4JVLA

Crystal structure of human estrogen sulfotransferase (sult1e1) in complex with inactive cofactor pap and estradiol (e2)
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
292
structure length
292
Chain Sequence
NSELDYYEKFEEVHGILMYKDFVKYWDNVEAFQARPDDLVIATYPKSGTTWVSEIVYMIYKEGDVEKCKEDVIFNRIPFLECRKENLMNGVKQLDEMNSPRIVKTHLPPELLPASFWEKDCKIIYLCRNAKDVAVSFYYFFLMVAGHPNPGSFPEFVEKFMQGQVPYGSWYKHVKSWWEKGKSPRVLFLFYEDLKEDIRKEVIKLIHFLERKPSEELVDRIIHHTSFQEMKNNPSTNYTTLPDEIMNQKLSPFMRKGITGDWKNHFTEALNEKFDKHYEQQMKESTLKFRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Estrogen sulfotransferase
publication title Mimicking of Estradiol Binding by Flame Retardants and Their Metabolites: A Crystallographic Analysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 113
structure length 292
sequence length 292
chains with identical sequence B
ec nomenclature ec 2.8.2.4: Estrone sulfotransferase.
pdb deposition date 2013-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4jvlA00
2VP2A 1M6NA 5JMTA 4HUQB 3U3RA 4B3CA 3IQWA 5IF9A 3A4NA 2GXAA 2GBLC 3ZVLA 3T1TA 3N2IA 4LPSA 3A1VA 4KU4A 3W6NA 3FKQA 1OHHA 2H8KA 3R9XA 2QN6A 1P6XA 3F8TA 2H92A 3TMKA 4QBIA 3T35A 5A4JA 3RS0A 3SDZA 3LLUA 3U44A 4LOAA 4WZBE 4EIWA 5FTMA 1EK0A 4KITB 1E79A 2W6JD 3GD7A 4HAUA 4II7A 4PPQA 3GMTA 1IY1A 1Q22A 3QXXA 2GCNA 1YZUA 2CNWA 5F3WB 3IGFA 4PO1A 3LW7A 1FOEB 5FH9A 5KHOC 1OH6A 3FYHA 1R0WA 1VG0B 1W49A 3KXIA 2VH5R 1KAGA 2HV8A 2REXB 1GL6A 2QE7A 3AP1A 1T0JB 1YVDA 3KX2A 2XXAB 3NG1A 4P33A 1S1CA 3D3QA 2PZGA 5DI3B 1M34E 1IHUA 3NWJA 3WP1B 3K0CC 4O25A 3LQRA 3OIYA 5FTNA 2NPFA 5JBQA 1UDWA 4C30A 1GTVA 3O8RA 2VTKA 1VG1A 3TUZC 2QP9X 5BW8A 2G1KA 3EA5A 4CEIB 1GRRA 1KKLA 3QSYA 5K8IA 1ZCBA 1N6LA 5AR1A 2CJWA 2C95A 3HJNA 1M7GA 3THOA 2WJIA 4TMXA 1EFHA 1ZM3A 4TYNA 3CF2A 3ZGXA 1OB5A 3GJ6A 4TTPA 4RFVA 3NDPA 3PITA 3SFZA 4HLCA 4DCUA 2EYQA 1LNZA 1A82A 1KGDA 1Z0IA 4NL4H 4RFSA 3RDPA 4C0QC 3AVWA 3H84A 4TLCA 1W47A 3KJEA 2W00A 4JJKA 2BCJQ 2ODNA 3TSOA 3FHTA 1E2EA 3O8BA 4V0OA 3T61A 1T5IA 4DC9A 4FCWA 5LD2B 4NU0A 5JECA 2P5SA 4PHGA 2CLDX 3GJ5A 4ZPXA 1S0UA 1MRNA 3Q72A 4MGIR 4D0GA 5JJKA 3RSLA 1E99A 1OHHD 1KK2A 4URVR 3AUXA 4JKIA 4C0BA 4JYBA 2BDTA 2J45A 3SI7A 1KSFX 2OXRA 4XVQA 1E79D 1I2MA 1WB9A 3EXAA 1YU9A 2VYFA 4WVFA 4FI3C 1G4UR 4G5OA 1BOFA 4PHHA 3THXA 2WPDA 3RS3A 2DWPA 2AXNA 5GJCA 4M1YA 2A7QA 2FSGA 1DO0A 2OCPA 4LWZA 3TVDA 2IA5A 5GVRA 2IEYA 2AHOA 1MOZA 5H1YA 1NMZA 3HYTA 2XAUA 2D3WA 4Q4LA 3AP2A 4V0LA 4UJ3A 2QE7D 2H5EA 1XD2A 2IK8A 5FUWA 1OW3B 4LHXA 5AJYA 3T5GA 1CJVC 4D0LB 5KDOA 4RZ3A 2P67A 3FTQA 4AKHA 1HQCA 5JZVA 2J5XA 3PEWA 2A5YB 4UNQA 3SFVA 2JLQA 3U7EB 1TUIA 2AK2A 3B85A 3AB3A 2IXEA 4A1FA 4PSKA 1IN7A 1FQKA 4U7DA 4EFNA 4Q7JB 5KDDA 1AKYA 1JI0A 4RCYA 1LW7A 1HH4A 2AK3A 1AJEA 3K0CA 4JKYA 2F3RA 2QQEA 2XTNA 1NLFA 4MQBA 3BS4A 3CH5A 2WICA 2ODBA 2CL6X 1I2DA 3EZ6A 2Z4SA 2JASA 4LBZA 5JLJA 1SZPA 1BIFA 1DE0A 4JZKA 5TY0A 4HYYA 2ORIA 1Q3TA 2EVWX 1YKSA 3HP1A 5H68A 2EFHB 4CYMA 4MYCA 4JLJA 4XWOA 2ZE6A 5K8LA 3DOEA 3U7FB 1LTQA 3ZQ6A 3CNNA 1E0SA 2BMDA 3QUSA 3O8DA 3WXMA 4I1UA 1R4AA 2OLKA 4TSFA 4X8LA 4EPWA 3MUFA 4P31A 4C0HA 4HDOB 2B7BA 1G8PA 3KFXA 2KE5A 4AYTA 4FMDB 4TQ9A 2J7KA 1EFRA 5JSZB 4AY2A 1LS1A 5HZKA 4NCJA 4RJLA 2WPDD 1YR6A 1SULA 2XZLA 1EX6A 1QHHA 3LH5A 2N46A 2XOKA 4IXMA 4V0MA 2PEYA 2HF9A 4QGAA 2XJ4A 1IM2A 1X6VA 4LJ4A 1S9DA 5KPDA 4IDPA 4QM7A 1DAEA 3LA6A 1K8RA 2WOJA 5HPYB 3DKPA 3WHLA 1SKYB 1VIAA 5FPHA 3MFYA 1G3UA 4E07A 1ANKA 1DVRA 2IYUA 4P4TA 4GOJA 1CRPA 1F6BA 1XMJA 3U7HB 2O8BA 1WRBA 4D4LA 1TQ6A 1H8EA 4NTZA 1TL7C 2C96A 1MV5A 2IYVA 1UKYA 2B21A 3LBIA 3UMFA 3B78A 3THYA 3NIBA 1UFQA 4BFZA 4OI2A 4D25A 2N1BA 2PMKA 1G7CA 3Q5DA 4Q48A 3KQNA 1E2GA 4B43A 4DSOA 5G41A 4OHZA 3L0SA 1IY2A 3SJAA 4DBLC 4BFSA 5EZ6B 4MH0R 2VHQA 3EPLA 1XJQA 3QOFA 1KI9A 2ZS8A 3QKRA 3REFA 3TSZA 3THWB 2GEVA 221PA 2VP4A 2W6IA 2FNAA 3VR1A 1NMYA 2F6RA 2Q3MA 1I4LD 2ZVPX 3KUCA 1Q0UA 4MYTA 5L3RA 2QA5A 3AGPA 1FQJA 3Q3JB 4OQMA 4M1MA 1TF7A 4Z1MA 2ZE8A 4NYJR 1OXXK 1TUEA 2NO6A 1ZNWA 3VNVA 1E96A 1OYYA 3OHMA 4B2PA 2PZFA 4MRNA 3KJGA 1AK2A 1YHNA 1RRGA 1E9CA 2IW3A 3U3JA 5J4YA 5CDFE 1ZIOA 1E9FA 1KO4A 1Z3IX 4TSFD 5CM9C 3U6KA 1PLKA 5AJZA 3MWYW 3KKOA 4D4JA 3A1SA 5JHGB 1DBSA 2RKOA 5FBVB 4JT2A 3NH9A 5C4MA 1F2TB 2ONKA 3B1YA 2QP3A 3H0KA 3PIRA 5FR1A 4BRUA 2A30A 1NIPA 3UG7A 3ZDQA 1EFRD 5TXGA 4PXAA 3RS7A 4YMWA 2R2AA 2PX0A 4BWYA 2IL1A 4DKXA 1XWIA 2ZS7A 4F4CA 4HZUA 1X86B 4RD0A 3V9PA 2XOKD 3PEUA 4OHVA 3ND9A 1R5NA 4HLQB 3DKVA 1KK3A 2FOLA 4B6FA 3LX5A 4W9MC 4Q7KA 1KZ7B 3R8CA 5FFMA 3OEED 2A5JA 2HYIC 2J9RA 2RGXA 2QSYA 3K0FA 2QT0A 5J40A 4P4SB 2BMFA 1K5GA 2F9MA 3C41J 1H65A 1AIPA 1F5NA 1G8GA 1QG4A 4GT1A 4BLQA 1NVVR 3K70C 1E3MA 3E2IA 4DVGA 1E32A 4LRWA 3QPVA 3RS2A 1OYWA 2RHDA 4G1UC 1W4CA 2IHYA 2EFEB 2BKUA 2C03A 3FGNA 3B60A 4B44A 2GESA 4QBHA 4BEJA 1O87A 3FKSA 4GPTA 2NO7A 1G9XA 1W36C 1XU4A 2O5VA 4KHZA 1CJUC 2GAAA 3I1FA 4LGMA 5HCNA 2O52A 2W6ID 4A2WA 4M1TA 4M0LA 4Q4AA 5L3QB 3IPYA 1Q20A 2XTMA 4D0NA 3OZXA 3CX7A 1ZU4A 1R0XA 4F93B 2ERXA 2JJ1A 4D26A 2WHXA 2QT1A 2DWQA 3IPXA 3K53A 1E6CA 4D81A 2O0JA 1G5RA 3W9YA 2DFNA 2GZAA 4EQ6A 3IHLA 4R9UC 1XCPA 4HUQA 2VSFA 3DMDA 4X8MA 4AG6A 1A7JA 3M0EA 2D4HA 4DLTA 2JLYA 1LFDB 2BJVA 2IUSA 1SXJE 3NVAA 3B5JA 5JS7A 2JLVA 4Q1EA 2A5DA 2X77A 3SHWA 3DEFA 1VKJA 4WOPA 3B1ZA 5KNCA 2H57A 4Z8YA 2WSSA 2YOHA 4IDNA 5JRZA 4OQFA 3AVPA 1E0AA 2XB2A 4BZPA 2NZ8A 4IDOA 3D7MA 5KNBA 4DJTA 2WAYA 2YHSA 3B1VA 1VG8A 4L9SA 4Q1CA 3AF3A 1GILA 3TBKA 2R6CA 3TGPA 2CLSA 3QXSA 4ZDIA 3ZD7A 2F7SA 1M1YE 4OKSA 1CR2A 4UXIA 4G01B 4LC1A 3I5YA 3FHCB 3QEJA 4XIGS 1YRAA 2K5UA 3U6BA 2TMKA 1Z6YA 1P60A 2NGRA 2UZIR 3LLMA 4GDFA 1R8QA 2IYZA 4V03A 4TZ6A 2DFTA 1F3OA 3I8SA 3H86A 4XH9B 5DI3A 3W90A 4AI6A 2Y8EA 4PR0A 2GDJA 2GA8A 2AXPA 2OV2A 1GKIA 1CULC 4DCNA 5AUQA 2H17A 4MDEA 3FKSD 1J70A 1U81A 2A9KA 1Q1ZA 5FPTA 4BASA 2JLXA 4F4JA 5G3YA 1QBKC 1JEDA 2Q3FA 1MO5A 3VR3A 3W6PA 4ZI3A 2FU5C 1JNYA 3LRPA 1A5TA 4N0DA 2P0EA 5JS8A 1GRQA 4C0AC 4URXR 4NYIQ 1FMJA 1GP2A 1S2MA 2ZTSA 3CZQA 2P5TB 1E2KA 2VBCA 2JJ1D 2AR7A 1NJFA 5AWFC 1KDPA 4OYHA 2V4ZA 3ASZA 5FOXA 4B3DA 4DDUA 4IOKA 4B3GA 5HR5A 4R2HA 4B32A 1P2UA 3X1YA 1MO6A 4PFSA 4AWXA 3ECCA 1JR6A 3PENA 2ODWA 4HAZA 1QHIA 4PHTA 2ZRGA 1AZTA 2HUPA 3TR5A 3X1WA 5DN6A 3K9HA 4HB2A 3X1XA 3WHKA 2WVJA 3A36A 3MD0A 2WWFA 3T34A 2X2FA 2JJ8A 4UKDA 1JALA 4F92B 2ZSDA 4HAVA 2WSSD 1J8YF 4JBWA 1P73A 5H70A 2XNSA 3FB4A 4PX9A 4XTCS 4ZCLA 5G53C 3RS5A 4QL3A 2OO7A 3REGA 3CNLA 2FG5A 4I81A 1LY1A 3AKCA 4B47A 5LDDC 3K0EA 5JEDA 3U7GA 4M1KA 4QGGA 3B1WA 2B6HA 2QMHA 2QAGC 2GJ8A 2ZRJA 4LJYA 4WXPA 2QPAA 4OBEA 4C9BA 2OBNA 3SOPA 4DXAA 5AUNB 2F55A 3SYLA 2V7QA 3ND8A 2QQ0A 3P27A 4KFRA 2O8CB 3KB2A 3QI2A 4Y0VA 4TYWA 1J7KA 1KAOA 3WMGA 2ZRAA 2EFCB 1ZVQA 1EWQA 4KLNA 3ICQB 4M1WA 4I99A 5FBRB 1HE8B 1Q1QA 2J87A 1VCMA 2RH5A 1AA9A 3B8HA 2PX3A 1P2TA 4XJXA 2Z0MA 3TE6A 5KSYA 1FZQA 2YYZA 4DIDA 3BH0A 2ZM5A 5EE5B 3TVTA 2OG2A 5DH9A 1Z6TA 4C2TA 5ANRB 5JWHA 3B1XA 5GADl 3UMSA 2FEMA 2PMDA 3G0HA 1GM5A 3CRVA 2C77A 3IEUA 2D2FA 3UMRA 4ZV4A 3BD9A 5FI1B 4MRVA 2G6BA 5IHPA 2DCUA 4RD3A 3AVYA 3JVUA 1N6PA 4PAOA 3SBDA 2CXXA 4PZYA 3A1WA 5CJPA 3W5JA 4JL8A 1YR7A 1WA5A 4DSUA 2AFHE 2RGEA 3DL0A 3U60B 1KI8A 3AF0A 4YMTA 1IQPA 4BE7B 3LXRA 2GJKA 3T1QA 3KXKA 4A4DA 4BEBA 2WMOB 3QKUA 1M7BA 1KY2A 1QHNA 3UATA 4GSYA 4UXHA 3CBQA 1EX7A 1J8MF 1YZKA 3K09A 4BLSA 3PUWA 1DAIA 4ERNA 2NO0A 5FL7A 3CRW1 4U00A 1MT0A 4M21A 2R8RA 1Z0FA 1E9RA 2ZRMA 2PJZA 3EWSA 3K0AB 1V43A 4EJSB 2GXQA 3VFDA 1KSGA 5DN6D 5F9HA 1N3BA 1SXJB 1XEXB 2KBFA 3U3OA 5M04A 1NLZA 1OLOA 2QU8A 1ZD9A 1XEWX 2ZJOA 3GFPA 1BYUA 4KI0A 4XOIA 2XSZA 3OF5A 2JLSA 2O0HA 4Q9KA 4OHYA 1IXRC 2QM7A 3QJYA 2WIAA 5F98A 4PPGA 1Z28A 1PZNA 1Z0DA 2BBWA 2PCLA 3DZ8A 2ZJBA 1T4GA 1Z8FA 2D62A 4NCKA 4WAUA 2WM9B 2P2LA 4R2IA 1WBBA 2VHUA 2GILA 4YXWA 3UWOA 3GLFB 1U0JA 1LB1B 4JLOA 4G5RA 2V7QD 4URYR 5D3QA 1G16A 1S3SA 3PV0A 2C9YA 4Q1BA 2IS2A 1VYTA 4G3XA 4C0LA 1NN0A 3NH6A 1NL3A 1UF9A 5DNYB 2FDCA 2GTPA 4PC3A 5L8VA 1HEIA 1QHYA 3GJ4A 2DWOA 2WJGA 4PO8A 3RRZA 3WY9A 1F2UB 2HF8A 1W2HA 2NIPA 4M9ZA 2IS4A 1U2RA 2V1XA 2IS1A 4PQFA 2FFAA 2VLIA 4PTLA 3WBKA 1UBFA 1ZNZA 3KB1A 2WWXA 1Z6GA 3AP3A 4HAXA 1KO7A 1ZW6A 1RJ9A 4GRAA 1ODFA 1X8LA 1YQTA 3AQ4A 3ZS8A 4G5GA 4GNKA 5CITA 1NN5A 4AD8A 5FBQB 4KVGA 4QJ5A 2VSXA 1P9WA 1ZUIA 3CX6A 2ORVA 5CB8A 3THWA 3VKGA 4RKEA 3X1DA 2IX3A 4QGFA 2ZSBA 1KJWA 4LUCA 3N2EA 3I62A 4OL0A 3WP0A 4AK9A 1G3RA 3FWYA 2GWHA 3KXLA 4BFTA 3LW8A 1J90A 1T8UA 1WF3A 4LJ8A 4OQLA 3WRXC 5SZIA 1EWRA 2IYLD 4OHXA 3GLIB 4YMUA 3S1AB 1N0VC 4KBFA 2YWFA 2GK7A 3NBZC 2HJVA 3EG5A 5L3SB 2XGJA 4BRWA 3OESA 5FL7D 5L3VA 2H1LA 1T6NA 3OFNA 2ZJ5A 3H4MA 4DLSA 1US8B 3LBNA 3P4XA 2KSQA 4IKEA 3NHBA 3QXCA 2ZRFA 521PA 1CR4A 1FPMA 4XWKA 4JMPA 2QROA 2I4IA 1M8PA 3KZ1E 1F2TA 2XSZD 2OFXA 4NP6A 1AM4D 1NF3A 3GJ0A 121PA 2RHMA 1JJVA 3WYGA 1XD8A 4LHZA 2HCJB 5BYJA 1XPRA 4UQOA 1ZYUA 3KFVA 3PVSA 4QJ3A 4W7SA 4YXWD 3GLHB 1R0ZA 1XFAA 4Q9LA 1A2BA 1XNJA 1Z47A 3VU9B 1S4QA 1YR9A 3CO5A 4A8JB 3ZQJA 4NKRA 1SKYE 2Q0HA 2QRZA 1CLUA 4LHVA 2ZRPA 4NMMA 4S35A 3B2EA 4B2IA 3CONA 5EE3A 1VDZA 4P4SA 4V0NA 4NHOA 2ZJ2A 4Q47A 1Z0AA 4G5QA 3B9QA 3ZLJA 3SNHA 1G8HA 1KMHA 1BMFA 1UM8A 1E1RA 2Q9CA 1ESMA 4JLBA 2WJJA 3DM5A 3QG5A 4EKDA 2J0SA 3Q7PA 1G19A 1P62B 4K8OA 2OBMA 1KIMA 3C7KA 3KJIA 4Q1AA 4P4UA 5FOSA 4TYYA 3F3YA 1TEVA 5FTLA 2FN4A 2RCNA 4ABYA 2OCBA 1P9NA 2OLJA 3QY0A 5HE9A 5G3ZA 3CH4B 4KXFB 1W4BA 2R6FA 1W4AA 4C3ZA 2GVZC 1AZSC 4TQAA 4L9WA 1QHXA 1UBGA 4LDJA 1OXVA 3FPAA 4LHWA 3K8YA 5H8WA 1OJLA 1NRJB 2WWGA 2ZQ5A 2BC9A 1NIJA 1FL9A 1S9HA 4LJAA 1GWNA 1FTNA 3OFND 3CF0A 4P3YA 4UJ5A 3PR1A 1KK1A 4GFDA 5CLLA 3SJZA 1G20E 5UKDA 1TNDA 2FMXA 2ODEA 1E98A 2QZ4A 4LK2A 2D7CA 1CTQA 2X2EA 4TLDA 1MRSA 5EXPA 3OEHA 4JLAA 1YRBA 1ZUHA 1Z0KA 3IBYA 1JJ7A 1TQ2A 4LY6A 4TWZA 1W2GA 4NYMR 2X19A 2A5GA 5DHFA 1U99A 2B8WA 2J3EA 4ZIRB 1HT2E 3QIAA 4KBGA 1GITA 2AWOA 4BQSA 4DDWA 4XVRA 2G83A 1RZ3A 2BBOA 2RGBA 1ZRHA 2VIIA 2CNWD 4ACAA 2ZUBA 4YDHB 1E9SA 3LO5A 4P0TA 3ZVRA 2C04A 3CPEA 3EZFA 4AYWA 2HCBA 3Q9LA 4KFUA 3L0OA 1S96A 5GJVC 3QG1A 1G3MA 1GG2A 1CJKC 1NG9A 1LV7A 3EAQA 1G8YA 4N1AA 4OI1A 2ATVA 1N0WA 4HB0A 4FXPA 4LYHA 4QNMA 5EP3A 1OFUX 1SVSA 2KI5A 1VYUA 2EWWA 1OFHA 1BMFD 1E1RD 3GEIA 3ETLA 3RC8A 2F43B 4DZZA 4CZ2A 3LVRE 3ZS9A 1Y63A 2J1LA 2G1JA 1RE0A 1PJRA 4P32A 2F1RA 3RYTC 3H1TA 2OSBA 3ADCA 1A2KC 1E0JA 1ZMXA 1KO1A 2VHTA 4BECA 3MLEA 5GJWC 1Z6AA 1P2VA 2Z4RA 2ZJZA 3IO5A 1VIYA 3MWJA 1C1YA 4DLVA 1IN6A 2IXFA 3CB4A 1W4RA 1JAIA 1SVMA 4GMDA 3OIWA 1MR3F 3BXZA 3NC1C 2GZDA 1BKDR 4HZIA 4I4LA 3RVBA 2OFOA 3LQQA 1R8SA 1NKTA 1XTKA 2ZITA 3A4MA 3DHWC 4TMZA 4B73A 4QJ4A 4WIAA 5CDFA 2GNOA 3RRNA 3BE4A 3IHWA 1Z2AA 1FUKA 2AL7A 1N6NA 2CDNA 2KBEA 3C5HA 5EUQB 4ZKEA 4Q00A 3KKMA 2YC2C 1AS2A 4AG5A 3OEHD 4D2IA 1TMKA 2WTUA 4GBMA 4QNRA 4PO9A 1OV4A 1ZIPA 2C9CA 4PC7A 3TRFA 4IVQA 1G7RA 1CXZA 1XZPA 2QPOA 3U61B 5SZJA 3RRYA 1GVNB 3I92A 4LYAA 3EX7C 2X8AA 3AVTA 2HLDA 2XZPA 4Q19A 4EPYA 1XB2A 2HT6A 1SHZA 2CL7X 2IS6A 2OUKA 4FW9A 2JLUA 2OXCA 5ELXA 2O8CA 1E9DA 1XJ0A 1W46A 1PUJA 2YC4C 1Z83A 2BMEA 3SJCA 2J0UB 2R62A 2IYSA 4TQUS 2FSHA 5E4FA 3RWMB 4BLRA 5J4HA 4AKIA 5TMPA 5FL3A 4ZCIA 1E2QA 3CW2A 2ZRBA 3R7WB 1RW4A 2LCFA 2CMKA 3CF6R 3OIUA 3TUJC 1UEJA 2OILA 2F9LA 2E87A 3A1UA 2W0SA 3ONWA 1PVOA 2F1IA 4DLXA 2MSDB 2VRWA 1R0YA 3CWZA 3K9GA 2Z83A 2IYTA 2D2EA 2ANCA 5FBLB 3DOFA 3F0TA 2BKEA 2V8OA 3WBJA 1XJCA 1ZM7A 5IK2A 4OI4A 1OXUA 2MMGA 3HPRA 1COWA 1G1MA 1GKYA 4QBGB 2DFKB 2EW1A 3OIVA 4IVRA 3L0PA 3LX8A 1XX6A 1II9A 4WZ6A 1TU4A 2GXUA 4IOMA 4YLGA 2DBYA 2YKGA 3NBFA 1E9BA 5FI0B 4A0HA 2CHQA 1NSFA 1G41A 2D74A 3K0AA 5DISB 4EJSA 1W1WA 5AJVB 4ZDWA 1SXJA 1XEXA 2GXSA 3U3MA 1DTSA 4GP6A 1EG7A 4M53A 5DGXA 3TK1A 4WBSA 2FSIA 4US2R 1WQ1R 2BM0A 1E94E 1W0JA 4MRPA 1Z5ZA 2CCKA 2J46A 2I1VB 1HE1C 2R6DA 3VX4A 4ZKDA 5JCPA 1IONA 3CKLA 1HT1E 2HLDD 5TVKA 1IXSB 2OM2A 5EE9A 1OFIA 721PA 2QMEA 4KO8A 4TLEA 5B64A 1NBME 3GLFA 3W8NA 4CT5A 3CLVA 3C14C 3HWSA 1TU3A 4A92A 3LVQE 4W5HA 4DLRA 1D8TA 3EZ7A 1IN4A 3NTUA 3GJ3A 4D4KA 1B0UA 4DIEA 4QFMA 2D7DA 1TADA 4TL6A 3EWAA 2ZI9A 4LV8B 4MDFA 3I5XA 1E2NA 4GZLA 2WOOA 1VTKA 4A2QA 4MKFA 4EPTA 2W2XA 1H8ED 2R6AA 4ZCMA 4MUBA 2OT3B 2UVQA 4B34A 1F2UA 2JEOA 3D31A 3R20A 2REBA 3SQWA 1C9KA 4B74A 5GJBA 3AF1A 1ZC3A 4X8HA 1OXSC 1VCIA 1NVUQ 3FDIA 3VMFA 2P65A 1ZINA 4DEYA 3MJRA 4CEHA 4GL2A 2G0TA 3GLGB 5CIWA 3ZVMA 3SHFA 1N5KA 1N5LA 1CR0A 1W5SA 1G7TA 3D6TB 3J81k 1NNEA 2GJSA 3AVOA 4NZYA 1XTJA 3R8FA 2FF7A 1CRQA 5LD2C 2BEJA 5TDHA 3UG6A 1N6HA 3CRMA 4DLYA 2WIBA 3KDSE 4CRWB 1TEXA 1E2LA 2QMUA 5IK2D 4Z1MD 1D6JA 1UADA 8OHMA 1QRAA 1COWD 3TAUA 1SHKA 1GNRA 3ZVNA 2CCGA 1RC8A 4QOSA 3I32A 1RVDA 4B33A 2CJWB 3GLIA 3S1AA 1Q3HA 1QHSA 1T3SA 2QGZA 4JVMA 3W5IA 5L3SA 3GP8A 1TF5A 1OIVA 1DAGA 2WBLC 5FOTA 2Z43A 4NYJQ 1TPZA 1US8A 2J0VA 1JAHA 3MJHA 4M1SA 1YZQA 4Q1FA 5CYOA 1SXJD 1BS1A 3FOZA 1E2DA 4MA4A 5JWOA 2GF9A 3KQKA 1T5LA 1P2SA 3MRSA 1KJZA 4B3XA 4MGKR 4M9QA 1W0JD 3CUEF 2ONJA 1XMIA 2NPIA 4F4IA 1IJEA 2ZS9A 1KI3A 4B48A 1T9HA 2ZU0C 1XMVA 4AYXA 4TLAA 3LD9A 3V4RA 1PUIA 2FV8A 3GLFE 3IIJA 2ZRCA 3GLHA 2XEXA 4IDQA 4IVPA 1CKEA 3VU9A 5EQTA 4A8JA 3FHOA 4XTRA 5J4LA 2ZXUA 2BV3A 4QKQA 2ZSFA 3PUYA 3P26A 4C0KA 3M4YA 3T15A 3THXB 5SZHB 2XXAA 4ON9A 2GJ9A 2GK6A 2G77B 1M7HA 2QG6A 3DVLA 1BYIA 1DO2A 2FWRA 2FE4A 4IFBA 3EZ9A 5DO9A 4LI0A 1NVVQ 4GP7A 2YVUA 2RGGA 4JVSB 4A0GA 4IXNA 3TKLA 1KDOA 3AM1A 4Q4HB 4N3NA 4CEIA 4B35A 1ZD1A 2FZLA 4C0JA 4O2LA 2ZRHA 3VX3A 1ONBA 3A4LA 1GIAA 1E0KA 1N5IA 1U0HC 4TTRA 4B6EA 1G5PA 621PA 3K09C 1T3HA 2Q3HA 3IKJA 4O2RA 3BERA 1HTWA 3LXXA 3CIOA 4RZXA 5A0FA 1N5JA 1KOFA 3QE0A 4JSYA 4FIDA 5FTJA 1OH8A 3AEZA 3IDQA 4RD6A 2B92A 1B23P 4ZI2A 4I1VA 2GZHA 3GLIE 4BPBA 2ZETA 3PFIA 3RAPR 3VHXA 5EXSA 2RAPA 5TARA 1YE8A 4KFSA 4EDHA 1XRJA 1GUAA 3G82C 1U9IA 2IF0A 4OI0A 1ZJ6A 3CM0A 2C5LA 2ZJAA 4TL9A 2IUTA 1SKQA 4RSGA 1DG3A 1U94A 5EJEA 4L4UA 4N0EA 1GNQA 2GETA 2G3YA 2KJQA 3VR5A 4FCVA 4ESHA 3ADBA 1ZUNB 2DPXA 2GVDC 2XX3A 3PUXA 3L8YA 4PZLA 2HEIA 4CDGA 1IN5A 3VHLB 4KJZA 1DPFA 3IILA 1EFTA 4ZIRA 5B30A 4ZDKA 3GLHE 5K8UA 1KDTA 4WZAE 4KVAA 3B7GA 4C2UA 1CU1A 4DDVA 4RD2A 1S1MA 2GCPA 5FOVA 1SVIA 1N6IA 2CK3A 2QMOA 3KJHA 4IJMA 2HDNB 4M2LA 1Z63A 2V1UA 2VA8A 2YJTD 4HAWA 3IQXA 3SS8A 5JJLA 3QBTA 2OESA 2O8FB 4WW0A 4H9GA 3FE2A 4V02A 4PC1A 4A15A 1AS0A 2GKSA 3GEHA 1QHHB 2FEOA 2EU8A 3MCAA 5DLQC 2R6GA 3ICEA 1G291 3K1JA 1N2CE 2W83A 2RGDA 4Q7LA 1T8TA 3K9NA 5KNDA 4PAQA 1QVAA 1G64A 2F43A 1XTRA 2Z6VA 3M1IA 3P1JA 4RD4A 3GJ7A 2PH1A 4RD1A 2BHRA 3QENA 5F2EA 1J2JA 3UK6A 3PEYA 4PSAA 3ASYA 2L0XA 3L2OB 3BFVA 3OE7A 3CR8A 3GFOA 3EC1A 5A5GA 4BLPA 1VHLA 1XCMA 3PXGA 3EPHA 1ESNA 1JR3E 5B2ZA 2RGNA 4NE2A 1RKBA 4KSCA 4Q03A 1AQUA 1VECA 1N6KA 3TH5A 5F9FA 3BIFA 2JCSA 2F1HA 4BGDA 2FJUA 2MSEB 5HKKA 4RY2A 1YZTA 4JL6A 3BOSA 2QBYB 3SYNA 4CGZA 1V5WA 3FMFA 1II8B 4DUGA 1KY3A 4IDHA 1U8ZA 1ZM9A 3C4JA 3HU1A 5KPJA 5CM8B 3UIEA 4US0R 2OFWA 5DYGA 2BOVA 1NN3A 4YC7A 3AKYA 4YQFA 2ZI4A 2GHIA 2Q6TA 3EIQA 4PQRA 4ARZB 5KOYA 2ERYA 1RFLA 2IWHA 1C4OA 1M74A 4GZMA 1JPNA 3U3KA 4EUNA 1Q21A 5JSZA 2YZ2A 4HUTA 4U5XA 3L8ZA 2IHBA 2ZU6A 4Z54A 1G17A 3AVUA 1UKEA 3Q85A 5P21A 2XB4A 4B2LA 3W6OA 1QG2A 1UDXA 1HURA 5HZHA 3W3ZB 4I1OA 1D9ZA 3F5FA 4PANA 2UKDA 3AV0B 1XTQA 3MAAC 4PSVA 1IOZA 2IF2A 3PUVA 4NPHA 3T5DA 5C46F 2CK3D 3K0SA 4FMBB 2Q9AA 5AK0A 4A6XA 2ZAMA 4JLDA 1LVGA 2IYQA 1D5CA 1ELOA 3LV8A 5FOUA 1E1QA 3I61A 1ZNYA 2J0UA 2FFBA 4NCIA 1DEKA 2G0NA 4IRUB 2FPLA 2YWEA 3C16C 1T3LA 3V4FA 1QHGA 3JZAA 3O47A 1PLJA 4QBFA 4QHSA 4DWJA 1ZM2A 2IT1A 1YJ5A 3R7WA 2LKDA 4JLNA 1WDTA 4TTQA 2ZVQX 2RGAA 1KI1A 5J4KA 2ZYTX 3OE7D 4OJQA 4FWIB 2H7VA 1W7AA 1K6MA 1XDBA 5CLQA 1CS4C 3TQFA 1DELA 1UBEA 1R2QA 2GEUA 3BH6A 1MH1A 1YR8A 3BFXA 4BUJA 2QTVB 5JEEA 1XBTA 3VR4A 3EPJA 4ASUA 2OHFA 1E9AA 2W2TA 2REOA 2ASEA 2QTFA 1NG1A 5HKKD 4A9AA 5J4VA 4M4SA 4TT3A 5SZKB 3I4LA 2R9VA 1ZBDA 2A2ZA 4US1R 2ZROA 4DUGD 3EIHA 3RNLA 3A1TA 4NBSA 3T12A 6Q21A 1X1SA 4DT1B 2BWJA 1GNPA 1M2OB 4PAMA 2RMKA 1Z2CA 4Q9JA 1IN8A 1P9RA 4A6PA 2AWNA 3AF2A 4E03A 4JLKA 4ZDJA 5EP4A 1HYQA 1YZGA 2J41A 3QKSB 3AH8A 4LYJA 5CK5A 4HLUA 4QG7A 5AJXA 1KDRA 2XZOA 2CEAA 3KL4A 4EQ6B 2IYRA 1XZQA 3T1OA 3BFKA 4IEEA 1Z6XA 2FGJA 3TUIC 3IUYA 1HY3A 3LAWA 4WXRA 1KSHA 4BLOA 5DI9A 5LPNA 1D2NA 3V00A 5EP1A 421PA 5JCZA 4A36A 3KQLA 4K46A 1JBKA 2YWGA 3B6EA 2VP9A 3HYRA 3KKNA 1FX0B 2GCOB 4C4PA 1G6HA 5KDLA 3T06B 3DMNA 4C0SA 3NBXX 1GDDA 1KTVA 5IT5A 5JFGA 3W34A 5C18A 1AN0A 4TMTA 3N5CA 2VP6A 1E1QD 1ZD8A 4JT4A 1GFIA 2W2VA 3IIKA 3QBVA 2KB0A 1IXZA 3TIFA 4B75A 1NP6A 4EPXA 3Q5EA 3KTAB 4TMVA 2A78A 1XP8A 1A4RA 3C8UA 1NVWQ 4LJ9A 3SU8A 2OBLA 2YOGA 1XXHE 1FMLA 2DR3A 2VP0A 4XVUA 2IC5A 2DYKA 2XJ9A 4YMSA 4TYQA 4HSEA 1W0KA 2NO9A 4DDTA 4PC2A 3TQCA 3GLGA 3VR6A 3ZZUA 4LBWA 4H1UA 3SR0A 5EXTA 4ASUD 5L3QA 2O8DB 1EGAA 3M6AA 1RRPA 3LNCA 1MO4A 2J59A 4FINA 2WKRA 3K70B 2JAQA 2ZSEA 4F91B 4TT3D 1OE0A 2VP5A 3A37A 1ZM4A 1NMXA 2DHRA 5D3MB 1FP6A 2HT1A 3CPJB 2FFHA 1D2MA 4PPNA 3BBPA 4Q66C 4M9XA 4BFVA 4ACBA 2PJRA 821PA 4TLBA 2I3BA 3WNBA 2FGKA 3NHAA 1EESA 1TF2A 4O3MA 4Q9IA 3QF4B 3I3SR 5B57C 4BLTA 3EC2A 1W36B 1P3JA 5FUVA 2MMCA 1SQ5A 2AKYA 4MKHA 5HE8A 5JI3E 2DFLA 3KKPA 2V9PA 3ZJYA 3RABA 4DHEA 2CE7A 2P6RA 4JJZA 4UNPA 1NJGA 3VR2A 2FFQA 4JLPA 2HXSA 3I72A 5JWRA 1NKSA 3WMEA 1IAQA 4M9SA 1UPTA 5JJIA 3Q7QA 1L7VC 4GMXA 5HTKA 3BORA 1G3QA 5B58C 1DAMA 4L8GA 4JIMA 4KCGA 1KI6B 5E7JA 2O0KA 5CJ2A 4Z51A 4IW3B 2HJGA 1DARA 2FA9A 2CHVA 3FMOB 3ZYCA 4EFMA 4LV6A 4DLWA 2GBLA 1R5OA 3BAFA 3P20A 1W5TA 3WYFA 4DCSA 3G5UA 4QRHA 1R5BA 4B76A 2PEZA 2VF7A 3NC0C 1L8QA 4Q18A 4E22A 4YDSA 3HU2A 4W5WA 2WV9A 2ZUCA 3I8XA 3A8TA 2VF8A 1WP9A 4JVLA 4L5BA 2IEZA 3QF7A 4R7ZA 5KTYA 2QUZA 4MUAA 4V0KA 5GVSA 1IJFA 3TLXA 1X8JA 2EFDB 1DOAA 2ZYUX 4LHYA 2AD5A 4Q9HA 1Q1BA 5DYIA 4Q4HA 3GLGE 1TTTA 4I1SA 2NOAA 1W0KD 2AD1A 2QL6A 4NONA 1XTIA 2GRJA 4MKGA 4O0MA 1FUUA 1EFCA 3TW8B 3ZH9B 3CZPA 3VTKA 2GJAA 3CR7A 4GI7A 2F3TA 2W58A 1GL7A 4NCNA 1SVKA 3T1VA 4B3FX 3N70A 3PG5A 2VPPA 2O8EB 3C15C 4AKGA 3UANA 3ZIAA 5C1BA 3PEVA 1OIWA 4EJSC 2EFGA 4OK3A 1VYVA 4C7OB 3BB1A 4E09A 1SXJC 4BFXA 5FUYA 3BGWA 5E7MA 2QP4A 2FH5B 4MITA 1ZC4A 5EE1A 3JZMA 3RWOA 2JA1A 3GQBA 4FD2A 2JATA 3R9IA 2A3RA 4U02A 1E9EA 5KSPA 3LWNA 1NLYA 4OQXA 2G88A 4MKIA 4AIIA 1RRFA 1Y3AA 1VCOA 4KAXA 4EPRA 3E1SA 3B9PA 3HR7A 2PLFA 5DHAA 2CVHA 1UKZA 1ZAKA 1Q44A 3HPQA 4M22A 2WJHA 1OPXA 1EFUA 2XTZA 3DDCA 1OFTA 2WKQA 4D4MA 1AKEA 4MRSA 1AS3A 2PLRA 2V54A 4TN1A 5EXXA 2PT7A 3CPHA 2ZAOA 4LX0A 5KSZA 1DADA 4QHTA 4RCZA 1WXQA 4JS0A 3BK7A 2JDIA 1NVXQ 1WE2A 3GJ8A 4LJ7A 4PC6A 5BXQC 2W0MA 3NXSA 1NBMA 4NYMQ 4DLZA 2X1VA 2ZPTX 3LDAA 2ZRLA 1H8HA 2NTYC 3HDTA 4OHWA 5JRJA 2PL3A 4EFLA 1UKVY 2BBSA 2OE2A 4BFUA 1KO5A 1U8YA 3FFAA 2QAJA 1E2JA 1D9XA 2G9NA 2O8FA 5DIFA 4XSHA 5FOWA 2LWIA 3QVUA 3EPKA 2BJWA 4PQYA 3QKTA 1XCGB 2ZYVX 4HLDA 3EZ2A 5HCIA 4DSTA 1KJYA 2C8VA 3DO6A 1OKKA 4D82A 1Q12A 1DAKA 1R7RA 4Q4JB 3OEEA 4LCBA 1II0A 3AGQA 3RANA 4JVNA 1Q57A 2QAGB 1GZSA 1XXHB 2WZQA 3Q8XB 1OF1A 2NO1A 3UXMA 4AC9A 3FFBA 3MSXA 1XEWY 1XEFA 3MWKA 2PCJA 3U4QB 1KHTA 3EA0A 1BH2A 3ADDA 1IY0A 3CWQA 3QPUA 4M1OA 3ZIAD 1CP2A 3WYAA 2WMNB 1ZP6A 2QI9C 4TZ0A 1RJ9B 2E1RA 3NDBB 2QBYA 2FPMA 1II8A 3IBGA 3QVVA 3ZZTA 2R44A 2C2HA 3AF4A 4Y0AA 2GEDA 2KWIA 1UAAA 4URWR 1KYIA 1AGPA 1R6BX 1S8FA 2WKPA 3NBYC 2C78A 1L4YA 1NY6A 2ZE7A 4HATA 1QVRA 4KYUA 4R98A 4A0RA 4B3BA 1MABB 1TX4B 1MO3A 1RYFA 2PZEA 1CJMA 3GFTA 4GOKA 4ARZA 4KLZA 4CF7A 2ZRNA 4XD7A 1G5TA 4XWAA 1QZXA 4CEJB 2WJYA 2ZE5A 1OXTA 4LBYA 3KQUA 3D8BA 4IOLA 2IXGA 4A8JC 5AUOB 3E5HA 2AFIE 2CE2X 2BCGY 1KNXA 2JDID 2YINC 2B8TA 4H1VA 4TMWA 4DCVA 2FX3A 1DAHA 3AVVA 1E2FA 3AKEA 1NBMD 2OAP1 3DZDA 3TSWA 3KKQA 5AJWA 3BH7A 1WCV1 2VSOA 4JLMA 3EARA 1H8HD 2P6NA 2VHJA 1R10A 5LB4A 3QNUA 3SJBA 3B82A 3W8RA 4D80A 5FPSA 5BN3A 3U44B 1TQ4A 1HUQA 2ZRKA 1L4UA 1KNQA 1TAGA 2JGNA 2VEDA 4QM6A 2QORA 3MGCA 4XSGA 2ZEJA 4V0ME 3PCRB 1JECA 5BQ5A 4DCTA 2BVNA 3CX8A 3HR8A 4KFTA 4LSGA 2RGCA 3RRMA 4DEXA 2Q9BA 3U2QA 4EPVA 4FMCB 3MG9A 3P32A 4MYHA 5DSZA 2C9OA 1CBUA 1P4SA 1OKKD 2WWYA 3AVXA 3LBHA 3PUZA 2FZ4A 1L2TA 1Z22A 4FN5A 3SQXA 1HQYE 1Q1EA 1S3GA 2JLRA 2QTHA 1Z06A 3GEEA 1WBDA 5E95A 2IYXA 3WNDA 1VPLA 2JIZA 4J0QA 2HXYA 3QXJA 3TNFA 4F38A 4DSNA 2YOFA 3BWDD 1GRNA 1KMHB 3SBEA 3DM9B 1P7CA 2ZYWX 3SN6A 3AUYA 3BC1A 1OH7A 1U9IC 1NN1A 1NY5A 1YZNA 4F7WA 2CCJA 3X2SA 4L15A 3TJZA 4NYIR 5FPKA 1UJ2A 4LC0A 1GSIA 2WJVA 3A58B 3EW9A 4FMDF 2ZJ8A 4UNSA 3RSOA 4Q1DA 2IWRA 4R71A 5JHHB 1A1VA 4KV9A 4LBVA 3AKDA 3SZRA 1G21E 2ZI5A 2ZANA 2ZRIA 4DT1A 4L16A 1F48A 4URUR 1G4AE 1JXMA 4K81B 1OSNA 2NMVA 4RFSB 4EAQA 2BM1A 2QGNA 2ZI7A 3BRWD 3EASA 2VQSA 3QKSA 1KKMA 4D6PA 4XD7D 4HI0E 1IBRA 2QRNA 1ZCAA 2A5FA 1MKYA 5CYPA 1D2EA 2UZ3A 2ZUDA 1KI4A 4DLUA 2GAOA 4RZ2A 1FW6A 4BFWA 1P61B 3B13B 3SC3A 4IEIA 2QPTA 1G6OA 3EIEA 5FBWB 4OJKA 1EXMA 1FP7A 1FX0A 2GCOA 3VKWA 1U0LA 1OT3A 1RPZA 2VL7A 2ZSAA 2SHKA 4PPFA 1F60A 2AN9A 3UWKA 1JPJA 5CB6A 4JBYA 4TMKA 1OIXA 5KO2A 3PQCA 2E9SA 1T0HB 4JLVA 1LF0A 1E2MA 1GOTA 1VCNA 1I4TD 2H18A 1CF4A 1X1RA 1P75A 1T91A 2VHCA 5FPYA 1NI3A 4E5UA 5BYKA 3I73A 3KQHA 1CR1A 1E2PA 3KTAA 5KU1A 4CIDA 2C98A 2OEPA 3LY5A 5LB2A 2RGNC 4RVCA 1X3SA 2QY9A 1VMAA 3CRQA 4M8NE 2QEQA 4OK6A 1XD2B 2C99A 1SVLA 4KSBA 4OQNA 1XPUA 2V3CC 2JIZD 1NSTA 3SYKA 1X8KA 3H2YA 1Z0JA 3QXHA 2Z5FA 5BN4A 1E2HA 1U90A 1JR3A 3L43A 4MRRA 2O8DA 3IO3A 1ZU5A 2AKAB 3IIMA 3JVVA 3CNOA 4JSTA 1LF5A 1O3YA 3SE0A 3K9LA 4GOXA 2DY1A 5C2JB 2JJ2A 4ZO4A 1Z08A 5D3MA 2DB3A 1N0UA 2ZR0A 1GL9B 4Z8XA 2QNRA 2LKCA 4RKFA 5KUTA 1TQDA 5BN5A 1KSJA 2V6JA 4ITRC 4URZR 5FR2A 5J47A 3LFUA 2WSMA 4CW7A 3UKDA 4KODA 1E2IA 3QF4A 1U8AA 4FCTA 4FMCF 2Q21A 1XPOA 4QXAA 4NH0A 3RS4A 2OCYC 4LYFA 3MWLA 5E7IA 2VO1A 2WWIA 1JXOA 3FMIA 2ZIAA 4JYCA 2EYUA 2CVFA 3MMPA 4LJ6A 2JLZA 1BO6A 2ATXA 3IEVA 2ZREA 1K5DA 1JB1A 4UNNA 2NQ2C 4LZZA 4IFEA 2WWHA 4MGZR 1KI6A 2J7PA 5G40A 3OAAA 4FWTA 3FMPB 4TL7A 4G5SA 2PT5A 2FPKA 3RC3A 1JEEA 3U5ZB 2RB4A 1HA3A 4KYIB 4LV5B 1E69A 2IBMA 5TB5A 2CL0X 5TV2A 2P3SA 2V55B 1I4DD 2CBZA 3QQ5A 3CRRA 4Q02A 5EE0A 4WA7A 5K8TA 3GPLA 3ADKA 2CLCX 1PLLA 4MGYR 4HAYA 4S2EA 5EZ5A 3X1ZA 4A2PA 4A0FA 1GAJA 1Z07A 4IOJA 2IYWA 3BB4A 1DAFA 4QHYA 1XTSA 1FFHA 1AGRA 3DPUA 1XD9A 4BZXA 5CK4A 2O8BB 4PHFA 1JQLB 3VNUA 1SGWA 1DS6A 1N25A 1VHTA 3UPUA 1JR3D 2EQBA 3C5CA 3THYB 4BFYA 4DB2A 3NEJA 5BWMA 4G0NA 2O8EA 3RHFA 1SVWA 3K70D 3QEOA 4UXJA 5J5CA 2NG1A 4C7OA 2XNDA 2PBRA 3TR0A 1QDEA 2JJ2D 1W44A 3GJXC 4HLUC 1RYHA 3QKRB 4NCHA 4ILEA 1CIPA 4W5JA 2JLWA 1GKUB 2CHGA 2BIFA 4HEJA 4HB3A 2V6IA 2ZRDA 1KO8A 3VKHA 4TL8A 4BZQA 4HB4A 5E3HA 4CVNA 1KI2A 2FSFA 1W36D 3L0IB 4IHQA 3ZZ0A 2OZEA 5AUPB 5IDVA 5KYKA 2ZR9A 2IUUA 2XITA 5CIQA 2OCAA 5KSOA 3PJRA 3QPWA 3WRYC 4AURA 1J99A 2AX4A 2I1QA 2P6UA 3NKVA 4A82A 4DRZA 1W48A 1Z29A 4NDZA 2J0QA 4AKEA 4UNRA 2J7PD 2BMJA 1UBCA 3OAAD 2ECKA 2ORWA 3E70C 1ZNXA 2ANBA 2MSCB 1JQJC 1RIFA 1SVOA 3R9WA 2EWVA 1KK0A 3AVQA 4JL5A 4Q7MB 2W6JA 3KUDA 4HZUB 3BB3A 2OAQ1 2R65A 4JBXA 1P72A 1E4YA 1KMQA 1G8FA 3P4YA 1CEEA 2HYDA 4YMVA 2IYYA 4X8OA 3VQTA 2QSZA 1FNNA 1KI7A 2N42A 2YV5A 3L82B 4Q21A 5DE3A 4HDQB 1QF9A 3K0FB 2WWWA 4Q4JA 2QM8A 2ZJYA 3TAHA 3NEYA 3GCGA 2QAGA 1OH5A 1XXHA 3RLFA 1N6OA 4OK5A 4CT4B 2ZR7A 1KZGB 1YZLA 1FTSA 2B7CA 2YWHA 4LJ5A 4Q01A 4QC2A 2YNMA 5C4GB 1LS6A 3U4QA 1WMSA 5FUXA 1ETUA 3WNCA 4B71A 5IRCD 5FTKA 3O8CA 4MYUA 1N6RA 5EUMA 1E4VA 4POAA 2GF0A 3SEAA 1XF9A 2ZI6A 1AQYA 4TYPA 3ZD6A 4DB4A 2BEKA 2H16A 2XNDD 1FNMA 4CEHB 1UEIA 3HU3A 1PV4A 1CJTC 1VG9B 5LBIA 1G18A 2WAXA 1U98A 1HV8A 1XMSA 4ESVA 4Q4AB 2D06A 1DG1G 4YONB 3W3AA 4RZUA 4PZZA 1OB2A 2ZI3A 2NZJA 2QENA 3TW4A 5EP2A 1P5ZB 4QGHA 3VAAA 3BJIC 4HDCA 3FVQA 1MABA 5JI2E 1G3IA 4Q5IA 3WMFA 2BBTA 2F1JA 4CEJA 1RRCA 1G7SA 4LPKA 3A6PC
chains in the Genus database with same CATH superfamily
5THQA 5JMTA 4WLFA 4BAZA 1KF0A 2B1QA 2FZGA 3LGSA 3B53X 3MWEA 4O1IA 1XDDA 4QOFA 4B3CA 4YR7A 5IN4A 2C2ZA 1X7XA 1A5ZA 1E6EA 3PNSA 1X7DA 2XDQA 2VJAA 3QX3A 3VOAA 2XKJE 3UB4A 3MTBA 3ZY3A 5AVVA 1OHHA 3HV0A 2H8KA 2ZJ6A 1PT6A 3MF4A 4ZQCB 1NPTO 1CDOA 2J5KA 3I2YX 4HRAA 2OTCA 5F1OA 3OIDA 1WR8A 4I55F 4BNHA 1EK0A 4KITB 4AUKA 4F72A 2GBCA 3A6JA 2B94A 2HGZA 2VATA 4JBLA 3SSMA 1WF6A 5C1OA 4OGLA 4QUEA 1LLCA 4YFYA 2D8AA 3TYXA 4DV0B 1ENOA 5JU6A 3WLIA 3KU4A 1XQ9A 1U0RA 1TMOA 4OPMA 4BP3A 1A77A 3I83A 1Q22A 2CJPA 2R86A 3RIGA 4P83A 4N41A 3NHFA 3IGFA 4PO1A 1G9SA 4G97A 1O6CA 1FDOA 2CKMA 3L7BA 2GPTA 1R0WA 3A28A 1JSLA 1T2DA 1DTWB 2AOVA 4L2IA 3AERB 4GLJA 1PR0A 3AP1A 1KJIA 2ICAA 3NG1A 2BE7A 1B6SA 4BO5A 4WFQA 3T9EA 1ZZEA 3ISTA 5HILA 5LWQA 1C9YA 2WI8A 1E6WA 2C8JA 3TM4A 3WIVA 2AZMA 3BXFA 5K0JA 2NPFA 3O3CA 1UDWA 5KINB 1O6ZA 2G71A 1Y37A 4BV2A 5E8JA 4D9HA 1DC4A 4F85A 4NBLA 5BW8A 2G1KA 3EA5A 4S1VA 4CEIB 4AJPA 1ZCBA 4NCXA 4BMVA 3KOXA 4I9UA 4OHKA 1DPGA 1UWLA 4JB3A 5E6SA 3A04A 1M7GA 2YIJA 4TRMA 2E6UX 2CDBA 1EFHA 1XZEA 5ALJA 3WK4A 3CF2A 2E5WA 1JFFB 1OD6A 5LXTF 2I2AA 1HLFA 4RFVA 1DX4A 3NDPA 3SFZA 4AZ0B 1HM5A 2WG1A 3WYEA 4HLCA 4G65A 2PX8A 4FR5A 4RBNA 1LNZA 4CKYA 2VOJA 2C3UA 4NL4H 3TQOA 1A50B 4WINA 3RDPA 2X3FA 3KJEA 2W00A 1DG9A 2BCJQ 3LWZA 4KIGA 1E2EA 3O8BA 3KZVA 3E03A 4FWBA 4JP3A 4V0OA 5ECGC 3T61A 4ZQHA 1SZCA 3B1JA 3PDCA 5DGCA 3M3PA 5EEHA 5F2OA 4BMCA 5AVWA 1QHEA 3PUJA 3DZKA 1ML3A 1EQ2A 3GGDA 3DZBA 4ZPXA 1THMA 1U7PA 4DSZA 1S0UA 1MRNA 4GMGA 3WRXA 2FX5A 1MEJA 2J30A 2RAUA 3P2KA 5JJKA 1OHHD 1RQNA 1KK2A 2XWSA 3WO0A 1J2YA 1Q83A 3L7LA 5C5DA 2XMCA 4EUKA 3EGEA 1CZHA 1E7YA 3WX0A 3G0IA 4XVQA 3NHSA 4MVXA 4YP0A 3UYKA 2DZDA 5EHXA 3LCRA 4CIXA 3A10A 1G4UR 4DQUA 4E7OA 1NKVA 2FHPA 3THXA 3RS3A 4AJNA 5AK5A 5GJCA 4WI1A 1DC7A 1DO0A 1NXOA 1U11A 3CHYA 3GBSA 4MB2A 1OWNA 3RV4A 3TVDA 4YJ3B 5H1YA 2CB0A 2IEYA 1MOZA 4CFZA 1V8BA 4WZZA 1JDUA 3VO8A 2DTXA 3OCUA 2O57A 3AP2A 4R9RA 5D5PA 4EABA 1IN1A 1B74A 4LYEA 1J56A 1FLDA 3VYSB 4D5EA 1OW3B 3QZUA 4LHXA 3UCFA 4NJOA 4EELA 3GRUA 4UAGA 3VH1A 1P2GA 1CVIA 1QVZA 1P5JA 2J5XA 3DT8A 3V4SA 2F3SA 1I9CA 16PKA 3PEWA 4UNQA 3C3PA 4JROA 4GLBA 2JHAA 3IV6A 4B8ZA 1TPYA 3U7QB 3ESDA 4BCCA 4G0QA 5ULLA 5ITZA 4Q7JB 5KDDA 5FORA 4BMZA 2NN3C 1DRKA 1LW7A 2YJZA 3I39X 5GZ1A 4AY5A 5C8VA 3GBVA 4JKYA 2F3RA 1I2BA 1NVDA 5EMKA 5ELLA 4E4TA 4UBJA 4HMPA 3LLCA 1ZVMA 1I3KA 3QVWA 3BS4A 3CH5A 2CL6X 1I2DA 3IMEA 1NMSA 4BO9A 1M6WA 2QRLA 4R9SA 5JLJA 1V7ZA 5JH7A 4KR0A 1SZPA 3A6KA 5ITSA 3KPVA 3DNFA 5E7QA 2DPHA 4BO3A 1OCEA 3NT5A 3ONNA 4A8HA 2XR1A 1T2FA 3DB2A 3K6JA 1DFGA 4I19A 5A4IS 2XH8A 3E82A 4CYMA 1QH8A 1EVJA 3HXMA 4CWAA 3PCTA 4UC0A 1W30A 3ZQ6A 2PNFA 4OXKA 4LTDA 3ILVA 4QYXA 4X1YA 4TMFA 1MAVA 2PUTA 4X84A 3D4OA 4GVXA 2JLAA 4EPWA 4J3FA 1NDHA 3LL4A 3Q3IA 1XELA 1RYDA 2DFPA 1FJGB 4HDOB 4Q4DA 2A9JA 1G42A 1G8PA 2BLLA 2RK3A 3E7XA 3HG7A 1H9AA 4TV8B 4UUAA 4ZVSA 1ZMOA 4WSOA 3TW0A 3WWDA 4ATNA 4C3OB 4DW8A 2B4QA 4O3FA 2COUA 2PLWA 1B6RA 1GNTA 5KOHA 2MSKA 3ZE2B 4HFNA 3WYDA 4Z6KA 1YQXA 3OD1A 2X5KO 1SULA 3FPLA 1EX6A 4DYHA 5GGXA 3GYBA 1MF7A 4U7FA 4OXIA 5E0OA 1ZOOA 2N46A 3KJFA 2PEYA 4RHTA 3QWIA 4QUBA 2G17A 4QGAA 2A57A 5J2UB 2Y99A 1EUQA 4LJ4A 1S9DA 5HQTA 1ORVA 2YVQA 2IVFA 1K8RA 3TRKA 5JW6A 2B5WA 4IDBA 2DXIA 3AMVA 1G3UA 3MFYA 4E07A 5K1ZA 3PS9A 1DVRA 1TK2A 2PV7A 4I0WB 3M9LA 2IP1A 3AEQA 1XMJA 3GHYA 1WRBA 1Y6ZA 1B8UA 5EXDA 4EYKA 4K0KB 4NOMA 3QWFA 4NTZA 4IIYA 5E0KB 1MV5A 2EW8A 3FBTA 3UMFA 3FPCA 1SXIA 1ZGZA 3THYA 2II6A 1UFQA 5CBPB 4BFZA 4OI2A 4Y3UA 1QVVA 4FSHA 3KOYA 3FGOA 3KJNA 5KWVA 2CDCA 4ZO6A 1E3LA 4G1FA 5KYNA 3W0LB 2OAEA 4AO6A 3KHUA 1U2ZA 1G63A 1GA4A 2AUTA 2VHQA 4QXPA 3EK2A 3OA2A 1KI9A 2QTLA 4NS1A 2C4NA 1P33A 1CK4A 4XW2A 3T7CA 2VP4A 4R3UC 2GD0A 3VR1A 4YCSA 1NMYA 2F6RA 2JFXA 2W90A 2Q3MA 1EX1A 4XPIB 1I4LD 5LN1A 4FQ5A 2WSYB 3ADOA 5K6AC 3UJHA 1T9GS 1GTSA 5CNMA 4ZCTA 2KLBA 1TF7A 1E1MA 3I04A 4Y9RA 4Z1MA 1CUBA 2G40A 2NO6A 3ZG6A 1E58A 4UW9A 2WB2A 4FKMA 1KFBB 4CDMA 5DMHA 1AK2A 5IUJC 3GA7A 1RRGA 5J4YA 2B83A 5CDFE 7REQA 3N2NA 1B7GO 2I8LA 1WHSA 4R2XA 3URMA 4F8EA 4GXTA 3ZI0A 5F21A 5AW5A 5CM9C 4YUZA 5LQSA 4RNCA 3U6KA 1PLKA 3IEIA 4M87A 5J2TF 3A1SA 4QUDA 1GEGA 3LBFA 3ENQA 3NH9A 5C4MA 4OY3A 1F2TB 2J9XB 3B1YA 5FR1A 4RPGA 2EJTA 3NU1A 4KZPA 4M0PA 4QOHA 3BZBA 2AVNA 5COBA 3EIXA 4YMWA 4FGLA 4KDEA 1NQWA 2D5CA 2ZS7A 1JN0A 5FI5A 4F4CA 1EUCA 4EI9A 1D07A 4KRYA 4JXZA 1H2XA 3ND9A 3DBLA 3PWZA 5LLSA 4BV8A 5B7PA 4W9MC 1WMFA 1Z8NA 4P7BA 3R74A 3A06A 4I6JA 3R8CA 1ESDA 4H16A 4IUDS 5ARDA 1U04A 1A5SB 2WPNA 4WT7A 5FFMA 3BL6A 1RACA 3C0KA 4XR9A 2QQFA 4YJGB 4AXBA 5J40A 3FX2A 1ZONA 4LWQA 4YP6A 1H65A 1F5NA 1ZPDA 1G8GA 3VR5H 2HSEA 3RS8A 1BRTA 4HQOA 1NPDA 4N5NA 3NNSA 1RXUA 1ZRSA 2PPVA 3KELA 4IQGA 4R6WA 3UTCA 4D56A 3BAZA 1CY2A 1QXSA 5LJLA 5CXSA 3RS2A 3C4QA 2IHNA 1ZK3A 2W6NA 2QXUA 1W4CA 1JG6A 3A6FA 5L9AA 3QLJA 4JASB 1LPBB 1VLVA 3IBFA 2X0IA 4QBHA 3ZR4B 4TV8F 2FPGB 5I8PA 4JV5B 4GPTA 4RE6A 3WV4A 2FEPA 4CUKA 4MV0A 3VH3A 1G9XA 1GPWB 3HK2A 5K3FB 4G8JA 1W36C 1GJRA 1XU4A 3KRTA 4I1IA 5IJ9A 4R2MA 5JAHA 5HCNA 2O0MA 2O52A 3C1AA 2ACWA 4A2WA 4KIWA 2O2XA 4YJDA 2O1XA 1KWKA 2TRSB 3OOJA 3P96A 1Q20A 2XTMA 5K05A 3DVSX 4K0RA 1OA0A 2JVIA 3CX7A 2IY8A 2D2IA 3X44A 1ZU4A 4F93B 1FXSA 3O4RA 2JJ1A 1SOVA 3QLVC 4LW8A 1H2ZA 5A3SA 1U3GA 3VVBA 3W6UA 1E3DA 3CCFA 4H6VA 1EDDA 1YRYE 3RUAA 1BEUB 3Q2IA 3W9YA 4TKVA 3ZLVA 3EMVA 1WXHA 2FZ5A 1EWVA 4IWXA 5L7YA 3O2SB 4X8MA 5DVZA 1WU7A 2QUKA 4AG6A 3HLKA 2PU5A 2D4HA 2VJLA 4DLTA 1LFDB 5HMLA 4H4EA 4C2BA 5I8ZA 3G2NA 3FUWA 2WR8A 4DQ0A 4DR5B 1ID8A 3L8EA 4UBMA 2A5DA 3SHWA 1FS5A 1G0OA 1GZ7A 1VKJA 3G6WA 3FNRA 3E8XA 5JD3A 5KNCA 3PX7A 3TTSA 2YOHA 4H6WA 3STUA 5JRZA 1YDGA 1M6VA 1GADO 1RBMA 1I6MA 2IXDA 2VJKA 3D7MA 1EZZA 4I9HA 1SBCA 1BDJA 1V3VA 1QS0B 2WF5A 4MW1A 4U2KA 3D4IA 5BN1A 3BEOA 4J1TA 1Z4KA 3KB6A 5IKOA 5T67A 3N8NA 1XCBA 1DP4A 5FPPA 4P53A 2UYCA 4L9SA 4C0XA 4Q1CA 2M6LA 3IQEA 1NRWA 4TRJA 3F46A 3TGPA 4DV6B 4GYJA 5CB4A 1FTQA 1W87A 1Z82A 1B14A 3QX7A 3WO1A 3QXSA 3VV2A 2F7SA 2BFMA 1CR2A 3T7AA 1IZYA 4G01B 3X3HA 3I5YA 4N01A 2WIJA 3MGKA 1ZD4A 3I5MA 3QEMB 4FP9A 3IOYA 3BFPA 3NT2A 1DRUA 3L8MA 4XDHA 2UZIR 3LLMA 3FPGA 3P97A 4MPPA 4GDFA 4V03A 1RQGA 5D00A 1YVEI 4A0QA 4CUZA 5GTDA 2QTRA 4J6EA 5DI3A 2ROQA 1MAHA 1RQXA 1XIVA 2GTHA 2WHPB 1CUDA 1UFKA 3CNQS 4N4AA 3V42A 2AXPA 1FSZA 1IEVA 1UDBA 4FN4A 1NW3A 4DQKA 2ZJ1A 3S8YA 1CULC 2TMDA 3LJKA 2ODTX 1TD9A 2H17A 3Q98A 2PZJA 4M86A 4YN3A 3I9V1 2J9YB 2A9KA 4G0OA 1KHHA 5FPTA 1NJSA 4BASA 1XL0A 1SCBA 1ZEJA 2RHBA 4X0EA 4BMYA 4BBJA 2Q3FA 4GZ5A 5A9SA 1Z4OA 4KRFA 3K9QO 3DFUA 4QQKA 1HOTA 1L8XA 3OQJA 3FAKA 3CLSC 4DJDC 1IMOA 4CIVA 5B1EA 3TI9A 1AA6A 5KNLA 1T4DA 4PXYA 3VDQA 2ONCA 2VHVA 1Q2XA 1CDDA 2MYTA 4EMSA 3T1YB 1GTG1 1A9YA 2JJ1D 4G56A 5AWFC 1EVZA 3JQGA 4DDUA 2D1QA 4TLLB 1GPAA 5HR5A 1C3OA 1MOQA 2POCA 3RJ9A 2XZDA 1XRSB 2NTJA 4L5IA 1M2GA 1NSYA 4OB8A 1JR6A 1QQ6A 5FNVB 3NHLA 1QHIA 2VT2A 4PHTA 2Y1LA 5IEBA 4MYSA 5IDYA 4M46A 4PLTA 3W2GA 1YR2A 4Q3NA 3X1WA 3ZDYB 3X1XA 1X2EA 1TA9A 3T5CA 4ZYZA 1RC0A 2VPQA 2JJ8A 2EDCA 1JALA 4RUKA 3DUFB 5KNCD 3S1SA 2I4TA 3T4XA 3HUEA 5H70A 2XNSA 2EERA 2XRYA 1B8NA 2B82A 3I9NA 2Q5CA 3RS5A 3REGA 2OO7A 2XHEA 3G0OA 1LY1A 1UL1X 3ROTA 1LH0A 3T7DA 2BFCB 3K0EA 3D0KA 1JJIA 4L28A 4PZCA 5HIIA 4CM8B 1ENZA 2MYUA 3CG4A 2PSEA 2KHZA 2QMHA 3H9GA 4CG0A 3PD7A 1DDGA 3JALB 4IV5A 2LCQA 3NTLA 2ZRJA 2Y2VA 1J0DA 3SXUB 1QFJA 1BN7A 2YNMC 4JQOA 2OBNA 4KR2A 3FCUB 1RTKA 3MINB 3SYLA 3U4GA 2HRCA 2QQ0A 4GHWA 4RZIA 4Y0VA 2Z1NA 2AEFA 4MP3A 1UIMA 1FDRA 1WMAA 4QUHA 4ZQGA 4LZOA 2A14A 2X5NA 3CZAA 4RU1A 2EFCB 2OCDA 2XOEA 4X95A 3OP1A 3UKOA 3WMGA 5A2GA 3UHFA 1REQA 4I99A 5F5XA 1DWOA 3GLVA 1HE8B 2FPSA 2J87A 4GU5A 1TVMA 1JLRA 1M2VB 2PX3A 5K01A 1PNRA 1LD3A 5KSYA 4PIVA 4RJIA 1DJMA 5JMPA 5T5QA 2YYZA 2ZM5A 3BH0A 4MQEB 5J4VA 2XYRA 4BIIA 5FV4A 4FGJA 4RTNA 4EUHA 3GN1A 1GY8A 1PE0A 4DS3A 2EJVA 2BFPA 1L9XA 3HC7A 3NGXA 5GADl 3UMSA 5J1TB 1D1QA 1GPBA 1GQRA 3MBOA 3PCXA 4FX2A 3T94A 1GM5A 2C77A 1QH1A 1WO8A 2ZJ0A 3QBEA 4G41A 2ARKA 3EIWA 4C4XA 2G6BA 3L6EA 3FIUA 4Y6QA 2GHRA 1N6PA 1QYXA 2QLLA 2CXXA 2Y6VA 1KQPA 3K4HA 2C4TA 4OLHA 1KI8A 3AF0A 1BVUA 3L05A 3N59A 2J9GA 3N0XA 4HDMA 2H4ZA 4DMHA 4PS1A 1RC1A 2BY4A 1Z8DA 4RC9A 1KY2A 3UATA 4ZVLA 4NOKA 3C1TA 1YZKA 2B0CA 1DAIA 5EI5A 2CLEB 4P35A 3ZHYA 1I30A 1N9GA 1M2KA 4M21A 1Z0FA 1NM5C 3ICOA 4WFKA 3VR6H 2GXQA 4EJSB 5AHWA 1KSGA 5BRAA 5JQGF 3SSOA 1SXJB 1ZR4A 3K72B 1JHUA 2FPPA 4L85A 4C4TA 4OP1A 1XEWX 1D1TA 1H42A 3KLMX 4Q9KA 1KMIY 5C80A 2P11A 3WWYA 4CQMA 5JALA 3HM2A 4JUCA 3I34X 3T3GA 2X4DA 4ALKA 4GX0A 1PNVA 3DZ8A 1TEZA 3J7TA 2FG7C 5A4DA 4X65B 1MQAA 2P2LA 1FP4B 5DJ5A 4DUPA 1HT3A 2GILA 1LTHR 8AT1A 2AKEA 1N3YA 5K3CA 4DM4A 4X1KB 2YVLA 1PDVA 2C83A 3RFXA 3E8MA 2UYOA 3PV0A 4HKTA 1PL7A 5BN3B 1SQSA 1KJ9A 5LU8A 1A1SA 2ID9A 3T41A 1DBVO 1PDWA 3DNPA 5EIHA 5FO0A 4TUYB 4C08A 3C8HA 5L8VA 3D6VA 1HEIA 5KOIA 2IW1A 2BONA 1SHTX 3BGSA 3V32A 1YACA 4BS9A 3FPFA 2WJGA 4PO8A 3PFWO 1TJ5A 2H4YA 4UVGA 3A7EA 1EVLA 1QNFA 4U7WA 4M0KA 3U49A 4C07A 2AA3A 4MV3A 1M34A 2IS4A 1U2RA 1E60A 1B4DA 3M4JA 3WBKA 4HS4A 1DIOB 1GPLA 5DOVA 4HAXA 1YFZA 4ETWA 3LVFO 3IPCA 5HM8A 4GRAA 3QU7A 4AF8A 1USIA 3MWDB 2DQ4A 4GNKA 1NN5A 1V2HE 2QMQA 2I2DA 1DZ3A 3JY6A 3U17A 3M6IA 2VSXA 3OLYA 4TXJA 3NDIA 3SLKA 2H9AA 2AW3A 4ZU1X 4B0PA 2H65A 2JLBA 4RKEA 8ABPA 2OPBA 5EPUA 2PKCA 5FUBA 3E6AA 4PLVA 4A91A 1Y7TA 1CQJA 1KJWA 3DMFA 4FYIA 1IK4A 4GUAA 3WP0A 4AK9A 1STOA 2GBPA 2GWHA 3D43A 3KTFA 3KXLA 4BFTA 2BGUA 5LYJB 4LMPA 1W94A 1WBJB 2H08A 3UUFA 2G07A 5IVHA 2GGSA 4QODA 3WQBA 4AFNA 4OHXA 1AO3A 2IYLD 2QD1A 3NEPX 3CLSD 4HN9A 2YWFA 3EZXA 5EJFA 1NF2A 1Q2UA 2GR9A 2JIOA 2MYPA 1M2HA 2N3ZA 2XLBA 4TTJA 1KQ3A 2NU8B 4BRWA 4ZTZB 2PYIA 4ME6A 3OFNA 5B1SA 3H4MA 1Q0LA 3U0VA 3R24A 4OA8A 5AH0A 2H1FA 3N2ZB 1US8B 2M6KA 4DLSA 3UGJA 2HQRA 3S81A 3G2PA 3IP8A 4G1VA 5TX7A 3M89A 1I5EA 3QXCA 3DF7A 1U2PA 4BJ1A 1CR4A 1JWLA 3W7AA 4AWBA 2I4IA 5BRJA 3FDZA 1M8PA 4J29A 1YJBA 3KZ1E 1G5FA 4EVQA 4DE5A 3LY8A 4ENSA 1AM4D 4MMXB 1W5AA 4LZNA 3GJ0A 4CQMD 1MX3A 1U8XX 4E4RA 2HNAA 2RIRA 5HFJA 5L40A 3P9QA 4LHZA 3TLZA 1KJJA 2HCJB 2JFBA 2QTGA 2QW8A 5EAIA 3RIYA 4UQOA 3VNSA 1ZYUA 1HDYA 3SVTA 3PVSA 4QJ3A 3IIEA 5IVIA 5I9TA 4BCDA 1SQ6A 4JH0A 3PNPA 3G9XA 4G26A 3WADA 4DG9A 2P3QA 4EENA 3ML1A 1L3CA 2BGJA 1TVEA 1S4QA 2B98A 3FDXA 1SKYE 4IBOA 2BI7A 1KRHA 2D5IA 2ZRPA 4B2IA 4P4SA 4WOJA 4CL2A 1M8GA 4L8WB 4G8CA 3WLRA 4NHOA 4QT4A 3BFJA 2VQEB 4Q47A 3AUUA 2W4MA 2H1RA 1JDPA 5DM70 3ZLJA 1E92A 4HEA6 5AHKA 2FW8A 1BMFA 4RS3A 5I6DA 1WHTA 5AW0A 4PS0A 4DXDA 3V46A 4JLBA 1SBQA 3C6MA 1OZGA 5K3SA 4G85A 4Z5XA 2BSAA 3CZMA 3RVOA 4W8OA 4CKWB 3AINA 1P62B 2BGLA 5I51A 1ULUA 1Y42X 2BYTA 2QGFA 4Q1AA 2UYHA 1OI3A 5FOSA 4ER0A 1CUSA 1YIAA 1D4FA 3OX4A 4R9VA 1XTZA 4DABA 3SVLA 1L5MA 1S2NA 3DLIA 1HDRA 1TM1E 3PPVA 4LKOA 5IASA 5JS1A 4BVHA 3F5DA 2OCBA 4ABYA 4KQMA 3ESYA 1I2AA 3QY0A 2QN1A 1D03A 1E1YA 3D1JA 4HL6A 2WFAA 4Y2RA 4KXFB 4HX2A 4RDXA 1W4BA 2R6FA 3K16A 3KC2A 3WK9A 5JNRA 5K03A 4TQAA 4L9WA 2IHTA 4LDJA 3FPAA 3NIFB 5AFSA 4ALLA 3IKMB 1I4EB 2FMUA 4KR9A 4WX2B 3VHXB 1FL9A 2CLKB 3OQVA 4OHCA 5REQA 3ZWVA 1GWNA 1PWXA 2HB6A 3AOGA 4M8KA 2Y92A 1YJQA 4KXWA 2ZCVA 3OFND 1J39A 4IS3A 1SVNA 2I3GA 1KP9A 3MUOA 5DHUA 5IYZB 3ABIA 3D4LA 5BUCA 1G20E 2FP4B 4LJRA 4YEDA 2ZJ4A 4X3CA 3D5TA 2QZ4A 3PZRA 4LK2A 5LOVF 2D7CA 3JX9A 4WRRA 5B6IA 5HRAA 1TVKB 1RXCA 5DLEA 2ZPAA 1DJLA 5K51A 3ELWA 1AT1A 1O57A 3O21A 3VI4B 5CFNA 1Z0KA 2VRNA 4ZZIA 3UOAB 4LY6A 3D5QA 1T34A 4AMBA 3DTVB 2GM4A 1W2GA 4NYMR 2X19A 4UPDA 2QDXA 3RYCB 2CNDA 2MR5A 1U1GA 1MLDA 2FQQA 4D9MA 2UXBB 1UZUA 4K6KA 4MUMA 3R75A 1JLLA 1YVUA 2AWOA 4K6GA 4DLPA 2BBOA 3SK0A 6NULA 3FY4A 2CNWD 4GIBA 3HY6A 4ACAA 1RQ2A 1U3TA 2VDPB 5L51A 1U8TA 4Q3DA 1OROA 3JQ7A 3LC7O 2OYCA 3BTUA 4MVJF 3RODA 3O94A 3ZVRA 1XQ1A 2C04A 4L8YA 4AYWA 3GNTA 3GW8A 3Q9LA 3TEFA 3UHPA 1Q3KA 3KDPA 2GPBA 3QG1A 1GG2A 1CJKC 1NG9A 3EAQA 2PA0A 4J7XA 4UZSA 1VI2A 4A3SA 1N0WA 1MQSA 1QAOA 1QTNA 2OY0A 3K31A 3C5EA 4PRKA 4PBSA 1SVSA 5BSGA 1VYUA 3U3DA 1M0SA 1BMFD 3SSAA 1JLSA 4IMRA 2DUUA 2VF2A 3ETLA 4TWBA 5LZ8A 3S55A 5HFAA 3T4EA 1PV1A 2WV7A 1YBAA 4X54A 2W2KB 2Y0CA 3LUPA 3TQSA 3ZS9A 1UZNA 3TRDA 1EP3B 2PRSA 2WJPA 3IQHX 3D81A 3RE1A 4KBYA 3RYTC 4QGBA 3TB6A 2OSBA 1ZMXA 4OOFA 1NFFA 2OPHA 4JR2A 4BECA 2VAMA 2OVBA 1DKOA 2XNJA 2EBWA 1Z6AA 2XUAA 2EKLA 4M0EA 5GJWC 4ES6A 1KZ4A 2ZJZA 3IO5A 3D7NA 1PFUA 4DLVA 5FUQA 1KFCB 1PJAA 3QWAA 1LNSA 4JA0A 3CB4A 2H2HA 2WIKA 4OHMA 4RTJA 5AI0A 4CMIA 2FSPA 1Y9ZA 3AJEA 4WLNA 1W34A 1PNTA 4I4LA 2DUNA 3AUAA 4J0HA 3RVBA 1XNRB 2GPJA 1YTUA 4OJMX 3KVYA 4DWWA 4HNVA 3LQQA 1X0XA 1XTKA 4B84A 3AIMA 5CFZA 3JS5A 3AHCA 4Z9XA 4S2UA 3L5KA 5SYAA 4YI5A 4WUVA 5FHQA 3RRNA 3SPXA 3QRWA 1Z62A 3VSEA 3FRHA 5ECWA 2R4UA 1DHRA 1EJ2A 2PT6A 3BE4A 4IHJA 3K9FC 2IIBA 5AJTA 1PGPA 1N6NA 3C5HA 5DMXA 3PEFA 3R23A 5TS3A 2VRBA 4ZKEA 4IF6A 2DUMA 1YQQA 1CE8B 3SYTA 3OLZA 1D04A 1T2AA 1SOMA 4FSDA 4K6FA 4QNRA 4PO9A 4BUZA 3QTLA 1S89A 4OX9B 3NYRA 1WUIS 2NXJA 1C29B 2JLCA 1X70A 1XZNA 3E2PA 1GVNB 3ZGYA 2Q7XA 4BE9A 2AXQA 4W1PA 5DDIP 3EX7C 2EDAA 2X8AA 1FQOA 2HLDA 3JQQA 4W7IA 1HG0A 1N7JA 1N36B 3MUNA 3KEFA 4C4AA 2HT6A 2Z2KA 3OM8A 1R6UA 3IH5A 5CXUA 4HDKB 3I6MA 1CUGA 4ZOLA 3I1JA 2FUG1 1XJ0A 5H3LA 3BDVA 5HW0A 4I08A 1SIOA 1TYDE 1QC5A 3D6FA 1SEPA 2JFNA 5E4FA 4FCCA 3ASUA 4M8SA 4I4TA 3GMIA 4C7XA 2HIMA 1QE3A 2JFOA 3EEQA 3NT4A 3IV7A 3HFGA 5TMPA 4AMYA 2GEKA 1GQSA 3CJTA 1NBAA 1T3GA 5FL3A 4EHFA 4NABA 3JD1A 4B4DA 3SHQA 2LCFA 3FYSA 2CMKA 3Q2KA 2VWQA 5HBRA 1EVIA 3DAPA 5H9WA 2E87A 4I3FA 4YVFA 3EVAA 2W0SA 1FEZA 4OHFA 4V0SA 4Z9BA 5GWXA 4DLXA 5GV7A 5KEIA 3V97A 3E9EA 2H52A 1TZCA 1U7WA 1ICEA 2Y6UA 2YFKA 3CWZA 3F3SA 4GMFA 3V34A 4ALIA 4R3WA 2BMVA 2I34A 4KQHA 3PQ4A 2Z3VA 4NE7A 2F1OA 4MJ3A 2GLTA 2H4HA 1D4AA 3WBJA 4JJFA 1XJCA 1ZM7A 2IV3A 2VJOA 1G6Q1 2X22A 3MRVA 4MTCA 2G7ZA 4WJLA 1DC3A 4QBGB 1FQWA 2DFKB 4L8LA 1Z68A 1ONOA 3L0PA 4L0QA 3H18A 4CLXA 4G2NA 3N2GA 4WZ6A 1JJBA 2BTQA 4ZAYA 2DBYA 1UT6A 2RFLA 1E9BA 5FI0B 5LQDA 5KKAA 2ZIUB 5DBHX 5TF4A 1L5HA 1SAYA 2PL5A 4LMRA 5D1NA 4TXHA 2IOHA 1W1WA 5AJVB 4ZDWA 5ALFA 4DLAA 4R01A 2ECOA 3PWTA 1NUAA 2DLDA 1EG7A 3B5IA 3CLTC 4LMAA 4X6YA 1V1JA 2R1TB 4UDYX 3P9IA 5AQ1A 4OQDA 1JTEA 4MRPA 2J46A 4PAGA 2R6DA 1PZXA 1SCJA 4EEKA 3J7AC 4P0PB 2H2WA 1JLMA 4OVKA 1RJWA 1IONA 4MB0A 1JFTA 1T9CA 3CUKA 2DQSA 2PV0A 3PGXA 3CKLA 2HLDD 1TYZA 5TVKA 3TIVA 4CMCA 721PA 4AQ7A 1I0LA 1OX4A 1NBME 3GLFA 4CT5A 2VDRB 1BG6A 3C14C 3IT1A 3PPXA 2C7VA 4MI9A 4H0NA 1TKCA 4W5HA 3F67A 3BQ9A 2D1RA 5KOJA 4D4KA 3GJ3A 1B0UA 4DIEA 3M6XA 1Z25A 4QFMA 1TADA 2JKVA 2OWDA 2RHGB 4GZLA 2WOOA 3EXFB 1WKVA 3MYYA 4L75A 5A1JA 2G63A 2HA0A 2W2XA 2IQ5A 1ZWLA 4RV5A 3ZIUA 4LZWA 4B34A 2JEOA 3D31A 3IQFA 4ZCMA 3R20A 1LK7A 3B20A 4RJJA 2REBA 4JI3B 3SQWA 5GJBA 2P2CA 3AF1A 1DT5A 3PDHA 4IJ5A 1ZC3A 1SCKA 1VBFA 1P2BA 1NVUQ 2HHJA 3FDIA 4RMGA 5G4KA 4U2EA 3VMFA 2P65A 1ZINA 4GOND 1B2LA 1JQEA 3MMNA 4CEHA 1AHNA 2G0TA 2FSVC 4AMGA 3SHFA 2WK1A 1CR0A 4IDEA 4TVKA 3KAPA 3D6TB 1O6FA 2NPOA 3OZCA 1N75A 3R8FA 2YIVX 1JPVA 3PR2B 4GBJA 5TF0A 2WIBA 3MPUA 1TEXA 1E2LA 4GF5A 4DCCA 2DX7A 3GV0A 1P6UA 3TAUA 4FHCA 1SHKA 5K99A 3CY6A 1RC8A 1L8AA 1RVDA 1IPHA 2PMEA 2CJWB 2GARA 3GLIA 1TKAA 3S1AA 2BKLA 1RMYA 4YJ2F 5C7LO 1V8PA 2DFVA 4TTSA 5L3SA 3D4NA 3DNMA 4OYRA 3GP8A 5A0TA 1E0DA 1GAXA 3VU3A 2VRCA 1CUEA 3GX1A 2Z43A 4NYJQ 5KSWB 5DRYA 1ZESA 2B9VA 3LZDA 5FF9A 1AVTA 1YUMA 1BS1A 3H5OA 3KKLA 2GYWA 2WEKA 4JB8A 5CT9A 5DEIA 4CNQA 5IZCC 2UUBB 5JWOA 4LXXA 2TSYB 3OCJA 3KQKA 4IICA 3HH8A 5CVDA 3AWIA 1CS0A 2PA3A 1T2UA 4B3XA 3M6FA 5BNIA 2XF8A 4U0JA 3JWIA 1ULTA 2ONJA 2HDWA 2NPIA 2NUAB 4C7BA 4OHRA 1DO8A 2ZS9A 3DFMA 3QVGB 3A25A 1T9HA 3ZHVA 4PX2A 5AVSA 5L45A 1RBYA 1U0FA 1USVA 5C8YA 5I7OA 5IT4A 3GLFE 3BRSA 2HPAA 1FFBA 3GLHA 2XEXA 4IVPA 1P18A 3BIWA 1IZ7A 1IZZA 1T4MA 1CKEA 1RHJA 1XZ8A 4II2A 3UC5A 3VU9A 4B8YA 5IXSA 3EWNA 1Y5NA 4S1NA 1J0CA 5EQTA 3RVJA 4J0EA 2GNPA 3DL2A 9GPBA 2YY6A 1MEEA 4ESEA 4QOIA 3ZHOA 1P17A 3PUYA 3P26A 4BO7A 2RCYA 4UBNA 3DZIA 1CZLA 1SU8A 1KAHA 1YDWA 4LZAA 1ZSNA 3R6DA 4NV1A 2C54A 5SZHB 3RBZA 2NP6A 2GJ9A 2GK6A 1DX9A 2FPWA 3ROGA 4AX4A 1Y4UA 1ZI9A 3AEYA 3DVLA 4WCDA 3SS7X 3CVOA 4EHNA 3TOZA 1BYIA 1B42A 2C84A 2IJGX 2OV3A 1JV2B 3AJ8A 2OFFA 4F1JA 2GPSA 1HEYA 2GUWA 1EGQA 4LI0A 3MWFA 3KT6A 1NVVQ 4ZANA 3UZUA 4AG3A 2EWMA 2I1WA 4IXNA 1K63A 4JVSB 3EXHB 3TKLA 4ZJZA 3E9YA 1CQIA 4B35A 1Z75A 3HEBA 1IVYA 4Y9SA 3IQDB 1ONBA 3A4LA 3EXG1 1GIAA 1N5IA 4TTAA 3QOXA 3ESAA 4LRQA 1GSOA 4Z3DA 3NALA 1MB2A 3ENZA 1LVHA 1T3HA 1JZQA 3MT0A 2FR0A 4C0LA 1ACMA 1MIHA 3B6IA 4H59A 4Y2UA 2YWRA 3CIOA 4RZXA 1I36A 4JSYA 4QG3A 4E5NA 2QRVA 1OH8A 4YP9A 2I66A 3IV9A 3K1TA 4ZI2A 5KB3A 1MP0A 2GZHA 3GLIE 4UU1A 3ZCVA 1SK9A 1WW8A 2X8JB 3FCOA 3PR3A 3RAPR 4QYWA 5IH7A 4XGRA 5ER6A 1PFYA 3U4IA 2FZVA 2G76A 4B1FA 4UVEA 4WJZA 1L9KA 2AZDA 1AQIA 3OQOA 1JHMA 3G82C 1U9IA 2VRCD 3I9OA 1ZJ6A 1J0EA 2G6TA 3DL4A 4DN6A 1UFVA 1LBQA 1VDMA 3NZEA 5I4KA 1P7PA 3GELA 3PFGA 1TUGA 4EGFA 1C0IA 3H0EA 3HHPA 1RE1A 3IMGA 3KYCB 1DG3A 3GZNA 3KQTA 5THKA 1OLUB 3WDMA 2Q1UA 2HA7A 2QZSA 3VR5A 1JEQB 1SIUA 2QJRA 2P5YA 4ESHA 3JYPA 4BE4A 3ER9A 1ZUNB 2GAJA 2GVDC 1PTJA 3U26A 4F6CA 1O97C 4PZLA 5DW0A 2HSZA 1RMTA 2JHGA 2R5WA 1GCOA 1WSBA 1M2NA 1M9NA 1EI9A 1RJDA 4ZDKA 1Y1KE 3GLHE 3B36A 3M34A 2COKA 3I9V6 1YQEA 1RKXA 2WSBA 4O2AF 5K8UA 1IG0A 2B30A 4KVAA 4MWCA 5JYCA 4BC0A 3W3AH 4QQRA 5LUAA 3WMXA 3F4KA 2QAIA 5AHOA 4IILA 3A1EA 4RD2A 2V97A 3PYLA 5PGMA 4YYEA 4BX0A 1SXPA 1SVIA 4RW0A 2CK3A 3KJHA 4PEVA 4TVOA 3R8XA 2V1UA 5I48A 3VKUA 3SZGA 4AX8A 3SS8A 4F60A 5AIBA 3B3QA 4PIMA 4QELA 1R9NA 2NW6A 4JC0A 2O8FB 1J0XO 2M6RA 3K05A 4DR2B 1QQBA 3CZCA 4I1PA 2CV1A 2ON6A 2XD9A 4N7RA 1EJ6A 4BJ3A 3WOHA 3WQRA 4C03A 1U63A 3OD5A 1SUEA 3QH4A 3ICEA 1KFEB 1FNSA 4NMWA 1NONA 1A8IA 4U8HA 1BJTA 2W83A 5NLLA 5BW6B 3EIFA 4XB1A 1O6BA 3K9NA 5LKRA 1GKLA 1R6TA 1Z12A 2VJBA 1ZMRA 3GFRA 1H5UA 3LUFA 3NOXA 1OILA 4OXQA 4RXUA 2EATA 4RF2A 4BLWA 1W8IA 4HGNA 3O93A 4YCDA 2HHLA 1UM9B 2QL9A 4QBTA 2VT3A 4NI5A 3DVAB 4GRDA 3EC1A 5A5GA 2Z5VA 4GI1A 4BLPA 1B8VA 1XCMA 3HCEA 2HWWA 2Q5OA 4DILA