2Y99A

Crystal structure of cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase (bphb)from pandoraea pnomenusa strain b-356 complex with co-enzyme nad
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
275
structure length
267
Chain Sequence
b'MKLTGEVALITGGASGLGRALVDRFVAEGARVAVLDKSAERLRELEVAHGGNAVGVVGDVRSLQDQKRAAERCLAAFGKIDTLIPNAGIWDYSTALADLPEDKIDAAFDDIFHVNVKGYIHAVKACLPALVSSRGSVVFTISNAGFYPNGGGPLYTATKHAVVGLVRQMAFELAPHVRVNGVAPGGMNTDLRGPSSLGVPLADMLKSVLPIGRMPALEEYTGAYVFFATRGDSLPATGALLNYDGGMGVRGFLTAAGGADLPEKLNI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CIS-2,3-DIHYDROBIPHENYL-2,3-DIOL DEHYDROGENASE
molecule tags Oxidoreductase
source organism Comamonas testosteroni
publication title Biochemical Studies and Ligand-Bound Structures of Biphenyl Dehydrogenase from Pandoraea Pnomenusa Strain B-356 Reveal a Basis for Broad Specificity of the Enzyme.
pubmed doi rcsb
total genus 86
structure length 267
sequence length 275
chains with identical sequence B
ec nomenclature ec 1.3.1.56: Cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase.
pdb deposition date 2011-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2y99A00
2Z1MA 4OHUA 4XYEA 4CLRB 4HNHA 1U2DA 1WPQA 1AE1A 3D5QA 5CP8A 4NFSA 4J1QA 1VC2A 2UV8A 2VZ9A 4FOSA 4K6FA 3KTDA 4NU5A 1J6UA 1C0KA 5DP2A 1M75A 5ER6A 3N74A 5GMOA 3ROKA 3ZDFA 4J2OA 1ZMTA 5B1YA 1CEQA 1PGNA 4FN4A 4N54A 3INRA 3CE6A 3OEYA 5EJ2A 4DXHA 1JU9A 1Y8QA 2B5VA 1E7WA 1JKJA 2FRDA 3DR3A 4FFRA 5F3RA 3JQ6A 3OETA 4UUNA 2VYVA 3RROA 2QYTA 4DC1A 4XX0A 3PQEA 2OHXA 5DOZA 1DOHA 4JXKA 3BHMA 4L73A 3TOXA 5IFLA 3E9NA 1KEUA 2JD1A 1ISGA 3MWDB 4CM1A 1HETA 3G1UA 1LDBA 4D41A 4I5GA 1OC4A 2E48A 1DFIA 1IHYA 3H8VA 4Q3CA 4JQCA 4WLOA 3RWBA 4DQXA 4DQVA 5DF1A 3RJ5A 4E2ZA 4G2NA 3AM3A 3AUTA 3HFSA 3EY4A 1XU7A 2HLPA 2VYNA 5EIOA 4M89A 2CNBA 4Q3AA 5JAMA 1T25A 1WLYA 3KV3O 1PR9A 3AFMA 2NQTA 2GD1O 4ZA2A 4Z0PA 3L9WA 2PKRA 2AG8A 4K1LA 1Z82A 1ZUD1 1PEDA 2BFMA 3BTOA 4CV2A 1B3BA 4BNYA 2EKPA 5I8WA 1GZ3A 1A4UA 1PJBA 5TX7A 2Y0EA 1OBFO 3HDJA 3IKTA 4E5KA 3UVEA 3PHIA 2EF1A 2WYUA 4ZQBA 1GV0A 1VL6A 3ZV5A 1SC6A 3WGZA 1YB4A 5JAQA 4LW8A 1MG5A 3RUDA 3DAGA 2W2LD 4M1QA 2HMTA 1B8PA 4NBRA 3TSCA 3IIEA 2GLXA 1YGYA 3GEDA 3TL2A 1LSOA 3C8MA 2CUKA 2NVUA 3K96A 5G4KB 2EGGA 5A05A 3UOGA 1DRWA 3KETA 2AG5A 4LMPA 2C29D 4EEXA 3BZUA 2TMDA 3LF1A 1E5QA 3AM4A 4LSMA 2NVBA 4Q3DA 1V0JA 3TL3A 1TXGA 3IJPA 4IM7A 5G2OA 3LC2O 3ONFA 3BMQB 3D1LA 3UAGA 2CFCA 3GZNA 5IJZA 4WNIA 1Y8RB 4KUEA 5ICMA 5ICSA 2WM3A 4RLSA 3KYCA 3OH8A 3H3FA 4RZHA 4BO6A 2IODA 3NT2A 2XPCA 1WZIA 3QJ5A 1Q0HA 3BMCB 3ZZNA 4MPDA 2P4HX 3AU8A 3GZ4A 2Q2QA 3ENNA 3GG2A 3NUGA 3H2SA 1V35A 1SAYA 1RYDA 2HUNA 4KTVE 5TF4A 3NJ8A 4I8XA 1PJLA 3ITDA 1UDCA 2R00A 4UEKA 4ZRNA 1TI7A 2FOIA 2JHFA 3B20A 1DIRA 3GVIA 2QIOA 4PG6A 4XZ3A 4IJVA 3AUSA 1HE5A 1DHTA 3CINA 1ADBA 1GQ2A 4Q39A 4K6CA 2OBYA 4FJ1A 4C7JA 4W99A 1P1KA 1YOVB 3LLSA 2I76A 2HU2A 4LRTB 2HQ1A 4MIYA 4DYVA 3COSA 1X1EA 1ZVMA 3QV1A 3DQPA 4R51A 2H9IA 1B7GO 2VOJA 3I83A 4NDNE 4NR0A 3RUCA 3SJ7A 2NU8A 5K0ZA 1SCUA 3ROMA 3C1OA 1SOVA 3KB6A 4QXMA 2IZ1A 2X9NA 4IIUA 1FDWA 2GYYA 4XIJA 1YWGO 4FW8A 4IJUA 4R1TA 4UUPA 4DGSA 1E7RA 1N2SA 3NDJA 5IZ4A 3RCBA 4ND2A 2DC1A 1PJSA 2Y1FA 4GQAA 1VJTA 3BTUA 1R4MA 2EKQA 2B5WA 1DHRA 3W8EA 4LMRA 1U8XX 3PPIA 3QW2A 3AFNA 3JQAA 1Z75A 1E3IA 1L7EA 4LGVA 3VTZA 1TT5A 3BMOA 5JBIA 3HHPA 1MV8A 1CDOA 3V5NA 3MJTA 2FP4A 3K9QO 4MVJI 3W6ZA 4PLCA 3IKVA 4R3NA 1PSDA 1YONA 2G1UA 3GRKA 3TJRA 2EERA 2CD9A 4CM9D 3F3SA 4CUKA 2PLAA 2AQIA 3O8QA 4P38A 5MDHA 2YHIB 1KC1A 1AXEA 3K30A 3RC1A 2A35A 3KSDO 1HDZA 4XA8A 4FB5A 2GO1A 2IEBA 4MVJA 3KZVA 4I9UA 1NAIA 2V65A 4JJFA 1KIFA 3INGA 4RF3A 4YJHA 1C0PA 2YHUA 2E37A 1JDJA 1R37A 1VM6A 1YKFA 2PR2A 5JAZA 1MA0A 3R6DA 2CSUA 1D3AA 3SEFA 1I33A 4C4OA 4CMBA 5BSFA 4FFOA 4G81A 3K5PA 3X2FA 5JMWA 1ZK2A 1SBYA 1DJNA 1GADO 4FC6A 5TRTA 4CM6A 1TB4A 4IMPA 2GNAA 5JNLA 4YEDA 2YV1A 4F6LA 3JQGB 3NDIA 2O2SA 5BSHA 3UCEA 1R12A 2B83A 2J5RA 3OHSX 1DSSG 3JQEA 2NU6A 3WBFA 3ADPA 4CM4B 7MDHA 4MOWA 3VZSA 2JKVA 3ZW8A 3WMXA 1R15A 5GY7A 4PG5A 4E32A 1P9LA 2E4AA 1HEUA 4WNCA 1HZJA 3CEAA 1QRRA 1IHXA 3OJEA 1R4NB 3AOEC 2P68A 4OSOA 3GN2A 1X7HA 2P9CA 4HX5A 2JCYA 3DBHB 3FI9A 1SMKA 4HFJA 1PQWA 3BHJA 1YBVA 5CG2A 3WGYA 3RUHA 4G65A 2I5PO 3BHIA 2X8LA 3GEMA 1F8FA 2V6FA 5C7LO 3D0OA 1CQIA 2NACA 2OFPA 3UGKA 3ZWMA 4HP8A 1KETA 1HL3A 3VZQA 2WSBA 1WXDA 1XGKA 4D46A 3U9LA 4XQEA 2R00C 3LQFA 4ROSA 1MB4A 1A72A 3ZV4A 3GLQA 4GGOA 4KUGA 1P45A 3TZKA 4ZRMA 4PLGA 2JCXA 1PQUA 1PU2A 5KJ6A 1XYGA 3OFSA 3FNGA 6ADHA 4RDHA 5A5FA 1YB5A 2ILTA 2NSDA 1AGNA 1EDOA 3L6EA 4TKLA 1EMDA 4H16A 3ITKA 3PIIA 5I7FA 3NRCA 3M1LA 1RM4A 2X0JA 1RM5A 3EK2A 3WX0A 4BNWA 1MUUA 1OC2A 2QRKA 3GOHA 5B4VA 1NVTA 2X5KO 1ZXBA 1A9YA 2VNAA 4M55A 2OGUA 2NVUB 4RVDA 1LXCA 1FDUA 4E4YA 1D1SA 3HQ4O 1ONNA 1WW8A 2ZIZA 5HA5A 3V2HA 3WGHA 1ZK1A 2PD6A 2DAPA 1YL5A 2NTJA 4RPJA 1JWAB 3VH3A 4I5DA 5LDGA 4EUEA 4QO7A 2E82A 3AU9A 4MVJM 3KXDA 4TROA 3DBLB 5AVOA 2HMWA 4IDCA 9LDBA 1I3NA 4D0SA 3ZHYA 1NQOA 5F1OA 1RWBA 4R68A 1PJCA 1W73A 1HE2A 5DULA 1E6WA 4XYMA 1EUZA 4E2YA 2Q49A 4L4RA 4AJNA 2BI8A 2BLLA 5B4TA 4GI2A 5CHEA 1NR7A 4XJSA 4FS3A 3HWRA 2AEMA 4DC0A 4KDEA 4QO8A 1ISIA 3L77A 1A5ZA 5JSFA 1U4SA 1YJ8A 5ILGA 1ZSNA 4ZQHA 1DFGA 1ZK0A 1XCBA 3QVOA 3TNLA 2I3GA 2BHLA 3QVTA 1ISFA 3GVXA 1H2HA 5JCXA 2Y66A 3GEGA 1GEGA 2XXJA 4FDAA 2DBQA 3AM5A 3KBOA 2VT3A 2D8AA 1GYPA 3H3JA 3M2TA 3O03A 4FFNA 4LVCA 4BKPA 3JD0A 3L4BA 4XQCA 4UVHA 4BNVA 1LTHR 1E1LA 4E6PA 2EKLA 2WJPA 3SBOA 3DHYA 3DC2A 4NJMA 3O8QB 4BMNA 3PWKA 5AXCA 1F12A 3ROPA 4CLEA 3QWAA 4GKVA 4QQRA 4PRLA 2FSSA 4J16A 4UEOA 1PS0A 3OIDA 5FWNA 1ZJZA 2JFHA 1T2EA 3X2EA 2YFHA 5EINA 1Q1NA 3K73O 3ORFA 4Y9DA 3ST7A 3VPXA 3DWFA 2H63A 1ZK3A 5A1TA 4R9RA 2G5CA 2CDBA 3D64A 4LSWA 3ZW9A 2VHYA 1YBMA 3GG9A 1ZEJA 4TVOA 1LJ8A 1M66A 3EC7A 2DPGA 2FPPA 5IDQA 4RPLA 3GVHA 3Q3CA 4XIYA 3TZCA 4AJHA 5TLSA 3GC6A 3OF2A 1LUAA 4K26A 1HRDA 4P4GA 1J4AA 3H9UA 1T4DA 1Y1PA 1RPNA 4A5OA 3TRIA 1U8FO 4KOAA 1YQGA 4D42A 1BVRA 2DU8A 4KDFA 1O89A 5KVVA 4QEDA 2YV2A 2X7HA 3DZKA 3F5QA 3P7MA 3PXXA 4NK4A 1SZJG 3VH2A 4BNJA 5IN4A 4EUHA 3WBBA 5G0UA 4YRAA 1I2BA 4EITA 4BNLA 4EJ0A 4FFMA 4ALLA 1WDKA 4U8GA 4NBVA 3FD8A 4ND5A 4TRJA 4WKGA 3PJFA 5FFFA 4CMEA 1ONPA 1U3TA 5L7WA 1K6JA 1GD1O 4YRBA 4OSPA 3DTYA 3PI7A 1B14A 1LLDA 3Q1LA 2EW2A 3C1AA 5A06A 2ZK7A 5B4UA 3C7DB 3JQFC 5H81A 3LVFO 3STHA 4ZQGA 4Y67A 5EERA 4L8VA 3DOCA 4GVXA 1GL3A 2ZCVA 2VNSA 3WDSA 3O9ZA 3Q2IA 4GBJA 2RCYA 3ETEA 4GKBA 1HYGA 5DN9A 1E6UA 3I9JA 2IEDA 3JQAD 4J3FA 2Q45A 3ASVA 3CKYA 4A27A 3TF5A 1KY5A 3OICA 1SPXA 3RC7A 4YAGA 4GH5A 5BNFA 5JCJA 3ZHBA 3I9KA 4II3A 3E5RA 1BTOA 5ES3A 4E12A 4LRSB 1F17A 4PLVA 1PIWA 1UAYA 4F3YA 2C7VA 3ZU5A 3SLKA 2X0RA 1YVEI 4CLXA 4YA6A 1J5PA 4PLPA 3A14A 2B37A 1I3LA 1U5AA 4E5YA 1UDAA 3EAGA 3ZWXA 1NQAO 2A92A 1VKNA 1XU9A 3AY7A 5IG2A 1HSOA 1NBOA 4IGFA 4RF5A 4YT5A 2PA3A 3PJEA 3AOGA 2BKAA 1QLHA 2W2LA 4N7RA 4J1NA 2YFQA 5L53A 3AI2A 4P8RA 4BMVA 3WYBA 1PZEA 1W6UA 4CUZA 2OP0A 3S2GA 2I9PA 1C3VA 5ENDA 4JBHA 4A2CA 2VUSA 1WWKA 1U3UA 2R6JA 5C7IO 1NWHA 2O4CA 3G17A 2QYSA 5A9SA 4FIZA 3NGXA 4ZU3A 4OXNA 1JKIA 3NTOA 4IDFA 3OECA 5L4LA 3KLPX 2DUWA 2BFAA 1N8KA 4PVCA 5KWEA 4JP2A 8LDHA 3UHAA 1JAYA 4XGNA 3EUWA 1AN9A 3TZ6A 5F1PA 4XCVA 1E3WA 1JQBA 2FZEA 2YJZA 1LX6A 3ZI0A 2ZYDA 3BMNA 1T2AA 3JQ7A 4HWKA 3GGOA 4IDBA 1BGVA 5DBIA 1YXMA 4EUFA 4B3IA 4IQ0A 3TDKA 3GGPA 2GR9A 4FSHA 2PTGA 1GAEO 4Y6SA 1D7OA 5COQA 4CJXA 1XLTA 3W4IA 5JMPA 3GMDA 3JD1A 5THQA 2YYYA 2VUTA 2X6TA 3DMTA 3U09A 4FPXA 3VPFA 3VPGA 4GX1A 4AFNA 2YHIA 2AW5A 4XRGA 3EVTA 2FPGA 1EQ2A 3KLMX 1MFZA 2WDZA 2RH4A 5ITWA 2YQ5A 1DC5A 3OBBA 4IIVA 2JCVA 4OOEA 1TT5B 4RLHA 3O26A 2NLOA 4N18A 4UUMA 1SEVA 3JQAB 3GDOA 4DMLA 1O95A 3VZRA 4HADA 4FD3A 3BTVA 4PZDA 3WGQA 4B4VA 3VVCA 3HADA 3L4SO 3R1IA 1BRMA 4OO3A 1A71A 3FN4A 3LK7A 2DTXA 3LSYA 1XELA 4GLOA 2PD4A 4DIOA 3ROQA 1LA2A 4EZBA 3RUEA 4R16A 1EVIA 2HDHA 2Y05A 4RVFA 4B4WA 1N1GA 3F47A 4CM9A 2Z5LA 2C0CA 4OQZA 2DVMA 4BKOA 3IJRA 1SB8A 3WOHA 3RBZA 2ZQYA 3KOUA 5IDXA 1PZGA 2W2KA 5G0WA 4R69A 5KOIA 1H6CA 4OXKA 3QWFA 5KKAA 1E1KA 3PZBA 4A73A 4RVHA 2Q4BA 5EMHA 2XAAA 3PFFA 4OOFA 4F45A 5JDCC 3PHHA 2G0TA 3WQSB 4NIMA 3DBLA 1DIBA 1DC6A 1DC3A 2JD0A 1XIVA 2OBNA 2WWRA 3BXXA 5F5NA 5TGDA 3WTBA 2ZTUA 3KUXA 2W8ZA 3JQ7B 5HS6A 3D3WB 3BMNB 4IS2A 1UUFA 2VWHA 2WD8A 3ZWYA 2HRBA 3WYCA 2NADA 3GMSA 1F06A 3PK0A 4XYGA 4Q3BA 2UUPA 3F9IA 4KUHA 3I9OA 3FPLA 3FF4A 3I9LA 5C3MA 3VC7A 1QYVA 2D5CA 4C7KA 3JTMA 4A7PA 1HF3A 4PLYA 4Z0TA 3IDSA 3AK4A 4ALJA 1LDMA 2J3HA 3AUUA 3WTCA 4MIEA 4RDIA 4TRMA 3GAFA 4BO7A 4TZKA 1B0AA 1NTOA 3DDNA 3O38A 2B4QA 4AVYA 2WE7A 1EVYA 2PKQP 5DCYA 4S3MA 1DFHA 3LT1A 2CDCA 2P5YA 3RKUA 5IDWA 4A0SA 1YO6A 3ON5A 3HN2A 4DPMA 1M2WA 2VN8A 2BGLA 2NUAA 4BO0A 3B1FA 4HNGA 4DLBA 1LDYA 4XB1A 3JYQA 4ONEA 3U3XA 3GN1A 4OQYA 1GUZA 3BMCA 4WLNA 4EYEA 4RVSA 3EZLA 4FFLA 1I01A 1X0XA 3GPDG 3PGXA 3V8BA 3PHJA 3PYXA 2DKNA 4RZIA 3CXRA 2F00A 1D1TA 5HWSA 5JDCA 4IMRA 3MJCA 3WXBA 3ZWCA 3ZWWA 2DBRA 1U5CA 1P1JA 2GPTA 4UVIA 3NJ4A 4H15A 4ESOA 3MEQA 4D0RA 4YAJA 3EVNA 4GPD1 4R41A 5CEFA 1JVBA 1QORA 1QG6A 3L9XA 2ZB4A 1S7CA 3FTPA 1IPFA 5IN5A 1Y7TA 5H83A 3D4OA 2Y0CA 3H9JA 1W8DA 2ZYGA 4IY1A 2VOEA 3RUFA 3DO5A 1VLLA 4CPDA 4Q3EA 2AEFA 1I36A 3JD2A 3JYOA 2G76A 5A9RA 5JXWA 1HTBA 3OIFA 4ZICA 2IXAA 4ZQEA 5EPOA 3H5RA 4R1SA 1ADCA 4CQMD 3WR5A 4PLWA 2O7QA 5FYDA 2P5UA 2PGDA 3DFUA 1LC0A 2GN6A 3INTA 4L74A 4B7XA 2PH5A 1X15A 3E9MA 1KBZA 2YDYA 3PHLA 4BGEA 4I08A 1O6ZA 3CPSA 2WD7B 1SO8A 5DOVA 1UXKA 2Q1TA 5TJ9A 1WNTA 3QVXA 3HDYA 5EQFA 1RM0A 3UCFA 1ZZEA 5HBRA 4UEJA 4AJ2A 3RI3A 3CIFA 3WIEA 1LC3A 4CLHA 1PGOA 2RAFA 1T24A 3GVPA 2QHXA 2VCYA 4Y6RA 3R3JA 2X0NA 4E0BA 1H94A 2VWQA 1ULUA 1LLUA 1IYZA 1ML3A 2OUIA 1TLTA 3RFTA 2PH3A 2HK8A 3E9QA 3F5SA 1U9JA 1W4ZA 4LK3A 5A3VA 4CV0A 4BNZA 1PWZA 2DT5A 3GUCA 4JIGA 2AE2A 1EVJA 3W8DA 1K2WA 3OSUA 4GMGA 3CTMA 3GNSA 3PJGA 1E7SA 5T57A 1DPGA 1UDBA 3IUSA 1PGQA 1PS9A 1EFLA 3WB9A 1YB1A 4A03A 3VKVA 2YW9A 2X4GA 1UZMA 5IAAA 4K28A 4M8SA 4U6SA 1KVTA 3WNQA 4PLFA 1JWBB 2UAGA 3Q9UA 4NBTA 5HRUA 1BG6A 3QWHA 1OAAA 3WGGA 5L7TA 3WJAA 2UVDA 3MJVA 1UR5A 4HBGA 4CL8A 2EV9A 2EEZA 2C5EA 3CZRA 4J7UA 4P4NA 1LRLA 3ETGA 1VL8A 1YOVA 3AUAA 1F0YA 1R4MB 1HDGO 1LSUA 3FPCA 1HLDA 2CMDA 4R01A 3S1LA 3WGTA 1HKUA 4WOJA 4I9NA 3IL2A 3TWOA 4RQUA 3KYDA 3QRWA 5EL0A 3D7LA 5G0TA 4RCVA 5AXAA 2ZCUA 2C54A 2WE8A 1NPTO 3QQPA 2Z95A 4YRDA 1DLJA 3IOYA 5T6BA 2GRAA 3DBRA 2ZQZA 4LN1A 3D5TA 3VAZA 1K5HA 4BO4A 4CLOA 1E1MA 4J4TA 1E5LA 4BNGA 4E5PA 5JLAA 3MTGA 5C37A 1U7TA 3QLJA 4Z0HO 1WDLA 2YDXA 1HDCA 2Q50A 1YQDA 4J6FA 4FJ0A 1Q7BA 1U3WA 3FCOA 3B1KA 2C59A 4BNHA 1FDVA 1PGPA 4MKRA 4XB2A 3VVBA 4E5NA 1E92A 1HT0A 5TIIA 2Y1CA 2A4KA 4BO2A 2H5LA 3OJLA 4Q9NA 3PEFA 3WIDA 1GYRA 3T7CA 1M76A 4HFMA 3ZWPA 3VH1A 4H7PA 3RAJA 1K89A 4AJOA 4N5LA 2Y1DA 3H65A 4NNJA 1KY4A 2PFGA 3HNPA 2VT2A 4CMGA 2DBVO 1Q0LA 3DOOA 2PGJA 3U5TA 4R3WA 1ENYA 4IDAA 3GNTA 1LQUA 1N92A 3FNEA 3DOJA 1RKXA 3M2PA 5H82A 4HKTA 1J49A 2ZB7A 2AQKA 2EGHA 2NM0A 3VOSA 2I99A 3O4RA 1H9AA 2O3TA 2VYND 4EJMA 1LRJA 3IP3A 2Y67A 5AOVA 2ZTMA 3QVWA 5JAIA 3EW7A 2AXQA 3A28A 4EGFA 1EBFA 4HFRA 1LLCA 1DAPA 2I66A 3I9NA 1GCOA 2FSVA 2WTBA 1ULSA 3I52A 4RPKA 5TT1A 3WSVA 4CODB 1ZW1A 2XOXA 1PS8A 4E30A 2C5AA 1IZ9A 2CF5A 4DTIA 1KVQA 1IY8A 3ONEA 4EDFA 4AJLA 3U4DA 2DTDA 1RJWA 9LDTA 3I4FA 4WUVA 4D79A 3CUKA 2GERA 1H5QA 1DJQA 1LRKA 4P22A 2OP1A 4DREA 2CVZA 1HYHA 1LU9A 3CH6A 4TQGA 4TRRA 5TS3A 1Y6JA 4O1MA 4DLLA 4BO1A 2EP5A 4YBZA 2C20A 5AXBA 1JLLA 3AWDA 1T1SA 4RJTA 2EP7A 5TJHA 1EE2A 3JQCA 1U28A 1ONOA 5L9AA 1LLQA 1NAHA 1TEHA 1H6BA 1LDGA 2A94A 1HE4A 3KSZO 4XKJA 4WGGA 4MP6A 3W4JA 5I7SA 2GUGA 2ZB3A 5K6AA 3PRJA 4J49A 3TQHA 4BIIA 1Y5MA 2BELA 2HO5A 4J7XA 1IULA 1C0IA 1KVRA 1VPDA 4AICA 4NI5A 4CLRA 4OJNA 3QWBA 1LDEA 2AHRA 1DAOA 4NBWA 4FFPA 1M6WA 2D3TA 3RC9A 4R1NA 4YTEA 2EHDA 4OYRA 7ADHA 5A04A 3OA0A 4BB6A 4QUKA 1GEEA 2CVQA 4GSLA 4BNMA 3BMOB 4PN3A 1PJQA 3HSKA 1KEPA 3PLNA 4I1IA 1FDSA 1KS9A 4WLFA 2QW8A 1DIGA 2Y1OA 5TC4A 2C2YA 3F46A 1QYDA 3DZFA 1E0DA 1HXHA 2HJRA 2AQHA 1PJ2A 4WCDA 5L40A 2LDBA 3RVDA 2RBEA 4K9DA 4FC7A 1H9BA 4FBGA 4JNKA 4NBUA 4WECA 5KIAA 2WD7A 2P91A 2DFVA 2NQ8A 4GX0A 4PIVA 4O59O 5IXYA 3GHYA 5I7EA 2GGSA 2WYVA 3FNHA 5LDHA 1G0NA 4DWVA 1R6DA 3DAPA 3OQ1A 1VE9A 4NFYA 1UAGA 4PZEA 2D0IA 1EFKA 1WZEA 3PYMA 2GZ3A 4LVUA 3CMMA 4AJIA 5A4DA 3U4CA 3EHEA 3K6JA 5C5IA 1V3TA 5EN4A 4AL4A 1P44A 5KNLA 4FOOA 3JD3A 4Z9FA 4YT2A 4GWKA 1HDRA 1PL8A 1K6IA 1DLIA 1CERA 3ZWVA 3QA9A 2I67A 1EUDA 3OQBA 3EYWA 3DZBA 4MVJE 4BGIA 3A06A 4RV9A 4MP8A 5DP1A 3JQ8A 1B15A 3ZNQA 1N5DA 2CY0A 5AXDA 1L7DA 3NGLA 4XR4A 2I65A 4R1UA 4KMSA 3FWNA 2B4TO 1YE3A 3ADOA 3V2GA 3WNVA 2SCUA 1IZ0A 4E2XA 1E3EA 3OMLA 2J3JA 2X1HA 3UH1A 2WYWA 2ZTVA 3GPIA 5T64A 5U4QA 4CMJA 1JVSA 1X7DA 2E49A 4QSMA 1UZNA 5L95A 4CQMB 1QV7A 2FMUA 1GCUA 1RM3A 1WVGA 5JFOA 5I9MA 3ZWAA 4RGBA 1E7YA 1IPEA 3E82A 1KOLA 4XQ9A 3BMQA 4ILKA 1QR6A 2X5OA 1E3SA 4AJPA 4BKRA 1IE3A 3GT0A 2D4AA 4CMIA 1Q7GA 3AJRA 4DVJA 3FBTA 4CR8A 5CEJA 4CMAA 1DEHA 5TQVA 1BDBA 1YL6A 5COBA 3HUDA 4CMCA 2YV3A 4MKZA 4PVDA 1UXJA 5CDYA 1XSEA 1Q0QA 3LT0A 4IJKA 3VHRA 3NTQA 3Q9NA 1WP4A 3GDFA 2O3JA 1A7AA 2O7SA 3D3EA 4MKXA 3GQVA 1I0ZA 1WMBA 2B35A 2VWGA 3WG9A 3WSWA 1OMOA 3C1TA 4OKIA 4JBIA 4W7IA 3GR6A 3HJAA 3MCVA 1I3KA 3UFXA 1BXZA 1G1AA 3PP8A 1BHSA 3MJ4A 4J9UE 2AQ8A 3NAQA 5L4SA 3LT2A 4J4BA 2FR1A 5JO9A 4ALNA 3BYZA 5KCZA 1HDXA 4B4UA 4MP3A 3PQFA 3TZQA 3G3EA 2J3IA 4BGUA 4ZN6A 2B0JA 3RFVA 2OZPA 2RH8A 4X54A 5KJCA 4J2HA 2HMUA 3WFJA 2NWQA 4QTZA 3ZWOA 3TN7A 1OI7A 4BVAA 3ZCXA 2DLDA 3PIDA 1NX6A 4KWIA 1UP7A 2VRCD 1I3MA 1NWCA 1FXSA 3RQSA 3B1JA 4BL5A 4CLDA 1ENOA 5B37A 4DPLA 2IDZA 5I9LA 1I2ZA 4TRNA 2Y0DA 4D7AA 3WQQA 4YJGA 4IGEA 3FR7A 4GWGA 3T4XA 4YACA 1GQQA 1K0UA 5DZSA 4XJTA 4YR9A 3OEWA 1FF9A 3WLEA 3GK3A 1C1XB 4WEQA 1KYQA 1UXGA 3FHLA 2Y99A 3I6IA 1D4FA 4U0KA 3ZNOA 3W6UA 3LF2A 5L45A 1Y8QB 2G17A 1KEWA 1EUCA 2Q2VA 4WEOA 4YAEA 3PLRA 1VI2A 4ND4A 2O3UA 3JQ9C 4RQTA 4A10A 1E77A 1O0SA 1GZ6A 5LC1A 4HXYA 1BDMA 2C07A 1NR1A 4BQPA 4FR5A 3LU1A 4NJMB 1GTMA 4DQUA 3RU9A 4IQGA 1CIVA 4IQ8A 3DZHA 3WWZA 5BSEA 1Y5RA 2HKIA 4BMSA 3DB2A 3R0IA 5IDYA 2WMDA 3QY9A 5BT9A 1MGOA 3F6YA 3QWIA 1BXGA 2Q3EA 2Q1UA 3GDGA 2IZ0A 3HE3A 2I3AA 3I3OA 3OJ0A 4NHEA 5DBFA 4ZHSA 4UULA 2VTEA 2JJYA 2O4UX 2V6BA 3DFZA 3F1KA 4JCOA 3HB5X 1B16A 1QP8A 5FI3A 3I23A 4OAQA 4RL6A 5F21A 1SEPA 1MLDA 2ZKLA 1P3DA 1VJ1A 1DRVA 2DBZA 3ANLA 1ZO8A 4MJLA 4RORA 3VPHA 3JQDA 4ZQFA 3LC1O 2HCTA 1FMCA 1TT7A 3CSDA 1NPDA 1DIAA 1I30A 4GX5A 4CUJA 2X22A 5C7OO 2G82A 1FDTA 1Y81A 3JD4A 4IJWA 2HMSA 4O63O 1KEVA 4E5MA 2Q2WA 5A02A 3HZZA 2D5AA 4MVJP 4JLWA 2O50A 3GAZA 2X0IA 4MVJH 5CG1A 3NT4A 4PLHA 1RYEA 3ZHXA 4BQRA 4CM8A 1NYTA 1FJHA 3NT5A 1N9GA 3LC7O 3RIHA 4BNIA 2PZKA 4NQZA 4IZIA 4II2A 5DT9A 1V6AA 3P19A 4AJEA 1DC4A 1ZK4A 2ZJ0A 3A1NA 4TWRA 1Z6ZA 1DIHA 5DBGA 1TVEA 4YYZA 1LEHA 5K9ZA 4BGVA 3TFOA 1MX3A 4EI2A 1H93A 5LCXA 1UXHA 1X1TA 1CWUA 1PZHA 4QX6A 4U5QA 4E3ZA 1CETA 2EG9A 5L4NA 4CV1A 1E1NA 2D59A 4W6ZA 1OFGA 3RSHA 1GUYA 4D43A 1A4IA 1QYCA 4KQWA 5COAA 4YAIA 3L07A 2JAPA 2PV7A 4BO3A 1MC4A 1UP6A 2HK9A 2Y1GA 1XA0A 1BSVA 4D3FA 3D4NA 4R5HA 1GUFA 3OQ6A 2V6MA 1JN0A 1XQ6A 3GY0A 4YT8A 3U62A 1NQ5A 4AJ4A 1AUPA 3RBVA 2IYOA 1NASA 3FWZA 5JCJD 1PL6A 4BNKA 1YBAA 2HK7A 3MOIA 3OIGA 4GL4A 1GY8A 3DBHA 3RUIA 4WCFC 3GHHA 3SX2A 2D2IA 4F46A 5JO0A 1N9GB 3H9QA 3JYPA 5A9TA 1NFQA 3QHAA 2GSDA 4AJKA 1LI4A 3GF4A 3VH4A 3P2YA 1NQTA 1NP3A 1PJTA 4U7WA 4A26A 4MDHA 4BB5A 4WLEA 2VZ8A 1QXSA 3C3XA 3I4CA 3ANMA 3SC4A 1VSUA 1EDZA 2GZ1A 4EJ6A 4IXWA 1IL0A 3E6AA 4OGWA 2GN8A 2VQ3A 2J5QA 1P0CA 1N7HA 3VDRA 1X0VA 1ZBQA 1U1IA 2NU9A 1PJ4A 3FBGA 4PCVA 3RKRA 5KTKA 3IP1A 2PNFA 1H2BA 1UJMA 3AI3A 5KVQA 4QFDA 1KERA 1GU7A 2GF2A 4L75A 4L4XA 3ZWNA 4GAEA 1IUKA 3AY3A 1NFRA 2O3QA 1VL0A 1A7KA 2BGMA 5G4LA 3IS3A 2VTDA 2QRLA 4DLAA 4CM8B 3S2FA 5T5QA 1QMGA 4E33A 2OO5A 2DQ4A 2VUUA 4E31A 2QQ5A 3PWZA 1BWSA 2DUUA 2ZATA 1CYDA 4MVJF 3DHNA 2ZJ1A 2QZZA 1BMDA 1KVSA 2C2XA 5EQDA 5DCWA 3HB4X 4L0QA 4CMKA 4GSKA 3LLVA 2OMEA 1EZ4A 3DHEA 3PVZA 3WICA 4NH4A 2YZ7A 2VYVD 3PZRA 5ILOA 3OM9A 4XGIA 3U0BA 4WOKA 2YQ4A 4DA9A 4FGWA 4YXFA 2CZCA 1Y9EA 3H6KA 1EEHA 5JPIA 5F1KA 3MOGA 2BI7A 4J0EA 1AHIA 4Z9YA 4BNNA 4DUPA 2Q4EA 1NHGA 2EWMA 1T1RA 1XG5A 2J5KA 3JV7A 3N7UA 5BNTA 1H6AA 1I8TA 1HSZA 4NG5A 5HTOA 5GZ3A 1XQ1A 1PJ3A 5U9CA 1GPDG 1HDYA 3OJFA 4G5HA 4O5OA 4OXYA 8ADHA 4O0LA 1P0FA 2CF6A 3SVTA 1PR3A 2FN7A 5BSGA 2J6IA 3W8FA 3LZ6A 5IZCC 4B4OA 3AOEA 3BTSA 1EK6A 4ZVVA 4YAKA 1JKFA 1DXYA 3IQDB 3LYLA 1WAMA 3SLGA 2CVOA 4UVGA 4DRYA 4DBVO 2B36A 4J1TA 2PZLA 3RUAA 4W9NC 3B70A 3ZV3A 4ALIA 4MVJD 4XEHA 1A9ZA 5JDIA 1P1HA 1P1RA 4Z6KA 5F5LA 5T67A 3V1TC 1W0CA 1YQXA 5K6AC 2HMVA 3PHGA 1N7GA 2VHXA 3GGGA 3V1YA 5A9SB 1V3UA 5L3ZA 4YJGB 4BKQA 4Y6PA 2QRJA 4KP7A 4ID9A 2VHVA 3ZH2A 3DXFA 4DMMA 3G0OA 4CL3A 4NJOA 1D8AA 5KVCA 3TOZA 3I5MA 4CV3A 3E18A 3OJOA 1F8GA 3WS7A 1R16A 1ZMOA 1EK5A 3JQFA 5TSDA 5JS6A 1SOWA 2VHZA 4JJIA 4XGKA 1XHLA 4BO5A 2XF8A 2Z1NA 4OIMA 4IDEA 1HLPA 1ZNQO 2DM6A 2BGKA 1I24A 1DO8A 1Y8RA 4IINA 1NVGA 3S55A 1E7QA 2F1KA 4ITUA 2W4QA 1LSSA 3FRJA 3ZN2A 2R2GA 1X7GA 4JK3A 2YY7A 1XR3A 1WMAA 2O23A 2EXXA 4Y8VA 1QYXA 2W98A 1CRWG 4XYBA 1OOEA 5ITVA 2GCGA 4YT4A 2FR8A 2EJWA 4D3DA 4OM8A 4NK5A 3QE3A 1Z74A 3IC5A 2X9GA 2C82A 2ET6A 1YDEA 2DTEA 4E13A 2OOSA 4L4SA 1PGJA 1X13A 3PFWO 3ASUA 4BO9A 5DCUA 3F1LA 3FR8A 4IXTA 3AW9A 4AJJA 4ND1A 1BW9A 3CZMA 1R4NA 1LBEA 4MO2A 4TKMA 3EDMA 3HG7A 3S8MA 3U49A 3VTFA 1GQYA 1R0LA 2D1YA 4HUJA 2H6EA 4WASA 3JQ9A 1TA4A 2BFOA 1NFFA 1JAXA 3ONDA 4M49A 3LDHA 4PG7A 3ZU3A 2WEKA 2IRWA 3PQDA 1ZEMA 4J1SA 3SXPA 1ID1A 4N5MA 3DTTA 4TMFA 3UUWA 3ZU4A 1KC3A 2Y93A 3Q11A 5KVSA 2V6GA 4XYLA 3SC6A 3NKLA 1Q7CA 2E6UX 5EESA 4I5FA 1AXGA 1NVMB 3PDUA 4GVLA 3Q0EA 5THKA 1YS4A 1C0LA 1HZZA 1NHWA 4W7HA 4LCJA 1H6DA 1ISHA 2X9VA 3UN1A 3HFGA 3AY6A 1EVZA 3QP9A 1JTVA 1BXGB 1UH5A 2NTVA 1I32A 4YJHB 3RFXA 3PYLA 4DPKA 4NPCA 3DAFA 4LISA 2CDAA 2VHWA 5CEEA 1O8CA 3RU7A 1YH3A 4JBGA 4PLZA 2W2KB 1IB6A 4ZGWA 3Q6IA 5TT0A 2H1SA 3WYEA 1LNQA 4B8WA 4MIOA 1I2CA 2O48X 4R4JA 1SB9A 3K8ZA 4E2WA 4PLTA 1MFPA 3NYWA 4J0FA 5DNAA 1Z45A 3DL2A 3IAHA 3U4IA 1M67A 1CJCA 1YDWA 2GDZA 1VJ0A 3ZGYA 3QIVA 5CPBA 1GPJA 2IXBA 4CQLB 4EBFA 2NNLD 3DMYA 3ICCA 4BS9A 1P31A 2VRBA 2B4RO 1T2CA 2EIHA 2FZWA 2I6TA 1Z7BA 4U0JA 4HFNA 3TZHA 5IZCA 4XDYA 1YL7A 3H5AA 4IPTA 3HDHA 4MINA 4RF4A 4DYDA 5A03A 1XWFA 3H4VA 3PGJA 4YB8A 3ZNPA 4AG3A 4EEZA 1GYQA 3C24A 1DRUA 4XR9A 1OZAA 1T2DA 4UREA 2QX7A 2BMAA 2NV6A 1ZXLA 4ALKA 4J91A 3WWYA 2P2SA 4BV9A 4IDGA 2O2YA 2Q1WA 1EBUA 1MXHA 2QG4A 2AMFA 2X23A 5I8ZA 1X14A 4BNTA 4J43A 1C1XA 6LDHA 2Y1EA 5A5EA 2BD0A 2FPIA 1B8UA 1ZFNA 3FSRA 4RVGA 3LT4A 4WPGA 4XD2A 1QKIA 2BFPA 4PRKA 1ARZA 4B3HA 4BNXA 1DDOA 2RHCA 2PKQO 1L1FA 3AI1A 5G0SA 1GV1A 3G49A 4D44A 5HM8A 4AJ1A 4M54A 1UXIA 3KHUA 2VZ0A 4W9NA 4Y98A 3T7EA 3MTJA 3G1TA 4OL9A 4PG8A 1EQUA 1JW9B 2X5JO 1ENPA 1HWYA 5CDSA 5JY1A 4RVUA 1E3WB 2X86A 2DPHA 1NM5A 4J4HA 3WFIA 3MJSA 4WLUA 2C7GA 4XQGA 4E21A 1G0OA 1E6EA 4BUCA 3L6DA 3H9EO 5ADHA 3GNQA 1PQPA 3BA1A 4TZTA 4CR6A 4ND3A 1ISJA 4URFA 1ZCJA 1R0SA 2W90A 3JQBC 3MJEA 4D3SA 3KYCB 3SJUA 4KWHA 4YQYA 3ABIA 5KJ1A 3KSUA 1K3TA 3F4LA 4J7CA 4N5NA 2OXIA 3RBXA 4FGSA 3UF0A 3GUYA 4QT0A 3GZNB 4J9VA 4M86A 3PJDA 3TPCA 2ZB8A 1ZH8A 4Z3DA 1UZLA 3RJ9A 4IBOA 1IOLA 1P77A 1C1DA 5JC1A 3UXYA 1YRLA 4WLVA 3K2EA 4LCEA 3L4BC 4R54A 1I5RA 5CPFA 2RHRA 4INAA 1PZFA 1E3LA 3NTRA 2JAHA 3ANNA 4BOYA 1U4OA 3JSAA 4I5EA 5JE8A 2IZZA 2GASA 5CAEA 5G4KA 5MGBA 4U6QA 3L0DA 5JYEA 2P4QA 3UICA 3H9GA 3E1KA 4CMIB 2IYPA 3JQBA 3DEYX 4BKUA 4OMUA 1LSJA 1B8VA 2GZ2A 5JC8A 4JN6B 3WQRA 1NNUA 1GR0A 1KVUA 3F4BA 3FTNA 3OA2A 4B8ZA 2RIRA 4CM4A 1T2FA 2IE0A 3R3SA 3WGIA 1B3RA 1LQTA 3NDRA 4UUOA 3K31A 1T26A 3E5MA 2VWPA 4RO0A 1O9BA 3IUPA 3VDQA 3MZ0A 4XWYA 2P9GA 3DONA 4YDRA 4CLOB 4CMEC 4YVFA 4GLLA 5KJEA 4WK6A 1ZJYA 3H5NA 2QZ9A 1VSVA 2O3SA 3JQ8B 3KEOA 1ADGA 4YCAA 5CFZA 5AYVA 3EGOA 1HE3A 1LDNA 3DZIA 2HSDA 1GFSA 2LDXA 1QV6A 1VKOA 4GMFA 2PZMA 1U2GA 4BNFA 4J90A 4QFCA 3V1UA 5KKCA 1Y9AA 1O94A 4WE3A 3HN7A 4IS3A 4MVJG 4YJFB 4Z3KA 3GH3A 3A4VA 1R66A 1XDWA 3BAZA 4IDDA 1DBVO 1T4BA 2PY6A 3RC2A 3JQGA 4BNUA 1P33A 1GZ4A 4DIBA 4UAGA 4DBZA 5BQFA 1O5IA 2P9EA 1QYWA 2FR0A 3D4PA 3DBRB 4NFHA 4R5MA 4UVDA 1P1IA 3JYNA 2OL4A 5AQ1A 1QSGA 1MG0A 3I6QA 3UKOA 3DZGA 4B7UA 4UVEA 4ZJUA 1PL7A 1EE9A 4CM7A 4CM5A 2ZTLA 4FQ8A 4RPGA 1SNYA 1MP0A 3W4KA 4CQLA 2UUOA 1U3VA 2DFDA 2NTNA 3M6IA 3WMWA 4R9SA 3IMFA 4HY3A 4QECA 5JYDA 3QVSA 3ZU2A 1UP4A 2EJVA 3GA0A 2PWZA 3ETDA 3KM0A 5I9NA 1NXQA 4FCCA 4P4LA 2V7PA 5CDTA 1M6HA 1ORRA 5L51A 3UW3A 2FWMX 1J0XO 4JGBA 5T8KC 3KO8A 4HV4A 4XDZA 1PWXA 5JY6A 3RD5A 3E03A 3WJ7A 1HYEA 3GVCA 1ZSYA 4S1VA 4W82A 2BF7A 3JYLA 3QSGA 5B12A 1XEAA 3GFGA 2BRUA 3G79A 1E3JA 3H7AA 1BVUA 4YWJA 4PG4A 4Q3NA 2UDPA 3DMTC 3KYBA 4NMHA 4RF2A 2B69A 4BV8A 1V8BA 3CMCO 2FHSA 3L6OO 4PGFA 5GZ6A 1ISMA 5JW6A 2O3RA 4FJ2A 5HS4A 2JFFA 3A9WA 1WDMA 1XKQA 3E48A 4I9HA 3NEPX 3C7AA 4YQZA 3OP4A 3KVOA 4IUYA 4PZCA 1PTJA 4JROA 2TMGA 2HJSA 3H2ZA 5BNIA 5L7YA 2FY8A 2HAEA 2J3KA 4L9RA 4YJFA 5FF9A 5T8KA 4NU6A 3K2BA 1C14A 4CR7A 2VRCA 1JA9A 3ICPA 1I10A 1BXKA 1GDHA 1CQJA 2PD3A 1B26A 3T4EA 1MC5A 5ENVA 3I9MA 5TNXA 1BW9B 1P1FA 4ALMA 1ADFA 1F14A 1H0KA 4JJGA 4CM3A 2Q46A 2A9FA 1QLJA 4RPHA 2NU7A 3ENKA 3FNFA 4IZHA 2PGLA 4B3JA 4JP3A 3JCZA 1ZKMA 2AEJA 3GFBA 3DZJA 3V2UA 5J23A 3KRTA 2UYYA 3EZYA 1K6XA 3K92A 4WJZA 1Q2XA 3GRPA 4KQXA 1MXFA 5IXSA 3P2OA 5BR7A 1ZSVA 3TFQA 1P74A 2EW8A 3PDJA 1YJQA 2AA3A 1VRWA 2J8ZA 2BH9A 2JD2A 4KTTE 1AHHA 4WCFA 3W1VA 3VZPA 3ZNNA 5JDIC 5I7VA 5G0VA 4L76A 4B7CA 3ZV6A 3ULKA 4DL9A 2JL1A 2NVWA 3WGOA 3U4HA 3C85A 4TVBA 4TSKA 3VKUA 4WCFB 1S6YA 1ENZA 4CMHA 1G6KA 3MWEB 4OH1A 3NV9A 4YJDA 1HDOA 3Q2KA 4CQMA 2GN4A 4O6VA 5IF3A 1U7HA 5CDGA 1V3VA 2JFGA 1NPYA 4OKNA 1PX0A 3B6ZA 1Z7EA 4D45A 2YUTA 3PWSA 4PFJA 3RASA 2OORA 3ZWBA 3C7CB 3P5SA 1FK8A 3PTZA 4XRRA 4BO8A 1V9LA 4Z9XA 1C1DB 4EW6A 1E7MA 5FEUA 3ZHZA 2HRZA 2PZJA 4H3VA 3BIOA 1DB3A 2PK3A 2JHGA 3NX4A 4DIFA 5DDIP 3VPSA 1R0KA 4ZD6A 3KEQA 3KYDB 2AE1A 3E8XA 4BHTA 1ZIDA 4W4TA 1CF2O 1Z73A 3DBVO 3S2IA 2Q1SA 2Q99A 1N1EA 3HDQA 4GX2A 5U1PA 3M1AA 2X58A 3WLFA 2GN9A 1A27A 5CDUA 4YPOA 1B2LA 5FI5A 4NZ9A 4B79A 5GZ1A 3S2EA 3EMKA 2XXBA 3I1JA 2Y68A 3N58A 5ER9A 2ZYAA 5KJFA 4F6CA 2POQX 3D3WA 4GGPA 3UCXA 4JX8A 5A3JA 4KZPA 4M87A
chains in the Genus database with same CATH superfamily
2A78A 2AYYA 5LMCA 1TU3A 4UAUA 4XYEA 2Q5CA 3IUBA 4UBOA 2G7ZA 3HO6A 2NAPA 4ABTA 4ETNA 4J1QA 1VC2A 1APBA 4DWOA 4K6FA 4QDKA 3MINB 4GZ3A 3VKGA 1J6UA 1EFCA 1EHYA 3JSXA 5DP2A 1M75A 3ROKA 1VB3A 5GMOA 3DMPA 3SAJA 5LU9A 2OLKA 4B2LA 3L8FA 4J2OA 1UT5A 1JJVA 1E9DA 2C7OA 3FOCA 5BN1A 3I5XA 3FDIA 3CE6A 2ZIAA 4LK2A 1FDIA 1JU9A 2ZAYA 2B5VA 3DVAA 4NEGA 4YASA 3VPBA 2OZEA 3KP1A 4GI5A 2DRIA 2JLUA 2IEZA 2J7PA 1QV9A 3OE4A 1RBZA 3UZUA 1TLFA 2OQ2A 4DR5B 1NLUA 4JL6A 3GT3A 3LPAA 4IEIA 3ADBA 4DXAA 4XX0A 3PQEA 2OHXA 5DOZA 1DOHA 1FC0A 4K8OA 6Q21A 3GGJA 1SBCA 1GPBA 4L73A 3TOXA 3Q8WA 5IFLA 1KEUA 1Q1AA 1RSZA 2ZM6B 1ISGA 1R0YA 4CM1A 4YXWD 3GU3A 3G1UA 4M9XA 3C6ZA 1K88A 3EG5A 5HGXA 1TK3A 4C0BA 1WXIA 3EQZA 3H8VA 5B6PA 2A5LA 3CURA 3AY0A 3FDFA 3BJMA 3HJFA 4A2PA 3THWA 3SM3A 2F90A 4G2NA 3VKFA 4JITA 2WLSA 3AM3A 1ORWA 3EY4A 1IATA 2VYNA 5AI9A 1TC2A 2XUFA 4K0RA 4RJLA 3RSLA 3UJHA 1J97A 3UQYS 4PXYA 4G9EA 4M89A 1GTSA 2WZDA 1XD9A 3WMFA 1STOA 4PYMA 4Q3AA 1WLYA 2X42A 2YVUA 3MJFA 3B51X 3L1HA 1L9KA 1Q11A 1A9RA 3L8DA 3ZLUA 1J33A 2CLKB 4LX8A 1FMFA 4J3JA 1F38A 2R1VA 2QS9A 4CL0A 5ESRA 2EKPA 3MJDA 821PA 1ITZA 1OBFO 1DEOA 2FCRA 3HDJA 3GH1A 1MABB 2ZPUA 5IAJA 4A6PA 3PHIA 1FFEA 1G9XA 1K7SN 4MRRA 1H3FA 2QIPA 3WJ2A 2FK7A 3R40A 1PW5A 4LW8A 1HDIA 1ZVKA 1J8DA 3BDIA 4NL4H 4AWXA 3K15A 4C1NA 4DLZA 5CK4A 5K3SA 2FPUA 2ZBDA 221PA 1A2OA 3CNNA 1N6IA 3LCUA 1XMIA 5E9JA 1DAIA 3OCYA 4NBRA 3C5HA 3TSCA 1I5EA 1Q57A 1VG1A 2F48A 3IIEA 4B3BA 2E2WA 3C8MA 2NVUA 3WP1B 2NXNA 1BFUA 1BJKA 2HBQA 2J3QA 3P0EA 2AG5A 4NTZA 4BU1A 3KETA 2OV8A 1EI9A 4B31A 4EGJA 3RVLA 4MUGA 3M3HA 3PD1A 1JEYB 4BLRA 2BHNA 3L6CA 4XVRA 3ZKWB 5AIAA 3AG5A 1NG9A 3QW4B 5BUSA 3U9TA 4QQKA 2XWJI 5GINE 4ARVA 2C4WA 4DMGA 1XTIA 4G86A 2QK4A 4WD3A 2CFCA 4Y1RB 5E6UA 3OTHA 1VJDA 3TI9A 1SU8A 5MF6A 3ZKWA 1JSZA 4FI3F 3T5PA 4JI8B 5LZ4A 1SKBA 5ICMA 1A98A 1U0OC 5ICSA 4KDRA 1SG9A 1A69A 1YR3A 1MU0A 1SU7A 5C4IA 3PR1A 3TSYA 4RLSA 3KYCA 2B8JA 2QN9A 4KFTA 4NCXA 1G19A 3ESAA 1KK2A 4EEKA 1TMGE 2XE8A 3PNSA 4JOSA 5MFPA 1V96A 3ENNA 3ICWA 1Z0UA 3AEUA 3HB7A 4KXYA 4G5XA 4M1OA 1RYDA 2HUNA 5TF4A 4ENSA 1U3DA 2Q9UA 3NJ8A 5CK5A 2G09A 3ITDA 4UEKA 2XVZA 4BECA 4IHJA 2FMTA 1PYOA 4FYKA 2FMHA 5M7EA 1OB5A 3D1VA 2AH5A 3B20A 3I9V1 4EFKA 3EHDA 4NAHA 3GVIA 4BN4A 4EJ2A 3PA6A 4V3BA 3KQPA 2OGSA 4LY9A 2Q2OA 4IJVA 1FXWA 4RHYA 1HQKA 4LBWA 1LNSA 2Y2UA 3MTDA 5THKA 5I8PA 3I28A 1C2YA 1D2CA 1QZTA 2OBYA 2ZE7A 2W48A 3MQ4A 4HAZA 2QU8A 2OENG 5DKFA 3DGFC 2HREA 1HT3A 3D3QA 1ULHA 4PZ9A 3ROXA 2F1OA 3ILXA 1DGQA 2A4MA 3VBCA 1JU4A 4P53A 4AY5A 5JALA 3LBNA 2HQ1A 3IE1A 1CU1A 1IBCA 3A32A 3SQLA 1X1EA 1ZVMA 5FWXA 2Q0HA 5KUTA 2VOJA 3RAEC 1KI9A 4MVWA 3DZDA 2GAAA 2C3PA 2JFYA 5E8RA 2ACWA 1RWKA 1ZN8A 1DQSA 3H9CA 4E5DA 1J06A 4ZMSA 3AHDA 2RDMA 3PIRA 2ZRNA 3A9SA 4HLQB 4BFYA 4F2HA 2CBXA 1ISPA 2JFBA 4G67A 4OATA 5I8WA 4X20B 3SQOA 3JWJA 1AMNA 1DRKA 4CCWA 5EHIA 4UUPA 1TVCA 3V1KA 1J8VA 3RRMA 2Q6LA 3NIDB 4OU4A 3SP1A 1AT1A 2QM3A 4ARZA 2RCNA 3QLUA 2P62A 1P4JA 2DC1A 1F2UA 3FLBA 4ND2A 5A2GA 1FP6A 3DDCA 4J2TA 3CZCA 1A4RA 2W2XA 1DHRA 3E35A 4LMRA 4LYDA 1WSAA 1L5GB 3OZWA 1GTVA 4HYYA 4N0DA 1RNLA 3JQAA 4JU8A 4MDYA 4D57A 3HWWA 1L7EA 3I92A 3OFJA 2QM0A 2OCAA 3MMNA 3GJSA 1TT5A 4HQFA 5EE1A 2NUTA 1WXWA 2O07A 2DHRA 1CDOA 2R84A 1T5TA 2NV0A 4L95C 2FP4A 3K9QO 2QMEA 4MVJI 1IVYA 1DMSA 3ZXIA 1IRIA 2GRJA 3L5OA 1VLMA 1PSDA 4HDNA 1QRUA 1W2GA 4MPRA 1CUWA 2B92A 2CD9A 4OX9Y 4YREA 2AZ4A 2YHIB 3AILA 1KC1A 1AXEA 3K30A 1G3MA 3DEAA 3OMWA 4Z8YA 3T5DA 4XA8A 3WDKA 5KSZA 1TZKA 1AUVA 4MVJA 4V0QA 2HYDA 4JI5B 2PJUA 3WMGA 3LYHA 5EMJA 5DEIA 2FSFA 4LI0A 3ZV7A 4G0VA 2V65A 2ZG6A 4IIDA 4RF3A 1Z8FA 3NBQA 1P2FA 4U2DA 5AFSA 1EVQA 2ADOA 5AM3A 4LXTA 3SEFA 4RD2A 4BAUA 4MHTA 2QD3A 2JHCA 2BUBA 1XNGA 1FLAA 4G81A 4JKYA 2OFFA 5JMWA 5K6RA 3HTXA 1SBYA 4FC6A 3CVWA 4HUQB 1N3LA 1EFPB 3WZMA 5IKPA 1SXJD 1OZ0A 2Q6OA 2YV1A 4EHHA 2AR7A 2NV2B 1MO4A 2O2SA 2RKBA 1QH8A 3JQGB 3THRA 1IUNA 4JP8A 3X1YA 3HM9A 1YQ9A 1NBMA 3HDGA 3A11A 4YI5A 4P3NA 1TEXA 2IBMA 1DSSG 3KJZA 2Q9CA 1S89A 1ZJ6A 4HXGA 1XTUA 3QFTA 2IZ7A 1Y42X 3WRXA 3WBFA 5F1YA 7YASA 3VZSA 3KFXA 2BKVA 3MT8A 5BV0A 5HK9A 1R15A 3L5KA 5GY7A 2IU4A 4PG5A 1GO2A 4DSOA 3O94A 3SHTA 3HYLA 5BV8A 5IWCA 5DX8A 1IHXA 3S6JA 2RGBA 3IEPA 4LFAB 1RJ9B 4J0KA 2Q3DA 2ORED 2P68A 1QK5A 1Z08A 1M6NA 2POCA 1UOQA 4OSOA 1TAUA 3AMVA 1YJCA 1Z5GA 3IR5A 5FBLB 1EIWA 5KSOA 4PR3A 3DBHB 3IPYA 2ZT5A 1P4SA 1FNDA 3EIHA 3PEYA 1YBVA 5FUBA 3KVYA 1AQUA 2X8LA 1F8FA 2V6FA 1VMEA 1KSGA 3ZS9A 1CQIA 2DUMA 2VQDA 3KFLA 4Z8XA 1KETA 4QVGA 3E81A 4W8GA 4JBIA 4H4DA 3WHLA 4DUYB 3U9LA 1X38A 3UHJA 2R00C 2P40A 2OQIA 3P20A 4MR8B 4QPCA 4ROSA 5ALEA 4AZ0B 5KNCH 1MOSA 5GPBA 1P45A 1B6GA 4PO1A 1JFFA 5DFAA 4GBMA 4R8RA 5JRZA 5LLTA 4YV0A 3T5MA 4PZPA 1PQUA 1XQ9A 2A1UA 1Q21A 3EMBA 5HCNA 2P67A 1RI5A 3NM4A 2AF4C 3FNGA 2KW5A 4PAMA 4RDHA 5A5FA 2ILTA 4MI9A 4IH4A 1L7RA 2NW6A 4HPXB 4W5QA 4LDQA 2BYTA 3QX3A 2ID4A 1EDOA 4I0WB 1YFLA 1H2XA 5JNTA 1F4VA 4JB8A 5HMMA 1X7XB 1M2FA 3M1LA 3R77A 4QUIA 2ZIFA 1UIMA 2E55A 3GI1A 3MELA 4Y0VA 3WX0A 1E2UA 4N9QA 2QRKA 3FSGD 4KGVA 3KCQA 2X5KO 5E6SB 2VNAA 3HCDA 2PX5A 2XGGA 4V0MA 4RVDA 2ASVA 3A4TA 3QVVA 1P29A 1QH9A 1H8EA 2AOWA 1C4KA 3MERA 4HWOA 4MWTA 3R3WA 3V2HA 3WGHA 1EM8B 4S04A 2DAPA 1ND5A 1YV9A 2IIBA 3CXUA 5DTIA 1NJSA 3D1JA 4RZ2A 4EUEA 4DDUA 5HKAA 1R0WA 5JT1A 4QO7A 1MOPA 3NW9A 3DYBA 3PB3A 3NTUA 1GGJA 1NUPA 4I55B 1QC5B 2C2GA 2QMZA 4FXPA 4YUXA 3T5CA 5L3SB 2JJ8A 2WIBA 1SCQA 1G17A 1E3QA 1SOAA 2XRFA 1A9SA 1QCDA 1RWBA 1U5BA 2WIGA 3DPSA 3LOPA 4Q16A 5DULA 1AK2A 4C30A 2PUCA 1TYBE 2B7CA 1TQ4A 4LSZA 1URPA 2BI8A 4F72A 5BRAA 5KWVA 4K9SA 4LF4B 1W49A 2P8JA 3CLSD 1RR6A 2Z0MA 4EF4A 3EB9A 1NJ6A 4FS3A 2B6NA 5CMLA 2EU8A 2FDXA 3V4RA 4N76A 4DC0A 3NASA 4JVSB 3K05A 2WP8J 3MC1A 4QO8A 5EHXA 3FF1A 2VPXA 3IQIX 3L05A 1A5ZA 4WV3A 5JSFA 2NUPB 3SBDA 5ILGA 4D8XA 4HPWA 1CUUA 3ZU6A 2I3GA 2ZE6A 1CBUA 3QVTA 4X1IA 3F8SA 3H8SA 1H2HA 3M82A 4IVRA 5DSTA 1Q2UA 3WGMA 4C0HA 4F2WA 3CT4A 5JCXA 3BCHA 3T5BA 2RK6A 5F3DA 5D51S 3M2TA 1JRLA 3L7NA 2VC2B 3BL8A 4N7MA 4UVHA 4OUDB 1J09A 1E1LA 4BNVA 1VB5A 5J2UF 3EA0A 2OKGA 1Q5PA 2EKLA 4H59A 4E6PA 2HHHB 2FPRA 4NJMA 1N6HA 4BMNA 4CFYA 2MDTA 4LNUA 1PWYE 3IVMA 5KYYA 1BYIA 4MVCA 2CXUA 1VIYA 2FSSA 1JDZA 1T9ZA 4PRLA 4WKNA 4ER3A 4C0SA 3F98A 5ERXA 2JFHA 4FMCF 5F77A 5LXTA 1QZXA 5D7BA 1ISRA 3EG9A 2E0IA 2PPVA 3K73O 3MLBA 3O3NB 5D6NA 1SJ9A 3F4KA 4PHCA 2BFEA 5TEWA 3T34A 3VPXA 5FHRA 4Z4QA 1IBKB 4HDSA 3STTA 3ODGA 2ZRJA 4N12A 2AOTB 4O2BF 3Q0TA 4UNIA 4JQYA 2DECA 3ZOKA 4IR7A 1NC3A 1F2UB 2MT9A 1HX7A 1JA1A 1M6YA 2BBOA 2DPGA 2F9LA 2MSKA 5IDQA 1T3HA 4XIYA 4P0QB 1P75A 3BXEA 1PR4A 3HC7A 1JYFA 4TL6A 1NM5C 3RVNA 1JJFA 1NNSA 4BTEA 3JWHA 1LUAA 1K5GA 4HVCA 3SOZA 4ER5A 4Y30A 3W5AA 3TRIA 4PNHA 4A5SA 2VJDA 4F9FA 1PFGA 3CCBA 2BFBB 5HE9A 4KOAA 4D42A 4YRSA 2O8NA 1UBOS 2GFQA 3EDQA 1TADA 1Z12A 4GMXA 3AB8A 3T3HA 1PR0A 3CLTC 4FHZA 2YV2A 3L92A 2QENA 3DZKA 2J0UB 2GCNA 1KH3A 2JAOA 5ALMA 5GJWC 5HIKA 4TVSA 1SZJG 3DEJA 1I51A 4NYMQ 2RG7A 1Z29A 2SICE 3CIOA 2FJPA 3RTEA 4HSGA 2BE7A 2J30A 1O95C 4PO8A 1ZOSA 4B7ZA 3KD2A 2ORWA 4QT4A 5KOJA 1WDKA 4U8GA 4NBVA 4TRJA 5FFFA 3OJXA 1XD2A 3B13B 3L0IB 4CMEA 2B82A 2BBWA 5CLHA 3U17A 3T0IA 1GD1O 2JLVA 1SBQA 4CIXA 5IT4A 1JQEA 4E94A 3PI7A 1ZJ5A 5JR3A 4EENA 2ZK7A 1P0IA 1L5FA 3BWXA 3LVFO 4G0MA 3STHA 4ZQGA 3B2NA 5EERA 4ARIA 2XUIA 3M33A 4I81A 1W1IA 3I0MA 3WDSA 1FFYA 4Y2PA 1EFRD 4X24A 3LXRA 3UMGA 3V8NA 4MR9A 2ODWA 4E09A 4UHBA 1J0BA 1VSBA 3CUEF 3EIFA 2C96A 3CKYA 4P2GA 2FLWA 1KY5A 3BGOS 4HLDA 1SUCA 2ECOA 3PL1A 4O4JF 4GH5A 4AS1A 4RIHA 4YP6A 3X3HA 3ZHBA 3I9KA 1MDFA 1NI4B 3G8DA 3RIMA 5D1HA 3DV2A 1KTIA 3B89A 3ZJ4A 1V7CA 4F3YA 3HABA 4JLKA 1T0PA 4LHXA 2XDQB 3MCAA 3P4XA 1ZAKA 5IHPA 1J99A 1YVEI 4CLXA 1J5PA 4OP3A 4ZV9A 3VJKA 1BQ4A 2D06A 3R3YA 2HCFA 4R05A 2EBFX 2XXAB 4TMWA 4W5NA 2B37A 1IOZA 4NAVA 1OLUA 1AUOA 2QW0X 1UWLA 2ZM5A 3B52X 3EWNA 4IV8A 3I0NA 3VMFA 1TX4B 4PQRA 1XU9A 5IG2A 2WU4A 1E0SA 2C5GA 3CWCA 3DOFA 2BGGA 2DJ5A 3OZAA 1HSOA 1XTVA 1NBOA 1WHSA 3EUAA 4IGFA 4YT5A 2VF5X 3LRPA 2PA3A 4UHFA 3SC3A 4ER6A 1GFZA 3DUFA 1DV2A 3DOUA 5JVDB 1VYHA 4FBLA 5B58C 3V8EA 2AD5A 4F4HA 2RGRA 3O92A 4ZOAA 2GM4A 3VOBA 5HQ3A 4QIHA 3I2YX 3PQ5A 1RPAA 3DCJA 2PT5A 3FUXA 1KMIY 2VUSA 1TJ5A 4QSHA 4NCBA 1XEXB 1LZKA 3UJDA 2UUBB 3G17A 1ZWKA 3MF4A 3PEWA 4KQKA 1MOZA 2IXGA 4P98A 3WAJA 1I4LD 4JEUA 4FB4A 1UPBA 4ZU3A 5J4VA 4N03A 5E7QA 1CRLA 3DZCA 4KXLA 4OQLA 5ICEA 3UG7A 1YB6A 3MXTA 3BSSA 3G5TA 4REQB 4YBRA 4EG5A 4UTNA 4CEIA 2H7CA 1G21B 1P2VA 4PFQA 1N8KA 3VO1A 5JJKA 2WG2A 3RVMA 8LDHA 4BC0A 3KZNA 1ZCZA 1U4NA 2B3TA 2WQ6A 1V45E 2AT1A 3EUWA 3CZPA 2BTQB 2IPXA 1AN9A 4FGLA 5DXAA 2EYUA 5F1PA 3CVJA 1V8ZA 3ZI0A 2FOLA 4ZCIA 2IGBA 1G9TA 1E1QA 1QK3A 3OZFA 1U80A 4NE9A 4IDBA 2GM3A 5DBIA 4OQPA 4EUFA 3M5WA 3ZZTA 4ZI7F 4D9BA 3TDKA 3AINA 2CE7A 2XRZA 2R8PA 4UFOA 3EIWA 1YVPA 2XRMA 1M5RA 2O7VA 3ORRA 1XLTA 1RAEA 4IRMA 4AYTA 5C8DA 3JD1A 3R8XA 4OUKX 5THQA 4GRAA 1JT9A 3OCCA 2WTEA 4Y3UA 4CFSA 3OESA 1PUIA 3G7UA 2CXPA 3N3BC 4ZZ2A 3U09A 3VPFA 4PV7A 3PUYA 4K88A 5EHNA 4DRZA 5CM8B 5CLFA 4BLVA 4AFNA 4URVR 2IXFA 3T15A 4B5KA 2E85A 4XRGA 1Z3IX 5K8VA 3I2HA 1SQ0A 1A8HA 1SU6A 5IASA 3QFRA 4QUJA 3FMPB 4A0GA 5HOQA 3QEAZ 2W6PA 2WDZA 2JGEA 4TLLB 4G5YA 3M4YA 2ZJBA 4IIVA 1ACLA 2VAWA 4MWOA 4KJXA 4J7AA 5ICCA 1B23P 2YV4A 4OKSA 2NLOA 1Y5NA 3A1TA 2PU5A 4V1CB 1VOTA 4KKXB 3VZRA 2A58A 4FD3A 2AJCA 1QQ7A 2BDTA 1U1CA 4S12A 4RADA 4UE6A 2VVTA 4ARAA 4B4VA 3HADA 3O2JA 3WO0A 3ZWKA 5K0EA 2QX8A 3LK7A 1FBTA 1Y4ZA 4KHZA 4AW9A 2JZCA 4EZBA 3OPYA 2BGNA 1EVIA 1RQLA 3K94A 2HDHA 2GLTA 5F7JA 3RUEA 4EARA 4M1EA 3UXHA 5AVUA 4H0CA 1QIKA 2ZZKA 2DXIA 1N1GA 1V7PC 3FWKA 5FUWA 1ULTA 1YR8A 5JNSA 2Z5LA 1SG6A 1WF3A 4HGRA 5CVVA 2JIBA 2NUTB 4F6RA 3RS9A 1Z3CA 5JSZA 4E08A 4P80A 1U8CB 1G5FA 1M34A 1BXRA 1UINA 1DQRA 5GONB 4R69A 4EVIA 5E7JA 4BP1A 1SKQA 2H9AA 3KKKA 4QBGB 4DFDA 3MNFA 2FUKA 3IDQA 4RVHA 5EMHA 1SQGA 1CR2A 5FOWA 2HSWA 4ARZB 1A9TA 2WUFA 3N2YA 3NWEA 4B9EA 1FUUA 4KE8A 1ECCA 3GJ0A 4MEBA 3HS3A 5JDCC 3TZLA 1U7DA 4RJIA 3QPDA 3HI4A 3KL4A 3FFAA 4TV9B 4XLZA 3P9PA 3DBLA 5F7XA 1TTTA 1DC6A 1BWPA 1PKXA 2JD0A 3WTBA 4BX3A 4DARA 3WGKA 2CK3A 2ZTUA 4I3HA 3I04A 5AKLA 2VSYA 4UEQA 3BMNB 3HY3A 1IG3A 4Y0NA 2QLJA 2JJ1D 4IXNA 4LV8B 2QN7A 5ERYA 1KMNA 1U2QA 4HOYA 2B1IA 1N1DA 2DE0X 2NADA 1VJRA 2Y9PB 4XYGA 3LLUA 2MSLA 2UUPA 3F9IA 1KYYA 3CVXA 3I9OA 3DYVA 2WSSA 4FQ7A 5AUOB 3J80A 3I9LA 1MVNA 4FFVA 1QYVA 1PW7A 4C7KA 3BSWA 5AVVA 4RGYA 4W5TA 4DDWA 3IDSA 1DC7A 3X43A 2PRJA 2VP5A 1LDMA 1XMSA 1UJBA 2J3HA 3AUUA 1EX1A 3IKJA 4MIEA 3LIIA 4TZKA 1LQ2A 4E1AA 2L17A 2H59A 1NTOA 1XRMA 2B4QA 3R3HA 4RBNA 4AVYA 5DM60 2CNWD 1WU7A 2W8BA 3OM8A 5DCYA 2ZE8A 2ANBA 3BN3A 1IZZA 4S3MA 3BK2A 2CDCA 5JWOA 3G1WA 1TK9A 1U6IA 3WQHA 4AJ9A 1AF4A 4DPMA 4JS0A 5BRJA 1ZVJA 1M2WA 2VN8A 3VR6A 3RVQA 4BO0A 3U3MA 5FFMA 3ZLVA 4ENQA 1ZGJA 1MDBA 3IBSA 1CUXA 4OQYA 5AK5A 1VKRA 4B6JA 1O3YA 3LMKA 4L5YA 4O33A 5AESA 3EZLA 4FFLA 3PGXA 3GPDG 4QYIB 1PI3A 8ATCA 4HN9A 4DWWA 5FUXA 3WXBA 4ETWA 2FX2A 3TLBA 2GHTA 1U5CA 1P1JA 2GPTA 3D2CA 1W34A 3ROTA 4GOKA 3FETA 2HIHA 2GFHA 1T8UA 3NJ4A 3BWYA 1D0VA 3K7EA 2QMQA 3MEQA 4H15A 3STYA 4B87A 4BWFB 1YGPA 2VPQA 2Q29A 3AIIA 5I5GA 1IHPA 4DANA 4AUNA 2D2XA 2B61A 1M1YE 3FTPA 5DHFA 1Y7TA 2DHDA 4F46A 2HDWA 4AZ3A 2Y0CA 1H05A 3ZDXB 2WJIA 1YZUA 5H3CA 3UANA 3S44A 1L4YA 2ZYGA 1RQPA 2VOEA 4IY1A 4EA9A 2NU6B 5HP4A 2PGNA 3UH0A 4FKMA 4Q3EA 4M0LA 2AEFA 3WC4A 3TTWA 4QBIA 3T7SA 4NY1A 5JXWA 1K8ZB 3W8DA 2GFIA 1IRXA 2HGZA 2Z2XA 1DKMA 4R1SA 2D54A 1IVNA 2ZSJA 3DD5A 4KI0A 4TQUS 1AKNA 2XMDA 4ZI5A 4PLWA 4H7FA 2VIIA 2AI3A 5FYDA 5IF3A 2P5UA 2PUAA 2R0QC 3BJRA 2C7QA 4B7XA 3O8OA 2PH5A 3U80A 3M70A 1EX9A 3DF7A 2YWJA 1W5FA 1X15A 4DCJA 4NPHA 1KAQA 4HEQA 5K2MA 2OG1A 5FWDA 3NHAA 3PHLA 4BGEA 2AIRA 1O6ZA 2O0KA 2VAPA 3LT5A 4QLAA 1RQGA 3UHPA 5AW8A 1SC4A 4HEHA 3UWOA 3D0KA 4CW7A 2HA0A 2LV8A 4UDXX 5DOVA 1QONA 4IEFB 2C4UA 5EQFA 3UCFA 4HGOA 1GUAA 1ZZEA 4LYFA 3JWIA 2AOUA 4FM9A 1CKEA 2O2GA 3RI3A 3VMMA 5JD3A 2Q5EA 4EY5A 2EFDB 5LR6A 5J1SB 3W34A 1UOEA 3L02A 1LC3A 4G8BA 3UC9A 2ZJ7A 3U60B 1I0IA 2RK4A 4IHQA 1Y4DE 5I9TA 2LKDA 2C99A 3M5CA 5AI6A 1M34B 2X0NA 3LUBA 4RA9A 3QE9Y 5E3JA 3EDOA 1IYZA 2NPIA 4H4CA 1XCPA 2OUIA 1TLTA 1WABA 3HYRA 3F9CA 3RFTA 3E9QA 4MW2A 3RRXA 2XW6A 4RY9A 1U9JA 4CV0A 1T6XA 1H8HD 4LHVA 4Z54A 1XQWA 2RE8A 3T1QA 4KR3A 1ZI6A 2AE2A 3KJGA 1K2WA 3OSUA 4GMGA 1N8SA 3CTMA 2I2BA 3AJ8A 2JIZA 2O54A 1DPGA 3B9QA 1PS9A 3V8MA 2QORA 5E9QA 2I3DA 1EK2A 1DTSA 4QUDA 3WB9A 3U5ZB 3ERCA 3A4MA 1RTTA 4XEUA 5C8ZA 1OH7A 4DR2B 4Y2RA 2C1ZA 3A27A 4ZT4A 3UBTA 4M8SA 5CH8A 4D9HA 4EAAA 4PLFA 3C4VA 2G4VA 2OUKA 3MT9A 2GZDA 3TJZA 1U0HC 3G0CA 2CUTA 1JWBB 3KXKA 3PFCA 3F6EX 3QLVC 4B3FX 2NU8B 2VI5A 5L7TA 3KEGA 1UR5A 3DDOA 4HBGA 4GMKA 5FUQA 2ZREA 2C5EA 4EK9A 3WZLA 1EUCB 3X2SA 1LRLA 3ETGA 1AB6A 4R6XA 3E0XA 4CVNA 4PPFA 4HXFB 2VK1A 4DCCA 1VL8A 5CA0B 1YOVA 2C4HA 3N2LA 2XE6A 4GUDA 1CLUA 3RHTA 1JEEA 4RS4A 4LNHA 5C32A 1V5FA 2PWYA 2RHGB 4KIJA 1II0A 1DJLA 3IAAA 1QP4A 1HLDA 2CMDA 1N7IA 4R01A 3S1LA 1EXVA 3OOWA 1HKUA 4LOLA 1YSCA 1C2TA 3FPAA 2F43A 2KM1A 1OI3A 3CZ4A 3DEZA 3EXHC 5EGNA 4KQJA 1SVNA 2FEMA 3D7LA 1RAIA 4RCVA 2BMWA 4ZXPA 3KDSE 4QJIA 2OG2A 4WKBA 4WK2B 1NPTO 3HCNA 3QQPA 4BBZA 2QD5A 3VR2A 1MHPA 1NI3A 1WJGA 1XXLA 4R0VA 3H2BA 5T6BA 3P9ZA 3UGTA 2GRAA 3M34A 5E38A 2QTFA 3L2OB 4XWGA 4X0EA 1K5HA 1T9BA 2AG0A 1K8QA 3NWOA 1DPFA 2GBCA 4J4TA 4BVLA 3EVEA 4JT4A 1P2UA 1GN8A 4BNGA 5FH9A 4FWTA 1GCGA 1YZHA 2F62A 3UWDA 3OZCA 4F3CA 1XRQA 1WDLA 3EXIB 1D1QA 3B1ZA 2YXDA 5DI3A 4MHOA 1Y89A 3ZWQA 1L5MA 4GBGA 1FMJA 1TYDE 3FDXA 2BTEA 2PLRA 4W8HA 3QY0A 5JMTA 5M29A 3SZGA 4E5NA 4FEAA 1NJGA 1A9QA 2QBYB 1QVZA 2ZR9A 1SXPA 5C46F 1QHSA 2YMMA 3FYUB 4S2EA 2A4KA 4F60A 4Q4HA 4YMWA 2OKCA 4Q9NA 4M99A 5GVSA 3WIDA 2JK0A 4Z2AA 3C8ZA 5A3SA 3IUQA 2FFBA 2BEWA 3GRRA 1MEEA 4HFMA 5DX1A 2ATIA 1TUIA 3EYAA 4H7PA 1CB7A 1KI6A 2QRHA 3JARB 4MVXA 1TGVA 5SY4A 4N5LA 3RAJA 2BEUA 1Q77A 1NUUA 2Y1DA 3SYKA 4D9IA 3FCXA 1I7PA 2PFGA 3HNPA 5JXGA 2VT2A 2LIVA 2FFAA 2DBVO 3EXG2 4BE9A 3A05A 2WOOA 4R3WA 4UD2A 1ENYA 2P4UA 4WXYB 4BVEA 2XCQA 4C3OB 1LQUA 3GLGE 1FVFA 3DOJA 1RKXA 3FNEA 3DCYA 5AM5A 4HKTA 5H82A 4AK9A 4JGGA 1J49A 2Q1YA 3BULA 4YMHA 5IYZA 1NN5A 2IUYA 2NM0A 2O57A 4BEWA 1TVKA 2I99A 4YLYA 2HH9A 1IMJA 2OXRA 3PDWA 4QOJA 5ESXA 5JLJA 2I4RA 1I94B 3CH4B 4NG4A 2BM1A 1V47A 2ZTMA 4A8JA 1RHJA 5C81A 2AXQA 3A28A 3B85A 4UAVA 4D92A 1NF3A 2RHLA 2XUOA 4YRFA 5FWAA 3GFPA 4PRZA 2BEUB 1SXQA 10MHA 2UXBB 4Q48A 1G291 4TGLA 3KSMA 1L5KA 3TQIA 4B35A 5D00A 1GA4A 4RVNA 2WTBA 1PJAA 3WSVA 4US0R 4BKMA 1PS8A 2C5AA 1IZ9A 2CF5A 4KCGA 5FOTA 4DTIA 1K3FA 2IYZA 2ZUUA 3A9CA 4P3XA 3UJ7A 2IYAA 4EB3A 1L3IA 3EWSA 1OLXA 3ONEA 5IH3A 3HRKA 3HV0A 4IJ6A 1A9OA 3U4DA 1U0BB 2BEVB 1RJWA 3SZLA 2DWQA 1P7YA 3T9BA 5KQLA 4DR6B 1A76A 3I4FA 2GXQA 2D0OB 4MS1B 3VFDA 1T5SA 1UDRA 4QJBA 4JUCA 3ZJVA 3HNOA 4TKUA 2P9QA 3OOHA 4P22A 4TV8A 4DEVA 2I71A 2YOGA 3IV7A 2YBEA 3N3AC 2CVZA 2WF9A 1GNTA 3BSFA 3L7LA 3AL3A 1K6EA 2I1QA 4O1MA 1FQKA 4TRRA 5TS3A 5ADVA 2DLCX 2IK8A 3LNTA 2G4CA 3C3JA 2C9OA 3ZCTA 2EP5A 3HUFA 2QB5A 4O4HA 1A1SA 1T1SA 4OMCA 4P33A 3R76A 3AF3A 1LB1B 2CV2A 4M9CA 2ENWA 3C6KA 4RKYA 2QAGB 4KQIA 3CNLA 1G55A 2QL5A 1NAHA 1TEHA 1V26A 4WADA 1OXSC 4RK6A 1HE4A 3KSZO 4L50A 2NTEA 1IJFA 3FYSA 4MZDA 3W4JA 4UW9A 2A9KA 3K8QA 1WCXA 4HAYA 3TQHA 4FKZA 4BIIA 3X1WA 3LBHA 1G7TA 2GN1A 2PGOA 4YQEA 2RHOA 3AF2A 5EZ6B 2O8CA 1I13A 4OBBA 4RFLA 3F5FA 3Q6MA 4FBMA 5EUMA 3U16A 5AK6A 2UYHA 1OXMA 1YJ5A 4OXRA 2FWJA 1MRNA 3G8YA 2VXYA 1GL7A 4QASA 3FPJA 4NBWA 3RNOA 4DG9A 1M6WA 1J8QA 1CVRA 1V48A 4KV7A 1V7QA 3WGJA 3ZQ4A 5A4KA 3KPWA 3O2NA 2EHDA 4YCNA 1PNQA 4Q1CA 5A04A 1CY0A 2AMVA 4RMHA 4QUKA 3W6OA 1FRNA 1RRGA 4BQSA 2BFEB 4ETMA 4PN3A 1GRVA 1GT6A 4JEHA 3HSKA 1Z88A 2V5UA 2VZLA 4QRHA 1N57A 2QAJA 5ITZB 2C2KA 5IVHA 1DQZA 2Q7DA 4HCJA 3FGPA 3ZY2A 4LV6A 1JLLB 1FDOA 2GBLC 2BW0A 1XDDA 3GJTA 3TAXA 4JYAB 1TKRA 2LE0A 2A84A 1A88A 1OB2A 1F4PA 1H2EA 1QYDA 1HXHA 4OJQA 1EWKA 1G8PA 3P2EA 1E9BA 4ENVA 5G41A 1P60A 1IM2A 2HTFA 4WCDA 3RU2A 2H1WA 5L40A 1R9MA 2B2NA 4F8EA 2W2MA 1P4RA 2LCFA 2LDBA 3UGQA 5IULC 1TGYA 3BICA 4PW0A 2EX4A 4B83A 4QM6A 3RVDA 4X20A 2XYGA 1T8YA 3D9QX 4FC7A 4N8DA 3BXZA 3DLCA 1YVUA 2C31A 3MWGA 4WECA 4D4HA 2H4FA 4X41A 2H2IA 2OVFA 4P6VF 4M0MA 1QQ5A 3DV9A 4A6XA 5FBKA 4PAOA 3RG2A 4YIKA 3X44A 5I7EA 3S7ZA 2DEUA 4DWVA 3SS8A 4BNDB 2BHTA 2QRUA 4FUTA 3QSYA 2EJCA 1VE9A 2PUJA 1FNCA 2D0IA 4WSOA 3H1GA 3EGDB 2Q3BA 2HRCA 4KW7A 4LVUA 2E4YA 3J81k 3TFWA 3ENVA 1V3TA 1OSNA 3QKSB 2VDVE 4O2BA 2XQFA 1RPJA 4FOOA 5I4BA 4Z9FA 4II7A 1G2OA 1N4AA 2GI4A 2DH6A 2O1EA 4QA9A 4RZXA 2IZ6A 1CERA 1V4BA 4LXXA 3C3YA 3EYWA 2IBTA 1MX9A 1PNOA 2PAAA 1QS0A 4AMUA 2GJKA 2I62A 2LGJA 4XSHA 2O8DB 1Z5UA 1Z2OX 3A06A 1ZIXA 2G5TA 3BIJA 3RH0A 3JQ8A 1B15A 3QXSA 4OU5A 5THXA 4OHWA 1VE5A 3MFYA 4P32A 1KQNA 2H07A 4RY8A 1M33A 4KMSA 2I4MA 2O2HA 4HWSA 5FA6A 2GD2A 2GK6A 2YZNA 4A0QA 4BMCA 4OD0A 4YALA 3ESYA 1KPIA 4C0KA 5HOEA 1VMAA 2QTRA 1IZ0A 4MGEA 4U7GA 2DZDA 2ZYRA 1KQOA 3ZK7A 2X1HA 4RK0A 4TMKA 5CT5A 5U4QA 3SE0A 3ZDYB 4QBTA 4XOUA 4JXJA 4CMJA 3IV9A 1JXOA 1QUEA 2QP4A 4EUSA 3TRKA 1FLDA 2E49A 3U6KA 2GAIA 4QSMA 5L95A 4PYKA 4CQMB 5FR2A 3L7BA 1WVGA 4E11A 4HB3A 4NMXB 2EHJA 2BEJA 1U2PA 4MUXA 2QTAA 4NABA 4G0ZA 4X45A 1IAVA 2ZUWA 1WDWB 1QR6A 1ZLYA 2IJGX 4BMYA 1ZD8A 3DG9A 4C5CA 3KQHA 4ND7A 2D4AA 2A1UB 4EFDA 4LZAA 4DVJA 3A9VA 1GAXA 5FHQA 2ST1A 4QDUA 3DE6X 1J2YA 4M3NA 3KJEA 5EIWA 3KTAA 2W70A 4P3YA 1DCKA 2W2VA 2PX0A 3KEFA 2G9QA 1MR3F 2CNNA 4MKZA 5HRCA 4PPQA 5CDYA 4KRYA 1VPTA 1RQXA 1L5HA 1D0SA 1KDYA 2JHPA 1GHTA 3DE7X 4X97A 3Q9NA 1UZAA 1CUVA 3F96A 4DLTA 1XV5A 2AFHA 1Q16A 2SKCA 1A5TA 3D3EA 5KX5B 4JV5B 4QBFA 1KRHA 2FKAA 5BUCA 4KPYA 2WTAA 1NLMA 3RK0A 3TINA 3WSWA 1UL1X 3SFVA 2WILA 1RJ9A 1BOFA 1YR9A 1CV2A 3E9CA 3MCVA 2D1RA 3HBNA 4JC4A 4MJ3A 3PP8A 1MPTA 1VMDA 1AMUA 1MABA 2YH2A 4J9UE 5HTKA 2GKGA 3G2QA 3NAQA 4JMLA 5K45A 3QFHA 3C43A 3RIGA 2FR1A 3BMXA 4Z4CA 3Q98A 4YS6A 4HRXA 5C1IA 2WIFA 4UDNA 1X1BA 3A2MA 3DWEX 1IQUA 2ZROA 3RRYA 4KFUA 3GJ6A 4QHYA 5DJ5A 4BGUA 2WSLA 1TM7E 3RFVA 3V33A 1VA5A 2NYUA 4EB0A 3AF6A 4PM4A 2HMUA 3EEIA 1N6LA 2FQ1A 2I03A 2V0CA 4FDUA 1OI7A 5K3DA 4BVAA 2SECE 3K16A 3PIDA 4DOMA 4ETIA 3G9UA 2VRCD 5BNZA 3MS2A 1MT3A 1D2MA 4OLJA 3RQSA 2QUJA 3H75A 3TG8A 1KO8A 2H7XA 3PHCA 5B7NA 4MCJA 5B37A 2VATA 3UWPA 3BB4A 4TRNA 5I9LA 1UBUS 1H4QA 1JSRA 2G88A 5KYKA 1V4VA 4IGEA 1O77A 3FR7A 4RKWA 2HA2A 2IT1A 4TS3A 2H51A 4YACA 3T4XA 1K0UA 5AW0A 2GM9A 4QTTB 3A26A 1RYBA 5JQGF 2MYUA 3OFVA 1NBEA 2DFNA 2PSSA 5K3FB 4YR9A 3AVYA 4JI2B 2O5RA 3IR7A 3QYFA 2FZVA 3FHLA 3QI7A 4EY4A 3A1EA 5LLSA 4W1RA 3ZNOA 1NUAA 3H11A 1BXRB 3LF2A 4OHFA 5GONA 1CNMA 2PDAA 2WQ7A 1Y8QB 1KEWA 2QJTA 4MNTA 3ND7A 4MS4A 4J76A 1JECA 2ABWA 1VI2A 3SYNA 1QDUA 2PUHA 4RQTA 4GKJB 1E77A 4JT8A 2ONJA 1XALA 2C3YA 1T0HB 1G4HA 1M34E 2HV8A 3F97A 1GZ6A 1QQTA 4P31A 1NMEA 4BWYA 4EQ6B 2IH4A 3P9QA 5DE3A 2C07A 3U3OA 3N8DA 2HCBA 1TMYA 4FR5A 4OHZA 3I4LA 1OFHA 3QFFA 2V7BA 2VTKA 3GLKA 5BSEA 3DZHA 4JP5A 5G53C 3QBEA 2ZUDA 2HKIA 4NYIQ 1KJIA 3R0IA 3AIMA 3GYGA 4MUBA 3MIIA 2C57A 2IXDA 3F6YA 3V3TA 2O5CA 1UJ5A 1FS4A 4FYHA 3PQ7A 1GGMA 2MR6A 2Q6TA 4V1CA 3VRHA 5KQPA 1BXGA 2Q3EA 1KE1A 1O2DA 1HEIA 3PFHA 4TQ9A 4IW3B 4ZYYA 3HSYA 1HYBA 1RJFA 1JVNA 2RONA 2R6FA 5LYYA 3C41J 1SD1A 2P3QA 1JIKA 4IZOA 2V0GA 3F6PA 3G5UA 4E14A 2O4UX 3QX7A 3CUTA 4R0NA 3VR4D 4GKKB 1QP8A 4UASA 5FI3A 1E2GA 3CGWA 4G63A 4RL6A 1RJDA 1S2DA 4UOQA 1MLDA 5HKKD 1LPPA 1P3DA 1VJ1A 2DBZA 2IVFA 2PU7A 1ZO8A 5A3QA 1GILA 4ZQFA 2JANA 3LC1O 1XMOB 3A2KA 3K9LA 1W29A 1U0RA