4JVLA

Crystal structure of human estrogen sulfotransferase (sult1e1) in complex with inactive cofactor pap and estradiol (e2)
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
292
structure length
292
Chain Sequence
b'NSELDYYEKFEEVHGILMYKDFVKYWDNVEAFQARPDDLVIATYPKSGTTWVSEIVYMIYKEGDVEKCKEDVIFNRIPFLECRKENLMNGVKQLDEMNSPRIVKTHLPPELLPASFWEKDCKIIYLCRNAKDVAVSFYYFFLMVAGHPNPGSFPEFVEKFMQGQVPYGSWYKHVKSWWEKGKSPRVLFLFYEDLKEDIRKEVIKLIHFLERKPSEELVDRIIHHTSFQEMKNNPSTNYTTLPDEIMNQKLSPFMRKGITGDWKNHFTEALNEKFDKHYEQQMKESTLKFRTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Estrogen sulfotransferase
molecule tags Transferase
source organism Homo sapiens
publication title Mimicking of Estradiol Binding by Flame Retardants and Their Metabolites: A Crystallographic Analysis.
pubmed doi rcsb
total genus 113
structure length 292
sequence length 292
chains with identical sequence B
ec nomenclature ec 2.8.2.4: Estrone sulfotransferase.
pdb deposition date 2013-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4jvlA00
2V1XA 4XTCS 3T5DA 3THXB 2EWVA 1ZNYA 3LVRE 3QPVA 2GJ9A 4A8JA 3GLIB 1C1YA 4ZO4A 3RWMB 4FMDB 3W8RA 4M1MA 1CS4C 4JLBA 3KKMA 1VIAA 1X1SA 2ZRKA 2XX3A 3OESA 2OBLA 3H4MA 5FL7A 1ETUA 3HU2A 3OIVA 1S4QA 4D0NA 4EUNA 3QXXA 1KK0A 2JLWA 1NL3A 3LX8A 1E2PA 1ZM7A 3SJCA 3EASA 1TAGA 2D2EA 4NYIQ 2YNMA 4OI2A 4OQXA 5EXSA 5EJEA 3LW7A 4M1TA 2XEXA 3B78A 3MD0A 3K0SA 5DGXA 2CL7X 2O0JA 1IN4A 3IO3A 1OSNA 2IW3A 4PR0A 5DI3A 4Q1FA 4TL8A 4MUBA 2FWRA 1BH2A 2ZJ2A 4DLRA 1DAHA 2BWJA 3MG9A 5JLJA 2JLYA 1ZIOA 5A5GA 1Y3AA 3NH6A 4KYUA 1HY3A 2WKQA 3BB1A 4MYHA 4KCGA 1UEJA 4WVFA 3IPXA 1GWNA 1E2HA 5HZKA 2O8CB 1BO6A 2IUSA 3KDSE 1LFDB 3HPRA 3C7KA 2PJZA 1R5NA 1UBCA 1R7RA 5J4VA 1ONBA 1X1RA 1JBKA 1N5KA 3I32A 1FL9A 3RLFA 1G291 2J5XA 3AP3A 1E98A 4A8JC 2QPAA 3EWSA 2N42A 4A0RA 1NMZA 3RSOA 2P2LA 3KXKA 3V9PA 2JLUA 1G3QA 3CH5A 1VCMA 5J40A 1VG1A 1W36C 1OYWA 2YC4C 3TMKA 3R9IA 5JECA 2QSYA 4XIGS 1E9SA 1P9RA 4PPQA 4US2R 1DELA 4CEHA 4QGGA 2HXYA 3FWYA 4I4LA 3FMOB 1JR3D 1PLKA 1GNRA 1MABA 2HEIA 1F60A 4MGKR 5JHHB 3VR4A 2GVZC 1CJKC 2KWIA 4PXAA 5TVKA 2HUPA 5BXQC 1Z2CA 2R6FA 3OEHD 3LNCA 4D6PA 2FZLA 4L16A 3ASZA 1NIJA 3LO5A 1NSTA 1QZXA 3ZZUA 2IEZA 3IILA 4ZDWA 3OFNA 3Q85A 1A7JA 3IHWA 2GAAA 5L3RA 2XNSA 3IKJA 4RZXA 3DZ8A 1VPLA 1R0YA 5CLQA 4G5RA 4IDNA 2H7VA 2X1VA 2FFAA 3QQ5A 2R2AA 2OXCA 1HUQA 4UNPA 1WBDA 2VO1A 1E4VA 4Q7JB 2O8EB 1SKYB 2PCLA 2XB4A 4PHTA 1IXZA 5HR5A 2RB4A 3EC1A 3EZ9A 1FX0A 2ZRFA 2QENA 2ZRMA 1ZNXA 4FD2A 2ONKA 3K70C 2FSFA 3GMTA 3CW2A 1TUIA 2FA9A 3PFIA 1Z0KA 2ZSDA 2EFGA 3BFKA 1YZGA 3FMPB 2JGNA 4ON9A 4TLBA 4JLMA 3FKQA 3B1ZA 2QMUA 1ZP6A 2Q6TA 1AM4D 1KSGA 2PX3A 4ZDJA 3U4QB 4AD8A 2BJWA 3CNLA 2RGEA 2BV3A 2XOKA 4BGDA 3DOFA 4CT4B 3H0KA 1N6LA 1ZC4A 2YINC 2FSGA 2PEZA 8OHMA 1D2MA 4L5BA 5AJYA 1NRJB 4IOKA 4DXAA 2W00A 1YZTA 3UANA 3I8SA 1JALA 2BDTA 4MRVA 2VSOA 1ZRHA 5BQ5A 1RRGA 2G6BA 2AK2A 2BCJQ 4V0NA 4DCVA 5IK2D 2ZRLA 3OIWA 3THXA 4P33A 3A4NA 3G82C 4B44A 2VF8A 4KFRA 5C46F 2YWEA 2VEDA 4OHVA 1E9AA 3VMFA 1WA5A 4OI4A 4KFTA 2PMDA 1G16A 1KI9A 4P32A 1TMKA 4HLDA 1GSIA 4M1SA 2QGNA 1Z6AA 3NEJA 4LYHA 3MWJA 4AI6A 1XXHE 2AK3A 1XJ0A 3GJXC 1NMYA 2ZROA 1KAGA 2DYKA 2AX4A 1FP6A 4AYTA 1F6BA 3K9HA 5KDDA 2XGJA 3EAQA 3K0CA 1G8YA 1U0HC 3IIMA 3T1OA 4LJ9A 4D4JA 1GAJA 4A92A 1Z0JA 2ZUCA 3NBXX 4ZCLA 3B1XA 4JLJA 2W58A 4P4UA 5EZ6B 4Q00A 4XD7A 5CM8B 4E5UA 4GNKA 2ORWA 5TDHA 5KTYA 4HLUC 1AKYA 3CUEF 5B57C 3NC1C 4Q4LA 4B32A 5DSZA 1ZU5A 2OBMA 3VNVA 4DT1B 3ONWA 2NPFA 1YE8A 2GHIA 4C0SA 4HAWA 4DSOA 3RDPA 1N6RA 1GOTA 3CWZA 3E1SA 2HXSA 4D0GA 1G4AE 3B9QA 1HEIA 3IIKA 2PJRA 2EVWX 4LOAA 5AJVB 5D3MA 4E03A 3VFDA 4K8OA 1Q1EA 4HB3A 4IHQA 1NG1A 2GXSA 3EZFA 4HDQB 1D6JA 3GEHA 1TEVA 2B6HA 4I1SA 2BC9A 4DVGA 1BIFA 1Q0UA 2FSIA 5CB6A 4AKHA 5FPTA 1KSHA 2PZFA 4LC0A 2CDNA 2IWRA 3TK1A 1JEEA 3THYA 5J47A 4EFNA 4DDVA 2VL7A 2FJUA 4JLNA 4PAQA 2C9CA 2CVHA 1CP2A 3PG5A 4M1OA 1S96A 5DH9A 4DRZA 4QJ5A 1Z5ZA 1P72A 1KKMA 1OFHA 4TWZA 1TQ4A 1NBMD 2GBLA 1GL7A 3AF1A 4ZPXA 2IYQA 5FBLB 4M1WA 1N6KA 5KPDA 1II9A 3GJ3A 1DAEA 4TSFD 2OBNA 1AS3A 1S8FA 2HLDA 1G8HA 3BIFA 2FX3A 1QHIA 3UWKA 2GCPA 1SVOA 5KSPA 1E2KA 1ZBDA 1RYHA 3WNBA 4ABYA 3ADCA 1S9HA 4M22A 2WAYA 3VKGA 3BRWD 5AUNB 2O0KA 2A78A 3MLEA 2WKPA 5AUQA 1LVGA 3QF7A 1W4RA 4GMXA 4W5HA 4Q1CA 3SQWA 2ZRAA 1XB2A 4XSHA 3PCRB 3TVTA 4FIDA 5FUWA 1JJVA 4KBGA 4A4DA 1G3IA 2MSDB 5KSYA 1MOZA 2A5DA 2SHKA 4PPGA 2IXGA 4Q9HA 3RRNA 1KDPA 2FGKA 3KQHA 4I1OA 4V0KA 2QAGC 2PZGA 4MRRA 4EFMA 3NIBA 3B13B 3DM9B 5L3SB 3U6KA 1IY2A 4A1FA 2VQSA 3ZVNA 4RD2A 4NH0A 1W36B 2PBRA 5K8LA 1C4OA 4BQSA 3T12A 4DHEA 3ND9A 1N6NA 2OUKA 2IBMA 1RJ9B 3GJ7A 1SULA 3WYFA 4B2IA 4DSNA 4TYNA 3AVXA 1T4GA 4RKEA 4IJMA 2D3WA 3CBQA 1L4UA 1D9ZA 2BOVA 2Q21A 4YXWA 1J70A 4MGZR 4QBGB 4RCYA 3CZPA 4JLAA 1P9NA 4M4SA 1Z3IX 1QVAA 2CE2X 4QC2A 4URWR 5AJXA 2DB3A 5EXXA 1N5IA 3BH0A 4NMMA 4ASUD 1R10A 2CLCX 1DO0A 3GLGA 1XTJA 4OQFA 2HT1A 3RVBA 1AGRA 1KY2A 1Q12A 1XJQA 2I1VB 3ZYCA 3PUYA 4YMTA 4ARZB 1EG7A 2OM2A 4PX9A 1CTQA 2NZ8A 2X2EA 4OQLA 4M1YA 4PO8A 1CR2A 2QUZA 2VA8A 2D62A 3UIEA 4G5OA 1HT2E 3KJHA 1XPUA 4C7OB 3C5HA 1TF7A 2WSSA 3NBFA 4KVGA 1JECA 2Z6VA 3CF0A 4Q01A 1J2JA 2DPXA 5KNCA 3W34A 3LD9A 2GBLC 4HDCA 3A37A 3EZ6A 2GA8A 2R6CA 1Q1BA 1ZVQA 1BKDR 2CNWA 2FFBA 3GJ5A 4LUCA 3AF4A 3DMNA 4F91B 3WP0A 3QKUA 5J5CA 5P21A 4BFTA 3LXXA 3B1YA 4Q4AB 3GLFA 3GLGE 3PUXA 1GKUB 2ZEJA 4DLWA 4W7SA 1JR3A 1MV5A 3AH8A 4GZLA 2A30A 3AKDA 3SJBA 3SYNA 2HJGA 3NKVA 4TQAA 3U7GA 1XTQA 1U8AA 2CK3A 4E07A 5BN5A 2ZUDA 3LVQE 4QBFA 3VR5A 1I4DD 2K5UA 3VR1A 3A4LA 2ZYVX 4K46A 3HJNA 2GEUA 5L3QA 4CEHB 1KO4A 1HYQA 3CX8A 3TQFA 4EPYA 1KO7A 1M7GA 5G41A 3ICQB 2O0HA 5F9FA 2WSMA 1KI7A 1NBME 3GFOA 1WF3A 3PQCA 4P4SA 1D8TA 1W4CA 2C77A 3SBDA 2O8DB 5F9HA 4NKRA 3K09A 1I4TD 5G40A 4V0OA 3O8CA 3EC2A 1ZW6A 3IIJA 3R20A 4EJSA 1DOAA 4DKXA 1J8YF 2ASEA 5FOSA 1T6NA 2VHJA 4MYTA 2XAUA 4LV5B 4I1UA 2WOOA 1PUIA 2JLXA 5BWMA 1SHZA 1Z6XA 1KKLA 4NZYA 4HI0E 3GEIA 4LJ6A 2GTPA 2DFLA 1VYTA 4B2PA 3VR2A 1WDTA 3QKSB 3KB2A 4EDHA 3MMPA 3C8UA 3IQWA 3KX2A 1R8QA 1IJFA 1CR0A 3SEAA 1SVLA 1FPMA 2JCSA 3BE4A 3K53A 4GOJA 4LHXA 3T35A 3CIOA 1PJRA 2GCOA 5CDFE 4DUGA 1E2MA 3FPAA 2REXB 4KFUA 2QMEA 3SYLA 4BLRA 3WNCA 2NTYC 2E87A 3H2YA 5EP1A 2NMVA 1KO1A 2XB2A 2ATVA 1LB1B 3LRPA 2ZJBA 4HUQA 4BZXA 1VG9B 1JR6A 2ZJ5A 3ZQ6A 1J7KA 4L9SA 2GZHA 2J59A 5FOXA 1GL6A 4WIAA 1NVVR 2P0EA 5L3SA 3WY9A 5FOUA 3QEJA 4FWIB 4IXNA 4OQNA 4B3CA 2QU8A 5FPKA 1RRCA 2BM0A 2OSBA 2GESA 3VR3A 5E3HA 2V1UA 1E32A 4DC9A 4C0HA 5FL3A 3RSLA 3WHLA 4IOMA 4B43A 5J4LA 1M74A 1IJEA 2HCJB 4KI0A 3SFZA 4TYWA 4L15A 1JB1A 5TMPA 3K1JA 4JBWA 2WIBA 4EJSB 1YR8A 3AF0A 1S2MA 3K09C 1GNPA 4ZCMA 4PSKA 3N2IA 2QROA 1PUJA 3SN6A 4LJ8A 1KY3A 1TQ2A 2WWGA 4LI0A 1UBFA 3ZDQA 4ZCIA 4JVLA 2OAP1 2FMXA 4WBSA 4E09A 3J81k 1E2NA 1GFIA 1T9HA 2ZRJA 2VH5R 1EFUA 1Z07A 3IPYA 4Q7KA 1W47A 1OFTA 6Q21A 2BMJA 2Q3HA 4AKIA 5F2EA 1OIWA 2DCUA 4M0LA 3AP2A 3AVOA 4MRNA 3L2OB 2BBTA 4ESHA 2DWQA 4PC7A 1W44A 1JQJC 3P32A 4YXWD 1JR3E 2EFDB 2ZM5A 2W6IA 1U0JA 3U6BA 1P2UA 5CYPA 1U2RA 1TPZA 1ZC3A 4BECA 1JPJA 4YDHB 5JRZA 4HSEA 4ASUA 1L8QA 4MKFA 3U3KA 3SZRA 4BZPA 3P27A 5ELXA 1DAGA 3FKSA 5E7JA 2C03A 5H1YA 1XCMA 3OIYA 2E9SA 2ZSFA 1IHUA 5JWHA 5H68A 4Z1MA 1ELOA 4Q4HA 1RRPA 2BCGY 3A36A 4NDZA 4WZ6A 5LPNA 2JA1A 4MGIR 4B33A 1N2CE 2ZAMA 3GJ0A 4JJKA 5L3VA 5K8UA 1ZUNB 4UKDA 4NU0A 4DSTA 2ZJAA 5JSZA 1AJEA 1FNMA 5CM9C 2ZYTX 4CEIB 2G1JA 2OV2A 3E2IA 2PT5A 2WZQA 2NO9A 4QHSA 3Q72A 4S2EA 3VU9A 4DLZA 4Q19A 5SZIA 3U44A 5KSOA 1KI3A 1LS6A 2AWOA 3X1XA 4TN1A 4JKYA 2HLDD 1SQ5A 2FSHA 2ZJOA 3DKVA 3QVUA 1EXMA 3U3OA 2YKGA 5KSZA 1UFQA 3SNHA 4MYUA 1KO8A 2IXFA 4C0LA 2CEAA 4RD6A 1Q20A 3BS4A 4LJ7A 4NYIR 1US8B 3SE0A 4QHTA 1R0XA 1T3SA 1PLLA 4AWXA 2GETA 2HDNB 1JNYA 1VYUA 1U8YA 4IVQA 2YWHA 4DCTA 1DO2A 3TUIC 2F43A 1KK1A 4O2LA 3EZ2A 1W1WA 3R9XA 3KQUA 4QBHA 3UATA 2ODWA 1V5WA 4A36A 5B58C 4G1UC 4Z8XA 3THOA 1H8EA 2V4ZA 1SKQA 1ZMXA 2Z4RA 4RJLA 2R6DA 1KNQA 4ACAA 1DG1G 1E2DA 2QM8A 1KOFA 1XXHA 4DB4A 2ZI6A 3VQTA 3P4YA 5FI0B 2WOJA 3QEOA 2RGCA 2EW1A 2JDID 3B6EA 2AD1A 1J99A 1FMLA 4JLPA 2F9MA 2VYFA 1VKJA 5AJZA 4BWYA 4UJ5A 4GI7A 2NOAA 1H65A 1E2QA 1C9KA 3BORA 4PPFA 3AVYA 3TRFA 1CJVC 1ZYUA 2XNDA 3W90A 2JAQA 3QXCA 4BFVA 3K0CC 1Z28A 4I1VA 2L0XA 3DPUA 4PTLA 1KK3A 3A4MA 5KDLA 3IBYA 4PC1A 2KI5A 3M1IA 1N6IA 4UNNA 1UEIA 2JEOA 4QGFA 2C8VA 1XEFA 4QHYA 3MAAC 2XITA 3CRW1 3QG1A 1VECA 4RFSA 1U94A 1Q1ZA 3FMIA 3RAPR 4MRSA 4EJSC 4Q7MB 5C4MA 2BHRA 1HV8A 1XDBA 3G0HA 1GM5A 4O0MA 3QPWA 4PC3A 3NBYC 3L0SA 3WNDA 3EIHA 1WMSA 1G3RA 1UBGA 1ZAKA 3RRZA 5CJPA 2C04A 1WRBA 1RKBA 3I4LA 3ZZTA 2O5VA 4BLQA 1J90A 4M53A 4HEJA 1VYVA 2EFHB 4WZAE 4NCHA 3T1QA 1KDRA 2ECKA 3LA6A 1U9IA 2BEKA 4IEIA 3BH7A 2WBLC 3AKEA 4MKIA 4NONA 2H1LA 1ZU4A 3CRQA 5LB2A 1XWIA 5JMTA 2V6IA 3QF4B 2F1JA 2V7QD 4Z8YA 1DAIA 2B8TA 5FOVA 1RIFA 1E6CA 1L2TA 3THYB 5B64A 2ZI3A 2BMDA 4EPVA 1RYFA 1TU3A 1U98A 1ZINA 2UVQA 4B73A 1IY0A 1CIPA 2OCPA 2PT7A 2R44A 5SZKB 4QM7A 2XJ4A 2GAOA 2AKAB 3QXHA 4P31A 1XD2B 1JAHA 3QKSA 3R8CA 2TMKA 2ZI4A 3QI2A 2RMKA 1SXJE 1ZM4A 4GBMA 4M9SA 1DARA 5AWFC 3AVWA 5FPSA 1RC8A 4QM6A 2J87A 4CGZA 5JEEA 4A82A 2GJKA 4JT4A 4A2WA 1HQYE 4A0FA 1W0JD 2GJ8A 1Z08A 3AF2A 4Q18A 2IYVA 5DYIA 4Y0VA 2D7DA 2Q3FA 4TYPA 3NVAA 4AYXA 1WB9A 3U44B 3OEHA 1PLJA 1Q22A 1M7HA 1DS6A 2ZJ8A 1IN5A 3F5FA 4LCBA 4AKGA 1N5JA 1Z06A 1DEKA 1GP2A 1KMQA 1Q21A 2CLDX 2G1KA 1W4AA 4TT3A 1NG9A 2CVFA 2QT0A 3KTAB 3UKDA 2EYQA 1DAMA 5CJ2A 3RS2A 1KGDA 3LAWA 3AP1A 4FMCB 1VCNA 5DHAA 1EFCA 4LYJA 2JLZA 3T5GA 3VX3A 1FZQA 2AN9A 3QXJA 1N3BA 4I81A 4NHOA 1P2SA 3TR5A 3BB4A 4AYWA 1RZ3A 2IYRA 2J9RA 1II8B 3FGNA 4Y0AA 4AURA 2GZDA 3NWJA 4FN5A 1EFRA 2WWHA 1XCPA 2IK8A 5CB8A 4LWZA 2I3BA 3PXGA 1T8TA 4QFMA 3TH5A 4EFLA 621PA 2RGNC 2EWWA 4V0ME 2NO0A 5TV2A 2OFWA 4CYMA 3FKSD 3CPEA 3TNFA 4LRWA 3NDBB 2VIIA 3A1VA 1H8HA 4JSTA 4IEEA 1G6HA 4KV9A 3ZIAA 1E2GA 4DLXA 1GRRA 4EAQA 5IHPA 1JI0A 4LK2A 1H8ED 4YMWA 3ZVLA 1E9DA 3CKLA 3EIEA 4KAXA 4GOKA 1GZSA 4HDOB 3BGWA 4C2UA 1OYYA 4UNSA 4MKHA 3IGFA 1OE0A 3RS4A 1X3SA 4ZDIA 3NH9A 1F2UA 2MSCB 4Q5IA 4B75A 2P5SA 2VP9A 5B2ZA 3SOPA 4XD7D 2ZETA 4ESVA 3BJIC 2CCGA 3K0AA 4HB4A 4IDHA 1X6VA 3DL0A 1K5DA 1ZNZA 1MT0A 221PA 4Q47A 1G8GA 4WXPA 2O8BA 1D9XA 3ICEA 4PQFA 3QOFA 4F4IA 1E9CA 3T1TA 4EQ6B 4N0EA 4Q4AA 2G9NA 2IYXA 3D31A 3EA0A 721PA 3GLFB 4GOXA 2HJVA 1FUUA 4E22A 3GLFE 1CJMA 2ZSAA 3OIUA 2V9PA 3LXRA 4LHYA 2XNDD 3QKRA 2J41A 2JATA 4Q4JA 4YMSA 3NHBA 1Z6GA 4NYMR 3M6AA 1TADA 1T0JB 1DAFA 1LTQA 4XOIA 4TMZA 4Q7LA 1XEWY 2FPLA 5EE0A 2GXQA 3UK6A 2F55A 1MH1A 2FU5C 3ZZ0A 2QTFA 4BEJA 3T61A 2GCNA 2XSZA 2BKEA 4RD3A 3Q7QA 1OT3A 2YC2C 4RCZA 3UXMA 4CEJB 3WBJA 1E9RA 1G5TA 3RS5A 4D2IA 2MMGA 1ZUHA 4YDSA 2JLRA 4OI0A 5GJVC 1COWA 1G3UA 2QPTA 3FB4A 4JLDA 4UXJA 2WJIA 5C4GB 3U4QA 5IF9A 1P75A 1Q57A 5H8WA 4N1AA 3TGPA 3D3QA 4RZUA 2IS6A 3SDZA 3ZVMA 1ZCAA 1DAKA 2IHBA 2ZYUX 4OI1A 4NCJA 2QZ4A 3W3AA 2QL6A 3FVQA 2WHXA 3KKOA 2J0SA 1KJWA 3UG6A 1PZNA 1EFTA 2QMHA 4G5QA 2ZAOA 2VRWA 2AWNA 1OLOA 1P61B 4HUTA 4XTRA 1D2NA 5EE9A 1E1RA 2V55B 5JI2E 1X8LA 3MWLA 4J0QA 1XZPA 1YZQA 4B35A 3C15C 5M04A 5EP3A 3RS7A 3WRYC 3GLHB 3CF6R 2H18A 3KB1A 2WJVA 3PUWA 3A1SA 1F2TB 1VMAA 5E7IA 4XVQA 5AR1A 5IDVA 3I8XA 3OFND 1EWQA 1EWRA 3U3MA 4TTPA 1HQCA 3UMFA 4OK3A 2QBYB 1OIXA 1KI4A 1UAAA 1YVDA 4DDTA 4BRWA 1TTTA 1N0WA 3NBZC 2PL3A 2HF8A 1DE0A 2X19A 3OZXA 3P4XA 1DADA 1XZQA 4HB0A 4PSVA 2AR7A 1LF0A 2H17A 5JWRA 2RGDA 1E2FA 3MCAA 1SVMA 2BEJA 4CDGA 2F1HA 521PA 4UNRA 4JVSB 3W5IA 2JJ8A 4LYAA 4DDUA 4BLTA 4B34A 3ZQJA 1YZNA 3TVDA 2XZOA 3SJZA 3ADBA 3T1VA 2ZSEA 5GJBA 3QXSA 3A1WA 1G41A 3FFAA 4Q21A 1Z0AA 3HP1A 3EWAA 4U00A 3A58B 5DNYB 1EESA 3RWOA 5AJWA 2IHYA 1P9WA 1T3LA 1TL7C 4MGYR 1XX6A 3W6PA 3QVVA 2CK3D 2W6JA 5D3MB 5DO9A 1OH8A 2LKDA 2VP6A 1ZM2A 3D8BA 3K70D 5BN4A 2LCFA 4L4UA 2C5LA 4TQUS 2DFKB 5JI3E 2J7PA 4LSGA 2QP4A 3BFXA 1KZGB 3EPLA 2H8KA 2A5GA 1TQDA 1G7SA 1SXJC 2HCBA 3LBHA 3PJRA 3I5YA 1SHKA 1ZNWA 4W5WA 5DI3B 2KBFA 1AKEA 4AY2A 1VCIA 4DCUA 1KI6A 4POAA 2RKOA 2GDJA 1W0JA 3BC1A 2B21A 2XJ9A 1AA9A 1LS1A 4CW7A 4G01B 3CH4B 4DLVA 4KYIB 1GDDA 1U0LA 3DZDA 1F2UB 1OHHA 5HKKD 3L0PA 1KJYA 2A9KA 3VKHA 2Z0MA 1SXJB 1KO5A 2X2FA 1E99A 5SZJA 1EK0A 5EE5B 2PLFA 3TAUA 5KO2A 4GPTA 1OPXA 3TW4A 3KUDA 3U7FB 4BFUA 2JJ2A 4TTQA 4M2LA 3Q5DA 3B1WA 2YVUA 4EPTA 3KZ1E 4XWKA 1NJGA 1XEWX 1MRSA 3HYTA 2WPDD 2D74A 4GP7A 3RS0A 1A82A 4IOLA 4Q4JB 5TB5A 1O3YA 1QHGA 3K9LA 2BIFA 1NVWQ 2P5TB 3AVVA 4US1R 5KDOA 2RHMA 3L8ZA 4DEYA 5KU1A 1XD2A 3CF2A 2AD5A 5LD2B 1QHNA 1SGWA 3LQRA 1Q3HA 3HU1A 2CJWB 3QUSA 3TUJC 3AUYA 3KKNA 5A4JA 4CEJA 4QNRA 5EUMA 1NJFA 2OEPA 5DE3A 1KIMA 3Q3JB 4V02A 3IQXA 5HPYB 3EPKA 2BMFA 2CL6X 3CRMA 4U5XA 1IN8A 4P0TA 3GEEA 4UJ3A 2KB0A 1E0KA 1XTKA 2IYTA 3AVQA 2WM9B 1M34E 3DDCA 4RFVA 4XWOA 3CWQA 4DIDA 3F8TA 4OBEA 1OKKD 2WVJA 4LX0A 2F6RA 2JLVA 2RGXA 2BKUA 2ODBA 4FI3C 4IVRA 1P5ZB 4PZZA 3TQCA 2IS4A 2MSEB 3DO6A 3N2EA 2J0UB 1GILA 4RD0A 1OH7A 1ZJ6A 2DFNA 2OE2A 2ERYA 1KYIA 1EX6A 1XP8A 3OEEA 3O47A 3UMSA 5TARA 3DEFA 4JJZA 4D4KA 2H16A 3NEYA 1YR7A 3CLVA 2IYZA 1E96A 1E2LA 2C99A 1AS2A 5F98A 3MSXA 3I73A 3LLMA 1XRJA 5E4FA 1EX7A 3LDAA 3HWSA 5JJLA 3FE2A 1QBKC 3JZMA 2J7KA 3LBIA 1XXHB 3FTQA 2NG1A 2W6JD 3QENA 2WJJA 3OF5A 1FTSA 3H1TA 2FPKA 3W3ZB 4GMDA 1TQ6A 2GRJA 4PHHA 4F38A 5CIWA 1MO4A 1QHHA 1IY1A 2RAPA 4TTRA 3GPLA 2CLSA 3AVPA 1A4RA 1CEEA 4UNQA 2O52A 3SR0A 4MH0R 5J4YA 2ZITA 5CK5A 2ORIA 2FEMA 5JS8A 4X8LA 3MJRA 2FG5A 3K0AB 4OQMA 4C2TA 5DLQC 2QE7A 4A0HA 2QMOA 3U7HB 5ANRB 1JPNA 3B1VA 4A9AA 1XPOA 2FDCA 3GLIA 5JEDA 5A0FA 4R2IA 3ZS9A 4ZIRA 2ANBA 2IL1A 4EKDA 3HPQA 2QN6A 4R7ZA 2C78A 2WAXA 3K9NA 4NYJR 3AKCA 5FTKA 4PO9A 2OFXA 2WWFA 3V4RA 2F1IA 1XMJA 1UBEA 3B82A 1OFUX 2IC5A 4FCVA 4N0DA 3AF3A 2R65A 5FFMA 3SS8A 2VP0A 3D7MA 5CK4A 5TXGA 3ZH9B 3T34A 3SJAA 2VP5A 1CKEA 2AKYA 4BLPA 3CRRA 4GFDA 4KLNA 3I1FA 2P6UA 4YC7A 1IOZA 2GZAA 3SHWA 3RNLA 1KI8A 2J1LA 3JVUA 5FUYA 1XTRA 3M0EA 2QI9C 1S0UA 4Q9IA 1MO6A 2VHUA 4M9XA 4HB2A 2R6AA 3MGCA 4PFSA 3ASYA 1ZD9A 2G0TA 4YONB 1LV7A 1SXJA 3PEUA 4QGHA 3OAAA 4Z1MD 2W0MA 2Z5FA 4FINA 2IX3A 1NKTA 1W0KA 4LBYA 5IRCD 2EYUA 1N6HA 1GTVA 4QG7A 5BYJA 3TIFA 4UXIA 1NF3A 1OH5A 421PA 2OXRA 5UKDA 3Q5EA 5FPYA 2WWYA 2ZR7A 4B3XA 1NVVQ 1YKSA 4NCKA 1TUEA 4D4LA 1BS1A 2V7QA 1G21E 3TSOA 3I61A 4JIMA 1UKZA 2ZREA 2J0VA 3QKTA 3WMFA 3VR6A 2V6JA 3CRVA 4JL5A 3BK7A 4LYFA 1PVOA 5DIFA 3K9GA 121PA 1GIAA 4JVMA 1Z29A 2NO7A 5JJKA 3B60A 2ZVQX 4TLAA 4DEXA 1SXJD 4GL2A 1KK2A 3BH6A 3PEYA 3UPUA 2BM1A 1CULC 1UJ2A 4CT5A 3OEED 5D3QA 2AXNA 1UKVY 3CPHA 4QXAA 2RH5A 4LJ5A 2C9YA 1BMFD 1RRFA 5EP2A 1P73A 1ZIPA 4HZUA 4TMWA 5JFGA 1X86B 2ANCA 1L7VC 4PC2A 4XJXA 1AIPA 4KLZA 4URUR 5FUXA 1KMHA 2YHSA 1P4SA 3X1YA 1VDZA 4TSFA 1OW3B 1W49A 3FHCB 4PHGA 1OJLA 3CX6A 3MWYW 2ORVA 4Q66C 1XJCA 4DZZA 1NY5A 5B30A 1KNXA 3LX5A 1XF9A 4JKIA 3QY0A 3K70B 3EG5A 4B3BA 1WE2A 1X8KA 3BXZA 3KL4A 2QTVB 1GKYA 4LDJA 2FPMA 4JLVA 3EX7C 2NGRA 4IVPA 3TE6A 3Q8XB 5E95A 2QE7D 2VP4A 4HLCA 1F5NA 1AK2A 5SZHB 5FR2A 4A6PA 4DSUA 1G7RA 2FGJA 5HCNA 2KE5A 1Z83A 2O8CA 3LFUA 4BE7B 1G9XA 1R6BX 3FYHA 3PIRA 4JYBA 1OXUA 3KKQA 4OHYA 2IT1A 2O8FA 5GJCA 1H8HD 4S35A 4G5SA 1ODFA 4QGAA 5C2JB 1KAOA 5JS7A 3W6NA 5DHFA 1GITA 4D0LB 2V8OA 4TMVA 2GWHA 4Z51A 1G64A 2JJ2D 3DMDA 3X1ZA 1Q44A 2EFCB 4G3XA 1I4LD 4EIWA 1E2IA 1CJUC 1QHXA 4JMPA 4Q1DA 3BAFA 1E9BA 4NCIA 4KXFB 5FTLA 1IBRA 2VHTA 1EFHA 4QRHA 3KUCA 1Z0FA 3RC8A 1WQ1R 5JSZB 1UPTA 1VHTA 1K8RA 4QJ4A 2DBYA 2DHRA 4TLEA 2DWOA 3QJYA 1AN0A 2QP3A 1NNEA 1YRBA 5H70A 1YR6A 1HE8B 4TYYA 1Z22A 4WZBE 2PLRA 1G8FA 2WJHA 4LC1A 4C0AC 2J45A 1XBTA 1KZ7B 4XVRA 4DDWA 1T91A 1QHYA 2DWPA 4HUQB 1P60A 1U90A 1MR3F 2QT1A 2VSFA 3NHAA 3PEWA 2VSXA 2OCYC 4DCSA 4RY2A 2FN4A 2ZRHA 5J4HA 1K6MA 1N6PA 2EFEB 5L3QB 4TMKA 3A6PC 1NVXQ 5KNDA 2GEVA 1NKSA 5EE3A 4RVCA 3I72A 2F43B 2ZIAA 2F7SA 4JT2A 4JYCA 1T8UA 2ATXA 4LHZA 4P4SB 4A6XA 4U02A 3RS3A 2KSQA 2ODNA 3IEVA 3ETLA 2BMEA 3BB3A 1IXRC 1ANKA 5EQTA 4B71A 3C41J 3QSYA 2BJVA 2FZ4A 2VLIA 3O8DA 3TJZA 1TF5A 4MDEA 1XMIA 2YV5A 2REBA 2Y8EA 4F4JA 1NIPA 4US0R 3U5ZB 1ZD1A 1G18A 5L8VA 1E79D 1YJ5A 4IOJA 1V43A 2ZRGA 5FPHA 3CZQA 4ZKDA 1UF9A 1E1QA 4KSCA 3B85A 1SZPA 1T0HB 4GRAA 4HZIA 4UXHA 4LHWA 2G77B 5LB4A 1DBSA 1LY1A 1ESMA 4W5JA 3RHFA 1GKIA 3W6OA 4QKQA 4GDFA 5JZVA 2WJGA 1E9FA 2OLJA 3L8YA 4LPKA 2A5FA 4V03A 2BVNA 2AL7A 4URZR 3LWNA 2VPPA 2VBCA 4Q9KA 3JVVA 1QG4A 2WICA 1E2EA 1R0ZA 2GKSA 2Z4SA 4PAMA 4F93B 5F3WB 3FFBA 2GJAA 1W46A 4FCTA 3GLHA 2KBEA 1E94E 1OKKA 3Q7PA 1F3OA 2O8BB 5IT5A 1M1YE 3CB4A 4URYR 5DYGA 2GCOB 2FE4A 1A2BA 1FQJA 1D5CA 3AGPA 1BYUA 2ZI7A 4FMDF 5CDFA 2WMOB 1G6OA 2WKRA 3IO5A 1QG2A 4IDQA 3QPUA 1NLFA 2A7QA 4RFSB 2J7PD 3DOEA 2JLSA 2R6GA 4WAUA 5FL7D 2ZANA 4LZZA 3EPJA 1QHHB 5JRJA 3GJ6A 4KSBA 2XTNA 4JLKA 1COWD 5DN6A 3OE7A 1FOEB 5EXTA 1OXSC 4BLOA 4QJ3A 2CXXA 2W83A 3MRSA 2C9OA 5E7MA 2ZE5A 4CZ2A 4DCNA 3GLHE 4ACBA 2CCKA 4P4TA 2VHCA 3HR7A 1U81A 4RSGA 1Z0IA 4ZI2A 1XNJA 2AFIE 4B3DA 2YWGA 3PV0A 2F3TA 2YOFA 4M9ZA 5CLLA 3KQKA 1CRPA 4W9MC 3GJ8A 1KDTA 1WXQA 3QF4A 2JLQA 1NY6A 1HH4A 1TF2A 3GQBA 1NMXA 1UDWA 1IONA 3O8RA 3I3SR 1OHHD 2HYIC 3HDTA 2G0NA 3VNUA 2JJ1A 3L82B 4DLYA 4OK5A 1XFAA 2IYLD 2Z83A 4HLUA 1R4AA 4BPBA 2UZIR 4U7DA 3LLUA 1HE1C 1G8PA 4R71A 3SQXA 4TLDA 3FMFA 1NVUQ 4D25A 2JJ1D 4IXMA 2Z43A 3A1UA 2PCJA 2WWWA 4BFWA 2IYYA 1MO3A 1KJZA 2ZXUA 3K0EA 4A2PA 5AUPB 4JLOA 2ZYWX 3EXAA 1DG3A 3L0OA 3X1WA 2QPOA 1Z8FA 2YOHA 5FI1B 4URVR 2ERXA 1DPFA 1OB2A 3RYTC 2QY9A 4LJ4A 4PC6A 2C2HA 1QVRA 3GFPA 3EW9A 3K8YA 1M7BA 2WWXA 3AUXA 5FBQB 4C4PA 2OILA 2OLKA 4AG5A 1BYIA 1JXMA 1W2GA 2LWIA 1YZLA 1KSJA 2VF7A 2QSZA 1VTKA 1RJ9A 2I1QA 1NP6A 5CYOA 4FWTA 3VTKA 5JCZA 2WPDA 4CEIA 4ZKEA 1HA3A 2RGBA 3VAAA 1W5SA 3OHMA 4DJTA 1JEDA 1YR9A 3L43A 4HZUB 2VHQA 3A1TA 2RGNA 3HR8A 4FMBB 4MA4A 2O8DA 2QORA 4LPSA 5FUVA 2W6ID 4JSYA 1W2HA 2CNWD 2CHQA 1FW6A 1GRQA 1YRAA 1PV4A 3FHTA 2D4HA 4B48A 5GADl 3QBTA 1VCOA 1FNNA 2AXPA 4IKEA 3ZVRA 4DBLC 3FHOA 5EP4A 3GLGB 4TT3D 3PITA 5GVRA 2CMKA 3I62A 3R7WA 1SKYE 4HAXA 3HYRA 4JS0A 1BMFA 2WSSD 3KJIA 1GUAA 2CHVA 2W2VA 3AKYA 3ECCA 4C0JA 3AGQA 5C1BA 3IHLA 4UQOA 4FCWA 3R8FA 1N5LA 1E2JA 4DT1A 5GJWC 1RW4A 4RD4A 2ZR0A 2ZTSA 3ZS8A 3EPHA 2J0UA 1JXOA 4NYJQ 3C16C 3WXMA 1AS0A 1E1QD 2OCAA 4XWAA 2JIZA 3IUYA 1FFHA 3FDIA 5J4KA 3T15A 1X8JA 1DTSA 1JJ7A 2GK7A 3GLIE 4D82A 3SBEA 2PEYA 1P2VA 2OAQ1 4GP6A 1CR1A 2HF9A 3ZLJA 2P67A 2W2XA 2WTUA 4H9GA 2F9LA 4PPNA 5EUQB 2XZLA 2CBZA 5LD2C 1G20E 1E79A 1P7CA 2RGAA 4RKFA 3HU3A 4LBWA 4X8HA 4TZ0A 3KQNA 1G5PA 1WBBA 1N6OA 3QIAA 1U8ZA 1T3HA 2LKCA 2MMCA 4A0GA 3QKRB 5FBWB 4ZV4A 1M8PA 3REFA 1IN6A 1P6XA 2OT3B 3E5HA 1AZSC 1KI1A 3WHKA 1GRNA 5HCIA 2FH5B 3IDQA 1TU4A 2G3YA 2OESA 4RZ2A 3SHFA 3B2EA 3AQ4A 4HAZA 4R9UC 5G3ZA 3S1AA 4MUAA 1OH6A 2F1RA 2WV9A 2ZS8A 5C18A 5KOYA 3PVSA 1Z63A 4B3FX 4KFSA 3U7EB 3CO5A 1P3JA 4LJYA 4Q48A 3NDPA 3VKWA 1YQTA 2YYZA 3AV0B 1XCGB 4KHZA 2GXAA 2IYUA 1U9IC 2Q9AA 4Q1EA 4BFZA 3WMEA 2IUUA 4F7WA 4QOSA 1CR4A 2W2TA 2EU8A 3VX4A 3G5UA 2FOLA 3ZD6A 2B92A 3NC0C 5JBQA 3EARA 3KXLA 4RZ3A 2IWHA 5DI9A 1XTIA 821PA 4EPRA 1JQLB 4KU4A 3WMGA 1SVIA 1UADA 5JHGB 4URXR 4BEBA 1I2DA 1SVWA 3P26A 4M9QA 4B74A 5HE8A 1IQPA 1EGAA 1G19A 1II0A 1KSFX 2NPIA 5JWOA 4MQBA 1W48A 3MFYA 5FR1A 5JJIA 1Y63A 3N5CA 5AUOB 3R9WA 1OXXK 4EPWA 4DLSA 3B9PA 4OL0A 2QRNA 1QF9A 2ZR9A 2FFQA 1G3MA 2A5YB 4JL6A 4BLSA 2P65A 4AG6A 3TUZC 1KI2A 3KFVA 3LW8A 3PENA 4KODA 4D80A 2QBYA 1N0UA 3W5JA 1LW7A 1VG0B 3RC3A 3TAHA 4BRUA 4KO8A 2XSZD 2IF0A 4V0LA 2ZRBA 4ARZA 3BFVA 1O87A 1RFLA 1TEXA 4NYMQ 3X2SA 4NP6A 3KJEA 1UM8A 2R8RA 3LQQA 2J46A 1XTSA 1WCV1 3U2QA 2GJSA 2JASA 1M2OB 3WYAA 4Z54A 4C0BA 4JBYA 4O2RA 4TQ9A 2IUTA 2YWFA 4PZLA 1W4BA 3B7GA 2YZ2A 1QHSA 5FTNA 4C0KA 1P2TA 5KUTA 3I92A 1Z6TA 4NCNA 2ZE7A 4OYHA 3S1AB 1AQUA 3RANA 4GT1A 3C5CA 1ESNA 4FW9A 4LBVA 4TMXA 3BOSA 3SC3A 4AIIA 4TLCA 3RRMA 4B76A 4CRWB 5KNBA 2C95A 4BFYA 2YOGA 4B47A 4XVUA 2A5JA 1BOFA 2QNRA 3AEZA 3SU8A 1YHNA 1ZCBA 3H86A 1XMVA 3BBPA 3KTAA 3R7WB 4M21A 4G0NA 5TY0A 4ZDKA 2VTKA 2PH1A 4JZKA 2O8EA 2QAGB 2XTZA 2ZE8A 3WRXC 5G53C 3ZGXA 1KI6B 4H1VA 4DB2A 4IFBA 2IA5A 4HLQB 3U3RA 1II8A 2ZUBA 3QG5A 5EE1A 2WIAA 3N70A 2G88A 2ODEA 2F3RA 1P62B 5FBVB 4O25A 3KKPA 2ZSBA 4BUJA 2OO7A 4CIDA 1Z2AA 2D7CA 2OFOA 3DVLA 3NG1A 1IN7A 4JBXA 4V0MA 5IK2A 4HAYA 1W7AA 5KYKA 3K0FB 1VG8A 2HT6A 2JDIA 2RGGA 1Q3TA 2D06A 3VHXA 2XZPA 4LY6A 1FUKA 2OG2A 3MJHA 1IXSB 4C0QC 4D26A 1NN5A 2P6RA 3ADKA 3CM0A 1S9DA 3JZAA 3AVTA 4OKSA 4IRUB 2V54A 1EFRD 3M4YA 1YZUA 5FH9A 2XOKD 1CJTC 2RCNA 3BD9A 4Q4HB 5HTKA 1B0UA 1CU1A 1KHTA 1ZM3A 1FP7A 4XH9B 1W5TA 2FEOA 4L9WA 3REGA 1R5BA 1GL9B 3DKPA 4KJZA 1XPRA 3ADDA 1CLUA 1M6NA 1R5OA 1RE0A 3TSWA 2REOA 2V3CC 2ZI9A 5FOWA 4LV8B 4P3YA 2NQ2C 2Q9BA 1FQKA 4OHWA 3VU9B 3AM1A 4NE2A 3CNNA 3PUVA 3TBKA 3F0TA 3MWKA 3CR7A 2XTMA 2KJQA 1Z6YA 4LV6A 3W9YA 1NLZA 3V4FA 1OB5A 4PHFA 5CITA 4D4MA 3THWA 1OV4A 2HYDA 1E0SA 3CPJB 5KPJA 1NSFA 3UMRA 3CNOA 5K8IA 3U61B 2CCJA 1MRNA 4ZI3A 1AZTA 1NN0A 1ZM9A 2ONJA 4FXPA 1US8A 2Q3MA 2XXAB 4FMCF 1RVDA 4M8NE 1I2MA 2QP9X 2X77A 1OF1A 3LBNA 3E70C 2ZPTX 4QBIA 5HE9A 2IS2A 2H57A 1E69A 2OCBA 1ZD8A 3KXIA 4PQRA 1IAQA 3LH5A 4DLUA 5BN3A 2BBWA 2ZU0C 3ZJYA 2UZ3A 1KTVA 4OJQA 4NPHA 1Q1QA 3PUZA 1E9EA 3GD7A 4NL4H 2IF2A 3F3YA 4BFSA 1R8SA 3CR8A 2O8FB 4D81A 1E0JA 4HATA 1RPZA 3T06B 1GNQA 1FTNA 2IYSA 3AVUA 4Q03A 3WP1B 2R62A 4RD1A 2IYWA 4LJAA 4PSAA 3U60B 1B23P 2CE7A 2W0SA 4G5GA 4GZMA 1L4YA 3V00A 1MO5A 4O3MA 3QBVA 4N3NA 1OFIA 2WWIA 1OIVA 3NXSA 2P6NA 1G7CA 4GSYA 1E3MA 1OXVA 3B5JA 4TL7A 2FFHA 2QG6A 1JAIA 2J0QA 1K5GA 2QTHA 1UKYA 2BBOA 1G4UR 2NO6A 4TYQA 2CL0X 4F4CA 1AGPA 2QQEA 4MKGA 2OHFA 4ZIRB 1NLYA 3RRYA 4DLTA 1R0WA 4IW3B 2A2ZA 4A15A 4IDOA 3IBGA 2A3RA 2J3EA 3PR1A 1S3GA 5BYKA 1XMSA 3EA5A 2ZJZA 4OK6A 4KBFA 1G7TA 3Q9LA 1HTWA 3D6TB 2GK6A 1G17A 2GXUA 2QAGA 4B3GA 1GVNB 1XEXA 2OZEA 1G1MA 2Q0HA 3DM5A 1YZKA 2NIPA 3KFXA 4PZYA 4BFXA 4WA7A 4NBSA 4LHVA 3LY5A 4PANA 4YMVA 2PX0A 2NO1A 4IDPA 2BBSA 3QE0A 3TR0A 1VHLA 1ZUIA 1W36D 4R2HA 4ITRC 1E4YA 4A8JB 2AHOA 2N1BA 5GVSA 2EQBA 4C9BA 1CF4A 4YLGA 1T5LA 5LBIA 2ZVPX 3OE7D 2FNAA 5DN6D 3C14C 2DY1A 3GP8A 4Q9LA 2GVDC 4TZ6A 1HT1E 4TMTA 4H1UA 3A8TA 4LBZA 1S3SA 4QNMA 4DUGD 4B2LA 1W0KD 3I5XA 1NI3A 3MUFA 5HKKA 4XSGA 3OAAD 3CONA 2NZJA 4Q9JA 5KHOC 4HYYA 1YU9A 3TW8B 3B8HA 1NN1A 4Q02A 3WBKA 4F92B 4C7OA 2FF7A 2Q9CA 1S1MA 4NTZA 4K81B 2X8AA 1TNDA 3L0IB 2GF9A 4MRPA 1OXTA 1CRQA 1LNZA 5G3YA 4HAVA 2DR3A 1T5IA 2UKDA 4WOPA 2D2FA 1XU4A 4HAUA 1QRAA 4OHZA 5AK0A 1G5RA 2QQ0A 1J8MF 2B7CA 2WMNB 5JCPA 3UWOA 1VIYA 1F48A 1U99A 1S1CA 2E1RA 2PZEA 2ZQ5A 3KQLA 3WYGA 1IM2A 2RHDA 3THWB 2I4IA 2R9VA 3PEVA 4CVNA 1DVRA 1Z0DA 5FOTA 4EQ6A 2B7BA 3ZIAD 2YJTD 1KMHB 4KITB 4TL6A 2ZE6A 4BZQA 1A1VA 1SVKA 2XXAA 4A2QA 3O8BA 3NTUA 4DWJA 2AFHE 3KJGA 4X8MA 4B6FA 1A5TA 3TKLA 2H92A 3RABA 2QEQA 2ZU6A 4C30A 2CJWA 4QL3A 2H5EA 1SVSA 3SYKA 2IS1A 3VHLB 2ZI5A 2C98A 4MITA 2CHGA 3QNUA 1MABB 2G83A 1QDEA 3X1DA 1N25A 3EIQA 1Z47A 2ZRCA 2HV8A 4KVAA 5LDDC 1NN3A 3ND8A 4Q1AA 5CIQA 3EZ7A 5FTJA 1LF5A 4AKEA 4C3ZA 3W8NA 3P20A 3C4JA 4B6EA 1CXZA 3AB3A 2C96A 3BWDD 2ZS7A 3DHWC 2IXEA 2JIZD 1XD9A 1UDXA 2N46A 3TLXA 4TL9A 4DIEA 2GEDA 1HURA 4R98A 4II7A 2GILA 4YMUA 2WJYA 4EPXA 5HZHA 1D2EA 2GNOA 2P3SA 4I99A 1FX0B 4X8OA 4L8GA 4PO1A 2ZRPA 5FBRB 1AQYA 3CX7A 3GJ4A 4LGMA 2IEYA 1KDOA 4AC9A 3GFTA 3IEUA 4PAOA 1FMJA 1E0AA 4BASA 1NBMA 2B8WA 1E1RD 3LV8A 4ERNA 2QA5A 4WW0A 3K0FA 5FTMA 3SI7A 4AK9A 1N0VC 3H84A 5K8TA 1F2TA 4MYCA 2QGZA 4OHXA 2ZS9A 4JVNA 1R2QA 4YQFA 5EXPA 5BW8A 2QRZA 3GCGA 2ZRNA 3U3JA 4MDFA 4CF7A 3BERA 1XD8A 1A2KC 2DFTA 4IFEA 1UKEA 2QAJA 1XEXB 2VP2A 5DISB 3TSZA 1GG2A 2GF0A 3UG7A 4OJKA 1CBUA 2ZRDA 3SFVA 4M1KA 2ZJYA 2PMKA 5EZ5A 3ZD7A 4PQYA 4WXRA 4JL8A 3P1JA 2FV8A 2ZRIA 4ILEA 1TX4B 3FOZA 2QM7A 1WP9A 1MKYA 4Q1BA
chains in the Genus database with same CATH superfamily
3RS9A 3D3JA 4ND3A 2J3JA 3F9CA 1KQ3A 1TZJA 4XTCS 5CAEB 2A9PA 5AM3A 3DAOA 3WA7A 1VL5A 2H54A 3A7EA 4J4HA 1ZNYA 2PJDA 3BMOB 3LVRE 5HKBA 1C30A 1CEXA 2CWDA 1XKLA 5J1TB 3H4MA 1SB8A 4E33A 3OIVA 1S4QA 4LECA 2NXNA 5HX7A 4JITA 4QXQA 3DS8A 1HL7A 3FRJA 6NULA 1SOAA 1NL3A 2VNJA 3LX8A 3B7PA 4U2CA 1ZM7A 1TAGA 3ZKAA 5L51A 2I65A 2FMTA 4BJ6A 1EK5A 5EJEA 4RDXA 2VCHA 2XEXA 3BTUA 5DGXA 2CL7X 1X0XA 1C7JA 3ZNOA 1IN4A 3PF8A 5DT9A 3IO3A 2IITA 3G0GA 1Z38A 3WLAA 3ZCSA 2HRBA 4Q1FA 1EA5A 1NQ5A 5GONF 4JI1B 1UWVA 3EFEA 2ZJ2A 1QUFA 2BWJA 3S5JA 4K88A 4U2GA 2XOXA 1L0BA 2WYIA 2W8BB 1J20A 4ICIA 3HZZA 4MRAA 5A5GA 4EP1A 1Y3AA 3BN3A 1TM2A 4WDQA 3NV9A 3Q5GA 1VRWA 3MC1A 4OGGA 2VJYA 3BB1A 3OFJA 4RXTA 1BCSB 2CXRA 2YBDA 1TPYA 4PGGA 3PLNA 3OPYA 2O1SA 2XPCA 1ABEA 4OJTA 4WVFA 2VJDA 1W19A 2W6OA 4EW6A 5TSDA 1GFWA 3G0IA 4G0XA 2I6FA 4DJJA 3HPRA 3EDOA 3RVNA 3KOXA 3FYCA 1G63A 1YA4A 3ZHXA 5ALXA 1JA0A 2OCGA 3EXEB 2XRMA 1R5NA 1GAWA 3MCTA 4MUEA 4R68A 4Y67A 2EARA 1R7RA 4R40A 2ZZMA 2G63A 4UCQA 1JBKA 2VF5X 2J30A 3JQQA 3LUFA 4PQEA 2J5XA 1JHRA 1CB7A 1E98A 2YL2A 2N42A 3EWSA 1QONA 1AX9A 4EW3A 1NMZA 4MZXA 1QM5A 2R00C 3KXKA 4ZOCA 2JLUA 1IIBA 1G3QA 2VN8A 3CH5A 5MHTA 1VCMA 1XGKA 2OXTA 5J40A 1JDTA 1HEYA 3BSSA 3G2KA 3R9IA 1EK6A 4XIGS 2V74B 5IAKA 4TKLA 1H6DA 4PPQA 3E15A 1LDBA 2AFIB 3Q7EA 5G4KA 2CV2A 1UQTA 3FWYA 5HSGA 1Z4PX 4DM4A 3FMOB 2VJLA 4YGXB 1M6HA 1TAUA 3WDLA 5CHYA 1F60A 4MGKR 3RC7A 4BFLA 4BQRA 4BQOA 1RC8A 3HJUA 5EPEA 1QO0A 4YH1A 3PGLA 4DR4B 3UMVA 4KNVA 2P2YA 4CE6A 4M46A 3LY9A 4JJ7A 2OP1A 1YI8A 1M1NB 3ASZA 2R97A 2IEGA 1USUA 1QZXA 4U2BA 3DTNA 2A9QA 4D6XA 3MXOA 2XQKA 4Y1FA 3OFNA 2GUGA 3Q85A 4MW5A 5E4JA 4DYDA 1H93A 1FSZA 4RZXA 3DAGA 2XVMA 2XWSA 3AEXA 3COPA 3KTFA 4G5RA 1FC0A 3QQ5A 2R2AA 5LQJA 1HUQA 2PRJA 4UQLA 3VPCA 1BHQ1 1QV9A 2XB4A 3D8SA 5DLEA 4RV5A 5DW0A 3ZEAA 5HR5A 3OPNA 3EZ9A 3CF4A 3PSHA 2QENA 3EFOB 4NNOA 1FW8A 5D6OA 2XMBA 5C46F 5FNVF 4WZAB 2QN3A 3S81A 1VB3A 3A9SA 3PFIA 2UUCB 1QFMA 4Z4FA 1LQ2A 4XYLA 1YZGA 2JGNA 2O1EA 1D0IA 3BDIA 4JLMA 2NYAA 4K8RB 3B1ZA 4DEVA 1PG2A 4JR0A 4D98A 4M8SA 2BFCB 1NF9A 1WNFA 1YE5A 2E18A 5T4BA 5AM4A 2WJAA 1RACA 3CNLA 2COKA 2RGEA 3G0DA 3EMKA 2HHLA 2CVZA 4P0QB 3L9WA 4Z3KA 3B38A 3D02A 1LGYA 3VUFA 3IE0A 5L7YA 4TV8F 2JGMA 3UKOA 4H27A 1QIIA 3PFBA 1Z16A 5BRJA 1WEKA 4DXAA 2AI1A 2F8LA 2W00A 3HDQA 3HQ4O 2G17A 1M2NA 3IQGX 5BRAA 2C4VA 4YRPA 4MK4A 2B2XA 3I8SA 5GGYA 2X9LA 1HL3A 1N4DA 2BDTA 3P9NA 5CX1B 3N8GA 4KZKA 4DCVA 2AK2A 4ZGGA 3HY4A 4HVTA 1VPEA 2PWYA 4JLWA 2AE1A 1XRLA 3CZ5A 5LN1A 2CHFA 5A04A 1KZ4A 2JGDB 4FLFA 3BILA 1AXGA 1F0NA 2B5VA 2P9JA 2XGSA 4GVXA 4O3FA 2R66A 4MNTA 4OHVA 4TKUB 1P44A 1X77A 1SBCA 2Q1WA 1WA5A 3LPDA 4P4LA 3V7NA 4KFTA 3HRKA 1BWPA 1BW9A 1KI9A 1HETA 1TMKA 2XWPA 3CEHA 3ETHA 4J16A 2W2NA 1T6ZA 3BWMA 3NEJA 4LYHA 2LDBA 2NV0A 3AFHA 1JH9A 1XJ0A 4YRQA 2AGVA 3LM8A 3ZY4A 1KAGA 4QOEA 3JQFC 1FP6A 4JJ4A 5ENDA 3K9HA 4KN6A 3TQHA 5KDDA 4UHEA 2PZAA 3K0CA 4ILKA 3NLLA 1BH6A 3T1OA 1GAJA 3LC2O 1DTWA 1ZESA 4LXUA 4P5PA 4BBJA 2P41A 5JE8A 1UZLA 2PS3A 4JAVC 5EZ6B 4YYEA 3GEBA 3N59A 4JCOA 1XT6A 3KPVA 4GNKA 3I58A 3N7AA 1AKYA 2IDKA 5FUQA 3NC1C 1LCIA 5CT8A 5EIXA 4BV8A 4DT1B 2HHJA 3I5AA 3ONWA 4C0SA 3LP8A 3LDGA 5TLSA 1HBJA 1VGRA 1VKOA 1U8TA 1A9PA 1GOTA 1N6RA 3ABQB 3RDPA 1Y5RA 4O08A 4N65A 3VU0A 3B9QA 1JDVA 1HEIA 2EBUA 2EVWX 4K9KA 1E59A 4ZCPA 2JH9A 1I1NA 3L1VA 3EGWA 3HN2A 1VBNA 1RAEA 1Z82A 2JFXA 5DYNA 1JLMA 1Q1EA 3L84A 4HB3A 4LOJA 5KKCA 2V59A 3EZFA 4HDQB 5CFMA 3C5VA 4IIUA 2EEZA 3DVAB 4QSHA 3UWDA 4X93A 3WWOA 3RODA 3FY4A 3U7IA 3W78A 4WN3A 4QUEA 5ARCA 3IBFA 2GUWA 5JFOA 3N2LA 3IJEB 2OK8A 1SUIA 1G8JA 1JEEA 4DDVA 2APJA 2VL7A 1GAXA 2C9CA 4X1KB 4J16C 3TX2A 2CVHA 1CP2A 2W4MA 3FNGA 1PG0A 1S96A 1Y1TA 2J9XB 4GXRA 3OM8A 4J3FA 3OJXA 4M1OA 4YEDA 1OZHA 1Z5ZA 1P72A 1VIVA 2ATEA 3E4CA 3IE2A 1NW6A 4NARA 5I45A 2QWXA 2B5OA 2XYVA 4F96A 1NVGA 4PGHA 1FX1A 2P2SA 1H6BA 3WYDA 1DAEA 1EP3B 4CLRB 1AS3A 1Z6QA 1Y6GA 1AQLA 1CJCA 5C5IA 3ORRA 1QHIA 2YZNA 3OM9A 1E2KA 2WM2A 1L5HB 1RYHA 2Y66A 3TR6A 5KBYA 5JC8A 2WAYA 4HQ6A 5AUNB 3JARB 5AKJA 2NNWB 4BVBA 2QM0A 2YXDA 2PR2A 3NHSA 3HZHA 4F1JA 2ZRAA 4RM3A 1PFKA 1GL3A 3YASA 3JAKA 5FAKA 1PT8A 1XIVA 3KLOA 3JQ7B 1I9GA 3K20A 1DTWB 3REOA 1G3IA 5BN5B 2VXCA 2FSUA 2MSDB 5KSYA 2YW9A 4DZTA 2A5DA 2BFWA 2SHKA 4UVDA 5C35A 1U1CA 5IMBA 3ZWPA 4I1OA 3GOHA 4BVGA 2PZGA 2FRXA 2WT8A 3TX6A 2WHYA 2MT9A 1RHQA 1M2VB 3D1LA 1SCIA 3DB2A 1W35A 4UMVA 4QATA 3ZVNA 3Q3VA 4LHEA 2RHWA 4P7BA 4OP1A 4KMOA 4JU9A 4DHEA 1N6NA 1SD2A 1RJ9B 2AIRA 3GJ7A 4TKVA 4W5NA 4TYNA 1DBVO 1UC5B 4UUNA 4IJMA 2ZXEA 3DOCA 2Q29A 3L8HA 1N2GA 3SF0A 3TN7A 1KU0A 2QQGA 5TMEA 1J70A 4TGLA 4MGZR 4Q93A 4R7TA 1MHTA 3NGXA 3AY7A 5AJXA 2DB3A 1Z3IX 2CE2X 2J4FA 1KP2A 1JG4A 4C1BA 2UXDB 4RPCA 1GT6A 1D4AA 3BH0A 3RH0A 3GAMA 4AZ0B 1XTJA 1BXGB 1HM5A 3G0BA 3CKMA 1Q1GA 1QO9A 1AGRA 1TZBA 2FWMX 1Z56C 3T9AA 4YMTA 4DV7B 1XZJA 1WJGA 1YRYE 4PX9A 1WXFA 1XYGA 2XNKA 3EEYA 2BP7B 4YMHA 4ES6A 4PNPA 4M1YA 4PO8A 1CRZA 2I99A 4MCJA 3RO7A 2D62A 1JPVA 1DWUA 3ZE8A 1FFBA 3Q8KA 1E64A 3I45A 1XPUA 4K03A 4ID9A 1MH9A 3HDVA 1JILA 2WSSA 4RDIA 5ED4A 2Z5LA 3AOEA 2G1AA 3CF0A 1J2JA 2Z09A 2DPXA 3H99A 4LWQA 2XKJE 5KNCA 5J1SB 4FEGA 1PL7A 4FKBA 4X7MA 3W34A 3LD9A 2C2YA 4HDCA 2QLJA 3RRXA 4R2XA 2GA8A 3ANSA 4QPDA 3VVLA 4KUEA 2CMGA 1TQHA 4GLLA 3VJKA 3QKUA 3WP0A 3L7YA 1YQDA 2BUAA 4Q4AB 1DX4A 1SUFA 3R0ZA 1G8SA 4HWTA 3DAPA 3GLGE 2PU7A 3O26A 4MR7A 5JPCA 5FB3A 4W7SA 1W25A 3V8PA 1YUNA 1T35A 3HO6A 1MV5A 1BD3A 5FULA 4U6SA 3AKDA 1KOGA 1V41E 4NE9A 1KERA 4PXYA 3GGGA 5DT2A 3B9RA 4OGKA 3HCNA 3ZUPA 2XE4A 1SUDA 4Q05A 5FORA 5C0OE 2O8VA 3L1JA 1OLSA 1A50B 4GR4A 3EFHA 2O2CA 3A4LA 1VFNA 3FUTA 4C04A 3MTQA 3TE7A 4U63A 2P68A 3HJNA 5L3QA 3CX8A 4KXLA 2MSKA 3ZV3A 4XVCA 2DWUA 1KO7A 1M7GA 3IAHA 1RP7A 5G41A 4G5XA 2O0HA 2ARKA 1VI2A 1HG0A 3A3YA 4JB2A 2YS7A 2I4TA 2NZ2A 4TVOA 5IU6A 1IN1A 1GTL1 1B8UA 3PHLA 3PQCA 1RTKA 4FFWA 4P4SA 1D8TA 1W4CA 4EARA 1ZLXA 3W9BA 2O8DB 3D7LA 4NKRA 3BUSA 4PF1A 1N7HA 2LRHA 4F5WA 4TOIA 5LQMA 4C4TA 2XNHA 2GK4A 1K6XA 3JQAD 1ZW6A 13PKA 3IIJA 5B2FA 1DOAA 5IKXA 1Y1RA 10MHA 4HGNA 3HBAA 3CEPB 1BQEA 3WGKA 1A8UA 3NOOA 5A9RA 2QUHA 4GBED 3BMNB 4Q82A 3IIEA 1MIHA 1H2WA 2WOOA 1PUIA 3IRVA 2FCRA 2B1GA 2OHGA 3OOHA 2JLXA 1E3JA 1KKLA 3DL4A 3CLUC 4L2IA 2H0RA 4LJ6A 1A5AB 4EJ0A 2GTPA 4EB0A 3IUQA 3E58A 1NU6A 3BCUA 3A9RA 3EXG1 4ND6A 2WG2A 3VR2A 1WDTA 3LG2A 3OCCA 4MVJH 5IJXA 4BB9A 2HK7A 3P2OA 4M1QA 4CF5A 5IBPA 1ARZA 1DXQA 1ZK2A 1E1LA 1K0FA 1R8QA 1CR0A 3WJ2A 1T1EA 4E30A 1SVLA 2WFLA 2JCSA 2XA2A 5AVZA 1WV1A 4HLNA 4QUDA 3ZK7A 1U3UA 4GOJA 2R8XA 2H1CA 1YMQA 4LHXA 5FTWA 3T35A 4Y18A 1BOOA 2I54A 3F5SA 4QYWA 4CKEB 1DJLA 1I1QB 3OCXA 2C7RA 1E2MA 3FPAA 4Q24A 4P4GA 5CEEA 1NI4B 4GSKA 5I7AA 3WNCA 5G0WA 1AGNA 2NTYC 3RFTA 4F6CA 4LJSA 2XDQB 5EP1A 5BR4A 1BJKA 3B6IA 2XB2A 4ZVOA 1UXKA 4QASA 1Q50A 1S8OA 2PZJA 4QLBA 4HUQA 3A06A 3BTOA 3JQAA 3N0RA 1J7KA 3Q8MA 2GZHA 5CGZA 1JEYA 1T10A 1L5KA 1IBKB 1D04A 1T29A 2Y92A 2O2HA 5L3SA 4C4XA 3UMMA 3PWTA 4QEKA 1Q95A 1KP3A 1KZ1A 5FOUA 5EWJB 1VOTA 4JU8A 5GWXA 3WGMA 5DU2A 4EUKA 4AZVA 5BMVF 3VPFA 5CA1A 5AK4A 3G3EA 3JD4A 5FPKA 2IOFK 3IVRA 3OFSA 4ESOA 3CSSA 1CZHA 3OQJA 5FL3A 3RSLA 2H29A 4IOMA 4QT0A 3HY3A 4B43A 4KR6A 3P9IA 5G0VA 4BQFA 4N3BA 4PN7A 4ZYLA 5LXTA 3EGXB 2VH2A 3K2QA 2ID7A 1JB1A 4RK4A 3K1JA 2R8EA 3L79A 2WIBA 2QJFA 3STXA 3K09C 5DP2A 5AW7A 2GVNA 1YAJA 2VEOA 2QROA 1SU6A 1I36A 2WWGA 3IP5A 2G7MC 3ITEA 3OD5A 3MUEA 4KOAA 5AVRA 5JD5A 3I4FA 4P83A 2ZUVA 3UHFA 3J81k 3K4HA 1AHPA 3KAPA 1Z07A 3TCXB 2BHTA 1YXMA 1W47A 3AJRA 2BMJA 2I9PA 1BFUA 1QAMA 1Y80A 1RMYA 4I66A 1IZ8A 3SXPA 3OETA 3GDGA 1K92A 4L8VA 4M0LA 4C1NA 1HDIA 3L2OB 2LIPA 4YPOA 5IDXA 1MB4A 1BVRA 4LQCA 2OMKA 1KH3A 4JODA 1DEHA 2CNDA 4QUGA 2B4RO 5CIYA 1JQJC 3R9XB 4YXWD 2ZM5A 3RSFA 2W6IA 3U6BA 3DVRX 1P2UA 3D1JA 4KO2S 2AOVA 3FJYA 1U2RA 4YJDA 5CYPA 4ZT4A 3UAGA 2WVHA 1JPJA 1V5IA 4H4DA 2BCEA 2IOYA 3B89A 4HSEA 4OMUA 3CSUA 4BZPA 1QF7A 1WS6A 2V7GA 3MGGA 4Z9BA 1DAGA 1U2SA 4G0WA 1YIOA 3Q15C 3RLIA 3MLBA 4XGNA 2C03A 5JS2A 4MP6A 3OIYA 3NZEA 5A1TA 3JQ9A 2R8BA 1IHUA 2ZSFA 4UE2A 4DXHA 1XZGA 4OFWA 4NEHB 1ELOA 1RRPA 2BCGY 4WZ6A 2QRUA 1Y98A 4MGIR 1TLFA 1FSFA 5L4NA 4BV9A 5L3VA 2CMFA 1QV7A 4YV7A 4DXDA 4UTZA 3HCPA 3UJHA 4RE5A 2Q5OA 5CM9C 3EVFA 4IJ5A 4H18A 4UULA 4ENSA 3E2IA 3QQPA 5JVDB 4R8KA 5ALPA 1GPLA 3U0VA 4ALLA 4BNUA 4ECEA 1XRPA 4EGSA 4IGFA 3P2YA 1KI3A 2AWOA 2C3UA 3CGWA 2IP1A 4JHXA 4IILA 1X7WB 4INJA 4J8PA 4TN1A 3ETNA 5BVHB 1SG9A 3CISA 4NBNA 2ZJOA 3H2ZA 4WJKB 3QVUA 4PW0A 3U3OA 5K0TA 1QQBA 4MQFA 1OYOA 3CLTC 5FF9A 1SIBE 3FWKA 2IXFA 3LCRA 1A9TA 4IJQA 5COQA 1Q20A 3H19A 5EHNA 2FAXA 1GGJA 4LJ7A 1US8B 3K8ZA 1T3SA 1N2CA 3OUTA 1GZ6A 1HG1A 3JQDA 1ZK3A 3MTDA 3ZBUA 1A98A 1PQPA 1QFSA 4WHMA 1RXYA 2YWHA 4IVQA 1DO2A 5KHAA 3NDRA 4LCEA 5BQXA 3LPAA 4E5PA 1ECFA 1LPNA 4BV3A 3RUFA 3ETGA 4CG0A 4A36A 2R1VA 1TJ4A 4PSDA 1JKFA 3TPZA 1R0KA 4G1UC 2D5IA 1NXWA 4KEAA 4Z8XA 4F71A 3ACCA 4RF2A 2O3TA 2Z4RA 3U81A 4HWRA 4S24A 4BUCA 3JD2A 4AO6A 1E2DA 1H5QA 4GAEA 4C3VA 1XXHA 1EG2A 1YRHA 2VK8A 4FFRA 4ZP1A 3D2CA 1LDGA 1Y89A 1E3QA 1FYWA 1Z7EA 2DPMA 3LFHA 4HVAA 1IFXA 2WJ4A 3ABRB 4YFVA 2XQIA 4RBNA 3G1UA 1ZBQA 2ZB4A 4EI2A 2AD1A 3Q1KA 3E3LA 4Y9TA 1OWNA 1XA4A 1V39A 4NV1A 3W4KA 5FLYA 2HR1A 5JROA 3B7WA 2FRDA 4UQPA 1DWQA 1H65A 1O6BA 3AY0A 2EBWA 3NTQA 1C9KA 2DLNA 2IIQA 3I6QA 3RTEA 3TRFA 3R76A 3E3OA 4Z86A 2XNDA 1TCAA 4ZVPA 2WAAA 3ZBPA 4G85A 2VWHA 3QXCA 3D6AA 4BFVA 2IPMA 3D7KA 3HUFA 4KQHA 1MX3A 1LW6E 3TDNA 1MT3A 2BEUB 2OTCA 3MNFA 4I1VA 4QQNA 4W99A 3I04M 3IBYA 2BI4A 2KI5A 2VZLA 2HU2A 2P0AA 3M1IA 3ETJA 4WINA 5CLGA 1UEIA 4RL4A 1XU9A 1UC4B 2WIFA 4HQOA 4BO2A 4QHYA 5CW1A 3MAAC 1K66A 1WLYA 2GASA 3U5TA 1IHYA 2COUA 1NX6A 3KPUA 4YCJA 1X0VA 4RPLA 2R2GA 1Y33E 1U94A 1Q1ZA 3FMIA 3DZHA 3FNFA 3NJRA 4MWDA 4Z9YA 4C0XA 1WM1A 3ZW8A 4CCYA 4MRSA 4XX1A 2UUAB 3FGZA 3OT1A 3N6VA 4WY5A 1NATA 1I33A 1HV8A 2NUAA 2OHXA 1XDBA 4TKZA 5K3EA 4KO3S 3UGJA 4O0MA 2DBRA 3QPWA 1N2EA 2R5NA 2AMLA 3QWIA 3NBYC 3L04A 3L0SA 3TLEA 3WNDA 3EIHA 4DQLA 5T64A 3OPMA 2F2TA 3E5RA 1WV0A 1WQ4A 3HLKA 4MW2A 3OCZA 3QLVC 3IVCA 3ROZA 5HBRA 1X7GA 3LQ2A 1V8FA 4BLQA 2O5VA 1CY1A 4IQ4A 1EX1A 1MIOB 2RB5A 4HEJA 1GGEA 4M53A 4P38A 2XUIA 5NULA 3ZU5A 1M1UA 1P1FA 2WUVA 1Z74A 2PD6A 3G8AA 3HB4X 1Y4ZA 3E22A 4COOA 1HDRA 3CLSD 1GPYA 2WYOA 3BPSA 4PR3A 5E4YA 1YC5A 3EBLA 1U9IA 4L3OA 2BEKA 3FKJA 3C7TA 4NZZA 1KEPA 1G21A 2HADA 1MN6A 2WBLC 2BRUC 2H1LA 4MKIA 4BX9A 4DIOA 3BA6A 4IGEA 5FYQA 5LB2A 2WC1A 2Z9BA 4YJKA 5JMTA 2YMLA 2HMYB 4IIJF 3IJPA 3VTFA 2PR7A 3BJMA 5E2AA 4MUFA 1DAIA 2B8TA 2Q3EA 5B1SA 4FZJA 2X0EA 1K97A 3T0GA 3H5IA 4ALKA 1JLHA 2CFTA 3OOWA 3QOYA 2RSLA 4XGQA 1E5QA 3GT0A 2J0EA 1ZINA 5FWXB 3QW4B 4MUIA 4D8UA 1YDWA 1KY5A 1X13A 2Q4RA 1Y6ZA 1EGVB 3V8EA 1E5DA 2GAOA 1MQAA 4RAQA 3C74A 4W8OA 1XD2B 3FUCA 5A4KA 2V03A 1TVKA 2TMKA 3CV3A 3CMMA 4NY1A 3R8CA 3WICA 1ZM4A 4X91A 4M9SA 3SK0A 4F3TA 4IX1A 3NBMA 3HNRA 2UYQA 4K1LA 2PXXA 2J87A 1Z7GA 2YBEA 2PO7A 1O96A 3KDPA 4QFDA 4S1PA 3I2IA 4A82A 3GAAA 4EG5A 1O77A 1HQYE 3I76A 1JX6A 3GRYA 3AF2A 3BGIA 1Z08A 2R7MA 1E7QA 3AG5A 3EIWA 3G23A 4Q18A 4Y0VA 2XT9A 3AL2A 1T4CA 4AYXA 1XAHA 3D8UA 3O74A 3IOCA 4QDTA 4AMBA 1M7HA 3EB9A 2VDJA 2ZJ8A 3QNMA 2HU8A 4EOGA 2G9RA 1I7NA 1N5JA 1SNYA 1Z2OX 1ZUD1 2XE7A 3SXUA 1V47A 4B4UA 4HGZA 4G23A 1DEKA 4UW9A 2WD7B 3KWJA 2CVFA 2QT0A 1OJ7A 3KTAB 2WINI 4JOSA 3UKDA 5AVYA 5L6MB 1RZRD 3GA7A 3FPCA 5AM5A 2GI4A 3DO5A 3A6DA 3AP1A 2TSYB 1N36B 5DHAA 4KPFC 1KEVA 3ZHCA 2D3TA 2X5KO 1N3BA 1BE0A 2QX4A 2RHLA 2QG9A 4INAA 3SZOA 4LF9B 3FGNA 5HMLA 4AURA 2POCA 2GZDA 3QVJA 1YASA 4L7QA 1JPUA 4LWZA 5L95A 3PXGA 3TLMA 3WWPA 4QFMA 4A1OA 3LQYA 4YCDA 3M6LA 1ZSVA 2R4UA 1MIOA 1XLTC 3EXHA 4EFLA 5LQNA 4OVKA 1SRRA 3FI9A 1SCNE 1WCIB 2QYHA 3KJZA 3MTGA 1O5OA 1CUHA 5I7RA 2FN3A 3KHUA 4CL0A 3A1VA 4DLNA 3D8TA 1ODLA 3O93A 2P2GA 5ERXA 4ZQFA 1ORIA 4LXGA 4GX0A 1E2GA 2ES4A 4WN9A 4QARA 1TJPB 2DR0A 1JI0A 3GRKA 2JBAA 5IHPA 2VPZA 2EX1A 4IGIA 1SQ0A 2W2LD 3DXZA 1OD6A 1YKGA 4RPHA 5LP6C 3T3GA 5HF6A 2H1IA 4YJ3F 2GLUA 3OZWA 2I87A 4YQZA 1TC1A 3EGIA 3KAKA 3L18A 1RQGA 4AIRA 3LYUA 1TO6A 3EIFA 4KAXA 3RVRA 4HDOB 4R1NA 2NADA 4Q9NA 2AW3A 4AY3A 3LT5A 2FQXA 5DBHX 1GRVA 4UNSA 3T8YA 4AS2A 2P40A 4PCLA 4O8ZA 4U7JA 4FB4A 4H17A 4LNHA 2DH6A 4YRTA 3ZCXA 4FR0A 1TVKB 5AW9A 1SK9A 3RASA 3ZY6A 2ZETA 4JYAB 1DFIA 2CCGA 3NHKA 1W4ZA 2D2IA 4HB4A 2JKYA 3BE8A 3DL0A 3KEQA 2OO3A 1N7IA 2X2OA 2FMUA 1YCHA 2NP7A 2BGJA 4CM8B 1U0EA 3OCWA 4OM7A 5BUSA 1EJ2A 1SM4A 1G8GA 1RHJA 3C48A 3L6EA 4HN9A 4YROA 1I2CA 3C3XA 2XI4A 4PQFA 2YWXA 5TQ2A 4EKGA 4EY5A 1X1DA 3JSXA 2XCSB 3VVCA 5C3MA 3GLFB 4J91A 1CUYA 2ID8A 1OBHA 1Y5MA 2DJIA 1FUUA 1WZCA 2Q0QA 1ODSA 4R9SA 4AO7A 4BNGA 1VHWA 1CJMA 2ZSAA 2J5KA 3GLFE 1VJCA 4N9QA 1GFSA 1VJRA 1NQOA 4LHYA 4PZPA 3TB4A 4B4VA 1JFTA 3QKRA 4MMXB 4Q4JA 1FS4A 4GRDA 4GLFA 2C9ZA 3KZKA 1ODIA 2JGIA 3ZWOA 2WZDA 1T0JB 4F6RB 4RE6A 5E3JA 5M3BA 2VHYA 2GXQA 4HBZA 2BGUA 4MV4A 4WQMA 1GDHA 1UK7A 3VXKA 3BHMA 1GLNA 3CZCA 3PFCA 1T9CA 2XSZA 3UYKA 1EJBA 2FEWB 4PV7A 4CF3A 1FFXA 4A5SA 3UXMA 2VK1A 3WKDA 2NT4A 4RNCA 4ZYXA 3ZY2A 2NUBA 4QULA 2EQAA 1E9RA 4L3WA 3RS5A 2MMGA 3WL7A 4GX1A 3M5WA 3MTBA 5FBKA 5TR9A 5GJVC 1COWA 1G3UA 3FB4A 4JLDA 3ICCA 5C4GB 1MVLA 2WJIA 5BSTA 2YVKA 4BWVA 3KQPA 5H8WA 1JLKA 4N1AA 4JQSA 4X60A 4O4HF 1ZISA 4C05A 4RZUA 5KB3A 1CUFA 1QMPA 1OR8A 3H17A 3ODGA 3SDZA 3WYBA 4PLVA 4MQFB 3FGPA 3UB4A 3A0RB 4HGQA 1E5XA 4NCJA 3W3AA 1AUXA 1ZMTA 2WHXA 4DGQA 1Z68A 1P2GA 3BULA 3KKOA 2J0SA 1KJWA 3RG2A 1KEWA 2ZAOA 4FYIA 5CLQA 2AWNA 1RXVA 4I55F 4HUTA 1GPNA 4OKNA 1KKUA 1RQ2A 1DLIA 2Y1LA 5JI2E 3C7CB 3NS7A 3AETA 1XZPA 1YZQA 3ZLUA 1J8QA 5B53A 5AVQA 5M04A 4JJFA 2Y1KA 5A7GA 2LUOA 1SOMA 2JGDA 3IAFA 3RS7A 1ECBA 1NA5A 1V2GA 2WF7A 1MOQA 3KB1A 2WJVA 4KAJA 3A1SA 1J0DA 5AR1A 3PT9A 5JCJA 1ML3A 1A9ZA 3I8XA 3ECSA 3OOSA 5BT9A 5BORA 3TECE 2HB6A 3EGDB 2HJWA 1BS2A 3BWVA 3FF4A 4ZQCB 4QRDA 4CLHA 1HQCA 3DEJA 1QZTA 4OK3A 2HW8A 2BHSA 3X44A 2FDRA 2M2IA 1KI4A 3RNOA 3OI7A 2CW5A 3NBZC 3MOIA 3PHGA 2HF8A 1EWTA 1ISMA 2BKVA 2X19A 4KIWA 4X85A 1PZFA 2AR7A 2FR1A 5JUWA 1U6KA 2HBRA 4PYMA 1P39A 4AMZA 6LDHA 1EVQA 1GNTA 3N53A 2ZSHA 3SQDA 2JJ8A 2PUWA 4BLTA 1H6CA 1YZNA 4MWBA 1BXRA 4MV3A 2Q3DA 1T1RA 2BI8A 2NSYA 2XUFA 4XFJA 5TX7A 1G41A 4DY6A 3VI3B 2BGGA 2IQIA 3FZNA 4ZARA 2BEUA 5HQTA 1R74A 2GNAA 3CW9A 4U00A 5CT9A 2PA3A 5IC6A 3NIWA 1EESA 3EF1A 3G79A 4RDCA 4MLCA 1GXSA 1V3VA 1N8KA 2WTMA 2W6JA 1Y82A 5PGMA 1W76A 4JI7B 4NJEB 1J7JA 2VP6A 2W22A 1WUJS 3H83A 4RYLA 3S2SA 4ZCRA 2ZYRA 1C8LA 1X7DA 3IEIA 2C5LA 4TQUS 2WM8A 4RUKA 5REQA 4UTVA 5JCJD 5JI3E 4LSGA 4QO8A 4UCXA 1SXJC 4N41A 3PJRA 1WSBA 1CIVA 4RF4A 1MTZA 2PMBA 3SD7A 5JYEA 3UNXA 1CCWA 1ZL0A 4I14A 3PIDA 4M38A 3ZU4A 1YC2A 2XJ9A 4Z2YA 4CW7A 4G01B 1M72A 3CH4B 1YB5A 2VF2A 3LK6A 3RIXA 1GDDA 3ZXYA 2HX1A 4DLVA 3DZDA 3Q8LA 3A3KA 2P79A 3IP3A 1YIDA 4BDSA 3QMWA 1M9NA 2HSZA 2Z57A 3L8MA 3WLEA 4IYRA 4BAZA 5M34A 3DHEA 3NAZA 2FR8C 4PYNA 5SZJA 1TYCA 2HNAA 1OPXA 3TW4A 3ANLA 1JFFA 4DKJA 2JJ2A 3JWPA 4HPWA 3FHJA 4ETNA 1L7QA 4CKBB 4DS3A 5CB0A 4M2LA 2NUTB 3W3AD 4CG2A 1NJGA 4W1PA 3PD7A 4OFZA 3ZKWB 4UMDA 4RSHA 5I7OA 4QPPA 3B3FA 3HYTA 5L45A 4IIBA 2R8PA 3M34A 5HUQA 4NE7A 4EY3A 4CJXA 3KUXA 3K9LA 3DFKA 1P8JA 5KVCA 2P5TB 3MAJA 4BMPB 3HWWA 2DM6A 1V8ZA 2C2KA 5KDOA 3LCCA 3BFPA 1LVUA 1XD2A 4E4YA 2GFHA 1QFXA 3CVUA 2C4HA 4P6VF 4DMHA 2Z4TA 5CEJA 2C00A 2YCLA 4MS3B 3KG2A 2CJWB 1QJ4A 3FOBA 3GZNB 3H7AA 4BTEA 2EP5A 4AECA 2DULA 1NKVA 4CQMA 1QYRA 1GZUA 2IVZA 2VYVA 2XCUA 4QNRA 3EDQA 5EUMA 5A0VA 1M66A 2OEPA 4MLZA 1KE2A 5ER6A 1KIMA 3Q3JB 3MRXA 3J81A 1THZA 1I7PA 3IQXA 3FYTA 4Q15A 4YAJA 3WL4A 4S04A 2CL6X 2H3HA 4ZVVA 1IN8A 1KMNA 5EKXA 2HA0A 4UJ3A 3I1JA 2E7ZA 4CNQA 3CPSA 2IYTA 4FE7A 4MQ4A 2WM9B 2HM7A 5J2TF 4RFVA 4RPKA 3DMHA 4CM9A 1M0TA 2QD2A 5DOVA 2QJRA 1CE8B 2RC5A 5DHUA 5HQJA 2JD0A 1QTRA 3IMCA 3ONFA 2P35A 2F6RA 5AI0A 5AVUA 2JLVA 3HCAA 1P5ZB 3ELWA 5GONB 4PZZA 5DWQA 3HKDA 3T7RA 3TQCA 1B0ZA 1J21A 1DSSG 3FFWA 2J0UB 1Y6RA 3BSYA 4L0DA 4RS4A 2PMEA 1OH7A 1ZJ6A 1B6RA 2ERYA 1KYIA 1L5LA 3T9CA 1HZZC 2PGOA 4D4KA 4AO8A 3ZI7A 5JAUA 4IH9A 1RHRA 3OTOB 2RD2A 2IYZA 4DR6B 3EXHB 1P0CA 4NZPA 3CZ9A 2C99A 5K1ZA 1L9KA 3TNJA 4OLAA 3MSXA 2QTAA 3LLMA 1HGXA 1XRJA 3IP1A 2QTZA 2HRRA 3TTVA 3A1DA 4HQLA 3OKPA 1OV6A 3DJFA 1MFZA 5H4GA 2YFQA 3A2MA 2YR0A 3JZMA 3MWEA 4IEFB 3FCUB 4KYTA 1TVMA 4OHCA 4YIHA 2VTBA 2YZKA 1SQ6A 1YGYA 4MTLA 4RHCA 5HGJA 5HKAA 3GV0A 2Y1CA 2WJJA 3NQ41 1P17A 1EQUA 2NAPA 5DYYA 4C5BA 3T7JA 4CNBA 4GMDA 4JKOA 3KHKA 4GKAA 4AJPA 1W88A 1NQAO 4JDUA 1MO4A 5CIWA 5CDYA 9GPBA 2SCUB 5F1KA 3HVHA 3BX1A 3V1MA 3T3HA 4R5HA 2BKLA 4D96A 2PX5A 3NNNA 4UNQA 3R0QA 4UC0A 1TMOA 3VAZA 2W98A 3MELA 4AQ7A 1DJQA 1PR0A 1PVDA 1B00A 2FG5A 2VDRB 3RV4A 2CDAA 2ABWA 3I53A 1JYSA 3UMJA 3T52A 3DE7X 1QU2A 1WKBA 1V7CA 5AH0A 4QAJA 3TIVA 4FDLA 1XOIA 5INTA 1TLLA 2TYSB 5JEDA 4RKRA 2H7CA 2ANBA 4X84A 4IGKA 4U6NA 1LC0A 3K2BA 4XLZA 3USCS 1Z37A 2DH5A 3BIWA 1YA6A 4BGVA 4PO9A 1D1PA 1ZVMA 2OFXA 3GPIA 4I55B 5DWVA 3FTEA 3B82A 3C1AA 3CZRA 4FCVA 3SS8A 5TXGA 5CDHA 4HG2A 1ZH2A 1ZQ9A 3UXHA 3WLRA 3S29A 2F4NA 1FNBA 1VL8A 3G88A 3PXBA 5C34B 3OT1B 3CRRA 4ZU3A 3K7EA 3LOQA 1NW7A 3BMCA 4Y9UA 3K0HA 2QNBA 2V98A 3RNLA 1KI8A 2IOQA 2EZ9A 2H4JA 2J9FA 3U80A 3JVUA 3A1NA 1WZ2A 3M0EA 4Q9IA 1O89A 1MO6A 1H2AS 4JEUA 2OORA 3C3AA 3MGCA 3FCEA 4B6SA 5BWOA 5C7IO 3D7SA 5KOJA 2O6HA 3NCHA 2G0TA 3FZQA 4BQIA 1M2VA 2O05A 2F67A 1UFRA 4QGHA 4KRFA 2DVMA 1V8BA 1XQ6A 4ZCQA 4ENQA 1W85B 4YECA 5JAMA 1KFKB 2Z5FA 3WI7A 2IX3A 4W7HA 1U63A 3TLBA 1MC4A 2FY8A 2DQYA 2OKCA 2QVZX 4LBYA 5IRCD 3C45A 4QG7A 3BDVA 5BYJA 3TIFA 4Y9RA 4K9QA 2WFLB 4HMQA 2WF6A 3KV3O 4MO9A 5TF4A 2CZGA 1QORA 4O4HA 1PJAA 5AK5A 3PGKA 5C1DA 3JWIA 421PA 4IX9A 3KOOA 4R2JA 2WWYA 1KEUA 2VHWA 3SIRA 2FI1A 3T54A 5D3ZA 2BTOA 3TOZA 1IG3A 4D4LA 2B35A 1BS1A 3HG7A 2QRVA 3ZOZA 3TSOA 3WSWA 1V4NA 5JAPA 1I6MA 4DA6A 1NWCA 3WLNA 4FBMA 3KT0A 1A72A 1H9CA 2J0VA 1KZHA 3WMFA 1JIQA 2V6JA 1U80A 2VTEA 2PKYX 1R66A 3O1JC 4JL5A 4K6KA 3BK7A 4U7WA 4YMGA 3QLUC 3SLRA 2O06A 1SXGA 2BP7A 2JGKA 4OGLA 4MLPA 3DFUA 1RBMA 4DEXA 5DNEA 1JHYA 2PVCA