1K88A

Crystal structure of procaspase-7
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
248
structure length
227
Chain Sequence
PTYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGARCKTLLEKPKLFFIQAARGRYKIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Apoptosis
molecule keywords procaspase-7
publication title Crystal structure of a procaspase-7 zymogen: mechanisms of activation and substrate binding
pubmed doi rcsb
source organism Homo sapiens
total genus 73
structure length 227
sequence length 248
chains with identical sequence B
ec nomenclature ec 3.4.22.60: Caspase-7.
pdb deposition date 2001-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1k88A00
1I4EB 5I9BA 4NOKA 3KJNA 4PS1A 1SC4A 2QL9A 2XZTA 3K7EA 4QUIA 4QTYA 1IBCA 2CDRA 2P2CA 4QU0A 1SHJA 2XYGA 3GJSA 3UOAB 2AR9A 4LSZA 3SIPA 4EHFA 5JFTA 4QUDA 1QDUA 4JR0A 4HQ0A 2C2KA 1RHJA 1GFWA 5IBPA 4EHDA 3BIJA 4N5DA 1NMEA 2NN3C 4HVAA 3D6FA 4JB8A 3H13A 4ZVQA 3RJMA 1RHUA 4EHLA 5IAGA 2H51A 5IAEA 2WDPA 4QULA 3DEJA 5K20A 2QL5A 4IEFB 3DEHA 4NOJA 2HBZA 3PCXA 4FDLA 1NMQA 4EHKA 1JXQA 5IANA 2H4WA 5IABA 2FQQA 3H1PA 4QUAA 5IC4A 3IBCA 4FXOA 1K86A 3QNWA 4DCJA 4EHHA 1GQFA 4NBLA 5IAJA 2H48A 1QTNA 4AWAA 5LU8A 1RWKA 4QU9A 5LUAA 1CP3A 4ZVPA 5IARA 2CNLA 3GJTA 4N7MA 4QU8A 2HBYA 1RHMA 2QLBA 1RHKA 2Y0BA 2CNNA 4FEAA 5IC6A 3NS7A 3NR2A 3P4UA 4QU5A 2K7ZA 2C2ZA 2H5JA 3V6MA 5IAKA 4NOLA 5IASA 2CJXA 3H11A 1PYOA 2FUNB 1RWWA 3PD1A 1RWVA 3R6GA 3P45A 4I1PA 3OD5A 4N6NA 4EHNA 4JR1A 5IBCA 4QUBA 4DCOA 3V55A 4EHAA 2QLFA 4AWBA 3R5KA 2FP3A 4JJEA 5H0IA 1RWPA 5I9TA 4JQYA 3H11B 3GJRA 1PAUA 4NBNA 2XZDA 2CNOA 3R6LA 4QUGA 2J33A 1KMCA 2J32A 4N6GA 4QUJA 3V6LA 4D3ZA 5IBRA 2J31A 3DEKA 4D3XA 1RWMA 2C2OA 4IYRA 3R7SA 3D6HA 4ZVOA 1ICEA 2Y1LA 4PRZA 4ZVUA 2C1EA 2H5IA 3GJQA 1SC3A 2H65A 1RHQA 3IBFA 3PD0A 2J30A 1I3OA 4ZVRA 1SHLA 3UO8B 2C2MA 3E4CA 4NOMA 4QTXA 1RWNA 3V4LA 1I51A 4AW9A 2DKOA 3SIRA 3H0EA 3EDQA 4QUHA 1RWXA 2H54A 1I4OA 4HQRA 3EDRA 2HBQA 3S70A 3R7BA 1M72A 1NW9B 3KJQA 4N7JA 4PS0A 4M9RA 2CNKA 1F1JA 3S8EA 1CVRA 1BMQA 4PRYA 3D6MA 4JJ8A 4N6OA 1F9EA 5LU9A 1RE1A 1K88A 1RHRA 3V3KA 2QLJA 4JJ7A 5LUBA 2XYHA 3V4OA 2XYPA 1RWOA 3R5JA 4I1RA 2H4YA 4D3YA 4DCPA 4FGUA 1QX3A 2HBRA 3KJFA 4EJFA 4ZVTA 3R7NA 4NBKA 3ITNA 2CJYA 3DEIA 2QL7A 4JQZA 4ZVSA 3NKFA 1NMSA 4JR2A 4QUEA 1SC1A
chains in the Genus database with same CATH superfamily
2GERA 5CYFA 2XGMA 3RABA 1WB9A 2W6JD 4HSGA 3ZJYA 3PC4A 1FFYA 5BOSB 1KF0A 2HWXA 2QRVA 4O5OA 3H8SA 4BECA 5IULC 2IQ5A 1WTAA 2ODQA 3KVRA 3VKWA 2BGLA 4R9UC 3T9EA 5CVUA 1EM8B 3EMKA 3G9UA 2IGTA 4PYJA 1GKIA 3IX7A 4EI7A 1J20A 1JWLA 2H3HA 3DWEX 2Q4OA 4LZZA 5HK9A 4ECEA 5GV7A 4YMVA 3USZA 4IEFB 4HGNA 4E5SA 3KQKA 3QEAZ 3IKMB 3KPUA 4HNHA 1VJ5A 4K1LA 2OCAA 4BNHA 3C7CB 4KQKA 2ZAGA 4OHKA 1BJTA 4U3JA 2Q1SA 3GU3A 5FXMA 1VKHA 3AMVA 3HTXA 4PGGA 2A1IA 2AEEA 4G2NA 2VQ6A 3ILYA 2O0HA 5DWQA 5BWLA 3O3NB 2V7QA 2JVKA 4F9EA 5I7FA 4P6VF 5FBHA 3GVPA 2QHXA 5FO0A 3S44A 1VTKA 4CN8A 1HKHA 3C7KA 1QOPB 4TMZA 5T4HA 1KDZA 3NVMB 2CXHA 4DHWA 5FAKA 4CM6A 3K1YA 5K8CA 2ZSIA 3ROQA 3ZGLA 1EFLA 2VSOA 4YAOA 5C8YA 5THKA 2QNRA 3KR0A 7REQB 4LDRA 5FUXA 1N3IA 2J7KA 2YUTA 4PZCA 4OTZA 3PGA1 1U9CA 3N8KA 1FY2A 4DLLA 1J39A 2OC9A 2GFQA 2JD2A 1PR2A 3DWGA 1T2EA 4L2IB 1E7QA 4UEQA 5LWQA 4GVPA 1BE1A 3IV6A 4BPBA 1JEDA 3C70A 5A9TA 2VSQA 3TPFA 4PYNA 3PIIA 3NUZA 1U4OA 1TVKB 1IN4A 1J99A 2EFCB 2VJKA 3BJRA 3D3EA 5BV8A 1GV1A 1BGWA 3BA1A 4HGZA 4JBWA 2ORYA 1G5TA 1NV9A 4MCJA 2BISA 5ALGA 4MS3A 4A8PA 4CQJA 4DDTA 2ZVDA 1YBMA 2FQ1A 1DIGA 2XUHA 3HKDA 3NIBA 2ZJYA 4GQBA 1I10A 1D4FA 4RZHA 3I52A 2ZXUA 1J42A 5DZSA 4LV8B 2G71A 4FFSA 4MRPA 5AJVB 3VOTA 1T5LA 2D3WA 1INLA 2OORA 4JL8A 4JLWA 5M34A 2JGAA 4HY3A 1XX6A 3G8YA 1ZVJA 3U7QB 1KFJB 2XHEA 2HHHB 4YH1A 5HKAA 3K31A 2QP3A 4JP8A 5FFNA 1AIPA 1Z38A 2VF7A 2G09A 3AF5A 1ENPA 3MYYA 3OMLA 4BMDA 1V8FA 4AP5A 2P9EA 2H2WA 5KYXA 1FTGA 3SYLA 5ABPA 1EA7A 1ETUA 4NZNA 3ZCPA 2VRCA 4M9QA 1LS6A 1DKMA 1I4WA 2WSMA 4HFRA 4Q9IA 3MRXA 2BFDA 2XDAA 1ZK1A 421PA 1YOVA 10MHA 4RGQA 4QGGA 1YVUA 2CFIA 1MO6A 4R51A 1RDFA 2VDQB 1JJBA 1QB7A 3TZEA 1LJUA 4FLEA 3L06A 3OM0A 3HKCB 4R01A 1U1FA 3EDOA 3CLKA 5AI8A 1O89A 3H4VA 4NFSA 5GVRA 3RRXA 4DJTA 3T3OA 2CGEA 1VJ1A 2OAP1 2PSJA 4BGIA 3H9EO 4IINA 1Z5VA 1QIFA 1CHDA 1JSZA 2E4ZA 2HBRA 4PAQA 4QYXA 3TVYA 1R4ZA 1VBNA 1FMFA 3BIXA 3NBXX 2CJYA 2OBFA 1NW4A 1RJDA 3M3PA 4PQEA 1M5RA 3IUNA 3NHAA 3Q88A 3WHIA 4D99A 3UH1A 2FSSA 4L22A 2XZTA 2R5NA 3NRCA 3T3EA 5AWFC 2JEOA 2VZ0A 4P9NA 4FDUA 4P92A 1UF9A 4X8OA 4MROA 4F8YA 1XT6A 4DV5B 3WSWA 2QW1A 3LUBA 4G1FA 3DSRA 3ZWWA 1GGVA 4EZEA 3B2EA 4KXMA 4E6EA 1SD2A 2H4HA 2WC1A 4QG3A 5F23A 3IHWA 3P9RA 4ZT2A 2FTKE 1E3IA 2FVYA 3C7DB 1ZL0A 2HX1A 2AQKA 5K2MA 4F5YA 4JVMA 5A4FS 5ADHA 3E9CA 3A4MA 5K4GA 1CJTC 2YRFA 1B4DA 4ZD6A 2C7VA 1LSUA 1WVGA 1X7ZB 1TM7E 1V6SA 1Q1EA 4LJSA 5IKMA 1JQEA 3NT4A 1BN6A 4G5SA 3GRZA 4NFYA 4EY4A 3BXFA 5H59A 3SQLA 3DBOB 4RS4A 3EY4A 1CE8B 4ILKA 1IHUA 1P5RA 4H7DA 4TRMA 5D3ZA 4IWXA 3ESCA 4XE5A 4WMLA 1Q21A 4R7TA 2Q9CA 3CH7A 4CMEC 3I4CA 4PLFA 4HC4A 3E8SA 2L0XA 4QU8A 5AHXA 3DOIA 3R5TA 2R1TB 1RHKA 4QODA 3SR4A 4D6XA 1JEYB 4J4TA 4CMCA 4DDUA 3O94A 1MC1A 3WRVA 4C7OB 1FRVA 4JVSB 3X1KA 4C6TB 4A15A 2F3UA 1PJBA 1TVCA 5CVEA 4YCSA 1C1XB 3CT6A 3MB8A 4IYJA 3OEHD 3PR3A 4LGMA 4DDHA 1GYRA 2VWGA 1J2TA 3GRAA 4ERNA 4JXZA 1DKOA 4ZZ3A 4HMOA 3GA5A 3H2KA 3LC7O 2NUAB 2Y3IA 3DQQA 3ID6C 1Y3AA 3MTDA 2FRVA 4X63A 2EXXA 2E49A 1FDRA 5T3YA 1WULS 4Q4AA 3OSZA 1AKNA 3GLUA 1V3QE 2VJYA 4Q3EA 2OFFA 4EAQA 1L5QA 4LZOA 5FI1B 4OBXA 1LB1B 1IEVA 1O0CA 4GKJB 3IT2A 5K0TA 5B5SA 3V00A 4DABA 1QHNA 1MEOA 4OHCA 1J21A 5HE8A 4CGZA 4DA8A 1YBAA 5L45A 4L08A 3UJDA 3KKEA 1TIKA 1BU8A 1KP9A 1O5IA 3AFHA 2RHMA 3LQFA 4AJNA 4U7TB 4QYTA 1PW7A 2A7XA 4S24A 3OE5A 1GU0A 1ST2A 3ODPA 1VJTA 2EW8A 1ZD1A 2JAWA 1QNLA 3I8OA 4IDQA 4E1VA 4LMRA 3X1MA 1GAXA 4KPUB 5LQUA 5F9FA 1NG9A 2A84A 4A0GA 3RS7A 2HF7A 4HEA1 1S2GA 1SBCA 1ZC3A 2OVBA 4G1UC 1M2NA 2O8FA 4E21A 4ZQBA 4JITA 3VTAA 4M1QA 1KFCB 3L41A 2E5WA 4A8TA 1PNTA 4DVGA 4MMZB 5HE9A 3S1AB 4E2XA 3UXHA 1GNQA 3JYLA 3ZHTA 5ICCA 4M1MA 3EG9B 5J47A 3E7PA 3O1JC 3QKRA 5GV8A 1N9GB 1EWVA 2GJ8A 5EINA 1IXRC 4EEKA 4N5MA 1PRYA 1CZNA 3HBNA 4CR8A 1N8NA 2D2EA 2W8ZA 4IHJA 4S04A 2B82A 3D0QA 4ND6A 4CCYB 4PS1A 4IH4A 2CDRA 3LXRA 3TK1A 2X40A 3AH8A 1JBEA 2AXEA 5LBTA 1H8HD 3BE4A 2O2GA 4MLDA 5E1BA 3RBVA 4YPVA 5KEIA 1KXZA 1TCVA 3MYRA 1UQUA 4XM0A 3UCFA 3IULA 4HNQA 5EXPA 3H2YA 1U5BA 1OPXA 3V7NA 5CB8A 4RMNA 1D8TA 2J3MA 5KKAA 2Z1DA 4BUZA 3QEMB 2Q50A 2IXFA 4MHOA 3FHJA 4RA6A 3T7JA 3TD6A 3U3JA 1J4AA 3LVFO 1FSZA 5GJCA 2FFAA 5C3MA 3BF8A 4OQXA 5J5CA 2ODWA 2WM9B 1T1JA 3EIUA 2DM6A 1IUOA 4MVCA 2XCIA 3D0RA 1UAGA 4OHWA 4NYJQ 3U39A 3ZI0A 1Q0QA 2LR0A 1V4VA 5EP4A 1GQFA 2GAOA 3KPYA 2ZRBA 1RRKA 1VCOA 1PK7A 2Q9UA 3BD6A 3D7SA 3FDZB 3C87A 4EJSA 1XRRA 2QX4A 2H0AA 2E4WA 2R8BA 3T9DA 3GPCA 1KU6A 4GMHA 2ASVA 5AK6A 1DSSG 5BR4A 4FI3F 1FSFA 1Y3DE 1RYNA 2WAMA 3PXEA 1XMVA 1AKTA 4RMHA 5JD3A 3RVNA 3OQIB 3VISA 1CR2A 1E92A 4F3RA 2BGKA 2JIDA 2WJHA 1DGQA 2HPAA 3HS3A 3R6DA 5CCXA 2X4LA 4LZLA 3UPUA 1L7RA 1YKFA 1YZTA 3EUWA 1W25A 1SXGA 1XA0A 4D4HA 3ZXXA 2BMEA 4CJXA 2FSPA 4NJEA 2NU9B 3E5HA 5H3CA 3V1KA 1KI9A 4QNNA 1SU4A 5EZYF 2W2LD 4FBGA 1VE6A 4ER3A 4RDIA 2JHAA 2CLIB 3GMDA 3TAXA 2GCGA 1TKAA 3JWIA 3VH1A 3THXB 4P3OA 1Y8QB 2WLSA 3VSBA 2KHZA 1Q15A 2DBYA 1F2TB 2C9MA 2J6CA 5EIBC 2XMBA 3DWFA 2XGJA 2B83A 2PUEA 3F3KA 1TZMA 4FGKA 3KKZA 1LEHA 3WJ2A 1GO2A 2CFRA 3BRSA 1DRVA 4I55A 4M0MA 1E1DA 3H17A 3PXDA 4S3MA 1TEZA 4JBIA 1I3OA 3TTXA 2YWCA 1BG6A 1NUPA 2PZGA 3VR1A 4EELA 2R7NA 4YUYA 5JAOA 1SQ6A 1J33A 1ZNYA 4R8VA 4U63A 3F96A 3PNSA 3LSYA 4K6KA 3IIKA 1CIPA 2WRZA 3K9FC 2GKOA 2EWVA 4DLRA 1EIZA 5AJTA 1PQWA 3AIIA 3HHEA 2P11A 1KK0A 4UM9D 4Y6GB 4EPXA 5CTAA 3JAMA 2OCBA 4PZZA 3DP9A 4HH4A 3A70A 3I9MA 4RJLA 5HXAA 2WM3A 5JSUA 4XWKA 3IAM1 4G0ZA 1R66A 2GHIA 1OFUA 3FRJA 5AW4A 4L57A 1YDFA 4C08A 5A03A 4J16C 3QYAA 3CLSD 9GPBA 4MYRA 4R84A 3WGQA 3IEVA 4WV3A 2QAJA 2VYFA 2BKXA 4IQ4A 3W90A 4EI8A 1T0JB 1GLGA 3CZCA 4QTZA 2UUCB 2CVZA 1NJ1A 2NO1A 2WWTA 3DMHA 2FF7A 2GCIA 2QL9A 5BV1A 3ZX5A 4AYTA 1OJ7A 3IOEA 3FMGA 4UHBA 1ZA1A 1E1QA 1SK9A 4D9IA 1URPA 1JLMA 2X9GA 4JYAB 4FS8A 3TTSA 2GNOA 2Q4RA 4XWTA 1O9HA 1WO8A 3FPBA 3QLTA 4RHEA 1U81A 1PK8A 1QDLB 4UUPA 5ALIA 5EJFA 3ZPXA 1FQJA 4RPKA 2XV1A 1UOEA 3DAOA 3HXMA 1FPQA 2XMQA 4KE7A 1L7DA 5TQ0A 1ZOIA 3N8GA 4BLTA 4RFSB 4DUZB 4MRNA 5FWYA 2Y8EA 3BA6A 3AILA 4RNDB 5IHPA 5K0JA 3MUFA 2EATA 3BE5A 3EDMA 2O0KA 5FTJA 4ZVVA 1Z06A 4XVQA 4OMUA 4L6CA 3L1KA 1E5XA 3T5MA 3SFZA 1TZKA 4IDBA 4PR3A 2XMPA 2WV9A 3PQ3A 3S40A 3QNWA 2Z8ZA 4KQ2A 3OQNA 2PVPA 3AVUA 1KZ4A 2H48A 3MD0A 4NBSA 4TX1A 4RTPA 1MJ5A 2HA4A 4QTUB 4XSVA 3EQ9A 3DAPA 3U4QB 1Z37A 3DZKA 1P39A 3GARA 1FU8A 4KIUA 3WICA 3PTAA 4FEAA 2I29A 4BEJA 4L9RA 4MW7A 3SBOA 2VAVA 3LA8A 4CLHA 2K7ZA 4GZLA 3C3EA 5B37A 4KSBA 3M8KA 3W5CA 1OIWA 5ALVA 1Z33A 2PX2A 2WM2A 2VYNA 4REOA 2ODNA 1QVZA 1NC3A 1NR5A 2AZ4A 1TMOA 2C20A 2JKZA 3H05A 4M1WA 1VE3A 3Q5GA 5MHTA 3W8DA 1ND6A 4TXMA 1KEUA 1SU6A 3H3FA 1JTVA 1NXXA 2ADFA 2VTKA 4KXNA 3A6HA 4R4JA 3WTCA 3ZU3A 1MH9A 2OM6A 3C2QA 3R23A 2OG1A 1AQIA 3X44A 1RWPA 5I9TA 3IS3A 3KAJA 3VNVA 3EIQA 1M2VA 1FNBA 2AN9A 3QXJA 3OCZA 3FI0A 3L05A 4MW0A 3HVRA 4UTNA 4Q1FA 1FMCA 1CR4A 4G07A 3IAEA 1E2LA 3LZ6A 2EBWA 3OIDA 4RGVA 3DCJA 1R9MA 2OEPA 3PB3A 5HRCA 4OHPA 3VGJA 4B4OA 3TKAA 3C6XA 4LHSA 3RLFA 2PZAA 1H3NA 4NCHA 2JJYA 1P9OA 1BDJA 5HBRA 2W93A 3N8NA 4QTXA 3NAZA 3CLVA 2HQOA 3CF6R 3HP4A 1PCXA 3DW1X 3PF9A 4M2LA 5KUTA 4KK4A 1E2FA 4X20B 2R65A 2HDOA 1H1LA 1HLPA 4P82A 3UHFA 1KI2A 5CIQA 4CQNA 1N2ZA 4CBVA 1NUAA 1ZMRA 3O9VA 3PQ4A 4JB3A 3G49A 3VO8A 1MB3A 3ZGVA 1WMAA 2XRZA 4RTMA 4DM7A 3T06B 2C07A 1U2GA 4P83A 3AY6A 1ACLA 2EJCA 2KYRA 4KYUA 3ELWA 4HFMA 3UY4A 9MHTA 3CEPB 5IEJA 2GVNA 1MRZA 1OC2A 2OFOA 1OMOA 1CD5A 1LPBB 2FZCA 2VJCA 1N6HA 2WIKA 3CC8A 3UJ7A 1JZQA 3B36A 5TV2A 4U00A 2Z2XA 5AHKA 1SUWA 5CG2A 2C7OA 1UCFA 4PZ0A 3RHFA 2IZZA 3FVWA 1PR4A 2MT9A 3WNDA 4BFWA 3DV2A 5JEDA 2X5JO 3VHQA 3O8RA 1YRWA 1HV8A 4AMGA 1YJAA 4Z53A 3WISA 4BZXA 2K2WA 1BSVA 2GPAA 3OZRA 2IPLA 4XH9B 2RE8A 2VFAA 4Q7JB 1HDCA 2QDKA 1J8MF 1T4GA 3RWBA 5H4GA 2A3RA 1CX9B 3U13A 4W1QA 3HCBA 4DW8A 3LV8A 3OZWA 1SXPA 4BQFA 3OX1A 5IM4F 3HA3A 3BM5A 4HNRA 4LCJA 2H51A 2J3HA 2GZMA 1QJCA 3U81A 5CFQA 1MN6A 3I2IA 4ARBA 3BD7A 3BQMB 3LWNA 3DZCA 4KKVA 1QIGA 3LT2A 1E1NA 1RC1A 3ECSA 1DJNA 3QF4B 1NQAO 2PGDA 1MABA 4Q03A 3GRVA 1GCUA 1USVA 3GPIA 4TKMA 4XSHA 3PXCX 3EMBA 5BUSA 1N6IA 2AFIE 4I5DA 2Z83A 2GJKA 3EA0A 1YT5A 3H2JA 2AWOA 4NBLA 1C0PA 4PLTA 3GNQA 1Y7PA 1JEOA 3JQ9A 1CF9A 3LCVB 4M9ZA 3RRFA 4EKEA 1WW2A 3ES9A 1LQUA 1NBEA 1NJ6A 1RWKA 2YHAA 2B0JA 4MDYA 3UMMA 1XPRA 1R9GA 3IJPA 4JZYA 3VU9A 4XR4A 4OBBA 1E4EA 1EVZA 4CHTA 1K3FA 5T41A 2AMYA 4I4TB 4D8WA 1MJGM 1P31A 4PZ9A 1W8IA 1MB4A 5MGBA 3WA7A 3TIGA 4JYMA 2RI6A 2CUZA 1NZDA 1J25A 5HZMA 1JJ7A 1S6YA 2FFRA 3Q72A 3HDGA 3I9V1 4KYIB 4XTRA 4EHNA 2NU7A 4HGYA 2HCJB 4DCOA 1V7CA 4CKWA 2CEAA 2NYAA 3RFCA 1SG6A 1YHZA 1YV9A 2ZSAA 3DWIA 2REQB 2MYPA 4WWHA 5D7BA 1ZGHA 1KYTA 1BJRE 3N2KB 3A3NA 4DIKA 5JNUA 3HCOA 4KL8S 4X8LA 1E18A 4GICA 4TMFA 3SZGA 3DC7A 3HABA 1IH8A 1GR1A 2VJOA 2FFJA 5H7XA 1PT6A 3CBQA 2I76A 3MJVA 3CEJA 3O2NA 4JAVC 4TMKA 1AURA 1G9SA 5NLLA 4D3FA 1PS9A 3QX9A 5FAXA 1MENA 4NOMA 4BO4A 2D1SA 2I4RA 1R74A 1U3VA 3GZTB 1DQRA 3FOAA 3CE6A 4DV6B 2RH5A 1QP4A 2IEGA 3IUBA 4MJLA 4L8LA 5L7YA 3VV2A 4A1OA 1NGSA 3GH3A 3GCDA 4Q3NA 1O57A 1Q74A 3ND7A 4R31A 3U7IA 1YJQA 3BMCB 4ZJPA 3J81k 4GVXA 1V26A 2HPVA 2CFSA 4HDMA 4IV8A 3JQGB 1PDWA 4PLWA 2IH4A 3QW4B 1PDVA 1MG0A 2ZRNA 4IUCS 3V34A 3ZUGA 5TGZA 4FOTA 5BP7A 1ZQ9A 4RO0A 5HTKA 3UJ9A 1ZINA 3QP9A 4ZT4A 5IMSA 1V47A 3QKWA 4ONEA 1ZN2A 2HNAA 2UDPA 2P4HX 1YB7A 1W36C 5G0WA 4AULA 3V48A 2E4VA 1N0WA 4MPDA 5F12A 5EIXA 3CUYA 2J0UB 2C59A 3H0KA 3ABOB 2XUAA 4INOA 4JKOA 3VO9A 4YROA 4EPVA 3GLFB 3QE4A 3NRJA 5AQ1A 1HE4A 1VG9B 4TWBA 3AONB 4RK5A 4DY4A 5C1PA 4I50A 1OKKA 3O38A 3MELA 3RUEA 2DWCA 4OFXA 2G17A 3OKPA 5BN3B 1W4BA 4NU6A 2V7BA 4RELA 3LVBA 3BXXA 3UMSA 1DKPA 3SYRA 3AM4A 3I28A 3N6VA 1LTKA 5JJKA 2EJWA 1QDUA 3CE9A 4YONB 5ICEA 3KWJA 1KK3A 3GMSA 3TLZA 5CD1A 3HP1A 1Y33E 2R3SA 3L0OA 3ER9A 4DJAA 1CUDA 1HE1C 2Y2UA 4E4TA 2AFIB 2BGTA 4I1UA 3FN4A 5KYUB 1CJSA 3VKUA 1W85A 2XWJI 2H1SA 5DM4A 1KZ9A 1RRFA 3G0HA 4TUYF 1A8IA 5ELLA 2DY0A 2DWOA 3AR8A 4M1SA 4NWIA 2JLYA 3BHMA 1QZXA 4JOSA 1ZM4A 1ODIA 1YR9A 3DLPX 3B6EA 2BKVA 1L6IA 3H99A 5IKPA 2PVCA 1NN3A 2BVNA 1ORDA 2FZVA 1AN0A 2WFLA 3R5HA 4BNUA 2ANCA 1JFFA 3BAFA 3GIDA 1V5WA 2V7GA 3AEZA 3M34A 2BOVA 2DFLA 3ISVA 3SXJA 1K27A 1G8FA 2AEMA 1GQOA 3GAFA 2XT9A 5FF9A 3RYIB 4DXAA 3MIZA 1EXMA 3BZUA 5EWLB 4ND8A 5KCZA 3KQPA 3EF3A 4YCDA 4CQLB 5KOJA 3CG4A 1TKRA 1ZO8A 4HNSA 1VSBA 2I4NA 4B3SB 4E2YA 4Y6RA 1CJVC 2B1QA 4RL4A 5M3BA 3RVRA 5C7IO 4BB6A 2W11A 1WXEA 2ESRA 3BQ9A 4ZTZB 2FEWB 4CTNA 3AP1A 2JIRA 1BVRA 1PT8A 3KB6A 3Q1KA 1P4GA 3QWBA 5ITSA 2C8VA 2D7JA 1D9XA 5FQNA 1Z4IA 3N70A 2APJA 1YRLA 2JAQA 3N3AC 4IIJF 1CY4A 3BRWA 4F6CA 5ADUS 4DT1A 4P32A 1RXSA 3FZYA 3U62A 3ZHZA 1NSYA 3MQ4A 2EP7A 2A59A 3AVQA 1PFVA 3E70C 1KZ7B 3ABQB 1T9HA 2JAPA 2SNIE 3BJIC 3CWZA 3MWFA 3O8QB 1IRXA 2PWAA 1T5TA 3JVDA 3PGXA 2L18A 2VRBA 1IXYA 3ZE6A 1H2WA 3AWDA 3JQ8A 3H18A 4PAWA 5AJZA 3TW8A 1TK3A 4WN3A 5IAOA 5KYWA 5J2TF 4FEGA 4YRDA 3WL5A 3E5MA 4ZHQF 2PKQP 5ALXA 1BD3A 3IOCA 3R4CA 5CG1A 5B6IA 2GHQA 2G67A 4UHJA 1FUIA 1GDDA 2O9JA 1R6TA 2Y1KA 2UVDA 3DV0B 1LD3A 3MF4A 5DIFA 3ESDA 1IPFA 3PDHA 2YMQA 3HA2A 4IQFA 4GUAA 1Z17A 3JATB 3VRHA 3ESBA 4XYEA 5HMMA 4DHEA 2Q6LA 3LQYA 4I4LA 1A50B 4C20A 2P8SA 1QLHA 1XVVA 4IIBA 5FB3A 4YRBA 1UOQA 4JBNA 4R8MA 2VVTA 1PKEA 3A4VA 3D59A 1ITZA 2RHCA 2VSFA 5BR8B 4CMJA 2QAGC 3DDNA 4WCFB 4DUPA 2JC3A 4WVFA 2FOXA 5TIIA 4MCHA 2KSQA 4XA8A 1U8FO 1XCMA 1BCRB 2C1XA 3FBTA 3K94A 3JVUA 3W9SA 3OF2A 4D0NA 3MWDB 2XIQA 3OIWA 2QRHA 4BYGA 5FBLB 3EVTA 4KR2A 4YJFB 1E3QA 3T95A 2R1UA 4X6LA 5L3SB 3FDJA 1SC4A 2B69A 1BFUA 2WYVA 1YO6A 4A2CA 2XUQA 2XBMA 2B5OA 3IQFA 3LRXA 4RMIA 3TRIA 4BCCA 4QO8A 5FHRA 4LSZA 4PTLA 3HCCA 2UU9B 1ID1A 4FMCB 2V59A 3EPHA 3CW9A 4AY4A 3HUUA 5SZJA 4BE9A 1O03A 2WI8A 4HBGA 4BB0A 2EKLA 4MYUA 2HWKA 2VT2A 3OX3A 2Q7DA 4F9TA 3F46A 4I2NA 1Z45A 4M1EA 4C5CA 4GI2A 1L9KA 4URVR 2QM7A 1LPAB 1U8UA 2B21A 4H6PA 2QP9X 5I7HA 4ISBA 3UQZA 5G4KA 5BY2A 4LBYA 1M8KA 3RTEA 3BTUA 4XJXA 5AI4A 4CKBA 4OKNA 1S8OA 3AL0C 3ZHRA 4IGFA 621PA 5FBZA 5LBUA 4CM9D 2X4GA 2ATXA 4B4WA 1UOOA 3MGBA 1ODKA 1PHPA 1T5DX 1B1AA 3D3KA 3PFBA 5JG7A 3QVOA 1GKLA 3RG8A 4K28A 2BFBA 2W6JA 2FUG1 3ANNA 2OFWA 3M5PA 2X8AA 3T52A 4C2UA 3A0RB 1D6SA 3W7VA 2A3NA 2AN4A 3UPDA 1JW9B 3KRTA 2PKCA 2P4SA 3G2JA 1P5HA 2JZNA 3GEDA 2XB6A 4KVZA 4M0EA 4U7FA 2R62A 5DM70 4N65A 3OZGA 4RVCA 2X6QA 3P9SA 1D2GA 3FCYA 4LI3X 4Z51A 5LXTA 2F1IA 6LDHA 2BGRA 3TRFA 1JV2B 1N2CE 4LXHA 2R1VA 3FW1A 1R3DA 2PKXA 2M6RA 2OO3A 1TKCA 3H1FA 5E3JA 1XNHA 5DXFA 5JO9A 3EWNA 4CUJA 1N2JA 4YHHB 3NTOA 5FUMA 5IVHA 2P6OA 1YFKA 4Y2SA 1CY8A 1F38A 4OM7A 3T7SA 3G8CA 4Q4HA 1M2KA 2PRKA 1YNSA 5EXEA 1CXZA 1UBHS 2WD9A 4Z0NA 1Z0IA 4BU0A 3P0RA 3ZGOA 3QQPA 4Z4CA 1IEXA 4LECA 3RADC 3QIAA 3AOEC 3ICCA 3WL6A 2Y9MB 3L84A 2Q1UA 1B2LA 1EP9A 2FQYA 3QV1A 4FE4A 4AVYA 3N0VA 4LBWA 4WZBA 3GQVA 4G4SO 2DUUA 2Z0MA 3DMGA 2COEA 3PZRA 2FY8A 2Q4TA 2R84A 5FORA 2XUOA 2WNSA 1ZSNA 3JD1A 4JSTA 5CX1A 1GVHA 4GO1A 1RWNA 2DJIA 1OTXA 2G4CA 3TSAA 1IAVA 5JS6A 1DWQA 5ETJA 1ISGA 3NYIA 4GRIA 3QPVA 3S2IA 5FPKA 2GPWA 4Q4JB 3BL6A 1PNRA 3OT1A 3NFYA 4DARA 4A5OA 4OY3A 1GUAA 3B48A 3INGA 4FIDA 2HJGA 2HRDA 4GP9A 4TXNA 1PEKE 1C1DA 3W05A 1X1SA 4B7CA 2EFDB 5EJMA 5HCIA 4N3CA 4CCSA 1T2VA 1JSLA 1WKVA 1FRQA 2Z08A 3CGGA 2POCA 5DYIA 4A0FA 1WEHA 5TQJA 3D8NA 3WWEA 3I58A 1YUNA 4CLXA 1A1SA 2J07A 2WTAA 4FZ3A 4GSKA 3UTCA 5JNRA 3KSUA 2EW2A 3KEQA 2HM7A 3IPXA 3MQFA 3P2IA 4QOGA 4BVLA 2LRHA 1ZUIA 3MW8A 3SS9X 1Z88A 4W5HA 1DJLA 2BHLA 3AM1A 1R0BA 1R4AA 1WEKA 4LRUA 2JCXA 2IEBA 1ML3A 2FZEA 4JCOA 4ND1A 3ZLTA 4PX2A 5JZ9A 1YFLA 2JI9A 1L7AA 2F8TA 2XD9A 1ZR4A 4R1MA 5LQRA 1A8PA 5CT4A 3U4HA 5CGZA 1U2PA 3UOAB 5GGYA 4F4UA 5TARA 2FWJA 4QECA 3ZLUA 3ZQ6A 4DIEA 3CRNA 3KQWA 1U0NA 3LU1A 1J8QA 2Z2YA 1RMYA 2HSGA 2NUTB 1NR7A 3EXIA 4OL9A 1OFHA 4B4DA 2O3QA 1RCTE 2HL6A 3JWHA 3OMWA 3WQRA 2OZLA 1W76A 3JYNA 1WZ2A 2QG6A 2HOQA 4LDZA 3TUJC 4IH9A 1C3OA 3RU3A 3HO8A 3ZW9A 2FW0A 2BEWB 1RJFA 4QYMA 3UMJA 1OIVA 1L4GA 4RU1A 1J2RA 4NCXA 1H9BA 2XWBF 4Z8XA 1P1BA 4HLUC 2AOXA 4H2DA 1CQWA 4EG0A 3IAAA 3LF1A 1J06A 3UJ6A 4GPD1 3LP6A 4DREA 4EF5A 1W73A 4EO7A 5REQB 4KI0A 1M73E 3GMTA 2QXYA 3L0BA 4GP6A 4YR7A 5L8VA 2ZTHA 3BMQA 1OWLA 1Q2UA 3D5EA 3UV3A 1Q5PA 5M29A 2P2GA 3CZPA 1V3TA 1P4RA 2CL7X 1WSAA 4ZVLA 4I9FA 1XTBA 4KLZA 2F9MA 2O2HA 2SBTA 3LBHA 4DJJA 4K3UA 2ZRIA 2CC2A 2X5KO 3SCZA 3UAVA 1J8FA 3ZDXB 4BGDA 4WKNA 1JZSA 5DRTA 4P3XA 4OXQA 2R00A 3PR1A 2JFNA 2VT6A 3T41A 1DG9A 2Y76A 4MK4A 4GKKB 3ROKA 3H4MA 5HJ7A 4DA0A 5BSKA 1SQ5A 2D8MA 4ALIA 3HJHA 3UT5A 4ILEA 4C0QC 1HA3A 4D2IA 3DMFA 3T0GA 1I8TA 2NZWA 3CISA 3M2TA 3WP1B 3I32A 2R2AA 3DB2A 5B1YA 2C2OA 4IYRA 4KQWA 4YJHB 1XXHB 4FYMA 2WU1A 4DJ5X 2EJTA 2L2QA 4E0BA 3FMOB 3RO7A 4US1R 1T1RA 1XCBA 1M8JA 4KGXA 4G97A 3COWA 5B7NA 4J0QA 4KDCA 2C5LA 2W2XA 4MHTA 4RHYA 4QHTA 4IHAA 4OJQA 4OJKA 5KX5B 4YIKA 1E2MA 3PQCA 1KS9A 2O59A 3I73A 4RM3A 1TM5E 3FWHA 4LHVA 1YZFA 2VTVA 3CZ5A 3MGGA 2QDXA 4DR6B 3D9QX 4RKEA 4IH1A 1Y5MA 3DHNA 4ID3A 4JENA 4U2EA 2WAYA 3I2YX 1QO0D 5DNEA 3VH3A 1F14A 4F38A 5BXYA 4RCZA 5T4FA 4O2BB 1X15A 1JFLA 1U7OA 2P40A 3EUEA 2X0DA 1MORA 2P41A 2IU4A 1RYDA 3NWBA 1XMSA 5FPHA 2W8BA 2C7PA 1YDWA 3B1XA 3V3KA 4HZIA 2FEPA 3QWIA 3GPLA 1TJNA 5E4YA 2GN0A 2D00A 4H3SA 5JVDA 2FSHA 4BBAA 3GC6A 4PG7A 1L7XA 1DG3A 1DOHA 3F3MA 3SJCA 1XR3A 1DOAA 3ITNA 4B73A 4RCVA 4HVLA 1CY6A 1EFPA 4DMRA 1MOPA 1NRIA 2IBMA 4KQXA 4RDCA 1PT9A 3C43A 4PFJA 3A26A 3JASB 4MGEA 4ZAXA 4QXAA 3VZDA 1IZ7A 4QTYA 4D57A 1IBCA 2ZR7A 1BCSB 3SYNA 1M2GA 2NO5A 5F2EA 4AX4A 3U5TA 4BN4A 3EPKA 1XVLA 4KAFA 4TS4A 4F21A 3L04A 1TU3A 4F5DA 2EWMA 2CF5A 1MDBA 3A4LA 1ZD2P 4Q48A 4W5RA 1N6LA 5JSZA 2VJNA 2CZQA 4TYWA 4FR0A 2BELA 2B20A 1ZK0A 4TYPA 1LBTA 3OLQA 4HADA 4N54A 3EXG2 1YASA 2ZFUA 2G83A 3DMTA 3L07A 4D44A 2VAMA 1WXXA 3EVGA 5DNDA 3STVA 4NV0A 5CPFA 1BW9A 4FXOA 2HC9A 2KX7A 3UYKA 3ROFA 5JI3E 2OG2A 2ZB3A 3KL2A 4RGBA 3T9FA 1ISSA 3WLSA 4YECA 4B74A 4KQEA 5AIBA 2DUMA 4NICA 3LPLA 1U1CA 3HVKA 1P5FA 1HYQA 1OE0A 2HRCA 3BD9A 5IEBA 1QU3A 1GZSA 2WJ4A 3BICA 4EVRA 1PHRA 1C5KA 4U3JB 1USIA 2B8WA 3GT7A 3SYMA 1TT5B 4LJKA 5LJLA 1H8HA 1PX2A 2G9UA 2OD7A 2GKSA 2GTPA 3DTNA 4D0GA 1NIJA 1KTIA 3G59A 3HJAA 1UKZA 3L9WA 1KSFX 3KNZA 1KRXA 1Y8AA 3G5TA 3Q4GA 1ETHA 3D6VA 3GLHA 2VUUA 3HZHA 2AQHA 3HYTA 4DQVA 3UPTA 3LQ4A 1F48A 4ON9A 3EVZA 1UDWA 1IY9A 2OT3B 4MGHA 1PSDA 2P9YA 1Z0ZA 3INNA 2IOQA 3U7FB 4G41A 2CXPA 1QLWA 3DW3X 1TKBA 3HHPA 2J09A 3PCTA 5C8YB 2ECPA 2YKGA 4I6JA 1DQZA 4J29A 3EA4A 1Z5GA 2VHWA 4GE3A 1PTJA 3IPYA 3N0WA 8LDHA 1Z8FA 2RB5A 3GVXA 2LKDA 3WLPA 4YCAA 1IOWA 1XDSA 2AMFA 3KVVA 3K70B 1H5NA 3PEWA 4H6VA 5EGSA 4LHWA 4CG0A 3MSCA 5ES4B 2HJRA 3LIIA 2PANA 5IDVA 1QO9A 5B1SA 2ET6A 3KCQA 4X1OA 5KVQA 4CM3A 4BQSA 1XD2A 1R0SA 1SC3A 2AI2A 3LUFA 4BAZA 3B2NA 2GXUA 3KU4A 1ILEA 4M0CA 5AMXA 2HK8A 1QG4A 3Q15C 1U28A 3Q98A 3TKLA 3RT9A 2Q9BA 4CG1A 5LQAA 4RTKA 4FBMA 3KR9A 1LLUA 1PV1A 3HKDB 3OEYA 1EGHA 1QE3A 1JDNA 1SKQA 2J85A 3OO1A 4FILA 3GCZA 4GLFA 3WLTA 4Q7QA 4YRGA 1OX4A 4ZJUA 2YIMA 5TMBA 1MVNA 2W2LA 3HYLA 4FC6A 3RUPA 2RHGB 3K1ZA 2D0PB 3GGGA 5ICSA 3KJEA 2I7VA 2SHKA 1GEEA 1JALA 3ABZA 4D0LB 2N75A 4HQLA 4XGNA 3HFRA 1R2QA 5LJIA 3RG2A 3FR8A 5IDYA 1HC7A 1X87A 4I4CA 1E9SA 1GG8A 5KYXB 2BE7A 2CVPA 2H1OA 1GNLA 4NZ9A 1JHAA 1V4BA 3DLHA 3LQ1A 4C5BA 4BNLA 4FHEA 4P8RA 2ZI5A 4B4VA 3AEQA 2ZEJA 3L43A 5F1YA 3HVUA 1YOVB 2B8NA 2IIPA 3UMYA 4C0BA 7ABPA 4PNZA 2ZIFA 2FYTA 4L1KA 1KAOA 4ZVMA 4BJ6A 1FE8A 5C7LO 4G8JA 5BYAA 5CFNA 3QU9A 4N0EA 2R85A 2B37A 2HADA 4HWRA 1E5DA 1QHYA 4PLYA 3ZNPA 4EAAA 4KX3A 3B7GA 4D8VA 2AR9A 1NQXA 5MN6A 2OC4A 4JP2A 4MR8A 3DVSX 5IC5A 4LHEA 4UZSA 3WADA 1JQ5A 3BXZA 1UODA 2FMXA 4FJ2A 3A6EA 4ZVQA 2JFYA 4PRLA 3JQRA 2WSBA 1DO0A 3JARB 4S1PA 1QCDA 4UNSA 1T43A 3DEJA 3IR7A 3C0KA 5CH8A 3VM6A 1OLOA 2CKDA 1L5HB 3D2LA 1ZOSA 4R9NA 1CZHA 3WLJA 5HFJA 3UAXA 1YS1X 1CUEA 1U3GA 2OD9A 3EGCA 4LOLA 4QFCA 3C3PA 4JEHA 3SNHA 4BV9A 3C16C 4HFJA 2IPOA 1NVVQ 2NSYA 2JLBA 4GP7A 2P5SA 2IY7A 4EHHA 3CJRA 2GRAA 1J70A 3AR2A 4P7GA 3KD2A 3MUEA 3T3MB 4DG9A 4TV9F 3VAYA 5J4HA 5HNKA 3S7ZA 3L8CA 4XUEA 3NEYA 1A2KC 5GGXA 3RC3A 1DRJA 1ZU4A 4DG5A 1RQ7A 1K1EA 5IF3A 4UCQA 2I7TA 8AT1A 4G09A 2XOKD 4O3MA 1ULBA 3A58B 5HCUA 4B6OA 2CNNA 4R98A 2OHHA 2XUFA 4IOMA 1RBZA 4ZOLA 4JGGA 1E7WA 1A9SA 3GJ7A 3JAKA 3NHJA 3ESXA 4N0DA 2C5BA 5EG5A 3I5YA 1CIVA 5A4KA 1CUVA 2AN3A 3SEQA 3WKCA 3FYUC 3R8CA 6REQA 2NT4A 2A9RA 5FRDA 5T8KC 1K68A 4MGKR 1TO6A 3R6GA 2WWHA 3NBAA 4DQKA 4N6NA 4B3TB 3G1WA 3MXTA 1M83A 1MMFB 1XI2A 1ZYUA 1NYQA 3PNOA 4TKUB 3Q40A 3K0FA 1MNAA 2GA8A 5CB6A 5IT0A 3ROPA 1K89A 2ZZMA 3PDCA 5KSZA 1CDEA 1CR1A 1E9FA 3A0UA 3GRRA 1OBVA 2CNOA 5G41A 1Z73A 3DYBA 3E9EA 4V0OA 2EL7A 3F2IA 4CT4B 2J7PD 2AG0A 2QA5A 3TW4A 4C7XA 4YMHA 1X77A 1E9BA 1WLYA 2MHCA 1ELOA 3FSEA 3SR3A 4ZVOA 1NSFA 1CUYA 1U2DC 1MOQA 2G0AA 3AC0A 5G0TA 3ZXUB 1T8SA 1P8JA 1T6ZA 1XZBA 2DPYA 2I80A 1RHQA 2CFOA 1T9BA 3ZD8A 1MX3A 3VZBA 1LS1A 5E8JA 1HWYA 3ZQKA 1GPBA 4Q47A 1ZNQO 4AJ9A 4EYEA 2IBSA 5JY1A 4U0JA 5IJAA 4LTNA 4CLRA 3VH4A 4YRCA 1BXRB 1IEWA 2PGNA 3KDPA 3X2FA 3ZYCA 5KBYA 5KHAA 4B5KA 1OXVA 1SO8A 2RARA 2P68A 5AT1A 3IEKA 3CWQA 4PNHA 4XFJA 1R6XA 1WY7A 1KJZA 3K9CA 3P9YA 3AUUA 4GMDA 1HH4A 5E6SB 4EM6A 2IUYA 2HI0A 3UQYS 2BHRA 1VA5A 1MB2A 4BTLA 4CVNA 3NUGA 1YA8A 3PQ5A 4TRRA 4UOZA 5A3QA 1PVOA 4R0NA 1IL0A 1RHRA 3C3BA 2IP4A 1GCGA 1TJ4A 4HX2A 2G06A 4CT0A 1WW8A 1D04A 4DLXA 5KMGA 4G85A 4J2OA 2A57A 2XXBA 2ZUUA 3UV6A 2DHCA 3AR5A 3IURA 3MBOA 1QK3A 2HDNB 3OE7A 4TV8F 4TYMA 5CIWA 3RFFA 1OH8A 2YDYA 4WADA 4YUXA 5MN4A 2PUWA 4TQAA 3O4HA 1X8JA 2UYQA 4N3AA 5DWDA 4W5TA 5BWOA 2ZRLA 3CGWA 3PHIA 1W75A 4HRAA 4MUIA 1VHQA 1S4MA 4XCVA 2GN6A 4DPLA 5KWVA 4P54A 3N75A 4O4HF 2XYVA 2JNWA 5CJPA 3QPAA 4DQLA 1IG3A 5E7IA 1ZOPA 2H7VA 3L6CA 2OOKA 3BQNB 3WYAA 1TF5A 2AZTA 2VATA 2YCLA 3C6ZA 1KBZA 5FOVA 3SIPA 3QKRB 1J90A 5E9JA 3TIFA 4B75A 2A67A 1AKVA 3G9XA 1XTQA 1BHO1 3VYTB 3FOBA 3JRNA 3KV1A 4IHJB 4C03A 4EGQA 5DBOA 3RH0A 1ZBDA 3NKVA 4RPCA 1XPUA 4II7A 5IAGA 4BNDA 3K6RA 2P6RA 1RFLA 3D3WB 3HXTA 3FG9A 4MJXA 1XA4A 2VP4A 3ZOKA 4I3GA 4ENQA 2RC6A 2ZUSA 4FDTA 3FWNA 3RTGA 1ZM3A 2OV4A 3RHSA 3KLPX 4NZOA 5JYDA 5BWBA 1L5OA 4IX9A 4CUKA 2ZYUX 1AZTA 1W59A 4IXMA 1W1WA 3TRJA 3IMGA 3KS9A 4DUGD 1U3CA 3C5HA 1U2SA 3O74A 4R2JA 4RA6B 1JLLB 3TAUA 4B82A 3R9WA 1GCOA 2ZAOA 2X14A 1LLQA 2ZWVA 4HMQA 3KJGA 2FSFA 3GEPA 5IT5A 1RRGA 4J0DA 4EPWA 3BWVA 1N1GA 5GQSA 2I5PO 2A9OA 1IATA 1F60A 1RCUA 2ZW9A 2C5FA 4Y2GA 5AUOB 3H84A 3OPQA 1PYOA 2BMFA 4FU0A 3K5PA 1E32A 2Q5CA 2GPSA 2IP2A 3K9BA 3A9SA 3N8DA 2Z6UA 4D9KA 1VE1A 4DB4A 1M1NB 5JANA 3Q1LA 1G9TA 1GA1A 2UZ1B 4GGMX 4DMLA 2IS2A 3QEKA 3HN2A 3SE7A 2PSFA 2PHZA 1E5TA 5KYKA 5C5CA 4V0LA 3W3AH 4ABTA 2WHQA 1P4JA 3NBYC 3I83A 1WRBA 3LCJA 1CBUA 3NYQA 5LZ4A 1NU8A 2QVGA 3QTTA 4QRHA 5CYOA 5FI3A 1XLWA 2FKAA 5JCPA 4X94A 1O9GA 3M4YA 1Z4JA 2CXRA 2HSZA 4FX2A 3E3LA 1JIQA 1VPLA 1LUAA 2R86A 4RCYA 4BKMA 4B34A 3L4EA 3NM6B 4H27A 5LD2C 1X0VA 2Y1LA 9LDTA 4K0KB 1T0IA 1UK7A 4FQ7A 3V2HA 2HO4A 3VX3A 5LP6C 1JAXA 4RPJA 1PGNA 1RIIA 5JTUA 3EPJA 4RQAA 4IFBA 1UZAA 3V7UA 1C4OA 3DD5A 3JQPA 3B38A 2EJVA 5CW2A 4OI0A 2P2DA 4P4UA 4E4YA 1HLFA 4TSRA 2COKA 3DKPA 4Y2HA 3UB4A 4PSUA 4I55B 3IUJA 5A5VA 3EUFA 1TK2A 5BQ3A 3ONNA 4TOIA 1OFUX 3FDIA 1NNSA 2J6BA 2R7AA 4RLFA 2C4VA 1BMQA 2EZUA 2QRQA 4TPKA 1G4UR 4Z8YA 4B3HA 3A2LA 4PRYA 3IVAA 5K3EA 2I3ZA 4UE6A 1F3LA 3CJTA 3DDSA 4YAEA 5DEIA 4P33A 3UWSA 1TE2A 2DH5A 3NVAA 3PKZA 1VLZA 1KQOA 2FMHA 2ZT6A 1T8TA 3UMVA 4I1RA 3IBTA 4YO8A 4CHGA 4EF4A 3OZVA 3AI1A 3SC2B 3REOA 3O4GA 4L8GA 4QREA 4EGJA 3WL4A 1VIDA 4ZARA 1E7SA 2F59A 4L4UA 4MP8A 3VR6D 3B9PA 3QYJA 1XFDA 1GYPA 2GDJA 3TTTA 3R0IA 4K9OA 5EE9A 1JP7A 2GEVA 3NHUA 4EVIA 4WZ6A 3K7EA 4PCAA 3LOUA 1QAQA 2V7PA 2WHYA 1ZIYA 5FNVA 1WE2A 2F6RA 2FP4A 1OBOA 2O7VA 3HMQA 4F12A 4DV3B 2X58A 2GD2A 4F2WA 1I6WA 5JC8A 1NA5A 2F9LA 2JI7A 3F71A 5P21A 3NH9A 1F8YA 2Q99A 4RZQA 1DOZA 1E6CA 2WR8A 5HDBB 4CU2A 2QG4A 5TB5A 4WNAB 2JKYA 3RSCA 3T3IA 3NJ4A 4N41A 2IYVA 5ESXA 4W4TA 2JJ1D 3BWMA 3LCMA 3WK7A 1ULTA 1TTQB 4Q1CA 2HW8A 1YJ5A 2DSNA 2IYXA 2YY5A 4S35A 1J24A 3N7UA 4XLTA 4Y2QA 3E9RA 4ZI7A 3N0TA 4C88A 5IZCA 3CVWA 3BMXA 4LYHA 5TJ9A 1N3BA 2B35A 4OUKX 4DDMA 1FDWA 5CCBA 2G5CA 2R6AA 4M86A 2J3DA 3ZHCA 5A04A 3IBCA 3GLGB 4WFJA 1RQRA 4FLMA 4DQUA 5AVKA 5TQ0B 3UFBA 2HU7A 4Q18A 1KFEB 5G0VA 5ARBA 1MFZA 1YQEA 1B42A 1FC0A 2YIDA 3HQ4O 1T8UA 1LNZA 1S8NA 1E20A 1TMGE 3IEPA 2PD3A 4M8LA 2BN4A 3RIGA 3SEFA 4ESHA 1SEPA 2NW6A 2C5GA 1XQ1A 2LE0A 1CEXA 1FNCA 1YACA 1Q17A 2PMDA 5DF1A 2VWQA 4UBNA 5GZ6A 3CKKA 1SKYB 1UWCA 4C3UA 1EFTA 4DV7B 1PWYE 3HCFA 1UK9A 3ZLBA 2QTGA 4G5HA 4KLNA 4BKPA 2X42A 3TEJA 1QZUA 2HTEA 3RIEA 1ZIXA 1F0KA 1PL7A 3B1FA 3S68A 4K6OA 1E1RA 3UWPA 2X7JA 1R3UA 3CKLA 3LHDA 3N2NA 3FY4A 4DMHA 1OFVA 3W9YA 3E53A 2C94A 1KH1A 4J2HA 5K03A 1K6MA 1Q22A 4XYLA 4DR1B 1E9EA 1GAWA 3JYPA 5GY7A 3CH6A 4UKDA 4AJOA 5KYNA 2PQMA 3WDMA 1C9MA 4Y7CA 1A9RA 3N53A 4OG2A 1O95C 3B1YA 4KVAA 1V96A 4RZIA 1SQGA 2Z5GA 4IOJA 2E55A 1M67A 2MYNA 3FUUA 2J31A 3I6QA 4HB3A 4I66A 4IDOA 4LHXA 1WVIA 3BXOA 4IDHA 2WFMA 1IIBA 3DFZA 1PO7A 3DKKA 4E3ZA 1G18A 1PVDA 1XJCA 5IFLA 1RLUA 3HBJA 4JY7A 2Q1XA 2NXJA 1CYEA 1A4UA 3FOCA 3RROA 4O29A 1UP7A 2O57A 4MGYR 1GU1A 4TTIA 4CIYA 3QLJA 3RUHA 1LRLA 1W6UA 3TUZC 2WQZA 5I7VA 1TPYA 3ECCA 2FUKA 3VU3A 4KWEA 2E5LB 2CF6A 4EGAA 3OQPA 5DPMA 5DI9A 3C98A 4Y2JA 4B3BA 4JV5B 4KE6A 5AFSA 3DE5X 1UKBA 2A78A 4H3HB 3HBFA 1YS9A 2VCYA 3GLKA 3QVJA 1XZAA 4YAWA 4B6PA 3GROA 4YCLA 1TAGA 5FUQA 2FN8A 3VPBA 1XVAA 4BQRA 2PS3A 4AZ0A 4F45A 4FGWA 2X0FA 4F60A 3W1WA 4J2TA 1CW2B 9ABPA 1PFQA 1DINA 1QQTA 2ZK7A 3LZCA 2OYCA 2WZDA 4GYKA 4M6WA 4OKIA 4LKOA 1MHPA 2J67A 4AO8A 5AW8A 3F49S 3I5MA 1N5IA 1RVV1 2IP1A 4B5LA 1OXSC 3KJFA 2EKQA 5DNAA 1LDBA 3FROA 2FJUA 5LA6F 2P1RA 3OICA 2B3TA 3GZNB 2QL7A 2HIMA 2O23A 3CW2A 1CJBA 2H0QA 1KSGA 4AWXA 4CM5A 2PO5A 4DCGA 5ICFA 4KPYA 1VP3A 3SG0A 2VKTA 5TGDA 1J97A 4ARCA 2P2CA 4G0YA 1EJ2A 3F73A 3WC4A 3GJSA 3NDPA 2ONZA 2ZJ7A 2BFNA 4KXWA 5F5NA 4QSHA 4TS9A 4EUHA 1E2HA 3CSDA 1N77A 1RAEA 2G04A 1V1MB 1SCJA 1U9YA 4Z9BA 5AW1A 2G36A 5I7SA 3KYDA 4M55A 1KY4A 3STUA 1JF8A 2FWNA 2YC4C 3ZDAA 4HLUA 3L0CA 1NBMD 1J0DA 3ZDFA 3L0PA 4CGYA 2I71A 2GAIA 1EJ0A 3P8ZA 1OGYA 4RULA 1QH8A 4C4SA 3BJMA 4MKZA 4ZU3A 2C42A 2ZJBA 3G2IA 2D1FA 3I9KA 2PE5A 3JYQA 3THRA 1DC4A 2NV2B 2Q8PA 2BEVA 4BV2A 5I4KA 1ACJA 2XZPA 3AF1A 3AX6A 1XDDA 2HT6A 2XB4A 4DEVA 4BGEA 1MABB 3A10A 3HSYA 3R7DA 5KTMA 4IGKA 5KVSA 4Z4QA 2PSSA 3N8IA 1P29A 5FBVB 1I2MA 1P60A 4D4MA 1TQ4A 5AI0A 4F4FA 2QTHA 1S3SA 2GWRA 1KBQA 4FW8A 1NMYA 1SUDA 3H11A 3C3AA 1YZYA 3QXHA 5BYBA 1FBTA 4DNPA 3PUHA 3I6ZA 3BE6A 1SQSA 3UFXA 5IT4A 1EEXB 1P81A 3BB4A 1E4EB 4ER0A 3UICA 4Z49A 4MEBA 2GJSA 2CV0A 3DBLA 3DE1X 1SPXA 2RIRA 1FFXA 5AI9A 5GMOA 1KK1A 1DUVG 2EFGA 2D4AA 2YS7A 3COPA 4RC9A 1HE5A 2DFPA 3UW1A 3KXPA 4RYDA 1TGVA 3BWEA 4WESB 3ROZA 3ZY3A 1ZWLA 3FCAA 1R1DA 1PR9A 2JW5A 3I01A 3OECA 4HATA 1AO3A 4J4BA 4LIPD 2O5RA 3EFEA 3A2NA 3H0CA 2QBYA 3M6XA 1KPHA 1U0EA 5FPPA 5LB4A 1W5EA 3G2HA 1GQRA 3N3BC 1QTIA 1IXKA 3CUWA 3TCXB 1R0LA 4KNWA 4IBOA 3GELA 1I3CA 4M1ZA 3LA6A 2V45A 1PJRA 1WOYA 3H1BA 4MH0R 5I3CA 2YTZA 1WM1A 2VPZA 3I05A 4JLKA 6ADHA 3FPHA 1EG7A 4RSRA 2Y93A 1FXSA 4MUFA 1R4NA 4I4NA 3FX2A 3P9NA 2JK1A 2YHIB 4IGAA 4YLGA 5F5LA 3CLRC 3HDTA 4ZAVA 2GYWA 2QROA 3I5AA 2FA9A 1FTWA 1RYHA 2XDQA 3NOOA 3I2HA 4TMVA 4KFCA 4IHQA 3SF8B 2CLOB 1AUVA 4FYJA 4ZA2A 1E6KA 2QX8A 3KU1A 4HX9A 2P2LA 2V55B 2YH2A 4KPFC 4C6HA 4O2AA 4W1RA 5IBQA 5TMEA 5EXXA 3DAFA 3ZQJA 3GLIA 1UMBA 3HLYA 1GTVA 3LBYA 2DULA 3M6AA 2BR4A 4XEUA 3QLVA 5G3YA 3ANMA 4QNMA 1QC5B 4BIMA 5DW3A 1XD8A 3SX0A 1W52X 2IEZA 4BX2A 1QBGA 1U8ZA 1TIPA 3I9LA 2B9VA 3ER6A 3D43A 4EB3A 1L0BA 2XMSA 5EUMA 3WWYA 1RXVA 3VJRA 1PEDA 5CT5A 3NWEA 2XSZD 3TPCA 4AUMA 2VZLA 5LQSA 5F1OA 3ABIA 3ZU6A 2QF7A 4QYWA 3RKRA 4MHSA 1MAVA 4I50B 4O8CA 2CXQA 4CM4B 5H02A 3RI3A 4FHDA 5B4TA 3AM5A 1L7NA 1OAKA 4GMKA 2FKNA 2O05A 5KNBA 4JSYA 1M6YA 2VDRB 1DPGA 1TLLA 3WSVA 4IEIA 3LFTA 4QBHA 3V97A 5F3RA 1OLUA 5AI6A 1NLMA 4AUNA 3GLQA 7YASA 3KOWA 5FA8A 1Q11A 3V2GA 3NHZA 4RDHA 3RQIA 1DC7A 4LFCB 3RV4A 3FTCA 4IF4A 3V2IA 5BW5A 2QLBA 2FSIA 4M38A 4U6NA 3A9UA 1EWYA 1G2IA 1P45A 1J0CA 3C5EA 3PDIB 3PITA 2BMDA 3IDSA 1N5KA 3W5UA 1AV6A 4LSGA 5H5JA 3AI3A 3VO1A 3MNFA 3DP7A 1SU7A 4W82A 1XZIA 5GINE 1V7PC 1JFFB 2VYQA 4J3FA 4W8GA 3ESZA 4P0PB 1I2ZA 1T35A 4B9AA 4LXTA 3C74A 5IVDA 3BSSA 3DTYA 3WLNA 1IK6A 4OOEA 1XZCA 4F8JA 2FW7A 1NKSA 1ENZA 1M1YB 3O8LA 1XL1A 2WKWA 3R7AA 3T5DA 2ZJ8A 2AK2A 4M7PA 4BGUA 3CHYA 4P7BA 3SZMA 4O4JA 3SS7X 5D6NA 5H0IA 3WL3A 4PWYA 2CUKA 2NTNA 5HZHA 3ZJTA 4GDFA 1OA0A 1WCV1 3HR8A 1CQPA 1YHYA 1W30A 2HHAA 1R5OA 4WN9A 4J0CA 4UOEA 5A4AA 2GWHA 2HTFA 5CTJA 5TPZD 1RYYA 1WU8A 3A3KA 3UTDA 2LBPA 2MR6A 2CLKB 1D1TA 2O0JA 1D5CA 1MNQA 3K8OE 4NV3A 4ZO9A 3ZKAA 4RBNA 4M3NA 5DX8A 3AEUA 4OI2A 4C7BA 3EIXA 4PZAA 5L4NA 5EYPA 2JLSA 3AXTA 4BO5A 2VAWA 2I99A 4DT1B 2X1VA 3H5IA 4OATA 5AVRA 4MYHA 1DQSA 4YP5A 2K87A 2Z9CA 3ACDA 1Y1PA 3EDQA 2P78A 2Q3EA 2C88A 3NHPA 1G8MA 1U8TA 4JEUA 3JALA 2YJZA 4DF3A 2AZDA 1F2VA 1Z6ZA 2SCUA 3JQ8B 2H31A 2H7CA 4U5XA 5HK8A 5KYWB 1EFCA 2WVAA 5BMOA 1KA9H 4GYWA 5FR1A 4RKQA 4ZI5A 1R6VA 3PKJA 1JLSA 4EG7A 3LTNC 3TOZA 5AVVA 1FUYB 4WZBE 4DILA 1UH5A 2VHQA 2QYOA 4KUHA 3AKEA 4U7WA 1NUUA 2CHEA 2IT1A 5DVZA 3HZRA 3RIXA 1HEUA 4RZXA 2OWEA 4YMSA 4LDAA 4C0HA 1PNVA 1FPMA 3JD2A 2IIBA 1B3RA 2P1DA 4I8DA 5SY9A 3R7NA 4PNEA 4ZCLA 5A6VA 3AB8A 4LRXA 1DAIA 2X8BA 3NYRA 1L8XA 5ED4A 1U3DA 3OETA 4KOAA 4N7BA 4NDAA 1FX1A 1I4EB 2GRJA 1LPPA 3TLCA 1DTEA 3VHRA 1I6KA 1D2NA 3HWX1 1YA4A 3KK0A 2G76A 4XX0A 4H3VA 4F6RB 3D7MA 4X1YA 1XJ0A 2EKDA 2NXCA 3ECAA 3PL1A 4J3JA 1TUIA 5ECGC 3EX7C 2VYCA 1RZVA 1CT9A 3G23A 2XOEA 1C7FA 3HBLA 3KQLA 1TM2A 1QO0A 1XRMA 1E77A 1YK0A 2VNSA 4DUYB 2PUVA 2CDBA 2XJ4A 3GJ0A 4L8FA 4UZFA 5DYYA 1QQBA 4WFIA 4TT8A 3TI9A 2WIFA 4O4IA 4J7UA 4MKXA 3FZEA 3EFBA 3O3CA 1R64A 3TCKA 2Q1TA 2FN9A 4WNCA 3OPYI 4CL8A 5HDQA 4OPMA 1X8XA 1V5IA 1IRIA 2FWBA 2WJIA 2J48A 3M6WA 4L5IA 5HEKA 1RE0A 2XWPA 3Q2KA 2HAEA 1KQPA 1MX1A 1V1JA 5A0VA 4OHRA 1QE5A 4ROTA 5IARA 2QTWB 4ZMSA 2F3SA 5DNWA 1RHMA 3DOFA 1CZRA 4D9NA 4YR9A 1YTUA 1HBJA 3V8RA 3WRYC 4CKBB 1P9RA 1FSSA 3WWZA 3M33A 1YRAA 4NZMA 3F6CA 1XWFA 1V48A 2YWDA 4IVPA 1CUFA 1NVTA 2X8JA 1QHGA 4GGPA 4LA4A 5F33A 1UWLA 1SELA 4DJFC 4U1RA 1SVOA 3DLAA 4K03A 2VBIA 4X7PA 3ROEA 4L7VA 4N9QA 1II8A 2DGDA 1IHDA 2IE0A 5ENDA 3WLQA 2R7LA 4IQ0A 3AU8A 1JX6A 4IEEA 5DKFA 2XXJA 4IFIA 2BKLA 2G70A 2HMTA 3K4HA 5LXTB 1FU7A 2GAFA 3JQDA 3LT5A 4DCUA 4YT4A 4XIIA 3F4BA 1TTTA 2R1VB 2VTDA 4OKSA 5DIZA 2QPOA 2QSUA 3OJFA 4LV6A 1XBTA 5SZKB 3TLAA 3TXAA 4JI2B 5ER6A 1YZKA 1PZGA 1SHZA 1SWWA 1GXSB 3OIYA 3WV5A 4P80A 2ZZKA 4OHMA 2HK9A 2FW6A 3OFSA 4MV6A 4Q4HB 5EXDA 3RU7A 3UGTA 2C5AA 2ZRFA 3MTJA 4PG5A 4TN5A 4W7IA 5KINB 2FEAA 1ZU5A 2HH9A 3MJHA 3PHJA 4C4PA 1PG0A 4OXYA 2VF2A 2FLKA 3V1TC 3CT4A 5B2FA 1HDYA 3ZXIA 2EZTA 3IP3A 3K2IA 3WGZA 2I3DA 1CB7A 4LWOA 1MB0A 1C0KA 1OREA 4PGFA 4TSKA 3W6PA 3HI6A 3GPBA 1BRTA 3RS8A 3MRSA 3OQ1A 2EX0A 5FOTA 5LLTA 2BUBA 2CB9A 3N7AA 1G8YA 2ENUA 1DDGA 1DLIA 2GO7A 2ZKLA 2QN8A 3IDOA 2V7VA 3CUEF 3PUXA 3ZE0B 2OD2A 3K71B 5C5DA 2JI6A 2C95A 2DFDA 3NBKA 3EF0A 3QTLA 3T8YA 1ZKDA 5EE1A 1FVOA 4DEYA 4DSNA 3EOAI 3FF1A 3RC8A 5IAAA 5ALMA 5JAPA 1G8AA 1POWA 2VC2B 2WY2D 4QBIA 1YQXA 2QU8A 3G3EA 3M83A 4AB1A 2ICAA 3EEYA 1T1EA 4IUYA 4HDKA 2R8EA 4N3BA 3RJ9A 3W4IA 3VR4H 3P52A 5CNKA 1L5WA 1O6FA 3CN7A 3FGOA 3D31A 3FPLA 3U4DA 4BNMA 5BSGA 2NVBA 5EJ8A 4JDUA 2W48A 3CKYA 4RADA 3RIMA 2FPOA 3ONEA 2QV7A 4QU0A 2BMVA 2CVQA 2VRWA 5D85A 5E7MA 2BTQA 3VJLA 5AVUA 1C9NA 3OU2A 3KQSA 3N5CA 4C2AA 1X7WA 4QNRA 3WYBA 1GFWA 2J9FA 3PQ6A 1KHTA 1T4MA 2Z8YA 4JASB 3VTKA 4FS3A 1E69A 2LCIA 2AOUA 3BTSA 2QQ5A 4P5DA 5JBQA 4YP9A 3OQOA 2JZCA 3N2GA 4FSHA 221PA 3LC2O 1OUMA 2ZREA 1ZA2A 2YNMD 4ZOEA 4EHKA 3G02A 1W93A 3MAJA 5JAHA 4H17A 4OA8A 1SMKA 5IWAB 1FQOA 4NBWA 1KHHA 2PZLA 4IWYA 4YIHA 3JPWA 3ZDBA 1EKXA 2HK6A 4Q9KA 2H1WA 5JI2E 3EXIB 5LBIA 1QTNA 2GZSA 2IUSA 4G01B 3RRBA 5AXAA 4DAEA 2DPLA 1RYEA 3HJFA 2LKCA 2OZLB 2IITA 3M5WA 2XMDA 3M2PA 2V6FA 3M9WA 5D5HA 5DX0A 4AO7A 4GMGA 2P1ZA 1C3OB 4UD2A 1F6DA 4BMNA 2N1BA 3LPMA 2V7UA 3H2GA 2O07A 3HBMA 1AK9A 2I2XB 3BORA 3O84A 3QA3E 4FX5A 4XIGS 3ZVKA 4BXOA 2HR1A 1KBOA 2LVBA 3I9FA 5BNWA 3U9SA 3D6TB 4DIBA 1ZVVA 2F8MA 2IYFA 2X3UA 3GHHA 2FDCA 4L74A 5KNDA 1QVAA 5I8PA 2E6KA 1PJ3A 1HTWA 2OV1A 4GMFA 4RNCA 2OK7A 5JXHA 4XFKA 2OB2A 3LLVA 1ZAKA 3BMQB 2QRLA 3F3SA 3H97A 3V55A 1CQXA 3FYCA 1MP0A 2A4KA 1SFRA 2FP3A 4D9EA 1XP5A 3CUUA 1KRHA 1LBSA 5DGTA 2FMTA 5H82A 2QRZA 1CV2A 1FFCA 1ZN9A 1DO2A 1U9IA 1YBHA 4LVUA 2REBA 1E96A 3FNFA 2AFVA 3CEHA 4G24A 3WQHA 1UIRA 4UU0A 5JD6A 4ZV7A 2B1RA 2VO1A 3ZE2B 2XOKA 4FGLA 4F5EA 1K5GA 4G0XA 4J0HA 5DRYA 1WF3A 3GLHE 4HWKA 4UBIA 1KOJA 2PQ0A 5TEWA 4CZ2A 1E2PA 3PLRA 3C41J 4D9JA 2XKJE 1AE1A 4UBKA 2IYOA 4RTJA 4H31A 4EG4A 1LNSA 4NCJA 4FNGA 5A62A 1P4AA 1P1FA 5DNVA 5JSKA 1SOWA 1MH1A 1U98A 1Z7WA 1N5JA 3RK1A 3ST7A 5KQMA 4U2CA 3W78A 4HPXB 3PJDA 2PGXA 1JKFA 2CLHB 4BAGA 1X6VA 3C24A 4BZZA 4ER7A 3TQHA 1THZA 4PSAA 3NCTA 4GX2A 1XJ5A 2DBZA 1Q19A 5EEHA 4MP3A 1VMEA 2M6SA 1MZPA 2J7PA 1RYZA 3KAKA 3N76A 4YNBA 1YIDA 2MYTA 1KIAA 4O02B 3SF0A 2CVOA 3GJ5A 3WLKX 4QGFA 1NT4A 2VDKB 3JQEA 1MC4A 2H8KA 3HB7A 3EFOA 4LPKA 3I2FA 3VBCA 2NO7A 5JVDF 2H1FA 3CJQA 3H7AA 1N4DA 4IV5A 4MUNA 2W8BB 1PJTA 1DKRA 1G5HA 2J5BA 3V1UA 4XUDA 1P7VA 3WGGA 1S3GA 4K46A 4MYDA 2VXCA 4HRYA 2JPDA 5ALJA 4OK3A 2ZU6A 5CAEA 1NBHA 3ZXSA 2VH2A 1DJPA 1YQGA 3DKVA 1DC8A 4Y2XA 1A2QA 2PCJA 3IVRA 3GUHA 3EQ7A 3VDRA 3DNMA 1K4KA 3QEJA 1XEFA 5CB4B 1LRKA 4FCCA 4DWWA 2CHFA 3AUXA 1E6WA 4MQFA 1P1HA 4D46A 4AUKA 4D98A 5DHPA 1RCFA 5EKDA 1JQDA 4II2A 2OXFA 3MMNA 4IQGA 2X9VA 2ISSD 4XJSA 3PFHA 4LOAA 1N25A 2AMJA 1QFMA 3OHMA 4L15A 3ZS9A 4TVSA 5KTPA 5HRAA 3B52X 1NLFA 3QHPA 4XLLA 5EUCA 5JSZB 2J3LA 2ZRGA 1JQLB 3TECE 3GMIA 5E0OA 4DSAA 1S0UA 3OY7A 4KFSA 1Z4OA 3GB9A 1G3UA 2V9CA 5J2TB 3JU3A 3B7WA 3NIGB 4H0FA 2XCRB 3AETA 3NC1C 1X14A 2XTJA 2ZBPA 4ZV9A 3TJMA 1FS6A 3P2JA 5E1DA 4DQDA 2DU8A 4OK6A 1U7ZA 1UFVA 5E4TA 5FWXA 3OJCA 1CP2A 4DXHA 3L1IA 4KIJA 3GFQA 1H6AA 2Y4OA 3FWZA 3MB5A 4KMMA 5ALSA 4CL3A 4IIDA 4CV1A 3D8SA 2OHJA 1VG8A 3CXRA 3L01A 4NY1A 3C3KA 3BRQA 4AC9A 2PGOA 1XAJA 2QUKA 3BK1A 5KHOC 4JUIA 4NXMB 2PT7A 4OQDA 5JDCC 1NYTA 4UPDA 2PFGA 1VHJA 1DXYA 1XA3A 3MLAA 1GGNA 1V3VA 2XADA 5G3ZA 5JAQA 3T1NA 3I4LA 4I6EA 3DXXA 3GDOA 3GLHB 3H5LA 2QY9A 3FM9A 1ZM2A 2DPXA 5JH7A 1SCAA 4CE6A 1VKNA 2Y68A 2R8OA 4DUGA 1N92A 5F1PA 2QN2A 5H4HA 5T5QA 1O1YA 2QTCA 3E0XA 4JLUA 2ETXA 3PICA 2X9NA 1O3YA 5B1IA 3GCGA 4MJ3A 2QOEA 3HKEA 1YI1A 5HS6A 4CLDA 1BRMA 1SZDA 7MDHA 3WO0A 3FAKA 4QZVA 2GGSA 1Z0KA 4PTZA 3A6JA 2C7GA 4IKOA 3W2IA 3GQBA 3V4LA 1TO1E 3PQDA 4HO1X 4BB9A 2BI7A 1QG2A 3DGFC 4J8PA 3DL0A 4BQQA 4BS9A 2IX9A 4GI5A 2HQ1A 2QN3A 3SLKA 4KWTA 5BT8A 1E2DA 1JXOA 1M2FA 5K0CA 2GD6A 4GOND 2V0NA 3EZGA 2B4TO 3UMCA 3E84A 4RLSA 2B4RO 4FOOA 4G5OA 3V3TA 4D8UA 4X8HA 4XDGA 5JBIA 1PJCA 2AJDA 1VSQA 4LOIA 1ZJYA 2BRUA 3DMNA 4UNQA 3AERB 2XCTB 4X92A 3UGJA 4A4DA 1Z5UA 2QVCA 5L51A 2EL9A 1HG1A 1OX4B 2WF8A 3IIJA 3QNUA 3C4JA 1DBQA 1KO4A 1QX3A 1KFKB 1S5PA 4PM4A 3V33A 4C0LA 4GBJA 1G19A 1ZUNA 1QRDA 5KTNA 3CCFA 4ZYUA 3DEIA 2QLTA 2BKAA 3UXYA 1DTWA 2KBFA 4JUCA 4AMZA 4TWAA 4XWWA 1J00A 4BP1A 4W9NA 1JDJA 2BCJQ 1MO2A 2H0RA 2JHGA 2BTOA 1X7HA 2WABA 3T9BA 4ZCIA 5KQGA 1FFGA 4ENUA 2XYGA 1WY5A 3PGVA 5DTEA 1PJQA 4BFUA 1CNEA 1WHSB 4MRMA 1ZD5A 5EMHA 1TQDA 2ZUCA 3HPRA 3LUPA 4IDEA 4J6FA 5CURA 1PUJA 2YQ4A 5JQGB 2FRDA 1ATZA 2IJGX 3C6KA 4RV4A 1C80A 4BNYA 4YMWA 3BK2A 1R6AA 3QVVA 1HEIA 2DYKA 5DBFA 3GA0A 3IRVA 4H7HA 5FOXA 4DWVA 2E18A 2W58A 4X00A 1TU4A 2HGZA 3GFVA 4WEOA 5ITVA 1O6GA 1TEVA 2O14A 3EIFA 4UM9B 3G2MA 1OT3A 1Z47A 5JQGA 4H08A 2ZIWB 4ZQHA 4YAUA 2RHBA 4PQGA 3GDFA 3VR6A 4KHPB 1I5RA 1IY8A 4Y6SA 2BFOA 4D56A 1U8XX 1CRPA 1SVSA 1V45E 3ZNNA 1EX9A 2G63A 3CNHA 4OP1A 1PVVA 1ZESA 2FEOA 5H68A 2QR5A 1UP6A 4A82A 3ZNQA 4AJHA 4M22A 5T7BA 1B14A 2JATA 1XUOA 3FTDA 3FUWA 4KAJA 4KNYA 4INZA 4YWJA 3D64A 3N28A 3NS7A 4J07A 1HLGA 3P4UA 4YRQA 2FMFA 3LGXA 4HAZA 1NJSA 3AOGA 3F97A 4FHZA 1L8LA 1UJ6A 2CD7A 2XF2A 3FE2A 3P27A 3R1IA 3FGPA 4HBZA 4J7AA 1T6XA 1FYVA 4ZOLF 3S1LA 3AJDA 3QKSB 1QIEA 4WTOA 4JOBA 4ZQCB 1UFOA 4PBRA 3RIHA 2AV6A 4H3KB 5CVJA 4G25A 3V4FA 3RF7A 5DCYA 4L85A 4BQOA 1A4IA 2YWHA 2VSNA 3HLTA 1XCPA 2XAAA 5LDGA 4YHBA 4X85A 1CSEE 3DV9A 5BV2P 1NDHA 2ZPUA 2R44A 2RAVA 3W34A 4C9BA 3AJEA 1PR6A 3U6BA 4Z3DA 1V37A 3H2IA 2XITA 3W4KA 1A7AA 3DM9B 5IYZF 6REQB 2KB0A 1JYFA 2GEKA 4KU4A 2FVXA 4LVOA 4EVSA 2MDTA 4BV3A 1OD6A 1IN7A 3V7WA 2WINI 4PTYA 1ZISA 4ESOA 1K8QA 1OGIA 1V71A 1VL8A 3K0FB 4R9VA 2DTXA 1G6HA 2IE8A 3F8WA 3IBFA 2VJLA 3QFFA 4FKZA 4TXHA 1XNJA 4UCFA 5MN5A 2EVWX 2RGRA 3A4YA 3JCZA 4A8JC 3PUWA 2DKFA 4A6XA 5A02A 5J1TB 2PEYA 4FYYA 1LXCA 3D7NA 1X9HA 4GH5A 2RAUA 1RWXA 4HRVA 4FDVA 1AGPA 1QANA 1OBCA 2C96A 2JD0A 3WGNA 4NU0A 1ZP6A 2A33A 4TT3D 1KPIA 1NVAA 2HRRA 3AQ4A 3OX4A 4WAUA 4DGQA 4L72A 2J0QA 1UK6A 4FNMA 4D4KA 1L7QA 3GWZA 3HV2A 5GJBA 4HJRA 4LF8B 3TIXB 1P75A 5CNJA 1XTTA 4RA9A 2DCMA 2WICA 1JQBA 2ZSBA 3OJWA 1DCFA 4B09A 2FW9A 2OR3A 3DUFB 1K08A 1X42A 1E9DA 2VXBA 2P75A 3CRRA 3KD3A 1VL2A 3OM8A 4IIGA 1W4AA 1YMQA 1AKEA 1T8YA 1YZUA 4QRIA 2VI5A 4B3DA 2X1MA 2MMCA 3HNOA 3OPNA 4OP3A 4Z4FA 1HNZB 3M6IA 3R4VA 2DPGA 3BB3A 1UPTA 2P69A 4F9GA 1PNOA 5JZSA 4ITVA 2PNJA 1Q50A 1QV6A 1KYZA 2VDJA 2NVUA 4EL5A 4XWAA 1P5ZB 1D7OA 3MTGA 5D86A 4EA9A 3O2QB 5KMGB 1NONA 4MO2A 2H9YA 2VDLB 1U6IA 1ISHA 1WB5A 2BTEA 3CRQA 3LK7A 2YJ6A 3DONA 3BJEA 1DJQA 1B6TA 1CPYA 5IX8A 3ETHA 2C83A 5F3DA 1CQIB 4HH3C 1T5HX 3ZWPA 3NGLA 2DTEA 5GONA 4R1LA 3UGKA 4CDRA 4MO9A 3SVLA 3JX9A 1ZMXA 4W6ZA 2A14A 2WVGA 3CEMA 5D00A 5K3FA 1RZRD 2O0LA 5CM2Z 3KXIA 4LJ6A 1UM9B 2Y1CA 2NV0A 3EASA 3DVQX 1HG0A 2Q5JA 4UCXA 1KQ3A 3H5WA 3EH2A 3I37X 2W6CX 1JG3A 2XMCA 821PA 4BNDB 3B1JA 4Z4GA 5BOVA 1AC5A 4JYZA 1FP4A 2YS6A 1PQYA 1KK2A 2GBCA 4K9QA 4CMKA 1KOFA 1DKUA 3SLGA 4CCAA 1ZGJA 2HBYA 3DZIA 1ZH2A 4KR6A 2BLLA 3TRKA 4BLSA 1IEQA 1BKSB 5JRJA 2ZPAA 1GADO 1GILA 1SRRA 1ZOOA 2I34A 3V6MA 2ZBRA 4A73A 1DFIA 2RKBA 3WQBA 3DVAA 3HU2A 5FNZA 3ZV4A 4FP9A 2XDWA 4LXIA 2J6HA 4MVJH 3QWFA 3H8JA 4QDXA 1OHHD 1NBMA 1S2MA 2PQ2A 2J5KA 2C9CA 1UXOA 4LZJA 1H3FA 3KOOA 3OJOA 4MSUA 4KQJA 4UAUA 3RSZA 2DOKA 3B78A 4MAAA 1JG4A 3BH7A 1XYGA 5FIUA 5FJIA 1NQWA 4KRXA 1W6RA 2C77A 2YXDA 1SEVA 2YWEA 3G5MA 2XZDA 3NORA 3HLKA 4CDGA 2RG1A 1KO7A 2A58A 3I0ZA 4QOFA 3TE6A 5JUWA 1FLDA 1CZKA 1OXXK 3O83A 1NJFA 1XNQB 1CULC 1BFDA 1OWNA 2JAXA 2SKEA 4QT0A 5C9ZA 5JARA 3AIMA 2B5WA 1EAYA 3RVMA 4JUDX 5BW8A 4EJ2A 2C9DA 3OEEA 4PX3A 4JLPA 3SQXA 5H16A 1N6OA 1I33A 2E9SA 4KMOA 4A2WA 1VKJA 2VJMB 3IE0A 1SCNE 3FTEA 5I5EA 4WGGA 4IF6A 4X54A 4D9MA 4HH0A 4BLPA 1YULA 1HSOA 3PHHA 1CF4A 4P1ZA 3V4RA 5F52A 2KW5A 4BNFA 3QJYA 1RYMA 3RYHB 4BWGA 5CA1A 3LL7A 3MILA 4U7GA 4MRAA 4MDEA 3AVWA 2HY7A 1R10A 1K88A 3D5QA 5KQSA 1LNQA 3G9ZA 4YAGA 3IUQA 4JJFA 2PMEA 4EX6A 2XMZA 4WH0A 1Z34A 2Y1GA 4UBLA 5WRFA 4EKIA 3ZI4A 4ZYVA 3O73A 1IVYA 3OUZA 5AM1A 1SHUX 2J9ZB 3TG8A 2R6R1 3FHLA 4BMVA 1SGWA 5ITWA 2C4HA 2V4MA 1N6KA 2VPQA 4L0QA 4UUOA 1B74A 2UZ0A 2RCNA 2XTMA 1QIDA 7REQA 1X1AA 1M2JA 2XUZA 3OVMA 4OXXA 4C0XA 5FH9A 2LNDA 4MLZA 2CLSA 3OWXA 3MT0A 4XR9A 2V54A 3FBGA 3G5LA 3Q3VA 1TCAA 4M87A 3VYUB 1SXJD 1C4WA 4FMDB 4IIYA 1KMQA 2QTNA 3FVRA 3UF0A 4C06A 4MVYA 1TVKA 5CNIA 5CDUA 5JS8A 3QUAA 4EATA 5C1BA 2OTCA 5LQDA 4WASA 5FNVB 4Q1EA 3V80A 3EGEA 3UAZA 1QQAA 3QU4A 1ZUD1 2JH3A 4CF4A 1KORA 3PWKA 3ZLJA 1PDOA 1OTHA 1W5TA 5MGNA 4QD3A 1NXVA 2XKAA 4KFUA 1XVIA 3QTBA 2PYIA 1EMDA 3O8OA 5L4SA 2NZ2A 1Y4UA 2PN1A 3I2JA 4YP6A 4ALLA 5IXYA 4KFRA 3R3YA 3PYMA 2I4LA 3U7QA 1VYUA 1QCZA 2CXNA 2B4KA 5U4QA 1EAMA 2EAUA 1Z6YA 2IZ7A 4MUJA 3AUJB 4PLHA 2D74A 4L0MA 4Q5IA 1KI6A 2EIXA 4N7MA 4D4GA 1YB6A 4YUAA 2GUGA 3RVLA 4GMXA 4RF2A 1QG6A 4RSHA 3B89A 1JEJA 1GGJA 5ER9A 2P6NA 5IC6A 2WHEA 2ZSJA 2B2NA 4F2PA 1C3JA 2XSZA 4OBWA 5GM2A 4CM7A 1Z0DA 5A4JA 1XSEA 2H17A 5JJCA 4G0VA 3B3AA 2HHCA 1NBIA 4IIEA 2R8RA 4PSKA 4E7OA 5EUQB 3R8FA 3T1VA 1HDGO 1A1VA 3IKLA 4CI9A 1R88A 2NO9A 4BC1A 4LXYA 4BO0A 2Z6QA 3HRHA 2DERA 3HKCA 4FUTA 5E6UB 1SY7A 1K2VN 3SZOA 3ZGZA 4YJ2F 2BEUA 1L5LA 3R5KA 3A14A 4U4AA 4X6XA 4R40A 5AKKA 4B3JA 1ULAA 3CEAA 5LFAA 4JQYA 2QENA 3RF6A 1F7UA 3ENKA 2OMEA 3K2BA 1GKYA 2YZ7A 3IQHX 3OPMA 4P7KA 4V0KA 1TRHA 2E48A 4YGYA 5K0GA 3M81A 2VNJA 1Z9BA 6AT1A 2FMIA 1F8GA 1LZKA 4RMJA 1O6CA 4HB0A 1GTSA 4IVRA 4WCFC 4EUFA 5HUJA 3QOFA 4RHXA 1ECBA 3NC4A 4F71A 3I23A 4LJYA 6YASA 2LV8A 2F17A 5TSDA 1Y9DA 1YVRA 3HFJA 3E27A 1E2KA 3IHLA 4LW8A 1G2OA 1T91A 3QBVA 4TXJA 3K1JA 3SIRA 4BNXA 4DA4A 4KO8A 3PA8A 1ZI6A 1NRWA 2H54A 1CTQA 2D2IA 2RGUA 3CV3A 3HJBA 3HV0A 2W6NA 1UEJA 2NXEA 1AS3A 2J0VA 4XUCA 1RQGA 4XD7D 4AKSA 2CSXA 4EITA 3ADCA 1X7ZA 4JHLA 5LOVF 1D2HA 3BYZA 2FZLA 4ITUA 1NVBA 5AESA 1G3QA 4HHEA 4PY2A 3N87A 3FPSA 3R6TA 2HA7A 1AUXA 2A30A 2GAJA 4QM7A 2FJ0A 5BRNA 4D9GA 3UG6A 1CRWG 2WJZB 3SIXA 4OO3A 1BOOA 1UBTS 1YCHA 2WAAA 2JI4A 4PHTA 2I1WA 4HS9A 3K9LA 3CZ4A 4HRXA 5A4DA 4L07A 4AZ0B 2I4TA 4DZTA 3K72B 2FUCA 4DIDA 3LRPA 4NMWA 4QUIA 2XVYA 4Y6OA 4AMYA 1L7MA 1WA5A 1G38A 5EQTA 2QSJA 1NURA 1N7HA 3ZH9B 1J8VA