2Y99A

Crystal structure of cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase (bphb)from pandoraea pnomenusa strain b-356 complex with co-enzyme nad
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
275
structure length
267
Chain Sequence
MKLTGEVALITGGASGLGRALVDRFVAEGARVAVLDKSAERLRELEVAHGGNAVGVVGDVRSLQDQKRAAERCLAAFGKIDTLIPNAGIWDYSTALADLPEDKIDAAFDDIFHVNVKGYIHAVKACLPALVSSRGSVVFTISNAGFYPNGGGPLYTATKHAVVGLVRQMAFELAPHVRVNGVAPGGMNTDLRGPSSLGVPLADMLKSVLPIGRMPALEEYTGAYVFFATRGDSLPATGALLNYDGGMGVRGFLTAAGGADLPEKLNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CIS-2,3-DIHYDROBIPHENYL-2,3-DIOL DEHYDROGENASE
publication title Biochemical Studies and Ligand-Bound Structures of Biphenyl Dehydrogenase from Pandoraea Pnomenusa Strain B-356 Reveal a Basis for Broad Specificity of the Enzyme.
pubmed doi rcsb
source organism Comamonas testosteroni
molecule tags Oxidoreductase
total genus 86
structure length 267
sequence length 275
chains with identical sequence B
ec nomenclature ec 1.3.1.56: Cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase.
pdb deposition date 2011-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2y99A00
4L4XA 3P2YA 5EPOA 4LW8A 1YKFA 2OBNA 1E7MA 4GL4A 5TT1A 5L7WA 4YB8A 3HDHA 2Q1SA 3KYDB 4IJVA 2C5EA 5F5NA 2I65A 4CM1A 5A03A 1BW9A 5KCZA 1Z75A 1DAOA 4EGFA 4P22A 3IJRA 3VC7A 1YS4A 4BKPA 1BSVA 1WXDA 2EEZA 3AOEA 4BB5A 5HWSA 1IB6A 5ICSA 4DXHA 4Q3AA 3VH2A 5I9LA 1ADBA 1T2CA 1RPNA 3PIIA 1QYWA 4J90A 3UF0A 3E9QA 4NR0A 4D3DA 3NT2A 5IN5A 4PG7A 4R16A 3PI7A 4OO3A 2FHSA 2X0RA 3W8DA 2BD0A 2I5PO 3HJAA 4II2A 3VPHA 4I1IA 4J91A 1RM4A 3FCOA 2HDHA 3L07A 4K26A 3PP8A 1DPGA 1MXFA 1UXJA 2Y1OA 4BO0A 5JAZA 4OM8A 4F6CA 1T2EA 4NPCA 2VHXA 1KVTA 2O3QA 1S7CA 2HMTA 4J43A 4WECA 2H1SA 4J1TA 4YWJA 1QKIA 1R0SA 3PWZA 4PG6A 4BNTA 3A06A 3ZV6A 1A9ZA 1LXCA 4KP7A 2O3UA 1MP0A 3W6UA 2QG4A 3OICA 1XU9A 2V6BA 5CPFA 4U6QA 3RCBA 1VM6A 5IG2A 4DMMA 3RC2A 2QZZA 3I9LA 3WGIA 4XYGA 1A71A 2GN9A 4BNNA 4MIEA 1KYQA 3TNLA 1WZEA 2G5CA 3GPDG 1RKXA 2TMGA 3LLSA 3I52A 2NQTA 1R0LA 3ST7A 1P44A 3D1LA 1C1XB 1Z6ZA 3GHYA 3WJAA 4WPGA 5JDCA 2EP7A 3DZIA 4WCFB 1LSSA 1LNQA 3ROQA 1WDKA 1HE5A 3W4IA 4FPXA 4MOWA 1R15A 5BSHA 4XEHA 1X14A 4Y6PA 1BRMA 4XB2A 2AA3A 5L95A 3DHYA 4HXYA 5G0VA 4U0JA 1YGYA 2B35A 2ZKLA 3ZN2A 3JSAA 3PHJA 1AXEA 4XYMA 1I3MA 4JBIA 1P74A 4WNCA 2BFPA 1NQ5A 4JNKA 3W4KA 4HFNA 4D44A 1YB4A 4BO5A 3Q1LA 3RBVA 2WM3A 5F1PA 4QTZA 1EFLA 3U62A 2O4CA 4TVOA 5JFOA 1CEQA 4KWHA 3H6KA 4FW8A 2EIHA 1JVBA 3I3OA 1FJHA 4OHUA 5GY7A 1A7KA 4WJZA 4AJHA 1F8GA 2YY7A 4BO4A 4UUMA 5FI3A 3L6EA 4MO2A 4X54A 3K31A 3GFGA 3HNPA 3JQAD 4CODB 4IUYA 4EYEA 3HZZA 3TPCA 2UV8A 2EERA 3V2UA 3PGJA 3DOOA 1NPDA 4CMHA 4DMLA 3JQFA 3IOYA 3HADA 1NM5A 2B4RO 1LDGA 3Q0EA 4RORA 5H81A 4YYZA 2LDBA 4NJMA 4QFCA 2P2SA 4BNKA 4FS3A 4DLBA 1PJTA 2OZPA 2WWRA 1KERA 5U4QA 1GDHA 5HRUA 2E82A 1H93A 4IJWA 1AXGA 2IDZA 3PJEA 4IDBA 2JAHA 5L4NA 3ULKA 5JS6A 1MV8A 2V6GA 4Y8VA 2V6FA 1E3WA 1XWFA 2HAEA 2P9EA 3GG9A 3B1KA 1K0UA 3ANNA 5LDGA 3MCVA 3NV9A 1LLUA 4A10A 3CXRA 2CVZA 2ZIZA 4O59O 5AXBA 1GQYA 1GUZA 1T4DA 3VPGA 1QG6A 4JJIA 2X9GA 3S2GA 3GR6A 2GR9A 4UUOA 2ZJ1A 1U5AA 5I8ZA 2GPTA 4IDAA 5JPIA 3RWBA 4TMFA 3ROPA 2EJWA 1PGQA 2JHGA 1VE9A 3PHLA 4DPKA 3AY6A 3ON5A 2W4QA 1O95A 2X58A 1RWBA 2YV3A 3C7CB 4P4LA 3SLGA 5I7VA 5G4LA 3HFGA 4KWIA 1IHXA 3NDJA 3CIFA 3INRA 5L7YA 1JAXA 4BNZA 3KO8A 1R4NB 4RVSA 1CIVA 4MKZA 4MJLA 1LSUA 3GRKA 5H82A 4DA9A 2C29D 1BHSA 1T2DA 1U2DA 5G4KA 3H9GA 1M67A 5C3MA 3AJRA 4UVHA 3TZKA 1DXYA 1U9JA 1PJ4A 2NADA 3GT0A 5FYDA 4F3YA 3VAZA 3BHMA 2CF5A 1C0KA 1EEHA 3B1FA 3JD2A 1ISIA 1LLDA 1L7EA 4NBTA 3BXXA 4M1QA 5DNAA 4D0SA 5DF1A 3RUHA 5IXSA 2HMWA 1O9BA 3H5RA 2Y1EA 5JBIA 1DOHA 3CMCO 1LDNA 1B26A 3JTMA 1YQGA 4E2ZA 1A4UA 5TX7A 2W2KB 4OH1A 3RUFA 2CY0A 1I30A 2FZWA 1D7OA 3PQEA 3L4SO 4FFNA 3H2ZA 2HK7A 4W6ZA 2DU8A 1MC4A 4ITUA 5JCJD 3JQ7B 4DQUA 2IZ0A 3QE3A 3E9NA 1W0CA 1VSVA 1JLLA 1GEGA 2O7QA 4NFSA 5AXCA 4TRRA 1MX3A 2W98A 2YZ7A 1YRLA 5L51A 3PHGA 2O3SA 1RM3A 2E6UX 1YJQA 4PLFA 3INTA 1W4ZA 3ZNOA 3PFFA 3KM0A 3IP3A 2PD6A 2GN8A 4JROA 2R00C 4PLWA 4CLOB 1ONPA 3NAQA 4M54A 3CH6A 1KEPA 3ITKA 4ZQGA 3WQQA 4FOSA 3EZLA 2NNLD 3GUYA 4PZEA 4MKRA 4ALMA 4XGIA 3OA0A 4D46A 5GZ6A 5KVQA 5TJ9A 3TRIA 3UCFA 5U9CA 3DBLA 3TOXA 1B8UA 3GZ4A 3LYLA 3AM3A 4RF5A 1PU2A 1PS9A 3L0DA 2YUTA 4G2NA 4Z9XA 4NH4A 2IEDA 2WD7A 3TN7A 5TGDA 3SJ7A 1Q0HA 4XX0A 3VH1A 2VHZA 4OAQA 4W82A 1Y9AA 1YL5A 3F4BA 4UULA 2GF2A 3D4PA 1Y8RB 3F5QA 1IOLA 3HUDA 3JYOA 2JJYA 4FQ8A 1LC3A 3O8QA 4LGVA 5KIAA 2EXXA 2C20A 1DLIA 2AQKA 1OBFO 3PYMA 4KUGA 3WLEA 1XQ1A 3DR3A 3F4LA 5ER6A 2PD3A 2EKPA 4JBGA 4Q9NA 2C7GA 2RBEA 1VRWA 4L4RA 1C14A 2EP5A 4FD3A 4XB1A 2X9NA 3VZPA 1JTVA 4ZGWA 3EMKA 3JYLA 3ZDFA 1GQQA 3F3SA 2YHUA 4NJOA 3WICA 1SCUA 1Y5RA 3WQSB 3NT4A 1RYDA 4K28A 4OSOA 3TFQA 1GAEO 4GX2A 1Y6JA 3QRWA 4EDFA 4IIUA 1U7HA 4UEJA 1ID1A 1DSSG 1GTMA 1NVTA 3CZRA 3PLRA 1HSZA 2Q99A 4TROA 4U0KA 3BAZA 3HSKA 4DQVA 1NTOA 3ZCXA 4ZHSA 4I9UA 1AGNA 1JAYA 4KTVE 4CR8A 2NACA 1HE4A 1CQIA 1F12A 4A5OA 3SXPA 1I24A 4XGNA 2DT5A 5COAA 5KKCA 3ADOA 3O03A 4J49A 3ROKA 1MFZA 1YDWA 2V65A 5G0TA 1IE3A 1UDBA 3CSDA 1BG6A 3ONFA 3WB9A 1PL6A 3ONDA 1DFGA 1NYTA 1KVQA 5HM8A 1R4MB 4B7UA 4BUCA 2VNSA 5I7EA 4WCFC 1EDOA 4YJGA 1U8XX 3WIDA 5KJ6A 3LQFA 3GPIA 1X7GA 2B69A 1NQOA 1T26A 3ZWPA 3WQRA 4E5NA 4FOOA 1GPJA 3N58A 1UAYA 1NQTA 4I5FA 3WWYA 1LQTA 3GVHA 5DN9A 2O3TA 3WDSA 1ZIDA 1PJ3A 2VTDA 4ONEA 1NR7A 4K6CA 3ANLA 4PIVA 2D1YA 1ZO8A 1NWCA 2HRBA 3DFUA 3G1TA 3JQAA 2GUGA 2GLXA 2WYVA 4YAGA 4ZRNA 4CM4B 3F6YA 4ND1A 3KYCB 3RAJA 3E48A 1KC3A 4OQYA 2DQ4A 3GVCA 2JFHA 3VH3A 2OFPA 1G1AA 2YHIB 3LVFO 2J3JA 3LF1A 3PHIA 4RPJA 4CMEC 3WYCA 4B4WA 9LDTA 3NDRA 3BIOA 1I01A 2Q1UA 1PR3A 2IYPA 2RHCA 4M49A 3WX0A 5CAEA 1V3TA 1ISMA 1JWAB 4GLOA 4GX5A 3ETEA 5F3RA 4BO1A 3HG7A 3ZV3A 1NPTO 2VRBA 4NK5A 3QVXA 2GN4A 3DZKA 4IXWA 2G1UA 1HDGO 4CQMA 2PZLA 1A7AA 2IEBA 2AW5A 1CYDA 3JQCA 1H2HA 3ZV4A 1R37A 4BNMA 2JD1A 3HWRA 4KMSA 5ITWA 3OFSA 5MGBA 1GY8A 1P33A 2PA3A 3WNVA 2X1HA 3AUTA 4DUPA 3NDIA 4M8SA 3A14A 3ZV5A 4E31A 1IPEA 5DDIP 4XJSA 5JYDA 1DJQA 1ZMOA 2LDXA 3ABIA 1CF2O 3MJVA 4GQAA 4CM8B 2FPPA 4EEXA 1P1HA 2OUIA 3JQGA 1EVJA 4BNUA 4WEOA 4ZRMA 4E32A 2YFHA 1NASA 1NFQA 4XYLA 1SOWA 1EQ2A 4MINA 4WLVA 4RCVA 4QECA 3KYBA 1ADGA 1JA9A 1YL7A 1B3RA 3AUSA 3OMLA 1U4SA 3GMDA 4YT5A 2DM6A 2P4QA 3IKVA 4BNGA 4HX5A 1Z82A 3ZU5A 5L7TA 3HFSA 3I6QA 3OSUA 3ZU4A 3L77A 1ZEJA 4I5DA 4RVGA 2I9PA 4U6SA 3M2PA 1WMBA 5EQFA 1B0AA 2CF6A 4Q3BA 4DPLA 2I6TA 3WR5A 2OP0A 3ZHXA 4B3JA 2IXAA 5DP1A 3GF4A 1HF3A 4PLPA 1LQUA 5JW6A 3D64A 4XYBA 4RF4A 5I9NA 1N9GA 2I3GA 1DFIA 2C59A 2J6IA 2HMSA 3ENNA 4U5QA 3D3WB 1TEHA 4RZIA 1HDXA 3JYNA 2AEFA 3GZNA 4AJKA 5KVVA 1GYPA 4QSMA 4EJ6A 2VUSA 4MVJI 4C7JA 3DMYA 1ZXLA 4BGIA 4CR7A 3X2FA 4DIFA 1Q0QA 4XJTA 3NJ8A 3JD4A 1UUFA 2ZYAA 4W99A 1X0VA 4YAEA 1GL3A 4YAJA 4HY3A 2VRCD 2GZ2A 4KQXA 4YA6A 1E3IA 3AY3A 5DZSA 1F8FA 2ZYGA 2NTVA 1BXGA 2QRLA 3C7DB 3RU9A 3F46A 2RHRA 4CM9A 3VKUA 2ZTLA 4ZJUA 3HDQA 4WASA 3C8MA 2Y93A 3OHSX 2HJRA 4FN4A 3QQPA 1VJ0A 4R4JA 5KJEA 4TWRA 3GHHA 3M6IA 1U2GA 3L6DA 2HCTA 3GAFA 2Q1WA 1PQUA 1LX6A 4LRTB 1YH3A 2Q45A 3JQDA 1GYQA 2HSDA 4XGKA 4R01A 1JKJA 3QY9A 1P1KA 4YT2A 5BNFA 4GGPA 1NAHA 5BT9A 4A26A 4CLEA 4RPKA 1CQJA 2PKRA 5DCWA 3B70A 5DP2A 3WOHA 3U3XA 4B79A 1ZH8A 2GGSA 1UZLA 1X1EA 3VTZA 1EQUA 2NTJA 2DTDA 3KB6A 2BH9A 4CV0A 3RQSA 3IQDB 1C0IA 3VPSA 4PLVA 2FR0A 2FN7A 3NYWA 1GUFA 2FZEA 1CJCA 3UAGA 4PLZA 4LMRA 3WGQA 5K6AA 2PGDA 5L45A 1SB8A 2PGLA 3GGPA 1TXGA 2VZ0A 4L0QA 2NV6A 3W4JA 1E1NA 1LDEA 4B3HA 3RBZA 1TT5B 1I3NA 2H9IA 4J16A 1PZGA 4QO7A 1Q0LA 3HN2A 2PZJA 4ID9A 4DRYA 3EDMA 3OBBA 2Y99A 3RUEA 1IULA 2GDZA 3L9XA 2YDYA 1DIAA 3WIEA 2H5LA 4MVJP 3KSZO 4D41A 1K3TA 5COQA 4PFJA 5BSEA 5H83A 2NSDA 3LF2A 3FBGA 1JN0A 4TZTA 1ISGA 1E5LA 2VYNA 2EV9A 3DAFA 5HS4A 4RO0A 3LLVA 1EUDA 2VYVA 1EBFA 1GCUA 1PJQA 1UR5A 3GEMA 4FFMA 2Z95A 4NI5A 3BMQA 1WNTA 3ZW8A 1FDWA 1LJ8A 5BQFA 2FSVA 1VI2A 1BXKA 3BTUA 5KNLA 1ZNQO 2C82A 1H6AA 4XQGA 3UVEA 2X0JA 4Z3KA 5L3ZA 5T8KC 5T67A 1AUPA 4IGFA 1EVIA 2I66A 1P0CA 3DBRB 3KEQA 3PLNA 4AL4A 1Q7GA 3UICA 2JCVA 4CL3A 6LDHA 4BQRA 1HDOA 4EUEA 4NFYA 1DRUA 3OETA 1V3VA 2WEKA 3P19A 4IMPA 4UVGA 4E21A 1PWZA 4IS3A 2Z1NA 4KTTE 4YR9A 1NWHA 2C07A 5B4UA 2Y0DA 5F21A 4PG5A 3DOJA 4JGBA 1E1LA 1BW9B 4BKOA 1D8AA 5TC4A 1M2WA 1UP7A 4BKRA 3ZNQA 2YW9A 4E12A 3VVBA 3I5MA 5C7IO 1LRKA 3OQBA 3F47A 1DAPA 2QYTA 4YCAA 1BWSA 2NU8A 3FR8A 4XA8A 4ZD6A 1IZ9A 1PGNA 1JW9B 1U3UA 2ZK7A 4Q39A 3QVWA 1XGKA 3KLPX 4A27A 1ENZA 2V6MA 3OIFA 1NHGA 4ZA2A 3R3JA 4BGVA 3ZW9A 4NMHA 5A04A 1O6ZA 2OBYA 2Y0EA 5DULA 3PPIA 3L4BC 1SMKA 4M55A 2J8ZA 1DFHA 4R5HA 2BF7A 2OMEA 2WJPA 4E33A 4BNWA 3OIDA 4D43A 3FF4A 1U5CA 4RQTA 4CPDA 3DHEA 2FMUA 4J9VA 5KVSA 1U3VA 2VHWA 4WLUA 1KOLA 5DOVA 3AU8A 3FSRA 3M2TA 4BO8A 1ZKMA 2DTEA 3DMTC 4WOJA 3ZGYA 5CDYA 4L74A 1B8PA 3W8FA 2V7PA 2W2LA 4FC6A 1T2AA 3PJGA 3RI3A 3FPCA 4HNGA 3HN7A 3IIEA 3IUSA 4IIVA 3KV3O 1N7GA 4DIBA 3VZSA 1H2BA 2O4UX 3H7AA 5EMHA 3TDKA 5JDIC 1SB9A 3HHPA 1VSUA 4Q3DA 5DCUA 3FRJA 5I8WA 4ZU3A 2VOJA 3H9EO 1IZ0A 4BNXA 3DFZA 5ENDA 1WWKA 2D59A 1YQXA 5KVCA 3H4VA 4HNHA 5CG2A 5DOZA 2HMUA 1UP6A 1T2FA 3OJ0A 4A0SA 4P4NA 4RV9A 1QLHA 1GADO 4WUVA 4CQLA 3MWDB 4OL9A 2UVDA 3Q3CA 1JKIA 4FFOA 1ZSYA 3BA1A 1HRDA 3UKOA 1KEUA 1BVUA 3I83A 3BMOA 4B3IA 4EBFA 5ILOA 3CTMA 3H3JA 1MLDA 5BNTA 3WGGA 4BMVA 1LI4A 4XIYA 4LVCA 1K5HA 3OJOA 3KZVA 4FCCA 5F1KA 4YACA 4BOYA 4JQCA 1PQWA 1Y1PA 2YDXA 3JQ6A 1IY8A 1ISHA 3K8ZA 1C1XA 4FJ0A 4XWYA 1XU7A 2BFAA 5THQA 1P45A 2I67A 3FWZA 5AXAA 1G0OA 2JFGA 3OP4A 3EVNA 1I2CA 2IZZA 2H63A 1QXSA 3O4RA 2EJVA 3MJSA 3KSDO 1LSJA 1LUAA 3GC6A 1E3JA 4PLGA 3WMXA 1PZEA 2VRCA 4OOFA 2Y68A 4OOEA 3FWNA 4WLNA 4IDDA 3GH3A 5IXYA 2JCYA 3LT1A 3HDYA 4XR4A 5JAQA 1K89A 4FB5A 3C24A 4BNYA 2XF8A 3CKYA 1UJMA 3JQ9C 3JD3A 5LCXA 1PS8A 4BNHA 5ER9A 3D0OA 5T57A 3GK3A 1FMCA 4RDIA 4WCDA 1ZK4A 4J1QA 4YJFA 1M6HA 4BO6A 4IDFA 4NJMB 4KQWA 1HE2A 2UUOA 1V35A 4XCVA 1MUUA 3RKRA 2ZB7A 1AN9A 3K92A 3BMNA 4QFDA 3DZBA 3QLJA 1N7HA 8ADHA 2FOIA 3PZRA 1E3WB 1N2SA 1XCBA 4NU5A 5JE8A 4OJNA 3TZCA 1DJNA 3M1AA 3WTCA 3QIVA 1K2WA 3OEYA 4LCEA 3GEDA 2X6TA 2X0IA 5ILGA 4CM5A 1ZSVA 4IMRA 3UN1A 3VZRA 4IINA 1C1DA 1YB5A 3VZQA 1PZFA 4CQMD 2Z5LA 2X5JO 1JVSA 4CMCA 4GLLA 3C3XA 4RPLA 2Y05A 4DYDA 4XRGA 1ORRA 1PGOA 4Z9YA 4D0RA 3QV1A 4MDHA 2BMAA 4PVCA 4I5EA 4LMPA 5C7LO 5TNXA 5LDHA 4KOAA 1VC2A 4QQRA 4RF3A 3JQBA 3IKTA 4RL6A 3GRPA 3O9ZA 4ZVVA 4G5HA 2GD1O 5BR7A 1KEVA 3VPFA 5IJZA 2GN6A 2BELA 3VPXA 3A4VA 1E7QA 2HLPA 4DIOA 1SC6A 3I9OA 3E6AA 1XLTA 4XQ9A 3INGA 5G4KB 2ZCUA 3S55A 1Y8QA 4UUPA 3N7UA 3PDJA 3IP1A 4AJ4A 1NVGA 3PRJA 2BFOA 1V0JA 3GY0A 1P9LA 1DIBA 3NTQA 3V2HA 4ALJA 5A4DA 5CEEA 1E7SA 1OMOA 4DVJA 3LDHA 2NUAA 1NHWA 1AE1A 2NWQA 1RM5A 1LRLA 3NGLA 3WMWA 3WBBA 4DYVA 3GDOA 3TOZA 1Q7BA 2RIRA 3ASUA 3ANMA 4E2XA 1XDWA 4FFPA 1SAYA 3RUDA 1NQAO 1GU7A 2C54A 3R3SA 4IJKA 2E37A 3IJPA 1DLJA 1YL6A 3ZU3A 3C85A 1QV6A 1T24A 4XDZA 3KOUA 1EE9A 4DGSA 4GKVA 1I2ZA 4IDCA 3QWHA 1PGJA 1OI7A 2D4AA 4UVDA 1EZ4A 2BFMA 1SEPA 1IHYA 2DBQA 2NVWA 3AW9A 1YJ8A 4J2OA 5JSFA 6ADHA 2PKQO 1KVUA 2W2KA 1H94A 3WG9A 1YQDA 1QMGA 4CM9D 1LBEA 2EKLA 4R68A 4TVBA 4YDRA 4PLYA 1H0KA 1XG5A 1M75A 2ZQZA 3BTVA 3DBLB 5CP8A 1L1FA 4CM6A 4I9NA 1OC2A 2DKNA 4KDFA 4JCOA 1JWBB 1VL6A 3KHUA 3R1IA 2WD7B 3MZ0A 4LISA 4C4OA 3CINA 1LC0A 1U4OA 4R54A 3RC7A 1KY5A 3AOEC 5EERA 1XELA 3NGXA 3H5NA 2QZ9A 5BNIA 5ICMA 5GMOA 4EUFA 2QW8A 3O8QB 4Y6SA 3ROMA 3ZNNA 4KUHA 4IQGA 3NT5A 4E4YA 4MVJG 4YJDA 4UVIA 5U1PA 4YQYA 1E1MA 3CEAA 1VJTA 2VNAA 4J2HA 1I36A 1PWXA 2P5UA 3IMFA 3PYLA 1KVRA 1YOVB 3HE3A 1ZSNA 1PGPA 2QX7A 4RGBA 5EJ2A 1YBAA 2D2IA 3OQ6A 1UZMA 3QJ5A 1DB3A 4IY1A 4I9HA 5CDSA 2E4AA 2G0TA 1ZW1A 1FDTA 4IS2A 4UREA 3ZWYA 5IDXA 3DAPA 5A3JA 1TLTA 2PH5A 1ISJA 1V9LA 2DUWA 3LC1O 2AG8A 5ITVA 1E3LA 5JCXA 2PFGA 2PZMA 3QHAA 3JYQA 4HFJA 4OKNA 1E6EA 4URFA 2E48A 3LT4A 5K9ZA 2PWZA 4AJNA 2Q4EA 4MKXA 4B4OA 1LLQA 5DCYA 3KETA 2VYND 2VZ8A 5TT0A 3RKUA 4NQZA 2PY6A 3LK7A 1FK8A 3V1TC 5A9SA 2VYVD 1R6DA 3UXYA 4D7AA 5JY1A 2ZATA 2Y1CA 5KOIA 1ZJYA 5CHEA 3OEWA 5JDCC 4D45A 4R41A 4CMIA 1ULSA 5TRTA 5JC1A 4RPGA 3GGOA 3QWBA 4MVJD 4N54A 5BSFA 1SOVA 5IZCA 4CLRA 1UP4A 1PSDA 2JD2A 2DLDA 1PTJA 4INAA 3ZHZA 4ZQHA 2JAPA 4GSLA 3DZHA 5TSDA 1YONA 4U8GA 4YAKA 2VCYA 4Y67A 1LTHR 3JQAB 3QW2A 4DC0A 2WE8A 1UDAA 2VWQA 4IXTA 3KUXA 2R2GA 3G49A 5DBIA 4WK6A 1LRJA 2AQIA 3V1UA 4BGUA 3AFMA 2IRWA 1HXHA 3MJEA 1LDBA 1IUKA 1WP4A 3DB2A 4GAEA 3DBHA 4B7CA 1DC6A 4YQZA 3B6ZA 3F9IA 3M1LA 4LRSB 2NM0A 3ZWBA 1ADFA 2ILTA 4L8VA 2SCUA 4M86A 5G0WA 1QLJA 3H9JA 3TJRA 3RJ9A 1CETA 4ALKA 4R1UA 5CDTA 2GASA 2J5RA 3D3EA 3D7LA 5CFZA 1RJWA 4IQ8A 4NG5A 2NLOA 2XXJA 3WGOA 1EUCA 5JMWA 1X7HA 2QYSA 3DQPA 4CQMB 1P1FA 3DAGA 3KYCA 3Q11A 4CMKA 3JQFC 2QIOA 3QA9A 4J1NA 4R5MA 4BNJA 1QYVA 2X9VA 4EI2A 4D3FA 3UCEA 3OJFA 1ZXBA 2NU6A 1CRWG 3S2EA 4WNIA 3EUWA 2W2LD 3CMMA 3GN2A 3MWEB 1FDSA 4TKMA 1G6KA 1FDVA 4PLCA 5MDHA 4BB6A 3ONEA 1R16A 2D5CA 2YQ4A 2YV2A 1X0XA 2CDCA 4XYEA 3W8EA 1WVGA 2NU7A 1B16A 4Z0TA 3VKVA 2XOXA 4BV9A 3C1AA 5A9RA 4AJEA 3LSYA 5JY6A 1B2LA 3PJDA 2Q2VA 1K6IA 2BGKA 4II3A 4R51A 3RVDA 3V2GA 4CV2A 1V3UA 2NQ8A 3ORFA 3I4FA 3CUKA 4AJLA 3FNFA 2P91A 3GGGA 3TZHA 1R12A 4CLXA 4EJ0A 1E92A 5T5QA 2AHRA 2YYYA 4PN3A 4Y6RA 4AJJA 3IDSA 4DWVA 3PEFA 4OGWA 1EMDA 2OP1A 4CJXA 4DREA 3P5SA 4BS9A 2X5KO 2RAFA 1PL8A 2YV1A 4YAIA 4N7RA 4TRJA 1J5PA 1E7WA 4IPTA 4L4SA 1IL0A 1N9GB 2X7HA 1J0XO 4NU6A 1PJLA 4WOKA 3UH1A 3QWAA 4R9RA 4YJHA 2O48X 4IZIA 1DC5A 4G81A 4QUKA 4RVUA 3AUAA 5TQVA 3WGYA 3ETDA 3QWFA 3UCXA 5EESA 4GGOA 2B36A 4XZ3A 4YVFA 3GZNB 1YVEI 4A7PA 1U28A 2FY8A 3EGOA 2Q4BA 3GMSA 3D5QA 1X7DA 3WFIA 4BO3A 4ZN6A 3WGZA 3KEOA 4J9UE 3JQ8A 2VZ9A 3SC4A 1ISFA 4E30A 1BXGB 4OQZA 5CDGA 3WWZA 3BMCA 4HUJA 1HLPA 5L53A 2VN8A 3I9JA 1TVEA 3K96A 4BL5A 3I6IA 1E5QA 3H5AA 2PR2A 2UDPA 2X5OA 3VH4A 4HV4A 4EZBA 4GBJA 1T4BA 3ICCA 3DBVO 2O2SA 2B4TO 2GRAA 4FDAA 2NTNA 3ZWVA 3CZMA 4TRMA 4CV3A 1J6UA 4O6VA 2X4GA 3O38A 5AOVA 4ZQEA 1K6JA 3U5TA 4UEKA 2WDZA 1I10A 1WPQA 1GYRA 2HK9A 2PKQP 2AE1A 2CVOA 3BHJA 1J4AA 1X1TA 1NNUA 2UUPA 4NHEA 1ZK1A 3SC6A 4ZICA 1YO6A 1BMDA 1U7TA 2NVUA 2BHLA 4OYRA 3JD0A 1U3WA 4J6FA 1B8VA 4ROSA 3E8XA 3AWDA 4AJOA 2VOEA 2YJZA 4E6PA 1SNYA 2VT2A 4ND3A 4CUZA 3FBTA 4J4BA 5HA5A 2O50A 3STHA 2B37A 1GR0A 1PIWA 1QR6A 4KZPA 4D42A 2PD4A 2OORA 3DTYA 4BKQA 2A9FA 3MJTA 4E5YA 2HRZA 1WLYA 4F46A 2BLLA 2ET6A 5A3VA 4CMJA 3D5TA 1GZ3A 4RDHA 1VLLA 1BTOA 1SBYA 1UXKA 3QVTA 2VWPA 3V1YA 2WE7A 5CEJA 2GCGA 3NEPX 2BI7A 4M87A 4JN6B 3W6ZA 4C7KA 1O8CA 5JO0A 4R1SA 3V5NA 4GI2A 1TB4A 3S2IA 5TF4A 3ZH2A 4BNLA 4MVJM 5J23A 3IS3A 1Q7CA 1TT7A 4DLLA 1D1SA 1S6YA 3K2EA 2OXIA 3BHIA 1P77A 1VKOA 2G17A 3EZYA 2CDAA 4NBWA 1BVRA 1J49A 2DPHA 2QHXA 3BMQB 2GNAA 1QYCA 3V8BA 4AICA 3ZWCA 3SX2A 5HTOA 1HLDA 3E18A 2X8LA 4BIIA 1E0DA 3PQFA 1MG0A 1JKFA 5JAMA 1MGOA 4DPMA 4E5KA 1I8TA 1PJSA 3ZZNA 4EUHA 4IZHA 3TF5A 1AHHA 3COSA 3GLQA 4AVYA 4MVJA 1GUYA 2XPCA 2XXBA 4ALLA 3NTOA 5HS6A 1HDRA 3EVTA 5JXWA 1HSOA 1O89A 2JHFA 1XIVA 3PTZA 4S3MA 4UAGA 4W9NC 4YEDA 1YWGO 3VDQA 3ZHYA 4AJPA 5KJFA 4J4TA 1O94A 3F1LA 4RZHA 3RFVA 5JYEA 2HUNA 3I23A 1HL3A 1EFKA 1HDZA 1YB1A 5T64A 3WXBA 2DBRA 8LDHA 4XQCA 3D4NA 3P7MA 2D3TA 2PTGA 3OF2A 2E49A 3AI3A 4JP2A 5JAIA 4YT4A 2P9GA 2QRJA 1TA4A 2VWHA 5TIIA 5COBA 4J7UA 4WE3A 2G82A 3ZWNA 2ZB3A 2EWMA 1KVSA 2Q49A 4N5NA 5AVOA 5T6BA 5ES3A 2BGMA 2R00A 4P4GA 3RC9A 4E5PA 4AFNA 1HZZA 3G0OA 1PQPA 5AYVA 5A5EA 5G0UA 1YBVA 4ND2A 3E9MA 1F14A 1GQ2A 4M89A 5I7SA 1H9BA 4EW6A 1YXMA 4KUEA 2BGLA 3SVTA 1RM0A 4D79A 4H7PA 3RUAA 3KYDA 4MPDA 3DO5A 1Y9EA 4ND5A 1GV1A 1DBVO 1HE3A 5FF9A 1RYEA 4XRRA 2OHXA 3IC5A 1GEEA 5C5IA 3OQ1A 5DBFA 3DL2A 3HB5X 2ZTVA 4RPHA 2BKAA 3K73O 4IDGA 2POQX 1E7RA 4I5GA 3W1VA 2OGUA 2O23A 3O26A 5L9AA 2CSUA 1DHRA 2RH4A 4LSMA 1F0YA 3LU1A 4NK4A 1ULUA 3D4OA 4HBGA 2A94A 3DTTA 3LC7O 1XR3A 2EGGA 4PRKA 3WLFA 4F6LA 1GZ4A 2HK8A 4CV1A 3FTNA 4QX6A 4BHTA 3PFWO 4PGFA 2DVMA 5JC8A 1G0NA 4DQXA 1HYHA 1WMAA 1EUZA 2HKIA 2OOSA 4DC1A 4GH5A 2AMFA 1CWUA 2Z1MA 4RVFA 4IDEA 2WYUA 2C5AA 1FF9A 1UXGA 4PZCA 1NVMB 2ZJ0A 5L4SA 3EK2A 4A03A 3SBOA 3DOCA 2EKQA 4E0BA 3VOSA 4CQLB 4F45A 1ENYA 2YFQA 4FGSA 2AG5A 4BMSA 5CDUA 2Q3EA 3GNQA 3BMOB 1NXQA 1WZIA 1P1JA 3GDFA 4Y9DA 3F5SA 4CLDA 4PG8A 2EGHA 3DWFA 1W73A 1OFGA 2A35A 5CEFA 1QRRA 3DONA 3N74A 5IAAA 3MEQA 1PX0A 1H6DA 4WGGA 3UOGA 4MP8A 3H8VA 4OXYA 2HJSA 1GZ6A 5IN4A 1Z7BA 3GDGA 2FR1A 2YQ5A 4YBZA 4WCFA 1P1RA 1NX6A 3NKLA 4LK3A 4HWKA 4NIMA 1HDYA 4PZDA 4JBHA 1E77A 4Z6KA 3ZWAA 5ENVA 2PNFA 3PDUA 1ZZEA 4FIZA 3QVSA 2Y0CA 4JLWA 2BRUA 3EHEA 4J0EA 4JX8A 1LSOA 3PK0A 3VHRA 3TZ6A 3GNSA 5HBRA 2DTXA 2HQ1A 3PHHA 1LEHA 1IPFA 1P31A 1YBMA 2O7SA 2VHVA 4FR5A 4YJFB 4NDNE 1LA2A 2TMDA 4Z0HO 3EC7A 4O0LA 3FNGA 4H3VA 3E5MA 4UEOA 3PQDA 3BMNB 1KIFA 5A05A 3CE6A 3OIGA 4BO9A 4CMEA 1HDCA 4FSHA 1DIHA 1NAIA 3U9LA 1FXSA 4CR6A 4LVUA 1Y7TA 2DBVO 2O3JA 3KVOA 2P68A 1P3DA 3ZWXA 1UZNA 3VVCA 3DZFA 4AJ1A 4BNVA 3FR7A 4W4TA 2DUUA 3WYEA 1N8KA 3K6JA 1EVZA 1C1DB 1QORA 4ILKA 4P38A 3B20A 3KBOA 4XQEA 3EY4A 1LU9A 3WFJA 1D1TA 1XEAA 2CMDA 1E3EA 3FPLA 2NU9A 3FI9A 2HU2A 1VJ1A 3UW3A 3NX4A 1XHLA 5EN4A 4BKUA 1F17A 1DEHA 4WLFA 3EYWA 4JXKA 1UXIA 3ZNPA 2JFFA 3RU7A 1KETA 1B15A 1NFRA 3FHLA 4LCJA 2QQ5A 3EAGA 4PVDA 4OXKA 4QEDA 3G3EA 5B12A 3ENKA 1N5DA 4YT8A 1VL0A 3RASA 3I4CA 5G2OA 5FI5A 4XKJA 4XIJA 3G1UA 2GZ1A 2GERA 4ZQFA 3SJUA 4NNJA 1GCOA 1OC4A 3PZBA 1OZAA 5FEUA 1Y8QB 4GMGA 4W7IA 3GVIA 1EK6A 1ZUD1 4XD2A 3ZHBA 3GQVA 3GNTA 5K6AC 4CL8A 4DLAA 3I9KA 4E2YA 4AG3A 2JCXA 4EEZA 4FC7A 3QSGA 1KY4A 3K2BA 1HEUA 5KWEA 3A28A 3ETGA 1F06A 1QV7A 1P0FA 5A02A 1V6AA 3AM5A 3OM9A 3QP9A 3AOGA 1A4IA 4NZ9A 3TSCA 4Z3DA 4ALIA 1ONNA 1U1IA 3G79A 1Z73A 3S8MA 3JCZA 2WD8A 4E3ZA 3JD1A 2AQ8A 3OA2A 3TQHA 1E7YA 3H65A 1R4NA 3B1JA 5KTKA 2XAAA 4PRLA 1HZJA 5C7OO 3UFXA 1I0ZA 2PK3A 3DZGA 3GEGA 1CERA 1I2BA 1OOEA 1V8BA 2VWGA 4TSKA 3ITDA 1SPXA 1PEDA 3I9MA 3GOHA 3RUCA 2AQHA 2EG9A 1KEWA 2OL4A 2CDBA 4S1VA 1ENPA 4NBVA 5EQDA 3UGKA 4E5MA 4NBUA 1XKQA 2I99A 3MJ4A 3MTJA 4FBGA 1MXHA 4Q3EA 4CUJA 1QP8A 2C7VA 1VKNA 4B8WA 1YDEA 2X0NA 3OJLA 1ZK2A 1GFSA 4R1TA 1ZK3A 3WSVA 2CZCA 2I76A 3JQEA 3SLKA 1D3AA 2DC1A 1DDOA 1R66A 3RC1A 3Q9NA 5A5FA 5TS3A 1H6CA 3MJCA 1PL7A 1SEVA 3E1KA 1PJCA 5KJCA 5B1YA 3OH8A 1MG5A 1U8FO 4YPOA 4GVLA 1FDUA 2CNBA 1W6UA 2B83A 2IODA 3JQ7A 3PXXA 3U4HA 3E82A 1HYEA 5A9TA 1DO8A 1M76A 1N1GA 5JLAA 1NR1A 2VTEA 3MOGA 3GUCA 1ZJZA 4TRNA 3U0BA 4BO2A 1E1KA 3NUGA 3P2OA 3RIHA 1A9YA 2ZB8A 4CLOA 4GKBA 5THKA 1T1RA 4HFRA 2F00A 4R3WA 3DXFA 4OIMA 5A1TA 1ZMTA 3GA0A 2EW8A 1LDYA 3GVXA 3I1JA 5DT9A 3AFNA 4HADA 4FFLA 1HETA 1A5ZA 2GO1A 3ADPA 2G76A 4Q3CA 2IXBA 2VUTA 1M6WA 5IFLA 2CD9A 2DFVA 5JMPA 2X22A 2J5KA 1HT0A 1EVYA 2B4QA 2DBZA 4J1SA 1U3TA 4UVEA 4O63O 1Y8RA 3AI1A 3L9WA 4JK3A 4JJFA 1T25A 2AXQA 1E3SA 4CLHA 1NFFA 2OO5A 1YOVA 5ADHA 3R0IA 4P8RA 1PJBA 5B4VA 5A9SB 2D5AA 3U09A 1CDOA 1I33A 1IYZA 1W8DA 4KDEA 5F5LA 7ADHA 3BTSA 1GV0A 5CPBA 2P9CA 1PJ2A 3T4EA 1VPDA 2P5YA 3S1LA 1WAMA 2PLAA 4CMIB 2WYWA 1HTBA 1Z74A 2Y66A 1BDMA 5T8KA 4K6FA 1MC5A 3WSWA 4YJGB 2WTBA 2FPIA 2WMDA 3WGTA 5JO9A 1EBUA 2F1KA 4CLRB 4RLSA 3UUWA 2ZCVA 3AI2A 3MOIA 4W9NA 3BTOA 3OECA 2Y1DA 5AQ1A 1A72A 4OXNA 3HDJA 1ZK0A 3U4CA 2JL1A 3T4XA 2DPGA 1NPYA 5EIOA 1X13A 2X23A 2ZYDA 3DDNA 3LT0A 4HFMA 1KBZA 1B14A 1N92A 4A2CA 2FWMX 3KXDA 4IM7A 3IL2A 5DBGA 3HQ4O 4ZQBA 1PS0A 4R3NA 3X2EA 2ZB4A 1Y81A 3SEFA 3WGHA 1BDBA 1R0KA 3QVOA 4L75A 1C0LA 4ALNA 4R9SA 3TL2A 3RFXA 1R4MA 3DBHB 4CMBA 5F1OA 2VQ3A 5FFFA 1QYDA 4MVJH 1UDCA 3ZWOA 1AHIA 3JV7A 1D4FA 1KS9A 2HO5A 1DIRA 4GVXA 1EK5A 1UAGA 2A4KA 2DAPA 2DFDA 4RJTA 4YXFA 4YTEA 1MB4A 2X86A 3NTRA 3NRCA 4I8XA 5IDWA 5IZ4A 2Y1FA 3BZUA 3RBXA 2CVQA 2CUKA 3DHNA 3PIDA 4BGEA 3L4BA 2D0IA 1HWYA 3CPSA 1C0PA 2BI8A 1E6UA 2JKVA 5EINA 1LDMA 4BQPA 1ZCJA 4CM4A 2AE2A 1B3BA 1JQBA 1SZJG 4MIOA 2QRKA 3PWKA 2Q50A 1I3LA 4B4UA 1DHTA 1VL8A 1WDMA 2YHIA 2PH3A 3DMTA 1BXZA 1MA0A 1JDJA 1UXHA 5TJHA 4E2WA 1X15A 3S2FA 4EJMA 3GFBA 2Q2WA 3WS7A 1H9AA 2VUUA 2Y67A 5KJ1A 4O5OA 3KTDA 4FJ1A 5JNLA 3C1OA 1JU9A 1P1IA 3H9UA 9LDBA 2J3HA 4MP6A 4RLHA 4J7CA 4FJ2A 5JDIA 2GYYA 1Y5MA 4W7HA 3TZQA 1Q1NA 1BGVA 3RFTA 3JQGB 2A92A 3AU9A 3K9QO 2B5VA 2VT3A 4IQ0A 3WBFA 1ML3A 4PG4A 3H2SA 2UYYA 2EF1A 5KKAA 4ND4A 2FPGA 1H5QA 4E13A 1DC4A 4XR9A 4Y98A 3RD5A 4MVJF 4WLEA 1Z45A 3JQBC 1DRWA 1XA0A 3U4IA 4UUNA 2WSBA 3Q2KA 3DC2A 4QO8A 1B7GO 1EDZA 3ZWMA 4EITA 1K6XA 4U7WA 4B4VA 3TL3A 5B4TA 3ZI0A 3Q6IA 4PLTA 4GWGA 4N18A 1I32A 4FGWA 4DL9A 4WLOA 4CM8A 4CM3A 4OSPA 2EW2A 2HMVA 4YJHB 1YE3A 1TI7A 5CG1A 1C3VA 2C0CA 4RQUA 3KLMX 4L76A 3T7EA 3UHAA 3HB4X 3U49A 3DZJA 4J4HA 1OAAA 4QXMA 2FP4A 1WW8A 2FSSA 4DBZA 1ONOA 1PR9A 1ENOA 2O3RA 4GWKA 1SO8A 1WDLA 3IUPA 5LC1A 2UAGA 4NFHA 1QSGA 1XYGA 4IBOA 5AXDA 4AJIA 4G65A 1NP3A 3BYZA 4RVDA 4CUKA 4HP8A 4GX1A 1Q2XA 3FTPA 3JQ8B 1EE2A 1HYGA 3MTGA 4I08A 3K30A 4ESOA 2J3IA 3BMCB 4AJ2A 2NVBA 3FD8A 3WTBA 4JJGA 3EW7A 4GPD1 5I9MA 1E6WA 2EHDA 3JQ9A 4DTIA 1ADCA 4BMNA 2RH8A 2W90A 2ZQYA 2D8AA 4YRBA 4GMFA 3C7AA 3QWIA 3LC2O 5JCJA 1HKUA 3GVPA 5IDQA 1O0SA 4Z9FA 3AY7A 3VDRA 5G0SA 3KSUA 3D3WA 2FR8A 2ZTMA 3FNHA 4N5LA 4N5MA 1GD1O 2IE0A 2PZKA 3PYXA 3R6DA 3E03A 4OKIA 3RSHA 4A73A 3H3FA 3RUIA 3WYBA 5GZ3A 1MFPA 5GZ1A 2RCYA 4XDYA 3WNQA 2Q1TA 3DEYX 5FWNA 4PCVA 5TLSA 3ASVA 4PLHA 1N1EA 3RJ5A 3C1TA 3GG2A 2GSDA 4CMGA 5B37A 3PWSA 3ICPA 1XQ6A 2NVUB 4MVJE 4BV8A 4QT0A 1O5IA 4LSWA 3VTFA 4CMAA 1KC1A 3Q9UA 1DC3A 3A1NA 3TWOA 3AUUA 4JP3A 3LZ6A 1ZFNA 3K5PA 4IGEA 4BVAA 4JIGA 2PGJA 3NJ4A 4J3FA 3Q2IA 4L73A 7MDHA 2B5WA 2ZTUA 1M66A 3ZWWA 4K1LA 1UH5A 3PGXA 3GN1A 4BO7A 4RVHA 2AEJA 4BNFA 3WJ7A 2IYOA 4CM7A 4WKGA 4FFRA 4R1NA 2AEMA 4BNIA 2GZ3A 2Y1GA 2PV7A 2IZ1A 4H15A 1LLCA 2W8ZA 4TZKA 5L4LA 4OMUA 4HKTA 4TQGA 2JD0A 1DRVA 1ZBQA 4MIYA 5K0ZA 1A27A 1Z7EA 5IDYA 4B8ZA 1T1SA 5I7FA 2H6EA 3FN4A 4YRDA 1H6BA 1QYXA 5IF3A 3AK4A 5EL0A 1ZEMA 4TKLA 1TT5A 2I3AA 3PVZA 3TFOA 2O2YA 1ARZA 1I5RA 2CFCA 3ZU2A 4D3SA 4J7XA 2R6JA 5C37A 1I3KA 2C2XA 2FRDA 3PJFA 3T7CA 4B7XA 5BSGA 1ZVMA 1DIGA 2B0JA 4Q3NA 2C2YA 2Q46A 3FNEA 3OJEA 4LN1A 2VHYA 3GAZA 5A06A 3E5RA 4Z0PA 3F1KA 1PZHA 4RF2A 1L7DA 3JYPA 4YRAA 3KRTA 3U4DA 5L40A 2P4HX 2Q2QA 3I9NA 4K9DA 4O1MA 4J0FA 3RROA 3IAHA 4GX0A 4NBRA 4L9RA 4GSKA 2J5QA 3LT2A 3L6OO 4WEQA 2J3KA 3G17A 1XSEA 3DBRA 3AM4A 4R69A 5IZCC 1NBOA 3A9WA 4MP3A 4IJUA 1GPDG 4H16A 3H9QA 4DBVO
chains in the Genus database with same CATH superfamily
2BGUA 4X6UA 1AF7A 2YN2A 4FHDA 1CJSA 2YZNA 4LVOA 3RVLA 4MRAA 2VF2A 2OBNA 1RP1A 2AXNA 4QELA 5ALRA 5TEVA 5A1JA 1FOEB 3IVGA 5BW5A 2MYPA 5HMMA 4B6QA 2OHGA 3A6GA 1E18A 1XTTA 2WK1A 4UBKA 521PA 3BF8A 4LBZA 2C5EA 5HVNA 1RXWA 1E1CA 16PKA 1JLMA 1QYRA 3HP4A 1BW9A 1RI3A 3KJIA 3KUDA 3OPVA 4ASUD 5A2QA 2O19A 1CXZA 1DAOA 2PRYA 1MH9A 4L95C 4HGYA 4P22A 1M1YE 3VC7A 4TYWA 2PDAA 2HWKA 3A1FA 3FFBA 3WOVA 1VLZA 2BEKA 1OYYA 3KEGA 3VH2A 3OT1B 2GTIA 1XRRA 5LMZA 1A9XA 1RPNA 4B48A 1KARA 2FW1A 1UBCA 821PA 4PG7A 2PVPA 1XXLA 1VHDA 1XDDA 2X0RA 2BV3A 3R7SA 1K98A 4LOAA 4NXNB 2IH4A 3CUVA 3CBGA 5AVJA 4BKMA 4II2A 4G0ZA 3VPHA 2Q9UA 5C3UA 2ZSBA 1QDEA 4J91A 4E7OA 2ZB2A 3CVOA 2HDHA 3L07A 4K26A 5A7FA 4YMWA 4RSGA 1DPGA 3NU1A 5KO2A 3MQ4A 4KG7A 5KOJA 4F6CA 1ZESA 2UVPA 3MCUA 5AW6A 1T2EA 1FXUA 1DWOA 3C45A 4O4LB 4OJKA 2VHXA 4KVGA 3RF7A 5EHNA 4EY3A 2O3QA 4BQOA 1PD1A 2B2XA 1R00A 1GG8A 2HMTA 2ZRMA 3EXFB 4PNPA 4QVKA 3AG6A 2ZAOA 3OCZA 3GL9A 4WECA 5EUBA 4EFNA 5ISMA 1XTIA 3E22B 4XCQA 1FW6A 2C95A 4BNTA 5BR4A 2P77A 2VF7A 3DDUA 1GSHA 1ST2A 2ZAMA 2Y1WA 5KYXA 4BY9E 1E62A 1IAQA 1XU9A 3P9ZA 4ID3A 2GXQA 1UF9A 3ITEA 3OM1A 4OHVA 4TUYA 5F1YA 2IQIA 3ZVRA 1VM6A 2H4FA 3M3HA 4DKXA 4NABA 5IG2A 2ZJAA 3RC2A 2Q5QA 4AZVA 2XWJI 1PRYA 4P32A 4EIWA 4R8MA 4V3CA 1P39A 3RYTC 4F2GA 4BNNA 4MIEA 3NM6B 1Z62A 3CQ9A 1KYQA 3D4BA 4HPXB 1JQ3A 4YO8A 4DCNA 4W5RA 3GPDG 4EMSA 2AG6A 2H92A 4U3JB 4NESA 4WV3A 3TLBA 2TMGA 1VGRA 1M2OB 1ZONA 2NQTA 3NEJA 3AFIA 1P44A 4JI0B 3KNZA 4WPGA 1WKBA 3KBBA 3UJDA 1BHO1 1RAHA 4DR6B 3Q8KA 4DC9A 3KKLA 4OY3A 3WHIA 1LSSA 3QYPA 3W78A 3ROQA 4E1AA 2Z2XA 1WDKA 1YK1A 121PA 3KC2A 3W4IA 3VU1A 4KX3A 3AKDA 5DHSA 4FPXA 5BP7A 1DC7A 1R15A 4AF7A 4DW8A 1XQYA 2OCYC 5BSHA 5HQTA 2JJ2A 1NN5A 1ZS9A 2ZYTX 3QU9A 4Y6PA 1LPBB 1EFAA 4GM0A 3EXG1 1BRMA 2H7XA 4IIFA 4LFCB 4L02A 5L95A 3MB5A 2I8AA 4U0JA 1XPUA 2AVDA 4G0XA 3LO8A 1YGYA 3ZJ4A 4L15A 1MT3A 1RYFA 4ER5A 3WLOA 2PQ2A 1FQOA 5FUBA 1TAQA 3QKWA 2A9VA 3WIOA 1BEEA 4QQFA 3QEMA 1JE1A 2WM3A 1AKYA 1MKYA 3NIFB 5D5PA 5LMUB 1G291 3BHNA 1K7XB 2VZLA 3U62A 5L3SA 5BXYA 4TVOA 4P0PB 4UM9B 2REQB 1PYOA 2QXTA 2V7XA 4X6XA 3TLEA 4HPWA 1QU3A 4CE6A 1OKKD 3WHPA 2HU5A 1QVRA 2AMYA 5DH9A 1PWHA 3ZE2B 4Y2SA 1P9NA 1D2MA 1RDFA 2EL7A 4PO3X 3KTAA 3RADC 1FJHA 4OHUA 1F5NA 3QLVC 4WJZA 1LGYA 2WJAA 1LPNA 2YY7A 3TM5A 2MIIA 3I5AA 3TW8B 4JOSA 3WLPA 1O96B 3KFVA 2IITA 3HRKA 3K31A 1X87A 4RE5A 3AX6A 3HNPA 1IDOA 2XNCA 1M0TA 1DELA 3HU2A 4RX1A 5DN6A 2ROQA 2R8XA 3TPCA 3G2HA 3QTBA 4NL4H 1ZD8A 2UV8A 2EERA 4F4UA 4K6GA 3WO0A 1NPDA 4D8UA 1E9CA 4RORA 1IHOA 4Y9UA 5H81A 4BTLA 1P7VA 1S3SA 5BWMA 2NSLA 3IDFA 3IV6A 3B9PA 4NJMA 3DZ8A 2I2XB 2OZPA 2R44A 1GDHA 5HRUA 3AF5A 3ZCTA 2KSQA 1H93A 4IJWA 2JLZA 2HI0A 1AXGA 1WCWA 1BE6A 2XB9A 1JG6A 1N9KA 5JS6A 1NW4A 2Y1LA 4XXHA 2XYRA 5CU7A 1QBKC 4UQLA 1JJFA 1CFZA 2JKYA 3MCVA 5K8LA 4MYTA 1LLUA 4L4YA 2WVHA 4A10A 1AS0A 4ESHA 5BOVA 1QE5A 4RWEA 3STWA 2I71A 3CXRA 4XLTA 1GPLA 1M0SA 4JC4A 1RRKA 3LPCA 4K03A 2Y0BA 3PENA 1ZA2A 3QFTA 4A1OA 1DAGA 1WZCA 4LNHA 5J2TF 4M1WA 1Y6FA 1NQWA 1K1EA 2FTKE 2XVMA 5I8ZA 4D9BA 1TDJA 4DMUB 3RWBA 4CIWA 2AFIB 1RWXA 2JGMA 2ZVDA 3F6SA 5E1DA 2EJWA 3IMGA 1MQ9A 1T43A 3KPUA 3QOWA 1MENA 3AY6A 4MRVA 1BCRB 1E2PA 2HV8A 3U7QA 1OYWA 2VC2B 4JSTA 1E20A 1ZJWA 2ECOA 4R2XA 3HPRA 1NXPA 4IMJB 4V0ME 1FX1A 1QQ7A 5IK2A 3SLGA 5I7VA 1HFKA 2PCLA 2OHOA 4YAWA 3X1WA 3BE5A 3IVMA 2CHEA 3L8GA 2B1RA 1I1OA 1L4BA 1E5VA 4IHJF 4QPPA 5L7YA 4RVSA 1QTQA 1CIVA 4LJSA 4MJLA 4C3VA 1LSUA 1QRSA 3H16A 3ZIAD 4OHMA 5AM0A 1E3MA 3OWOA 4B6JA 1TPZA 1U2DA 1TF7A 1X7WA 4Q1VA 1M67A 3A3OA 4EPYA 3W7BA 4QPCA 1DXYA 3QH4A 4QTTB 5HJ7A 2NADA 1RNLA 1SUEA 5JNUA 3VAZA 2CF5A 1C0KA 1KYYA 4RFLA 1FVOA 4AURA 3TEJA 4P81A 4HH4A 2F3RA 1C30A 1GRNA 1BJRE 4GMHA 1V6CA 3ODPA 5IXSA 1WXFA 1JLKA 3BL8A 1VLVA 4IRXA 4P4UA 4UNRA 1YR8A 1KOFA 2PUWA 1EFCA 4KN8A 4XSVA 4MW1A 3T34A 3V1KA 1YQGA 4E2ZA 3RUFA 2I7TA 1U2PA 2W2KB 5EFOA 5AHKA 1XXHA 3PQEA 1TCBA 5EJ5A 1SXPA 4MS1B 2PX6A 4FD2A 1WTAA 1X92A 4GPAA 3VR3D 5G3YA 5JS1A 4W6ZA 5IVKA 1HO3A 2X0KA 4ITUA 3DKRA 1ELOA 2FWPA 3QE3A 3BE8A 5FUQA 1RWPA 3BK2A 3E9NA 4U7HA 2IU0A 1WMEA 3PF8A 3B51X 3EFOB 4ASUA 3NYQA 2O7QA 4NFSA 4YLEA 4ZO6A 1AVTA 3AH8A 5DNDA 1MX3A 1FS4A 2YZ7A 3L2OB 3QPDA 4MS3A 1TA9A 2O3SA 4IFIA 2VXYA 4LWZA 4PLFA 5IH3A 1HLFA 5A5VA 1G5RA 1GAQA 3D3NA 3P71T 5A71A 1DBWA 3MMSA 2UYCA 2ILVA 1QC5A 2Q0HA 4X61A 1EWQA 1U65A 1XZMA 1KEPA 1HZZC 1RXCA 2F8MA 3EC1A 4HWPA 1PW7A 4OAOA 2G8LA 4RCZA 3UV3A 2NNLD 3ISJA 4PZEA 3SQNA 1OXMA 1OWPA 4LTMA 1N2CB 3OA0A 1KDYA 2CSXA 4B3GA 4YCDA 4TMYA 4ISBA 3TRIA 3TOXA 1B8UA 2BZ0A 2HF8A 2JF0A 2PSHA 1H2RS 3GDHA 3GZ4A 4BFWA 5B1EA 1HLGA 2TECE 4X85A 4D9FA 3AM3A 1GKLA 5C4GB 2BDTA 1PU2A 3RJTA 1X86B 4JIMA 4ZYWA 3HKBB 1A96A 2IVFA 3ZGXA 2XIJA 2ONCA 2ZUBA 5D51S 5TGDA 2F48A 4NLLA 5JSUA 3VH1A 4XX0A 2ZT5A 4OAQA 1Y5LA 1Y9AA 4HX9A 2YVUA 3FZYA 1NVXQ 4NPAA 4BV2A 2WQ7A 2PZ8A 1J5XA 1AGPA 2GF2A 1Y8RB 3I4LA 1NDUA 3FYUA 5L3QB 2BKEA 1IOLA 1LX7A 3JYOA 1P3JA 2OXRA 3PHCA 5M2QA 4QPNA 4EI8A 1EX1A 4A36A 1V8PA 2MDTA 1H2EA 5FQOA 3U1TA 2NYRA 1DLIA 1GGKA 2AQKA 3AR7A 3O6VA 2R11A 4CDMA 2QKYA 4BP1A 2PD3A 1V4NA 2EKPA 5HX7A 5LQCA 3A1UA 4NENB 3UK2A 2RBEA 5CXXA 2RAUA 2DERA 1VRWA 1L9KA 2QORA 3DT8A 4L4RA 4ZJZA 3HSYA 3G9TA 2X9NA 1W35A 5D8DA 1PBNA 4FNOA 1U0BB 1OFTA 1GQQA 3F3SA 4IUCS 3C3AA 4N47A 2HCFA 2W2TA 4IO1A 4NJOA 1Z5VA 2F55A 1SCUA 2P2ZA 1Y5RA 3IMEA 3WQSB 1JHUA 1RYDA 1F51E 1L1RA 2ZBUA 3K1YA 3OIUA 4K28A 2VUIB 4OSOA 3QRWA 3BDIA 3TFQA 3ZYCA 1DBIA 2ZR9A 3KQYA 1SUCA 1YVRA 3UPUA 3M5CA 1GTMA 1JU3A 1GDDA 3F3KA 3GUZA 3JZIA 3MYRA 2RHDA 2GTPA 4U0KA 1HV8A 2FF5A 1H85A 1ZGGA 2C42A 3BAZA 2ENWA 2H59A 4TROA 4E08A 4Q9KA 3ZCXA 1NRXA 4I9UA 5AM3A 4LS3A 1AGNA 2DFTA 4WESA 3WLJA 4WBNB 4CR8A 1DO0A 1K5PA 1BOOA 3I0NA 3CLKA 3PUJA 4TL8A 1XLWA 4WW0A 1CQWA 2VJMB 5TQ0B 1CQIA 3DO8A 3H1TA 3ORYA 3R44A 3SU8A 4E13A 2GETA 3B2EA 3A1SA 2WJ4A 3CX6A 3ISVA 1NL3A 1I24A 2PBZA 5HFAA 4DZTA 1LQ2A 1KR2A 5COAA 2PX8A 3O03A 1R64A 2HTFA 3PGVA 4J49A 4HMOA 4G1BA 2V55B 1UDBA 1B6RA 1BG6A 3FCUB 2BJWA 3UXMA 3ONDA 5AVZA 1NYTA 1KVQA 4LECA 1R4MB 4BUCA 5I7EA 5IUNC 4FEEA 3ND7A 1U8XX 4GM1A 4URYR 5KJ6A 4OQQA 3EG9A 4KE9A 3T94A 2W70A 1NQOA 3SZOA 3KQKA 5B1HA 3ZWPA 1KU6A 4CCYB 4FOOA 2FDXA 3JY6A 4M1OA 3F97A 1UAYA 2YH2A 4J0IA 5EKUA 3IQZA 3WWYA 2QQEA 4M1TA 3L0SA 5DN9A 1Q1ZA 3UMJA 3JASB 3WDSA 4CKZA 2QRZA 1AGRA 3M9XA 3GGJA 5EA2A 3TE6A 1T3GA 4K6CA 4PIVA 4HI0E 5TE9A 1ZO8A 3IP6A 4RKQA 3DFUA 3G1TA 5K20A 3CX4A 3LNTA 2G5PA 2Y1KA 3DDWA 3L02A 4DDVA 3KQVA 5FWAA 7YASA 1QAQA 2NZWA 4CM4B 3FDFA 1Y37A 4FMBB 1X9GA 5TPWB 4B8YA 1GILA 3N6VA 4JX9A 2WMOB 3AXTA 1I6LA 1G1AA 3AF1A 3VH3A 1BN6A 4EX6A 3B5EA 3J81A 5DO9A 4JLJA 3A05A 2HPVA 1U9ZA 4JB2A 1ODLA 1X38A 5DB4A 9LDTA 3VC1A 4I2NA 5H80A 1I01A 2Q1UA 2IYPA 2RHCA 4JT2A 4WJLA 4Q16A 4ZALA 5CAEA 1L1QA 1LPAB 1JWAB 2IUEA 3DEZA 4Y2RA 2VSXA 5H9VA 4GR4A 5JHGB 5ARDA 3VU3A 4I50A 2GRJA 5EPUA 1U6KA 1QO9A 3MCAA 4RMJA 2W8BA 3TSZA 5JEDA 3GLRA 3HG7A 3GRCA 4JI3B 1NPTO 3OEHA 3BD7A 3E3OA 4AUNA 4RY0A 4QHTA 4MEAA 3N1UA 3ENQA 1HDGO 1JT2A 5CT9A 4D26A 4X7MA 3GZJA 2PZLA 3CLRC 5ALOA 1A7AA 2DBYA 4C4RA 1XE3A 5KTTA 1UBFA 3EZ9A 2RC6A 2WMYA 1WX1A 5BUSA 2P78A 2PGIA 4H59A 2LPMA 3FVWA 2JD1A 2EX0A 2MWMA 3NTXA 4Y7DA 1AKMA 5I7RA 2CVPA 1P9RA 2IELA 5AT1A 3AHIA 1THTA 1L5QA 1DOZA 1GY8A 1D2CA 3WNVA 3O94A 5KVAA 3G6KA 3S28A 2V0NA 5K4HA 4BN0A 1GL9B 2P2CA 5BWBA 2PUAA 1FDOA 1EVQA 1Y9ZA 4XJSA 1DJQA 5JNSA 4CI9A 4QGSA 2VJYA 3ABIA 4TL6A 4WXEA 4YFVA 5LA6A 5IWCA 5TT1A 3PX2A 3HEBA 4F3CA 2FPPA 1MRNA 2XUAA 2O2ZA 3ZIAA 3VPDA 1P1HA 2OUIA 3M33A 5JBNA 2IBTA 1OZGA 4RCYA 4XYLA 4JDPA 1EQ2A 4F1KA 1VYVA 3QEBZ 1N6RA 4RCVA 1Z08A 2HSGA 1VCHA 3VJMA 1GT6A 4LJKA 4Z0NA 4YT5A 2C2OA 2I9KA 3TRJA 1H1LB 1BDJA 4H2DA 1UMKA 1CUIA 1SG0A 3D0RA 2CCGA 4O29A 5CM9C 3V4ZA 4HOYA 3UNXA 2NO0A 3HFSA 2V5UA 3SHOA 4C6HA 1ZLXA 3CNBA 3OSUA 1HURA 1Z4QA 1ZEJA 2O7VA 3OE7A 3CZ5A 1ZW6A 1O58A 2I9PA 3D6UA 3DLTA 3O73A 1WMBA 4ZO7A 1B0AA 3BILA 5EQFA 4YPFA 4M83A 4RD3A 3C5VA 3QOYA 9ABPA 5AM4A 3FUWA 3C3BA 2CKDA 2I6GA 3RVMA 4RF4A 5E4TA 1Y6RA 3IQGX 3T7KA 3CBQA 3F98A 4GQIA 2F8LA 4DR1B 4UCQA 3VR3A 1TEHA 2VXCA 3CF0A 5TVGA 3O92A 4RZIA 4AWXA 2PZEA 5BVHB 3JZAA 4EJ6A 4BC0A 3FFTA 2WIJA 1IN4A 1Q0QA 1QHFA 2G06A 2GEUA 4BC1A 1XKTA 3RU2A 2ZIWB 3GP5A 2CJFA 2YW2A 4WERA 4FDMA 1MJFA 3O3MB 1GL3A 4LJLA 2WAMA 3X3HA 3O82A 4HY3A 4KQXA 1E3IA 3ROTA 2JLUA 2GKOA 4U4AA 3RFUA 1V1MA 3ZY2A 2ZYGA 2NTVA 1BXGA 2PGXA 3C7DB 3F46A 5DI3A 1I9CA 2Y93A 1OAOA 1RXYA 3G9ZA 1JAHA 3VU9B 1KO4A 3TAXA 3GHHA 3N0VA 5KC9A 5I3ZA 3G8DA 5DLDA 1U2GA 2ODBA 3KWLA 3QHPA 4MH0R 4ZV7A 3GAFA 2OVBA 4IKEA 2AWOA 2Q1WA 1PQUA 1T9AA 4LRTB 5AI0A 1ODJA 3UGTA 3FOCA 2QPTA 4WCVA 3V6LA 4J0HA 2R8BA 2G77B 3OWXA 5GV8A 2JATA 1GSAA 3IP7A 3FLBA 1IBSA 4R01A 1VI5A 3QY9A 1XCPA 1Z6AA 5HPYB 2ZSFA 2CCKA 2QYHA 1VJ5A 1UJNA 3ETLA 4DFDA 3A25A 3DTVD 5DCWA 5EE5B 3IUBA 1EA5A 2ANCA 2JRLA 3B70A 4WH0A 5DP2A 5BUCA 4OEHA 2GGSA 7ABPA 4OHYA 3FSGA 2AT1A 3L84A 3MM4A 3FBWA 2J7KA 3KB6A 4L9AA 3HBFA 3T5BA 4PLVA 2O8FA 3AEYA 5CX1B 3EVFA 2CCJA 1RZVA 4Z1OA 3NYWA 7GPBA 1GUFA 1XTRA 2FZEA 4YC7A 3FNRA 3L8FA 4PLZA 3AR8A 5IAEA 4HB2A 5IHXA 2FQXA 4K9MA 1TXGA 2NV6A 2Y9PB 4GVPA 1E1NA 3W4JA 1LDEA 4JKOA 4K0RA 1G9TA 2QROA 4W8HA 3RBZA 2H9IA 3UO8B 1HBJA 4LK2A 1I1HA 3HN2A 1PNQA 3ZLVA 3FJYA 3OBBA 1QH1B 1KKMA 4EPXA 3O3NB 2AUMA 4XLZA 3IXLA 3WIEA 2FPUA 4YAUA 3BRQA 1OQAA 4MVJP 4MYUA 1ZMBA 2J32A 3NQ41 1UK6A 2H08A 3G2KA 4G84A 1LW7A 2ZSEA 5H83A 4U2GA 3BCUA 1JN0A 3AETB 4QT4A 2ZI6A 3V97A 2EV9A 4IIYA 4RO0A 5TQ2A 1GCUA 4ZHQF 2FV8A 1FLDA 1W5SA 2Z95A 4NI5A 5T4HA 1ZOIA 2O7NA 2FWIA 4DUGD 1LPOA 5EIEA 3S2ZA 2FFJA 2ID7A 4NP6A 1AB6A 3F7MA 1W36D 3DH0A 1QB8A 2J9FB 3UVEA 1SOUA 3O1IC 4W63A 5L3ZA 1BMFA 1OLSB 1NKSA 1N6NA 3PRHA 1ORIA 2ONKA 3DW1X 4BMPB 3A6FA 4EGQA 4W5OA 2NP7A 4KQHA 3RVBA 2Q5CA 5JCZA 4L8LA 4QDZA 4J3JA 4C03A 5CITA 1ID8A 3C6QA 1I5OA 1OLXB 2BTOA 3EZFA 2EFJA 4EUEA 1DT3A 4G07A 3PC8A 5LIRA 1IU9A 5GPBA 2AHOA 4M1MA 1LF5A 3VX3A 5DBOA 2B30A 3WKDA 4BP3A 4R1PA 5KWVA 2Y0DA 2WJVA 5F21A 3OPXA 5AHOA 3TJMA 4C0AC 3C3DA 2GHIA 5KU7A 4BKOA 2AC7A 3TNFA 3OI7A 2AFHE 3ZNQA 2Z2ZA 4GZ3A 4KFCA 3I5MA 4ZJYA 1L6IA 3F47A 2XMSA 3FR8A 4OK3A 3S70A 4DA9A 2DR2A 4J0QA 3SZRA 1JW9B 3DMNA 4YRRA 4N3AA 4UBMA 4MUNA 4Q39A 1Q0RA 1JIQA 4QDTA 4MWGA 4H7EA 4ZA2A 4JC8A 1ZD9A 1JHOA 1LTKA 1Y3FE 2D5LA 4PHFA 5DWQA 1GUAA 4HNAA 5DULA 3DP7A 1YBHA 1KJQA 3PPIA 3DGEC 3JZFA 1B93A 3LLUA 4M55A 3ZX5A 1XO1A 1ZH2A 3HB0A 3T6KA 3TNJA 4TKVA 4BXOB 1W88A 2C0PA 2ZULA 4QAQA 4ALJA 1U5CA 2FWAA 2GUWA 1SCNE 1HT2E 3CUWA 4CPDA 2B5OA 5TS2A 4WLUA 4X1YB 1REQB 3AU8A 5HJEA 1EJ2A 2H0RA 3LVBA 4JQOA 4AZ3B 5CDYA 1LY1A 2DTEA 4WOJA 2PT6A 3K20A 5DMXA 7AT1A 5JZBA 1Z2OX 3G6WA 3EVZA 2K4MA 3OZVA 3ZXUB 2WB2A 2GBPA 4K9OA 3RS5A 5AI9A 3BXEA 5GAJA 4CNQA 2J67A 3PJGA 1VG1A 4E46A 5EHXA 4HNGA 4HN2A 5E7JA 3FGPA 5FTKA 1YA8A 1KI6B 3G0GA 5TVKA 4ZT4A 3WIVA 3KV3O 5KOHB 1W49A 1G7TA 1TD9A 2K6GA 5AJZA 1O4VA 5EMHA 2HLHA 4JVOA 3PTAA 2J0SA 1SB9A 3UJAA 1EHYA 1FTQA 2Q5FA 4O2BF 4B17A 4FWIB 1XKLA 4LPSA 2CHGA 5D86A 4NAHA 4ZU3A 2C7QA 2QLTA 4Y30A 3I8XA 4BNXA 1EFRA 1OSNA 3GFTA 4NRDA 3ZS8A 5HJ5A 1FFXB 5CH5A 4UZFA 1YQXA 4D6YA 4R0NA 3Q8LA 1YNSA 1WW3A 4U1RA 3EPLA 2VYQA 2AMLA 3HUFA 2O54A 5EJIA 3UJ9A 2VRNA 3EQ9A 4ZT6A 1CR4A 1U9IC 1IB0A 2BFDA 3AGPA 4FKBA 1PNOA 1SVMA 3Q3CA 2ZBFA 1JKIA 1ZSYA 1BS1A 3BA1A 4GSYA 2JIZA 4B3IA 3BMOA 1RQNA 2HZ7A 1Z4MA 4U9IS 3CTMA 3H3JA 4IG9A 5BNTA 1GNQA 1AQUA 4UHKA 2QZ4A 3ADKA 1PQWA 4RA9B 4BJHB 4OL0A 4Y2TA 4J0KA 1YFJA 5GJBA 1C1XA 2XMDA 2XOEA 4JOCA 2OFFA 2FWNA 1XU7A 2PANA 3HGQA 3QE0A 4J76A 3SHQA 4BECA 3CVUA 4NMWA 1G5TA 1P45A 3KJHA 3N6XA 1TO6A 4XASA 2HQRA 3FUVA 5DEOA 4GPEA 5FNZA 4O1IA 5LOVB 1CIJA 3EY9A 1UKCA 1XZFA 1I2CA 4FT4A 3CRMA 2Q6OA 2H63A 2Z4TA 4LJ7A 4XUEA 3SR4A 5ITZB 3MCZA 2IHKA 3W2EA 4CCSA 1LUAA 1UEJA 1A5TA 4X97A 4KACA 4HGPA 4OOFA 4JHLA 4EHBA 4WLNA 1T4MA 5IXYA 1GN9A 1N2IA 3HDYA 5JAQA 4TMVA 1WABA 1R18A 3A6HA 4LQCA 3LNCA 4Q15A 1GG5A 3QEOA 3CKYA 4CKCA 3S8EA 3R0QA 1PS8A 2C5SA 2C4VA 3HR7A 4EUKA 4AF6A 4J6EA 4RIGA 5ER9A 1R8YA 1W0KD 3D0OA 3T5AA 1UDXA 3KZKA 3IBSA 2DY1A 4Y2GA 1V5IA 3IOMA 3LKBA 3NR2A 3I2FA 3AR6A 4YJFA 1DOAA 4OHWA 1ZUHA 2PS9A 1WMSA 3LECA 1FUKA 5FBRB 3TB6A 4QNRA 1WY5A 2HJWA 4LOKA 4CG2A 1V6SA 3VC3A 1FMFA 1E4EB 2H4WA 5CVCA 3ILHA 1N7HA 3PZRA 3VTAA 4C6TB 4NU5A 4PFQA 4JT8A 2H4XA 3LX6A 4OJNA 5F77A 1BQEA 2MINB 3BRWA 2P2LA 3M1AA 4X1OA 4KPUB 3TD6A 3S27A 3LHKA 5IRCD 2RGEA 5FTLA 4HPJB 2PT5A 5CK4A 3ZHRA 1JGTA 1BYUA 3N2GB 1OXUA 5B7PA 2XMGA 4MVCA 1ZJ5A 2J5BA 2I2FA 5AFSA 3J7AC 1QP4A 1RU3A 3RRXA 3OLCX 4F92B 1CD5A 2XDQB 3RT1A 1UPBA 1E3DA 2H4JA 4GLLA 4DYDA 5SZKB 4XRGA 5CR9A 1VG9B 1H2XA 3AMVA 5ECYA 2Z2IA 4YP0A 1VC2A 4TLAA 3RG2A 4QQRA 1KYIA 3JWPA 3NH9A 4OG2A 3T06B 3VUEA 3GRPA 3O9ZA 4DLNA 4X8OA 3FRIA 4NYJR 5ALMA 3DE6X 4K9KA 3V4LA 1P7WA 3OQHA 4LYAA 3ECCA 4MV3A 2HFKA 2JAWA 5KCMA 3A4VA 2H16A 3UMBA 1Z8NA 1NBMA 3BDAA 1PP4A 4HMQA 1HOTA 1SC6A 4LDRA 4OHXA 2Y0PA 4FYHA 3UPDA 1QONA 1XLTA 1G8JA 2IXGA 4XQ9A 1P4GA 5FPQA 1HORA 2JJ8A 3INGA 3LDGA 3MT0A 4MUGA 4QFBA 1C29B 5BW4A 4RH1A 3U2QA 2HOQA 3IJ5A 3S55A 3OUUA 3GJZA 1F5SA 1Y8QA 2QAJA 1U3GA 4GBED 1I2MA 5EVCA 4X94A 3ZE7A 5JH7B 3IP1A 5CXSA 4BAUA 4WNAB 2VTVA 3L6CA 2HV9A 1ZOLA 3LBIA 3GDWA 1RBZA 4RHXA 1DIBA 2H1LA 3K0AB 4GP9A 4PYNA 2H31A 4Q19A 3T5DA 1Y5NA 4DMKA 4RVOA 1T8PA 4Z8XA 3V2HA 2RGRA 3RC8A 2EX1A 1E7SA 4HH1A 4KV7A 3WK8A 3PV0A 2W6JD 1OMOA 4DVJA 4M2LA 1X7YB 1Z5UA 4J2TA 2NWQA 4CEJB 3ZUPA 4P80A 5TGTA 1E9FA 1CP2A 3W6OA 3EZ7A 3WMWA 3WBBA 3PR1A 1HOXA 4PS1A 2OG2A 4U7GA 5DNWA 5CFMA 3IBFA 1Q7BA 2P3OA 4RKWA 4TZ6A 1G98A 3G8BA 2RIRA 1VE3A 3ASUA 3LHDA 4IIJA 4E2XA 1XDWA 3RFFA 1GU7A 4IYRA 3R3SA 3RTAA 1U3DA 1E3QA 1AUXA 2DX7A 2Q7XA 2ZRNA 2E37A 1P2BA 3CSSA 2ZI7A 3ZU3A 2D7JA 3BGDA 1JXAA 1VTKA 3C85A 4DNXA 1G8YA 1MRSA 1T24A 2FF7A 2NUPB 1Q1QA 4OB6A 3KOUA 3L93A 2UZAA 1NW6A 3UHPA 4GKVA 1I2ZA 3W3AD 2GPSA 4FP9A 4IDCA 1HM5A 1P9OA 1OI7A 4Z8YA 5EHIA 4UVDA 2DQKA 1ZOPA 2B0CA 3X1KA 3FHCB 1YR7A 2Y2VA 2BR3A 3C5HA 4KRYA 4YRMA 4N6OA 3WK5A 1Z8HA 1QIMA 2DBQA 2NVWA 1HA3A 2C5GA 3AW9A 3I2JA 1SVOA 4J2OA 3WG9A 3HO8A 4D5GA 4CM9D 4D3XA 2QQGA 4TVBA 4YDRA 4LE0A 4D80A 1NSTA 4LOLA 1L4EA 1H0KA 4GLFA 4L5JA 5CNIA 3BTVA 3DBLB 5PGMA 4B2LA 3GT7A 2A9KA 1L1FA 2RD2A 1K68A 1ODFA 2X13A 1OC2A 4KDFA 1NVDA 4D5EA 5BPHA 1S02A 1VL6A 1TW2A 5FLXA 3EGWA 3R1IA 3ZLBA 3ZBTA 1QBGA 1PX2A 2C94A 4R54A 5F7JA 3I2HA 3RC7A 5KWIA 3X43A 2H52A 5FUYA 2YXBA 5EXTA 3NTVA 3NGXA 1KEEB 1TCAA 1G9XA 1XK6A 1NDQA 5DYYA 4EG4A 5BNIA 1UFOA 1EFDN 5ICMA 1R8XA 2QW8A 1TKAA 2XXAA 4DSNA 1ZRMA 4MVJG 1HQCA 1DEAA 4YJDA 4YQYA 4RZXA 2ATVA 2VNAA 3MQ2A 2IYWA 4F8EA 5BV1A 3MTDA 1RC1A 5MFPA 3IMFA 3M9LA 4PTYA 1Q12A 2JHAA 1KVRA 4M7RA 5ERYA 2QE7A 2QX7A 3H6GA 1NXSA 4K81B 1F7UA 1OJLA 1YBAA 3SN6A 2D2IA 3OIVA 2GYWA 4NZPA 4QAJA 2G72A 2QBYB 1ATZA 4BZPA 2VFAA 4I9HA 1LW6E 4M0DA 4RD6A 5C34B 3A58B 3N6RA 1FDTA 2E4AA 2G0TA 1S96A 1T1IA 3MJHA 1UKAA 3PLAE 4G0WA 1P1CA 5U4XA 4BATA 2PH5A 3LXUX 3DLBA 3D2LA 3LP8A 3LX8A 2R97A 1SXJD 5ALZA 2DUWA 2AG8A 4YV0A 2PO7A 3PFGA 3U7IA 5JCXA 2F8SA 3QHAA 1HYQA 4N82A 5HIIA 4G1MB 4TQ9A 2KX7A 2F9FA 4OXIA 2VJCA 2PWZA 4ER0A 4F11A 2PSFA 2YS7A 5GJVC 4MKXA 1ZM7A 4B4OA 3HL4A 3E5HA 4KI7A 4YGXB 4Q37A 3KETA 3RKUA 2C3OA 5FOWA 5TT0A 1FK8A 3A0UA 2AXEA 3TR6A 3IQHX 3RSLA 4H7DA 3E2PA 1FMLA 4O02B 2WAXA 2WW8A 3AEZA 3MSCA 1UFRA 3FDZA 5CHEA 3DDHA 1A2KC 3OUZA 2EW1A 1KDVA 4CMIA 4N41A 1I80A 5TRTA 4X71A 1FTSA 5CLQA 1EFPA 2P4SA 4BEBA 4JXXA 4RPGA 4UDOA 1YNOA 2ZU6A 4PV7A 3F78A 2HHAA 1BNCA 4MVJD 3F8TA 2HA6A 1UBSB 3THOA 1INLA 1SOVA 4FXPA 3T41A 5G41A 3ELUA 4CLRA 1KJZA 3LUJA 3A4NA 1NVKA 1CZRA 1S5PA 3H2JA 2XTZA 1JEEA 3DKVA 2DLDA 5EVJA 1J7KA 2ZUVA 1W581 2KE5A 4YHHB 1DT5A 4JBNA 1PTJA 3A2LA 1T9CA 3GO4A 4CBVA 3ZEIA 3IV7A 3JRNA 3QMPA 2FG5A 3DZHA 5HXAA 1VMIA 2VCYA 3CWQA 3KXPA 3SM3A 2NSHA 1QFSA 2JHCA 3BCRA 4M8KA 1VPTA 2YZGA 3A4LA 5CUQA 2E5LB 5SYNA 1QX4A 4IXTA 1W4CA 1CEEA 4XQ0A 1W0KA 3KUXA 2R5FA 4LRWA 4CNBA 1RJ9A 3G49A 1FSSA 2R85A 4YRPA 3W2GA 1E1RA 2ACEA 1OFVA 1P4HA 3V1UA 1R27A 2M6RA 4GPZA 1YQWA 2V1UA 4N48A 2F67A 2CNWD 1KAMA 5FNVF 4PN7A 4WKCA 4WN3A 4DA6A 2OKGA 2PYIA 3M1LA 3FMPB 1ADFA 2ILTA 1PL0A 2SCUA 2XGOA 5H3HA 2GFIA 3U3RA 2HIMA 3HO1A 3CW8X 1QLJA 4F86A 4V0NA 3RJ9A 1SVUA 4ALKA 1A77A 3HM9A 3D3EA 2QRVA 5FIUA 4OI1A 2R47A 4BQNA 5EIXA 3ID6C 1XMQB 2UYQA 4NG5A 1RKBA 3WGOA 1EUCA 4UOZA 1CUEA 1Z16A 1X7HA 3FFWA 3DQPA 3BBPA 4CQMB 1NVEA 4DSAA 3DE4X 2Z8YA 5JXIA 5BR8B 2NXJA 4FWTA 4TSFA 2AZMA 5J4YA 3ZK8A 4WFKA 2QIOA 3QA9A 4J1NA 2HF7A 2P90A 2CUZA 1HG1A 2JGKA 1QYVA 1J25A 3IELA 3KWFA 3BEDA 3S4YA 5CBPB 2WSSD 4F5WA 1Q17A 4GPIB 1EAYA 1YB6A 4D9CA 1M8FA 1KI8A 2QLNA 5HF9A 4FWBA 4EHNA 5E0KB 4RZQA 4WNIA 5EXXA 4FE3A 3FPBA 2B34A 1QJCA 4D9GA 4HVTA 5IM4F 1AQNA 1FDSA 4KK4A 4LCBA 1YFLA 1II8B 5JQGB 1GZDA 1IM2A 5LXTF 1B42A 1FDVA 2BMFA 1VKRA 1QQBA 2P8SA 3PICA 1ECBA 1Y1LA 3AHCA 3ONEA 5DEIA 3CX7A 4XYEA 4AM8A 3AIOA 1WVGA 4RTNA 3VR5D 1B16A 1TCVA 3INNA 3JWHA 4LEIA 4QBGB 4Z0TA 2XOXA 3DAOA 4V0LA 2WWYA 3D3KA 4AJEA 3LSYA 3BD6A 5D85A 4RK6A 1K6IA 4R51A 3NRJA 3WMFA 1BFDA 1PDWA 5EJEA 5JAUA 5DRTA 4V2UA 4G5OA 2NQ8A 4A2WA 1EBBA 3LWNA 1EXWA 1ZRNA 3EN0A 1MJNA 1R5NA 2D1QA 4RZ2A 1NMYA 1RKVA 1VBFA 4KIWA 3UMSA 4MV0A 3HGMA 3IDSA 2QR5A 3E35A 4MDFA 4M8LA 4OGWA 4XM0A 2SBTA 3FROA 3M6AA 1NN3A 1U7DA 3A1DA 4KDRA 1Y6GA 4E7PA 3LUGA 4PE5B 2X5KO 3O8BA 1WL8A 3U7FB 3KR2A 1P5HA 3H84A 5AOBA 5HGJA 2HCJB 4XTCS 4N7RA 2IGTA 4HQOA 2NPIA 1OZ0A 4WZAB 5BSUA 1A3CA 1G3MA 2VR1A 1GZ7A 3KHKA 4NU6A 4A6PA 6REQA 4MQFB 3V9PA 3QWAA 2EF0A 3CN9A 2O48X 4RVUA 3V4OA 3WGYA 4YGYA 5TQVA 1T0PA 4ENVA 3NBAA 1TAUA 3QWFA 5IC5A 4A9AA 1WDTA 3FOWA 4DDTA 5K0EA 4YVFA 3GZNB 5BY2A 1BHJA 3QF4A 3ABOB 4OP2A 2FY8A 2I2WA 2Q4BA 5BMVB 2IHNA 3OC0A 3I6MA 3VHXA 3VHQA 1P81A 3VO9A 1Z0KA 1WCIB 3MB8A 2NXWA 3P9SA 3WFIA 3W3AA 4BO3A 4Q4AB 2XY4A 4F2WA 2Z9BA 2JH9A 5AJUA 3GYBA 3O8LA 4FN5A 5AICA 2Y2UA 2CT8A 4OQMA 1PNTA 1OWOA 2JFUA 2QL9A 5BQ5A 4JI1B 3QLVA 4C7OA 1YR2A 1KR5A 1J9GA 2Z08A 4P08A 5C31A 2GXAA 3I9JA 2FDCA 1CHNA 2RBKA 5EJ4A 4BL5A 1E5QA 1EFUA 1JG7A 1KFCB 4HGRA 3M1IA 1ZNWA 5A4FS 2IYXA 2OKCA 2UDPA 3TOCA 2WU8A 4EZBA 3MS4A 1P0MA 3M5PA 4GBJA 3P2EA 3KE8A 3P0RA 3DBVO 3ZYZA 2O2SA 2B4TO 3KPJA 4ZQIA 4LKOA 5AKZA 1FP4B 1M2GA 2NTNA 1GU0A 2ZUUA 4P31A 5H1YA 3VR6A 3ZWVA 3WGVA 4YCSA 3L40A 1TAGA 1DKOA 1FFEA 5AOVA 4ZQEA 5AUQA 3S0JA 4ARVA 3NHBA 3UG7A 1WXWA 3INYA 1JKJB 2WDZA 1Y8CA 1E58A 2V5AA 4YRLA 3CRZA 3R4CA 3UBMA 1IJEA 1PR6A 4JVLA 4L85A 4L72A 4Z99A 2J4CA 3THRA 3SQWA 2JLVA 3BHJA 3ELWA 2VEOA 4AC9A 1UIMA 3F6CA 1UPTA 4OQPA 4Q7MB 3VO1A 1ZK1A 4FT2A 1XVIA 5ABPA 1YO6A 1C9KA 2NVUA 3IAAA 2J59A 4B74A 1TRKA 3NHZA 3HWSA 4C0WA 3EODA 4JOBA 3HKCB 3KQUA 1X3LA 3KALA 2O2EA 3KXLA 1B6SA 1XF9A 2IOQA 2PSDA 4OI4A 4K40A 5DK6A 5J2UF 2JLRA 5HA5A 3EMVA 1GR0A 1PIWA 1ZCFA 2QDXA 5CCBA 1BDHA 2AOXA 4X8HA 2AZTA 4F60A 4WZBE 1MB0A 2HRZA 1WLYA 2A3RA 2BLLA 2ET6A 1A04A 4UC0A 1GZ3A 1VLLA 4MYDA 5JVDB 1ETHA 1E69A 2QMQA 4X6YA 1P2FA 2BYTA 4ZVQA 4ZZ2A 2FPXA 2QL5A 3OG9A 5CEJA 3M6FA 4DG5A 3Q3VA 2AD5A 4M87A 2QDKA 1SC4A 1RXEA 1O8CA 1VGVA 5EJ9A 4WN9B 5IBQA 1TB4A 4LFBB 4RTSA 3QA3E 5TF4A 2BN4A 4NAUA 5BQPA 5KEIA 2XWPA 5K3CA 2XUZA 2XA1A 1D1SA 3QFCA 1S6YA 3PB3A 3K6SB 1SHJA 1SUAA 3BHIA 4GL2A 4BVJA 2WAYA 2CL0X 4P0QB 1VKOA 5CCXA 4ZDJA 2CDAA 4NBWA 2DPHA 1J49A 2H1IA 1JHRA 5G1OA 3V8BA 5IDVA 3ZWCA 3SX2A 1THMA 1E94E 3BC1A 1HLDA 3GB9A 3PNMA 4MPJA 4BIIA 2EGUA 4P36A 4DTCA 3GXOA 5CFRA 1MG0A 1CB0A 4DPMA 4E5KA 1YUNA 1TU4A 3GAMA 1UBHS 4MPTA 1TCCA 3ZHQA 1AHHA 3GLQA 3URMA 4MCIA 1I51A 1WY7A 5FRDA 4MVJA 1CY8A 3NTOA 1