4JVLA

Crystal structure of human estrogen sulfotransferase (sult1e1) in complex with inactive cofactor pap and estradiol (e2)
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
292
structure length
292
Chain Sequence
NSELDYYEKFEEVHGILMYKDFVKYWDNVEAFQARPDDLVIATYPKSGTTWVSEIVYMIYKEGDVEKCKEDVIFNRIPFLECRKENLMNGVKQLDEMNSPRIVKTHLPPELLPASFWEKDCKIIYLCRNAKDVAVSFYYFFLMVAGHPNPGSFPEFVEKFMQGQVPYGSWYKHVKSWWEKGKSPRVLFLFYEDLKEDIRKEVIKLIHFLERKPSEELVDRIIHHTSFQEMKNNPSTNYTTLPDEIMNQKLSPFMRKGITGDWKNHFTEALNEKFDKHYEQQMKESTLKFRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Estrogen sulfotransferase
publication title Mimicking of Estradiol Binding by Flame Retardants and Their Metabolites: A Crystallographic Analysis.
pubmed doi rcsb
source organism Homo sapiens
total genus 113
structure length 292
sequence length 292
chains with identical sequence B
ec nomenclature ec 2.8.2.4: Estrone sulfotransferase.
pdb deposition date 2013-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4jvlA00
3BERA 3RS4A 5B57C 2XZPA 4NYIQ 2VBCA 5IHPA 2XITA 4GOKA 3D8BA 5FTMA 1AKEA 1C9KA 4M1TA 2WWYA 4ZO4A 3ZZTA 4RFSB 1OB5A 4URVR 3OEED 2VHJA 2FFHA 3WNDA 2Q0HA 3K09C 3NC0C 2RGEA 3O8RA 1G4UR 3I8XA 3CZQA 3QXCA 3PEUA 2FSGA 3P1JA 4B47A 2V6IA 3R9XA 1Q1BA 3TW8B 2XNSA 2WAXA 1TQ4A 2ZRMA 4HUTA 2V7QD 5IRCD 4N0EA 1NMYA 3CZPA 2KSQA 1GNRA 1EWQA 1VIAA 3ASZA 1L2TA 5SZHB 2PL3A 4B74A 4KI0A 1W7AA 2P6RA 5EP2A 3ZQJA 1Q44A 3BORA 3PEYA 4TYWA 221PA 1OHHD 4A9AA 2FMXA 4BWYA 1XCGB 3AGPA 3QIAA 2XZOA 1JECA 1NKSA 3FMFA 1JXMA 2NIPA 4NKRA 5BQ5A 4N0DA 3KJIA 2QEQA 1ZD1A 1NMXA 4HAUA 3RRMA 3BH7A 2E9SA 1OF1A 2W2TA 3GEEA 2F1HA 3WMFA 1RRGA 4D0NA 521PA 4D4LA 1NVVR 1K8RA 1WMSA 4RKEA 5KSZA 3LRPA 2IS1A 3T35A 5TMPA 4NCKA 2WJIA 4HLQB 5EZ5A 3RHFA 1XEWY 4HDQB 3B6EA 4X8LA 2OESA 4CEIA 4NCJA 1AS3A 3PVSA 5FOXA 1II8A 3MAAC 5FOVA 5J5CA 1BYUA 4RZUA 3VR1A 4ZDIA 2FV8A 1GL6A 2G6BA 4OI0A 2W0MA 4CEJA 1NLYA 4BFXA 2Q9BA 4GSYA 5JJIA 4LHZA 4UXHA 1XU4A 2AR7A 5H8WA 1E2KA 3IO3A 1WE2A 1SKQA 2PZFA 3W5IA 3OZXA 5P21A 2AHOA 3GLFB 4ZKEA 3M6AA 4JT4A 1DOAA 1XD8A 4JLBA 4EQ6A 3TSOA 1KOFA 1ZM9A 4OK6A 5K8UA 1ZYUA 5KNCA 1NN5A 1SXJB 3A1TA 2YC2C 4WVFA 1DELA 1KAGA 1UDWA 1TF5A 5C46F 4GMXA 1AQYA 4YMWA 1U0HC 2XAUA 4JLAA 2JATA 4LJ7A 5JZVA 3CR8A 4JLDA 5EUQB 2CL7X 1DEKA 4Z1MA 2DWQA 3VNVA 5E4FA 3FFBA 2I1VB 1FW6A 3BD9A 5F2EA 3KKPA 2R6FA 3EZFA 4BLRA 1ZP6A 1EFRD 4HB3A 4PQFA 2A5YB 2VO1A 1EESA 4FMBB 1E9BA 1IXSB 4Z8XA 2DY1A 5FR2A 1T91A 1TF2A 1UKVY 2DPXA 3HPRA 4QXAA 5TDHA 2EFGA 3NIBA 5FPSA 2C9CA 5JRJA 1G5RA 1U90A 1FPMA 3GLHA 4Q47A 4MUAA 3AKDA 4P3YA 4YLGA 2YWHA 2C9YA 2P2LA 1SHKA 2JJ1A 2ZYVX 3KFVA 4RSGA 4ZDWA 4V0ME 3NC1C 3U61B 1KI2A 2Z6VA 5JECA 4FCTA 3EW9A 5H70A 3SQXA 3X1WA 1NN1A 1DAFA 3EARA 4OQXA 2IYLD 4MRRA 2YC4C 1RJ9A 3NH9A 2CXXA 1JR6A 2PZEA 3IDQA 2GEUA 3L0IB 3PCRB 1AGPA 4UXIA 1NG9A 4KFTA 1RRPA 2BDTA 2FU5C 1ZW6A 2QP4A 4N1AA 1R0XA 1E79D 1NMZA 4GOXA 3DMDA 2EWWA 1FX0B 1XBTA 1Z22A 3CKLA 1NSTA 1ZD8A 4EIWA 4ZIRA 5EE5B 3TW4A 5GADl 1G8PA 3ZYCA 5FPYA 3C41J 3FOZA 1P73A 2WOJA 5G3ZA 2QBYB 1JB1A 2ZSFA 3PIRA 2F9MA 2FOLA 3B7GA 4KHZA 2KBFA 2GNOA 4XWOA 1OFUX 3CRVA 4IHQA 1FOEB 2EU8A 4TQAA 1D5CA 1XTKA 3OFNA 1IY1A 4P4TA 4TN1A 1NLFA 4G5OA 1OH7A 1IN4A 1ZAKA 5GJCA 3EX7C 1YZTA 2GCOB 3IBYA 1RYFA 1Q3TA 1XJQA 3WMGA 3DL0A 3A4MA 4IVRA 4B32A 4DEXA 5CB6A 4LBZA 4KFSA 4MGIR 2GZHA 1TU4A 3K0AA 1GUAA 1Z28A 4UJ3A 4ERNA 3BFKA 1Q1EA 3OESA 3FHTA 3BB1A 4GDFA 1YE8A 5DHFA 2REBA 2IBMA 5LBIA 2YYZA 4O0MA 3CNNA 4HLCA 3ZJYA 4LDJA 2J7PD 4QGFA 3QNUA 3VAAA 1OXUA 4C30A 1M2OB 4A6XA 1L4YA 3KQHA 3CO5A 3ICEA 2CEAA 4GP6A 3SN6A 4KVGA 4YMTA 1HE8B 1ZC4A 2GJKA 4BZXA 2NQ2C 3VMFA 1E9DA 2JAQA 1KY3A 2VSXA 4KBFA 4BLQA 4F92B 1G20E 2H18A 1LS6A 2ZTSA 3BC1A 4YQFA 2WOOA 2ODWA 3E5HA 5JI3E 3TUZC 1XZPA 3K1JA 4E09A 1SQ5A 4B48A 4KITB 3WYGA 1VG9B 2JLRA 2ATXA 4M1OA 1SVLA 1E2QA 3QOFA 1N25A 3U3MA 4XVQA 2BJWA 1J7KA 1KSHA 2J45A 2ZRHA 3MSXA 4IOJA 3D3QA 2XB4A 4RCZA 1G16A 1E4VA 1ODFA 2O0JA 2OLKA 1GILA 1KKLA 3CONA 1CJKC 2FA9A 4OHVA 1VDZA 1CBUA 3GJ3A 3WYFA 4IEIA 2O5VA 4MKIA 5EP3A 2OEPA 3OIWA 4JVSB 4PX9A 1QHSA 1XWIA 4OQMA 3EPKA 2BBOA 5JJLA 2F1IA 3I32A 3CLVA 2DFTA 3QXJA 4WBSA 1NVUQ 1Q1ZA 2QMUA 4J0QA 3PXGA 4AG5A 1OH6A 4QRHA 5F9HA 1V5WA 3LVRE 2MMCA 1W2GA 4JS0A 2BEJA 2AWNA 1UBFA 3WP1B 1II0A 4Q19A 4CT4B 2KE5A 2ZJOA 2D2FA 3A4NA 5H68A 4D4MA 2IXFA 2P5TB 5D3QA 2DCUA 1KI6A 2ATVA 2ORWA 4JLMA 4Z1MD 4CEHB 1MT0A 2H7VA 2ZE7A 3VU9A 4EAQA 1IY0A 1R8SA 2G77B 1OB2A 4IOKA 5FPKA 1TEXA 4B3FX 2R6CA 2ZRIA 4B35A 4DDWA 3FHCB 4BFYA 2BCGY 3LY5A 1DAKA 3A1VA 1P7CA 1XP8A 2W6JD 2ZROA 1E99A 2XX3A 3KXLA 3TAHA 3BBPA 4DZZA 2D2EA 1Q21A 4NYJR 4RD0A 1XPOA 2PT5A 1P61B 1MO5A 1KK0A 4A15A 1QHYA 4IFEA 1XJCA 2JJ1D 2IC5A 5HTKA 1AK2A 5FTNA 2FSFA 4GP7A 2IUTA 4JLKA 4QG7A 3T12A 4JLPA 3QBTA 4A82A 4RY2A 5FH9A 2RCNA 2QROA 3C5HA 4EJSA 1H8EA 2YOHA 1V43A 3KKOA 4FMCF 3QPVA 3TBKA 3BGWA 4C3ZA 2ONJA 1G41A 3UXMA 3I4LA 3EPJA 5EXSA 1E94E 1U99A 2WM9B 2ZM5A 1CJUC 4QBGB 3L82B 1Z5ZA 1FNNA 3QUSA 1CULC 1W2HA 4KO8A 3GLIA 1NSFA 1QF9A 1XRJA 8OHMA 3DO6A 2YVUA 1GRRA 3WHKA 5HZHA 3U5ZB 3I5XA 1ZIOA 4FXPA 4Z54A 1ZD9A 4A92A 3KUDA 4TTQA 5HE9A 4UJ5A 4G3XA 2X77A 3OFND 3BJIC 5JWOA 1EFHA 3VKHA 4TSFA 3PQCA 4EDHA 4XOIA 3IO5A 4LPSA 3UMSA 2Q21A 2VP9A 5L3RA 5M04A 4JLVA 4DLUA 2PT7A 3D31A 4BRWA 2QM7A 4BEJA 4B43A 2IWHA 2ZJAA 2F6RA 3PUZA 4OKSA 1U8AA 5J47A 3MG9A 1II8B 1G17A 3PR1A 4FWIB 1XD2A 3Q8XB 3AKEA 4JL6A 3T5GA 4KBGA 5CB8A 2E1RA 3EA5A 3VX3A 1W1WA 4B3BA 1S1MA 2H17A 2CNWA 1NN3A 2AD1A 2RHDA 3CF0A 4Q1FA 5CLLA 4EPTA 4HZUA 2BMFA 3CNOA 5EE9A 5AJYA 5FFMA 3ADCA 2XB2A 3WMEA 2GKSA 3RWMB 4B2LA 4QBHA 1VCIA 4BRUA 2QL6A 2XNDA 1M7BA 2H8KA 4PFSA 5KSOA 4BFZA 3K0SA 3WY9A 4KODA 2R65A 4I99A 1AGRA 2ODEA 2WWWA 3NH6A 3O8CA 4RD2A 1SHZA 3W3AA 1T9HA 4TYPA 1SVIA 1T5LA 4ESHA 1Z0DA 1IN8A 4LJAA 1VTKA 2EVWX 5LB2A 3X2SA 3W34A 2ZYTX 4HB4A 3AF1A 3GJXC 1YR8A 4I1VA 1WXQA 3SFVA 3GJ6A 3IQXA 3QF4A 2PCJA 1XMSA 4XJXA 3VQTA 1FP6A 3TNFA 3GJ0A 5G3YA 2CHGA 5G40A 3AVTA 1ZNXA 1WP9A 1M1YE 2Q3HA 1VG1A 3KQKA 5FOSA 2F3TA 3C14C 3CRRA 3TR0A 4DBLC 1H8HD 2F1RA 2ZE8A 2V3CC 1W36D 2ZI5A 4C0JA 3RRZA 5KDDA 2WVJA 1US8B 2D7CA 3GLHB 3RSLA 3AVVA 3K70D 4PC2A 1XZQA 5CM8B 3WP0A 3KKNA 1CKEA 3I1FA 3EASA 4HYYA 4TLAA 2J5XA 2RH5A 2Q3FA 1Q3HA 4O2LA 3U4QA 2QSZA 1XB2A 1Z47A 5JHHB 2FF7A 4BFVA 3KTAA 1T3HA 3MJHA 2ZJZA 4PXAA 2ZAMA 4LX0A 5TV2A 4EJSC 2HLDD 4DRZA 1RJ9B 5JRZA 1F48A 2BEKA 3MWKA 4LHWA 4M9QA 3LFUA 3Q5EA 5CK5A 1A7JA 3H0KA 2R6GA 4W5HA 4UNQA 1GP2A 5L3QA 4OI2A 4B33A 1AIPA 3HR7A 3IPXA 4KVAA 3U7EB 4ACAA 1UKZA 2L0XA 3EIEA 1DADA 3GJ5A 2R9VA 4RKFA 2C95A 2ZU6A 5AJXA 5BYJA 1SULA 2P6UA 2ZI7A 3NEJA 2G88A 3GFPA 1K5GA 3DPUA 3QEOA 3B9QA 1SKYB 5DO9A 3FDIA 3TLXA 1VPLA 2CVFA 2JDIA 3LW7A 1WRBA 1J70A 1E1QA 2GF0A 2GDJA 3PG5A 3OE7D 4LOAA 4EPYA 2P67A 1S96A 3THYA 3ASYA 1TNDA 3LVQE 2C78A 3N2EA 1IJEA 2FDCA 1H8ED 5JEEA 2ZUDA 2LKCA 3SDZA 3SR0A 3IQWA 1NN0A 2FWRA 2QAGA 1N5LA 3KDSE 1F60A 3OF5A 4PO8A 5FOTA 2DYKA 4QHYA 1J2JA 1N5JA 5JS7A 4DXAA 5HR5A 3EWSA 1E4YA 2MSEB 3GFTA 2FG5A 4PHFA 1J99A 2GVZC 2AKAB 1GIAA 4MRPA 4EFMA 1E69A 1BKDR 4B3GA 1M7GA 3E70C 3P27A 4FWTA 3A37A 3B13B 3AVUA 4JBYA 1KIMA 4OBEA 2O0HA 1G3UA 2V6JA 2CE7A 1R5NA 4Q4HB 4QM7A 3BFVA 5E7MA 4A8JC 2OFOA 1XTQA 1UFQA 5AJVB 5IT5A 2ZS9A 4OK5A 2BMDA 1N0WA 2NMVA 4P4SB 1EFTA 1AA9A 1CXZA 4U00A 1GFIA 4LJ8A 1X8KA 3QY0A 3B1XA 1YHNA 2YJTD 1T4GA 4JKIA 3ZS8A 2RGDA 2J3EA 2ZITA 3BXZA 2CL6X 4A2WA 4C9BA 5FTJA 4RZ2A 2HYDA 4LRWA 4Q7KA 2GETA 2NO9A 1NG1A 4DLRA 4URXR 1KJWA 3P20A 3DKVA 3P4YA 4WA7A 1VCOA 1VG0B 1IN5A 1KK2A 3M1IA 4JSYA 3MMPA 5DI3A 4EPXA 4EPWA 1Z0AA 5JWRA 2GVDC 1U98A 1HH4A 2X2FA 3NVAA 4DLZA 4LHYA 1DAIA 2HT1A 1TQDA 2PLFA 5AUQA 4B44A 2ERYA 1A5TA 2WWHA 2CNWD 2MSCB 3AKYA 3GLGB 3IIKA 3PUWA 1NLZA 4Q4AB 4CIDA 2GTPA 5FOWA 3GJ8A 4L9SA 5J4LA 4JIMA 2ODNA 5CITA 3UWKA 1XTJA 1E0JA 2XNDD 3MJRA 2QGNA 2RMKA 4V0MA 2GILA 4HB2A 3X1XA 2JGNA 1G8HA 2GHIA 4R9UC 2ZYWX 3R7WA 3UIEA 1GITA 1YZGA 3HDTA 1P9NA 3PEVA 1Z07A 3G0HA 1U94A 4TWZA 3DOFA 2OM2A 3MUFA 4GOJA 2FEMA 4DCSA 4XVUA 2G1KA 1QZXA 3A58B 3EZ9A 5JEDA 3I73A 1R5OA 2P6NA 3LXXA 4KYUA 3RANA 2RKOA 5AR1A 4HATA 1Z6XA 2Q6TA 3Q7QA 2SHKA 4CW7A 5DNYB 4KLNA 2Q3MA 2WKRA 5A5GA 3MGCA 5C4MA 4DSUA 4GT1A 1X86B 4RD6A 1EFRA 3DMNA 3JZMA 2GXAA 1A82A 3LBIA 5FBQB 4US2R 1P62B 3PENA 1K5DA 1JAHA 4X8MA 2XSZA 3VX4A 3MWYW 5JCPA 2R2AA 3SOPA 4W9MC 4D6PA 3PITA 2EW1A 2TMKA 3G82C 1ZM4A 6Q21A 1ZC3A 2NG1A 3UKDA 1GL7A 2EFHB 2RB4A 3O8BA 4LJ9A 1E3MA 3THOA 2RGBA 2V1XA 2ZANA 3FHOA 4KSCA 4JSTA 2CL0X 1KMHA 2VF7A 5CYPA 1OKKA 4C7OA 4OL0A 1NJGA 3I61A 3U60B 4CZ2A 1C4OA 2XTMA 5FOUA 2MMGA 5E7JA 2JLXA 2O8CA 2ZI6A 4PQRA 1KHTA 1RRFA 3FMIA 4QJ4A 5JFGA 4ASUA 4NHOA 1UEIA 1W4AA 3SC3A 4XIGS 1QHHB 4IJMA 4RD1A 1E9RA 1XDBA 1W5TA 3AF3A 4FW9A 4JVLA 1E79A 3BH6A 3GLIB 1JR3A 1U0LA 4HAXA 1W4CA 4URUR 1Z0FA 4AIIA 4JJKA 4MYTA 3K0FB 4H9GA 3DEFA 4Q1EA 2O8BB 4DB4A 2YINC 4ZCIA 3NEYA 4US1R 3EZ2A 2ZI3A 2BWJA 3L0OA 3LQRA 3X1ZA 3QKSA 4II7A 5GJWC 4GI7A 4DDTA 2JDID 1E1QD 2AKYA 2DFKB 4BFUA 5FUWA 4L5BA 1DAMA 3HJNA 1NVVQ 5TB5A 2O8EA 1NIPA 3CRQA 2D7DA 4NCHA 3TUJC 1KNXA 4NMMA 3P4XA 3L0PA 4JYBA 4RZXA 1P9WA 3ADDA 3AVQA 1G7RA 4NE2A 3RS3A 1GDDA 5DSZA 4MA4A 3WHLA 4B2IA 1XFAA 4HEJA 4Q21A 5SZKB 3FKQA 1OXTA 2PEZA 5L3SA 2AD5A 4D26A 1F5NA 1MH1A 2B21A 2J7PA 3I5YA 1S8FA 4PO9A 1H65A 2AFHE 1J90A 2OXCA 4M1SA 1ZU5A 4A8JB 1G8GA 1GWNA 2R44A 1M34E 4S35A 2VP0A 1BYIA 4IDOA 2O8DA 4G0NA 3L2OB 5CJPA 5E3HA 5E7IA 4F4IA 4JBXA 3W8NA 2JJ8A 4MYCA 2F43B 2IWRA 4R98A 3AEZA 3A8TA 3CPEA 4FMDB 1KAOA 1I2MA 2GJ9A 3AVXA 2H16A 2QG6A 4M2LA 2O0KA 4LBYA 4HLUA 2EYQA 2ZI9A 2ZJBA 2GRJA 3QKRA 4LY6A 1QVRA 1SGWA 3ND8A 3B5JA 3U3OA 2LWIA 4MDEA 4DT1B 1E32A 3KUCA 1ETUA 5K8IA 2C04A 2GESA 2HJGA 4CRWB 1EG7A 3AVWA 3BH0A 3GPLA 2PX0A 4LJYA 2VF8A 2CLCX 1CEEA 1VKJA 3M0EA 2X8AA 5HCIA 2J41A 4YONB 4FCVA 5IF9A 2QTHA 3OHMA 5DN6D 4DCVA 2QRZA 4LYAA 2V54A 1VYVA 4GFDA 2ZS7A 3FMPB 5BWMA 2NGRA 1Z6TA 4DLYA 2AXNA 1MABA 4JLNA 1M8PA 3I8SA 3ADKA 2VP5A 3FGNA 3JVVA 2CJWB 1EFUA 3ZH9B 2BBWA 1BO6A 3FWYA 5HPYB 2OLJA 4PPGA 1IONA 2A78A 1KO8A 3RS0A 3EPLA 3UANA 4IRUB 1WQ1R 1OXXK 4Y0VA 3T06B 1BMFA 2XSZD 1S9DA 1DBSA 1N6LA 3RRYA 2QP3A 1N0UA 2W6JA 1W44A 3IPYA 1ZJ6A 2Q9CA 5JS8A 1TTTA 3ZLJA 1DS6A 2OSBA 2NPIA 1G7SA 1KK1A 4D4KA 4ARZB 3FKSD 5FBVB 2ZRNA 3H2YA 4GMDA 5JSZB 2O8FA 3IHLA 1OKKD 1JEDA 2AWOA 3R9WA 1UEJA 1N6NA 3K0EA 3E2IA 5EP4A 4A2PA 4C2TA 2IS2A 1G1MA 3LQQA 2OILA 2XXAA 2BC9A 4UNPA 1Q12A 3ZZ0A 1UJ2A 4ASUD 721PA 1RKBA 2IUSA 1VMAA 1OW3B 1I4LD 2NO7A 2J0SA 1VHLA 3EWAA 2IYYA 4QJ3A 2A3RA 2BV3A 3R8FA 1IQPA 4HUQA 5HZKA 3RS7A 5DH9A 1LNZA 1JR3D 3KB1A 5TVKA 4R2HA 4M1KA 2CCGA 2JLQA 3W3ZB 4C0SA 1UDXA 2ZRCA 2WWIA 3BB3A 1E96A 2FJUA 1DARA 4PC3A 2HCBA 5KSYA 4RJLA 1SZPA 4Q4JA 1X3SA 5LDDC 1XMVA 4IDPA 1F2UB 1TADA 2FNAA 4UNRA 4A0RA 2YOFA 4BECA 1XXHE 3B1YA 3KKMA 3DDCA 3AF4A 4LK2A 1UADA 2IT1A 3QXHA 1KO5A 1RRCA 3EXAA 3VFDA 3V4RA 3C5CA 1IM2A 1SVSA 2IYUA 4LHVA 3IIMA 5BN5A 1FNMA 1E9CA 1FTNA 1OLOA 2A5FA 2HT6A 4PR0A 4LHXA 3OEHA 1T0JB 4AYWA 3FMOB 4B75A 4D82A 2RHMA 5AK0A 5CDFE 2ZRBA 2J0UB 2XTZA 4IOMA 3VNUA 3OAAA 1FL9A 4HAWA 1ONBA 4X8HA 3RC3A 2YWGA 3U7FB 2ERXA 3MFYA 4Q9KA 4AURA 1JJ7A 3A1UA 1JR3E 2QPTA 4F38A 4QM6A 3SI7A 3E1SA 4H1UA 2F1JA 4TTRA 3B1WA 1CJMA 3SEAA 4OI1A 3QPUA 1TEVA 3SJBA 2B7BA 4OYHA 3THXA 3CF6R 3VKGA 2IYWA 4M9SA 4W5WA 2WV9A 5J4KA 1AJEA 2IHBA 2WZQA 2HXSA 4WXRA 4AD8A 2V1UA 4C0KA 4TT3A 1NNEA 3B9PA 4OHYA 2OZEA 1IXRC 3CIOA 1XJ0A 2QU8A 4LCBA 4PANA 3U7HB 4Q9HA 1AM4D 1E9EA 3OIVA 4KAXA 4BLOA 4TMTA 1Q57A 1NP6A 4AKHA 4UQOA 1KSGA 4NYJQ 2BM0A 4A0GA 3C15C 5FBWB 4XWKA 1OYYA 1FTSA 4W5JA 1WBDA 1H8HA 2QN6A 2H57A 1TU3A 4I4LA 2QNRA 1KKMA 1KI3A 3EZ7A 4BLTA 4DSOA 1T8UA 4M9ZA 1R5BA 2OAP1 3EIQA 2REOA 2IHYA 3H84A 2ZQ5A 2FN4A 2ZRKA 4R7ZA 1KO4A 5EQTA 3EC1A 3QKUA 3CW2A 1IHUA 3PV0A 1VECA 5LPNA 3ZD7A 4EKDA 1G64A 4IXNA 2O8CB 3JVUA 3X1DA 2PJZA 2ZU0C 4GPTA 3AGQA 4AKGA 5JBQA 1D2EA 1P2SA 1TPZA 4DHEA 2HLDA 5D3MB 3U6BA 4AWXA 4Q9JA 1G4AE 1E0KA 2ZEJA 4AKEA 2WAYA 1OH8A 3U3JA 2A5DA 3AVYA 2ZSEA 1QHNA 4RCYA 5B2ZA 1Z29A 1BMFD 2PMKA 2YZ2A 4MKHA 3VR4A 3CRMA 4MKFA 2UZ3A 5K8LA 1HT2E 1KYIA 2WJGA 4OK3A 3WYAA 4ZI3A 3WNBA 3ONWA 4DCTA 5DGXA 3ZDQA 1OE0A 1PLKA 4CGZA 1KDTA 3CUEF 3QKSB 3ND9A 3QG5A 5HE8A 3FPAA 2W00A 5J4VA 1T8TA 4TLCA 1LF0A 1KO7A 2G0TA 2VP2A 5DE3A 3VHLB 3CH4B 1VHTA 4NYMR 1E2IA 2OUKA 1ELOA 3OE7A 3NBFA 5CLQA 1OXSC 3LO5A 3TMKA 1E9SA 3KX2A 3Q7PA 3HU1A 4JJZA 4YC7A 2EYUA 4LYJA 2EQBA 2CE2X 4DJTA 1NY5A 2IA5A 1OYWA 2GCNA 5FL3A 1KMQA 3ZVNA 5EJEA 1QHXA 4LPKA 5KO2A 3U3KA 3U7GA 4DWJA 3B8HA 5FR1A 3ZVRA 4ILEA 4ITRC 1CR2A 5SZIA 1KZGB 2A9KA 5FBRB 1XTIA 1Q0UA 4EFLA 2A5JA 1CLUA 4AC9A 5B58C 3N70A 3EG5A 1T0HB 1NY6A 4FCWA 3IHWA 1I2DA 3QBVA 4MITA 2GBLA 1W0KD 1HY3A 4JZKA 1VIYA 3MLEA 4ESVA 4QGAA 2HYIC 4BGDA 3S1AA 1GTVA 4OJQA 3U44A 1IJFA 4HDCA 1MKYA 1KDRA 4XD7A 3NWJA 4CEIB 3SZRA 3IGFA 4B3DA 1K6MA 2FFQA 2ZJ8A 3VTKA 5KYKA 1BS1A 3LX8A 3SE0A 3OEHD 5FI1B 5B30A 4CEJB 1ESMA 1SVKA 3UATA 5CYOA 2IYQA 2OO7A 4QL3A 4RFSA 1NKTA 2HCJB 4XH9B 2R62A 1KNQA 2WMNB 3OAAD 4G5SA 3G5UA 5EP1A 3RS5A 3W5JA 2WICA 4NU0A 1BOFA 1HURA 2DFLA 2W0SA 2BMJA 4DSTA 3UG6A 4C0BA 1W36C 4EQ6B 1HE1C 2F7SA 4ZCMA 3K0CA 3FB4A 1G8YA 1G5PA 1II9A 2QY9A 3K70C 2ZRGA 2AK2A 1ESNA 2C03A 2V9PA 2B8TA 3EZ6A 4LGMA 4LSGA 3AM1A 3ETLA 2PBRA 5TARA 2BCJQ 2G0NA 4TLEA 3CWQA 5DI9A 3VR6A 1XEFA 1MABB 1O87A 4YDSA 5GJVC 3OIYA 1E2NA 4G1UC 2JA1A 4URYR 4O3MA 4TT3D 2CVHA 3H4MA 4IDNA 3A1WA 1HUQA 1YR9A 2N46A 3L0SA 5CJ2A 5FL7A 4C2UA 5FPHA 3R20A 4TMZA 2WWXA 3MWJA 3CX8A 4PZYA 4Q7JB 4TYQA 3RYTC 4FMDF 4TLBA 4DLVA 2VHTA 3T61A 3BK7A 4PC1A 4Q00A 1P2VA 2ZSAA 5CK4A 4TL9A 4V0KA 4PPNA 2CHQA 4B2PA 4XSGA 4ZPXA 1JNYA 1E6CA 4IVPA 3QEJA 2QMHA 2NO6A 4G5QA 1ZRHA 3V9PA 4HB0A 2VL7A 2X19A 4OQLA 3REFA 4C4PA 3RRNA 3AF0A 1B23P 1XD9A 2QPAA 2KBEA 4XSHA 1G6HA 1TAGA 1R0WA 1CJTC 3VR3A 4KSBA 5FPTA 4DDVA 2GJAA 2FPLA 4YDHB 4HUQB 2WTUA 2X2EA 2ZRPA 4PTLA 4PHHA 4WXPA 4ZIRB 1VCMA 3TQCA 4JVNA 3D6TB 2Q9AA 3ZGXA 2IXGA 3SHWA 4QC2A 3ICQB 1S9HA 1NVWQ 1E1RA 3KQNA 4B34A 2R6AA 1ZUHA 4NBSA 1U9IA 5AUOB 5SZJA 1G19A 3HWSA 2WSSD 1TF7A 4CT5A 3F0TA 4EPRA 3PUYA 1P72A 2RGAA 2RGNA 5JI2E 2YHSA 1F2TA 2QZ4A 5DYGA 4ZDKA 1P75A 1U2RA 2ZSBA 3SQWA 5GVRA 4AK9A 5KPDA 2VA8A 3K0AB 1T3LA 4M53A 1WF3A 2FE4A 1RYHA 3OIUA 2WSMA 3FTQA 3UMRA 2C96A 1YZUA 3GD7A 1R7RA 2OBMA 3QF7A 1JPJA 2ASEA 4LJ4A 1W4BA 1J8MF 1YRBA 4HAZA 3GLGE 1GOTA 1IY2A 3LXRA 3DKPA 4NPHA 3QXXA 2FSHA 2C99A 3H1TA 4P33A 4XTCS 1ZCAA 2OFWA 3SU8A 1M6NA 3F3YA 2IK8A 2WBLC 1OFTA 4AY2A 4TL6A 621PA 1KY2A 1S3GA 1IAQA 2DR3A 2ZRLA 1W46A 2G9NA 1LTQA 2Z83A 4XVRA 1AN0A 1N5IA 4ON9A 1E2FA 4ZCLA 3NXSA 4D0LB 3AKCA 2FPMA 1FX0A 3TRFA 3K53A 4XD7D 3HU3A 2UVQA 821PA 4ACBA 3IBGA 4BFTA 2CCKA 1BIFA 5EE3A 4KU4A 3WRXC 4CYMA 2Z4SA 2IW3A 4AI6A 3SBEA 1U81A 2JEOA 1D2NA 3QI2A 4LJ5A 3V00A 3BOSA 1MO4A 1YR6A 5CIQA 1DTSA 3NBYC 2RAPA 2BIFA 4OQFA 5A0FA 2XZLA 2J46A 3B1ZA 4M22A 3LDAA 4KJZA 3UWOA 4V02A 1CS4C 4FINA 3SBDA 1P2TA 1G8FA 1ZVQA 1FUKA 2ZYUX 3IKJA 4L9WA 2QENA 4K81B 5IDVA 1W36B 2JLWA 1G21E 2VIIA 2XGJA 1HEIA 2QUZA 4TL7A 2CLDX 3T34A 5EE0A 3K70B 5DN6A 2FFBA 4MUBA 2BJVA 4L8GA 2R8RA 1ZUNB 4JMPA 2HXYA 2AX4A 2J1LA 1FQKA 2I4IA 3R8CA 1UBGA 4B3XA 4ZKDA 3TSZA 4M21A 1G18A 2H1LA 1KI6B 3W8RA 3IILA 2JLYA 2FSIA 1OIWA 4PAQA 3VHXA 3VU9B 1W48A 5FL7D 4TYYA 2ANBA 4YMVA 3I92A 2HV8A 1JBKA 1XMIA 3QE0A 4ABYA 1EWRA 4RD3A 4L16A 4DLTA 1OFIA 4CF7A 1M7HA 1X8LA 2IEZA 3CR7A 4IVQA 4JKYA 4KXFB 4DEYA 3X1YA 3QJYA 1UAAA 4JVMA 1XTRA 4PQYA 2CLSA 4Q9LA 2ORIA 3AQ4A 4LUCA 4Q9IA 4D81A 4DC9A 3BFXA 1XF9A 1KZ7B 1Q1QA 2ZRJA 2ECKA 4OHWA 4UNSA 3ZZUA 4O25A 1JEEA 1KTVA 1XXHA 2GZAA 1X6VA 1N6IA 2OE2A 2OV2A 2W58A 3FKSA 3KXIA 4WIAA 4Z8YA 4E22A 4MGKR 5FUYA 2FH5B 2FGKA 1FMJA 1ZINA 2VHCA 4BE7B 3KXKA 2Z0MA 3GP8A 2NZJA 2W83A 1DO0A 2H5EA 4PAMA 4FI3C 1MV5A 2G3YA 3LD9A 3CPJB 4EJSB 3EC2A 2JIZA 2QA5A 4URZR 3EA0A 1XCMA 4PHGA 2QAGC 4PC7A 3ADBA 1OT3A 1E2EA 2ZI4A 3TIFA 1S3SA 2IF0A 2ZUCA 4BASA 2N42A 5CDFA 1XEXA 1Z3IX 3LV8A 1CR4A 1GRNA 4Q03A 1YVDA 1D2MA 1SXJD 1CR0A 4G01B 1WDTA 1E1RD 4YMSA 3LLUA 2C5LA 1KSFX 2PX3A 2BHRA 3GQBA 2QORA 2YWFA 3AUXA 4YXWA 5KHOC 3RDPA 1UBCA 1E0SA 4CEHA 2PEYA 3MCAA 3Q85A 2VHUA 3THWA 1TQ2A 4JL5A 4NP6A 4JLJA 4RVCA 1AS0A 4Q7MB 1XEWX 2AK3A 2G1JA 3S1AB 1A4RA 3TSWA 1DO2A 3CWZA 1VYTA 3WBKA 5KNBA 3EPHA 2GWHA 1NF3A 4KFRA 5TY0A 4NCIA 1SVMA 1XD2B 2CCJA 2GXQA 1OIXA 2ZE6A 3D7MA 4IDQA 3TH5A 5TXGA 1TQ6A 2QTVB 1QHIA 4KV9A 4QBFA 1FMLA 2A5GA 3I72A 2PCLA 4HZUB 1YRAA 1Z8FA 2JJ2A 4HSEA 4O2RA 4Q5IA 5HKKA 2WJJA 1Z83A 4IDHA 5KDLA 3GLFE 3A6PC 1P2UA 1E2HA 2ZPTX 2QQ0A 1Z63A 2IEYA 4OHXA 4M9XA 2P0EA 4B3CA 1G3RA 4ZI2A 1SXJE 1ZIPA 2OHFA 1HYQA 2UKDA 3PUVA 2F9LA 4OHZA 5JHGB 1XX6A 2VEDA 1N3BA 2K5UA 1U0JA 2OG2A 3SJZA 3DVLA 1G9XA 4GZLA 4TMKA 1QDEA 1R2QA 3L8ZA 1FZQA 3A36A 3V4FA 1RVDA 1Z2AA 4OQNA 4URWR 5LB4A 3KL4A 3LW8A 4NL4H 1CTQA 1Q22A 2Z43A 3W90A 1S4QA 4UXJA 4MYUA 4WAUA 3TAUA 2ODBA 2D4HA 2PZGA 3QF4B 3ZIAA 3GJ4A 4D0GA 2D3WA 4NYIR 4P31A 3AB3A 2XOKA 3RS2A 1OSNA 2IS6A 1OFHA 3GJ7A 1DG3A 3FYHA 4Q1AA 1TUEA 4QKQA 1KK3A 4PPFA 1BH2A 3L8YA 1LFDB 5DYIA 5BN3A 5J40A 1N6HA 1OXVA 2BBSA 1VYUA 4V0NA 3U4QB 1JQJC 1RZ3A 2RGXA 4UKDA 4IKEA 4YMUA 4QBIA 1EX7A 3PFIA 1COWD 1N6RA 3KTAB 1Q20A 4QNRA 5L8VA 4IXMA 3SYKA 4TQUS 3K9HA 3GEHA 421PA 1D8TA 1E0AA 1W0JD 3I3SR 2QAJA 2IF2A 1DG1G 2WPDA 5DHAA 4BLPA 3DM5A 2CK3A 5EUMA 2ONKA 4P0TA 1NVXQ 2GAOA 1SVWA 4ZV4A 4QNMA 4A6PA 2MSDB 5L3QB 4GL2A 3ZVLA 3TUIC 5EXPA 1DAEA 1X8JA 3CRW1 4A2QA 4A1FA 2ZR0A 2QQEA 1UPTA 2QI9C 4K46A 5AJWA 3HYRA 4TMVA 5DISB 1RC8A 3BWDD 1QRAA 3VR5A 3KB2A 2GEDA 4E03A 2VP6A 1GNQA 3NDPA 2DWOA 2XJ9A 3REGA 3RLFA 1F2TB 3FVQA 3ZQ6A 3LBNA 1OV4A 4M0LA 3K8YA 3HR8A 4XTRA 1C1YA 3RNLA 4TYNA 1R0YA 2VH5R 3EAQA 3HP1A 3ZVMA 3THYB 1G6OA 2OCYC 2JIZD 2JLSA 2VTKA 3TJZA 1G7CA 1LF5A 2JLZA 1FQJA 3GEIA 4GRAA 4BEBA 2A2ZA 2QAGB 3K9GA 4E5UA 2FEOA 3P26A 3T1OA 2RGCA 2WWGA 4C0AC 1CRPA 5AWFC 2ANCA 2IYXA 1US8A 4Q7LA 5BN4A 4E07A 1X1RA 4PO1A 4B71A 1KO1A 3NBXX 5KTYA 4QHTA 2IS4A 1NBMD 5UKDA 1E2PA 1KJZA 5EZ6B 2ZRFA 1ZM2A 2WJHA 2D74A 4YXWD 3ZD6A 4KLZA 1JAIA 1MR3F 2ZVPX 5EXXA 1GRQA 4M1WA 1A1VA 3AUYA 1F6BA 4KFUA 1ZUIA 1Y3AA 4TTPA 4C0LA 2GA8A 1W0KA 1ZCBA 1EXMA 4AG6A 4Z51A 4HDOB 2D06A 2YOGA 3HPQA 1NRJB 1QBKC 1ZNZA 1GL9B 5KU1A 1IBRA 1YJ5A 2VRWA 5AUNB 2NPFA 5BYKA 4HLUC 5DI3B 5JCZA 1E2LA 4X8OA 5ANRB 4DIDA 2ZXUA 1AS2A 3UPUA 3QG1A 2O52A 2B7CA 1FP7A 2JJ2D 4EUNA 3NTUA 4B73A 5HKKD 2IYZA 2GJSA 2ZUBA 4PAOA 4R71A 4HAYA 1LVGA 3LWNA 4Q1BA 3NKVA 4LYFA 1QHGA 1M74A 1P60A 4FIDA 3R7WB 4QHSA 4Q02A 4B76A 4LC0A 1WBBA 2DWPA 1NBME 1GZSA 4PHTA 4DKXA 1T5IA 2VPPA 5B64A 2ZRAA 1D6JA 1MRSA 3K9LA 4C0HA 4DLXA 1ZMXA 2JASA 3TQFA 3A4LA 2PMDA 3SNHA 3AVPA 4G5GA 4D80A 2DB3A 1JXOA 5G41A 4GBMA 4TLDA 1KI7A 1EFCA 4NCNA 2VYFA 3DZ8A 3KJEA 4HAVA 4Q4HA 4DIEA 2VQSA 3ZIAD 3DOEA 4Q1DA 3ZS9A 2BKEA 3BAFA 2WMOB 2HEIA 1JQLB 1YQTA 4DUGA 1YZQA 2XOKD 1W5SA 4DCNA 1RPZA 4P4SA 2W6IA 4Q4LA 4OI4A 5DIFA 5BW8A 1RFLA 1I4DD 1B0UA 1NIJA 3NG1A 3EIHA 4LYHA 1DPFA 1KGDA 1XPUA 2W2VA 4QGHA 1XXHB 4MKGA 5FTKA 1IXZA 3GMTA 4NYMQ 4NZYA 1PJRA 1KMHB 3Q72A 2GEVA 3B82A 4JYCA 4C7OB 4Q48A 5EE1A 1MRNA 1ZM7A 2PJRA 3KZ1E 2ZVQX 5C18A 2KI5A 3B2EA 3GLGA 3C8UA 4CVNA 2J0VA 2ZIAA 1KI1A 4G5RA 4Q4AA 1YZNA 3M4YA 2WPDD 3FE2A 2REXB 2CK3D 1HQCA 3SJCA 3PEWA 3BE4A 3KQUA 1Y63A 1LY1A 1PUIA 1XEXB 3LBHA 3TE6A 2C98A 2QT1A 2ORVA 2CMKA 3DZDA 4FN5A 1G7TA 2YWEA 5FI0B 4U02A 3MD0A 2P5SA 2CHVA 2C77A 1G3QA 2CBZA 5KUTA 4WZ6A 1CP2A 2OBLA 3QXSA 2F55A 3RAPR 1S2MA 4MRVA 5EXTA 3PUXA 1JPNA 4MYHA 4DLWA 1W47A 2B6HA 2GZDA 1AZSC 2WSSA 4M4SA 3THWB 2ZREA 4M1MA 5KOYA 3NBZC 2GAAA 3WXMA 2GK6A 2OAQ1 2GJ8A 4R2IA 2O8EB 3WBJA 4P32A 1NL3A 1QVAA 2FGJA 2IYVA 4RD4A 5KPJA 2BMEA 3K9NA 4DB2A 4ZDJA 1TL7C 1GG2A 1N5KA 3LX5A 4AYXA 2Z5FA 1CU1A 3QVVA 1EX6A 2ZJ5A 1RW4A 3QSYA 1ZU4A 1CJVC 1MOZA 5L3SB 4M1YA 3RVBA 4MRSA 3HYTA 1PUJA 4D25A 2J7KA 1ZNWA 2OCPA 3CBQA 3JZAA 3Q5DA 2EFCB 3N5CA 3W6OA 5FTLA 2QMOA 5JLJA 2O8DB 3AV0B 4IEEA 4DSNA 3Q9LA 2I1QA 3AVOA 3B1VA 5CM9C 4LV5B 5LD2C 1E2MA 1QHHA 4US0R 2ZJYA 1LV7A 4PSVA 3T15A 2N1BA 1R6BX 5HCNA 5JWHA 1T6NA 3MRSA 3BS4A 4LJ6A 3QKRB 3UMFA 3K0FA 2O8BA 2HDNB 3BB4A 3GCGA 2NO0A 3T1VA 4Q66C 1YKSA 4BQSA 4L4UA 1FFHA 1Z08A 3CM0A 1LW7A 1GNPA 2EFDB 1ANKA 4C0QC 2VHQA 121PA 1QG2A 2HJVA 2WWFA 2CDNA 1OH5A 2W2XA 2QTFA 3KFXA 3AP3A 3TVDA 4QJ5A 3W9YA 2HUPA 3GLHE 4PZZA 2IYTA 1E2DA 3LNCA 4IFBA 4P4UA 2WJVA 1GSIA 1WA5A 2IXEA 2VSOA 2YNMA 2QRNA 4TZ0A 1UKYA 2GXSA 2VLIA 2IUUA 4BFSA 2ZAOA 1CR1A 1L7VC 1T3SA 4IOLA 2OCAA 4LC1A 2UZIR 1AKYA 1MO6A 1ZBDA 2NOAA 2Z4RA 1P4SA 4LV8B 2G83A 2Y8EA 4I1SA 4JBWA 4A36A 2OFXA 3TKLA 5BXQC 1DAGA 4QOSA 4DUGD 4A8JA 1P3JA 5J4HA 1DVRA 5F3WB 4TZ6A 1EGAA 2B8WA 2X1VA 2W6ID 4S2EA 4NTZA 3ECCA 1N6OA 1XPRA 3IEVA 1J8YF 1ZNYA 3B60A 4MGYR 2J87A 2LKDA 4H1VA 4TL8A 4DVGA 2V8OA 4A4DA 4JLOA 2F43A 1PVOA 4POAA 5G53C 4BLSA 4L15A 1E9FA 2V55B 1SKYE 2ZETA 2BM1A 2O8FB 1N6PA 2ZE5A 3IUYA 2BBTA 2WIAA 3KJGA 1YZKA 2VSFA 2F3RA 1HT1E 5H1YA 2QSYA 1GKYA 4B6EA 2A30A 2ZR9A 1GKIA 2ZR7A 4DT1A 3KQLA 1FUUA 2XXAB 2FFAA 1KI4A 3F8TA 4CDGA 2KB0A 4WZBE 1KI8A 1R10A 3LA6A 2QGZA 3TK1A 1MO3A 2GK7A 1AQUA 2QE7A 4M8NE 3GLFA 3NDBB 4PSAA 2AN9A 1G291 2HF8A 3UG7A 5A4JA 1XCPA 1TMKA 2DHRA 2JLVA 1Z6GA 4EFNA 3HU2A 3VR2A 3U6KA 1SXJA 4Q01A 4XWAA 1OJLA 5JMTA 4BPBA 4GNKA 5IK2A 4DCUA 2BOVA 2FZLA 2WJYA 5FBLB 4AKIA 4BZQA 2EWVA 1R8QA 2V4ZA 3LLMA 4BUJA 4PC6A 1JI0A 2ZJ2A 1OIVA 2WHXA 2GBLC 1W49A 4MGZR 5K8TA 1XMJA 2CJWA 1P5ZB 1PLLA 4Q4JB 1YZLA 1E9AA 3FFAA 3AH8A 3TGPA 4LBWA 4DLSA 1F3OA 4NH0A 1CF4A 2GCPA 3RABA 1LB1B 4HZIA 4QGGA 5L3VA 2QMEA 4RZ3A 5E95A 4D4JA 1DAHA 1HQYE 4V0LA 1A2BA 2IL1A 3SS8A 2D62A 1NI3A 1OPXA 2PH1A 1Z6AA 3SYLA 4HLDA 3WNCA 3IEUA 4MQBA 5CIWA 1D9XA 4ARZA 3C16C 1PZNA 4NONA 5KNDA 1L8QA 5AJZA 1S1CA 5JSZA 3J81k 3MWLA 2LCFA 2J59A 4DDUA 2KJQA 1HTWA 1HA3A 3N2IA 3OEEA 4U5XA 3SHFA 2ZSDA 1Z2CA 2OT3B 2NO1A 4V0OA 2PLRA 3K0CC 2C8VA 3TR5A 1UKEA 2AFIE 5AUPB 1W4RA 2YKGA 1S0UA 5LD2B 4TQ9A 2XEXA 2DFNA 1KDPA 4LZZA 1X1SA 2QP9X 3THXB 2A7QA 2H92A 4EPVA 5J4YA 2EFEB 3UK6A 2V7QA 1L4UA 1GVNB 2NTYC 2OXRA 1XNJA 4I81A 4JT2A 3H86A 5DLQC 1KJYA 3O8DA 4I1OA 3SFZA 3NHAA 4F7WA 3NHBA 1CRQA 1NJFA 1N6KA 2J0QA 4HI0E 1OHHA 2QBYA 3QKTA 3BIFA 3SYNA 2E87A 4BFWA 2QT0A 1TX4B 1QG4A 2P65A 4TSFD 1VG8A 4NDZA 5F9FA 4PPQA 3LAWA 3VKWA 3T1TA 1Z0IA 1F2UA 2GCOA 1EK0A 4UNNA 2FZ4A 4JL8A 2AXPA 1SVOA 2C2HA 3K09A 1D9ZA 3L43A 4FD2A 5KSPA 1G3MA 3B78A 1WCV1 3CPHA 1CIPA 3P32A 2WKPA 2JCSA 1U8ZA 4PSKA 1E2GA 3CX7A 3U3RA 1G3IA 3B85A 5ELXA 5FUXA 2B92A 2WIBA 5C2JB 3AF2A 3LH5A 1UBEA 3C7KA 1JJVA 3QPWA 4KYIB 2DBYA 3IIJA 1Z0JA 1COWA 4Y0AA 4U7DA 4AYTA 1RIFA 2P3SA 1VCNA 1W0JA 4OJKA 3RWOA 4F4CA 1HV8A 1TUIA 2J0UA 2ZRDA 3BRWD 4N3NA 3CF2A 4IW3B 2QM8A 1YU9A 1PV4A 3W6NA 1GM5A 3AP2A 1UM8A 4W7SA 3QVUA 3GLIE 1KI9A 2J9RA 4D2IA 1KSJA 3AP1A 5JJKA 4F91B 1IN6A 1SXJC 1UF9A 4RFVA 4LI0A 1IN7A 3R9IA 1I4TD 1DE0A 4K8OA 2WKQA 3RSOA 2IX3A 3W6PA 1U9IC 3PJRA 2KWIA 3GFOA 3Q3JB 4GZMA 2VP4A 1AZTA 4MDFA 4F4JA 2GXUA 5KDOA 2RGNC 3A1SA 1R0ZA 5C1BA 2GF9A 1WB9A 5GJBA 3T5DA 4LBVA 2BKUA 4PZLA 4A0FA 5GVSA 4MH0R 4LWZA 3CX6A 3U2QA 5FUVA 1N0VC 3CNLA 1XTSA 3O47A 3C4JA 1A2KC 4F93B 2QE7D 3TVTA 2R6DA 2IYSA 2OBNA 2FX3A 2JLUA 2XJ4A 4Q1CA 2ZS8A 2AL7A 1E2JA 4A0HA 1YR7A 1E98A 4FMCB 3DM9B 4WOPA 3QENA 1O3YA 2IYRA 5F98A 4TMXA 1R4AA 1NBMA 2I3BA 3DHWC 3RC8A 1Z06A 2BVNA 5IK2D 4Q18A 1JALA 1P9RA 2XTNA 3WRYC 2OCBA 4B6FA 3F5FA 2C9OA 2QPOA 3CB4A 4BZPA 1Z0KA 5D3MA 3T1QA 1RE0A 1GAJA 2NZ8A 4I1UA 3SJAA 1PLJA 4WW0A 4LV6A 4KCGA 5C4GB 2RGGA 3KJHA 1Z6YA 4V03A 3KKQA 3CH5A 1LS1A 3QQ5A 1GKUB 1N2CE 1IOZA 2YV5A 3U44B 3I62A 4MRNA 1KDOA 1U8YA 1P6XA 1G5TA 4WZAE 2HF9A 2FPKA 4TMWA 1ZM3A 4QFMA
chains in the Genus database with same CATH superfamily
2VDWB 4JH0A 3D8BA 1QLWA 2I78A 1FJGB 1U04A 3ORFA 4RFSB 5BPHA 1X7XA 3L06A 3PGLA 3D6HA 4AP9A 4URVR 2X0EA 5BV7A 2D5BA 3U56A 2LP4Y 4C01A 2X9GA 3NC0C 2D00A 3KVYA 5DBEX 1G4UR 1UZUA 3O8RA 3HBMA 3URMA 3QXCA 1X94A 4XGKA 4B47A 3O95A 4PGGA 4WLFA 4MDHA 3MHTA 1FTQA 3IAM1 1YZHA 3E9QA 2YWXA 1RAAA 1V26A 1NBAA 1TQ4A 3MHPA 4RACA 3ETJA 3HEBA 2I2XB 2D5AA 2K87A 4Y1RB 1YRLA 2JAHA 3GYGA 4H4DA 5EHGA 3L0YA 2IHTA 2XUZA 4J6EA 1VIAA 3W8EA 1L2TA 3VGPA 6LDHA 4WCDA 2O19A 1QVVA 1AB5A 1TTHA 3SKVA 5EP2A 3KJNA 1Q44A 3VZDA 3DYIA 4DNPA 5AH0A 2QJTA 1MHTA 2Z8ZA 2FMXA 4TYWA 1CC1S 1XCGB 3AGPA 3NZEA 3QIAA 4OHMA 1PRYA 3FMFA 2NIPA 3K3PA 4WUVA 3NV7A 1PGJA 4JUCA 5G0SA 1NDQA 1TJ4A 5LMCA 3AUFA 2QEQA 1VJDA 2R1TB 2OGUA 4IHKA 2UUPA 1BGVA 3U16A 2W5UA 3PD1A 3GEEA 3GGGA 5EPEA 3A0UA 2FSVC 1KGSA 1R6XA 2J32A 4LEIA 3DBIA 1HXHA 3HVJA 4LX8A 1G8KA 4KAFA 2WC1A 4D4LA 3E6AA 4XGNA 4WSOA 2IS1A 2OL4A 1SFRA 3T35A 3K30A 3GARA 1QFXA 1QUEA 2CFOA 3BGDA 4NCKA 1LI4A 2AC2A 4Q37A 2JL1A 4NFYA 2OESA 5J43A 2GZ1A 1II8A 3MAAC 1MEEA 4JJ7A 5EKXA 2EARA 3BMQA 3LJKA 4AU1A 2FV8A 3SOZA 3ZCRA 1Q0QA 4I1PA 1RWBA 4QOIA 4HO1X 5BMVB 1DMSA 4CEJA 4BFXA 2CLMB 4WFKA 4GSYA 2GN2A 4HQKA 2VA9A 3ECSA 3ET5A 3QE2A 5GM2A 2AR7A 5CTAA 1PZGA 3ZWYA 1E2KA 1BHJA 1WE2A 2QN9A 4DQVA 1UJCA 3ZNNA 2PZFA 2Z1NA 3W5IA 5P21A 3WLRA 1V7PC 3GUVA 3NGLA 3RJMA 1XD8A 4G81A 5AXBA 4B6OA 4BTLA 4YP7A 1GDTA 2FP3A 3HKDB 3W0LB 3HFJA 3ZHZA 3BJZA 1QXSA 1RE1A 2HSJA 4NBRA 5AXCA 2EERA 5LWHA 4OG2A 3HXMA 3HCWA 4DJJA 3PDIB 4BGUA 3OQOA 2YC2C 1YR2A 1GR1A 2NXCA 1UDWA 4AB1A 4DQLA 3BIOA 1T5DX 2B1JA 2J3MA 2X40A 2YVAA 2IXBA 4JLAA 1J7JA 2AJ8A 4V2IA 1GTJ1 1KY5A 4JLDA 2CL7X 4ZRNA 1DEKA 4CI9A 1YV9A 2HK9A 3M5CA 1UPXA 4LOKA 3PEEA 4U7GA 2PA3A 2A8YA 2XT0A 4BV8A 2OCLA 4BLRA 2NU6B 4Q15A 3N6XA 3O26A 1NWHA 3OSZA 2WWRA 4HB3A 5H4GA 2ZJ6A 3F3MA 3R3WA 4GXTA 1EDDA 4TRRA 4O0LA 1LGYA 4Z8XA 3ZGVA 5ADVA 4HNAA 1JHYA 2WILA 3EEIA 2NTNA 4R2MA 5CP8A 4YGXB 1BC5A 5TDHA 4DY4A 2EFGA 2RSLA 4QTZA 1BQEA 1W87A 1SB8A 3LPNA 3GLHA 4YLGA 4I55B 2YWHA 2Y0CA 3JQBA 1SHKA 3VHRA 3JAMA 5FJJA 1GPDG 4RSGA 4KL8S 4ZDWA 1Y80A 5JAQA 2Z6VA 3V42A 5JECA 3EW9A 1BE0A 2LZ0A 3LF2A 2BYTA 3IXMA 3X1WA 1L6RA 4OQXA 2IYLD 3FBGA 1E2BA 4ANFA 4AJNA 2A1IA 1ATZA 5ESRA 2YC4C 1RJ9A 1AA6A 4JP3A 1H9CA 1S3IA 2DJIA 2I4MA 1T5OA 3O94A 1SC4A 3PNLA 3M5WA 4KRXA 5FULA 3UJ9A 2VQ6A 2P9ZA 3NOVA 1L7MA 1AGPA 3PC3A 1NG9A 1X1EA 1ZW6A 1WEKA 2R5WA 1C1DA 1R0XA 1E79D 3C7AA 4GOXA 4IIFA 5AKGA 4CIYA 3DMDA 1FX0B 4AJ2A 4ZIRA 1ZD8A 4OXRA 3TAXA 3OC0A 4N6GA 5FLYA 3FOZA 4DV5B 1P73A 2WOJA 5G3ZA 1EBFA 5GQSA 1XCLA 1I32A 2FOLA 2KBFA 3H4TA 1N33B 1WABA 1QKJA 2KW5A 4GSKA 1XTKA 3IP6A 2E4WA 4M8SA 3R5FA 4UREA 2PH5A 1PZXA 4Y2HA 5C51B 2DAPA 2G28A 4W5QA 5MF6A 1ZAKA 2EZUA 3DL0A 2IFTA 1E2UA 5CB6A 4KFSA 4F3KA 3K9BA 1Z28A 3SHVA 3KAPA 1HRDA 3KYJB 1Q1EA 3BUSA 3ETHA 1DC6A 1FFGA 3FNHA 1BD4A 3OESA 4BGVA 4C5CA 3FHTA 1YE8A 2REBA 4PN3A 4AJ9A 1UQUA 3CXRA 3CQ9A 1Y8RB 4GD3Q 4WZBA 4ZQHA 1ECGA 4KYTA 1K68A 3IE1A 1FYDA 4YP1A 4DAEA 1OMOA 4I4IA 1S2DA 3PPIA 3VAAA 4QLBA 3K8QA 4A6XA 1JDJA 1L4YA 2PUWA 2I7DA 3ICEA 4GP6A 2GJKA 1XZCA 2NQ2C 2PSSA 3IP3A 3QKWA 1E9DA 1W25A 1KY3A 2EIXA 4KBFA 4AXXA 3OKCA 1YB5A 3HJBA 3RGGA 1OZAA 2ZTLA 3JYLA 3D2CA 1HDRA 2BH9A 2ZTSA 2JVKA 3V2UA 4YR9A 4U2GA 4RTSA 4DIOA 3BC1A 3IRVA 5BNWA 2J9ZB 3JQRA 2FMHA 2ODWA 4MX8A 2OAEA 4MV9A 4X9XA 1RKQA 1XZPA 4E09A 3S70A 3WYGA 4DJAA 2ETVA 2ATXA 1KJJA 4MS1B 3L77A 2W42A 2GPWA 1NE2A 3PYMA 1PT9A 4XVQA 2BJWA 3SVZA 2XRZA 1J7KA 2ZRHA 1NDUA 3I04A 4LQ4A 5HIJA 3WGTA 2ZB7A 2Q4OA 2C29D 3NT4A 1EUCB 4D1YA 1P31A 3H2SA 4GKKB 2OLKA 4JNCA 1VLJA 1GILA 1KKLA 2P6PA 3D2LA 1CJKC 1YRYE 4KBYA 4M0FA 3OZDA 4O2BB 4OHVA 5CB4F 4R9NA 4WEQA 3HL4A 4FZJA 3WI7A 3AI7A 1GT91 4BU0A 4OBXA 3WYFA 2O5VA 2P4SA 1YC2A 1E4EB 1GA4A 2OEPA 3OIWA 3O1LA 4JVSB 5U1PA 1AF7A 4OQMA 3VO1A 2BBOA 5JADA 3CLVA 3QXJA 4UPEA 2QMUA 1GV0A 1SD5A 4QRHA 1NSYA 1DBIA 2XXBA 1YJCA 3CKKA 2CXUA 5ENDA 2MMCA 1W2GA 3L8GA 3TZLA 2BEJA 3WP1B 5CFOA 1DXYA 1II0A 3W9BA 4MRMB 4LTNA 4Q19A 1IJBA 5L95A 2FPPA 1UFKA 3PNMA 4ALJA 4D4MA 4R2XA 2ZIEA 4MR9B 2DCUA 2H4HA 2XCLA 2I1WA 4WD3A 2ZE7A 1FYEA 3RAFC 1ZVVA 1YULA 1R8SA 3KKKA 1HE4A 1XO1A 3EXHA 5FPKA 4B4OA 1ENZA 2R6CA 3COWA 3U3ZA 2YMLA 4CLOA 3EDQA 1E6UA 2Z6AA 2VJYA 1VGRA 2X4IA 2W6JD 4M46A 1AT1A 4OHPA 3LT2A 2BT4A 1E99A 4DZZA 2W7TA 4JI8B 1JYFA 4NYJR 2C4VA 2WINI 4N9WA 1C8BA 5DGIA 2FPUA 5LC1A 3SSAA 2DKOA 5ITSA 1P61B 4TTSA 1MO5A 3KT8A 2GARA 1SBYA 1CYDA 3NHLA 2RI6A 1XDUA 5FTNA 1N5MA 2FSFA 2PLWA 3WYEA 1DLJA 1NJ6A 4JOCA 1M1XB 1KVTA 1UR5A 2WVGA 4QG7A 4FNAA 5I7AA 4FGUA 4DMFA 4RY2A 1KEEB 1ODKA 5BV1A 2CFRA 4N5IX 4FSDA 4J7CA 3KRTA 1K6JA 2IHJA 2QROA 3C5HA 3EUWA 4BUCA 5K8VA 1Z18A 1FFBA 4S12A 4ZGBA 3KBOA 3KKOA 3PRJA 4GM4A 1RWNA 2QLLA 1O58A 4IO1A 3SX2A 3UB4A 5EXSA 3VPHA 5CEJA 2Q1UA 4L2IA 2ILVA 4UVHA 1I0ZA 1YI0A 2Y92A 3B6IA 5DHTA 4QBGB 1HM5A 1U9YA 4DSAA 1QX4A 1PNVA 2AG1A 5IWAB 1CULC 1W2HA 2I8LA 2R00A 4KO8A 3PDCA 3UV3A 2XBUA 1XRJA 3DO6A 3JD2A 3LNTA 2EKBA 4ZEOA 5HZHA 2YV3A 3IDZA 4PRYA 3I5XA 1I5OA 2O6HA 1YD7A 4O1MA 1XDGA 1ICEA 4TTQA 4U7FA 1DQSA 4G3XA 3NKLA 4ZAVA 4AZVA 5B3JC 1L9XA 1Q7RA 4GX2A 4DTCA 1TVMA 1NYRA 4XOIA 3UMSA 5K1ZA 4J3NA 5L3RA 3OPYB 3KSDO 4KWIA 1A50B 4WCVA 2PT7A 3D31A 4AMGA 4BRWA 2QM7A 3KYDA 1T1EA 5EPUA 2XMRA 1DDIA 4O29A 5BO5A 3SVTA 1RMQA 1T5SA 4R5MA 1Y6FA 4DA8A 3PR1A 4FWIB 4K9PA 3AK4A 3EGWA 4PIPA 5DGCA 2C5GA 2FUG6 1JT2A 2QTBA 4KR0A 5JAZA 2XLBA 4CQNA 4KXUA 3ZLBA 3R3SA 2QTVA 1WZCA 2P0AA 2RHDA 4ZVSA 1ZKDA 3NHSA 5CLLA 2XQKA 2BMFA 5FFMA 3HYCA 2ESRA 4KLCA 3RWMB 4YASA 4B2LA 1U28C 3WLFA 5BR8B 1VCIA 3NEAA 3ZHTA 1V3TA 2Z09A 4NX2A 2D3TA 1M7BA 3DW3X 4MUMA 4QDXA 3UT5B 3OICA 1J5PA 1K89A 3OMWA 1IHYA 2J07A 3F6EX 2CDBA 5BYAA 4KO1S 2BDUA 3SAJA 3T52A 4OB6A 4DPMA 2ODEA 3O8CA 2WFAA 2EIHA 2FWJA 2HHLA 4JQYA 1SVIA 3QVTA 1N2SA 3LRXA 4LCEA 4HDRA 4TYPA 5G1PA 1JDVA 1U7DA 2IELA 4ESHA 5JH7F 1LUAA 3VR0A 4ND6A 1Q0ZA 4QUKA 4EA8A 2A57A 2JGKA 3MCZA 5H9VA 3BMCA 3MLAA 3WRXA 4DQ0A 4RL4A 2ZYTX 3MJDA 5EXEA 4AN0A 5K99A 1X1BA 1WXQA 3I23A 4Z0HO 3SFVA 3IQXA 1FFWA 4KUHA 2XAAA 2I1LA 3A14A 3QOXA 3DBRA 2MSWA 5JARA 3JZIA 2ABWA 2BGLA 1O95C 3QM1A 5G40A 1M1YE 3JSAA 3N87A 4RNCA 1BVRA 3NBMA 1VG1A 4FQ8A 3KQKA 1NUSA 5FOSA 1M0TA 5IAGA 3DUWA 1E58A 5AK4A 1IVNA 1V1MB 3L05A 3SXUA 3A7EA 3L93A 3EDRA 2ACWA 1DV2A 2CLFB 1DC8A 1KQ3A 5BN4B 3A6FA 2D7CA 3I3OA 2GZRA 3EVZA 2QLFA 1P33A 1ZVMA 3GFRA 5CM8B 1NMSA 3KKNA 4XDHA 3RUIA 4HYYA 1QKKA 3D81A 3TM4A 2J5XA 2RH5A 4INPA 2HF2A 1Q3HA 3U4QA 3VBEA 3B3JA 1GLVA 1W9MA 3WDKA 2CHUA 1LRJA 1XB2A 1Z47A 2FF7A 1EE2A 1GCUA 1Y9AA 2VNSA 1ZX1A 4PXAA 4LX0A 3RUCA 4BVFA 2SKCA 3LP8A 2GKGA 1NWCA 2CC2A 1UFVA 3LK6A 1LSJA 5JRZA 1OFGA 4HVTA 5MDHA 3WB1A 5IJ0B 1KYYA 3MWKA 4LHWA 4M9QA 5CK5A 3ZCXA 2HADA 1U8FO 4BATA 3LCVB 5E9QA 2X1HA 1SXGA 4F97A 3FF1A 1D4FA 3MGAA 4QQ8A 4YEDA 3HR7A 4KVAA 5D5PA 3ZWKA 5IUNC 1LTKA 1UKZA 2QN8A 1NNSA 2BKXA 1VJTA 1NV9A 3GJ5A 4LJSA 1JU3A 5ITZA 4L02A 2E3JA 2FRXA 2C95A 4ENWA 5BYJA 1P5RA 1IXYA 3NEJA 3TINA 2G88A 4CDRA 3DPUA 4F3YA 3M8KA 4QVIA 3VO8A 3ULKA 3RB8A 1LK5A 5BVGB 1SKYB 1E7QA 2P8JA 1F7VA 1SRRA 3LW7A 1RI3A 3BDVA 2QN1A 4WK6A 1K4KA 2GDJA 2VDRB 1P6UA 3ZDCA 2V58A 3SYRA 3X2EA 3KEGA 4Y2UA 1S96A 5AM0A 3THYA 3UJDA 1EKXA 1TNDA 1W5FA 2C78A 3TR6A 4WXEA 1G2QA 4I9FA 3UWPA 2X14A 1H8ED 1ISJA 4BL5A 3ELBA 3N5KA 4NS4A 4DIBA 4X41A 1NN0A 2AMLA 4I50A 4MCIA 1N5LA 3HJTA 3KDSE 2JFNA 3FWPA 4QHYA 1J2JA 3G5TA 3L7LA 3IAXA 4UTVA 4D9BA 1PKXA 2WDPA 3D4BA 3EWSA 1QCCA 2MSEB 3GFTA 4GPBA 3FCOA 4NFLA 4ERXA 4Z4FA 3VM6A 4MRPA 4H16A 1E69A 3MJFA 4EFMA 3EXEB 4YUYA 1M7GA 3E70C 4AW9A 1G3UA 5JASA 2CE7A 4Q4HB 4KWHA 2QTWB 5D7BA 5CA1A 2QYTA 4A8JC 5AJVB 1UFQA 5IT5A 5CFZA 2ZS9A 2HAEA 4ZO7A 4HFNA 3AEQA 3MGBA 2CXQA 3I6ZA 2V98A 1KFCB 1Y33E 1WHSA 4ZYZA 1CXZA 2ETXA 4U00A 4LJ8A 3ZHYA 3PXEA 1DRUA 4X71A 3ROTA 1LDEA 1T4GA 5TT0A 5JR3A 4KUGA 3V6LA 2J3EA 2ZITA 2HBYA 1ADJA 3BXZA 3F78A 3IVAA 4TKUA 3H17A 3KEMA 2H4XA 4FKZA 4UUQA 5F52A 3T7SA 3JY6A 3W78A 3WGUA 2OUIA 1KJWA 1O7JA 3DKVA 3P4YA 4Y2TA 1VCOA 3ZXUB 3KVNA 1LRKA 3MMPA 1M2VB 5JWRA 1HH4A 3KAKA 2E82A 2XKBA 3EBPA 1DAIA 4LHYA 4LSWA 3WK9A 4DFDA 2HT1A 4B44A 2H1CA 1CETA 1NZJA 2C07A 3DE0X 1QTIA 3ICWA 3O21A 2CNWD 3FOEC 1N9ZA 3IIKA 4H7HA 5CRIA 4CIDA 5FOWA 3ZY4A 1SG0A 2Y99A 4FGKA 4FEGA 5CITA 5AKZA 1E0JA 1P2FA 4V0MA 2GILA 2ZPUA 1P6QA 3KC2A 4BMNA 3CURA 3ZUGA 1GO2A 3UIEA 3TLBA 5BNIA 1JZSA 1EVQA 2OCKA 3HDTA 2LIPA 1SAYA 3U7JA 4HVAA 1FVHA 1KH1A 4TLLB 2HW8A 3VZBA 3MUFA 3C87A 5FUBA 4GZ3A 3R6TA 5I8PA 4MAFA 2NSLA 1H1LB 5JEDA 2HK8A 1R5OA 2QX7A 3I73A 3LXXA 3V8NA 1VL1A 2ZBUA 1FXWA 2HRCA 1KAEA 3EUEA 3PRYA 3RANA 1K7SN 2NACA 4HATA 1Z6XA 2I76A 3MCUA 3VU8A 2YN4A 4L51A 2A84A 1QE5A 2QYOA 1JHQA 2RG7A 2PX4A 3B6ZA 4DSUA 4WBNF 4U63A 2O57A 2WNSA 1JKIA 3GRKA 4RKRA 3GT7A 3TD9A 1U0FA 2HMWA 2GXAA 2P2ZA 4YIKA 5BQPA 4DV3B 1LK7A 2XSZA 3HVUA 1PW5A 3M6IA 2R2AA 1Z7EA 3SOPA 2FRDA 1UPAA 3PITA 2EW1A 4KQHA 5BV2P 3RU2A 3GF4A 3TQTA 2EFHB 1J07A 1EUDA 3NHRA 3O8BA 4FX5A 2JC3A 1F06A 4KWEA 4PG7A 3OZ7A 2ZANA 5EVJA 1NOKA 5C1IA 1Z38A 3O4RA 2NU9A 2VTBA 4YJ2F 1IWOA 4C2AA 3TB6A 3WL4A 4OL0A 2R1ZA 1NJGA 4OU4A 1SD1A 1C4OA 3E18A 4IILA 2XTMA 4EUEA 1VPWA 3BWBA 1OC4A 4FILA 4O5AA 1YVUA 3ACBA 3I05A 1AO3A 2ZWVA 4LMAA 4ASUA 1UMCA 2JIBA 2WHRA 3UWMA 2VWPA 3BTOA 5JE8A 5CBKA 2Q1YA 5EQFA 4LECA 3ZWBA 4JYAB 4F9FA 2P4UA 2W6MA 4FB5A 5A03A 2LIVA 5HQJA 4FW9A 4JVLA 1E79A 4RV5A 5F73A 1JR3A 4HAXA 1G20A 1Z0FA 1S2GA 3JAWA 3TQRA 4HADA 2A9QA 3UYLA 4Q1EA 1M6VB 2FXVA 3DEJA 4KQWA 4X7RA 2PFGA 4DB4A 4ZCIA 4FDMA 4US1R 5ALVA 3FTNA 4YAWA 3RUFA 4DDMA 1FJXA 2HKIA 2CXNA 2GYUA 2HBRA 3L0OA 3LQRA 3QKSA 3GNLA 4H08A 2WFZA 3CLRC 2PPVA 1E1QD 1JWLA 3IQDB 4E0BA 2AKYA 1YBHA 3L01A 3S28A 5I7OA 5FUWA 5KTSA 5LR6A 1JSZA 2NU7B 2EP8A 2VJLA 1AQNA 5K3AA 1XNGA 5K3CA 4OU5A 3SZUA 4NMMA 1D1PA 4PLHA 2GQ0A 4H60A 4UAVA 1L7XA 1S2LA 2DTDA 4JYBA 1WXHA 4R31A 4X94A 4P36A 2XOEA 1JXAA 2VPTA 1UKAA 3AVQA 3HUDA 3PHBE 3P2YA 5LXTB 1G7RA 2JI6A 1N57A 1Y1QA 2AJCA 2ZTHA 1XZBA 3DP9A 4PCLA 4PRKA 5DSZA 3UB3A 3WLOA 2X6RA 4BV2A 4RE6A 9MHTA 1OWNA 1XFAA 3C6MA 3DEKA 4HEJA 5CX1B 1XV5A 5FPPA 3H19A 1OXTA 4K3UA 1ZUWA 2AD5A 4R6XA 4Z4CA 3ODGA 5JY6A 4QSMA 3RWBA 3T9FA 4CMEC 5CFLA 2UAGA 2FYTA 1J90A 2OXCA 4RANA 3RLIA 2YFYA 3ZK7A 4P1ZA 3S99A 1ZU5A 3Q41A 2VSNA 2J8ZA 2FDRA 1O0BA 1M34E 1WCYA 1MT3A 2VP0A 4UAJA 3N2KA 2AOUA 3TZEA 1LLFA 4C03A 5EY5B 4PTZA 3CMMA 4KV7A 3H2HA 4RQAA 4EGJA 2XNHA 5E9JA 2IWRA 1EX1A 4O5OA 3A8TA 2YWDA 1WXEA 3BJRA 1BXKA 1I2MA 4J49A 2FZKA 1I8TA 2PWAA 1N7HA 5D84A 1HFWA 4TVBA 1N2CB 3PPXA 4M86A 5GY7A 4HLUA 5DBFA 2ZI9A 3BXGA 5LIRA 3GZTB 4FFSA 4AM8A 2VC2B 3NYWA 2ICAA 5AM1A 1U7OA 1WUIS 4HT3B 1T1JA 5LP6A 5EN4A 4B4WA 3HBLA 4MDEA 4TUYA 3T9CA 1Q1GA 1E32A 3B70A 3D5TA 3KUCA 4MSUA 3NBUA 5GONF 5K8IA 5EIEA 4B17A 1IJKA 3MW8A 3CU5A 4CRWB 4F72A 3AVWA 2I29A 2QN7A 3GPLA 1JG4A 1QBGA 2P6OA 5JYEA 5HK9A 2CLCX 2I3GA 1CEEA 3CJRA 1TT5A 1VKJA 1A0OA 3E1KA 4QXPA 5MFPA 4O4HB 4PFQA 4ZK2A 2J41A 2PPLA 6GPBA 2VUIB 3ON5A 3QUTA 2H1OA 1KFJB 1IM5A 1PYOA 1OV6A 1UZAA 2JHCA 3Q7RA 3DCJA 1U8EA 3CUYA 3GJSA 5DN6D 3NCTA 4XD2A 3OA0A 1U2QA 1Q84A 4PZ9A 3N75A 3RAGA 1VYVA 2RCYA 4GFDA 2RE8A 4DR5B 4PLPA 4MP3A 3GRYA 2WEKA 4XWGA 3FMPB 2NGRA 1E7WA 2V0NA 4I3GA 1CHDA 2VHVA 3FGZA 4L6CA 1W85B 1MABA 4Y7DA 3F74A 3TZ6A 4DLYA 5IDXA 2VP5A 1H2XA 1Z2NX 4F71A 1C3XA 1KZ6A 1QDUA 4M1ZA 2PUEA 2GK3A 1NI4A 3E7DA 1TTPB 1Y1LA 3PICA 2OLJA 4N65A 4PPGA 5DSXA 5NULA 4H0FA 2A78A 3HUTA 4K9SA 3EPLA 3J7AC 2R66A 4IRUB 4RXUA 1B42A 1U31A 4Z9AA 3UANA 3NHFA 4BJ1A 4Y0VA 3H5IA 3A0RB 1EU1A 3T06B 3KJFA 3T3GA 1S9DA 4BWVA 3DTVD 2YHIA 3EDOA 1GQSA 2QMYA 3ED1A 4KB5A 2W6JA 1HEUA 1W44A 3Q15C 3IPYA 4KWTA 3J7TA 4JU8A 3PQ8A 1ONPA 4OMCA 3KD2A 1NW5A 5KTKA 3EG9B 4LKOA 4FJ1A 2R25B 4QJBA 3ZJ5A 2FWMX 2H4YA 2AOWA 3RIGA 3L7BA 2GEFA 3I01A 2A33A 5JSZB 1RRKA 1V25A 3IHLA 1TIBA 3BD7A 3BXHA 4PFJA 4ZYUA 1H85A 3R9WA 1N6NA 5I8WA 1TOAA 1EJBA 4R6WA 3G85A 3I4CA 4C2TA 1X80B 1WPXA 3D0QA 3KR2A 2AQ8A 1G1MA 4IMPA 4YN3A 3KZXA 4GGMX 4HEA6 3EQZA 1XHEA 4QPZA 3WLLA 3RARA 1UXKA 1MC4A 4GM0A 4RHUA 4X45A 4HDKB 5ALNA 5CFNA 3EWAA 2Q0XA 1ML4A 1H94A 1QYRA 2UYQA 1CK4A 2A3RA 2BV3A 4KEAA 4C78A 4QJ3A 4EG1A 1FDIA 3RS7A 5DH9A 1XHFA 1NT2A 2Y05A 5F7XA 5EINA 3PQFA 1Y5IA 4R2HA 2FUNB 4FOSA 2YUTA 3EXG1 4UDNA 2CCGA 2JLQA 2RJNA 4C0SA 1UDXA 3H3JA 2DPMA 4L5AA 2E55A 1GGVA 3BB3A 1FDOA 4RTLA 5KX5B 3FKJA 1XVLA 2GLXA 3NTRA 2PNFA 3MSCA 4GO1A 3V2HA 3AHEA 1M1NA 5AKYA 4DREA 1U4SA 2HCBA 9ATCA 1V16A 3AOEA 1SZPA 1RBQA 1JS1X 3A1NA 5LDDC 4IDPA 3RF7A 1R8JA 2OHIA 2ZXEA 1EQAA 4YR7A 4W63A 3OH8A 1D04A 5E6UA 3B89A 3QRWA 3B1YA 3W5CA 3DDCA 4LK2A 5HOQA 3ZWXA 2XE4A 1WY5A 3IB3A 3H2JA 2IT1A 5E1DA 3B20A 3IVMA 3L5OA 3C5CA 3RQIA 4KXXA 4LHVA 3IIMA 5BN5A 1C0EA 1EAMA 1QKIA 1OLOA 3L1VA 2VVTA 3C1AA 1IWBB 2P9BA 4LHXA 3TSYA 3L07A 3OEHA 4S1NA 4L85A 3HSKA 4S1PA 3U0BA 3WK7A 1GEEA 4AYWA 3FBTA 5I7VA 4ZT4A 4CJXA 4UMVA 2GPYA 4CMJA 3CKYA 5DGHA 5SYAA 2XTZA 4DWWA 4IOMA 5JDIA 1NQTA 1FL9A 3IT3A 1R16A 3OWHA 5J2UF 4X8HA 1YJAA 1Z25A 3CSDA 4F5DA 2ERXA 3MFYA 4FYWA 4Q9KA 4F38A 3E1SA 1CP3A 5ALLA 3HTXA 3ESQA 3ZZMA 1DIRA 2H1HA 4JB0A 2AKEA 1T29A 1TEVA 1CDDA 2OMEA 2ZBPA 1L5NA 5MFZA 3VKGA 3CF6R 3NM6B 3ZDFA 4J1TA 3DLAA 1EZ1A 4RHCA 4XGRA 4RHXA 1U9CA 3TG8A 5JQWA 2E5FA 5FWYA 2OB1A 3DFIA 1H5UA 2P3LA 2WZQA 3AHJA 3F96A 3FCEA 3O83A 1RFGE 4JJ4A 4QXMA 4WXRA 2O5EA 1GRCA 5FI3A 1RTKA 1J0AA 3T9AA 3WQSB 4TT3A 3U7QB 3I9OA 5HQ3A 4ARCA 1IXRC 3GL9A 2QU8A 1O97C 1AKTA 1GUYA 1EXDA 4JC0A 2W8ZA 2DFDA 1ABFA 1OLSA 4C05A 5F2KA 4DOMA 4AKHA 5D5QA 4Z86A 5B36A 1D09A 4NYJQ 2QZ9A 3Q7IA 4Y2RA 5TJHA 3WE7A 4W5JA 1FTSA 1WBDA 3LKZA 1I6WA 4RY8A 1TU3A 3GP5A 1RJFA 1KKMA 1KI3A 3Q1KA 3BICA 3NUGA 3R6LA 4CG1A 4URXR 1L5VA 2ZTMA 3OT5A 3O9ZA 3II6X 1EG2A 1EVYA 2FG7C 1OX5A 4HEHA 4R7ZA 3VNQA 4DKJA 2AEMA 3OUTA 4IR7A 4JU9A 3MS7A 4V1CI 1ULTA 5LPNA 1G64A 3ZLVA 2O8CB 3AJ9A 1CQIA 3JVUA 2V0GA 1FSSA 3BVPA 4E5YA 1ARZA 2ZU0C 3GNQA 1KA9H 3FJYA 5D1HA 1Z6PA 3S2YA 1EFVB 1P2SA 5JBQA 1TPZA 4JOSA 3WG9A 4IMRA 4RA9A 3JYPA 5D3MB 3UY4A 4AWXA 3U6BA 2ZEJA 2YR0A 1PE0A 2G07A 3HLKA 3UHPA 2IRWA 1ISFA 3DE5X 3CVWA 4G63A 3AVYA 3T4XA 5K6AC 1T9CA 1Z29A 5FDFA 3C24A 2V5AA 1FDTA 3N1UA 4FT2A 2WJGA 4NE7A 4J3FA 3BF7A 1T2CA 3FUWA 1L4HA 1SCNE 3ONWA 3RRFA 3VU3A 3N58A 1OE0A 3WNBA 5IEBA 3ZDQA 4CGZA 1KDTA 3R6DA 4I2NA 1DQRA 1QV9A 3QG5A 3QITA 5HE8A 2I6FA 2W00A 5ENZA 1PEKE 5B7NA 2AW3A 1P2GA 2FP4B 2G0TA 2VP2A 5DE3A 4CQLA 1XR3A 1Z4OA 1YR1A 1CZNA 5IJ9A 1TW3A 1E3QA 1UOOA 3RF6A 3IIIA 2HB6A 1QFSA 2B25A 4HNGA 3NBFA 5ILGA 1OXSC 3TMKA 5F4BA 4ZT7A 4JJZA 4IIGA 1QH0A 3K4QA 4X6UA 1M6HA 4YC7A 2EYUA 3BE8A 2EQBA 2OXIA 1U2DA 2EJTA 3H04A 2CE2X 3K31A 4RZHA 3OQNA 3QEAZ 2W2PA 3R9XB 2R96A 2VK4A 2LD4A 4D3SA 4DJTA 1N3IA 5A1JA 1MHPA 1BRTA 4B3RB 4OSPA 4FHEA 1QH8A 5FL3A 3ACCA 2OVBA 5DF1A 3ESBA 2BEWB 4B40A 1QHXA 1X1DA 2NTEA 5KO2A 1ZJYA 2PS0A 3JQGA 1TEZA 3KSBC 1YR3A 3QVLA 1XTIA 2JHPA 2QRMA 1Q0UA 1A8UA 4I5EA 3UHOA 1Z4PX 4EUKA 3H1EA 2QE6A 1AN9A 3RCBA 5T64A 1GEGA 3EVNA 3WGMA 4J0GA 1JQ5A 1D07A 4XX1A 4PEVA 4U2CA 1D0VA 1NY6A 5CYGA 1I2DA 1TZBA 4IUBS 4E1BA 2GBLA 1HY3A 5BWBA 2ES4A 1KR2A 3MLEA 3U9SA 5LQMA 1Y5MA 4QGAA 4MPJA 4JJIA 4J3JA 2ZSUA 4XA8A 3SNKA 4C4TA 3EBOA 5DNDA 5CHYA 1MFZA 1K6IA 1JDBC 1I36A 2PRIA 3S1AA 4QT4A 4DA4A 1I2ZA 1GTVA 2X6TA 1USVA 3DUFA 1XZGA 2QTRA 3U44A 2KPOA 3B52X 2ROQA 4CKBB 1GPH1 4EG0A 4ARAA 2IU4A 3G2OA 1VPEA 1U2SA 4GVLA 1ZOSA 4P53A 2JK0A 2V3VA 3DR5A 4YNBA 3AG5A 1C30B 2ZJ8A 4NJEA 1BS1A 4YRQA 4A16A 5IANA 4Z7QB 3FOCA 2B5OA 3CEAA 1UPBA 2BFEA 1TUBA 5FI1B 1ESMA 4YCBA 4DR3B 2WG2A 3A4VA 3WJ2A 4QL3A 1VE7A 1TA9A 2ACEA 4BVKA 4WADA 2EBUA 2EX4A 4P98A 1A71A 1NATA 2C5AA 1KNQA 4XH9B 4XXHA 5AVYA 5KTMA 1ACMA 4AUEA 4IUYA 3I2KA 3W5JA 1W36C 3WTCA 2BMJA 2X5JO 4QECA 5IH3A 4DSTA 3TIVA 4EQ6B 1HE1C 5LLSA 3K0CA 3LLVA 1UBHS 4GEGA 1NXPA 2FEXA 2YYYA 4OXYA 2ZRGA 4LGMA 1ESNA 2B4TO 3EZ6A 2B8TA 2WD7B 4KJXA 4DMCA 3U09A 3LECA 3ETLA 3IP9A 2VH1A 3LDFA 4L4XA 1PK9A 2G0NA 5BYBA 4EUFA 5K20A 5L7WA 3RASA 3JYQA 3UWSA 2UZ4A 3HR4A 3Q3VA 1UMDB 4MW4A 1GFSA 1E2NA 4E2YA 5CCEA 2JA1A 2F3SA 5AW0A 1BDIA 4URYR 4YQZA 4O3MA 1UL1X 2O3UA 3GDFA 4CNQA 2F90A 4DRYA 3A1WA 3N7TA 2N46A 3R5KA 5F1YA 4C2UA 1KEWA 2JKZA 2WA1A 3R20A 1BCSA 2XDQB 1NR5A 1A77A 4NR0A 4PZYA 5TE9A 5TPZA 4E5VA 4Z7OB 2Y0PA 4TLBA 3T61A 1MOSA 2Q5IA 5ALYA 4YYEA 1GUBA 2UZ0A 1U3FA 4TL9A 4J75A 4V0KA 3TDKA 4W9NA 3N76A 2CHQA 2C4UA 4M7RA 2Q3LA 3SSNA 3UXHA 4ZOLB 3UBMA 1E6CA 4OA5A 5BQOA 1KJQA 5C1DA 1FP4A 2EFYA 2WUWE 1Z5VA 4FHFA 4CM9D 1NURA 1TA4A 3LX4A 2OXEA 4IDEA 3PQ6A 3TJMA 4W1RA 3ZCQA 3V9PA 1DV1A 1ORRA 2B5VA 2PYDA 4OQLA 1J33A 3H9CA 3REFA 4J0JA 2FWBA 3AF0A 3RVPA 1B23P 4A0QA 2LXNA 4R16A 1J8DA 1XD9A 4BS9A 1JAXA 1N0HA 2AI1A 2WQZA 5JNLA 1R15A 1Y8QB 1RZVA 4HYEA 4KR3A 2WJZB 2NYAA 4GR5A 1QH1A 3ENVA 3E53A 4IPTA 4KSBA 4YYZA 4Q3KA 5KYYA 1ZH6A 4ODIA 2X2EA 1AVTA 4RUKA 4PTLA 4UEOA 1Q95A 4WKPA 4G1FA 4K28A 1PHRA 4WXPA 3ZHSA 1H1DA 2EXXA 3DCYA 3QMMA 3D6TB 4L0MA 4CN8A 2Q9AA 3P9KA 3QVSA 3ZGXA 3LOPA 4GLJA 4GMFA 3W2GA 4C3UA 2W48A 4ZOQI 1V4VA 4CF3A 4FJ2A 3KB8A 3KQNA 2P9CA 2JFPA 4LS3A 4B34A 1ZUHA 4BBPA 1YQWA 2HA2A 2WSSD 3TCNA 1EVKA 4IWYA 1P72A 2A3NA 1VSVA 3IEKA 3AUTA 4ARUA 4BQOA 3KZKA 2QZ4A 5DYGA 2COUA 5JI2E 1PJ4A 4KXWA 3R4VA 3GEMA 5DWDA 4NC9A 1ENOA 4E5MA 3SQWA 4BB0A 5E9AA 4D44A 3OQPA 5KPDA 1RCFA 2YN0A 3DMGA 3K0AB 4X60A 5FQNA 8GPBA 4K0KB 1K9VF 2FEAA 3C97A 3U4GA 3W04A 3K9CA 4EVQA 2WSMA 2ZVDA 4F8EA 1NQ5A 2C96A 4PZUA 4M0UA 1R7RA 1EIWA 3NTLA 3QF7A 1FFEA 4EHFA 3CLTC 4LJ4A 4YMGA 1DTEA 1YU6A 3I58A 1J8MF 4U2EA 1GOTA 1HTBA 2W90A 3Q0IA 5AKHA 5ILOA 4XB6B 2ZULA 1OTXA 1V3QE 2AXQA 1XKQA 3LXMA 3V97A 2DMRA 2GN8A 4J4TA 1LV8A 1SUWA 5AOVA 2B0JA 3WYNA 4MROA 4NARA 3G0DA 2LW7A 3PL5A 3RD5A 3H1TA 2Y0EA 4I9UA 2Q2VA 3KJXA 2R11A 3OKFA 1I2AA 4LXGA 5CVDA 3STHA 1LBHA 2H51A 2G8NA 1QQ5A 3F3YA 3SU8A 1DGQA 1NVMB 2HU8A 1OFTA 5JVDF 4N9QA 4HRAA 621PA 2XQVA 2J9FB 3SLGA 5AM2A 1JEYA 1TB4A 1S3GA 2C7VA 2IUEA 3FFWA 2ZRLA 1KJ8A 4UU0A 4W5NA 3Q0EA 2EP5A 1W46A 3PUKA 1WPRA 3ND7A 2JAXA 1LTQA 1KDYA 1MAAA 4XVRA 1AN0A 5JCJA 5CA1F 2DEUA 2JFBA 4WUTA 4ZCLA 3TS1A 3K6SA 2GO7A