1J23A

Crystal structure of archaeal xpf/mus81 homolog, hef from pyrococcus furiosus, nuclease domain
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
131
structure length
131
Chain Sequence
VKVVVDSRELRSEVVKRLKLLGVKLEVKTLDVGDYIISEDVAIERKSANDLIQSIIDGGLFDQVKRLKEAYSRPIMIVEGSLYGIRNVHPNAIRGAIAAVTVDFGVPIIFSSTPEETAQYIFLIAKREQEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ATP-dependent RNA helicase, putative
publication title X-Ray and Biochemical Anatomy of an Archaeal XPF/Rad1/Mus81 Family Nuclease. Similarity between Its Endonuclease Domain and Restriction Enzymes
pubmed doi rcsb
source organism Pyrococcus furiosus
total genus 47
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2002-12-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02732 ERCC4 ERCC4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10130 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1j23A00
4P0QB 4M6WA 2A1IA 2ZIXA 4M6WB 4BXOA 1J22A 1J25A 2ZIWB 2BHNA 2BGWA 4BXOB 2ZIVB 2JPDA 1J24A 4P0PB 2JNWA 1J23A 2M9MA 2ZIUB
chains in the Genus database with same CATH superfamily
3ELDA 1H5NA 1QVVA 2VZ8A 4UMFA 3MQ4A 2ZM5A 1SG6A 2VKQA 8ABPA 4UPDA 3SD7A 1C7JA 3PDWA 4XGNA 2AG8A 2PRIA 4HZIA 1RT9A 1BOFA 2WWRA 3TB4A 1NXXA 3MEQA 4IHKA 3H6HA 3F2IA 4GO1A 5DHUA 2FPGA 2IL1A 2O7VA 1QG6A 1YMUA 2WYUA 3HV2A 1DGQA 4ZYXA 1SG9A 1ZGBA 5EUQB 3RT7A 3ZWYA 5KYWB 2NUPA 3B9PA 4BMPB 4YMGA 3P96A 2WTBA 3LQRA 1KPHA 4ID9A 3OFVA 3I52A 4I0WB 4LMPA 4F4IA 4UQOA 4EG3A 4ENRA 5F78A 2J5KA 4FC6A 3CPSA 3V4RA 2R97A 2NV0A 2QTFA 4YMLA 2OZKA 1ZAKA 2GNAA 3P8ZA 5JO0A 4BQOA 1ADYA 1DKMA 4DZZA 3OJLA 2J3LA 4EI8A 1XZEA 2XEDA 2XNCA 5IS2A 2Z57A 2ZRLA 4LYJA 1JBQA 1J8MF 4GF5A 1ZESA 2RK6A 3AKDA 4Q4DA 4XDZA 2ZCUA 1NRWA 1Y8QA 3H2KA 4YAFA 2FJUA 1E6EA 3IUSA 3KCNA 4W5HA 5CFMA 1H3EA 3TCNA 2XJ4A 2BFCB 2XE7A 2JGDA 4L16A 4U4AA 1ZC3A 5JCZA 2QEQA 2ZCJA 2ZSBA 4EL5A 4F5WA 5LBTA 3DQQA 2DKOA 1MH9A 4DCMA 1Z26A 4IJVA 1E4YA 4K3UA 5BSWA 1J07A 2GERA 2WILA 2XGOA 1Q12A 1DDGA 2DR2A 4TV8A 4M6WA 3OG9A 4TQ9A 5CA0B 1TEZA 3NDRA 4LAFA 5FWAA 2H29A 5AM0A 5E6RA 5EIOA 4BJ1A 1K97A 3KT0A 2XOKD 3FHCB 4F5ZA 1OVMA 5JVDF 1BMDA 1NJGA 4X64B 3I5YA 1MV5A 2FPLA 1IULA 3C8DA 3FPJA 2W4IA 4KDCA 2VDJA 5LQMA 2VCHA 1RTKA 3VRHA 4I9NA 4WNIA 4IH9A 2CE7A 2NXCA 1VIVA 1GRCA 1RS0A 2C8JA 1OFUA 3CW8X 2DQSA 3DV9A 4BO8A 2E4WA 4WRRA 3RKRA 2Z2XA 3DVLA 3Q40A 2GCNA 4QSHA 1YMVA 4YRZA 3BHNA 5A6SA 1TA9A 5E1MA 1W85B 1Y37A 5HOEA 4UBMA 5LPNA 2Z6QA 2PKYX 3AL2A 1NW8A 5AM2A 1EJ6A 3T5BA 3FA2A 3L8MA 4CMHA 4DNOA 4IQ4A 4BLPA 1KKLA 2G36A 1NI5A 1WLYA 4I9HA 3RYTC 3VH4A 4EEKA 1O94A 1NXSA 4QEDA 5A4MS 2XRZA 5BUQA 1D1SA 5KOHA 4JC0A 4OQ4A 4JLWA 1JMVA 2O2DA 2QD1A 5DCYA 2V0GA 2HJVA 3QFCA 5BSRA 3K2EA 5FO0A 1PNRA 3P2JA 4XLZA 2FAXA 2R6CA 4D98A 4G0YA 3CUKA 2DLNA 1AGYA 1JNXX 3A0UA 3I0ZA 5CM2Z 2PLNA 4DBLC 1FDUA 1T9AA 2XBLA 1KR5A 4XE5A 1YVPA 3EDYA 1UBFA 1HNNA 2F17A 4HGZA 3HU3A 1EWYA 3BH0A 2GX6A 2NO1A 4BNGA 2I6QA 3FSRA 1QQTA 2Z56A 3QX9A 4G9BA 4MB6A 3RTCA 2PJRA 4TYWA 3PA8A 1NMZA 4FGWA 1XEAA 5I5GA 5DM70 3ZX5A 2ZAMA 3ZDZB 3Q4GA 1P73A 3LVFO 4TTSA 1NZJA 4H3SA 5HRAA 4UAJA 2CE2X 4ER3A 2PFGA 5M04A 3BQMB 3EASA 2PSHA 1TIKA 2AZXA 3PL5A 4LFCB 1VHDA 2B7LA 3DE2X 4DCGA 4GBGA 4DCSA 3IDFA 4BN0A 2O8EB 4GQAA 4ARVA 1KEEB 1UBRS 1UUFA 1CZOA 3O7MA 1F5SA 2Y99A 3BG5A 4ZQGA 2WU8A 1SBHA 3EIWA 3L1UA 1NNSA 2CJYA 3AV3A 1KQNA 4DF3A 1JXMA 4D9BA 1UXOA 3DV0B 1SBZA 3ENWA 1I4EB 1X7XB 1ZRNA 2I29A 3ILSA 2CZCA 4FR5A 5I7UA 5DSTA 2H54A 4O4HB 1CUAA 4BNLA 2QK4A 3T7AA 2ZXUA 3I61A 2C61A 3PEVA 1OPXA 2Z1MA 4MOWA 3D3WB 5T3UA 3EAFA 3SOZA 1W1UA 4PS0A 5TJ9A 4NMWA 2YY5A 1H1TA 5TX7A 2HBYA 2FWBA 1LEHA 1B1CA 4YVFA 4UNIA 1VSBA 1AOXA 4AL4A 2GBLC 3W9SA 3ZY3A 4K9OA 3QE0A 2OR3A 3WMXA 1Z75A 3C5WP 2Q1YA 1T9HA 4P3YA 4G09A 4Q01A 1W581 3KB2A 3LUDA 1W36B 4DV3B 4I7EA 3PGJA 2WIFA 4V3CA 3LRPA 1EFVA 4S2EA 1G59A 1CYEA 3M6UA 1FTNA 2JIRA 5AMXA 2C59A 1D2HA 1QHGA 1LCIA 1TJNA 3DPIA 3DUFB 3QRWA 1H2FA 3IVRA 1ZFNA 4I3GA 3X1DA 3UJBA 4BPRA 1RQPA 4H1WA 4TYMA 2Y6UA 5LA6B 4YAKA 1X8XA 3I04A 1SC4A 1NFFA 4DWOA 3M8KA 1DC8A 1KOJA 1WDTA 3WGTA 1OZAA 4CLOA 1Z5UA 4NEHB 4DV0B 2O7QA 3PHBE 1NJSA 4B81A 4R2JA 2DFKB 3KFVA 4U7JA 2GZAA 4Y6SA 3E3OA 3CF4G 4JMPA 1WZ2A 3BIWA 1DWOA 1RI2A 3FUCA 3WGVA 3ZE6A 1AHNA 3G0IA 1KPIA 3FDZA 3TS1A 2WU0A 1OZFA 1QZUA 3LQFA 2E7ZA 1EWTA 3AF3A 1QB7A 3O4RA 3PFKA 4GKBA 4UVEA 4JX9A 3TXYA 5AW0A 1JPNA 3K9NA 1IMJA 4FOOA 1SFRA 2IITA 1TPYA 5G0TA 4NZNA 4DSTA 5DCLA 2IW3A 2WM2A 3X1ZA 4EB0A 5K2OA 5K45A 3S6JA 1GZVA 1C3EA 1NX6A 2HRBA 2E48A 3ROQA 4FMCB 1KA9H 4MV3A 4OH1A 2E4ZA 3CRNA 3KUKA 4Q4CA 4B4KA 2H2IA 4F4CA 2G1UA 4Q19A 2R6DA 3WZLA 2HMYB 2QMUA 1VJDA 4WEOA 4N9WA 1SVUA 1CDZA 1RAEA 2H4JA 1T2DA 2QL5A 2XYRA 3WRXA 1SKMA 1ZD2P 1GL7A 4H2DA 4OHRA 5HYVA 2HBZA 1P60A 3JU3A 3P94A 2W6NA 4IS3A 4WEQA 4V0NA 4F3RA 2IP4A 1IXYA 4GDMA 4UOEA 5JAZA 2AG0A 2HM7A 3VU0A 4MS4A 4Z8YA 3UWOA 1NKTA 4HEQA 3BHJA 3OTWA 1U0JA 1RRPA 2DR3A 3PICA 3QBEA 4C20A 4V1CI 4W63A 2H4XA 1VBFA 2P0AA 3KQQA 3N9IA 2WNSA 3ZV7A 4AZ3B 2EWVA 1JVNA 4Y9DA 1HQDA 1RXCA 4FD3A 2ESRA 3PDJA 5ALRA 4FX2A 2Y05A 3AI1A 4ENSA 3DFMA 4IDQA 5FTMA 4MO2A 2FI1A 2GN6A 3BMOA 3LECA 4INJA 4QUEA 4QQ8A 3ZWPA 2M32A 1NF3A 1TEXA 2B99A 1QHEA 3NHUA 4ZMBA 1OXMA 5JFGA 2VN8A 2X6RA 4OK5A 1KKUA 3RFCA 3RKUA 4OGWA 5EKDA 3QFSA 5BWOA 2APJA 1TECE 4IZIA 4HUTA 3CUSA 2B4QA 3SC4A 3JQ6A 1ES9A 5A6VA 1WNTA 1AKTA 2LZ0A 3NWPA 3LHSA 4MWSA 2ZVQX 4BP3A 1D2EA 1WQ3A 3BTUA 4B35A 3H1FA 3NHWA 1JA9A 1CJBA 2FWRA 2HLDA 1E2FA 2IE0A 2VHWA 3CLTD 1RWWA 4JBIA 3LJKA 1U8XX 1CX9B 4HG2A 5ILQA 3IQHX 2NGRA 1M1UA 3LNCA 4Q4HB 4YWJA 1NYTA 3OF5A 3NAGA 4GH5A 4X93A 4E5MA 1E98A 4YCCA 3PYXA 5BMVB 2BFNA 4BNZA 4I5EA 2A86A 4WNAA 3RHTA 1XQXA 3V4VB 1EUQA 2Q3JA 2QR3A 4ND6A 3DDHA 2R6HA 4HNAA 2BDTA 3P32A 2XVXA 1HLPA 3PC8C 1ML4A 3B60A 3LZDA 4K7JA 1DBVO 4C05A 1ZCZA 4OJNA 5K5EA 3UMRA 2HT6A 2RAUA 2PT9A 4FNMA 1FTWA 5J47A 2VO1A 5HQJA 3P9PA 5C5EA 1M6HA 2YJTD 3O38A 1TZMA 3P19A 4DIMA 2ATIA 5KNDD 1Q0TA 3ZLUA 3T1HB 2ZS9A 2XTAA 1OTHA 4JT8A 4BNDB 1X70A 3HBFA 5FULA 4BU0A 1FUYB 3OQIA 4LCBA 3W05A 1P1CA 5B3KA 3SAJA 1L6IA 1PUJA 1E77A 3AUSA 4M1WA 3V46A 1VIDA 4MKRA 2HF2A 4YB8A 4HNHA 4IZHA 4C0HA 4GL2A 2CVQA 3EMVA 5KBYA 3QVLA 5E2BA 1ULUA 2H1CA 5KZMB 1ONPA 5J23A 1QG0A 2V7QD 2ZIZA 1RJDA 4YY3B 1WOYA 3LUCA 2W37A 4OOFA 1Y3DE 3L8EA 2WOOA 1EAYA 5L7YA 3PZRA 1PVOA 2PSSA 2FPKA 4LGVA 3BM5A 2I6FA 3UXYA 3SEFA 1RAGA 1A9ZA 1TQ2A 1D1PA 2P2SA 2XWJI 1PDVA 3H11B 3VZDA 5B7GA 1CUYA 2QM0A 3KBOA 2I8LA 4JQYA 1EK1A 1I51A 1QV9A 1VE1A 3LQ2A 4P93A 1N6LA 4Y1FA 4RDCA 4YT5A 2OBXA 1G9TA 1E8MA 2C1ZA 1JIXA 3PNMA 1TU4A 1LRJA 1OU0A 1RRVA 3QVTA 5EP2A 2YJ5A 1JVBA 2PJUA 3NRBA 1VLJA 5K8VA 3D2BA 2VBFA 1WCXA 4KIWA 3BB1A 4XFKA 2O1SA 1KJQA 3CYFA 3KVRA 4XA8A 1TF5A 3BXZA 4KGZA 2ZP1A 4X6XA 4D3YA 2VVTA 1NQVA 2LCIA 4YAIA 1E3JA 2P9BA 3MC1A 4LJKA 2FDXA 1SBNE 4GGMX 3ME5A 1Z39A 3NWOA 4OUDA 4B9EA 4E46A 2QZZA 2XKJE 4IR7A 1E79D 1KZGB 3B7PA 5I47A 3FZQA 4U2KA 4TX1A 3OAAD 3Q2KA 3TLBA 4BUCA 4GXRA 1V7QA 4PV7A 5AHRA 5FTKA 3WK6A 4EKGA 1JQDA 5BP7A 4L22A 1LFDB 4EPWA 3HB0A 1HYBA 4MUGA 1OX4A 4EGFA 2ZYAA 4EMBA 4CEIB 1EHCA 1YS4A 4LVCA 1SUCA 4S05A 1IPEA 3LCJA 4HGQA 1NA5A 4FYIA 4CTNA 2Z9BA 4TRMA 4JZKA 4O6VA 4W5TA 3HI6A 5EJIA 2EP5A 2VRBA 1D3AA 1XZJA 4EX7A 4ZQEA 5IKMA 1JX6A 2O4UX 2P11A 2AC7A 2YYYA 5AJYA 5CNKA 4B17A 1IY0A 2C88A 2HHCA 3EGVA 3L18A 2ORWA 4NMMA 4XVUA 1RI5A 1Z35A 4N3GA 5JD3A 3OZAA 2JJ2A 1XCPA 5IAOA 3U1TA 4GPD1 3IUMA 1H8HD 1Q77A 3K0AA 2G76A 4Y8VA 1Q1ZA 1RCTE 4EO9A 2WJWA 4I6GA 3IRUA 4Y0NA 3EEOA 1QP7A 4M37A 5KKAA 3N0VA 3PUXA 1ZVQA 5FFMA 1JVSA 3M83A 3KTOA 4BUJA 1ZL2A 3SC3A 2H1FA 4O63O 4Q82A 2DUWA 6NULA 4QATA 3WL5A 2J67A 1HOTA 2AT1A 2R7NA 5A62A 2ZWPA 1EDZA 2DQYA 3KZMA 3MWGA 4NYMQ 4YMSA 5T67A 1DKOA 2F67A 1OXTA 4M1EA 4Y1RA 1FSZA 3ZHBA 1GZHB 5KSWB 3GP8A 1PG2A 4EW6A 4LXUA 3HWRA 4HNGA 1NVEA 1U7DA 1R8JA 3FTPA 3LPLA 3PNQA 4HTAA 4QU5A 3TOVA 5JU6A 1OJ7A 1SEVA 3PWSA 2EP7A 3QVKA 4CKCA 3CFYA 3R74A 4EBBA 2F1JA 1BNCA 2MWMA 4HXFB 4JP8A 4UNQA 3DXYA 2DXIA 5F1KA 2QY9A 5FBLB 4ZQBA 3NPMA 5A0FA 2OYRA 3TUJC 4PN3A 2ZRHA 4PG8A 5CXSA 2ZRJA 4LGMA 4F5YA 5EHZA 5HRCA 2O2SA 4MS3B 1V4VA 1EJ0A 4KO1S 2PUTA 2GJKA 4ATNA 5ELXA 4H16A 3MTEA 4J0KA 1Y7LA 2X1LA 3ZQUA 5DYGA 1YZLA 1MTZA 5ERYA 4XUGB 3SS9X 1DUVG 3JSAA 3PE4A 1E89A 1WKCA 2GAOA 2RCNA 3URKA 2R2GA 2MT9A 4HLDA 1RLIA 3EVBA 3VZBA 1KYXA 4H7KA 4P35A 1YVRA 5HFJA 4ZO4A 2QLFA 1SXIA 5CB6A 1ZNWA 3WWCA 2HA7A 5HTOA 2W93A 2WVJA 4NBSA 3MUFA 4NP6A 1I3KA 2K2WA 4R0MA 4B8ZA 1XVTA 5EIEA 5JJ5A 1PFKA 3OPYA 4GUDA 1QH1B 3NOQA 2AKYA 2A92A 4FJ0A 3UY4A 4IFIA 4BWVA 4GX5A 3B89A 16PKA 3PPXA 5JO9A 4Q1AA 4TWBA 4BLQA 1K3FA 1XTJA 1D6MA 3A7DA 2VPIA 4ZFNA 2IOYA 2VAXA 4ISBA 5AUOB 3TF5A 2HJWA 5FP0A 5HRUA 1GO2A 2NXEA 1H94A 3GLIA 2NNLD 1WHSB 1LC0A 4CLRA 2JGIA 2P35A 2B37A 4HDSA 4L5CA 2J0EA 4K6CA 5D6NA 3U4AA 2P3LA 1C9NA 3M0EA 2VPPA 3V4ZA 2G0TA 2YWGA 1QGUA 1QNLA 2GEVA 3ETGA 4F85A 2IV2X 4NEQA 1X1QA 1JFFB 3PXCX 4TZTA 3KTFA 2AD5A 2PKCA 2LPMA 3KP1A 5DGIA 4FPXA 4D9CA 3BD7A 1BXRB 1TZ2A 4KPUB 5TGZA 4GMDA 2P67A 3FJYA 2W2XA 5BNIA 1W59A 3UMJA 5LOVF 1A1VA 4HEHA 4CMEC 4JSRA 3WGKA 3M5PA 5H02A 1D9ZA 2IQIA 3RIYA 2GAIA 1RZ3A 4Y2PA 1OI3A 4Z1MA 1B14A 5DBOA 1PT8A 1R6TA 4RY9A 4RQAA 4TV8F 3THRA 3UB4A 4ED9A 5TLSA 4LXIA 5IJ0B 1GDTA 3A1SA 2FLWA 3AILA 3HV0A 4C7BA 4ZGWA 5CXXA 2JH9A 3V33A 3A1EA 1YTLA 2A78A 2MSLA 1Y1RA 1CVLA 1LBSA 3VI3B 4LJSA 1VMDA 4P3XA 3DNMA 1RQLA 2H9IA 2ADMA 3LMKA 4LC0A 1V9LA 5EHNA 4ZEWA 3B6EA 5A3SA 2BTEA 4NYJQ 3UAWA 4AK9A 1HDIA 4QDTA 4ZVQA 3ZE2B 3JAWA 1DO8A 2H2HA 3VSDA 3WLFA 3RJ5A 1JR4A 2G9VA 5FQOA 5IJWA 1RWOA 3OIWA 2VF7A 4WI1A 3MSXA 2PS1A 1T43A 1TK3A 1QGED 3L82B 3EQ8A 3H5OA 2COKA 2WIDA 5D01A 1QVZA 4LXQA 5BXQC 2ZXEA 4DV1B 1W49A 4MJXA 4E1BA 3ENKA 5ALJA 1PG0A 3PEWA 3VHQA 1BDIA 2QROA 1CUDA 3IJEB 3NDJA 4KDEA 1YBMA 1NBWB 3R0ZA 4DEYA 3T1VA 1D8AA 1ZVMA 2XQGA 3WYGA 3LW8A 1UFRA 4ZT3A 1M8GA 2X6QA 4BVHA 5CVUA 2QTWB 2FWJA 2YWHA 1Y3HA 2YOGA 4R9VA 2NZUG 3GG2A 2HJRA 5KVSA 1QPBA 2NVOA 1YK0A 5CT4A 5DNVA 5FWYB 1IZ0A 3HDYA 1ANKA 2E0IA 2FX3A 3TI9A 5IT5A 1JNYA 1U1EA 4A5OA 4D4JA 2H0QA 2Q2VA 5CYFA 3AHEA 3I53A 5H83A 3JYOA 5SY6A 3JR3A 1VJ1A 1T2AA 4YDSA 4ZOAA 4XOIA 1KI6B 3EBOA 3RUPA 3UUFA 3ZHVA 6ABPA 3DMGA 3GMTA 1GT91 1ZZEA 1FLNA 3UC9A 1EXWA 1DWPA 1MT3A 5FUQA 2RCYA 4HWPA 3AP2A 3KWFA 4UU7A 1A9XB 1Y9AA 3AM5A 4MW2A 1REQA 1XDBA 4QLBA 5A5GA 3HO1A 1JQLB 3OCXA 2QPOA 4I55B 2XV1A 3OLQA 2EP8A 1HX7A 1Y89A 4ZHSA 1SHKA 1DEHA 4POOA 5CDFA 2XW6A 2AUNA 2R8ZA 3ZIAD 4BRWA 1PJLA 2VTBA 4L08A 2PMFA 3F8TA 2I91A 2V7VA 1OBCA 4NJOA 3W3AH 1E59A 4DOMA 1LPOA 1Z6TA 3K32A 2QG6A 1JE1A 2VF8A 3OM9A 4PYOA 2HMSA 2HHHB 1MRZA 3GWZA 3AF5A 3DDOA 3M81A 1YIAA 2AD1A 2GRAA 2YJ3A 3FIUA 3NT2A 4X6LA 4BIIA 1ZINA 4HWRA 4LMBA 4W5OA 2N47A 5K0SA 2WWFA 4PZCA 1PK7A 4N40A 4ZYYA 1KDYA 4KXUA 4BLVA 3B48A 5A2GA 3WJ1A 2G07A 1N8NA 2DWPA 4DG8A 3IOYA 3IDOA 2WBLC 2JZCA 4PTLA 1BE6A 1E4EB 3CCBA 3ETHA 1HL7A 1C3JA 1RE0A 1TJ3A 3EBLA 3PJDA 3JPYA 1W8DA 3PR2B 3CVXA 4DR5B 4KVAA 2QE7A 1F8FA 4Z4GA 3LDAA 1QHHB 2P9TA 1Z38A 3ZDBA 4R1LA 3VJLA 3HBNA 2X4IA 5DH9A 2WKRA 2RGNC 2ASVA 3QH4A 2GBCA 2IYFA 1DIOB 3F46A 3FB1A 2H1HA 3U6BA 2GTPA 4BE7B 3L84A 1E9DA 1KVUA 1Y1KE 2PCJA 3W2FA 5BR8B 1O3YA 3UXHA 2YW9A 4RZXA 3OE4A 3I4FA 1E9CA 1DQSA 2WM8A 2VSXA 3K0KA 1JPUA 3QA9A 3IIIA 5K0TA 1RJ9A 2QPLA 1R4NA 4TRNA 3CY6A 3RYFA 3EF1A 2WHPA 1HFKA 1Y82A 1X92A 2WT8A 5CFPA 3T9FA 1FYDA 1FFBA 3OD5A 1JDVA 2NYAA 2SHKA 4I8IA 4MRNA 3CNQS 3CUEF 2GD1O 4TMXA 1E6LA 2BFDB 1M2VB 1ZMRA 5D5HA 3C6YA 1XR3A 3R0QA 1ENPA 4TMYA 4AZTA 4HSGA 1M1YB 4HDKB 1GA4A 4MR8A 3S29A 5ABPA 4OQLA 1ZD9A 4NCXA 2JFHA 2RHWA 1E5TA 5TPWB 3DZDA 4TSFD 1AXEA 1UK8A 3V7FA 1N6RA 3A9RA 4G67A 4DDWA 4J4BA 1XVLA 2H1WA 3TX2A 1SCDA 2YJNA 3AWIA 2O8NA 3T9EA 3K09A 1PS9A 2EZ9A 2HRCA 3I34X 5GMOA 3W8RA 2YVUA 3FHLA 4JHXA 1XRPA 2WWYA 1ODJA 1P1RA 3L40A 3WFIA 1CR1A 2QP9X 3L8GA 3OZEA 1XCGB 3FWNA 1UJBA 3DONA 1P0QA 4IQGA 4X8LA 3ZJ5A 2O8CA 1E7RA 1G0OA 1Q3TA 1RYDA 1SZCA 1T5HX 1US8A 1K7YA 2D8MA 3LTEA 4IMRA 1K92A 4GW3A 4NNOA 3SHQA 2IX9A 2C2XA 3BXOA 5LD2C 1IIRA 3RRBA 2IKSA 5JZOA 5BPFA 1DEOA 4DLAA 1G20A 4N8EA 2YMPA 2Y9PB 2O07A 3E4DA 3HNRA 4NENB 3VDRA 2AEMA 4K03A 3K1ZA 3ZJUA 3B2NA 2ODBA 1AX9A 4JT2A 1GSOA 1XRNA 1BRMA 5J40A 2F3TA 4JNCA 5HTKA 5CBPA 5F9HA 3NC1C 5FR2A 4M1KA 3PBKA 1NU8A 1YB7A 3GXOA 4Q37A 1PRYA 1QIHA 2ADFA 2VHTA 4PBSA 1RFLA 3CLVA 3AFOA 5EE0A 1S9HA 2XF8A 4E88A 1Q7TA 1ECGA 1H8EA 3R9KA 4G25A 3ZQ4A 4P22A 3T1OA 3GB9A 2CEAA 3N2KA 1DEAA 1TZKA 3KR2A 4HF7A 4HEA1 1Z28A 1RXYA 1N5DA 2WVGA 1JSXA 2OQVA 3RV3A 1XC7A 4PYIA 1W0JA 1V43A 4PZEA 3JRNA 4XR9A 4RZSA 4BLOA 1IOVA 2EX0A 4WMLA 3RVQA 3U0VA 2CVOA 4QEKA 4B6QA 3DE6X 2HPHA 4PLZA 3UAZA 3WRYC 3ADBA 1SU4A 1IOLA 3IKJA 4DA7A 1MVNA 3F5QA 4L72A 2GH1A 5FOVA 4F06A 1ULBA 4ERNA 1HT1E 1UBCA 4YT8A 2D4AA 2WYWA 1X7DA 2L0XA 3S2UA 4ZJYA 2BM9A 2XR1A 2PMBA 2GHTA 5C8YA 5DBIA 2PUDA 1G66A 1XMSA 1OA1A 3ROXA 3AR4A 4TVBA 4MKGA 1GAJA 4AKHA 1S96A 2IYSA 3ZY2A 3RRMA 2NZYA 5FL3A 1VSUA 2P9QA 2XMDA 3WHIA 3WLIA 5B1EA 1M1YE 2OUIA 5ITZB 1Y6FA 1QP0A 1N36B 4YLGA 2D1FA 4AY3A 1IOWA 2GLXA 2PGNA 5HIAA 3K0FB 2QQFA 2QRHA 3PC7A 3N0XA 4HWGA 3CO5A 5E9AA 3HYLA 1VLQA 3EB9A 3P1JA 3WQHA 1Z5WA 4IIXA 4B3JA 4Y7DA 3R1IA 3FCUB 4OJYA 4PRZA 1W5BA 3S7TA 3HA3A 4DT1A 3RC7A 3IE1A 4E22A 4LJAA 1UEIA 1T8YA 2C97A 2IGBA 2AJDA 4URUR 4U7PB 1UEXC 5CHYA 2EEZA 2O14A 5J2UB 2J7PA 4P36A 2IHZA 3SDZA 4NAUA 1Z82A 1NSTA 4HZGA 1TMKA 2O54A 3VSEA 4EY8A 1YA4A 1YZNA 3GT7A 3O94A 1GKKA 3QEJA 1LVUA 4P4TA 5CH5A 2DE0X 5FBHA 5BSVA 1XFAA 2FSVC 1K0FA 4ARSA 3GGGA 5C7LO 1LJLA 4II2A 2AL7A 3HE3A 1ZK3A 4XM2A 1FQKA 3U48A 1DPGA 1G3MA 2O8VA 4ZZ3A 2EYQA 3LUFA 4JLPA 4ID3A 1UPFA 3AF2A 1NXQA 1QP8A 3JWHA 4FCWA 4N7JA 4P9NA 1A4XA 5AVYA 2REBA 3TW6A 2XZPA 1EINA 1XCBA 3F5SA 2OKCA 3BE4A 3NNDA 3MCAA 3VYUB 1ZGCA 4DA0A 2NZ8A 5LM3A 1YQXA 2OHHA 3NFRA 4DV4B 3SS7X 4NH4A 2YV5A 2V6GA 2R62A 4NY1A 1H0KA 4KREA 5FFFA 2B6HA 3BICA 2QNRA 4COOA 2JFYA 1NVUQ 3M6LA 4KRYA 2H7VA 1KAEA 3KX2A 4IP0A 1TUIA 2VNJA 3IEXA 4LIPD 4Q3NA 4NFHA 3OPXA 4YN3A 3I3SR 1CQIA 1I2BA 5KVAA 1S7CA 4CHGA 5ECGC 5J63A 1HDXA 1V35A 1IZ8A 1I10A 3ABIA 3GJ8A 4TKMA 4YJDA 1ISIA 3ZW7A 5AQ1A 1JBEA 3A25A 3Q3CA 3NTOA 1EB9A 1EM8B 1XKTA 3MMSA 1JDBB 1LLQA 2FPIA 3VPXA 5CEFA 4KN5A 5U9CA 3CNNA 3WYNA 4ADSG 3EA4A 1GU0A 3HEAA 5TE9A 1MGOA 1UKVY 1WW2A 5LSAA 1RQXA 1ODTC 4UUMA 5EYPA 1R88A 4E2XA 2R0QC 1WIWA 2VSFA 5TT1A 1PKXA 4ZCPA 3ZNOA 3GLHA 3IQDB 3PA6A 4K6FA 5LZ2A 2DEUA 4WFIA 3ICPA 3ICWA 3PR3A 5LVAA 3UK7A 2O8FA 5FOSA 1NSFA 3G9XA 3OLZA 5CHEA 4AO8A 5B1IA 1EJ2A 5LU9A 5EJ5A 3ZDAA 4FOSA 4RD1A 4TMWA 3C1TA 3G9UA 5TNXA 1C9DB 2GK6A 2HO5A 3PIRA 4B0OA 3KRTA 4N3BA 2OCPA 1SXGA 3NX4A 3JATA 5DNAA 3AVWA 4UXJA 1Q6ZA 2KBEA 4WZBB 1FFHA 3TLGA 4ZHQA 1E2IA 3R44A 5IABA 3H5IA 1O6CA 4CT0A 3MGGA 5D84A 3ZDEA 2J3HA 4FIDA 5JYEA 2Q5QA 4FW8A 3L3BA 5E2IA 3QVWA 3F78A 1Z5GA 4NZMA 1DE0A 2PXAA 4OM8A 2H08A 5GINE 1IM8A 2D1SA 4EG0A 4AJNA 1XJCA 4CRWB 1XF9A 2D4HA 4JBNA 3FRHA 1G8JA 4PS1A 1KH1A 2TRSB 2F90A 3ZXUB 4B7UA 4IRMA 2DSTA 2FCAA 3FD8A 1KDPA 3R2JA 3OTIA 4B6EA 3FSJX 3DKKA 3EJ6A 4H59A 2Y1XA 1RLTA 1X7YB 3FNBA 2YOHA 5EJAA 2D3TA 4NBTA 1J0EA 2O50A 3B1ZA 1OYVA 5EEGA 4P0QB 3UUGA 3Q98A 5F5XA 4NEGA 5JC8A 3GCGA 4RV5A 1PWYE 2WHXA 4UHKA 1E2QA 1H6DA 3OZVA 2BFEA 4I4TA 4KE9A 5F64A 5AD1A 5I51A 1U9ZA 1DJPA 1MORA 2DPGA 1J2JA 2UVPA 4BNHA 2FWNA 3ETNA 3CNBA 1UL1X 4FE7A 1L5HA 4ZYTA 2WMNB 1IDN1 2JRCA 3O2QB 3Q6NA 1EUYA 1Y7TA 4BNMA 4L3WA 2HXGA 3QEMB 5F4ZA 1I6KA 3ZCPA 4G0WA 3BBLA 3N2EA 2NSLA 1JDTA 4KQCA 4AZ0A 4PIVA 2PR7A 1B93A 1E1RD 1TM4E 3OM8A 4JLMA 2XUQA 1K8RA 2RGWA 5DHRA 4OXIA 4FUQA 4WK2B 5FA6A 5LU8A 2ZRCA 4YMWA 4FOLA 4JB0A 3V1LA 4TKVA 5ED4A 2J3JA 3EXIA 3KWLA 1NN5A 3IQIX 4FM9A 4WZAA 1VFPA 3MA0A 2O8BA 3RBZA 4CV1A 3TFWA 1KZ4A 5ENDA 4MWBA 4KUGA 4Z3OA 4MJLA 2JFBA 1Z6ZA 5JWHA 1PTKA 2Q2WA 2K4MA 3DCJA 4QEZA 4TTTS 1XRLA 3F1LA 4KRGA 2AF3C 2CV1A 2RIRA 2NU6B 5DRTA 3ZUPA 1JPJA 1XU4A 4J1QA 1C3VA 2D74A 1SH7A 3Q6IA 4HN4B 1GXSB 2FPUA 1JLLB 4H7FA 1ZI8A 2XWSA 1JDSA 2C4WA 1EK6A 4WZBE 1GTVA 3EVEA 3K9CA 4YFYA 5BVHA 3HB4X 3AR7A 1WVIA 1RVDA 4JMLA 1FTGA 3DE4X 2A9JA 2FX5A 3AB8A 2ISQA 3VBCA 4LJ6A 1CU1A 1W1WA 1Z08A 1YZUA 3UHAA 1NLUA 4I1OA 4LWZA 3LCRA 2ES4A 3UMSA 2DB3A 1W52X 3JVDA 1A9SA 3A9TA 3P2IA 5HPYB 1PJCA 4BHTA 2CWDA 1XZBA 1O0SA 4MQBA 3GT0A 5KDLA 1KE1A 3W5JA 3EDMA 2BRUC 3K05A 1TLFA 2D1TA 4IY1A 4RHTA 1GTG1 4OLAA 2XA2A 1FDRA 1EGAA 1NUUA 5HDQA 3HPRA 4D8TA 5E38A 1KI4A 1IK6A 4GLJA 5K3FA 3Q85A 2OBBA 3KDAA 4G8DA 4MUFA 4UPVA 1PK9A 3KJXA 1R5NA 3CLSC 3GZ4A 2L18A 1CP3A 3LDHA 4N6OA 3O5AA 3ZI0A 1F1JA 1HYHA 4NBKA 1GG9A 1XWIA 3F6PA 2J30A 3M1LA 4QOEA 1RHKA 4UFNA 1KXZA 3TM4A 3UFXB 2HDOA 2QUAA 3ZWVA 4HFJA 3QG5A 1AKRA 3T3GA 5DN6A 4M0LA 2FOLA 4Q9HA 4D9MA 3ZE9A 3A6PC 2YIMA 3KLPX 4QASA 5EKXA 5ICMA 1ZUHA 4UZSA 4OQEA 4NSNA 2AW3A 2GETA 3KUUA 4P7JA 1F0KA 1M54A 1QKIA 1X38A 2GD6A 4NQZA 3BGWA 5KYUA 4CQMA 2QXYA 2YXBA 1BWPA 1IBKB 3A04A 3W3AD 1C8BA 3JARA 1UOOA 2XRYA 2P9HA 2PO7A 3ZBPA 2YMMA 4X63A 5LP6B 5IVKA 1Q0PA 1HV8A 2ID9A 3QW2A 1DOHA 4DNXA 5KTOA 3OC6A 2OCKA 1K9SA 4JXXA 1GNPA 2PX8A 3PVCA 1Z8FA 3Q3VA 3MELA 3BIJA 1GQFA 2PX4A 1BU5A 4IGAA 2OAEA 3JTEA 1KI2A 3BN3A 1BHQ1 2L17A 2XNDA 1BDMA 1T4GA 4Z4CA 1JTEA 2VPTA 4MR7A 5BNZA 1W5EA 4HQRA 1SOUA 4RX1A 4LRUA 1A9QA 5DTRA 4CQLB 1D9XA 1Y9ZA 3ROEA 1DG3A 4PANA 4I3HA 3ASZA 3BXXA 3IB3A 1QANA 3U62A 5JPDA 5LNK1 3WLSA 3WJ7A 2XCUA 1SD5A 2GF2A 4GYYA 4DZTA 3D3KA 3UAYA 2B9EA 2JCSA 1JLHA 3FVWA 4MO9A 3BIOA 3PIIA 2PUHA 2ID4A 1KP3A 4L02A 3P9NA 1EXVA 1QLHA 2BY4A 1V6SA 3N8NA 4FKZA 3JVEA 1RD4A 2JJ1A 2PJDA 5COBA 2QJTA 5JRZA 2YQZA 1I4OA 2XTZA 4XCXA 4HXEB 1NP6A 3DOJA 4XFDA 3QUSA 4ZAZA 2QRKA 3CNLA 5H16A 4ZO9A 2B35A 4F3YA 4F3NA 2HB6A 3L7AA 2N0SA 3I6BA 3QOFA 3R9IA 5ICSA 5LBUA 4YJ2A 2E55A 4H7EA 3T61A 4ND8B 4RFVA 2H11A 2IIQA 3RSGA 1FTQA 3VPAA 3A06A 5AKYA 2JBHA 3EG9A 2VDQB 5C51B 4PCVA 1F2UB 2BP7A 2X1VA 4ZYVA 2ZSIA 3SGLA 4ZOLA 3PENA 1UM9B 1C9JA 3RVKA 5K4GA 3U7GA 1I9CA 2JFWA 3EN0A 2XDQB 5TY0A 4OB8A 3A6DA 1T8UA 3THOA 4EPRA 1JYSA 4LTNA 2NU8B 3N6VA 4Z54A 3S1AA 3F98A 3WMRA 4UUAA 1O58A 4ALLA 2VP0A 3DXZA 3I2HA 4K81B 4L50A 4QOHA 1XA4A 2UXCB 3AUUA 4RA9B 4GLFA 4R9RA 5DLQC 2HF7A 3U7EB 4DA6A 4FYKA 3ABQB 5CLQA 3SX0A 4RETA 3RTBA 3MRTA 4WY5A 1M72A 4WZZA 3VR1A 2XVAA 1CVRA 1V1JA 1WCWA 4G4GA 1IEWA 1V45E 1JDPA 3IBYA 2QYSA 5KSPA 4L8GA 2WJ6A 1PR0A 2WPDA 2J46A 2CYBA 3G8AA 2A5JA 4L4ZA 2O0MA 3IP8A 1LPSA 1TU0A 2XSZA 4JHLA 4LNUB 4G26A 4M8LA 4PWYA 4ZV7A 1KBZA 3MBOA 3W8NA 2ZUSA 3ICOA 5I4IA 1XD2B 4X71A 5JD6A 4P2GA 2QN8A 3C4VA 4NV3A 3ELWA 1G8SA 3GRPA 4EA6A 3R8FA 1YT5A 4QOSA 4RELA 1KVQA 3P9IA 4XSVA 4FB5A 4GZ6A 5K4HA 2PK3A 3MLBA 3KOMA 3CLSD 4DUGA 7REQB 3G88A 3MT0A 1MD9A 1P9NA 1WZCA 2QD4A 3EGXA 3LWNA 4YGYA 2RHMA 4TZ0A 3V42A 2JAWA 3V2GA 3E58A 5LIPA 3FXAA 1GUAA 1SOMA 1TE2A 1DDIA 1HTWA 4TLMB 4GSYA 4N41A 4Z3KA 3HZOA 3EH2A 3PI6A 3T9DA 4AF7A 4C4SA 4XD2A 4BKOA 4MKFA 4OI2A 4YJGB 1IHYA 3FPGA 1CRLA 3DMRA 4L28A 1GPKA 5IC6A 3ZU3A 1ZIDA 3BS4A 5HS4A 3DAYA 2P0EA 1TVKB 1Z13A 2B4KA 1Z56C 3ZE8A 1ZD4A 2IEYA 2V03A 1CZLA 4QODA 2Q1TA 3VR6A 3OPQA 3U60B 5I3CA 4MIYA 2JLXA 1E7WA 4RU1A 4URHA 5BW8A 1Y81A 5LXTB 1V8FA 5H0IA 3RVOA 4A0HA 4GKAA 2GDJA 1XTTA 5EPUA 4H6VA 1TFUA 4GP9A 1VMIA 2X0JA 2FMUA 3DWFA 4J16C 3AFIA 4MUAA 5HSGA 4MS1A 3HCRA 4N47A 4NARA 1N6PA 1L1EA 1W96A 3VPCA 4FQ5A 1G2OA 3HCFA 2ZJ6A 3MLAA 4UCXA 2ZUBA 1EYZA 1F1BA 3HA7A 3BJEA 4MWTA 4EGQA 2JIBA 1XEXA 3K94A 2ONCA 3G2KA 3P52A 1MAAA 3RVNA 3P9KA 1EX1A 3D4IA 2YZ2A 4O2BF 5J2TA 2Z8XA 4YA6A 1QFSA 3HZRA 4II7A 3GW8A 4CTJA 3I3OA 1P0FA 3GRFA 4M9SA 4RE5A 2ZZKA 1EX7A 1WSDA 1X1TA 2YCBA 3M1AA 3NBMA 3STUA 3LU1A 1CQZA 4TYNA 3Q1KA 1W2HA 3GRAA 4AG5A 4B3BA 2DHDA 4ZARA 5KQMA 1QGOA 1C8LA 3NDBB 2EEPA 3JX9A 4FFNA 4FFPA 2PGAA 5HKLA 3PRJA 5IKXA 1SXJA 5T8KA 2IVFA 4YH1A 1DC6A 2EFDB 1Q92A 4OEHA 4DMFA 4C01A 3UG6A 3ZU6A 2IPLA 4FFWA 2OT3B 1VM6A 1ORTA 4G97A 2W58A 4GPIB 3QY9A 1NP3A 1A5SB 2JFVA 3SC2A 3EZLA 1C4WA 2EDAA 1LPMA 4FYVA 4J7CA 2IXFA 4B9AA 1Y7IA 4AX4A 2CKMA 2H31A 2OGZA 4DXAA 3L41A 1NVBA 2ASEA 3KZOA 3LT5A 3PQ8A 1J2EA 2OOSA 2C92A 3L0YA 3V55A 5EJGA 3X1JA 2IUEA 3CWQA 4H08A 3GF4A 4WXPA 1TL7C 3W04A 4WGGA 3O9MA 4IGEA 4EMUA 2QD2A 3SKVA 3H5RA 5A05A 1LK5A 4WCDA 1P75A 2HQBA 4Z49A 3HA5A 3LHKA 3FYTA 3IAXA 1SVKA 3UXEA 3VPDA 4G4IA 1SU6A 3HJGA 3JW8A 1B15A 3GLUA 5BW4A 5KX5B 1J22A 2VOJA 4GI5A 5DCUA 2QUHA 3CE9A 5TEWA 2FRVA 2HKIA 3KQVA 2IE8A 4GVXA 4LA4A 3NHFA 3V2HA 2OZVA 3ZWKA 3WSVA 4BVKA 3K4QA 1NUAA 3OZIA 2D0IA 2WT4A 2VF2A 4RK1A 2L2QA 2JHCA 4RPGA 4V2IA 1PT9A 1Y3FE 1EB8A 2WA2A 3NT4A 5AVXA 4KQ2A 5EIXA 3H2ZA 3V6LA 2NPFA 1QO0A 4QYIB 5B12A 3TR5A 2HMVA 2O3TA 2GMWA 1NXPA 2IHJA 2ZEJA 3ZCSA 1OI7A 4RKRA 4ENPA 3JV7A 1SZPA 2Q45A 3KZVA 4RJLA 5DGCA 1ZGJA 4EMTA 5FPSA 3EFOA 5KIAA 5DO9A 2FKAA 2XB6A 1AU9A 3GCDA 3PHJA 3M9XA 4DHEA 4ZT4A 1CJSA 4QXAA 4V0RA 5GZ6A 2BKXA 2G17A 4ZK6A 1CUBA 3IMCA 4G5QA 4IUYA 3I83A 4WFQA 2C7QA 221PA 3H2JA 2IX3A 1OH8A 1CTQA 3TUZC 3ZHQA 4JKIA 2LV8A 4HQNA 5K0GA 1MC5A 5AQEA 5LL6P 4OKSA 3GJ7A 3VGPA 2EHDA 4XLTA 2XQJA 2Y76A 3AHGA 3S2ZA 1SCJA 3A1CA 2QPAA 1P2DA 2K6GA 4GUAA 1HY3A 1QSGA 2RHHA 3AERB 4G5FA 3W6OA 3WWYA 2ORYA 4CM3A 5KU1A 2VQFB 1M5UA 5KHAA 1A50B 2E6UX 3A4VA 4G4JA 1CY2A 3IOMA 1FQOA 3ZQKA 3WDSA 4BX9A 2ZUFA 4TL6A 2EJTA 1O94C 3P9SA 3AUAA 4RH1A 3ANMA 4UTNA 2ZZNA 4UZEA 2C20A 1RJFA 3DAHA 2HK6A 2Q6VA 2Y1DA 4TV9F 4YUVA 3C15C 5F3DA 2O48X 3ASUA 3GX1A 4LUCA 1B2LA 2NSYA 4IOLA 2FMXA 1EIWA 4YUYA 4UM5A 1IN7A 4G5SA 3R8XA 5BQXA 2XMSA 4BBPA 3KAQA 1Y3IA 1GWNA 1RXSA 3GVCA 1G17A 3H6GA 5BN4B 3FMFA 1OFGA 5H68A 4M88A 4J7UA 4M7PA 1M75A 5FI5A 1AIPA 4GI1A 5AM5A 3UPTA 1NAIA 1SVIA 3JASB 3RRFA 1FS6A 5CDHA 2QUIA 4CODB 4L3VA 3VU3A 2QZSA 4WXEA 1Y7PA 1KZ1A 3KYDA 1EP2B 1LSSA 1QHIA 3LVBA 2CXUA 2OB1A 1X15A 2EKPA 3KB8A 4LPKA 2I8AA 3HUEA 4LYFA 5DYYA 4E5UA 3C5CA 4H0NA 4Z4EA 1AHIA 4D4IA 4KQ6A 5EMJA 5AUNB 1J5XA 5E0OA 1GPYA 2P9GA 1E3TA 3KQOA 3MFQA 3KBBA 1Z0ZA 3VMFA 5LQKA 4YJFB 3RT1A 3IURA 4YPOA 2H63A 1XYVA 2DFDA 1WPXA 4FLFA 4V0ME 5CGZA 5E9WA 2I55A 5GONB 1ZR4A 1GQ2A 2AXEA 1ISSA 2YN2A 3N0TA 3JQGB 5EJMA 1ZH2A 1V1MA 3FTCA 2XYPA 3A6HA 4PC6A 1WXHA 2PGLA 3CGWA 4PC1A 1WCIB 1YL6A 3IAUA 3OQ6A 3C1UA 5I3ZA 4A73A 1KNQA 5KVCA 2ZJ0A 4H27A 5KI6A 2YVAA 3VVMA 1AGPA 4ZV9A 1XHEA 3A1UA 4AROA 1SRRA 3A14A 3SIXA 3UMCA 3A27A 4DJTA 1H93A 4LBZA 2GEUA 5ER6A 1VPVA 2RGUA 1NRIA 4NR0A 1QPZA 3G9QA 4FEYA 2VYQA 1GU7A 4LZAA 4MYSA 4JQZA 1W88B 3C3YA 1NURA 3H9QA 1J8QA 2ZYSA 3LGSA 4HXYA 4EVQA 4YAGA 1U2RA 3AEQA 1DB3A 4B32A 2PYZA 3C3WA 4AN4A 4MVJI 3RDPA 3A4TA 4MLPA 2GFQA 1EWKA 1YASA 2BHTA 3KOYA 4JA2A 5JFTA 1OJLA 5JUWA 4W1RA 4JS0A 3THYB 2GB4A 2Z5FA 1TX4B 1ZW1A 3BWCA 3RGGA 1SXPA 3INGA 1X77A 2E4UA 4XQEA 1PV2A 3WAGA 3OTHA 3DT8A 5F35A 3ZPXA 2CYAA 2F00A 5B6JA 1Y6GA 5KJ6A 1U0SY 1Z06A 1OC4A 1MNAA 1RQGA 2ZJFA 3VH1A 5KOJA 3OPMA 4V03A 1QX4A 3D02A 2FEMA 1VLZA 3PRYA 4I9FA 4B83A 4ND3A 3ILHA 2DWQA 1U94A 4O08A 1QIDA 2H5LA 1JJFA 1QG2A 3K5PA 4AAYA 2VAPA 1KGSA 1CQJB 1WDKA 2QXUA 3GFQA 4YT2A 3T5PA 1JFLA 3TCKA 3AYXB 1GQRA 2Q4TA 4NZYA 4LF4B 1O9BA 2EFGA 4F72A 5IKEA 3NM5A 5JY6A 3CKYA 4JJ6A 2HA4A 4RFSA 2Z4SA 2XUZA 4XTRA 3R76A 4YPVA 5IVDA 3X1WA 4KFCA 3LP6A 1K0UA 4F2WA 3B52X 4BCCA 3ZDCA 1GR1A 3R6GA 3AZPA 5AO9A 5CM9C 1M8JA 3WA7A 2W98A 4G65A 4JUFA 2VNSA 1WB6A 2AF4C 4O33A 1PJAA 3IT3A 1KFBB 4MJ3A 2I7DA 3GBSA 4XOUA 2IKQA 1Z62A 3NH6A 3IIKA 5EFZA 2VAWA 4E12A 3SLRA 3GNTA 1GKLA 1S8FA 1U81A 3WRXC 2E4XA 1V25A 1CCWA 5HXAA 5DNWA 4YT4A 1MN6A 2GRUA 3FDFA 2ICAA 3I72A 3IERA 4ZCIA 5M5BA 1OI4A 4PZLA 3RGWS 1NT4A 2F3SA 5JCJA 3TAUA 2OFOA 1GTJ1 4F56A 3NOVA 4AYXA 2XTNA 1RQNA 4CUZA 3DAOA 4RZHA 3TLMA 1GZ3A 1LBTA 2I3ZA 3VUFA 4LK2A 3RLFA 1P1HA 3R6LA 1ECBA 4CCYB 3GG9A 4AKEA 5IP5A 3ONEA 3OKFA 1Y6JA 3IHWA 4NNPA 5FV4A 3MRXA 2PRYA 4Y6QA 5KYWA 1THGA 5BT9A 3HACA 2OAP1 3YASA 4GOMD 4C4XA 4BP8A 1X14A 4WECA 1P1JA 5IF3A 3BWVA 2J31A 3PG5A 3AKCA 2PLRA 4ZICA 1KI9A 2WWWA 1TKAA 2GJ4A 4N6NA 1PS0A 4V02A 3X1KA 1ECFA 1BEZA 2GS9A 2QYTA 1XALA 1P4AA 3E84A 4Q7EA 5EA2A 4OSEA 1PUXA 4RCZA 4RL4A 5FPPA 3GR6A 3QPUA 1DWUA 2H59A 3TTUA 2YQ4A 3IAFA 1X3SA 3IOCA 1GZ5A 4QE3A 1JHPA 3QBTA 1OBOA 1SXQA 1E4VA 1E2UA 1Q57A 1A4UA 5CURA 2JATA 4DMHA 4Z5XA 2BFCA 5KWIA 2QN1A 4KVGA 3TECE 3ZV3A 2XRFA 1WTCA 3MIZA 2OCXA 2X3FA 4IJWA 5IT4A 1YWGO 3BE6A 5DDIP 1ZUNB 2RH8A 3AM3A 1VE3A 4L2IB 3A10A 1T13A 3UB3A 5FNZA 2V1XA 5CA0A 2HRZA 1L1RA 4BO0A 1K89A 1NNLA 3WK5A 1TVCA 3ILXA 1XA3A 1ZL0A 5EP1A 1D2MA 3CJQA 5DW3A 3T7DA 3S5UA 4ZT2A 1AKQA 1K4MA 1LBQA 1OCEA 3KU4A 3K1JA 1N2ZA 2X4DA 5HGJA 2H00A 4PX3A 1J97A 1OA0A 1VL0A 3N3AC 3PD0A 4G1FA 3TSYA 3AHHA 4JBHA 3NBQA 1E6CA 3NDIA 3DXXA 1W9MA 4OSOA 3V1KA 3JD3A 4NFYA 3WWEA 1VJRA 1CRZA 1MXHA 2R4TA 3GH1A 4PSVA 4RGBA 3WSWA 3RK1A 3V4SA 4YRKA 4JLBA 4WKCA 5D8DA 1U1CA 3F9CA 3OM0A 4K6GA 2VR1A 2VSNA 3M6WA 3HWWA 5C5DA 1W85A 3QU4A 2H1VA 4N82A 1TW3A 5BQOA 3TQSA 4DPMA 4JVOA 5U4XA 5DBHX 3KXDA 5G0UA 2R6JA 5EY5B 1CDDA 2A7QA 2BFOA 4B3XA 2Y4NA 3KEQA 3NRCA 3GFTA 5C8DA 5CDTA 1HUQA 3LTNC 2BZGA 2PM8A 2J0UB 4V2UA 2FEKA 4CN9A 2HNKA 4WDRA 1O54A 5AVRA 4LOJA 1PL6A 4KXYA 5LJLA 1YU9A 4GRDA 3SEAA 4PEVA 3MBIA 4JGIA 1NXWA 4BV2A 2FOIA 3H2SA 1FSPA 3SLKA 3TSAA 3TFOA 2DM6A 4PZYA 4WADA 3C8HA 5JVDB 3WKCA 1ORHA 1SQ0A 4EIWA 1A2OA 2FP4B 2VXBA 1NUHA 2X8JB 5BOVA 3STHA 2G0NA 2HRRA 4CF6A 4HNTA 3PRKE 1N1MA 1P18A 2A5FA 2HMAA 2NTYC 3OP1A 3ADCA 1BWSA 5HCNA 2YIJA 4RD2A 2ZKIA 5C8VA 3KZCA 1HT2E 3KE8A 2PYDA 5BR7A 1T35A 2HLHA 4N0MA 1DUSA 4WH0A 3LBAA 3FY4A 2BR5A 1NULA 4D8VA 3ZIUA 3LQKA 1AMOA 1DEKA 1AA6A 3VQTA 1X3LA 1XFDA 2WZDA 1DAKA 1DINA 2ZXFA 4ZVTA 4YMIA 1UFOA 1JRLA 4BS9A 1MJGA 2IP2A 2JIMA 3TQCA 4RMIA 2JIOA 5D86A 2O8EA 3SZMA 4EA8A 4RMHA 3H75A 4HLNA 3BJIC 4BJ3A 2P1ZA 3PHHA 1KEEA 5SICE 4OXQA 1VYUA 2DERA 2YIVX 5ITVA 4KQGA 1PT6A 1U7TA 3I9FA 4L4RA 2X3UA 2OM2A 1QONA 1UANA 4DJJA 3FMIA 4AJ2A 4EPYA 2I0FA 3DV0A 3K6RA 1AQNA 1E7QA 1SZJG 1X7XA 2AUMA 3D8HA 2HY7A 2V55B 4O4HA 1R6BX 3WYBA 1Y4ZA 3DQPA 5IXYA 2A7XA 2GCPA 2BMWA 5L4NA 4F1KA 3D3WA 4LV8B 2VK8A 5IAEA 1MA3A 1CR6A 1QIEA 4MV0A 3TW4A 2EJBA 2NYRA 2RAVA 1T2VA 3QQPA 4HAZA 4AC9A 1LZKA 1X9HA 2FFJA 4E5VA 1Q0HA 1LNQA 1YRYE 1DJOA 2FZKA 4OFXA 5K0BA 1BAPA 1FVFA 2VK1A 4P1ZA 5K05A 2P62A 2ZSAA 4Q9NA 2BSXA 1L4BA 3WNZA 1PQYA 2JIZA 3PFIA 1VMKA 4S12A 2A9RA 2Q2QA 3SIPA 4DN6A 4U0JA 1HE4A 4C78A 1USWA 3MS2A 2GJAA 5EZ6B 4HWTA 1V4BA 1JP7A 2FA9A 3DUFA 3HVHA 3QPBA 4NATA 5DSZA 3TO5A 4BJHB 3D1JA 4QGAA 3HFGA 3SMQA 4MTLA 2HCJB 1EDBA 5LA6A 4B4VA 3TLYA 5C34B 4DQVA 1AQJA 3D6MA 3AIOA 4GMKA 1VMAA 5E9JA 2NSDA 5BSEA 2RE8A 5DM60 1WZUA 3AJ8A 3AONB 3L01A 2CHVA 4KQKA 3PHLA 5ALNA 5D3KA 5FTWA 3WX0A 4IPTA 1OLUB 1ZNXA 3QXJA 5JD5A 4JI7B 4KRFA 5F2NA 3DLAA 3I92A 2MMGA 1PI3A 2PS3A 3T4EA 3UGTA 4TWAA 4PG4A 4RF3A 3OE7A 1OX6A 4D96A 1B3RA 4OHYA 3ZQ6A 4B6OA 2GFHA 4RY8A 3PQFA 5FDFA 3DOIA 1Z4KA 1J0XO 1Z5NA 2JLAA 3COZA 3PCXA 5DB4A 5AI0A 3VKFA 5A3QA 3IBFA 3CNEA 3X2EA 1NJ2A 4RLFA 3KYIB 4IQFA 1SC9A 3QI7A 5HZMA 2WSSA 3OFSA 2ZYVX 3FM9A 2FCRA 1RVV1 2AJLI 3WLKX 2H2GA 3NXSA 3RS5A 2IZ5A 1HO3A 3CEJA 4CM4B 2NOAA 1Q50A 4RAQA 1RWNA 3KIPA 5JZ9A 4RF4A 4WGFA 4NBLA 3EPPA 3RJTA 2P1RA 1NC3A 3BHMA 2Y8EA 1JE0A 1LDBA 4B85A 2XT9A 2UUAB 5DXAA 4KXVA 4GVLA 4DV7B 2A88A 3IP7A 2NQTA 1CRWG 1MEJA 3TLZA 4ZI2A 2Q1UA 4CV0A 4MI6A 4CKZA 4IO1A 4ZANA 4PONA 5AW9A 1GV1A 2HU5A 3Q9UA 5C18A 1RXWA 1PQWA 3HYCA 3FROA 4PGGA 4AZ3A 4MQ6A 3V8PA 4HTFB 3CVUA 4IHAA 2Q5LA 4R7ZA 4ZAXA 1T5IA 1SPXA 2R7AA 1AO0A 1UJ4A 4M9RA 1C8KA 4OG2A 3FWZA 4NVRA 4RQTA 4BVBA 1Y63A 2QDKA 4A91A 2XB9A 4EYQA 2GXAA 4QNMA 5A4KA 1M7HA 5ALZA 3GMIA 3IAHA 4B3IA 4RH3A 2WTUA 2WKSA 2X5NA 4EFMA 1GAEO 4R1SA 1OUMA 4MKHA 1O4WA 1T5SA 2MU1A 3WFZA 5T57A 4FUTA 3VYWA 1NMXA 4D8WA 2XMRA 5DYIA 3M3DA 2HIAA 5FLYA 1A9RA 1I1QB 3FFAA 4F8EA 4BO6A 1RYYA 3AR6A 3SZ3A 2NYUA 1VL1A 3D8NA 3KQPA 4C07A 1NN1A 3K9WA 2MR5A 1NVKA 5GVRA 3BCRA 2AR7A 4JOQA 4Q4HA 3ROZA 1DAIA 3ZVLA 4JGBA 4EGJA 1DBRA 3TQFA 3PEFA 3KSZO 4C3UA 5L45A 5BMVA 1MEEA 3EFHA 4HAXA 2VJQA 4Z7QB 2VQ6A 4YP0A 5K3EA 3HBMA 3ICEA 3SSAA 4C14A 3ANLA 5BNTA 3U1VA 5CLHA 1WZNA 2JK0A 3PJFA 4WESB 2EL9A 2JVIA 3DTNA 3GU3A 3B9QA 1KMIY 3H05A 1A5TA 3DVAB 5JTUA 2Q7OE 2HNBA 4Q3AA 1RLJA 3I6ZA 3SM3A 2Z95A 1JBKA 2EBUA 3K5IA 3ZZNA 4AUKA 1P4HA 1N9ZA 3HR7A 4BNDA 2AMYA 3LYAA 3TLCA 5JJBA 3NJ8A 1CJKC 3GGOA 3QYPA 4EATA 4MROA 4MRSA 1U6IA 2OD7A 3EIQA 2HSGA 1LFAA 4NMHA 1W5AA 4H4DA 1V9SA 1W87A 2JJ2D 3OY2A 2FFRA 3IR7A 2BONA 2VDOB 3ZYCA 3L1VA 4ARIA 4QPNA 3U7HB 1U9CA 4QYMA 1NFRA 4CLXA 5HIJA 2AIRA 4TT3D 4MDEA 4IJ5A 1VA5A 4EUSA 3H11A 3GAAA 2PSFA 4LWPA 4XCVA 4FYMA 2VG8A 3Q7SA 4WN9B 5CXQA 2CK3A 4HB4A 5CFZA 4DIBA 1WX1A 1KR2A 1AMUA 4TTIA 3VR5H 3RRJA 1FXWA 3BEDA 4H17A 1L7DA 3E3AA 2VOEA 3H84A 3N8DA 3AW8A 4HPWA 3DH0A 4C5CA 2Q28A 4RVHA 4CI9A 4KLAA 4CF3A 5FOUA 3OZXA 4BV8A 4BFXA 3HXQA 1YB2A 4JUIA 1SUSA 2WF7A 5A4IS 2QY6A 2BSAA 1GARA 2YJGA 3GLKA 4NOMA 3W5UA 4P82A 5EL0A 4W7SA 1V7ZA 4WVLA 1QTQA 1PWZA 3UJ3X 4HH0A 1IU9A 3VR3A 4F71A 3HY3A 1VYHA 4RVUA 5EZQA 2HWWA 4YCMA 1YS9A 3IVMA 1N34B 5IDWA 4KUEA 1F8UA 3E1GA 3RHFA 2HJSA 3EPRA 2BMEA 1NI4B 2NM0A 3OJCA 2QPTA 2ZUDA 1P2UA 1Y3AA 4HHEA 5A5DA 4KDFA 5JH7B 3VVBA 4Q7QA 2HCBA 2ANBA 1Q3HA 2C2ZA 3C5EA 3WBKA 1U3UA 1K7XB 2GA8A 4CEIA 1COWA 3EVCA 2ECPA 2BCGY 5DYTA 1V3UA 3MCVA 3KHSA 4DSNA 4G5XA 1MZVA 3IB6A 3SVTA 1M5RA 4AI6A 4ZT5A 3JWPA 5DYWA 3D3JA 4LZNA 2XUHA 5EGNA 1JLMA 1JU9A 2H16A 3DJYA 4DANA 1J5EB 5AJHA 5K3OA 2OFPA 2XITA 3OJOA 1ULAA 3EPHA 4XGIA 3N0WA 1EE9A 2W83A 4EYSA 3TPCA 3VTFA 1Q14A 1UP7A 4B0PA 3ZCTA 1CUXA 3TD6A 2ZQYA 4C76A 3OQBA 1EBBA 1LI5A 3GBVA 4E2ZA 2WQ7A 2WG2A 2XVMA 2VAVA 1ADBA 2OSVA 5F52A 2PV0A 4JVMA 2P4EA 4X61A 3SYLA 2GN2A 5HM8A 2JI4A 2DRIA 5BQPA 1Y4AE 4QJIA 2GWHA 1O89A 2C5AA 5C81A 4O1HA 4KC0A 3CX8A 3FTDA 3AL0C 1RWKA 4PNZA 4DQUA 3INRA 3RR2A 4M1ZA 1EX9A 4JX8A 5G1PA 3K09C 1JB9A 4LE0A 2WTMA 3PKJA 4ZV4A 1I7QB 2ZPUA 3OQOA 3J80A 2F62A 2JGNA 3LVQE 1Q6YA 1L9XA 1JFRA 4GEKA 1G6OA 3ZHTA 5IHXA 5ALHA 4F3CA 2C3OA 4BXOB 3QYFA 3IEMA 4J07A 2E2WA 3JVIA 4J29A 4M0UA 2G9ZA 2TMYA 3GMDA 3IE0A 5FTLA 3UJAA 4NYMR 1SCBA 3H5WA 3HKEB 3JALB 4IUCS 5ECDA 1UDXA 3KKQA 1Y6QA 2FN8A 1QBKC 1E2MA 3WLRA 3ROTA 3GJTA 1ZH8A 3CKKA 4MS3A 1DZIA 2OVFA 1U0OC 3GA0A 3HJCA 3EXEB 4Q03A 4YUZA 1T91A 2AB0A 4Q9LA 3C3MA 5BQFA 4CMBA 2DBRA 3HM2A 2NLOA 1RXVA 1DTSA 4YIHA 1T6ZA 3WK4A 3SMVA 3TOZA 3QHQA 2FLVA 2Y1KA 4MVWA 3DTVB 1KXJA 1L2TA 1TYAE 3RC3A 2IH2A 1Z6XA 4AWXA 3RC8A 4NU8X 3IPRA 4J2TA 5L40A 3DEHA 1CIVA 5A9TA 1MG5A 1O87A 1AY0A 3LS2A 3SJZA 4DWJA 1OBHA 3IAM6 4QDKA 3V48A 2GXSA 1FW8A 4Y2HA 4HV4A 3PTAA 1AZLA 3EISA 2G40A 3LC7O 2G9UA 4C6RA 3FX2A 2GQ0A 1QH1A 2LVBA 2X3YA 4FDUA 3AESB 4MGZR 3ZGVA 4CMCA 4BP9A 4EZEA 3HJRA 1YTUA 5EIWA 3N2LA 4W8GA 5JS6A 1C7IA 1A7JA 2IZ1A 1HA3A 2OK7A 4K9MA 1QZZA 1WHSA 4AJEA 2HA0A 1J8DA 3EMBA 2C00A 3B7WA 1MDBA 1RRCA 4NMLA 1XEFA 1FMLA 3WRVA 2PIDA 1S7GA 2W2VA 3OCZA 4I66A 1U9YA 5JSZB 1JFFA 2C5BA 3G0DA 3LDUA 4QELA 1ATZA 3PC3A 2B8WA 1BXRA 1XZNA 4BC1A 3D6VA 2ZAIA 2EYUA 4KPUA 1KORA 3FWYA 3N28A 4GI7A 2REQB 5EKUA 2I65A 3VVCA 1YQDA 4AJLA 4DR6B 3R7AA 4HYQA 2FZCA 4BNVA 3HWX1 2O2YA 4J0FA 4J0JA 4US2R 2I99A 5ENZA 5IJ0A 3KJIA 4PPQA 2LWIA 1U7XA 1TC2A 4JOBA 4IIJF 2XWPA 4XX0B 4BNXA 4KQXA 1BX0A 3L0DA 2X9QA 3L5KA 4FS3A 5D2CA 1Z7EA 1Y6ZA 1VSTA 1BE1A 5C5IA 5K6AA 5JXWA 3C6XA 4BX0A 1E2NA 1JXAA 1KK3A 2QORA 2W43A 1PLKA 2OHJA 2ZBQA 3B1FA 3EZXA 5IJXA 4ER7A 4H6PA 4KI7A 2QUBA 1JMKC 4LYDA 4GX2A 3DGEC 2AE2A 3HABA 1Q3KA 1W4AA 1Z74A 2CDAA 4NYJR 2JHFA 4MWEA 1RNLA 4BC0A 4AQ7A 2HBQA 3QM1A 3G0GA 4EF6A 4BGVA 3RS9A 1NPDA 1I2CA 2V54A 4KO2S 4HQ0A 2C04A 5LOVB 3A2LA 1LY1A 2QE7D 3R3ZA 4YO8A 5DKFA 3O7WA 3UG7A 2ZANA 1NL3A 5G3YA 4QKQA 4PCUA 4D0NA 5BWCA 5FBVB 4IDNA 4ALNA 3BZUA 3JZMA 1U2ZA 1VCOA 1P39A 3AVQA 1P7CA 3IP6A 1LW6E 4LHWA 4MV9A 4WY2A 1QH9A 3MZ0A 4RZQA 5AJZA 5IBPA 4KACA 4RCYA 1FRNA 4LF8B 2R85A 2PZMA 1USUA 2HUPA 4AZSA 1P77A 1ACLA 1TDJA 2ZB8A 3KHKA 3NHRA 1EG7A 3DBOB 1WDWB 3H1TA 4HYEA 2ZIGA 3WV4A 5FWYA 1E5VA 5ICGA 1O0BA 1C7EA 3MBKA 2YWFA 4W5JA 4XEHA 1TF2A 2QVGA 4GZLA 1WW8A 1USVA 5HIIA 4UE3S 3GEGA 3M70A 5JPCA 1GL3A 1FL9A 3FWPA 1KI6A 3LZ6A 4N9QA 2H1RA 3TUIC 3NP9A 4BJ6A 3G5MA 121PA 1P0PA 5AHXA 3GLQA 1MO2A 2GKGA 2ZGVA 4LF5B 2R65A 1F2TB 1HQYE 1B0AA 2R00A 3H19A 1KI1A 5BY2A 3U49A 4X66B 3HCOA 5F98A 1A9XA 2WFZA 2DY1A 1B4DA 2OBFA 3CNHA 5C7IO 2D7DA 2NO9A 4I55A 1BQEA 2PKWA 3CF6R 3ZWBA 2PUCA 4WKBA 3DZIA 1CD5A 1KEZA 1G63A 3NYWA 4JQSA 3T52A 2V65A 4HQOA 4L78A 2LGJA 1ZW6A 5B7QA 3G82C 4ENTA 4OHPA 3VVLA 5ALXA 4Z99A 4M55A 2X0NA 3FZNA 4TGLA 3GVIA 5IVIA 3WYFA 1U2TA 1CUZA 1TT5B 2HWYA 3GLSA 1EFKA 2ZTUA 3JQCA 1QWSA 4WOJA 3S27A 4Z2AA 1YS7A 1Q95A 3A2NA 5I4KA 3CE6A 4YV1A 5AW2A 1SG0A 1TTHA 1XWWA 4JI2B 5EZYB 2C77A 1U3FA 3E3MA 4RPJA 4YASA 4R3NA 3RFFA 5YASA 3UAVA 1NQUA 1E99A 4UU0A 3B6MA 1XO1A 2ADOA 3UICA 3DLBA 1OTXA 4X94A 1AKWA 1T8TA 3JPWA 3KXKA 1VZ3A 4K6MA 1ZMTA 1WMSA 4XVRA 3S7ZA 3L5OA 3N8IA 4CMAA 1GV0A 1XLTA 4N0PA 2IXGA 3SN6A 1DUIA 2HA5A 3GCXA 2Q21A 3HFRA 2IPNA 3WGYA 4I4NA 1E4EA 1P81A 4XGRA 5HF6A 3WQBA 4AJHA 1A9PA 5AJWA 3SU8A 3SZLA 2RHCA 4YX9A 4JXZA 2WJ3A 4DR1B 1BVYF 1UPUA 3AHDA 1QHHA 2BMFA 4GNKA 2Y2VA 4L95C 1JHVA 1O2DA 2GPBA 2NVBA 3OCVA 2Z6UA 1FUUA 3H65A 3HYSA 1P62B 4H7DA 4ZCMA 5BSFA 2GKSA 1J2UA 3KJNA 3G89A 4FZRA 3DKPA 2FF5A 2XOKA 3N2ZB 2H17A 1CXZA 3V80A 1ZHOA 2PS0A 3WADA 3JRXA 1W48A 2RGCA 5B2FA 2XUKA 5JSQA 2ACEA 4RUKA 5EWJB 1VB5A 1ZSYA 4A92A 2V3WA 1VBNA 2AN3A 1JQ5A 1XD8A 1HDEA 3ESRA 3R09A 5ALQA 4EENA 5H3LA 3PPIA 2Y9MB 5ES3A 2HIMA 1Z0UA 2JAPA 4PCLA 4EFKA 1AE1A 5CVJA 3EXFB 2BFDA 3F90A 1M2VA 1TFRA 2JRLA 2XMGA 4GMGA 1MGPA 5JATA 1FB5A 3P0HA 3K5HA 1J09A 4JQCA 3WL6A 1M1YA 2EQAA 3FRIA 4HDKA 3V97A 2D1QA 2GJ8A 4GWLA 4RTSA 2ZB2A 1NKSA 3LHIA 5TPWA 4ZEVA 1HG1A 2PKXA 5FWDA 3TDKA 3O0TA 2FUEA 4W1PA 2ILTA 3HJHA 3VR6H 2X2OA 3MMNA 3PGXA 5T6MA 5FI0B 2PWBA 4S0ZA 2Y1LA 1V48A 5EEHA 3GHHA 4KPFC 1SBYA 4N01A 2GZHA 3OO1A 5KTRA 2OGSA 3WKDA 4LJRA 1BGVA 2YYSA 4R1NA 3S70A 1RPTA 5CUQA 3T1YB 2BMAA 1V47A 3A4YA 3GEBA 1N2BA 2C3MA 3MRSA 3PF9A 5FYDA 4RD0A 5IZ4A 4D9HA 1C3LA 9LDBA 3V7UA 1QQBA 1WPGA 2QRPA 2H3HA 2YZNA 5DX1A 2IYPA 3BWYA 2FZGA 4ZTUB 1FSFA 1N92A 3G59A 3S2EA 4NENA 3G1WA 4YQEA 4B5KA 4N5NA 4D74A 1NHGA 4XFJA 1NQ5A 4QAJA 2Z5LA 2I7VA 3MJFA 4LDNA 4NRDA 4ZIRB 1J9GA 2IU3A 3W5AA 5E4FA 4EG8A 3PXDA 3C6BA 1T9CA 3HCWA 1NVFA 3LT2A 4QQNA 1Z7WA 1QXSA 3M9WA 2YVQA 3S8EA 2CWWA 4UQPA 4J43A 2OTCA 3M4JA 4MYDA 1D4ZA 1W47A 1QB8A 1Y6RA 2BTQB 3H8JA 3S4YA 1HG0A 2I7CA 4J4TA 1J39A 1RWBA 3HN6A 4G01B 2ZB4A 2ZM6B 4KQHA 2QF7A 3GC6A 1MNQA 2HT1A 1M73E 2P2NA 2C5EA 2XOXA 4OVKA 3NP7A 1A8QA 3RYHB 2OE2A 3DA8A 4JEUA 3H2IA 4LHSA 4B79A 3TZ6A 1JH9A 2PPVA 1IYZA 1Y9DA 1E6WA 1ZVKA 3AHJA 4LVOA 1F2VA 2ZI9A 3P97A 2HEIA 5CD9A 4EDHA 3N8GA 1ISRA 4NJMB 1KJYA 3GJSA 2IIBA 1XB2A 3H42B 3IODA 5K0ZA 1QCDA 4KE8A 1VHTA 3NBUA 5K8TA 3TB6A 1MO3A 2HJGA 4S2UA 4JYPA 2OP1A 2G1PA 1HLFA 1N9KA 1YI1A 2JD1A 3HR8A 4OMUA 4XGQA 2DKNA 3S8MA 2HU8A 2ZSKA 1VE7A 3LHDA 4XQ0A 1JI3A 1DRWA 1LVGA 3N0RA 4KFSA 1SKAA 4CM5A 5ITZA 1XCLA 4OKIA 2VJPA 5I5EA 1JFTA 2FHPA 1OGIA 4GKVA 1XYYA 1DG9A 4ZQIA 4HGNA 3K0FA 1UMKA 2I62A 1EGQA 3AUXA 4V38A 5FPYA 2EGGA 1RRKA 3VR5D 2GVZC 3L7OA 4M7WA 3C8MA 4P32A 4Q9DA 4KLZA 4RKYA 3C48A 4HRVA 2PLAA 5CGQB 5GY7A 3FOFC 1GU1A 1CZUA 1HDZA 1W19A 3OF2A 3R6WA 4ON9A 1KRWA 2MSWA 1JQEA 4G1VA 4I8DA 1YKGA 2JHGA 1C9YA 2GM5A 4Z7NB 3I2JA 1L8AA 1JT9A 3HTXA 3H13A 1OLSB 1LI4A 5I7RA 3S81A 4X6UA 3CUVA 2WP8J 1JS1X 3HBJA 2CDBA 3ZDYB 4EDFA 5A0VA 4BFLA 2NTEA 3GA7A 4H35A 2B3DA 1JSZA 4BZWA 5J2UA 3SR3A 2OLJA 2XNKA 1GT6A 5ARBA 5A06A 3RO7A 3IV7A 3A9UA 2FWPA 1HFWA 1U3DA 4R8VA 4Z86A 2W2LD 4MRPA 3UH0A 2QU8A 4ISCA 3M2PA 3S68A 1R0BA 3FOEC 1U11A 4TVSA 4KMRA 3LFHA 4WBXC 4DWWA 3UWKA 3BYZA 5AKJA 4R8MA 2WD7B 4YWHA 4ZCSA 4CBVA 3LD9A 4EVSA 2UU9B 4Y9UA 2C94A 4AF8A 2JCBA 2V45A 5BSHA 5JAPA 2YQ5A 2HWXA 2GYWA 2O4CA 3PLNA 2NZ2A 4GM0A 1HNWB 2WD9A 1ONBA 4WNYA 5HFNA 3KVOA 4B6GA 2IY9A 4Q3BA 1Y4UA 1GPAA 1U7OA 3DBVO 2FQWA 2O3QA 1NVMB 2H1IA 1RKUA 3D6TB 4E2WA 2FMTA 4E5KA 3C7KA 3LNTA 1FNNA 2KYRA 5LLSA 3HEBA 1L5LA 4B34A 4G0XA 1P0CA 2RAFA 4MV4A 2FR0A 1XHLA 4N0EA 2CKDA 2XNJA 3TPZA 3BFKA 1CC1S 1RABA 2XYQA 5BR4A 5TS2A 3M9LA 2WG0A 3BKXA 2YH2A 3LBYA 4YMUA 2GGSA 4G4SP 2PZ8A 3OZSA 4YV7A 4PU0A 4TVKA 1BVUA 4YDQA 2FZLA 3U37A 1EUZA 5AJXA 2PGXA 1EM8A 1KJJA 3HKCB 2YXPX 4BMXA 3LLVA 3T7SA 2GA9A 4PYJA 2XCIA 3S99A 4CU2A 1BFUA 3GVHA 2JLQA 1PJ2A 1IG3A 3R4VA 5AKHA 5LQDA 4DUZB 1OE0A 4GAEA 1E2GA 4Q12A 3A1NA 1YNSA 4Q4JB 1MABB 4Q24A 4Z9XA 4H9GA 5EAIA 4TQUS 3WHPA 1UF9A 5DWQA 2Z5GA 3DB2A 4D6XA 1YIDA 4MQUA 4UVGA 1UBOS 4N4AA 4B3CA 3PX7A 3W06A 2NUTB 4JVSB 1U0FA 1XTIA 3UTCA 1I7PA 1VCIA 1YUBA 5F5NA 1J2TA 2FSGA 1DBIA 1JSRA 4DV2B 3BFXA 4L8WB 4AULA 4WZBA 3D7NA 1EA5A 3TDNA 1J7JA 4AY4A 2XX3A 2CNWD 3M1YA 4LGYA 1IZZA 1TYZA 3FKSA 1CF4A 1IXZA 4AMYA 3VISA 1HEIA 3KHTA 1EESA 3K2BA 1OXVA 4RHCA 5B3LA 3HP4A 4IEIA 4KZPA 3AETB 4PHGA 3AVUA 1BEEA 2EW8A 4MAAA 1M0WA 1OVGA 4BBZA 4EZBA 2PR2A 2VUIB 1JI0A 2NSHA 3VKVA 1LNZA 3RSQA 1V3QE 3CUTA 4GM1A 4GU5A 2YZMA 1WZEA 2FRXA 2ZI7A 1DIAA 5KNDA 5LDHA 4KOAA 1DDOA 2G67A 1JG4A 1B73A 1WDLA 1X7YA 4GLOA 2Y0BA 4ML3A 5IXSA 1JEYB 3L6DA 4UXIA 4A8TA 4CR8A 1J23A 2BMVA 1YB4A 5EKSA 4UNPA 4MCAA 4QECA 2ZJ4A 1W5TA 3P27A 1FTYA 2VHYA 3O9ZA 3KNZA 4XI9A 4V0SA 1DFHA 4NIMA 5BXYA 2FOXA 4J3FA 4B87A 4JN6B 5LN1A 3MTJA 3H4VA 2V7QA 5AKEA 2ZITA 1SULA 4RWEA 3LC1O 4NECA 3SSNA 2QD5A 1GFWA 4UCFA 4B71A 1IHDA 3GCWA 3MMZA 2JKVA 4H7IA 5HF5A 1FQWA 3RCBA 3V00A 2G1JA 3QEMA 4ZOEA 4X3OA 3QOWA 4FYXA 3UAXA 3MIIA 1XK6A 2DUUA 2FG7C 1RM5A 4PPNA 3SK0A 3DZGA 4BP1A 4DXDA 2WU1A 1VCMA 5K2MA 4PRKA 1FDOA 4ETNA 3N2YA 4JJ8A 3I8SA 2A0FA 5DM0A 3BGVA 3SQLA 3UYLA 3MWJA 2P4SA 4AJ1A 4QBKA 1PYGA 1PEYA 1Z07A 1OGYA 1WU7A 2IZ7A 3LCMA 4TSRA 4UTZA 1J0BA 5J4HA 1NFQA 3ILVA 1UBKS 3HCBA 5CNIA 2AN4A 5CDSA 5IW8A 2R8YA 2ZBFA 1I3NA 5ITWA 3NQ41 5ITSA 2ET6A 1NOIA 1GADO 4CI0B 2ZRPA 1CY1A 2NU6A 1E79A 1OYYA 1M74A 4IGKA 3MT9A 2RKBA 1DCTA 3NGMA 2IRWA 3OAAA 4IZ6A 4BB9A 1WB5A 3QJ5A 1HTBA 1IJBA 1GXSA 1JLLA 1X1EA 2Q3BA 2XNDD 1OV4A 3VTKA 4X8OA 3N7TA 1UCFA 4M1QA 1F4LA 3IHTA 5IYZF 4G0UA 1ZDMA 3VKHA 5JAMA 5D1HA 2X0RA 1LDEA 1G21B 1HK7A 2G77B 1MAHA 1E7MA 3VDQA 2WIGA 1F51E 1H0SA 4UARA 3K30A 5HF9A 4PIPA 3C4JA 3FUVA 3QQ5A 3VSCA 2VWQA 3PNSA 4CXMA 2ODNA 3FNFA 3EX7C 2PMCA 3EC1A 2OAQ1 4OP3A 4TQGA 1I0ZA 1SXJC 2AE1A 1N6HA 2CFOA 2QVZX 3LXRA 3MMXA 1A5ZA 4Z8XA 5IDYA 1HRKA 2OQ2A 4PFQA 4JYZA 1V41E 3KS9A 2I3DA 3ZDQA 3U4QB 4G0VA 1GPDG 3KJQA 5REQB 5IJZA 5CDGA 3RAFC 4Y7CA 1EFAA 1UBEA 5H81A 1WF6A 4J3NA 4DKJA 4K28A 1CWUA 4JBGA 3OWHA 1H8HA 1S3FA 3HLYA 1JJIA 2PSJA 2ABWA 4HQKA 2FGKA 5PNTA 3ZD6A 3UFXA 2BPOA 5A0TA 2RMKA 1E1NA 3ZGYA 3K71B 4OFBA 1XDSA 2XZDA 4WCVA 4ZZ2A 1RIIA 1A04A 5L3QB 1EK5A 1GGNA 5B55A 1Z4OA 2GOYA 4RTKA 3FKQA 1NDUA 2C57A 2Y68A 2NAPA 1Z73A 2VP2A 4FHCA 4IDOA 3GEHA 4JA0A 4TTJA 2CLCX 3DP7A 4FGSA 2BW0A 4PSKA 4WJKB 1E6KA 1TYDE 1T0JB 4DS3A 2E4YA 1RC1A 3Q0EA 1EE1A 3RANA 2JZNA 2MR6A 5ADWA 3U56A 1BXZA 1LH0A 5K9ZA 3I2KA 1RAAA 2DTEA 5CPBA 2I4LA 4B45A 2IHYA 5FIUA 3TOSA 3R77A 4ND2A 5CIWA 1K3TA 1JEQB 4BNUA 5LP6A 4DBVO 3HLTA 1ZITA 3AX6A 1M8KA 3MRVA 4C4PA 2CDRA 4RSHA 4AM8A 4DM4A 3K70D 4ARAA 4US0R 3NV7A 4HWSA 1AUQA 1JGTA 1MLDA 3DDWA 3H87A 4BO3A 1I30A 1TJ4A 1VKZA 1DO2A 2A6PA 4JLJA 2R44A 4D6YA 2VDLB 5AK3A 1KU6A 3AINA 3DWEX 1ORVA 1QIKA 4C22A 4ZN6A 1MB4A 3FYSA 4O2AF 2W22A 5DEOA 3QV1A 3W5IA 4ZHQF 2PHZA 3G8CA 5DULA 1S2OA 4CQLA 2IS6A 1QGDA 5A3VA 5HS6A 4C7OA 4QUIA 4UNSA 2R8OA 5CK5A 3VOSA 1G21E 2RH4A 2HQRA 3WMGA 1FX1A 2IU4A 1IRXA 1EZ1A 1M0TA 5AVWA 1JAZA 2P4QA 4B3TB 1BMQA 1GAXA 4HATA 1SR8A 3O8DA 1C0KA 4JLKA 1NF8A 5BV1A 1RAIA 1QYIA 3CU5A 4YDHB 1JR2A 1NPTO 1GA6A 1FFGA 2CD9A 2ZIUB 1JHQA 3ZJTA 2ZI3A 1G2QA 4LXYA 1N5MA 2WABA 3B3QA 4HNUA 4DUGD 1SN7A 1KMCA 2BFBB 3C43A 1NVAA 1XJQA 3O9VA 4QTTB 4X95A 4UFPA 2XCRB 3F74A 2Q5HA 2V7TA 1QRUA 3ZWMA 5AI8A 1M83A 1Z34A 3U26A 2IYAA 3NIFB 4IRXA 2B7CA 5IRCD 2V98A 3CZ9A 4ZVNA 1DIHA 2V5AA 1JHZA 2QTLA 2ZU6A 5DNUA 4ND8A 4ZC8A 5TF4A 1YULA 4NKRA 1AF4A 2SCUB 3VZRA 3GELA 2RC5A 2WW8A 3FSGD 3HGTA 5CBKA 2BJWA 3HMQA 4BQPA 3ZC3A 4DCNA 5FLXA 4HDCA 1F2UA 1VHQA 2VUSA 2FG6C 2PQ0A 3F7TA 4MQLA 5ALYA 4W6QA 5F3RA 1SVOA 1SIWA 1UM9A 4K1LA 3T3MB 2O7NA 2HMUA 4U6NA 4YUAA 1NR5A 2CFCA 3IMGA 2X76A 4FGZA 2P8JA 2XDQA 2AR9A 4WX2B 1PT7A 5G53C 3WL8A 2PL1A 1TK9A 4FDLA 2NU8A 1SVNA 2OHXA 1XLWA 3ETCA 3UJDA 5IT0A 5IK2D 1WMBA 1EDOA 2EKLA 2UYQA 4U63A 4M86A 3RVDA 3FR8A 3X3HA 3VNVA 3ETEA 3B3FA 2EFJA 3RTAA 3JQFA 4RA9A 3TL2A 4E3WA 1U63A 3GD5A 5TDHA 4F3TA 3LPMA 3WG9A 4YRPA 5HR5A 1U9JA 5CVDA 1PTJC 2GM3A 3MILA 4B7AA 1YUMA 4FEAA 3CBQA 3MPUA 1Y5IA 2QVBA 1JQJC 4G5OA 4L75A 4P8RA 5K3DA 4AJKA 4EUEA 2ZJZA 4F5DA 4GWKA 2X0DA 4AMGA 2RGDA 3EC2A 3G0HA 1KI3A 1GPLA 1WSWA 1GCAA 1EFCA 3GVPA 4LNUA 5JJKA 4WFJA 5FADA 3A6GA 2ZUEA 4XM1A 2JVKA 2OO3A 5T64A 4N6GA 4RS3A 1UT6A 3U5TA 4F93B 3OFKA 3BD6A 2ZBVA 1QRAA 1CYDA 2BEJA 2JIPA 1XD2A 3NIGB 3LCVB 1Y42X 3EULA 5MN4A 2V5VA 3MOSA 1G8HA 1P2VA 4JC4A 4U6QA 5GJCA 3AVTA 4ZRDA 1QLWA 3ACCA 3EEBA 1X1RA 1VE9A 3RUCA 1KNXA 1Y8CA 2FMKA 4G56A 4BZQA 4E14A 1N2JA 1NW7A 2ZT8A 2A1UB 3PPVA 7REQA 4P0PB 1J8YF 2SECE 2GXUA 2RI0A 3DZKA 1U3TA 2F1OA 2RHBA 1INLA 4PYRA 1SCNE 3ZEAA 3TNLA 4YAUA 3QBDA 3WLQA 5AUPB 4B44A 4XB6B 2HF9A 2GEKA 4NE2A 3PK0A 3C6ZA 1L5NA 5ECWA 9MHTA 4YJGA 5JXJA 3ZKWB 2R6FA 3AUKA 3I23A 4Z3DA 4TL8A 3ZU2A 4PHCA 2PS9A 4Q4AB 4QPCA 4BX3A 1TVKA 1Q91A 2BKAA 1K8XB 2UZ0A 1YZKA 1U8FO 3E9NA 2FB9A 2REOA 4A6PA 4WKNA 3H0KA 2P7IA 1CQXA 3MAAC 3MWYW 2IU6A 4PAWA 3Q1LA 5ALIA 4Z2YA 3DOUA 1SZDA 4BLTA 4EUNA 1PNOA 1MQAA 1I9GA 3C3JA 3K5WA 5JI2E 1SGWA 5LXTA 3SXUB 3D5EA 2I4IA 2F2TA 3ZHSA 5JZBA 1UMBB 2AK3A 1R6VA 5DNDA 5G2OA 5IBQA 3SFZA 3DDCA 3VDNB 4L73A 1G6HA 4U7TB 1YDFA 4HDMB 2DHQA 2J9GA 3BVPA 4LNAA 2XUFA 4GL4A 1NXOA 1EMDA 5TARA 5ILOA 1ZM3A 5JCOA 1T15A 1T1SA 2VYFA 1MOQA 2OP0A 3BWDD 3CLRC 3FYDA 3NXKA