1GZ3A 3IR5A 1XQ9A 2TMGA 4OOEA 3SP1A 3UMFA 3HKCA 1GEEA 3R6DA 5F52A 3WP1B 4BAUA 4RV9A 3KHUA 5BXYA 3D5QA 2NUTA 1V8DA 2NX2A 1MVNA 1O96B 3L6BA 2KWIA 3T5AA 2HPHA 2FZ4A 3EUAA 4J9UE 4N0DA 3PI7A 1TM5E 4R69A 1A5ZA 5AKGA 2DFLA 1JVBA 3K5IA 4EAAA 2WF5A 2XDQB 5IF9A 1OA0A 4LSMA 1O89A 2QSJA 3TL6A 4DT1A 2Q3LA 3TLAA 4EYQA 7REQA 2IYFA 5DYWA 1L5SA 4PLWA 5LN1A 1Y5MA 1GU7A 1R8QA 2AD5A 2BI8A 2F59A 1V7ZA 3B3QA 3VYTB 1YACA 2WZCA 1Z75A 4MUEA 3LOPA 1M6YA 2IXTA 2PRJA 1GPBA 2VFAA 1M83A 4J03A 2J6CA 1B3RA 2GNPA 5KC9A 2EXXA 2Z1MA 4HDRB 1DKNA 2A0UA 2O7VA 1K4KA 3AJDA 3PI6A 3V9AA 3Q0TA 2FY8A 5REQA 4P3XA 5LMCA 3LXRA 3M83A 4U00A 1SUAA 5I9NA 3EVTA 3AIMA 3IV7A 5J23A 2CGEA 3DOFA 1HT1E 3BTVA 1BVYF 1DX6A 1TDJA 1BYIA 3KYJB 3OURA 4MDHA 4RLSA 1MABB 3AF5A 1KJWA 2NO0A 3B9BA 2OAQ1 2WJ6A 1X0VA 3DV0A 2VHQA 1V26A 5KYGA 2EU8A 3ZDXB 3AVXA 1QK4A 1HA3A 2EFCB 1YR7A 5K05A 1VP3A 1IG3A 4RNDB 2WM3A 1FRVA 1G38A 3KETA 2ZB3A 1C8VB 3D8UA 4ZT6A 4J0EA 5TE9A 1SC1A 2B4RO 3ZHUA 4M7OA 2CVQA 4ZT3A 1L7VC 2EZ8A 1OX4B 4E1VA 1UT5A 2AEJA 2BBWA 5FXMA 1AU9A 2D1YA 3BJEA 1PRYA 2V6FA 3AFGA 2WLTA 1Z63A 1E20A 1R8JA 4QDXA 4UNIA 2FWAA 5ALSA 5L7YA 3DQQA 3MSCA 1RTKA 1TCVA 1S2IA 3TLGA 5I01A 5KTSA 1BDHA 5B7PA 3D6NB 3AL0C 3OTQA 1KF0A 1RWOA 1P1CA 2VUSA 2QT0A 1ACJA 1REQA 1KERA 2XUIA 1OT3A 3TWOA 2C99A 5B7GA 1LNZA 1UFVA 4TTAA 3VHXA 3WGOA 4WK0B 1LPSA 3LSYA 4ZYYA 1AXEA 4XM0A 3DF9A 1KNXA 1S3SA 5GPBA 4FKBA 3WRYA 4ETMA 3FWYA 1KEEB 3K2QA 4M9RA 3TBKA 2JLXA 3F6YA 1J2YA 1PGQA 1P2TA 3C6QA 1TIPA 3JXEA 4DGQA 3RRZA 1N2CE 1Q91A 4YACA 1U7TA 5LVAA 2AOWA 1PFWA 3I9V1 2MSCB 2O52A 1ZCBA 1I9CA 1UKEA 5F76A 3V1NA 1N2GA 3RSFA 1G7TA 4EP1A 1FTNA 2NO9A 3F8TA 3LX6A 4NV3A 1BXGB 2BGUA 4K9MA 3GFPA 3H2KA 3TCKA 1SXQA 2AW5A 1DC4A 1XMIA 4PGAA 3GVPA 4KNWA 3W3AD 3HA3A 5DNVA 3HM2A 3GNLA 3AR2A 2CMKA 2VSOA 1VMDA 2B36A 2QZSA 2JIDA 4UTRA 2RGGA 3IT2A 4YXFA 4RPLA 4N5NA 4BCCA 3EWIA 3H1EA 4KR3A 2EKDA 4MCAA 4A10A 1FUEA 1H2FA 1LPNA 5HGJA 3ZZTA 2EQ5A 1Q21A 1Q74A 2FR0A 2L82A 4LYJA 3TMKA 5L7TA 1Z2AA 1NVAA 3N0WA 1U28A 1GN9A 1XU9A 2PCLA 3EDMA 3ZBTA 1F06A 1TM4E 2XOKD 5FL7D 4ZCIA 3ZNOA 3WSTA 2KMLA 1U2EA 3HXLA 5IDQA 2R6AA 5KQGA 2Q2OA 4BNIA 3ET5A 1ZK1A 4HNAA 5EIAA 3BWBA 4FI3C 4OQ4A 3RHFA 3WNZA 2V6MA 4D4IA 4FYMA 2APJA 2GEFA 1QYCA 3CLRD 3GLHE 4TRNA 5H02A 2Q7OE 3U1TA 3TG8A 3IQHX 3OESA 5C46F 3GPCA 3IQFA 3D81A 4MR8B 1YB6A 1T6YA 2EDAA 3I42A 4R54A 1JAIA 4H6XA 5CCDA 4CN9A 2WLSA 4J7CA 3TRKA 4G67A 2ZSUA 1B74A 4A5OA 2XMPA 3JVUA 3W5UA 3P9YA 3AHJA 3WV4A 2YFYA 2VIIA 3IUQA 3A4LA 4FIZA 2IX9A 2IS6A 5BSVA 4FE3A 1S0UA 5EINA 3KXKA 1HZJA 1KI9A 3OLYA 4MITA 8MHTA 2A9PA 3HBNA 3RAPR 2QX4A 2I1LA 3KB8A 4UQLA 4BFSA 1B42A 3A4YA 5T41A 1UJ2A 3DKVA 5FI3A 1GZVA 3M6IA 3M3PA 1JV2B 5C81A 1Y9DA 2J09A 2ZB4A 3G79A 3AW9A 3L43A 3OTGA 4JI8B 5FTLA 3OE5A 1ZIXA 5I9TA 4X0EA 5A7HA 2CJWB 3LW8A 1WXHA 2OT3B 1H22A 3C6MA 4TTSA 4QQNA 4Z53A 1CRZA 1TX4B 1X8JA 4RV4A 5D7BA 3RTEA 2WKWA 3VR1A 5KQLA 1XDBA 4Z49A 5KVAA 5IN5A 5FTMA 4OLHA 4R0NA 4N7RA 3GK3A 2VT7A 4CTOA 1UMBA 3AFOA 1RYEA 3QVJA 2PD3A 3IMFA 1GADO 2YHBA 1M6VB 4WGGA 3CCFA 1KQGA 5K8TA 3IUBA 4QJ4A 2VEOA 4HGRA 4RK4A 4XJVA 2DCUA 3TI9A 1T8PA 3RYHA 5A5VA 4R9UC 5C1BA 1T1JA 3LC7O 1F60A 3VXKA 3WK8A 7ADHA 2X2PA 4Z4EA 2BE7A 1M5UA 1U2SA 3AOGA 3DE5X 5FOQA 2EBUA 4P4NA 1YKFA 2CNDA 2WILA 3RKUA 3JALA 2PMBA 3KOMA 4M86A 3RNLA 1ZO8A 4LNAA 4KWIA 4CG1A 3GFRA 3IOCA 4A15A 1U6JA 2RB5A 5EHIA 3R3UA 4XTRA 2ZJ4A 3CLTC 1E2NA 2AUMA 1MVOA 3D2CA 4RX1A 4B3CA 2NV2B 3WTCA 4F6RB 3IQWA 3FUUA 2VHVA 2YJ4A 4MYSA 1LC3A 5T6BA 1H85A 1EB8A 3LPNA 5IJXA 2PBLA 4DM3A 5JXWA 2JLSA 4GIBA 4NQZA 5JNSA 5CUQA 2R6DA 5ERGB 1JG3A 1QONA 3WGMA 3DAHA 3EGDB 4YJ3B 5DTRA 1JQBA 3HZHA 1WPQA 3LQKA 3AOEC 3KUCA 3L8FA 2JIPA 1JLLA 1LPPA 3ZGVA 5HIAA 4MTCA 3X1JA 2R87A 1TZJA 2Q46A 3SJ7A 5DN9A 3BMXA 1XVVA 2FG7C 3QRWA 1XFDA 1U04A 1UBMS 4R05A 1H3NA 4HAIA 1SOUA 3ICCA 1G2IA 1SOMA 3O31A 4P3YA 5TR9A 5J5CA 4MLDA 3X2FA 1M76A 1N2JA 3ANTA 4NE2A 2OHHA 4NPAA 3FZYA 4TQGA 3WLKX 2R3SA 2AXQA 3DAFA 5LB2A 1HDIA 5K6TA 2GHIA 2AGVA 2FSVA 4J2OA 4KQ9A 1SC3A 3L41A 3IV9A 5EFOA 4NYIR 5JO0A 5F9MA 3FCSB 4RA6B 3AG5A 2WNSA 1P2UA 1QVRA 1K6IA 2JI4A 3G13A 3MWFA 4JSYA 3MF4A 4INPA 1CB7A 3A9VA 3SIWA 5DE3A 1SNYA 2BHTA 3A1NA 1PZXA 5JDCA 4KI0A 2WAOA 3FROA 5H16A 4CKEA 4QSMA 3JARA 2E4XA 4DYDA 2WI8A 1K75A 5DX0A 1PQPA 5K3SA 3ZH2A 2B21A 2ZT5A 4IUDS 5AR1A 4MQFB 1PEAA 4JQSA 4IO0A 5KOJB 1YQUA 3T61A 5FWYA 1SXPA 3ENNA 3GT0A 2NMVA 2GETA 4V02A 2YBDA 1BS9A 3GUZA 3H11B 4CIXA 2GPAA 4KR0A 4WIAA 2JJ1A 4I7EA 3MT0A 1N1GA 4N5IX 4DYHA 2H7XA 2O7QA 1DQNA 1XTPA 5EKUA 1L5FA 4JQCA 3UZUA 3EXAA 2I34A 3HGMA 4JVLA 4P0TA 4E46A 2C97A 1J5XA 1DX9A 2YIMA 2FSIA 3RUHA 2L18A 3CX6A 3QPVA 4Y2UA 4GWLA 3NX4A 3BG5A 3L1IA 4KZPA 1IM5A 4YR9A 1X7DA 4QOGA 1EUCB 4NE9A 4YFVA 3AR3A 1ORVA 5A4MS 1FDSA 2EJTA 1N5OX 5C18A 3ND8A 2D7CA 2V0CA 4J2HA 1MKYA 1A4RA 4I08A 2NP6A 3A1VA 1EXDA 2HLNA 1KR2A 4JB2A 3E2PA 4ZEOA 4IHJA 3UMVA 3SJCA 2WJJA 5SY6A 1NP3A 4YB8A 3TGLA 1JU4A 5JCPA 1UFOA 3ANNA 3OUTA 4J07A 1E2DA 2YRFA 1NVWQ 2IUSA 2VH2A 2D8AA 4O4IF 1JBEA 4YRPA 1Q7CA 4OHKA 4AO6A 1II9A 4O3FA 3A37A 1NLMA 1NQTA 1SOWA 5E1OA 4HTFA 3PNLA 3HCOA 1MR3F 2ATEA 3BRQA 5KAMA 1LBHA 2A35A 2Z2ZA 4ZA2A 3M6XA 1EHIA 1PBTA 3H19A 4NL4H 4ESOA 3CVJA 1CERA 3STHA 4FSHA 3MELA 3QKRA 4UE6A 3W7AA 3ZWAA 3F7OA 3F6EX 2ANBA 4MUAA 1YQGA 3S6JA 4JB0A 1ZEMA 1N25A 1WMSA 4ZJUA 2EHJA 3EPPA 2ZBPA 4BIIA 1KQ3A 3K73O 4JT2A 1V5FA 3QBDA 4ZVQA 1LNQA 3Q11A 4C6TB 4DCPA 2YQ5A 3R20A 1TVKA 4ID3A 4QQ8A 4WXYB 5IBQA 5K0CA 1ZLYA 2OB2A 2GWRA 1N6HA 3O91A 3JQFC 3SQLA 4B76A 2YBEA 4OBXA 3QPUA 3PC3A 3O8QB 4H3VA 4EFMA 2HJSA 3ZDFA 3QUBA 3LF2A 3QKUA 4HL6A 4HX2A 5E9JA 2XXAB 3QFSA 1VYTA 4K7JA 2BP7B 4U7TB 1VKHA 4FLFA 1TA4A 1SQ6A 1GNRA 1JEDA 4MVXA 3ENKA 4IRXA 4CTMA 2GN2A 2YIJA 3BFVA 5BMOA 4JR1A 4IDHA 2WYOA 2X8WA 4E15A 2WHEA 3MOIA 4P84A 3FBTA 4LRQA 1QOQB 2B7CA 4DMRA 4E2XA 1NUSA 2XUDA 5JRJA 3RGGA 2QUAA 3C3XA 4I8XA 2YY5A 4ANFA 3GPIA 4JU9A 2Z6AA 4L3OA 3L8YA 1MEOA 2EFGA 4S1NA 3E5NA 4PFQA 4GX0A 1GQOA 4IDPA 5EZ6B 1NFQA 4QTUB 1PFVA 4GPZA 1UWVA 1LZKA 2D7JA 3RPEA 4DM4A 4H7IA 1VB3A 3VR4H 3E3NA 3FYUB 4O63O 4AD8A 4RKQA 1TO1E 1FXWF 2R11A 5BR1A 3GDGA 3AR4A 3PGJA 1W36C 4Y6LA 4AMGA 3K1YA 4Q9IA 5JDCC 2ZRDA 4KQEA 3BD8A 1ECPA 4CL0A 1AUPA 3JAKB 2X1VA 1VBNA 4Z7QB 3RWOA 4AAYA 3EJWA 1N5IA 4K3VA 1BWQA 2ECFA 1CSEE 2P9JA 1U28C 4MYRA 3I5MA 3UJ6A 1DWUA 4I1PA 3GH1A 6REQB 3TR6A 4ZOLB 1D6NA 1L8AA 3EEYA 2ZQYA 3TYXA 4U63A 1XHEA 1JJIA 3ENWA 5JNLA 2HA2A 1UPFA 1H5NA 3SYLA 4WDRA 3W6PA 1RI1A 4NMXB 5BUCA 2YWEA 2F3RA 3X1WA 2EOAA 3MUFA 1CRPA 2BBTA 1XTIA 2P90A 3ASVA 3FSJX 2NXEA 1Z4QA 4OJQA 5ICFA 2QIPA 1WF6A 1SZPA 2PKYX 2AZXA 3QXHA 4LRYA 4WECA 4JVSB 2GSDA 2QD5A 3DUWA 4UEQA 4GOKA 2KYRA 2AL7A 3A10A 4DLTA 1E3DA 2F7SA 1Q20A 3N28A 3SQNA 2VP0A 2QUJA 3SC4A 4BNDA 3U81A 4RD1A 1VLMA 1Y63A 2OV1A 2WSSD 2AZ4A 3H8JA 4NAUA 5C32A 1LSOA 4R1LA 3ZI4A 4LXXA 3CVOA 3L6RA 3LWNA 4YGXB 3O9MA 1E5VA 4OKNA 2EW1A 3HHPA 3L3BA 3OF2A 3VU1A 4E1BA 2ZI4A 4F84A 5G4LA 4MVYA 1Z74A 2VDNB 2VWPA 5GOZA 2ZAOA 3LDHA 3ZWBA 4DLPA 4EHNA 5IM4F 1UK9A 2F64A 4GH5A 3C5HA 3GLGE 1LNSA 1UXIA 4G25A 4RZ2A 4XH9B 3WAKA 4JXXA 2ET6A 2YUIA 1GWNA 4L51A 4PO8A 1H2YA 3ULKA 5K4AA 3BGSA 4JI1B 4DNOA 1BCRB 4HYYA 3LRXA 2VJNA 2I7DA 3BMQA 2V4ZA 3Q3CA 3UAZA 2J0UB 1RI2A 1Y6GA 1NONA 1TMOA 4MYHA 4ROSA 3DCYA 4YCMA 1MGOA 3ASZA 4HZUB 3LUCA 3ANYB 2H7CA 4UBMA 2K4MA 4ZI2A 4O2BB 3DAPA 1KAGA 3PCRB 1QGUA 2J4CA 4YRRA 2BUCA 3SOZA 5ELXA 2VJAA 3FTFA 2RE8A 1XCMA 1I2BA 4NZZA 4RANA 3WX0A 1W88A 4X1IA 3GQBB 1R74A 4P7JA 1GU0A 1YJ8A 4XB6B 4NJMB 2DFNA 5GY7A 3RS3A 1US8A 3GDOA 1FBNA 1LLUA 4C5BA 5JJBA 4AQYB 2FW6A 5D85A 1KNQA 1UIRA 1ZH4A 3IODA 1GY8A 2QRUA 3WMEA 4I1VA 1TMGE 2JBAB 1NWCA 1Y8RB 3D3NA 2PLRA 5I4KA 4QJIA 3T7RA 4AWBA 3OICA 4I81A 1CDOA 3CE9A 4MS1A 1R00A 1MQ8B 1B6RA 3R5SA 3NIDB 5MFPA 1Q19A 3U4GA 5FTJA 5HKOA 3AVUA 1V35A 4MQEB 5CLLA 4G09A 1I7DA 4A36A 1S01A 3VPFA 5BWMA 2FK8A 4KQFA 3FRHA 1QH0A 2E85A 1UOEA 3A4NA 2XCTB 3ZVNA 1BVRA 3AI2A 1SA0A 3EC2A 1LQUA 1EX6A 1YUMA 2RK4A 4CKBA 4TS3A 3NHFA 3NTRA 1PZNA 1D6MA 3OH8A 3EG5A 3HQ4O 1H93A 2C2GA 2VLBA 2BTQB 4LA4A 4LC0A 1UBLS 3V7FA 2IC5A 1VHTA 1EAYA 2FRDA 4TN5A 2HQRA 1RI3A 3EVEA 1ZM7A 1BJTA 4LIPD 1J2TA 5CT4A 4DLAA 3AEYA 3C5VA 1G6Q1 1JVNA 2ETVA 3KSUA 4MWBA 2WSYB 3L0BA 5L53A 1C7JA 5I47A 1FP6A 4PF1A 2PX2A 3P9XA 1JEQA 2P5YA 2YCBA 2YZGA 1K27A 2YINC 2X0KA 5HK8A 2XCRB 4OYHA 2QBYB 5HFAA 2XE8A 4TVOA 4TKVB 3VH4A 3DO5A 4LWOA 2QQFA 3NXSA 4HQOA 2WJ3A 3H7IA 3OIVA 5TDHA 4CHGA 3KJNA 2VHTA 5A4JA 3TO5A 2HQSA 3C43A 1T5LA 1RYMA 1CPYA 3DXXA 2PZLA 5A6SA 5IF3A 2HU8A 5HIMA 1O2DA 4EMTA 2B9VA 2NZ2A 4P9NA 2WF7A 4WN9B 1Y3CE 3AUUA 3H9CA 2RC6A 1QP4A 3GRKA 4WCFA 2DWQA 2X3UA 4EPYA 1DIBA 1SU8A 2IY9A 3TLYA 4AC9A 3FOZA 1GZHB 1Z2DA 3KTAB 4KQKA 1HNWB 4RKYA 3ETHA 4IYJA 1IM8A 2PWPA 4PRKA 3LT5A 2HR1A 1JPUA 3RSZA 1E2PA 1UBNA 1QPBA 2GA8A 3F46A 1PKXA 3GLTA 1OKKD 4QXAA 1Z0IA 3VNAA 1P73A 1NJ1A 2QM3A 4RPHA 3O82A 3GLFB 2OBBA 1XQWA 4LOJA 1PW5A 1V5EA 3PQEA 2R1TA 1RWWA 4FKMA 4N4AA 5KCMA 5DNWA 3ADOA 1SFRA 4LSWA 2OBFA 1EBBA 2YIDA 2AFRA 2QSUA 3P94A 3FMOB 1GPNA 4QXOA 4EHLA 4W1RA 1NW6A 1JHZA 1E2HA 1EU1A 1FMJA 5KOIA 5EE0A 3AIIA 2XAAA 3U56A 4US0R 3OF3A 4IG9A 4B47A 4TQ9A 2CDNA 1E4EB 1TB4A 2OB1A 2WF9A 5AKYA 1WTCA 5HBGA 3WGHA 4E4TA 4DR4B 1DUSA 4N1AA 1W4ZA 4P36A 3BMOA 3TLXA 1EFKA 1V96A 4CVNA 2BFPA 4JA2A 5B6JA 4HRYA 3VR5H 2YVAA 1OC2A 3HWWA 2R1ZA 4KFSA 2IWRA 5A4IS 5I8WA 3AUAA 4YECA 4RGYA 2EFEB 1E2EA 2A4MA 2ADFA 5TMPA 2WSBA 2QTBA 2OHOA 4CUKA 3M1IA 4JHXA 2X9GA 1Y7LA 2A4KA 3BDVA 1XQYA 5FJIA 4UDYX 1CUCA 5T4HA 3OM0A 3RQIA 1G8SA 4Z6KA 1Y5NA 2OYRA 4PPFA 3CLSD 1YDWA 3JQGA 2H1IA 1XRPA 3BMNB 4YYEA 4Q7MB 4JLAA 4XFJA 3R0ZA 4B7XA 1NLYA 4F4DA 1Q3HA 2CZCA 1RQGA 2H2HA 2IY7A 5FBRB 2VWGA 4ZOAA 2ODEA 4X93A 4L5IA 4EUSA 4NBKA 3D3EA 3OLCX 5AKKA 5LB4A 1UBCA 4PAWA 4GZ5A 2CYAA 4D98A 2CXSA 3GZJA 1WETA 2XF2A 2QTMA 1DIGA 1II8B 1W7AA 1DS6A 2Q5LA 1E1LA 3FH0A 3HWRA 1H9CA 2J1LA 2CUKA 4XUGB 2PD6A 1Z07A 1SMKA 5KWJA 3RUCA 3S1SA 2BM1A 2W7TA 1MH1A 3QX7A 4O5AA 3PNBA 2ONYA 4N5DA 5DHTA 1QFYA 1KJ9A 5BSEA 4LXUA 2GARA 1U8CB 4JWTA 4MA4A 3TB6A 1QZ3A 4N8DA 4ARUA 1OR8A 3GR6A 5CIYA 2H4WA 5D2CA 3WA6A 1GCUA 1TKAA 2C3OA 3CV3A 4YJHA 1CJSA 1QQ7A 3G0CA 3PQ8A 4U8GA 4UATA 1JQEA 3WHKA 1XI2A 1OY1A 4J49A 4MPJA 4YRFA 2YFHA 5C1IA 3T15A 2JHAA 3RVBA 3BXEA 1E8NA 2VJYA 4LUCA 1T26A 1QLWA 1BMDA 4GW3A 5AM4A 3SD7A 3KNZA 3KQNA 3RE1A 1E61A 5EIHA 4EFNA 5DM2A 2OWDA 4HPWA 1NATA 5HRUA 5LD2B 4KFUA 1NPYA 3I72A 2OBMA 2DUMA 4RCYA 4KXMA 2I2AA 1IQUA 3GCZA 2I0FA 3SPXA 3D8HA 4EAQA 3B6EA 1YDMA 1GQFA 3VYVA 1I80A 2HJGA 3PSHA 4XJSA 3UT5A 4KPUA 1BKSB 2ISCA 4V0SA 1T15A 3MGCA 1P8AA 2JGIA 3AIKA 2IIVA 2WHYA 1F2UA 1YA6A 4FU0A 5ALYA 1Q1AA 3OG9A 2GT1A 2I1VB 2YY7A 1M0WA 3C7DB 1NIJA 3EARA 4KACA 3CNBA 5FD8A 5KO2A 4TRMA 2Y1OA 2ZRNA 3HVUA 3U3OA 4CXMA 3PU6A 3DLAA 1L2TA 3AP3A 4URYR 4B1FA 2WFMA 1CX9B 1NPTO 2IYXA 1SXJE 3M6VA 4BNZA 3I39X 1TQHA 5E1MA 2OD2A 4QODA 1FNNA 4D0GA 3C7TA 3O0TA 5GTDA 1EWVA 1U2TA 2YYAA 4BNKA 1YGPA 1PWHA 1N33B 4UAGA 1WXIA 1N6KA 2J07A 3CSDA 4YFYA 4BEJA 5L8VA 2UUBB 3SLGA 4BMZA 2DFKB 3V4RA 4KR7A 5BNFA 3ZEIA 2F1JA 2VWQA 3ZE6A 3GCXA 1RPJA 1M7GA 3A25A 1GRVA 3E8MA 4AZ0B 5BUZA 4IUBS 4AJIA 1YOBA 1KI3A 2IVFA 3A1UA 4TYNA 2VC2B 2AS0A 5IAEA 5JH7F 4TVKA 1VPEA 3JYNA 2HMUA 1CRQA 3DEAA 1QFSA 1RADA 4OREX 3NTUA 2H85A 3HL4A 5JPDA 5BSTA 2GKSA 3Q98A 2FLVA 1MIOA 3L7LA 1JJAA 1XVAA 1K08A 2JIZA 1E62A 1WDWB 3I1IA 4K1XA 4OHZA 1IXZA 1TRKA 4GSKA 1NVBA 1YMQA 2VNHA 2EZ9A 3FPEA 3Q6NA 4TMTA 4WI1A 2VPTA 4MKXA 3RBAA 1R9NA 1LB1B 3PIIA 1E3SA 1K9SA 3KJEA 5TJ9A 4AWXA 1R0YA 4K9QA 4RSRA 4F3RA 4Z4QA 4U6NA 2WDPA 4OHBA 4NK5A 1KSGA 1C7QA 4KPEC 3IXQA 1L8QA 2YHAA 3OY2A 1W25A 1NC1A 1SCAA 3OJ0A 4NQRA 4LY3A 4QEDA 2JFQA 4Q15A 1NUTA 4RJKA 5KTTA 5B64A 1CEQA 5DISB 3S5JA 4RVCA 4ZCRA 1ONOA 2AOUA 2QRGA 2CMGA 4NEQA 3VHRA 4K6FA 4DDKA 4DPMA 4HZGA 3MBKA 5C5DA 3F6SA 3GZTB 3SQWA 4OBBA 4BL5A 2P9EA 4UEWA 1YRQA 3OE7A 3TD2A 4OD0A 1U6IA 2PUCA 5EJ5A 3H87A 2ZWMA 2O8NA 2WK1A 4S1OA 3IXLA 2HXSA 3VJRA 4KIGA 1DQSA 1XTRA 2MSDB 3OHPA 4DZZA 3OJCA 1E94E 2OXFA 3PGMA 1P3JA 4W82A 3E2MA 1T8RA 3WYEA 5HF5A 2CNLA 5DSTA 3TEMA 1ACLA 4LQDA 4BKPA 1H8HD 1DAOA 1M2HA 3UA4A 2GM5A 1ADGA 1L4LA 2FSGA 1MFPA 1ML4A 2FFQA 3VGPA 5A1TA 4C7KA 4D9JA 1YB2A 1GQQA 2AMVA 2XCIA 4NESA 4H0NA 2PXAA 3KZMA 4PLZA 1YF3A 2BH9A 2YICA 4M46A 4ARSA 1TLTA 1FX0A 5CJPA 1E1CB 4HJRA 4RTLA 3HV0A 1U3WA 3TZHA 3NHLA 4MDFA 2JC3A 2NG1A 1W4RA 3RVMA 1TUBB 1ZN7A 1Z6GA 2FXIA 3EVGA 2AKAB 4I4NA 5AUNB 2E5LB 1KFBB 3A04A 4BFLA 2GJ4A 1F8XA 5IYZA 2GVDC 2ZIFA 1QVVA 1SVLA 3BRWD 3HCWA 1ZVQA 3HSKA 1XNJA 4OB8A 3WXBA 5JCJA 1S8OA 2YHIA 3LLUA 3PFIA 3S8MA 4DMMA 4M8SA 4BUZA 4ZZ0A 4LRTB 4RD4A 5TMEA 4PRLA 3C3MA 3AKEA 3AJRA 5DK4A 4C6SA 3FCCA 4AN0A 1LDEA 2PV7A 3W2GA 4NAHA 4QGFA 1MAWA 1NDHA 2NO4A 1LPMA 3P96A 3H4IA 4C6HA 4EELA 2IPLA 4GX1A 5A4AA 3VC3A 4D0RA 4NFSA 3DHWC 4GZMA 4YEDA 1YS7A 3UHOA 4JGIA 4BO0A 3SZRA 4GP9A 4CMBA 3VSEA 2Z95A 2Z3ZA 3GJSA 5T4FA 4DMCA 2G77B 1PFQA 3FNHA 2V58A 3K0CC 1GV1A 3FFBA 1D2MA 1ODKA 2QUHA 5AWFC 4JLMA 4MYUA 3ZWNA 2Y0PA 3CN9A 2B3TA 2CBXA 1IQ0A 2XDQA 2DQKA 3DLTA 4JUFA 4PRYA 3PQ7A 3I5XA 3RRJA 4GQBA 2ZBGA 5MGBA 1J42A 3TZEA 3CWZA 2VAPA 3ZGYA 1Q7BA 1TKBA 3HBFA 1HFKA 3KFVA 2ZAIA 4X7BA 3EQ6A 5GONA 1Q50A 1NN0A 1M2KA 3V5NA 4F21A 2CY0A 2IEYA 2AXPA 3HKDA 1T3HA 1AMUA 4I50A 2QW0X 5BWBA 1AT1A 1NQVA 3CRVA 1UBRS 3QM1A 2WJAA 4XEHA 1WBDA 1V8PA 2C4NA 1ULSA 1GUYA 4O4LB 4MP3A 2VPXA 1MPTA 1P1HA 2AEFA 2YJ6A 3FFXA 3BIWA 3M5CA 3MLEA 4HS9A 4Y9SA 5CIWA 1YZYA 3VBCA 2O8EA 3R77A 2QVBA 3DDNA 4TWBA 2Q4EA 3WOHA 2I7CA 4C7OB 2CXXA 5DI3A 1MAAA 1ABFA 1ORRA 4JOCA 3L1JA 1T5IA 5E7IA 1D2HA 1XX6A 4D4GA 4Q4JB 5IVKA 4IZIA 1JW9B 1I94B 1G1MA 4DUGD 2ZXEA 4IQGA 1WCIA 3N2KB 1P4SA 3IESA 5IHPA 4JX9A 3PDHA 4WESB 5ISMA 4P93A 1E9BA 4Z54A 3FDJA 2AE2A 2VJMB 3PGKA 4TXHA 3QKTA 4PG6A 4UVIA 3EAQA 4XGNA 2XUGA 4WZZA 1QG2A 4C3ZA 2DTEA 5JWOA 2PXHA 3E3AA 2N0SA 3PFNA 4ARZA 2F8TA 2SCUA 3NV7A 1YS4A 2LGJA 3MJRA 4BRWA 1Q95A 1VKZA 2BF4A 1KH3A 1DUVG 1WVMA 3AF0A 5HM6A 1ZEJA 3VO2A 2X0DA 3RU9A 1XWIA 2C94A 1OE0A 1XZKA 4I9NA 1YO6A 4PGFA 4RD2A 4RMIA 2V7PA 2RIRA 4NCIA 2OCXA 1XQ1A 4AF7A 3I05A 3GOHA 4IP0A 2Y1LA 2ADOA 5H0IA 2G04A 3W05A 3H8WA 3V7WA 5EL0A 5MGNA 4HFNA 1IB0A 5JHHB 3H4TA 3O73A 5JRDS 1IXKA 1KAHA 1BWPA 2XE4A 4NJEA 1JWBB 5HKKD 3FTNA 3W5BA 2ZRIA 4XIFA 4NS1A 4EUKA 1JDTA 3QJYA 4RQBA 4C06A 1JILA 3PVSA 3QHQA 3PPYA 1WB6A 1IPHA 3WP0A 2FZ5A 4KHZA 2O0LA 1JEQB 2P2ZA 4JB8A 4D8WA 4BJ1A 2J0SA 4QYXA 1XFAA 2XKBA 3IAHA 4JDUA 1LZLA 3Q7QA 2CHGA 2OLEA 1CCWA 1X7GA 3H6HA 1T4DA 4ZVOA 3UTCA 3RVRA 2Z2JA 4LDPA 4IVQA 3OU6A 4IDEA 4E7OA 4Q4HA 1IBLB 2AE1A 3LRTA 2QYSA 5KNBA 1B23P 2NU6A 5ANRB 2A0YA 4HDSB 4PLPA 4C3VA 5H81A 2CJXA 1CKEA 4GPAA 1VRWA 1TIKA 3C1TA 4XB1A 1BOFA 1EDDA 1E9VA 3L06A 4PHCA 4MKGA 4EG3A 4F1JA 3B3AA 1T2VA 3DE6X 1CQWA 2B1GA 1L4FA 1RPAA 3DZDA 4KBFA 5EA2A 4TLDA 5EEGA 3DL4A 2MSEB 4BECA 4JI4B 3EH2A 5HMLA 1OZHA 1NY5A 3SF8A 3TRHA 2ZVJA 2AKYA 4ZFNA 1ZUD1 1G21E 2CVHA 4J1QA 3BDIA 3MCAA 3W8RA 2WKRA 1M8JA 1NLUA 2Z4SA 4FFOA 2A58A 2LUOA 5H1YA 4OV6B 2IWHA 1QV9A 5G0WA 3EZ9A 4DLYA 4KMRA 2OOSA 5CFOA 1W36D 2QHXA 4PHTA 4ZDWA 1YVUA 2Q6VA 4QUAA 3RT7A 3RS7A 5F2KA 3TVYA 5DHAA 2VDLB 2NNWB 4F5YA 1JHVA 2RAPA 3UJAA 3EVCA 1X1RA 1ISIA 1Z3IX 2IHVA 1J25A 3LX5A 3HY4A 3SYKA 3RC8A 4EM6A 1GNSA 1M2VA 3DULA 3G82C 4O08A 2Q49A 3HDHA 2P11A 4EEXA 3FE2A 3A9SA 4JNCA 3E1GA 2MSWA 1BMTA 2XNDA 1IHPA 4XX0B 1DBPA 2IDMA 4E22A 2BGLA 5YASA 1RC8A 5ALDA 2AV6A 3ZCQA 2CD7A 4D4JA 4DLSA 1DG9A 1NUQA 5LP6F 4H18A 2H4ZA 3DMFA 1O87A 4TSRA 1IY0A 3R8XA 1V71A 1SEVA 2NVUA 3LA6A 3PYXA 4V0LA 1V3VA 4CMIB 3BZBA 2QL6A 3PK0A 2XHZA 3OZVA 4IDDA 3FUVA 3ENQA 4QSHA 5DYNA 1U11A 2JI8A 4FKZA 1PYOA 1KOGA 3NWOA 2VK4A 1N0HA 1LXCA 5JNTA 3I2GA 1OXSC 3OLZA 3ETGA 3PHGA 5CYOA 4CR7A 4DADA 4MPPA 3VPDA 1DCMA 2FHPA 3V8PA 1M72A 1AHIA 5CPBA 3LCUA 2X1LA 3M6FA 1VKRA 3O7MA 1X7XA 4TRRA 1HPLA 2A8YA 5IUNC 1I14A 4D9MA 1MZPA 3B78A 4L74A 4XDZA 3WK7A 3LCJA 1MXFA 4Q5IA 3ENVA 4B7ZA 1IUKA 2OM2A 2AVDA 3IJ5A 2C4VA 4RK0A 4FEEA 4E09A 1IBMB 2FN4A 1NNI1 4OI0A 3OZAA 3ER6A 1U90A 2C4HA 3GFSA 2FEWB 4YS6A 1X19A 2ZWOA 2JFOA 3T3MB 5BPHA 3K9FC 3C7AA 1ORHA 1AHPA 3WICA 3M4JA 5JG7A 4HEJA 5IC4A 5K5EA 3AHGA 2A33A 3HYNA 1OOEA 2O4UX 2ZM6B 4UE2A 1AN9A 3IKJA 2I6GA 5EZSA 3GCWA 4MW5A 4OKSA 5CLQA 5CG1A 3G2MA 1NM5A 3B3JA 4CL2A 4BO9A 1DQZA 5AVRA 3H42B 3LUAA 4BNGA 1Y5LA 3DAYA 3BQ9A 4EHHA 7MDHA 2L19A 3KK0A 4Q4LA 1K0FA 4EIWA 1JLMA 3LBAA 1P17A 4KMSA 4JV5B 3EVBA 5JJCA 4LMRA 2H06A 1SBHA 1RMYA 1CYEA 3K0BA 3OQVA 4UFPA 2P7IA 2WVHA 1AXGA 3JD3A 3EZXA 1WX1A 2ODNA 3IMCA 3IOEA 3OT1A 4RPCA 4FMDB 5CA1B 4KYTA 4OP1A 1UPCA 2H00A 1MAVA 5IVPA 1ZJWA 4DMKA 2NUAB 2J6HA 1ODTC 2E4VA 1WXWA 3CTMA 3GNTA 2Z8YM 1PQYA 4AZWA 3AEUA 3U19A 4IBOA 2DTXA 4B9EA 2YJGA 3KLOA 4GGPA 2Q5FA 4R5HA 4ZTBA 4CE6A 1T6ZA 1ZNWA 2ATXA 4UD6A 1JG6A 1W5EA 2ZTSA 1WXXA 2JD1A 2Q4OA 3NETA 4G01B 4ND3A 4MHOA 4QU5A 2QYTA 5L3ZA 2XGJA 2JFXA 3QF4B 2OHVA 4PAQA 3AO0B 2GD2A 4RA6A 3V97A 3KD2A 5FQOA 3V4VB 1URPA 2ZSAA 1TPZA 1U0HC 3P9CA 2DY1A 3BWVA 4DJEC 2BYTA 1S6YA 1T0PA 2X4DA 4G2NA 2QLLA 2RARA 5BW4A 4MK4A 5CBKA 5HWSA 2XYPA 1T2EA 5C51B 3DVSX 2ZUDA 2VYFA 3CSUA 1T1SA 1J5PA 2WHPB 4KO4S 1UZUA 1HNNA 4M49A 2OAP1 4DB4A 6ADHA 4GOXA 3G17A 5CM8B 1XCJA 1M6WA 1RI5A 2KQUA 2HTEA 3IC5A 4YJFA 3ZYZA 2HWYA 2CEKA 4XQ9A 4ZMBA 3AILA 3HVKA 5ENZA 3NQ41 3DTNA 3E7PA 1J6UA 5A9SA 5KVVA 2G25A 2GFHA 3MJHA 3OKFA 3QXJA 3LBHA 3R3XA 3ZQ6A 1CQZA 3AI1A 2C20A 4O3MA 2D4HA 3DWIA 1Q7EA 3A05A 4QVIA 1H4SA 3K9CA 4N12A 3GJ6A 1FXSA 4A8JA 2JGDA 1C8LA 1AZTA 3OLWA 3PR2B 4HAVA 4G5QA 2C9CA 5EKXA 5IVHA 3FJ1A 2VRCA 1EE1A 4L6CA 5JD4A 4B5LA 2JGNA 2Q28A 4C88A 3EG9B 3MRSA 3TXAA 3LP5A 4A2PA 2IOQA 2Y27A 4I55A 2XUPA 5JW6A 3U4MA 2XJ4A 1PJQA 3KL2A 1FLDA 2YL2A 3D1LA 4DQXA 5AUPB 5TEWA 4FFWA 3QU5A 4P3KA 1XQVA 5JSHA 4G81A 5CHYA 1WCXA 2YXEA 4DABA 2OXTA 1ECFA 3RIYA 3BFKA 3FKQA 3ZHTA 4BE4A 4CLOB 3E3OA 4B7CA 1BFKA 1P80A 4Y3UA 4CKCB 1R64A 3UGQA 4KQMA 2Y2VA 1EX1A 1RTTA 1TC1A 4RD3A 2W9XA 4TZ0A 5I48A 1C29B 4M9XA 1U3CA 4QD3A 3BIJA 1E59A 3C6XA 4CIBA 4JXZA 2X5OA 2JZCA 4KNYA 3PZRA 4L1KA 4M1KA 5E7QA 4OHYA 3GLIB 4G8JA 1QQAA 3E0XA 1TTTA 2BMVA 2W2PA 3GLVA 4S1PA 2RGXA 2DGDA 2VNIA 3B2NA 4IDFA 4J0DA 4WJZA 2BFEB 3HEBA 1R66A 5IDWA 5UKDA 3DTVA 4UBKA 2QQEA 1CB0A 3V32A 4FYWA 3IHKA 4KLRA 5JDIC 1FFBA 1EDZA 1Y34E 2P8SA 1E2IA 4LY0A 5EMLA 2X19A 3IUMA 3K71B 1B15A 3S68A 4JI6B 3QXSA 2AF3C 2X8LA 5DBFA 4U2BA 1DJQA 2XGSA 1SBYA 4F9FA 2B3DA 3PKZA 2FW7A 4C4XA 4RTQA 5FB3A 1J4AA 5JUWA 2QXUA 1TKRA 4R81A 3K0AA 1VMAA 1NVEA 2D54A 2XDWA 3B6KA 3KXDA 4MEJA 4MULA 3V1MA 3JYLA 2SKCA 4YNBA 5BR7A 3A3NA 1CDZA 2RMKA 3PDIB 4Z1MA 2XUOA 1J8YF 5LKRA 1X3SA 2A67A 2JGEA 2Q5QA 3PXCX 4RELA 3Q0IA 5EE1A 2DXIA 3VUEA 5EE3A 2P27A 1QCZA 3H75A 1FEZA 3FNIA 4FBGA 4G9GA 2PSJA 1OH5A 1JNXX 4TLCA 1HT0A 5EXSA 2JNWA 4FBMA 1HYHA 2VXYA 2OFFA 4MOWA 3WYFA 5HKKA 1DKUA 5CTAA 4UEOA 2NADA 5HQTA 1K88A 2B2NA 1ULAA 1WPGA 3IEKA 4L28A 1QIHA 3NUQA 1R8YA 2X13A 2XB9A 4NV1A 4YP5A 4C7XA 5KYYB 2RGRA 3V34A 4RF5A 1OQAA 3L7CA 4A92A 1B1CA 4EG4A 3TZ6A 3P97A 3B13B 2WF6A 5ESDA 1RQ7A 3CR3C 1YK1A 3EOZA 3ZC3A 1L6IA 1U0LA 1HDXA 5FAXA 4FDAA 1EPUA 1CTQA 1MO5A 2B69A 3ILVA 3PC8A 4MKHA 3TN7A 1XA0A 3UXMA 3A32A 3VQTA 3LCVB 3NP7A 1K6MA 1KH2A 3KVRA 3KJFA 3LUGA 4ND5A 1Z7EA 5ILQA 4YAKA 1V37A 3MSXA 5DSZA 1CP2A 3BUSA 4F1WA 4ENTA 3TXXA 1A5SB 3JAKA 4TXNA 1C1DB 2XDYA