1L5QA

Human liver glycogen phosphorylase a complexed with caffeine, n-acetyl-beta-d-glucopyranosylamine, and cp-403700
Total Genus 334
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
334
sequence length
809
structure length
791
Chain Sequence
ENVAELKKSFNRHLHFTLVKDRNVATTRDYYFALAHTVRDHLVGRWIRTQQHYYDKCPKRVYYLSLEFYMGRTLQNTMINLGLQNACDEAIYQLGLDIEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGIRYEYGIFNQKIRDGWQVEEADDWLRYGNPWEKSRPEFMLPVHFYGKVEHTNTGTKWIDTQVVLALPYDTPVPGYMNNTVNTMRLWSARAPNDYIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAATLQDIIRRFKASKFVFDAFPDQVAIQLNDTHPALAIPELMRIFVDIEKLPWSKAWELTQKTFAYTNHTVLPEALERWPVDLVEKLLPRHLEIIYEINQKHLDRIVALFPKDVDRLRRMSLIEEEGSKRINMAHLCIVGSHAVNGVAKIHSDIVKTKVFKDFSELEPDKFQNKTNGITPRRWLLLCNPGLAELIAEKIGEDYVKDLSQLTKLHSFLGDDVFLRELAKVKQENKLKFSQFLETEYKVKINPSSMFDVQVKRIHEYKRQLLNCLHVITMYNRIKKDPKKLFVPRTVIIGGKAAPGYHMAKMIIKLITSVADVVNNDPMVGSKLKVIFLENYRVSLAEKVIPATDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIDDVAALDKKGYEAKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFYHDRFKVFADYEAYVKCQDKVSQLYMNPKAWNTMVLKNIAASGKFSSDRTIKEYAQNIWNVEPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Glycogen phosphorylase, liver form
publication title Structure-activity analysis of the purine binding site of human liver glycogen phosphorylase.
pubmed doi rcsb
source organism Homo sapiens
total genus 334
structure length 791
sequence length 809
chains with identical sequence B
ec nomenclature ec 2.4.1.1: Glycogen phosphorylase.
pdb deposition date 2002-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00343 Phosphorylase Carbohydrate phosphorylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 1l5qA02
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 1l5qA01
3BCUA 3NB0A 3RSZA 4N3CA 3ZCTA 1NLMA 4RIGA 2BGTA 2QLMA 2ACWA 3CV3A 3MBOA 1K08A 5GPBA 4GYWA 3O3CA 4RIFA 4RENA 1FC0A 2SKEA 2ACVA 5D00A 4RIIA 1XC7A 2QZSA 1GGNA 2IYAA 3GPBA 1Z6QA 3HBMA 2QN8A 1L5RA 2H1FA 2VCHA 1UQUA 1NOJA 1P2GA 1WV1A 1RRVA 2PRJA 4AY5A 4RBNA 3L01A 1FTWA 5TMDA 2OFFA 3HBFA 1WV0A 1Z8DA 3QHPA 3OY2A 1C50A 4AMGA 3L7DA 4YUAA 5BNWA 2KS6A 3BD8A 3L7BA 2XGSA 4GZ5A 3L79A 3BD6A 4FZRA 4FKZA 1ABBA 3L7AA 3ZCSA 2G9UA 1Z6PA 4MRAA 3E3LA 2PYDA 3G2HA 4X6LA 4X7PA 2X0FA 3DDSA 5TMEA 2BFWA 1PNVA 1O6CA 3T3GA 3MTAA 2XMPA 2XA9A 3OT5A 1C8LA 1P29A 2XA1A 3FROA 2X6QA 3CEHA 5C1DA 4WACA 1GPYA 3DZCA 3WADA 3G2NA 3Q3IA 1NZFA 1L5WA 3C4VA 3VDNB 3C48A 1FTYA 2AZDA 2R60A 1RZVA 5HXAA 4F97A 2HY7A 1QM5A 4XI9A 4BQEA 3SYMA 2F3SA 1Y6FA 3CEMA 3MSCA 2SKCA 2BGUA 3T5TA 3G2IA 3EBOA 3WAGA 4KQMA 2IUYA 1JG6A 1WUTA 1PSWA 3S29A 2ZB2A 1SXQA 1Z62A 3IA7A 2PRIA 4BQFA 4GPBA 2QRGA 1E1YA 1C3JA 4G2TA 2JLBA 4REMA 3MT7A 3NCHA 2JJMA 3D1JA 5ENZA 1F6DA 5I45A 1AHPA 3H4IA 1FU8A 3RT1A 3T7DA 3HBJA 3S0JA 1C8KA 1WW2A 5D01A 2C1ZA 1GPAA 5LQDA 4MI3A 3D0QA 1NOKA 1JG7A 3H4TA 3EBPA 2VCEA 4X7MA 1FA9A 2GT1A 1GFZA 2XCIA 1L5QA 1YGPA 2F3PA 1H5UA 3MRXA 4GYYA 2BISA 5TVGA 2F3UA 2IV7A 2C1XA 1FU4A 1Y6GA 2GJ4A 2GM9A 4CTNA 1XL1A 2WTXA 2SKDA 3PE3A 1L5VA 2R4TA 3BCSA 4EKYA 2GPNA 3OKAA 4NEQA 1FS4A 3RHZA 2VSNA 3MTDA 1EXVA 1B4DA 4CDRA 2X6RA 2AW3A 3OTIA 4BFCA 2XGMA 1L6IA 2FFRA 3T3DA 5IKPA 2IV3A 2YJNA 1L5SA 4X7RA 2R66A 3GUHA 4RIHA 4L22A 4YI3A 2H1HA 1VGVA 3MT8A 2XA2A 4MI9A 3OY7A 3UYLA 4LDPA 2C9ZA 3CX4A 1FU7A 2FETA 3E3OA 4MHSA 2AV6A 1SXPA 2VSYA 3OKPA 4Z5XA 4M83A 2PYIA 1PN3A 3ZCRA 2X0EA 7GPBA 1JIXA 4RELA 3OTHA 1PYGA 2GEKA 4NC9A 4LEIA 3AMVA 1P4JA 1NZDA 1XV5A 2QLNA 3MTBA 2QRQA 3HBNA 4NESA 4EJ2A 4AY6A 3BEOA 4WADA 2FF5A 3S28A 3T3EA 1JIUA 3RSCA 3NP7A 3BDAA 3CUVA 3C4QA 4MI6A 5IKOA 1KTIA 4GZ6A 1RZUA 2ASVA 9GPBA 3D0RA 3L7CA 3G2LA 8GPBA 1Y8ZA 4N9WA 4N3AA 2XGOA 2QRPA 2GPBA 1QKJA 3UYKA 4MHOA 1UQTA 1NOIA 3CEJA 2ATIA 3VUFA 3SYRA 4KQ1A 1JEJA 2GPAA 3MQFA 4M60A 1IIRA 1F0KA 3OTGA 3VDMA 2QRMA 4RIEA 3ZCVA 1HLFA 4EL0A 3G2JA 2Q6VA 3VUEA 2P6PA 5JTTA 3NPAA 2G9RA 2PQ6A 1GG8A 3T3IA 3NP9A 2C4MA 2ECPA 3MRTA 3ZCUA 3Q3EA 3CUYA 3MS4A 5DLDA 2QLLA 3ZCPA 2IEGA 1LWOA 6GPBA 3BD7A 3TAXA 1K06A 4F96A 5JTUA 2IEIA 2VG8A 4WHMA 2IW1A 2QN3A 3G2KA 2AMVA 1P4GA 4EL5A 3Q3HA 3CUUA 3MS7A 2R4UA 5TMBA 1M5RA 1XL0A 1UZUA 4YI5A 1WUYA 3E3NA 2QN7A 3COPA 1BX3A 3NC4A 3MRVA 2F3QA 4QLBA 3MT9A 3CUTA 4N39A 3TSAA 1E4OA 3OKCA 1L7XA 2QRHA 2XCUA 1LWNA 2IYFA 4N3BA 4W6QA 3PE4A 1IXYA 1EM6A 3S2UA 1XOIA 3IAAA 2O6LA 1GZ5A 2QN1A 3S27A 4EKEA 1NVKA 4BQIA 4CTOA 4MICA 4CTMA 4PQGA 4AN4A 4HWGA 2F9FA 1AXRA 3T3HA 4KQ2A 1A8IA 2G9QA 2QNBA 1YA6A 5DU2A 1FTQA 3TOVA 5DXFA 3NAZA 2QN9A 2G9VA 1P4HA 1P2BA 2QN2A 2R68A 2X0DA 4M7PA 4GZ3A 3DDWA 4AMBA 2GEJA 1WW3A 1P2DA 1V4VA 4XIFA 2JZCA 3QKWA 1GPBA 1XKXA 1J39A 3BCRA 3MS2A 1JIVA 3CUWA 3DD1A 3ZCQA 3WC4A 4F9FA 4HLNA
chains in the Genus database with same CATH superfamily
2ZITA 1BN6A 1CQZA 3UAWA 2FFBA 3PCRB 1ZL2A 3HYLA 5KS2A 3OP1A 3RUHA 3T4UA 2NUPB 3CLRD 5IN5A 1YRWA 1SXIA 2XYPA 3JARB 3B82A 4RTQA 4WXYB 2IBTA 3N6XA 2B7LA 4DJEC 4ZI3A 1GTSA 3C41J 4KV7A 3VBEA 1XDWA 3O47A 3P94A 4XQEA 4GYWA 3OJOA 3ZNNA 5B3LA 4Q34A 4ZHQB 2SKEA 1VBFA 4M0EA 1NRIA 3G85A 1QGAA 2H1SA 1ZM2A 1WMSA 2HFJA 4P86A 5ALNA 3BSFA 1GGNA 2A2ZA 3E9MA 3HUFA 5CFLA 1KC3A 5ADWA 2JCXA 2MSWA 4XB1A 1VMDA 2FFJA 1QHFA 2JATA 3EISA 4KGDA 4OQLA 2ONJA 2R00A 2ZRJA 5BVHB 1WKVA 1VL5A 1T6BY 3TQRA 3ZW9A 2VTBB 3VR5H 4DMGA 2D1YA 2C9BA 3HFGA 4DWVA 2FUKA 3A7DA 2G40A 4RY2A 2J5QA 1E2PA 5KVSA 2GF0A 1UF9A 4ID9A 5A4AA 4MEAA 2D54A 5B6IA 2HZBA 1EGQA 1G5PA 1Z4QA 1DHRA 5TEVA 2F59A 1QAMA 2RG1A 2H7CA 4Y2XA 1H23A 1MUUA 4XJVA 4QUAA 4B3HA 2XMDA 4Q7QA 3NDPA 2IF2A 3G9TA 1UL1X 3LQRA 4I50F 4JB0A 2YOFA 4D9CA 1X15A 2X7XA 1QLJA 1YZTA 4U9IS 2QTLA 3IX7A 5I4CA 4E5YA 4GZ5A 4PC6A 4LWZA 5KCZA 1XZBA 3K6RA 1QGZA 4XCXA 3DHWC 4JXJA 4JROA 3NGMA 1QPGA 4P84A 4QOGA 5EKXA 3ROEA 2ZSDA 4XSGA 1FLAA 3R24A 5GONA 5CAEB 3ZGNA 4B7ZA 2FVXA 3PUJA 4GQIA 1Q44A 4C4OA 1X86B 2BW0A 4F4FA 4HSGA 2A94A 3LUJA 1UBUS 3T0FA 2I66A 1XB2A 3URMA 1A9XB 3BSSA 5AM4A 5KVQA 1K3UB 2A7QA 4KL8S 4EOGA 4YHHB 4PLPA 3T5GA 4TSFA 5AW3A 3GBPA 1NI4A 3P8ZA 1RW4A 2B69A 5BP7A 5K6TA 4BGDA 4UEWA 1WB4A 1KR5A 2CXSA 1RKUA 2CMKA 4WEQA 2HLHA 1H0HA 4DIFA 5L53A 1AGPA 2PJRA 1IBRA 3HVUA 3P32A 3L7KA 1D7AA 3EX7C 2H06A 3C8ZA 1U0BB 2B25A 2YN4A 3KV1A 5HBGA 2EX4A 3Q88A 3LF1A 4F12A 4ZHSA 5TJHA 3ONFA 4EF4A 1V41E 4ZCMA 3DOHA 2V55B 2A9QA 4WSOA 2GHRA 1XZNA 1LZKA 2EBUA 3FNRA 3TRHA 2PN1A 3EPHA 3LBHA 2O7NA 2UYQA 1DDGA 2ZYRA 4HDNB 3VSBA 5JAMA 3WL8A 2AZDA 1ZVJA 2CHUA 4GQBA 3SF8A 3IULA 1M33A 3F3SA 1NXWA 2QU7A 1GCUA 2PZKA 3GEGA 2DPHA 4OBWA 4BDSA 2WU3A 4BQEA 3D7KA 4K9QA 1HQKA 3WGKA 2Q21A 2QJOA 1QRAA 4DR5B 4YQYA 2RHWA 1W4AA 2HRDA 2A4MA 2HZ7A 1W85B 2BRUC 4RMIA 3TR6A 1UWVA 1L6RA 2SKCA 2I03A 3GX1A 2VRCD 4CIXA 2ES4A 3BRCA 4JBIA 4DSOA 4EG1A 3B12A 2WWRA 1E89A 1ZONA 4U7HA 3T4PA 2J07A 1GL9B 3K2BA 3WRYC 1L7VC 3HVKA 2V7UA 5FHRA 3IKMB 1FFHA 4BP9A 5CYPA 5JD4A 3DONA 2OGZA 5F78A 1YL7A 2JAWA 4F4IA 3USCS 2ZXEA 2GN2A 4G0VA 1DSSG 2C82A 2W6NA 1T5OA 2P6UA 3PFFA 4JEMA 1G3RA 1Y7LA 3PNQA 5EMJA 3HTXA 3MZ0A 5FTMA 5JMWA 3FHCB 4MV5A 5L9AA 2FZGA 4F2HA 1G8YA 5LR6A 1E1YA 2VUUA 4JYPA 5DNVA 4EMTA 1JEAA 2O2JA 1Q7BA 2WA2A 4QVKA 4B44A 3W2TA 4YCLA 3RRJA 5C5EA 4Q6BA 2VNIA 1GXSB 3ADKA 3TW8B 1V7QA 3W2GA 4EX7A 4HWKA 2ADFA 9ABPA 1F6DA 1RHJA 3LVFO 3PC4A 1GFWA 2ZTSA 1B1CA 1N8TA 2VAXA 1Y5IA 1M1YE 4H7PA 4RULA 4X00A 1K88A 1NHWA 1FYFA 2O57A 1RACA 1H93A 4RJLA 4KAJA 1UT6A 5FR2A 1B2RA 3DYBA 3KR2A 1ZJ4A 3QVSA 2HJGA 1T35A 1PZNA 3LNCA 1BFKA 1KZHA 3P97A 4FN4A 5DTJA 4JODA 4MUEA 4PO8A 4E21A 3ASYA 3GQBA 3H8JA 3IT2A 4DMHA 2BGKA 1R0CA 4N3NA 3PLNA 3ANTA 2PSEA 1KWGA 2GYVA 2WT4A 1CS0A 3DBVO 4FYVA 3JAMA 2QX6A 4BEWA 4QOFA 2GT1A 4PLWA 1GFZA 3MXOA 3ZHTA 4DA8A 3OA0A 5JPDA 1EWQA 1CVLA 4KUHA 2ZAYA 1D07A 5I7AA 3BWXA 4YX9A 3UGJA 4GE3A 1SUCA 1W5BA 4L6IA 3ENZA 5C8DA 2ZIXA 2ZW9A 4Z9AA 2BFAA 3JQ8A 2HK7A 2XOXA 3CVVA 2V6FA 2R9VA 5TVGA 1GZ6A 1XLTC 1AOXA 2VDKB 3DFIA 5DCYA 4LZNA 1SOWA 4DLSA 4EJMA 5LDHA 1FFSA 4BTLA 1PBTA 1TLTA 4S2EA 3X2FA 4CG1A 5JZMA 3RJMA 5K3CA 5KOIA 4RS3A 5KTYA 3LUBA 5DYYA 4EKYA 2NWQA 4P6VF 1MAVA 1XYVA 3L0DA 5D6NA 4CMIB 4I66A 3KEGA 1OYWA 1O4VA 4YAWA 4DM3A 5KYUA 3K6SA 1XAJA 3I0ZA 2RGDA 3BWYA 4FSDA 4FCVA 3QPWA 3R4CA 1FS5A 2QE6A 3NHRA 4K9LA 3ADOA 1N78A 5C8VA 5J5CA 2H1CA 2ZUVA 4Y1EA 1E2FA 3IMFA 3DV2A 3G88A 4J03A 2UYHA 1LI4A 2Z8YA 1GDTA 4BV8A 1YJXA 1OB5A 4KMRA 1L4UA 1VPLA 1AZLA 3TZKA 5GONB 1KYIA 5GP1A 3DHEA 4EI8A 1XRPA 3JPWA 1T1EA 3VKWA 1YTLA 4IFIA 3AG5A 3Q7PA 3V4OA 3ZY5A 5JNTA 4ZMSA 4YDRA 2QRLA 2XT0A 3CM0A 5JLJA 1AG9A 3MUNA 4HQFA 1OT5A 2BR5A 3GQVA 5TF0A 4B9AA 4J91A 4FWIB 2L2QA 4HAIA 1NMZA 3AJRA 2FRVA 5KOYA 1BA2A 1CR0A 1U8XX 5HIJA 4Y6PA 1LBQA 4LWPA 3WHIA 1L7NA 2QW1A 2WM8A 1DXHA 3ENKA 3H9GA 2E5FA 4N7JA 4WZ6A 3KXDA 4TX1A 4YJGA 5FWXA 4EHFA 4J3FA 1VTKA 1JMVA 4ZQIA 1QDUA 2B9EA 3E3OA 4U7WA 2FX5A 2X2FA 1JHQA 3MLBA 2ENUA 1JA9A 4RFLA 2BFEA 2D4AA 2YXLA 4R1LA 2VSYA 4TRMA 2XUOA 1C7JA 2M98A 1GY8A 3A2MA 4DUPA 5K8LA 1JZTA 3LYLA 4PHHA 3WOHA 4Z5XA 1YQUA 2Q1WA 2PGOA 4N8SA 5F64A 4MW2A 2OOSA 5DBGA 3ZQ4A 2P79A 1I5OA 4PX2A 1B16A 1HFEL 2ZSIA 3A3OA 5CM9C 4YMTA 5LKRA 4MPJA 4CFSA 1MEOA 4TROA 4XR9A 3LRTA 5GTDA 3QWFA 5DN9A 1A71A 3WLQA 4JBNA 2YRXA 3JVVA 4LDAA 3TLJA 1H6BA 3QKRA 1LW7A 5DYWA 1EUDA 3KPJA 4EFLA 2VP5A 3EDOA 4CT0A 4CCAA 1UIMA 1W8DA 4AY4A 3R6GA 4IQGA 2P6RA 1U90A 2EF0A 4G5YA 1QWSA 3E9NA 3HEAA 2EBFX 2I4OA 4FGUA 1R4MB 3BAFA 4YRTA 2FMHA 5JSKA 3OECA 1J22A 1NPDA 5DGTA 1KVQA 2YQ4A 5DM2A 3AR3A 3MPUA 5BRAA 4ALKA 2QMYA 4W9MC 3W6ZA 3X1WA 1OTXA 1U9IA 3IP7A 3WLRA 4DDTA 1YIOA 2FF5A 2DBZA 4E30A 2JAUA 1XU9A 3I2FA 3RTDA 2AKYA 1P5HA 4EI7A 1IVNA 1RM0A 3DUFA 1ZC4A 3TLZA 2FPPB 1FUUA 1NBEA 3TIGA 4B73A 3V48A 1WW8A 1KZ9A 4S2UA 1U2PA 2FHSA 4NJMB 1NV8A 5EP4A 1JKXA 2C9MA 4FFNA 4RY9A 3ZS9A 3OOJA 4UE6A 1ESMA 3HDHA 1P8JA 5AVTA 3KQLA 1QFSA 1RZUA 1QV7A 4H0FA 1CSEE 3T9AA 1F0YA 3RYFB 4I55A 3SE0A 3L7CA 2C8VA 2JGRA 5IC6A 4MJ3A 4QL3A 4MVWA 4F8EA 3M3DA 4A0GA 4XYBA 3GH3A 4XPIB 1W5AA 2PUGA 1CS0B 3A1NA 4QU9A 3JWJA 4XWTA 5CXQA 2YJTD 5J3JA 2ATIA 2ZANA 1JMKC 1EEXB 4PG7A 3TGWA 2REBA 1TIKA 4OQEA 3QEJA 1QFMA 2QL5A 3PRHA 1YZKA 2D1QA 3C3MA 5DX0A 3VC7A 2B78A 3CE6A 2IUEA 1Z35A 1W9MA 2AC4A 2OE2A 4ABYA 3LNTA 4DUYB 2YIDA 2OESA 3ZGLA 3JQ8B 4ZEMA 2FHPA 4IV8A 5JALA 2O0LA 1SUIA 3AV0B 5KHAA 3DNMA 4WWHA 1SCUA 3T15A 1JPVA 1E3WB 4MTCA 3BA1A 1VYTA 1C1HA 3OQMA 4Z0TA 2J3HA 1QYCA 2NW6A 3C74A 3T35A 5DN6D 3N0VA 3A9VA 2GARA 4CG2A 4Y9RA 1EJ0A 5IU6A 1YCHA 4N5LA 3I8SA 3NANA 7YASA 1BO6A 2ZZKA 3BD7A 5CLFA 1NFQA 3M5DA 4LMBA 5JEDA 1KOJA 3K6SB 4RTOA 2HMYB 1TT5A 1NN3A 1U31A 3L8MA 3K72B 3VSDA 4IDDA 3WHPA 3PF8A 3QU9A 5IBQA 5ALQA 4LJ9A 2C7GA 1TK2A 2IEIA 1E7SA 1SFRA 2VG8A 1JRLA 3EXIA 4KH1A 4YVFA 3I9KA 4WW0A 4OLFA 1Q7CA 1ULAA 4EA9A 2YXNA 1JU3A 3B1JA 3I5AA 1HE8B 3FSGA 1KSJA 5GOZA 4CMBA 1IIBA 4C7OB 1DJQA 3FXAA 3HSKA 2P4UA 4JI0B 2RHGB 1UBJS 1K8QA 3CUUA 4U8HA 4P1ZA 3W7AA 2RJ3A 3GNTA 1D4OA 1FQWA 3PHJA 1RJEA 3AU8A 2GZ2A 5CNMA 4KXYA 3ZWVA 4NBLA 1R16A 3OP4A 4NE2A 2O52A 3QKSB 1WA5A 2O3RA 2OOKA 4WZBA 4A2WA 4IDGA 3S8YA 3M6IA 2FZCA 1JJIA 2WWIA 4TGLA 1FXSA 2XZOA 4LISA 1C30A 1HLPA 2P7IA 2Q6TA 1PL0A 3COPA 1BX3A 4U1RA 4YUVA 3WIEA 1XDSA 3V55A 4D7AA 3GMSA 4Z7OB 3R4VA 1YF3A 1DFGA 5HFJA 3E8XA 4D9IA 1VGQA 3UAZA 3KSUA 4RF3A 3BIFA 1FJ2A 1P0PA 3EAGA 4YJGB 1OREA 4B43A 5FWXB 5CLHA 1NUQA 1QH8A 4D9GA 2W93A 3HL0A 1OKKA 5E9WA 3I37X 5T8KA 4B09A 4K3UA 2GZSA 3FA2A 4HLUC 1PGPA 1VGRA 2JLCA 1R6BX 3D3WB 3OQVA 4MUMA 4IQ4A 4MGIR 1E2IA 4UUNA 5IT5A 1EM6A 2CMHA 1BD3A 4FHFA 1OVMA 4CZ2A 2WP0A 5CYGA 4TRNA 3FTCA 2PYZA 3HA3A 1VSUA 2Z2ZA 3BRWD 3M5PA 4K87A 4LOKA 3TZEA 3UFBA 3MJDA 1C29B 3ZCXA 2QN1A 4JUFA 1M2EA 1HRDA 5J59A 3RK0A 1PJZA 2HHAA 1KKLA 3ZNOA 2CCKA 3ZWPA 4E2FA 4MUBA 4NFYA 2CHFA 1HZZA 1Q14A 1ISIA 2IBSA 1S02A 3NKFA 2VDVE 3D8RA 3FWHA 3QUTA 4KZKA 5JH7F 1OASA 1P8AA 2JF0A 3HYCA 3IQFA 3QKRB 4PZAA 3CF0A 4W5JA 5ECYA 4P3YA 5G0SA 1PR4A 4QLAA 1THZA 1A5SB 1VSTA 1E62A 1THTA 2WV9A 3EZLA 3IHWA 2CJWA 1GKIA 1PT5A 1UK9A 4P22A 4AYWA 1VRCA 4DSTA 3H5IA 3RC3A 4IZIA 4TT3A 3D6TB 1FDIA 2FN3A 4IHQA 2QX9A 3KT6A 5D1NA 4NXNB 4L4RA 3SZLA 3HCOA 5G02A 4C2AA 5HR5A 1FIUA 2DTDA 1G2QA 2EJCA 2XUZA 5ITZA 1HDYA 1N2HA 2FN4A 3NHBA 4MR7B 1RLJA 4HGZA 3U1VA 3WO1A 4F04A 1B93A 2YS6A 4V38A 4CM4A 4CGZA 2HEGA 3F5FA 4KXWA 1P2DA 1V3TA 1W52X 2DFNA 4IO1A 1D6MA 1KO8A 1AA6A 4QYMA 4Y0VA 4YMIA 4KPYA 2FUCA 2X9NA 3BXGA 3FPFA 3NZEA 2G06A 3W8NA 5IDXA 2PX6A 2YMMA 3P9IA 3WLHA 5HQ3B 3DD1A 2A92A 1WMAA 3ZCQA 2X22A 3IVXA 2OV6A 2WM3A 5IJAA 1F06A 3N3BC 4CN9A 5GIOE 4JASB 4MS1A 2QDKA 2NU9B 2D62A 2TECE 1BHO1 3LHIA 1KI4A 4EYQA 3SU8A 1IG0A 2PZBA 3WG9A 1Z5GA 5JYBA 2IE0A 2ZROA 1YGYA 3BGVA 2M6KA 3CZQA 3TRFA 5IFLA 5JD5A 2BMJA 3OFND 2QROA 2QLMA 4FHCA 4HB0A 3NH6A 2J0SA 8MHTA 5AVJA 3OMWA 4MK4A 2H2HA 4A6DA 2WIFA 2WJ4A 3AYZB 4RIFA 4LXGA 1T9DA 1RHUA 3EMDA 3GDGA 4JOCA 2VVTA 4RIIA 5K0FA 2B9VA 5JSZA 3ESQA 3QMWA 5TQJA 4LECA 1XXHB 2AZMA 4V2UA 5TX7A 3KBBA 3KR0A 3KJIA 1NXVA 3N28A 4J1TA 4DJAA 2Q3HA 1X1CA 2B4TO 2ZIWB 4NBWA 2A1IA 1H4TA 1KQ3A 2ZRLA 4DWOA 2WSSA 2ZYHA 3O8QB 4BO8A 2KX7A 1FTWA 3JYNA 3L4BC 5TMDA 1BDBA 1H2XA 5IEJA 1RTTA 3HMQA 3ZLJA 1NXSA 1YB1A 2EZ9A 3MWJA 2OC4A 4Z9FA 1GVHA 1MAAA 5J2TA 1BGXT 1OBCA 1NSTA 1O96A 2XJ4A 3D2BA 1TT5B 3OTQA 4TQ9A 4U2FA 4ZQHA 2J31A 1CQIA 1Y37A 4KBFA 1C7EA 3F8TA 2DCMA 1HA3A 1PJCA 5IDWA 4HEA1 1COWD 2D5IA 5F1KA 1RM4A 1W7AA 2FZLA 2ONCA 4TUYF 4YQEA 4MKIA 5B7NA 3H5OA 2PYDA 3U7EB 3EUAA 1C5KA 1HOTA 1O5IA 4TT8A 1FFAA 2F7SA 4Y1RA 4G4SP 1AD2A 5K51A 1KJWA 1GNTA 1GJRA 3WK6A 4URXR 1RADA 4HK4A 3OPMA 3N8NA 4C78A 5K7SA 5KC9A 4JBLA 2XMGA 5KOJB 5BOVA 2XA1A 4ZTUB 2OLEA 2MT9A 3DH0A 2R48A 3B53X 2Q5FA 5ERGB 1SQFA 3EF1A 4COOA 4E6PA 4Y2UA 4F93B 2B34A 3DTVB 1M7BA 2WUGA 4LCEA 1GPYA 1Y5NA 3EYAA 2RGXA 1QH1A 2Z6AA 2JGMA 3NHSA 1ZKMA 4DIMA 1VIAA 2C20A 3HV2A 1QH8B 4OGGA 3KQWA 5JAOA 3CPHA 3RC9A 1CB0A 4E1BA 1NX6A 2QZPA 9LDTA 4KRFA 2JFQA 3QBDA 3W5BA 5CG1A 5JY1A 2I34A 4LPKA 1I10A 4IOMA 2I7TA 2ZJ4A 4FDMA 2A0FA 2VAWA 3BJMA 1WU8A 3CH7A 3JQBA 1A4RA 2I6SA 4K8RB 3WICA 1A04A 5A4JA 2CBZA 1AO3A 1CU1A 3T7KA 2NXWA 3UAXA 4LFAB 1WO8A 3HRIA 1BHJA 1UZLA 4WCFA 3G0DA 3HE3A 4YYZA 221PA 1BEEA 5EYPB 2YXBA 5HIAA 4FYJA 5L3RA 1W0JA 2ZE6A 1JI3A 1AKTA 3PUXA 2OHJA 4AL4A 4KR9A 4JIGA 1RIIA 1JG6A 4BJ6A 4TQUS 2PGAA 4R9UC 4DVGA 3D2LA 3LT5A 1U0HC 1LBTA 3T6KA 4M9ZA 4HSEA 4AJHA 1RI4A 1G8FA 2QRGA 1Z6YA 5LOVA 4TLEA 3KZ1E 2FW0A 1DOZA 2BH9A 3PA6A 2VZEA 4CR6A 3MT7A 1TVKB 4LXUA 1V16A 2YFQA 3I1FA 3T4EA 5ITZB 4NZ9A 2HMWA 1WHSA 4HQNA 1FQOA 4X3PA 5IZCC 1HGXA 4CM4B 3AKDA 2DT8A 2GAIA 4TV9A 5FPTA 1PWHA 3WLTA 3SJAA 4D9HA 1UPBA 2QLFA 2HU7A 2PH3A 2H1VA 5KB3A 1Z0KA 3UAYA 1E77A 4Q4DA 1PFWA 2IDZA 2VZ0A 3E5RA 3SQMA 5JHGB 4I2VA 1M10A 4QUKA 1D3AA 1GGKA 2AH5A 1PV2A 1RAHA 2E85A 3HU1A 3ZWBA 2HQRA 3BWDD 4BMPB 2CMDA 3N53A 4LE2A 3TK1A 2ODPA 1FYXA 1UXOA 3QLUA 4XYMA 5LP6F 1U2EA 4MS1B 4UHKA 4BKQA 4BWFB 1UP6A 3DZJA 4CLEA 3DUWA 1TYEB 3M2TA 1JHAA 2Y1KA 1TKRA 3PG5A 1CQXA 4HY3A 4OXYA 5CLQA 3EG5A 4ARZB 1ZU4A 3IKTA 4KR2A 4Z2YA 1GTG1 3ZGOA 3N2KB 2O0MA 1PJLA 3A05A 4LYGA 4R83A 1ORTA 1W4RA 3DWFA 3BRQA 1BEZA 4IDFA 2ZRIA 1IEXA 2GKSA 3IMEA 3IXQA 3LSYA 2F3PA 3D4BA 3ZE0B 2BLLA 2W2OA 4IQ0A 2XUKA 1R8XA 2ZSJA 4OXNA 1SVOA 1AQLA 1S9HA 4QUHA 1LC0A 5JSZB 1H5UA 3KG2A 4Z4EA 3R9KA 4URFA 4Q9JA 4Q15A 4DCCA 3KOZA 3FKJA 2BOVA 2LNDA 4HUTA 3GWGA 1E4EA 1Y81A 2H2IA 4H18A 2WR8A 1M76A 1PI3A 1L4LA 2QD1A 1E8DA 1BS9A 4FEAA 4JJEA 3VO2A 3I4FA 4M0KA 3RRBA 3H42B 3SMVA 4DKJA 5CFRA 1RQPA 2I2WA 3IERA 4J49A 1RYFA 2QTTA 1Y3HA 4QO8A 1SVWA 1YHNA 5AI0A 3PITA 4NWIA 2I9PA 3ILSA 1C7FA 1L4BA 2A9VA 1E1NA 3FBTA 1D7OA 5E9AA 2WICA 2CL7X 3G2MA 2TYSB 2A0KA 3ZZNA 3KVYA 3EZ2A 3OTOB 4DNFA 3QIVA 4M9SA 5ILGA 3WL7A 3A0RB 3ZDBA 4Q1FA 3UWOA 1D2AA 1KI7A 4YUXA 3WZ2A 2Q4RA 1KJJA 2QYSA 3WLKX 1QO9A 1EUCA 4WBXC 1VG1A 3IRUA 4KK4A 2F1JA 3G0OA 1YNOA 1H2AS 3E2PA 4EO7A 1FZQA 2DFDA 4KBGA 3SEZA 4D9NA 3IUPA 1QDLB 2P3SA 3OPVA 5A1JA 1EE9A 3ZVMA 1WCYA 3I01A 3D0OA 2CVHA 1E4VA 1U9JA 5DE3A 5IBPA 5H3LA 2REOA 3HKCB 2NO5A 3OI7A 4BWVA 4AW9A 1RXWA 3DV0A 3FCXA 4XWGA 5CIWA 3PNKA 4TLLB 1OXXK 4ZO7A 3U6KA 1E79A 1KGSA 3S5JA 3ZLUA 3ZXYA 5C18A 1EFPA 1W2GA 1X77A 3RS4A 2AUMA 4KQIA 1WR8A 1YTUA 1OV6A 1W87A 4P3NA 3A1EA 3JCZA 4QQNA 2DQSA 2JVJA 4MHSA 2AXEA 2IELA 1QH1B 2AV6A 3U7RA 1H5QA 4G1CA 1IY1A 3RRZA 1ZK4A 3AUXA 5K09A 3SHQA 3X1XA 1A50B 5CBPA 2G1JA 2I2CA 3PD0A 3E53A 1BVYF 4DLVA 3C15C 4HWSA 1E3JA 3NIFB 2HDNB 3CH6A 5KTTA 2ZJZA 3FYDA 3GGSA 4QQKA 5AM5A 4I5GA 5KKCA 1OFVA 1ULTA 2YMQA 4P4SB 4CODB 3I8XA 1MQ9A 3IUBA 3PWZA 3LX8A 2C0QA 3RAGA 3V9AA 2AN9A 2WQZA 4DLLA 4WOPA 1KYZA 1LW6E 1NMEA 1CRZA 2NN3C 2PGDA 1X2EA 2ZDGA 3V1UA 4BQSA 4WCFB 4B2LA 1K6JA 3PXEA 3CF2A 4Y6LA 1FRZA 1THMA 1FYWA 2FRDC 1CJBA 3Q5GA 4YDQA 4G97A 3WL4A 1WEHA 1GFIA 1PYGA 3PDUA 2C58A 3UC5A 1P7ZA 1IXKA 3IQHX 1P0MA 1TO6A 2BE7A 2XAUA 4R6WA 3VNUA 3O0TA 5BSWA 4C0QC 4P81A 1Y8CA 4LJ4A 5I3CA 1JKFA 2UZ1B 1GNPA 1TU3A 1L7OA 2IHVA 2RHRA 4FX5A 4Y6GB 4ZT3A 5L3VA 3O38A 1X1QA 2PZJA 4I1VA 3IAHA 3UJ8A 1TZBA 4G23A 5D3QA 3LX5A 1Z0AA 3OZXA 1IDN1 3C87A 3NLLA 2GETA 3QWHA 1OCEA 4DDUA 1RBYA 1UC8A 3CUVA 1WHSB 5EG5A 4WLFA 2ERYA 4TV9B 1CUGA 1S01A 1B0PA 2A35A 4CMEC 2MWMA 1P2UA 3MQ4A 3FDZA 4RF4A 4PINA 2IU4A 2PZ8A 3BCHA 4IIUA 4CEJB 5AKJA 3NMUF 3BGWA 2FSFA 4ZDKA 2YFYA 3HDJA 3QUBA 1Z88A 4TKLA 3NNSA 3D0RA 4HZUB 2BP7A 5SY4A 1CZKA 3H1BA 4AB1A 2PL1A 1K2WA 4YCNA 2MYTA 1MW9X 4LSZA 4ZVKA 4KNVA 4D97A 2ZWIA 1XEXA 5CM8B 4G0QA 2QE7A 3W8FA 2W2VA 4PCUA 3OOSA 3VR6D 3B60A 4GP7A 4BZPA 4DDVA 2P1RA 4TV8F 1YJ8A 4W9RA 3DTTA 3LAWA 3FYSA 3V8NA 3N1UA 2RC5A 1EP3B 2PQ2A 4HOYA 10MHA 1KL7A 1WUJS 1NAHA 1JQKA 4J4BA 5B36A 4L6CA 1QHHA 3DR5A 3X1KA 2FCRA 2P6OA 5I8WA 3ETCA 1FRQA 4OJKA 3ABQB 4ZAZA 1V6CA 2E9SA 2YASA 4WNAA 2DBVO 1XJ5A 1JFTA 4EVSA 1UT5A 3PNYA 1DBVO 2WYUA 5EIBD 4LVNA 4EEZA 1R8QA 3L6BA 1C9NA 4BAUA 4I9FA 4ESVA 1FYVA 3TIFA 4RPHA 4Q3KA 2GJ9A 2OBLA 3X1ZA 2XXAB 5AHRA 4KPEC 3G5AA 1Z5NA 1QYXA 5HOEA 1R0WA 2VR1A 2GWHA 2IW1A 2O54A 3RTBA 4DLYA 2WOJA 3W5UA 4DR1B 3KLOA 1V26A 5L4LA 3I04A 4MUHA 5CA0A 3PFCA 1IY8A 5TT1A 4JEIA 4BMVA 4KKVA 1P4GA 2OFWA 4EL5A 3SX2A 2FWPA 2OGTA 5IX8A 2WINI 3W34A 3LC1O 4GC9A 2HCBA 5FV7A 3SYLA 3RIXA 3ANYB 1XVUA 2BDTA 2V96A 3O73A 1KETA 1BWQA 1ISJA 2R84A 3CF4G 1EUCB 3IUQA 3GGDA 5CJ2A 1U2SA 5DHQA 4AROA 2JI4A 4ENRA 4B81A 3SX4A 4YWJA 4GC5A 3TNJA 3V46A 2HEIA 4UHFA 2VT6A 3WFZA 1R27A 1JBQA 5IARA 4OREX 2BY4A 4LE1A 4C0JA 1LLCA 3LK6A 2BBOA 3C8HA 4EX6A 4CT4B 4YRDA 4Z4IA 3DV0B 2HMAA 4ETIA 5ICCA 1L5HB 2G1AA 5JARA 3LFTA 1G5QA 1M1NA 3EQ8A 1XBTA 1W96A 3HADA 2ZT8A 4KO1S 1CC1S 2HDHA 3MRVA 4QIHA 3DB1A 3VR6H 2W4MA 5E2BA 2C7QA 2V4MA 3AJAA 3KT0A 4C5AA 4HC4A 4I8XA 4ATNA 1N2XA 1X92A 2QRHA 5JI3E 3GDWA 2MIIA 4PZDA 5F3DA 4DWJA 2C2BA 4LXXA 5CBPB 3OX2A 1ZUIA 5I6DA 3B6EA 3GWZA 3R40A 2DWCA 2YN0A 2NO1A 4DG8A 2Y77A 1LBHA 4E09A 5A2QA 1G2OA 4NOLA 1ZJJA 2ZRFA 3H1TA 5LXTA 2QA5A 3NONA 1DEHA 1C1DA 2O5VA 4LN1A 1K97A 4P0QB 1KE2A 4IIGA 1ABEA 1B26A 1ZA1A 2JLAA 3WGUA 3SVTA 2WRZA 1AN9A 3O2NA 5L51A 4J9VA 2PZFA 2QL6A 2ZWMA 2G5CA 4HADA 3W5SA 4XWOA 4MS3A 4I14A 1SCIA 1A8IA 3MFYA 1SRQA 4NBKA 3OBIA 4YLYA 1NXXA 1VMIA 2ID8A 3MOGA 5KWJA 1XXLA 3FOZA 1G1MA 5LYJA 2HHJA 5JD3A 4PSKA 4IJ5A 4KO4S 1Y1PA 5K2MA 4RVOA 2ZR9A 3I28A 4WECA 5HBRA 1OJLA 3AEXA 2O7RA 2OO7A 4Q02A 2Q50A 3TTVA 4EQZA 1QNFA 2G7ZA 5FADA 3KLPX 4H1VA 2UYGA 5F21A 3TIIA 4C4SA 2IS1A 2D8AA 1EVQA 3DTVD 4OJTA 1AKUA 1ITZA 2MSLA 2PWZA 3RFUA 3WBJA 4OQQA 1KVRA 3GJSA 4BBZA 3DR3A 2Z2KA 2IL1A 2ODBA 2PKEA 3KYJB 4RH1A 4WI1A 2PSSA 1H2HA 4N5IX 3TD9A 5BR4A 4WKOA 4BIIA 4QTUB 4CIWA 2F1RA 4MJ7A 4YIKA 3JQQA 3P9QA 3MGGA 3ROGA 5BR1A 1G1AA 2HF2A 2C2KA 2Z5FA 3C3XA 3FDZB 3M82A 4LV6A 4UVGA 4GM4A 1GUFA 2QR5A 4P7FA 3G8CA 1IEWA 3TX6A 1AUOA 1QCZA 4LTMA 3SKXA 3TIXB 4BB6A 5C7IO 5JS8A 1G8KA 3EZ6A 2H2DA 2BP7B 4YJ2F 2W6MA 2ZEJA 3N5CA 1YB5A 5LC1A 1NVEA 4RXTA 3HKEA 2TMYA 4G1MB 4JH0A 1HDGO 1HUQA 3JRXA 4NLLA 3ZCTA 1YASA 4JJ8A 1ICIA 4CLOA 4A0FA 1FX0B 2NZYA 2H1OA 3HVRA 3O3CA 3CZAA 3RTGA 1FC0A 3UBTA 4AJNA 5D00A 1LDNA 1XC7A 1GT6A 3FWPA 4CLDA 2C29D 4H59A 3HA5A 1SUAA 2CNKA 1LV7A 1Z2DA 1MJFA 2P9HA 3A6FA 3FVQA 1RWVA 3IEKA 3LPAA 5IJWA 2RHCA 2PRJA 2CKMA 4K26A 5FFMA 5DXAA 1Z2CA 2CNOA 1M2WA 4IAOA 4M0MA 3ULKA 3WGHA 2YY6A 2OP1A 2UXBB 5TJ9A 3I42A 1NLFA 2P65A 4MLZA 1WV0A 3O4GA 4IGKA 3TCXB 5JZOA 5ICSA 4J4TA 1AURA 4FR0A 5F7OA 4DCOA 1P6UA 2I4MA 2YVLA 5LQRA 2WKRA 4MPTA 5NULA 3KQMA 2NG1A 3N8DA 2LXNA 4FFPA 2JIPA 4O63O 1QDEA 1SQ6A 2AIRA 2CVOA 2G09A 2Z8ZA 5AQEA 5TQ0A 3WGLA 3WQSB 2BMWA 3BRSA 4HDQB 3QLEA 5LD2C 4RL6A 2C2HA 3CS3A 3RGWS 4BZQA 3BD6A 2OEPA 2V5UA 4J7UA 5HM8A 4NR0A 4EF5A 4KU4A 2YZMA 1O57A 5IP5A 1P1RA 3PICA 5AK0A 1BFUA 1W49A 2J3EA 3MAAC 3RFVA 3WB2A 2XYVA 3U9TA 2B7CA 4Y2RA 2YMPA 1XGKA 3L8CA 2Z3VA 2QTNA 3II6X 3IOMA 1EVYA 3DV9A 2X0FA 5HRUA 3ZGZA 1I7SB 3UPTA 4R1SA 4YGYA 3AKEA 3HEBA 3UOAB 2CXQA 3GJ7A 5GJWC 2ZWAA 3N7AA 1VM6A 2IYRA 1N4DA 2IK8A 2QTRA 4QVGA 2HNBA 1GQOA 3PEUA 4XUCA 2P1DA 2RDMA 1TA0A 1Z26A 2AJLI 2P2CA 3GLHA 4JY7A 2D7DA 1NC3A 4P7KA 2X6QA 3S99A 4I50B 5C1PA 4AY2A 1SIUA 1V4NA 4YP0A 2PH7A 3NXSA 1GTJ1 1MJNA 3AFNA 1U7TA 3AI1A 1M1NB 3L5OA 1FNDA 2J46A 4HGOA 4P08A 1T0BA 4PU0A 3AY7A 2V7QA 2BJWA 4R68A 1KI3A 5C4GB 2CUZA 2QRNA 3E7DA 2W42A 4LKRA 5I7UA 3WIOA 4LQ4A 3AL0C 4AJKA 1E69A 1BWPA 4F86A 2BGGA 3HXOA 2WSSD 4IO0A 2W90A 1KYWA 1FTYA 4N12A 5H68A 4N5NA 4XJTA 4X54A 1SM4A 4BNKA 4Z53A 4FNGA 2PGIA 5GMOA 3DB2A 1NPTO 4PNHA 3VKGA 4UBLA 2QVGA 2QD4A 4DG5A 1R66A 3SXUB 4XI9A 5LMNB 1H3NA 1GNLA 3O95A 4UXIA 1LF0A 3AFIA 1ABFA 4B3XA 3KEOA 3Q9UA 1KEWA 4IPTA 1V9CA 2Q4DA 3FVTA 4LYAA 4N54A 3ORSA 1SN7A 4EHJA 4ZRMA 4ZDJA 621PA 5L3QA 1LPMA 2QTWB 3KTFA 4QXRA 2JIZA 1CW2B 3R09A 3IILA 3NNNA 4LYEA 1UWCA 4HJXA 2PSFA 1ZESA 3DEJA 5EOVA 4G5OA 2HBZA 5AVYA 2IXBA 2Q0HA 4E1AA 5IDVA 1V5EA 5F2EA 4CM3A 1QBKC 3IAM6 3LXXA 1ODJA 2ZM6B 2EWMA 4BE7B 2QRZA 4DXAA 2CMGA 1FMLA 2J0VA 4HXFB 2YIMA 4OQMA 4W99A 5CHYA 1OXVA 1JPNA 3K0CA 4MVJG 4QZVA 1J4AA 2Q5OA 3C0KA 2O3UA 4Q4HA 4F56A 1YJAA 1TM3E 3S55A 4EGFA 3CB4A 3GUCA 4PAGA 2OUIA 2VJBA 4ZXPA 1FFXA 2BBTA 5I45A 5JRJA 1KKMA 5ALDA 3KX2A 2G0AA 3H4IA 3DQPA 1NHGA 1YACA 1EPUA 3L6RA 1XNJA 4L15A 3T7DA 4PYJA 4P36A 3L7JA 2NVUA 4QC2A 3QW2A 4QHSA 5LNK6 1VHDA 5LDDC 1HL7A 3M0EA 2G9NA 1QP8A 4QYXA 1SXJA 3LYUA 4TYPA 4FYPA 3P9XA 4C7MA 5LJIA 2EGGA 2QQEA 4L51A 2ZJYA 2MSNA 4LBZA 4QYSA 2R47A 4IDPA 4L08A 2JFBA 2YY5A 2OHVA 3FSJX 2NYAA 1NOKA 4KDEA 1NN0A 4C3UA 4JZYA 5EUCA 2PLAA 2QOEA 3ZX5A 4AJJA 4PO3X 1WY5A 5JZ9A 2F4VB 3RFFA 2BC9A 2XCIA 3KFXA 1MAWA 3BK7A 1E2DA 1BIFA 1WTCA 3HRKA 4KSYA 3F71A 4XDYA 1U3WA 4KE8A 3ZHBA 1JTEA 2XKAA 4G01B 1W0JD 2V7VA 2V6MA 1VIMA 2GHTA 3OIYA 2CZGA 1GLNA 1N9ZA 3MMPA 5IXSA 5A7GA 2QJWA 3UWSA 3FM9A 1PFUA 2SHKA 5ERYA 1XMVA 5AKIA 4ENVA 3CTPA 4XVUA 1L5OA 3JQFC 1BS1A 1FEZA 1LLQA 3NFRA 4FZVA 1N34B 1JR2A 4WESA 4CIYA 1YNSA 1SULA 1T9ZA 2EJBA 4M22A 4FFRA 4U5XA 1IOVA 3LYHA 3LOPA 2DWPA 1SG6A 3N39C 4K1LA 3C5CA 4Q37A 4OHKA 4ZVPA 2DZDA 1T8PA 1VC2A 3SF0A 3OJCA 3P2EA 1V6SA 3CTMA 5BN5B 4CV2A 1F60A 3VRHA 1XJQA 4Q4CA 1PO7A 2HT6A 1U4OA 2EW2A 3WRXC 4B6QA 4I1PA 5B4UA 1Y89A 3DLHA 1P9LA 2ZWPA 4G5QA 3OX1A 1G4UR 4RX1A 4EJ0A 4YHBA 1P7CA 4OHZA 2J9FB 4HWRA 4INJA 3QG5A 3MCWA 1WU7A 1VIVA 4AT1A 5AK4A 3NHLA 1B74A 1ISMA 1YZFA 1E9EA 3A9RA 3JYHA 4XM0A 3HN7A 2AX3A 1MRZA 2O2SA 3EQ9A 1SA0A 4OGWA 5D84A 2HUNA 5A4DA 3S8EA 5KO2A 2H1IA 2XD4A 3A2NA 1US8A 1VGVA 2BUBA 1HH4A 2VXBA 3KJEA 1P0QA 3RC2A 2CY0A 1NWCA 2GO7A 1V96A 2FJ0A 2H9IA 3LZCA 3FWKA 3GLHB 3DDZX 5ED4A 3JSAA 4I5EA 1YAHA 1HKUA 2YW9A 2PCJA 3ESBA 1RWWA 1UP4A 3F5MA 1SZDA 1Y7PA 3WQRA 4MXDA 5CITA 2PWBA 3N7UA 3VU0A 1FDUA 4G8JA 3AKCA 3RVKA 3WRVA 4BVJA 4ZKDA 1GZ7A 5HOQA 5LLDA 2WJIA 3SBDA 4F72A 3AP3A 4EEKA 2C3MA 2IXEA 4RFSA 1VSQA 2NPIA 2VWGA 1OA0A 4L4SA 3ORFA 4CCSA 1F6BA 4RJKA 2XNCA 1DO8A 1UJBA 3QFRA 3O8CA 1OYYA 5DVZA 4LF6B 3QSYA 5K3AA 2V8OA 5M5BA 3I6BA 4EATA 3WMFA 4CKCA 1W46A 2A0XA 3V8VA 4NJEA 1U0OC 3N75A 4W4TA 1CQWA 2HO5A 1OAKA 4AMVA 1BX1A 1RC8A 1T15A 5D87A 3EIEA 1JSXA 1G63A 1VBNA 3AUFA 2BM9A 1VKJA 4QKQA 3QHQA 3ITDA 2AI2A 4HGPA 3ZHUA 1QCDA 4YTEA 5AKHA 2XF2A 5L3QB 1MC5A 5SZIA 1PJBA 2HCFA 3PR1A 3Q3VA 3IAXA 1W59A 4QTZA 1S3IA 3DHVA 4MQFA 1DBQA 3LLUA 5ULLA 2HU8A 1PZGA 1ZOLA 2O5EA 1QXSA 2GEKA 4INOA 2YINC 1V1JA 5JO0A 5EMNA 4JQYA 2J87A 1CF2O 1UC9A 4L5BA 4RKEA 4DR6B 1P4JA 3H65A 4YJFA 4JFRA 2FF7A 4V0MA 4HX9A 1G9XA 2BUAA 2ONZA 3DLIA 3MTBA 3Q3JB 4N40A 2EEPA 5F1YA 4YCMA 1L5FA 1R7RA 3ZNPA 5JBNA 4PG6A 2NZJA 4FKBA 1NF9A 2GPYA 4MIYA 4E5UA 2Q5QA 3GA7A 2PE5A 3RS9A 2WM9B 1G8HA 2G8NA 1J24A 1E79D 2AF4C 3RASA 3RSCA 1MNQA 1PHRA 4Q4HB 3T06B 4B85A 4C08A 6CHYA 1CRPA 5J9FA 2NMVA 2CCJA 2NV6A 5E1OA 4BPRA 5IS2A 1A95A 4PVCA 4CF5A 3D6VA 1TCVA 1VG9B 1DBRA 1YE3A 3DO8A 4MQEA 4MI6A 3LIPA 2C0PA 2VA8A 1AKRA 4MCIA 2HU5A 3F6YA 1UBTS 2R65A 2PU5A 2FPSA 2L0XA 1Z6AA 3G8YA 3VO1A 3U0BA 4IUBS 2CGEA 2NVWA 3A1TA 5E3HA 1SXJB 1TF2A 1XTPA 3K6JA 4OXXA 1YS6A 1HDOA 1SOUA 1XHFA 3P45A 3LKZA 8GPBA 5UKDA 1PZFA 2I2FA 1SVLA 1GVNB 1W1UA 4LK3A 1K3TA 4YRRA 3DCIA 2CW5A 2XQGA 3EXHA 4X1KA 3BWVA 3B48A 3PQCA 4GBGA 1VPVA 4FCCA 4CVNA 4YPOA 3V8EA 3QUAA 1AQIA 1RJWA 3H1EA 4D0GA 3AESA 4CWAA 1JHZA 1SURA 3E5NA 4AJ4A 1TU4A 2HSZA 4DIKA 3CX3A 1FZTA 4M1OA 3DEIA 5I8PA 2ATVA 1TA4A 2IKSA 2YZ2A 4YO7A 3A6PC 1DLJA 3GU3A 2I6GA 2ARKA 1GQ2A 1HX7A 1MXFA 1J2TA 4R31A 2BVNA 3P2YA 1T91A 1ZU5A 4C2UA 2LR0A 1EG7A 3O3MB 1W5TA 4G4JA 3LUCA 3U3RA 1SCDA 3AG6A 2IUSA 1F2DA 4QHTA 3WMWA 3DLTA 4A0HA 1G6OA 2AQKA 2W70A 1GAJA 3AR5A 3CPSA 3CPEA 2IW3A 4JKOA 3RJTA 4HGQA 2A0UA 2WMDA 1K06A 1JLHA 3QU2A 4HMOA 1Y9AA 2I6XA 1XRMA 3I2GA 3RAEC 1FSSA 4UEQA 3F6RA 3QI7A 3ZI0A 1YA4A 5DHFA 1JMYA 2UXDB 3IVMA 1NASA 2EFGA 3FOBA 2UXCB 1CUSA 2XQJA 2Z2XA 1X1AA 4ITVA 5TGDA 3VH1A 4JI2B 1F0NA 4UOEA 4MCJA 4MYRA 1DG9A 3OZGA 4K8OA 5FA5A 1LQUA 5FEMA 3EEQA 1M34A 4KE6A 5EZ6B 3RJ5A 1J1UA 3KR1A 2CXXA 1BKSB 2VHXA 3WGYA 2XYHA 1KDVA 3CH4B 1G2PA 3DLCA 5IW8A 1KVSA 2XRYA 5EQDA 1SA0B 1Z73A 1NW3A 1WUYA 4Q3NA 4MWSA 1YZLA 1PTJC 5ALIA 2QE7D 1US8B 1MB3A 1KK2A 2PFSA 4D8VA 1PJRA 2JI8A 3U4AA 4AP9A 1TD1A 5AI8A 5LMCA 3RS2A 3WP0A 1ZMXA 3EG9A 1N1DA 4D6PA 3LW7A 4G65A 3EQZA 4S1PA 1VHTA 1SY7A 1JHRA 3MJCA 2PS9A 4TUYA 3THOA 2VHVA 5FUMA 5C32A 3NJ8A 4K9MA 3ZJVA 4HH0A 1LJLA 4V3CA 3TQSA 3VTAA 1FUKA 4RFSB 4IDNA 1R4ZA 3R75A 4D81A 5BW4A 3V4SA 5FTLA 3U7GA 1OLUA 2BCJQ 2E5LB 5DYTA 1IJBA 1UOOA 1CUHA 1HV8A 2GN9A 3OM1A 1K7CA 2RONA 4CKCB 4AAYA 3UAGA 2GZAA 2ID9A 4NJEB 3V2GA 5B3KA 2OXTA 3WBBA 3GG2A 4MJXA 1OH6A 1UAAA 4H35A 3RYCB 4JKIA 4BQIA 4KE7A 4L85A 2RAPA 1E99A 5E4TA 4L02A 4IFTA 1Q3HA 4PONA 2YS7A 2Q4EA 4J0CA 3SIRA 3SZGA 1CEXA 1ZIXA 1UXGA 2OQIA 2WAAA 3C7TA 3CBQA 3MJ4A 3P96A 4HWTA 4E5MA 2H4WA 3WSVA 2MR6A 2P35A 4FONA 3AUUA 2FSIA 3A6GA 4JL8A 3NVDA 3C2QA 1AMUA 1FX1A 4MP6A 2PL5A 5I9MA 2ACEA 5AW9A 4AURA 3UJPA 3ZE9A 3K0EA 2IKQA 2LKCA 3GZNA 5JDCA 5LUBA 4G85A 1V11B 3JY6A 4ACBA 2X58A 4HDOB 5B12A 5TB5A 5EJ5A 1RMTA 5JCZA 4Y7CA 4M89A 4XPZA 2QMZA 4LHSA 5HE9A 4Z1MA 2WFMA 3P5SA 4C5BA 3QA3E 5EQJB 2XWPA 3SYNA 2FJPA 4UFOA 2PUWA 5ICEA 1GPJA 3GDOA 4EG4A 4H0CA 2VQSA 4W1RA 2W22A 1OYOA 4IH9A 3THRA 1I0IA 1MFPA 4IVQA 4R0MA 1TJYA 3CVWA 5JH7B 3WMGA 1J39A 1E9AA 3V7NA 1XKTA 3CKYA 1CUEA 1JIVA 1CP2A 4XM2A 1S96A 3TW0A 2PWYA 3HXTA 1SMKA 3IS3A 4BEVA 4XGIA 3ZDXB 2QV0A 4OOFA 4I99A 4EARA 4F4DA 1EB9A 3AR9A 2HA0A 3FFTA 5DNYB 1NVXQ 1DXOA 4CLHA 4UQOA 2VJDA 3RSZA 2CYAA 2F3RA 1X38A 2JAHA 1X7ZA 2PJZA 3GJXC 1KHHA 1VXOA 2O3TA 5C7LO 1KO5A 4BTVA 5BURA 3LK7A 3AEYA 1MG5A 2F00A 4NMMA 3BTOA 4LCBA 5H59A 3GLGA 2J3JA 1HQDA 2Q5LA 3FF4A 1J09A 2JFZA 3R3UA 4TTPA 5EE9A 3H1AA 3AESB 1P33A 1FCJA 3CGGA 1JHDA 3A3PA 3GK3A 3TOSA 4DMRA 2WTUA 3E18A 5EXDA 4PC3A 4RC9A 4TL9A 4EPVA 1ZOPA 1E5XA 2VDPB 4TKUA 2B6NA 2GI4A 5BVGA 4AY5A 1YU6A 2Y27A 3OZEA 1ZUWA 2BCGY 3AEKB 5TMPA 3L4SO 3WIVA 1AQUA 2O9JA 1U1CA 3GRVA 1ELOA 1PJ3A 2QORA 3HP4A 3PP8A 5JPIA 2RGCA 3C3DA 1MTOA 3S5UA 5IFKA 1S4QA 4RM3A 4ZU1X 1Z0JA 3T9CA 1UMBA 5AJTA 1DIOB 3SQNA 5EJMA 3QXHA 1E3EA 2Q2OA 3R5TA 1JXAA 5IAKA 3BD8A 1IONA 1Q50A 5CVJA 5CXSA 1TCAA 1BGVA 3OEYA 3KTDA 3ZQ6A 5HXAA 1EEHA 2C5BA 1KEEB 1XELA 2V7EA 4JNCA 2EBWA 1VI5A 3CRRA 4AECA 4FKZA 2ZAOA 4TWRA 1KU6A 3COYA 1K8XB 4NYIR 4C4XA 1O0SA 3FIJA 2Z57A 1DBSA 4HFRA 4QOSA 4TTIA 4EUSA 4BTEA 5EHZA 4XAQA 2FSVA 1I30A 1B6SA 3MELA 4OH1A 1WZIA 3TTXA 2P5UA 1M34B 2ZXFA 2JGLA 2YY7A 2FKAA 4JLNA 3RFCA 2BV3A 2CLOB 3PNVA 4BL5A 3LDGA 1QB7A 2BTEA 1XPUA 1NRJB 3R0QA 4X9XA 5GM2A 8ATCA 3CU5A 2OYRA 2QAGB 2QQGA 2XJ9A 5T7BA 2JJ1A 1KIMA 3ENWA 2PPVA 4PS1A 2WF9A 3FDIA 4KN9S 4KB5A 2JCBA 1A8QA 3TZBA 1RHQA 3ADPA 3IIEA 3M6XA 4ON9A 4ENPA 4CIAA 5LQMA 1TE2A 2IYOA 5AVXA 1KJQA 4JVMA 3CG0A 2VHUA 3K8ZA 1Z5VA 2EQ5A 4TXLA 2AJCA 2B30A 2AMFA 1WX1A 3HUTA 3UXEA 4C6TB 1G7CA 1CQPA 2XCQA 3JYLA 4RD2A 4HNGA 3DPUA 1RKBA 3KJFA 4UREA 1BSVA 4XYGA 1CUBA 3G2NA 3UT6A 1KDOA 5FBLB 1PQ4A 4TUYB 3TRKA 3RUPA 1GSAA 2ZUSA 1ADFA 2I76A 3BSWA 4FDVA 4EECA 2W0SA 5COBA 5HWSA 4DLRA 4L7VA 1YDGA 2H6EA 4FINA 4P38A 4YRLA 2ZYGA 3FX2A 4C07A 4D4GA 3DHNA 2ZBVA 2PXCA 1ZMRA 4X5OA 2O8BB 3EDCA 4D6XA 1WDKA 3CVXA 1FXWA 4CM8A 1DDIA 5B3JA 3PPVA 5KUTA 4UFPA 1WHTA 2GBPA 2OK8A 3KCNA 2QP3A 1AT1A 4Q3BA 1B14A 1CUDA 2VEOA 1CIJA 1RPNA 2ZRNA 4JJKA 4KACA 4MIOA 1NYRA 1XJCA 3ICPA 3LYAA 4JI6B 4CMCA 1I1HA 5EJ8A 3EVFA 3IH5A 3AQIA 1K3FA 4MJLA 3UCXA 4IVRA 3PQ4A 1TGYA 1C0LA 2ZRQA 2XPCA 3GPCA 3G02A 4HS4A 1SXQA 3ZXSA 4X8LA 1ZMBA 4A2CA 2VP2A 1MFZA 3AILA 4E5DA 4IJWA 1HDXA 3NNDA 4NF2A 1VKZA 1UZAA 2C4HA 2BZ1A 2HF7A 2Y1CA 1C3JA 3DKVA 3GZNB 3MD9A 4R2WA 3HCCA 4UUQA 2V7TA 3N59A 4EWLA 2PNFA 1EDZA 2VH5R 2ZVDA 3WL6A 3HPQA 4UTRA 4YXWA 4U9UA 5HJ2A 3WQBA 4YAEA 3NYIA 1BHQ1 3D5QA 5TT0A 2XZLA 2IC5A 3ZQJA 2NUAB 3SJBA 4BNHA 1LDMA 4LSGA 3WNVA 4ALNA 3VVCA 3RM3A 3V4LA 3BXZA 3MGKA 3I2YX 1L8LA 2J3IA 4OM8A 2DHEA 3R8CA 1RFGE 2ZSEA 3BXFA 3HBJA 5TPZA 4D02A 3MWGA 2GERA 4KK3A 2Y1LA 4MUXA 1RT9A 1S2GA 4BO3A 1PUJA 2C1ZA 3NHFA 4QJIA 2CHVA 2R3SA 5FHQA 3TJZA 3IR5A 1KJ9A 2VJPA 3AUJB 4UCXA 1PNQA 1R6UA 2V9PA 2Y0EA 1CYDA 1ZQ1A 3KWJA 3MOIA 4Q5IA 4QXOA 2Q29A 1X7ZB 1YJCA 2AEMA 2WWTA 4DNPA 2QBYA 5IT0A 4ZYTA 1U2GA 3N76A 1AGYA 1FA9A 1JSCA 3IP9A 1M6EX 2W8BA 2WK1A 3MB5A 3HWSA 1L5QA 3F1KA 1GR0A 4G1UC 3GLGB 4G89A 1D2RA 2JIZD 3NX4A 2OENG 4AG6A 1X74A 3GH1A 4FE4A 2ISSD 4DRZA 1DAKA 1MGPA 5PGMA 5AFSA 2BFOA 5DZSA 2F3UA 5P21A 2IV7A 3UMBA 4PN7A 1FB5A 4CEIA 5ES3A 2IYEA 2ZUUA 1PDOA 1FU4A 2PR7A 4OP3A 1EUQA 4TKUB 1XZFA 2FN7A 2YOGA 4P5EA 5DBHX 3VM6A 3KQSA 2ZUDA 1Z0SA 3L18A 1T24A 5LP6B 1P4AA 4HDRA 1NY6A 5NLLA 4C30A 3NBQA 3NCTA 5C81A 5DTEA 1X0XA 1M2NA 4K1XA 4Q1AA 4DJFC 3IEMA 1FDSA 1Y5MA 3LUAA 4HD8A 3OH8A 3W06A 4W5NA 3R0JA 2I4LA 5FTJA 4AYXA 3L05A 4TV8A 5BMVF 4EHNA 8ABPA 1EFVA 1RRKA 1XPJA 1SXHA 2X6RA 5DJ5A 5JLAA 3WKEA 2ZWOA 3CNNA 1IAQA 1T1RA 3DWIA 3NS7A 1WTAA 4M46A 1U0SY 2FFRA 4EBBA 1PDWA 4Y2HA 3T3DA 1DJLA 1R4AA 3NIGB 2IV3A 4AMUA 3OZUA 3SDBA 1SXJD 4OP1A 3PPWA 1RHMA 2ZRDA 3UO8B 1MV8A 4J9UE 2JS7A 4A26A 1YE5A 1I3OA 3A11A 4C05A 1GM5A 1MC4A 3W79A 2JCVA 3KFVA 3GUHA 1PHPA 3OOWA 1GZ4A 5I7WA 1XMQB 3CVUA 4UEJA 1B8NA 1T10A 3UWDA 1T8UA 1A7AA 5HIMA 1IWBB 2YHSA 2EL9A 3I4LA 1IRXA 1RWOA 4ZAFA 6REQA 4BLQA 4HLDA 2ZOSA 3A3YA 4YRMA 1QSGA 2XYQA 3UJBA 2W0MA 1R9GA 1LK7A 2Y99A 2CHEA 4WRRA 3Q9LA 1L4HA 3ND7A 3EHDA 3R7FA 2JLQA 2OCAA 2RHDA 3GXOA 1KP9A 1C9MA 2FETA 3N70A 1BJTA 1GGHA 3OZWA 4YI5A 2JLUA 1A69A 1XHLA 1O1YA 1Q5PA 1XTTA 4WOCA 3TXXA 4BNYA 3ET4A 3SM9A 7REQB 4YFVA 3UZUA 1P1BA 1TX4B 2QTMA 3OCVA 3UHAA 4BRWA 4EFMA 2BHRA 1AMOA 2E3JA 3H2SA 3OKPA 4G4GA 5I7OA 2GXUA 3UHJA 4MW5A 4FYKA 3ISTA 2NX2A 2P68A 1XMSA 1D9ZA 4NKRA 4DPMA 4RCYA 3AKZA 4JLBA 5EPUA 3H17A 5H02A 3I12A 1KPGA 2WY2D 1MVOA 2EZ4A 2IWHA 4CYMA 3LLSA 2W83A 5LN1A 4CM8B 3O8DA 4AS3A 1II8A 5DI3B 5HKLA 2EF1A 2NTVA 4FNOA 3SQLA 2IT1A 4GRAA 4CL0A 5JSUA 5LL6P 1E0AA 1TJ4A 2B21A 3WDMA 2E5WA 3W7BA 1N0HA 4PGHA 4D8XA 4RVSA 2WC1A 4HFMA 4BU0A 5EA2A 3LY5A 3THYA 1PL6A 3LDUA 3PHLA 4DEXA 3C1OA 4K6CA 2QLNA 3O8RA 1RP1A 2DQKA 1T2AA 1ZD8A 3ER6A 3LRXA 4HPWA 1KXJA 1HTTA 1S8NA 1O94A 2R85A 1N6OA 3WDSA 4LFBB 2IU0A 3A4MA 1J5XA 2BI4A 3CNHA 3COSA 2ZT6A 1SBYA 4MIKA 3L8GA 1FW8A 2HM7A 4A10A 4BVFA 3TS1A 2E21A 2NSHA 3TVDA 4M0LA 5JWOA 1IUOA 4G1FA 4MINA 4N0EA 5CCDA 3BIJA 4UHCA 1QVAA 4RXUA 4TLAA 3ZTTA 3QX7A 3FR8A 5CH5A 3MCUA 4GLBA 2UZ0A 3PJGA 1JF8A 3C85A 2XIJA 2IS2A 5BNZA 2AEJA 2D2FA 1R0RE 3T1NA 4FYXA 2XTNA 3R76A 3MFQA 1BXZA 3QZUA 4TTRA 5IKOA 3WDKA 4BNGA 4C7VA 4D96A 4EG5A 1KTIA 1F7VA 4DOMA 5ALWA 4JSRA 4R51A 1WUKS 1O4WA 2ZTVA 3B1WA 3V1NA 4NXMB 3NEJA 3CUKA 5HF6A 2AEEA 3NM5A 2IYTA 4GOMD 3N0RA 1Y1SA 4R8VA 2ZRAA 2WTNA 1P18A 1LS1A 3ZU5A 3N0WA 2VWQA 4M1ZA 3MBIA 1SZPA 4WQMA 2RKWA 4N3AA 1JFVA 1C80A 1RSZA 2CL5A 5IWAB 5AP9A 3CG4A 2HU2A 3SY8A 4Z0PA 4BE4A 3I9JA 1OU0A 3EE6A 3I32A 5DF1A 4UASA 5JXIA 3BWEA 6NULA 3ZVNA 2O2IA 4IG4A 4MTLA 3GVCA 3LD9A 4JYZA 3CLTC 3U5TA 1J33A 5DWQA 1G8JA 3NIWA 4OSEA 4TXMA 5AMXA 3KTOA 4YRIA 3ZUGA 2QT0A 1IM8A 4JL6A 3CSUA 4O1IA 1OYVA 3T3IA 1DEOA 3TG2A 1CRWG 2HHCA 3DT6A 3ROMA 3Q3EA 4BNLA 5K99A 4S0ZA 2LIVA 1RXSA 3GZTB 3ZCPA 2WJ6A 1LX6A 4B8WA 4YJ2A 2OO5A 4HL6A 5H9WA 2O0JA 4XR4A 1O97D 1KMHA 1QHIA 2X2EA 1VCNA 4MWTA 1MJ5A 4OI2A 1NBOA 3K9HA 4WY2A 3OJLA 5CYOA 3SEAA 1IZZA 5DTRA 4FQ8A 3QBEA 4RS4A 2E4XA 2UVPA 3PXCX 4FS3A 4M87A 3R0IA 5L4NA 3C5EA 2OVFA 3NHKA 3Q2OA 4TV8B 3BJIC 4TWBA 4WHMA 3S1SA 3RVOA 4KXLA 1LB1B 1VA4A 2ZSAA 2ODWA 1ECPA 3W8DA 1SEPA 4M0DA 3CZ9A 4MMXB 5KQRA 2C07A 2F1IA 4QA9A 3KLNA 4S1WA 3IAEA 4DJDC 3H9EO 6ADHA 2ZS8A 1CETA 2ORVA 3R3YA 3ZHQA 2EFYA 1I14A 4FQ5A 4EIWA 5ANRB 5EWLA 1JJVA 4YRFA 4OHVA 2YWXA 1NZJA 4G9GA 4PYIA 4Y0NA 3RF6A 6REQB 4H9GA 2WU4A 3COVA 3EC7A 3TQOA 3Q87B 1PV1A 2OO3A 3FFAA 2H54A 2JIRA 4P32A 2X42A 3FYHA 1ZHFA 4JT8A 5B1EA 1W5EA 1W9HA 2PVSA 3MT9A 3CUTA 1QC5B 2QK4A 1E4OA 3OQNA 1Z6XA 1TLLA 5L8VA 3OKCA 1L5GB 4ZVRA 3UMSA 1ZR4A 1ZMTA 3KQKA 4WL0A 5F51A 1E60A 3UJ3X 4HDCA 4J0KA 4LX0A 1KMMA 4PC1A 1EDBA 4M1KA 3RE1A 1GTL1 1ZIDA 4DSNA 1MZVA 3TQCA 1XZPA 4UBNA 1YDEA 4B40A 1PFKA 2J4FA 4EM6A 4GKJB 4PG5A 2FZWA 3IAAA 4RDHA 4CV1A 2CUKA 1C7ZA 2Q41A 3FYUA 3P0EA 4FDAA 4PANA 4WJKB 4EPRA 2VBGA 3HCBA 4Z4GA 3JALB 3VU8A 2CLKB 2CV1A 3DPSA 3HY4A 3M33A 1R0SA 1ZICA 4CTMA 1B8PA 1KYVA 1H1LA 1U5BB 4J1TC 3ZXXA 4D9BA 1JI0A 1U0EA 1PX0A 2F9FA 5HF5A 1ONPA 5H81A 1J5EB 4U63A 3ILHA 4NARA 2IVFA 1E3IA 3BFPA 2AG5A 3BKXA 3HI6A 3KZMA 5DU2A 1EH5A 2V6JA 5B1HA 3AIOA 1BKYA 4FC7A 3RBAA 4HEJA 4PZEA 1FS6A 4BU1A 4QXAA 3NDIA 4G07A 4N5HX 4K0RA 1JQLB 4TS1A 3ESRA 4KGVA 5FOQA 3GRPA 2ZJOA 3R74A 2J6HA 1MVNA 1OWNA 1QRSA 2Q7OE 2RBGA 1EBUA 1SIWA 5C31A 5EUMA 3VNAA 5K3OA 1MOQA 3SOPA 3K7EA 1NF2A 1RRFA 3FDJA 2D1RA 3LI2A 3PJEA 4FD3A 4RPLA 4I2NA 5GJVC 5GVRA 3V2HA 3GAAA 4O6VA 4E6EA 3AUAA 2DR3A 3RVSA 2A9FA 2O0HA 3HRHA 1C1XA 2Q1TA 4OU4A 1AHIA 4ZEWA 4AZSA 3NOQA 1OXSC 5JADA 4WUVA 4WH0A 2HQBA 4IDCA 1EFDN 3TSZA 4PAWA 2PR2A 4G0UA 2PWPA 4EHAA 1AF7A 2IEDA 3F3KA 3GD5A 3A9UA 2E4WA 2GM5A 4S1TA 2B5OA 4BO5A 2QTVA 2VWPA 1Q0SA 1T26A 3KSAC 4IHJF 4MWZA 4UPVA 2HW8A 1XO1A 4OJQA 4AZTA 3QYPA 2FMKA 2N47A 2V59A 3ACCA 3QLVA 1MJHA 1NUUA 2FQQA 2QVLA 3B1FA 4UBOA 3TPFA 3WYNA 4EP1A 5BQ3A 4GKKB 3UGKA 4P2GA 3BK1A 1CIVA 1NJ6A 2VSQA 3PPXA 4F3RA 4N3CA 5KU7A 3U1BA 4FUQA 4LY9A 2G1PA 3VHRA 1Z22A 4DA0A 1XNQB 2GBLC 4W6ZA 3KUCA 1F6WA 4P9NA 2L69A 3KHKA 1YR6A 2DFTA 1OBVA 4BOYA 3PCXA 1CWUA 1AK9A 1KK0A 3ZQUA 1FE8A 3FPCA 1J8YF 3A6DA 2XXBA 1D09A 2VHTA 3MERA 2Z98A 2DF8A 2VYND 3OC6A 2VZ8A 4K9PA 3ZWXA 3AU9A 3GPBA 5BOSA 1LC3A 3HBMA 2PT9A 1SPBS 1JDSA 2PKCA 1ZNXA 3S81A 2CHGA 1PZHA 2WUWE 1G5IA 5A6VA 4JJFA 3SC2A 4A8JA 1ZA2A 1I0LA 1DG3A 3NIDB 2QGNA 4KXVA 3I1JA 2EJWA 1PCXA 2IXAA 2WPDA 3HBFA 4LZWA 3U49A 2FFQA 5BN4A 1ILEA 4FBMA 2DSTA 4YJ2B 2R2GA 1NNLA 1Q11A 4MUJA 4Z1MD 3TSYA 1KMHB 1W8IA 3MWYW 3QFTA 2FW7A 1TF5A 5HQJA 4ENTA 4KFCA 1IHUA 3H99A 3BUSA 1WSAA 3KU1A 3UOWA 1NAIA 4BJ3A 1KERA 3L7BA 4BLTA 2WNSA 1Q1AA 2XGSA 1VJ0A 3PUHA 5FP0A 4DN6A 3A10A 1JB9A 2VDJA 4AJOA 3WWZA 5BPHA 5IYZA 3IUMA 3DG9A 4KP7A 1BCRA 5F12A 4N76A 4XXHA 1GDHA 3E1SA 1NXTA 2P8JA 1Z6TA 1E3DA 3A32A 3EQ2A 2GO1A 3KYDA 3LU1A 3UFXA 2IU6A 1U3CA 1UPTA 2Y9MB 2YNMA 3R7LA 2F3TA 4BGVA 4FGLA 1S2DA 2QYOA 3I2HA 4JSYA 5FBKA 3UK7A 3B6MA 4J1NA 1RRMA 3OURA 4U7FA 1H5NA 1R5JA 4I81A 1C3EA 4KRXA 5JO9A 3SNKA 4OK3A 1KBZA 4U7GA 4DV7B 4NL4H 3UTCA 4BUJA 4WBNA 2EL7A 3FZYA 2CFSA 4MV7A 5B3AA 5IF3A 5KPDA 3NAGA 3FROA 3WGOA 4UCWA 1M2FA 1T8SA 4IIJF 1G5FA 5DLYA 3EIHA 2OHHA 3R5XA 2ZI9A 3GYBA 1D2CA 3VSEA 3BE8A 3IVAA 4B5LA 2JLVA 3FHOA 1XG5A 8AT1A 1CE8A 3M5WA 1KO4A 3I34X 5D3KA 4CDNA 3TNYA 3TVYA 4B3SB 3GELA 3IAM1 3GGJA 4E7OA 3JX9A 1X14A 1Y1TA 2COEA 2X13A 3RUFA 4WZAA 1L7MA 5FULA 3BULA 2D13A 5AKXA 2XKJE 4CG3A 1V45E 3UUWA 1Q91A 2BEVA 4L4XA 1MIOA 5JJBA 4D3SA 2ILVA 3FYUB 4WERA 2ISCA 3GRYA 3IHLA 4L8VA 4MH0R 4MB6A 2RBKA 2LCQA 1IN4A 1JDBB 3HGMA 1Y6FA 3BL6A 2FMTA 1C3OB 2FE1A 1KC1A 1R6VA 1MRSA 1DC4A 1U28A 3GLHE 3I5MA 4Q39A 4ZN6A 4URYR 1C4WA 1H1LB 3K8OE 1D5CA 4B3MB 4FOLA 2VZ9A 4HG2A 3S7TA 3L1KA 2JBAA 1IJEA 5LNK1 5LMZA 3LVBA 3LSTA 4PIMA 2HT1A 4MULA 1Z07A 3RS7A 2JLZA 1R6XA 3NJRA 4IM7A 2V0NA 4IIDA 3RIHA 4KLCA 3F46A 3IA7A 3A58B 2ZUEA 1U0GA 2HR1A 1MO3A 1U1DA 2D06A 3ZOKA 5AHXA 3RSHA 4CF4A 1XR3A 1RCTE 3AOGA 2JJ1D 1D2MA 4REMA 1MF7A 3E1KA 3OJEA 2YYYA 1O8BA 5BV7A 3OLZA 5KINB 2EG9A 3WGTA 1BROA 3D1JA 3KXKA 1RJDA 2RI1A 3LT4A 2P30A 2IP2A 4NG4A 3VYSB 1T29A 2ZIFA 3K5IA 3GVHA 1HQYE 2XE8A 3IE1A 2AN1A 3SXJA 4MUKA 2C2GA 4RO0A 3OU6A 4LYYA 4YAFA 1Y1RA 1DAFA 2DXIA 1GO2A 1LI7A 3PZBA 4PBRA 3QW4B 1XRRA 2H2WA 2Z4TA 2UZAA 1ISHA 1JHVA 3D8HA 1LRKA 3IPRA 4AIRA 2XH8A 2QTVB 2QUKA 3A04A 4FHDA 2ZVJA 5EMHA 4G56A 1CJSA 4MI3A 4W5HA 5KSYA 1EGVB 1GSIA 1P17A 2XECA 3CA8A 3IOEA 1WVMA 3FPHA 3JAKA 4IEEA 5CLLA 2HRCA 5BQOA 2DR2A 3HC7A 4A5SA 3G2QA 1MQSA 3W90A 3AV3A 1QQAA 1PR1A 1TYCA 1JHMA 1H6AA 2QUAA 3GIWA 1W29A 1YJBA 3WB0A 2ZBFA 2WTBA 5J5VA 4A23A 2BN4A 3MOSA 4U2KA 4X45A 1J0CA 5HNKA 4CM6A 2CD9A 1BHSA 5D7NA 1E7RA 2BISA 1WMEA 1WKCA 4O0MA 3X1YA 4YCAA 4TKVA 3USZA 1YZHA 4H7HA 2CNDA 1Z4OA 3IE2A 4JU8A 4C3OB 4QM6A 1UPUA 4HVCA 1TVMA 5FBWB 1NULA 1EYZA 2AFIB 2GM9A 3AR4A 1I32A 2SKDA 4D92A 4DYHA 3ABZA 2AR9A 4RTJA 2I0FA 4NNJA 1Y3AA 4NHEA 2V45A 1SXJE 1UDBA 4GKAA 3M9WA 1JEYA 1FLVA 3AHGA 3N2NA 5E3IA 4XFJA 2Q3JA 2WD7A 3D54D 1SCQA 1H9AA 1U7XA 1H22A 1Q0QA 2PUJA 2YUIA 4Y2SA 3X44A 4M76B 3BN3A 3FBWA 2FUEA 3VNVA 5HCNA 2G5GX 3DZBA 3UH1A 4Z54A 3PXXA 3QV1A 1XDGA 3QF4A 4NHOA 5HMLA 1JA1A 3RHFA 5D5QA 4AQYB 3QEBZ 3CF4A 3QEAZ 2VP0A 1YONA 5TPZD 5IKPA 3SBOA 3F98A 2X41A 4UNIA 1RWKA 3U26A 1IEQA 1WWKA 2FKNA 3KV3O 1KEKA 3I05A 3KYDB 4XARA 5KQSA 1T3SA 4NABA 4CIVA 4UTOA 1SCAA 5TEWA 1JXQA 1V7PC 4M1TA 4KN8A 1GP2A 4LF9B 5H4GA 3D4LA 3QXGA 3ENQA 1EAMA 1A9QA 1XZEA 2CKDA 2Q49A 4RVNA 3G9XA 5FB3A 3TTUA 1N2ZA 5JDIA 3NAQA 4JLVA 3QGMA 3OFKA 4L27A 4R81A 1V8DA 1MOZA 4MI9A 5JBQA 1J97A 2QM7A 3PIIA 3QPDA 4K3VA 3PEFA 1WCV1 2PRKA 2ZR8A 3GT0A 3E70C 3JQ6A 4MYTA 5TC4A 1AUPA 4B3CA 1U0NA 3IYLW 3ZZTA 4F5EA 3CX4A 1J1ZA 3H75A 2VTVA 2QJRA 1JALA 4EB6B 4LJLA 2W7TA 2X4DA 3NH9A 1HO3A 4TYQA 4BDTA 2FG5A 3JATB 4RD3A 4PIVA 2AKEA 3B7GA 1YJ5A 1OAOA 4IXTA 5EZQA 5DHUA 2LGJA 4R2KA 3M3HA 4M1MA 1L8QA 1YQWA 2UDPA 5C4IA 1W4BA 3LY7A 1FLNA 4OD0A 1XMJA 2ECFA 1WUHS 2YVAA 4WY8A 4JITA 4DCPA 3Q1LA 4WZAB 1LLFA 4J0HA 2Z4SA 5JCOA 5JAHA 3BH0A 4G0NA 3WIUA 4FDTA 2VOJA 1MIOB 3NYRA 4I1UA 2ORYA 1VBKA 2E4AA 1O6FA 1Z82A 1IBSA 3MGBA 3DDOA 2XXAA 1M0EA 4TMXA 1VPWA 1EE2A 2WNIA 1E94E 3AUKA 3FKSD 5DSTA 5AVKA 5JANA 4GU5A 5M29A 4PG4A 3QKTA 4PR3A 3E7WA 3PYLA 3T7IA 1E9SA 1OF1A 2EFJA 1SC6A 2HF9A 1R4NB 1LSJA 1Z83A 2KHZA 2VYFA 2H00A 1Q2UA 3U4MA 1W6RA 2XDQA 3ZIAA 4JEUA 5AW7A 3R7SA 5HQTA 1A72A 2EKZA 4ZCLA 3U7FB 4UTXA 4NC9A 1KFKB 3FOAA 1GNVA 1XE3A 4UEOA 4XJSA 1XNGA 3S8MA 2RGWA 4I6JA 1C3LA 3CFYA 2P3QA 4R2HA 2V1UA 2V0CA 4CMJA 4F4UA 3EIFA 5ALTA 3LPMA 1J2RA 3UTDA 2BJVA 2P9JA 1TLFA 4H6PA 1NLUA 2BMDA 2X0JA 2DFKB 4NESA 1DWOA 1YIDA 2CJPA 4PLTA 5AW1A 1D4ZA 2CC2A 3BEOA 3I4CA 4OKNA 4QGHA 2GPJA 3U80A 4IDQA 5CDSA 3JZFA 4WADA 4O3MA 1ST2A 2O14A 3AFMA 3D8TA 3EIOA 2JFFA 2H7YA 4B4UA 2XDYA 5K3FB 3PF9A 4YCBA 1PR3A 1M1XB 4N0MA 4H0NA 3PENA 1Q7GA 1SCJA 4JXKA 5J4YA 5BV0A 3JD3A 3C3AA 3WK7A 4RNDB 1RD4A 2H07A 2MTBA 4O08A 4FFWA 3TLAA 3V8MA 3F2VA 1BRTA 2E55A 1R50A 1JHUA 2XDWA 4ER3A 3FOWA 1HYGA 1HSZA 1W0KA 1Z39A 4ZVSA 3R7WB 4X1IB 3ZLBA 1UBRS 5M3BA 1DAOA 1A5BB 1CUFA 4H4DA 3H1GA 1M6NA 1V1MA 2OKGA 3MD0A 4I1RA 3VYRB 4V0ME 4ISBA 5KVAA 4KYVA 1P2FA 2J9YB 3GR6A 4IGEA 1H3FA 1N6KA 1UQTA 3DDNA 1QYWA 2FEKA 3AQ4A 2JIBA 3MJFA 4GECA 5BYJA 4EW2A 4GG1A 1JEJA 4KR7A 2QW0X 1JLLA 5LKAA 2F43B 5MHTA 3FOFC 4AI6A 2GNPA 1WKBA 1F20A 2JBHA 3QKIA 3TH5A 3OIWA 3VUEA 4PZ9A 4D0RA 4RZUA 1TO1E 3AJDA 4MOWA 3RQSA 2EATA 2XQFA 1BE8A 2AK2A 2XOEA 3NPAA 3C7CB 4IF6A 4JLKA 4ALJA 3K73O 5HDBB 4EYSA 3Q1KA 2H48A 1TTTA 1MB0A 3EZ9A 4IX9A 2BKUA 3QVGA 2J7PA 1FP4B 1EDDA 2Z6VA 4W5WA 2C2OA 2C96A 1N1GA 2LIPA 2V7PA 5BWNA 2ENWA 1UBEA 3PI6A 1Y5LA 1NP6A 1SRRA 1LWOA 4B33A 4Z1OA 1Q83A 1ORRA 1JEYB 1VBMA 4LTNA 1OV4A 3TBFA 4L16A 4KXXA 2WD7B 4TVSA 3PIDA 4NPCA 5EIFA 3TF5A 3R5FA 4BMSA 3M6FA 2F8SA 4YROA 3P0IA 4Q01A 3UIEA 1NJFA 3EVBA 3W8RA 1ZHHA 1NLYA 2CNWA 4HI0E 4LBVA 4XRRA 4ZYXA 1EESA 5IASA 1XALA 1NJ1A 2OC9A 1ZN2A 2QX4A 3R3HA 3R0XA 4HRXA 4IJ6A 3RVRA 1R5BA 2O6HA 3PRJA 1TJ5A 1VLHA 2AMVA 3ZZ1A 5HKKA 2YWEA 2GTIA 3HV0A 3Q11A 1JQEA 1NQWA 2FDXA 3KKKA 1WBJB 3L77A 3NYQA 1GNRA 4TS4A 2IHJA 3LDHA 3ZV4A 3ZU6A 4ASUD 5FUVA 4CQLB 3AP2A 3U3JA 4P5DA 1JEQB 1K4MA 1C41A 1ZOIA 5JCJD 3GPLA 1XRQA 2Y66A 1N5LA 3C14C 5C80A 4YV2A 4Y2PA 1G3UA 4C9BA 2ZYDA 5ARDA 1K68A 1P7VA 1II0A 4M7OA 1UJNA 3OOHA 3K9GA 3PI7A 3TECE 3AY0A 1WMDA 4JDUA 3GRFA 5KYNA 1MX3A 4I5IA 3H16A 4CR7A 5KREA 4PE5B 1JFFB 5JASA 1TXGA 3FMOB 3RT7A 2IYUA 1DXQA 1UKVY 4IQ8A 2WZDA 2B4RO 1IUNA 3KM0A 3N2LA 4OBBA 4NH0A 5IM5A 5KX5A 4IYRA 4ZT6A 4KFUA 3EFOA 3VYVA 1UEIA 4P7JA 4K6GA 3ZWCA 1BW9A 1DG1G 3IP8A 3H04A 1XUOA 4OXIA 4Z99A 1DV1A 4R16A 5KSPA 4L4ZA 4PY2A 1RI1A 1K9SA 3HP1A 1KDPA 3QBTA 3KLMX 4WLUA 1HE4A 1KJ8A 1HDRA 1M34E 4L2IA 4CCYA 1RYZA 2FR8A 1EXNA 2OAP1 2H65A 4LC0A 4OHCA 4WOKA 3VTZA 4MEBA 4WKGA 3K92A 3DBLB 1JQJC 2AXNA 2NZ2A 1Z75A 3HG7A 3MWLA 1QQ7A 4IHKA 1JNYA 2ET6A 4O5AA 1O9BA 4XIIA 1QJ4A 3E2IA 3B7WA 3DZIA 1RJGA 3P9SA 5HDQA 2B36A 4R1NA 2Y0PA 3NBAA 3NYWA 1FF9A 4I36A 3PXAA 2AYZA 2PNJA 2JASA 1FNBA 3GJ3A 2WJPA 1M1YA 2CL0X 2Z6QA 1J9ZA 2FA9A 3D7NA 3AEQB 3HUDA 4WCDA 5AKLA 1SZJG 5JS1A 2DECA 4JI4B 2UUPA 2IYLD 1DKMA 4MVJA 4ZCTA 1E2LA 1Z56C 1CD5A 2J0QA 1YWGO 4XEHA 3F78A 5M34A 3IVRA 2P2GA 2AGVA 1E2JA 4R1QA 1RI2A 3Q9SA 4ZVNA 2ZJ2A 4TVBA 5CYFA 4R2MA 4XQCA 3X1DA 2QN2A 2ZB3A 1GKLA 2R68A 5HIIA 1DE0A 2Q5CA 3SQXA 2QRUA 1LD3A 4KQGA 4MUYA 3RC7A 2PKRA 1UFOA 4NYJR 5CLJA 3IQXA 4P92A 4CE6A 3A4LA 3LW8A 2XEDA 4CG0A 1T0UA 2ODTX 2G28A 5TF4A