2Y99A

Crystal structure of cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase (bphb)from pandoraea pnomenusa strain b-356 complex with co-enzyme nad
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
275
structure length
267
Chain Sequence
MKLTGEVALITGGASGLGRALVDRFVAEGARVAVLDKSAERLRELEVAHGGNAVGVVGDVRSLQDQKRAAERCLAAFGKIDTLIPNAGIWDYSTALADLPEDKIDAAFDDIFHVNVKGYIHAVKACLPALVSSRGSVVFTISNAGFYPNGGGPLYTATKHAVVGLVRQMAFELAPHVRVNGVAPGGMNTDLRGPSSLGVPLADMLKSVLPIGRMPALEEYTGAYVFFATRGDSLPATGALLNYDGGMGVRGFLTAAGGADLPEKLNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CIS-2,3-DIHYDROBIPHENYL-2,3-DIOL DEHYDROGENASE
publication title Biochemical Studies and Ligand-Bound Structures of Biphenyl Dehydrogenase from Pandoraea Pnomenusa Strain B-356 Reveal a Basis for Broad Specificity of the Enzyme.
pubmed doi rcsb
source organism Comamonas testosteroni
molecule tags Oxidoreductase
total genus 86
structure length 267
sequence length 275
chains with identical sequence B
ec nomenclature ec 1.3.1.56: Cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase.
pdb deposition date 2011-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2y99A00
3GUCA 5ITVA 1YRLA 3F1KA 1DIRA 3L07A 4H15A 5I8WA 3QLJA 3WLFA 4CMEA 3DWFA 4WOJA 4H3VA 2C7VA 3RKRA 4W82A 1KVSA 3PJEA 1ZJZA 4BO9A 3DTYA 4JP3A 1X1TA 1HL3A 4YVFA 3OSUA 3GN2A 2V65A 3NTQA 3Q2KA 4BS9A 4BB6A 3PXXA 3DZKA 4JCOA 1A4IA 2X0NA 3KZVA 3JD2A 4M49A 2NSDA 3OQBA 4FJ2A 2F00A 1D3AA 2FHSA 3B1FA 1YQGA 3VHRA 1SB9A 1U3UA 5A04A 1C1XB 4PLCA 3JD4A 3GOHA 1KYQA 3GPIA 3ZWMA 4DIBA 4O0LA 3WNQA 4I9NA 5LDHA 3VZSA 4TZTA 3UGKA 5KJFA 5F5NA 3X2FA 4JXKA 4J91A 1EK6A 2BMAA 2O3JA 5BT9A 4TVOA 4OMUA 7ADHA 1LDNA 1Y5RA 2Q1TA 3ZHZA 2H63A 3PWKA 1PGJA 4RVSA 3DHYA 2JCVA 4Z0HO 1PQUA 1Y8QB 2NVBA 3GVIA 5KVQA 4MIYA 4NQZA 4XGNA 1PJ2A 1KVQA 4XB1A 5CDYA 1ISFA 2VOEA 3PEFA 5JPIA 4BB5A 3OJOA 4WLEA 2DAPA 4WNIA 4YRDA 2NADA 1YE3A 1ZNQO 1I30A 3NJ8A 3RROA 3LF2A 1GDHA 2BFPA 3QJ5A 4GH5A 2XF8A 3PIIA 1GQ2A 4AJIA 2PGDA 4BNIA 1HZZA 1V6AA 1XHLA 5DCWA 4PIVA 5G2OA 4OXNA 3QVTA 2H6EA 4CM8A 4J1NA 3WGGA 5KJ6A 2ET6A 2HAEA 1C0LA 3SC6A 3WWYA 2DQ4A 3JQDA 2EP7A 3AUSA 4B4WA 3BMNA 3TL2A 3GHHA 4GVXA 5L9AA 1K89A 4CM7A 1SB8A 1NVGA 3C1TA 1ISHA 4W99A 1U3WA 2J5RA 3TOZA 1PZHA 3ZWNA 2YFQA 4EUHA 3PDUA 4DYDA 1E3SA 5L7YA 1DDOA 1EUDA 1HDZA 1ZUD1 4BNWA 2F1KA 3DAGA 5L4LA 2ZIZA 4FQ8A 3S2IA 4CM1A 1M76A 2IEBA 2Y67A 3M1AA 3MEQA 4J49A 1KY4A 3IKVA 3CTMA 2FR8A 4N5LA 2X22A 2Q1SA 4UEKA 1DHRA 3DONA 3I9MA 3Q9UA 1E3JA 1TB4A 4MVJM 4OO3A 4CLDA 2BI7A 4CR6A 3DAFA 4RLSA 4ALKA 4RJTA 1OFGA 2BFAA 2YV2A 1K3TA 1RM4A 3BYZA 4R1NA 4UUOA 1B8UA 2CDAA 2NLOA 4Z9FA 1HSOA 5JY6A 1PJ3A 1UZLA 3I83A 1X13A 3HZZA 1FK8A 4YT2A 5TLSA 3EGOA 4QXMA 2P5UA 3NT2A 4FFLA 4XEHA 1NHWA 2JHGA 2VHXA 3OECA 4ZQHA 4UVGA 2IXAA 2HU2A 4HY3A 2AE1A 1B7GO 5IZCA 5DCYA 2DBQA 1FDTA 1A27A 5A9SA 1WAMA 3NAQA 2C82A 1ZSVA 2VWHA 1LDYA 1YXMA 5A9TA 3U4DA 1IULA 2NU7A 2X0IA 3D5TA 2BLLA 3BMQB 5I7FA 4RZIA 3TFQA 4J6FA 3QY9A 1SEPA 4IIUA 2PZJA 3H8VA 3E5MA 2HSDA 4JQCA 1HTBA 4DXHA 1KETA 3PZRA 1YDWA 4RVUA 1W6UA 2JKVA 5EQFA 3ZW8A 1EVYA 3GAZA 4DIFA 3WGZA 3FPLA 2ZCUA 3KETA 4BNZA 3WYBA 2WYUA 4AJKA 3DFUA 4U6QA 1B14A 2WE8A 3GRKA 1UAYA 2EWMA 3WGIA 1ML3A 2PWZA 5KJEA 1J0XO 2GN8A 2QX7A 4G2NA 3B70A 1GFSA 2BGKA 2E82A 4ALJA 3AUUA 1IE3A 3LZ6A 4IDEA 4NFSA 1GPJA 3PYLA 1P45A 3BA1A 4BO1A 3M2TA 3PJDA 4KTVE 1U5CA 5BQFA 1UUFA 1UXGA 2QRLA 1YOVA 4AJJA 5TNXA 4B4VA 3FHLA 2X6TA 4LISA 1NPDA 2CY0A 1WDMA 2J5KA 4W9NA 5JC1A 2R00C 1EUCA 3RD5A 4CM5A 4DTIA 1UXIA 3AJRA 4GMGA 3DFZA 4XJTA 2X9NA 3BAZA 4H7PA 1LLCA 1PJLA 3Q0EA 4UREA 3SXPA 3F5QA 1OOEA 3LSYA 3C1OA 2GZ3A 1VI2A 4YT4A 1CETA 1JWAB 3ZWWA 3D5QA 4E31A 1CEQA 1HDGO 2UDPA 3KLPX 1BW9B 1EVZA 2CUKA 2VTEA 2AEJA 4ND1A 5I8ZA 2Q99A 4L8VA 2GASA 2EGGA 2W2LD 3NJ4A 3F4BA 3N7UA 4II3A 4RF2A 4CODB 3CINA 3KVOA 4CLHA 2ZYAA 1QG6A 4YPOA 2E49A 2B36A 3KSUA 1JAYA 4J4BA 4BV9A 1SNYA 3E1KA 4HV4A 3DC2A 4KQXA 3C7DB 2I3GA 2IXBA 1P3DA 4CLOA 1JTVA 4CMIA 2X58A 4CUZA 1CRWG 3I23A 2G17A 4XYMA 1LJ8A 3VDQA 2GERA 3QW2A 4PG5A 2FMUA 3C8MA 1GQQA 4R5MA 4D0SA 4FBGA 1UDBA 3K73O 4ZN6A 2I9PA 3ETGA 3TFOA 4RVFA 5IXYA 1GCUA 3RWBA 5JAIA 1DFHA 3LDHA 5F1KA 3TQHA 4F3YA 2V6FA 1E7SA 3S55A 2FPPA 2ZCVA 3UH1A 3O03A 3I1JA 3PLNA 1N1EA 4ROSA 3VKVA 4C7KA 2C2XA 4ZHSA 5K6AA 3SLKA 1E7QA 2AQIA 2NTNA 4HWKA 4J7UA 1UZMA 4R9RA 1WMAA 2RCYA 1SZJG 5F1PA 1QORA 1ID1A 3VH3A 5J23A 1P74A 1XLTA 1YWGO 4KUGA 1A71A 4QFDA 1T26A 3C7AA 3D3EA 2FN7A 3ASUA 5FI5A 1LUAA 1O5IA 3F4LA 4OHUA 5F3RA 2ILTA 2CF5A 3INRA 5GZ6A 2JCYA 3BTOA 2E48A 1KEWA 2QHXA 4FC7A 3WTCA 1B8VA 3MTJA 1HWYA 5CP8A 1TT5A 2AHRA 2GN4A 4R9SA 4CUJA 2FPIA 2EHDA 2W8ZA 5ER9A 2VWGA 3L9XA 3TRIA 4DC0A 4Q3CA 1NXQA 5A03A 1NYTA 4PLWA 1HE5A 2Y66A 4O63O 4Y6RA 3GMDA 1T2AA 2WJPA 1GZ4A 1W8DA 4CMHA 1H9AA 3FPCA 2IYPA 3ZWOA 1FJHA 4M87A 3TJRA 5IJZA 4GLLA 3FNEA 1R4NB 4NBWA 4XB2A 3OJEA 4XR4A 5ENDA 5C7IO 1Q1NA 1E1LA 3MJVA 2I3AA 2D5CA 3FNGA 1HDYA 3QWFA 4R69A 2C20A 2AE2A 3W4KA 4QT0A 5JBIA 1YONA 2GD1O 3AUTA 3I4FA 3QWHA 3AI3A 2YHUA 4BGEA 4RPGA 4FFRA 3P7MA 3GZ4A 1VRWA 4QO8A 2EKLA 3DBHA 3H2SA 3NRCA 3A1NA 3AI1A 3HHPA 3GNQA 3ZN2A 4XYGA 5B4UA 2DBZA 3AOEA 1GADO 3GA0A 1VKOA 3G0OA 2Y93A 1HDRA 1BSVA 1QV7A 4AL4A 4RPKA 1R12A 1ZW1A 1LI4A 5DOZA 4ESOA 4YCAA 4MVJF 3V8BA 2O50A 3U4HA 4JJGA 4D3DA 5IFLA 1X7DA 2I99A 3F46A 4N5NA 4FB5A 3AM4A 3PJFA 2E4AA 3P2OA 4IJVA 2V6MA 1IUKA 4HFRA 4QQRA 3NV9A 3U5TA 5KVVA 4OIMA 4D0RA 4BNLA 3ANLA 4IS3A 4I8XA 1ISIA 3WSWA 1B2LA 1ADBA 3ZNNA 2X1HA 2Q46A 4DPKA 1NASA 3QRWA 4XKJA 2Y1CA 1SCUA 3WWZA 1T1RA 1B3BA 2TMDA 3S8MA 3R0IA 1QLJA 3OA2A 1HDOA 1F8GA 3TZKA 4E2WA 1ZK3A 5EESA 5JAQA 4UUPA 1PL6A 4J4TA 3T4XA 5T5QA 4OGWA 3I6IA 3KYCB 4PN3A 4R1UA 4R3WA 1DC4A 1R0SA 1ZCJA 3ZNQA 2OFPA 2EW8A 3V1TC 3D4OA 2DBRA 2HMWA 2EIHA 3DB2A 2P4QA 2AQKA 3GPDG 3R6DA 2X7HA 3JQ9C 2NWQA 4E12A 4JROA 4UUNA 4DPLA 4ZQGA 3O38A 3VDRA 2D4AA 1KOLA 3RC2A 1NNUA 4OOFA 1RM3A 3PI7A 1OZAA 4DA9A 4P4NA 3C3XA 3QWIA 1MX3A 4RDHA 1FDUA 2SCUA 1GV1A 5CDTA 4RL6A 5ICSA 3U49A 4UVIA 3ZWAA 1Q7GA 4L0QA 2YYYA 2VHVA 1DIGA 3OM9A 3P19A 1NX6A 4O1MA 4WLOA 3TSCA 1QYCA 4GKVA 4DREA 1LNQA 1SEVA 2DUUA 5CG1A 3BHJA 3AY6A 3M6IA 3ZV4A 1GL3A 5L7TA 3NGXA 1MV8A 1ISJA 1FXSA 2YY7A 5BSHA 3GMSA 1PGQA 4B4OA 3GG2A 4CLRB 3BHMA 3I9NA 4CM9A 3GVCA 4HKTA 1U9JA 4MVJA 3H6KA 4YJGB 4YTEA 2FSVA 3K6JA 4E0BA 1A9YA 4XYBA 1C14A 3LC1O 1NQ5A 2J6IA 4NU6A 4YQYA 1I3NA 4M54A 4PCVA 5HWSA 4YWJA 4BNGA 5C37A 5DOVA 5AYVA 2BGMA 2UV8A 4IY1A 4GQAA 5KKCA 4EGFA 1RWBA 3PK0A 1P1JA 4LCEA 3DZIA 3FNHA 1WZIA 1R6DA 4I5DA 4Z3KA 3WLEA 4OL9A 4R1SA 2PR2A 4R3NA 4EDFA 4E32A 4Q3NA 4BO7A 2NM0A 3K8ZA 3D4PA 3KHUA 3GEGA 1H6CA 1Y8RB 1GV0A 3IIEA 4MIEA 3G17A 4L75A 5A3VA 2PFGA 4IMPA 2DKNA 4NU5A 3EW7A 1ZXBA 3GZNB 1ZMOA 1X7HA 3IAHA 1R66A 4MO2A 3RUAA 1I2BA 4KUHA 4BNVA 4CM9D 3FN4A 4MVJD 5DBGA 3OP4A 4PVDA 4YAKA 8ADHA 1DJQA 1HYHA 5JYDA 4FR5A 3ASVA 4HFMA 4DLAA 5L7WA 1JW9B 2GN6A 5KOIA 4JJFA 3K30A 5I7SA 3OIFA 4ZICA 2WEKA 1IPEA 3OMLA 2FR1A 3K5PA 4Z9XA 1NQTA 4YA6A 1JWBB 4J9UE 4AG3A 4FC6A 6ADHA 1LDMA 1TT7A 1QYDA 4OSOA 4R68A 4RO0A 3UCFA 3MJCA 4CLXA 3C24A 2J3JA 2X5JO 3ONFA 2Q4BA 4EJ0A 3VC7A 2Y0CA 1KS9A 4QEDA 4J7CA 1ZJYA 2W90A 3GY0A 4IQGA 4A7PA 3HQ4O 2QYTA 5L51A 1EDZA 3RUHA 2WYWA 1B8PA 1R4MB 3JCZA 1H94A 1NQOA 3DO5A 1LA2A 2CDBA 4BO0A 5TS3A 1BXGB 1M75A 3DEYX 3SJ7A 2UUPA 2WE7A 4PZDA 4JBHA 3PQFA 3WGHA 3ROQA 3ADOA 3SLGA 1QRRA 4GWKA 3IOYA 3TZCA 5ITWA 1O94A 3GDOA 4Q3AA 4YJHB 1B0AA 2WD7A 4RQUA 3L0DA 4P22A 4BIIA 3WX0A 3IKTA 4TQGA 2ZB7A 3L6OO 1XQ6A 1FDWA 3DZJA 3EDMA 3ETDA 4BKPA 3F9IA 3CKYA 3E9QA 2FSSA 1LRLA 2XXJA 5DZSA 3JQAB 4PLHA 2EP5A 1PJCA 3MJSA 1S6YA 3RJ5A 3VPSA 2PD6A 1DXYA 1BHSA 3JQ7A 3O8QA 3VVBA 4RORA 3T7EA 1ZSNA 3GAFA 1T4DA 2WYVA 1XKQA 4TRRA 4ND3A 4FOOA 4CQMA 5AQ1A 5GMOA 3JQCA 1ISGA 3FWNA 4KZPA 5HRUA 4Q3BA 1NWHA 5DP2A 4BKOA 5CEFA 2P5YA 1NFQA 2DBVO 5TJHA 1EDOA 2YDXA 1E77A 4IDDA 4OXKA 5C3MA 1KVUA 1ONNA 1L1FA 4BNNA 4TMFA 5JMPA 1LSUA 1GEGA 2VYVA 3WGQA 5EN4A 1PS0A 3JQFC 5B4VA 2V6BA 4B8WA 3VKUA 1ULUA 3I5MA 4MVJP 2Y99A 1SOVA 4FSHA 3G1TA 3H65A 1T2CA 3GVHA 3RBVA 1A72A 1XGKA 3OICA 3WSVA 4KUEA 3QVXA 4YAEA 3SX2A 1E6EA 2OUIA 1DLJA 3LLSA 3IP1A 4PLZA 4IGEA 4PGFA 5C7LO 4Y6PA 3JQGB 3G49A 4D46A 3ZV6A 1V9LA 3WGOA 1YJ8A 1C1XA 4ZVVA 4CQMD 1P1FA 3FF4A 2JCXA 5DBIA 3M1LA 4OYRA 3PFWO 1TLTA 3QWBA 5HS4A 2FRDA 1PZGA 3E82A 3HFSA 4LVCA 1LQUA 2QZ9A 1PZFA 4Q3EA 4CUKA 4R1TA 3UFXA 4Z6KA 2B5VA 1G1AA 3HNPA 3TZQA 5CG2A 5JDCA 1YBVA 4CMAA 2W2KB 4YRBA 1Y8QA 2HMUA 5ADHA 5U9CA 4ZQFA 1I3LA 1K6JA 3UCEA 2EEZA 3QQPA 4RVDA 1Y5MA 3K2BA 5JS6A 3UKOA 4NIMA 2O2YA 4GLOA 3AW9A 5EMHA 4I5FA 3JYNA 5BSGA 3DQPA 3PHLA 4HP8A 2R6JA 4L4RA 3OEWA 4KWIA 1YDEA 2Y68A 4BMSA 3OHSX 4XD2A 3O26A 4MVJG 2AEMA 3GLQA 5ILGA 1M6HA 4FJ0A 4NHEA 4RPHA 4U0KA 4YBZA 1XYGA 1NPYA 2PZKA 3BTSA 3A28A 3PQDA 4ITUA 1T2FA 3KLMX 5ER6A 3GC6A 4LRTB 4JP2A 5C5IA 1WZEA 4HFNA 4CV1A 2P9EA 3HB4X 4DC1A 2PZLA 3NX4A 3ZV3A 4IDGA 4IM7A 4EJMA 1PJSA 1XU7A 2IE0A 1SOWA 1ZXLA 1XELA 4UVHA 3WMWA 3EK2A 1E5LA 1Z75A 1A4UA 2O7SA 5L45A 4NK4A 2OOSA 2JAHA 4GX0A 3DHNA 3AUAA 3RUIA 1PEDA 2DTEA 3Q6IA 2OBNA 2VHZA 4MP6A 5DNAA 5TGDA 2GUGA 5HM8A 3X2EA 1NQAO 1VPDA 1HDXA 3GNSA 5HBRA 1DC3A 1P0CA 5EQDA 3U3XA 3WB9A 3WG9A 2JFGA 1KC1A 1PIWA 1KEVA 5U4QA 3ZDFA 3JD1A 3H7AA 3KYBA 3GQVA 1ADCA 3CE6A 4CQLB 2D1YA 3W1VA 1F0YA 3R3JA 1WLYA 2O4UX 1ZMTA 1GU7A 3BTUA 1P33A 5K0ZA 5CDUA 3V1YA 3WDSA 2A9FA 3AY7A 3H5RA 1B16A 1QP8A 5I7EA 2XAAA 2YW9A 2RBEA 3W8FA 4S3MA 3PDJA 5T8KC 1MGOA 2O3QA 3L6DA 4E5KA 4YR9A 4PLPA 3R1IA 3V2UA 3BXXA 1SBYA 4J1TA 1N1GA 4YEDA 5KKAA 2VHWA 1KVTA 3BMOA 1Y7TA 4ZA2A 1XIVA 1EMDA 3NYWA 1JKIA 5B1YA 1EZ4A 4XIYA 3UF0A 4EI2A 2HCTA 1I8TA 4QO7A 4DMLA 2WM3A 1G0OA 3GVXA 3W6UA 1LRKA 3FSRA 3GUYA 1UAGA 3JQ8A 1X14A 3H3FA 3WYEA 1QYVA 1ZO8A 2JAPA 3HB5X 5EPOA 3QE3A 4QSMA 1ZIDA 5FI3A 2G0TA 1E7YA 4GPD1 4WK6A 1YL5A 2WWRA 3E9MA 4ZRNA 2NQ8A 1ZK0A 2ZATA 5CEJA 2BHLA 3KEOA 1RM5A 2VCYA 4LW8A 4II2A 2XXBA 4WEOA 1PZEA 4I5GA 3PLRA 2YV3A 3I4CA 3HG7A 3HJAA 4LK3A 3DMTC 5I9LA 3AU9A 2IZ0A 4L74A 4ONEA 1E7RA 5CHEA 2D3TA 1O95A 2PLAA 3AU8A 3FR8A 1V0JA 4QUKA 4H16A 5JW6A 5JFOA 5IN5A 4PG8A 2Q2VA 4M8SA 4PVCA 2AMFA 2X5OA 2B4RO 3DBVO 4WASA 2YFHA 4X54A 1GY8A 1E1NA 1LC0A 1BXZA 3Q2IA 4YT8A 1VC2A 2VYNA 1O89A 2BF7A 1U5AA 2OGUA 3FCOA 4E5NA 4CMBA 4AJ4A 3FBTA 4J9VA 5TT1A 3EZYA 3WNVA 1BW9A 3TZ6A 1V3UA 1WDLA 1T2EA 2G76A 1DRVA 1NFRA 4Y9DA 1ISMA 1DIHA 2NUAA 2IRWA 3NEPX 1QMGA 4GX5A 4GMFA 1Q7BA 5G4KB 1ONOA 2NVUB 4MDHA 3FI9A 2OP0A 3OIGA 4GX2A 3H3JA 3IUPA 1EUZA 1QKIA 3WBBA 4XRRA 5KVCA 3QA9A 4K6FA 4DRYA 2NNLD 1LRJA 3GH3A 4TKLA 3VPHA 3GGGA 3PHHA 1E3WB 3W8DA 2IZ1A 3HFGA 1GCOA 1MB4A 4WCFC 2VUUA 4NK5A 1SC6A 5JDIC 4DBVO 2W4QA 2PK3A 4RVGA 5A02A 1RKXA 1EEHA 3VH2A 3RAJA 3CMCO 1U3VA 1E1MA 1X7GA 2B83A 1WPQA 3KM0A 3B20A 3QVWA 2WTBA 2CVOA 2J8ZA 3G3EA 1R0KA 1LDEA 4E5PA 2QRKA 3WTBA 1GZ6A 1M2WA 2VQ3A 5IZ4A 1EQ2A 5BNFA 5JMWA 2VT2A 1T2DA 1A7AA 4AJPA 2FR0A 5EJ2A 3RKUA 5B12A 5JC8A 1DSSG 2OORA 1FF9A 2EG9A 1WDKA 3MWEB 2OO5A 4K9DA 4RCVA 2O48X 4BHTA 2HRBA 4RV9A 2G1UA 4WPGA 1E1KA 4E21A 3CH6A 1RJWA 1ADFA 1CWUA 3RC9A 4BOYA 1XSEA 3IQDB 4LN1A 4AJ1A 4WECA 3ROMA 1KEPA 3BMCB 4PLVA 4RGBA 4F6CA 2Z95A 3OQ1A 1YQXA 3ZHXA 4CMEC 4QX6A 4NZ9A 2C2YA 3H9QA 3ADPA 1X15A 3Q1LA 4UEOA 5H81A 3HSKA 1PTJA 1EQUA 1ZZEA 1B15A 4CLOB 2HJRA 5TF4A 5B37A 1V8BA 1LDGA 1DB3A 4WCDA 2PH3A 1N5DA 1E6WA 2A35A 2DM6A 2ZQYA 3O4RA 3VZRA 1LSOA 4YAGA 2OMEA 3LVFO 2RHRA 1VL6A 1ZFNA 2DTXA 2HRZA 4WUVA 4DGSA 3DOOA 1K6IA 5TT0A 2B69A 1OBFO 5COAA 2JD0A 1GD1O 1QR6A 4WJZA 3K9QO 5COQA 4IJKA 1E3LA 2VUSA 1HLPA 6LDHA 3UW3A 3MJTA 2FOIA 4DVJA 1GR0A 3DBLA 1EFKA 2AXQA 2O3UA 1TA4A 3G79A 1HXHA 2HJSA 3LQFA 1Q7CA 2D2IA 1VSUA 2C5AA 3H9EO 4NPCA 5G0VA 3RFXA 9LDBA 2HO5A 1GUZA 1BXKA 1I3MA 4G81A 3WJAA 4BKQA 3I9KA 5IDQA 1NAHA 3Q9NA 4XDYA 1O6ZA 3AK4A 2WSBA 4DIOA 4ND2A 3AOGA 1U2DA 4RVHA 3JQBA 3T4EA 3LF1A 1MP0A 1JA9A 1V3TA 3TNLA 3U0BA 4MJLA 3ITDA 5EINA 3KRTA 3U9LA 3KYCA 4J7XA 1NTOA 5AVOA 4B4UA 4ZGWA 3E5RA 3DR3A 5JAMA 2P9CA 2YJZA 1S7CA 1K5HA 4IDBA 4E2ZA 4YB8A 1MXFA 1MC5A 2FPGA 3DAPA 4L76A 2B5WA 4PZCA 3UICA 4TKMA 4O5OA 3DXFA 2IDZA 2GPTA 1VE9A 3QVOA 2A4KA 2C54A 4FFOA 1ZSYA 3GR6A 2PNFA 2VNSA 3SJUA 3PRJA 1EVJA 5JAZA 4RLHA 2IZZA 3JQEA 1YJQA 3BZUA 3IUSA 2B35A 5T57A 2ZB3A 2PZMA 4A27A 1VJTA 2D5AA 4OM8A 4BVAA 1JDJA 3F5SA 1D1TA 2Q2WA 3FTPA 3W8EA 1KBZA 3ENNA 4GSLA 1D8AA 1JVSA 1NWCA 3WFJA 1BTOA 4DLLA 2BD0A 2I67A 2CDCA 1VSVA 1ZK4A 1FDVA 2PKRA 2VTDA 4E30A 2OHXA 4JNKA 3MZ0A 1MA0A 3KSZO 4M86A 4A26A 2HMVA 4JK3A 4BNUA 4BV8A 1U2GA 1YS4A 1L7DA 4TRNA 3UCXA 4BNXA 1BWSA 1DRWA 3FD8A 3SEFA 3BIOA 2VRCA 5LDGA 3F6YA 1I5RA 1DIBA 2QZZA 3PHGA 4C7JA 1PS8A 5A06A 1XWFA 4CLRA 1I33A 3UOGA 1ENZA 3QV1A 2NU6A 3NGLA 2DPGA 3PGXA 4CV0A 4CMGA 5CDGA 2XOXA 2NV6A 4YJGA 4YQZA 3EZLA 4HNHA 4NBRA 2NU8A 2XPCA 1PJQA 5JXWA 4PZEA 5G0WA 3EAGA 4OH1A 5ILOA 3V2GA 1BRMA 1T24A 3QHAA 1NVTA 5L4NA 1PGNA 3RU7A 4TRJA 4DQVA 2IYOA 2BFMA 3C7CB 3D0OA 1D4FA 1P0FA 1UR5A 3RUDA 3INGA 3ITKA 3PQEA 5BNIA 4BO8A 2PGLA 3CZRA 2VOJA 3JYOA 3V1UA 5AXBA 2Y1GA 4BUCA 1A7KA 4EZBA 1EBUA 4KWHA 4J0FA 4CJXA 4DLBA 5GY7A 5KCZA 1HDCA 1ARZA 2X5KO 1YVEI 1Y8RA 5BSFA 1CDOA 3EUWA 5H82A 5ICMA 4NJMA 4CR8A 2VRCD 4LMRA 4URFA 3GZNA 3NT4A 1U1IA 1Z6ZA 3HDYA 2GNAA 3QVSA 4P38A 3WICA 1GZ3A 1N9GB 1UXKA 3RUCA 1PQPA 4KP7A 4FS3A 3OF2A 2GDZA 2IODA 4JLWA 1YBMA 4XCVA 4BGUA 2JD1A 1MXHA 4OSPA 1Q0LA 4E2XA 2POQX 5TQVA 2CNBA 3D3WB 5JY1A 2PV7A 3KYDA 1DPGA 3P5SA 4W9NC 1LU9A 2X8LA 1SMKA 3GT0A 4S1VA 4CPDA 3RC7A 3K2EA 1JAXA 1HRDA 1NR7A 1CERA 4B7XA 1H6AA 4UUMA 1YL6A 5DULA 2WD8A 2JL1A 1LX6A 1N7GA 2A94A 1PSDA 1Z7BA 5T64A 1C1DA 1DO8A 2Q2QA 3KTDA 4LVUA 3EHEA 5JLAA 3OIDA 4HFJA 1Z7EA 1R4MA 1LSJA 5ENVA 1VJ0A 1OC2A 4BGVA 1HF3A 2GZ1A 3KUXA 1BXGA 4WGGA 3UUWA 3WQQA 1JVBA 3A14A 3COSA 4B7CA 2PKQO 2ZTLA 3U09A 2EKPA 1HSZA 3ZWPA 4JBIA 1HE3A 2HK7A 1GYPA 1MFPA 4FFMA 2DVMA 1DIAA 1JU9A 1CJCA 4HXYA 4PLFA 4IUYA 4DQUA 1H6BA 2ZYDA 4Y98A 4FOSA 4W4TA 2P4HX 1GEEA 5GZ1A 3IC5A 1BDBA 2AA3A 2BELA 2C07A 2HMSA 2V6GA 4IJWA 4N7RA 3ZWYA 2EF1A 3EMKA 1O9BA 4NR0A 4QECA 4J3FA 1DC5A 4RZHA 3CIFA 1RM0A 1DHTA 1PS9A 4E33A 1E92A 1X1EA 1R15A 2YZ7A 2ZQZA 1K2WA 3GFGA 4IIVA 3ZI0A 5K6AC 1GYQA 1XDWA 3VPFA 1DLIA 4IQ0A 2EJVA 1OI7A 2OP1A 1X0VA 4U5QA 4R54A 4KQWA 4FGSA 1PJ4A 1IHXA 4IZIA 1PQWA 3CSDA 5I7VA 1PU2A 2LDXA 4WLNA 4AICA 4J1SA 3DZHA 2ZJ1A 1Z73A 3GVPA 4CL8A 1CYDA 4WKGA 2R00A 1EVIA 1HYGA 3PHJA 4D3FA 4YACA 3MJ4A 2CMDA 3ICPA 2DT5A 1ZK2A 5B4TA 3FR7A 4XGKA 4I9HA 3DBRB 3ZCXA 3WQRA 1A9ZA 4QTZA 5CPBA 1H6DA 1O0SA 3QIVA 5JO0A 3PP8A 4INAA 1D1SA 1PGOA 2VT3A 3K92A 4KDEA 1PR9A 3NKLA 4Q39A 4R01A 1ORRA 3HE3A 4MP8A 4BMNA 3GEDA 2HK9A 2J5QA 3JQGA 4GL4A 1HLDA 1E3EA 4BNJA 1I32A 4C4OA 1UDCA 4CV3A 1IY8A 2X0RA 3LC2O 3U4IA 4EUFA 4N18A 3WOHA 3SC4A 3ONDA 4AJHA 4LCJA 4D79A 2H5LA 2P68A 1QYWA 3PGJA 2AG5A 1QV6A 2CF6A 4A73A 2OZPA 5F5LA 4BGIA 3MJEA 3D64A 2J3HA 3RVDA 1AXGA 1YGYA 2BH9A 3E8XA 3CZMA 4U6SA 3B1KA 3ULKA 3FBGA 3ZH2A 3AOEC 3VTZA 1HEUA 4NFHA 4GWGA 3RUFA 5I9NA 3PJGA 4AJNA 1PL7A 3JQ7B 1YO6A 4WCFB 1N7HA 1CQJA 4XX0A 3B1JA 3ETEA 1TI7A 3INTA 3ZWCA 7MDHA 4LRSB 2VZ8A 4EW6A 1PWZA 1P1IA 4RPJA 1ONPA 4FIZA 1T25A 2VZ0A 4XRGA 1P44A 1C3VA 2Q45A 1DRUA 4EEZA 4DMMA 4NI5A 4J43A 4BNMA 1UP4A 3HWRA 4R41A 1YQDA 3LT4A 4YJFB 1HE4A 3U62A 5FWNA 2GRAA 5MDHA 5DN9A 4L73A 1LLDA 2YUTA 1VKNA 3Q11A 1OAAA 5CFZA 3G1UA 4LGVA 1HZJA 5CEEA 1J5PA 2JD2A 2VRBA 1ENPA 2VYVD 3FRJA 4YAJA 4D43A 1RYEA 2ZJ0A 4J1QA 1BDMA 3CMMA 4CM4B 3ROKA 4BNTA 2LDBA 3E9NA 2I65A 1YB4A 4M89A 4MVJE 3CPSA 3NTRA 4JGBA 4XWYA 4FPXA 2EERA 2PD3A 4RPLA 8LDHA 2YHIB 3JTMA 5LC1A 4PG7A 5F1OA 4B3IA 5A05A 4O59O 3GEMA 3UVEA 2B0JA 1XR3A 4UVEA 3QWAA 4PG6A 3WMXA 1NVMB 4BL5A 2H1SA 2HKIA 5EERA 5A5FA 5A1TA 3JYQA 3LT2A 1MFZA 2Y1FA 3MOGA 2C59A 3IJRA 3KEQA 1JN0A 3VOSA 5IXSA 1FMCA 1H9BA 1YH3A 3LYLA 4I08A 4XR9A 3L4SO 2AW5A 3JD0A 3SVTA 4J16A 3NTOA 4E2YA 2D59A 4E4YA 2O2SA 3OJFA 4PG4A 3ZU4A 1Y9AA 3PVZA 1VJ1A 2P91A 2PD4A 1VL8A 1KIFA 3ICCA 1ZEJA 3MCVA 3VAZA 3C85A 1JQBA 4CQLA 1H2HA 4FW8A 4ND5A 3NDJA 5A4DA 5K9ZA 4D44A 3H9JA 1WVGA 4W7HA 2X4GA 1YKFA 4D3SA 3IL2A 1NHGA 4IMRA 3ORFA 3WYCA 4CMJA 4I1IA 4M55A 3PWZA 5AXCA 3TWOA 2Y1DA 4J2HA 5BNTA 4R4JA 3A06A 2C5EA 1M66A 4J0EA 2C29D 4NJOA 4ALNA 1DAPA 4B3HA 2YDYA 5L4SA 2GZ2A 3M2PA 3AWDA 3V5NA 1AHIA 1ENOA 2QRJA 3I3OA 3RFVA 2P9GA 1P9LA 1W0CA 1LQTA 3EC7A 4NG5A 1HT0A 2CD9A 4U8GA 3PYMA 2A92A 2HMTA 3NUGA 3MOIA 4AJEA 4BNFA 3UXYA 3EVTA 3AFNA 3GDFA 4DWVA 1GAEO 5DDIP 1V35A 4K1LA 1HE2A 1PX0A 3DOJA 4O6VA 3SBOA 4GAEA 4BNYA 4WEQA 4IDAA 3ZNPA 3RJ9A 4BO4A 3L4BC 2IEDA 4DBZA 1LC3A 1R16A 3I52A 3MWDB 5AXAA 3LK7A 3BMQA 3GRPA 1EBFA 3ZGYA 4BNHA 3WBFA 5DCUA 3A9WA 4CM8B 1UJMA 4MOWA 2NQTA 3WFIA 1EFLA 1JKFA 1DOHA 4GGOA 1Y1PA 3JQ9A 3ABIA 2BKAA 3BMNB 1IZ9A 2AQHA 4UAGA 1GUFA 3W6ZA 4IDCA 2OL4A 2ZYGA 4K6CA 1KVRA 1FDSA 1XU9A 1H5QA 2NVWA 4WNCA 1G6KA 3ANMA 5KJ1A 3K96A 1ADGA 1WMBA 1IL0A 4B7UA 4IXTA 4CLEA 3OJ0A 2G5CA 3GG9A 3ZV5A 3NT5A 4MKZA 3OBBA 5FYDA 3TZHA 5A9RA 1W73A 1NPTO 4IDFA 2DU8A 1SO8A 4CMKA 3I6QA 4XIJA 1N8KA 3BMOB 3TL3A 1PJTA 2C7GA 1MC4A 1UP7A 2CZCA 5G4KA 4UULA 2EW2A 2DLDA 4P8RA 4ZD6A 2ZTMA 2GCGA 3B6ZA 2NVUA 3PWSA 4OQZA 3JQ8B 3ZHYA 5U1PA 2B4QA 3H4VA 1IPFA 4E6PA 3DMYA 2AG8A 3JD3A 3RU9A 5A9SB 4NBUA 2YQ5A 4JIGA 1Z45A 1H0KA 4MIOA 1D7OA 2HK8A 4NDNE 2NU9A 3MTGA 3FWZA 5I9MA 1WXDA 1E3WA 2W2LA 4W6ZA 2FWMX 1NAIA 1HYEA 3D7LA 1VLLA 2I6TA 1GYRA 4OAQA 2RH4A 3AI2A 4KOAA 2RAFA 5TRTA 4OJNA 3D4NA 1WWKA 4DPMA 4FDAA 1ZH8A 3ZWXA 3OQ6A 4GI2A 2O3SA 3LC7O 4ZQEA 1R0LA 5DBFA 4FD3A 3UHAA 5FF9A 2Z1MA 4Q9NA 4TVBA 3GHYA 1RYDA 1VL0A 5BSEA 4AJOA 5AOVA 1ZBQA 3GGPA 2B4TO 3F1LA 4RDIA 3TOXA 3WIEA 1G0NA 4YRAA 3A4VA 2Y1EA 3L77A 4JN6B 2BFOA 2FZWA 3DZGA 3HN2A 3KOUA 5H83A 1CIVA 1JKJA 3FTNA 5KNLA 1F8FA 1GPDG 2VYND 2OBYA 4I9UA 3KV3O 4XQCA 3RFTA 1KC3A 1E5QA 1GUYA 1P31A 2HDHA 3OA0A 3F47A 1RPNA 4JX8A 1LDBA 2FP4A 5G0SA 5A5EA 3D1LA 1YOVB 3CXRA 3C1AA 3HN7A 4UVDA 2E37A 4NH4A 3BMCA 3RCBA 2HQ1A 4EBFA 2O3RA 2G82A 5IAAA 4FJ1A 1UXJA 1BVUA 1NFFA 1P1RA 1MG5A 1KEUA 2R2GA 4W7IA 3V2HA 3TF5A 2PH5A 4IGFA 4FN4A 2AQ8A 2EXXA 2QIOA 5L53A 3QP9A 4XJSA 3S1LA 4D45A 5ES3A 3TPCA 5A3JA 2VWPA 2WMDA 2V7PA 2EJWA 4RF4A 1BMDA 4L9RA 4XQGA 1AGNA 4R51A 1NBOA 1QSGA 3KBOA 5DT9A 4R16A 1DFGA 4EUEA 3GFBA 3H2ZA 4G5HA 4U0JA 1UZNA 1R4NA 3S2GA 4YYZA 3VZQA 3JQ6A 5G4LA 3ANNA 3HDHA 4E13A 5IDYA 3KSDO 1E0DA 2Y0DA 1M67A 4CMIB 4ZU3A 2JHFA 3RI3A 3WJ7A 2YQ4A 4OKIA 4BO3A 1ZKMA 2UVDA 1JLLA 2GYYA 5IN4A 3GF4A 4K28A 3T7CA 1AN9A 2P2SA 1U7TA 3HDQA 4A5OA 1NR1A 4PRLA 5JDCC 4BMVA 2GGSA 3WQSB 5JNLA 2GLXA 3K31A 1CF2O 3LLVA 2X9VA 2GF2A 4A10A 1H93A 3L6EA 1E3IA 1I36A 4IPTA 1DFIA 3N58A 3AM3A 2Y0EA 3PTZA 4DQXA 5THQA 1Q2XA 3ONEA 5JO9A 4NBVA 4WE3A 2DFVA 4A2CA 3W4JA 1DC6A 4CL3A 1DBVO 4MKXA 3PYXA 3H9GA 1BGVA 2NTVA 4FFPA 3VVCA 2B37A 2JFHA 2X9GA 4MVJI 3IP3A 3PPIA 5T67A 2D0IA 3PFFA 1J49A 3S2FA 1MG0A 4IZHA 4E3ZA 3CUKA 3WIDA 3JV7A 4CMCA 4FGWA 3UAGA 5KJCA 1U8XX 3GK3A 4BO2A 4L4XA 1F06A 1SPXA 1U3TA 1YBAA 4PLYA 3ZW9A 1SAYA 4IXWA 4MVJH 3JQFA 1TT5B 4ZRMA 3AY3A 3JYLA 1XA0A 1YB1A 1LLQA 3VZPA 2TMGA 1NP3A 1OMOA 2VUTA 2PA3A 3O9ZA 9LDTA 3RIHA 5DF1A 1ZK1A 3UN1A 4CV2A 2CFCA 3RASA 3GDGA 3EYWA 1AXEA 3NDIA 2Q49A 3E18A 1XEAA 4RQTA 3AM5A 4E5YA 5MGBA 4AJ2A 5IDWA 2UAGA 5C7OO 3I9OA 4LSMA 3OETA 2W98A 4WOKA 3LT1A 3H5AA 3E03A 2VHYA 2Q3EA 2CSUA 1R37A 4PFJA 1T1SA 1AHHA 4NMHA 5G0UA 1PR3A 1XCBA 4TZKA 3DBLB 1K0UA 1Z82A 2ZTUA 2Q1UA 4J4HA 1U4OA 1ULSA 1V3VA 1EK5A 4ALMA 3DBHB 4EITA 1WP4A 1N92A 1GTMA 5TC4A 3FNFA 1DEHA 2X0JA 4FFNA 3WS7A 1I0ZA 3IS3A 1ENYA 2BGLA 2NACA 3STHA 3DL2A 2Y05A 4N54A 2UUOA 1LSSA 4P4LA 1QXSA 4KMSA 4EYEA 5CPFA 3HADA 3I9JA 2DFDA 2VZ9A 3ST7A 4HNGA 3IJPA 3ZWVA 1U8FO 1TEHA 4GBJA 5KTKA 1U7HA 4DYVA 3ROPA 3ZHBA 4D41A 2DTDA 2HUNA 4IS2A 4HX5A 2I76A 5HS6A 4XA8A 3RBXA 4XGIA 1PL8A 2GO1A 1E6UA 2Q1WA 5CAEA 1T4BA 2DC1A 4B8ZA 4EEXA 5KVSA 2I5PO 4KDFA 1P1KA 4K26A 2J3KA 3R3SA 4YT5A 5IF3A 4IBOA 3L9WA 3EY4A 4BO6A 4YJDA 3E6AA 4ZQBA 3VTFA 1B3RA 4XYLA 3RUEA 5IZCC 2O23A 2EV9A 1I01A 1ZEMA 5EL0A 3DHEA 4U7WA 1AE1A 1LTHR 4P4GA 2YV1A 4KTTE 4Y8VA 1I2CA 3VH4A 4YXFA 4Z3DA 4BQPA 1I24A 4CM6A 1KY5A 4MPDA 1TVEA 4ND4A 2UYYA 1F14A 1E7MA 3IDSA 4MKRA 1MLDA 3S2EA 2Y1OA 4R5HA 4ALIA 4G65A 2O4CA 5CDSA 2RH8A 2NTJA 4WLUA 4Y67A 1N9GA 3RC1A 3ZU5A 4DUPA 3HDJA 4WLVA 1L7EA 1IB6A 1NM5A 1WNTA 4L4SA 1U4SA 4BKRA 1YL7A 2RIRA 3RSHA 5IG2A 1EE9A 3PHIA 4Q3DA 4BQRA 5L95A 3PIDA 4GSKA 3F3SA 5JCJA 2ZK7A 2Q4EA 2PY6A 3DOCA 3D3WA 3DTTA 3ZWBA 1I3KA 3OEYA 1X0XA 1GQYA 5EIOA 1P77A 3PZBA 1IYZA 1IOLA 5JSFA 3CEAA 1C0KA 3DZFA 3JSAA 4A03A 3GNTA 4GGPA 3ZZNA 5TJ9A 1BVRA 2GSDA 3WGTA 5JYEA 4PRKA 4Z0TA 4LSWA 3ZU3A 3QSGA 3GN1A 4JBGA 2QYSA 4CM3A 3DZBA 1J6UA 3RQSA 1J4AA 1MUUA 4PLTA 3RBZA 4GVLA 1XG5A 1Y9EA 2BI8A 5T8KA 4B79A 5TX7A 4J90A 3ZU2A 1QYXA 2GN9A 3L4BA 5L40A 1C0IA 1KERA 4XYEA 3KB6A 5HA5A 4OKNA 4YDRA 5T6BA 5KWEA 1U28A 2RHCA 1ZVMA 1WW8A 4XZ3A 4OOEA 1LEHA 1LBEA 4XDZA 4BKUA 3N74A 3ENKA 4MINA 2JFFA 2QW8A 3KO8A 4GX1A 5JCJD 4CR7A 1DJNA 4J2OA 5THKA 1UP6A 1PGPA 4ALLA 1Y81A 4TROA 3JYPA 4OXYA 3H9UA 4NJMB 4ID9A 4IQ8A 4OQYA 4PLGA 1HETA 2FZEA 2ZB4A 1H2BA 2C0CA 5GZ3A 1W4ZA 3I9LA 4NFYA 1YB5A 5F21A 3OFSA 5L3ZA 4A0SA 4YJHA 4F6LA 1LLUA 2VNAA 3ON5A 4RF5A 3DMTA 3BTVA 2ZTVA 4NNJA 1K6XA 3OJLA 2DPHA 3JQAA 1OC4A 4WLFA 3KYDB 3KXDA 5IDXA 2BRUA 2QQ5A 1UDAA 2Q50A 5LCXA 1Q0QA 2CVZA 2OXIA 4D7AA 3VH1A 1Q0HA 1HKUA 2JJYA 4HADA 4I5EA 3DDNA 4F46A 1M6WA 4EJ6A 2GR9A 1F17A 2EKQA 3NDRA 1C1DB 3ZNOA 1PWXA 5FEUA 1LXCA 2AEFA 2H9IA 4NBTA 3P2YA 3DBRA 4GKBA 4DL9A 5JCXA 2O3TA 1TXGA 5AXDA 4B3JA 2E6UX 2X23A 2VWQA 2VN8A 1O8CA 4UEJA 3LU1A 3U4CA 1I2ZA 3IMFA 4AFNA 3H5NA 4MP3A 4AVYA 3TDKA 1E7WA 4ILKA 4HUJA 2EGHA 2CVQA 3W4IA 1PJBA 4QFCA 1BG6A 3Q3CA 4XQ9A 4AJLA 2FY8A 1DAOA 4RF3A 5KIAA 3JQAD 4ZJUA 3BHIA 4M1QA 3AFMA 1AUPA 4YAIA 2Z1NA 1QLHA 4XQEA 4Z0PA 5G0TA 2WDZA 1UXHA 1I10A 4TRMA 5DP1A 5BR7A 4BNKA 2I66A 4WCFA 1XQ1A 1N2SA 3E48A 4D42A 4Y6SA 3WGYA 1Y6JA 3OH8A 4FCCA 5JDIA 2WD7B 2ZKLA 5TIIA 2X86A 3EVNA 2D8AA 3GGOA 4E5MA 5FFFA 4JJIA 1VM6A 1P1HA 1B26A 4TSKA 3VPGA 4Z9YA 3LT0A 2PGJA 3WXBA 5TSDA 4N5MA 4YJFA 4TWRA 2ZB8A 4LMPA 1Z74A 2HLPA 1A5ZA 2QG4A 1CQIA 2PKQP 2PTGA 1C0PA 2J3IA 4BO5A 2W2KA 1EE2A 1IZ0A 1UH5A 2O7QA 3O8QB 4IINA 2DUWA 3VPXA 4CM4A 3HUDA 5JE8A 1F12A 3TN7A 4CQMB 4F45A 4HBGA 3JQBC 5HTOA 5COBA 1IHYA 3WR5A 2YHIA 2Z5LA 4IJUA
chains in the Genus database with same CATH superfamily
3KUCA 5C8YB 2FTKE 4Y30A 1LK0A 4HAXA 4P2GA 4FTWA 4RY0A 1E2GA 1DIRA 4RKWA 3U6KA 2R6GA 4QPJC 3HCAA 5C3UA 4H15A 5I8WA 2Z4SA 1LNSA 1XF1A 3OOJA 3QLJA 1DMRA 1L5OA 3FOCA 4KQCA 1JLRA 4G25A 1GTJ1 2G0AA 1P7PA 1KS2A 2C7VA 3BWYA 4K6KA 4OHKA 1KVSA 3RKRA 3HBFA 2ZSUA 4YI5A 3UJ3X 1N2GA 1UODA 3THXB 3R9XB 3K71B 4I4TA 3H2IA 4TTAA 3S0JA 4YRKA 1G3RA 2AMLA 4YAOA 2E21A 2F59A 4C89A 3FGPA 2ECFA 3P4UA 1Z22A 2X19A 3PC7A 4NZNA 3WI7A 4BS9A 2OQRA 4ZAGA 4D9FA 3HU1A 3OTWA 4GP9A 5E0KB 4LRWA 3S44A 2NMVA 5U4XA 3OOWA 4DLKA 5AOCA 2B1GA 2O8DB 3CXUA 4V0QA 4M49A 3RDPA 4WJLA 1YMQA 2F00A 4G4GA 1DBPA 3G7UA 4XIFA 4DUGD 3LLMA 4GR9A 1Y1KE 3SAJA 1KIMA 4PC7A 3LP6A 2CJPA 4LX8A 2CUTA 2DECA 5KYXB 3A6GA 1K6MA 1KYQA 5AJUA 3ZWMA 1AK2A 1ZRSA 2JGDA 2YJNA 4I9NA 5LDHA 2RFLA 3LHDA 5AUOB 5CNMA 4JXKA 4J91A 4OHFA 1U2GC 3HACA 5BT9A 4LF7B 4TVOA 1KBQA 4NX2A 1LDNA 2Q6TA 2YWGA 2H63A 1NU8A 3ZUPA 1MA3A 1E8MA 1K7FB 2YMLA 1AQIA 2IKQA 2C8KA 2ZXFA 3R8XA 2JCVA 3FZGA 1PQUA 1Y8QB 1O6CA 5I5EA 2X1VA 2WZQA 4Z4QA 2JEZA 2WOJA 3MINB 4W5WA 2I22A 3ZWDA 4U5XA 2PZGA 2VQEB 1WA5A 3OM1A 2QZSA 1A8PA 1ISFA 2MSEB 1M5UA 2VOEA 1DUSA 3PEFA 3GBSA 1QPBA 2F64A 1W0KA 1ZIPA 3C15C 5KOHB 2R8ZA 3Q4GA 4BE7B 4GR4A 1ZNQO 4BQFA 4GW3A 1N2ZA 4DUZB 2XXAA 1UWVA 1VCMA 4O4LA 4AN1A 2WJVA 1J1IA 3AUFA 1GQ2A 2IC5A 2PGDA 4BNIA 3R9WA 5DK4A 1HZZA 2ACVA 3MWDA 3PC8A 1T9ZA 2HBYA 2QL5A 4CL0A 4EW2A 4AY2A 4CFSA 7AT1A 2EDAA 2QM8A 3FA2A 3G7NA 1CCWA 1V1MB 4MUBA 3LIPA 4AWBA 4H4CA 4J1NA 4ANFA 2GCOA 1PDWA 1UXOA 2ET6A 2QN9A 4LYYA 2E5LB 3PENA 3VJKA 4MW2A 5A4IS 3DLCA 3EODA 5TMEA 3ZGVA 2D8MA 5A3QA 4KN6A 2EX1A 2Y1LA 4BLPA 1SB8A 4W99A 2J0UB 2ZSEA 4F4UA 4P3YA 1E4EB 1NUHA 3DJYA 4HB0A 1E1DA 1RHKA 3ZWNA 2WAOA 4M4SA 4PTZA 3JZAA 1VL2A 3N2ZB 2ZRJA 5L7YA 2F1KA 3DAGA 3DZCA 2Z9CA 3OJWA 4MICA 4KVGA 1AF7A 1G2QA 3ZQJA 2OXEA 2IEBA 3MEQA 3NXKA 4QAQA 3SBDA 3IKVA 4AM8A 1ICEA 4HQ0A 2FR8A 3NC0C 4AY6A 4O02B 4PU0A 1GUAA 3WHKA 3Q1KA 3I9MA 3Q9UA 1W0KD 1VHJA 2GA9A 1OR8A 3DD5A 1U3GA 2IIPA 4CR6A 1AS2A 2ZG6A 4RJTA 4LXXA 1ZM2A 1V5FA 5F51A 3MJDA 3MS4A 4CIAA 2YV2A 2WVHA 5H68A 5GWXA 1YHNA 2G9ZA 1UBOS 2PT5A 5BV8A 5C2JB 1LBIA 2VHUA 4B5LA 1N5OX 4DV1B 1USGA 2DERA 2BZGA 3QF4A 5B53A 3D8BA 3TW8A 3PC6A 2WJZB 3UUGA 2NP7A 2CGEA 1NURA 2YJ3A 1T8PA 3EGOA 4MR9A 2XYHA 3CX8A 1GVHA 1L5VA 3BUSA 3BH0A 3RU2A 2IH4A 3I6ZA 1SY7A 4UVGA 4NAVA 5LFAA 2HU2A 2Q4TA 2PFKA 4HDNB 1F2UB 2Q28A 4PXYA 4ZAYA 3BD7A 1B7GO 4UNPA 4WY8A 5IZCA 1G18A 2PQ0A 5DCYA 5EE5B 2GXQA 2C82A 2VWHA 4Q6BA 1SRQA 5FTNA 1WMSA 2WAMA 3ZW7A 4M1EA 5A9TA 2P79A 2I4LA 4G3XA 3MMZA 1TM4E 2X0IA 3OT5A 1L8OA 4MIKA 3ZY4A 4DT1B 4DSTA 2F4NA 4QVKA 2NO0A 3QY9A 4I6GA 1CULC 1SEPA 3V48A 3QUSA 3NNSA 5F2KA 3N0VA 4DV3B 4MB2A 2PDAA 1H42A 4MDFA 4DXHA 2VSXA 4OB7A 1D2EA 2VP4A 2BHTA 2PT6A 2IF0A 1E6LA 2HH9A 1T4CA 3ZW8A 3V55A 3EH2A 1M1UA 4MPRA 4OQPA 4Q7LA 3WGZA 1AZWA 5IUNC 1O96A 4HNAA 2UUAB 4HGOA 4GPAA 4NOJA 2PT7A 1AGPA 1JDUA 2QRNA 1ZLXA 4LQLA 3WYBA 3H86A 1J56A 5HJ2A 2HDOA 4S2UA 4U6QA 1S8OA 3IDQA 3DV2A 1U2QA 4ZDKA 5IRCD 1SD5A 1GQOA 2OR3A 3GA5A 3WGIA 2Q62A 5CJ2A 1O58A 3EZ6A 2GN8A 3HB7A 5TARA 1GUDA 4OA8A 1YZTA 2I4OA 3G88A 1IE3A 4BQOA 4DLRA 2DFPA 3EDOA 3LZ6A 4NFSA 3TEFA 4BKMA 4EMTA 2EZTA 4B75A 1P45A 1I6KA 2VP0A 3P27A 4BO1A 1CUGA 4H60A 3UENA 1P91A 3C3WA 5A4MS 1I2MA 2QRLA 3LFTA 3M49A 4AJJA 5DNCA 1CFZA 3FHLA 4B4VA 1AC5A 1Y9DA 4PZYA 4EW3A 4YV0A 4F84A 1RABA 3IA2A 4JVNA 2BMVA 2QTNA 2PLRA 3V7YA 2J5KA 1T5SA 3GOQA 3WKDA 5HQJA 3KJFA 2R00C 2GBLC 3KJZA 2XQFA 1YR3A 4Q9IA 1EESA 5I3CA 3FPSA 3DFZA 4P33A 1JAIA 2NXEA 4XJTA 3SHTA 2G36A 3L8YA 4CN8A 1KI2A 2DPYA 3LSYA 1UBMS 3MWEA 1VI2A 1P3Y1 3NXSA 4LYHA 3L8MA 4E31A 1Y7IA 3A2MA 2UDPA 4ZV4A 5M2QA 4KHPB 1OWLA 2PUAA 2E4YA 2RGEA 3L84A 1UJ6A 1QRTA 5I8ZA 2Q99A 1E4OA 3E84A 1ZIOA 2EGGA 2W2LD 2WG2A 1GPUA 3CF0A 3NJ4A 4PSKA 5ALTA 3TW4A 2C2WA 2DSTA 2WINI 3CINA 3KVOA 4IOKA 4L15A 4OG2A 2NUAB 4CLHA 5TV2A 4YPOA 5CFOA 3KSUA 3WMRA 4P0TA 3MNFA 1JAYA 4J4BA 3IQZA 2VEOA 1SNYA 4QU8A 4YUWA 1OW3B 1WHTA 4Z7QB 1X38A 3LDAA 4PSVA 1U0GA 4M1MA 5A2QA 3KSAC 5FHRA 5CGZA 5HBGA 3OCUA 4E88A 2PVSA 2QNBA 5EJ9A 5IBCA 3ZLBA 2G17A 3CKMA 4BVJA 3HJNA 4TYQA 4P92A 1PZMA 5IBQA 1SXJE 4HJXA 3OFNA 4RCYA 5TMDA 3WB2A 2GERA 2QVGA 4R5MA 1RPZA 2FVXA 2QL7A 2AYXA 5E6UB 1JFFA 2BKUA 2Z3WA 2I9PA 1I4WA 3DDUA 4RVFA 4RXUA 4LZPA 3RWBA 5JH7F 3TQHA 1CE8B 2V6FA 1E7SA 3B6IA 3PD0A 3GA7A 1YFJA 4FMBB 2IYFA 3O03A 1RD4A 4C7KA 2C2XA 4MV1A 2ACKA 4WSOA 4Y1GA 5FWYB 2CN1A 1Z7YA 2AQIA 3RAEC 4R9RA 1NC3A 3ABZA 1T43A 3BXEA 1ZUNB 1SZJG 1P0IA 2GCEA 3EWAA 5HILA 3JAKA 4I6EA 4MQ5A 2OFFA 2MSLA 3Q7RA 5SY6A 1QX4A 3GU3A 4BRUA 1T26A 3C7AA 1IJBA 4EHIA 5JROA 2FN7A 1KZGB 1O5IA 4S1OA 1G9SA 4QUIA 1ECLA 4OHUA 4Q7QA 2CF5A 2Z4TA 5I4KA 1U7DA 2QHXA 3KX2A 4H7HA 3WTCA 4C4AA 1OH8A 2PSSA 3T1VA 4G0PA 5CP8A 4EYGA 2AHRA 1U2TA 2GN4A 4R9SA 2BAGA 2EHDA 4KAAA 4DR4B 2VWGA 4ARZA 2OSBA 3OFND 3AY0A 2Q6LA 2W6MA 3TRIA 2ODTX 1TYDE 3LCRA 1NC1A 3K32A 5A03A 2VP5A 3CISA 4D57A 1HE5A 2Y66A 1N2CA 3QVKA 4WZBA 4YRFA 2WJPA 5EMKA 3HM2A 3NYIA 1KMMA 4Q7MB 2A7QA 1N2IA 1QE3A 4KPEC 4RZ3A 1OBOA 4M87A 1EP2B 2OECA 4LGYA 4YCCA 5LIPA 2ZBGA 4XR4A 5BOVA 5CFQA 2GN2A 2I3AA 621PA 1IG3A 3VI3B 3ZD6A 2HU8A 2NO4A 1HDYA 2R86A 3TD6A 4ZI7B 2ORYA 4K6HA 4R69A 5DTMA 4Q9KA 1EJ0A 4QT0A 4NE9A 3FPAA 1KI9A 3NYQA 1XDSA 2HV8A 2BPOA 4WKPA 3TTVA 4BZZA 2VAWA 1OLSB 3AUTA 1V2HE 3I4FA 4UHBA 3T7JA 5EWJB 4ZC8A 4MQFB 2WUDA 5JNRA 4EY7A 1YZFA 4EG7A 5JZOA 4ADSG 2NV2B 3A1NA 1UMBB 2D1RA 2QP4A 3HHPA 3ZGNA 2CL7X 1RXVA 4XYGA 5F1YA 4ZT7A 1U31A 3H0CA 1W1IA 2JW5A 3R4VA 3CF4A 4A8JB 1AUQA 3G8AA 3H2JA 3HJHA 4Q48A 4X84A 1QGUB 4C5CA 5AW4A 1XJCA 1L1RA 2PLFA 1BE1A 5EHNA 3T3PB 1V1RA 1G59A 1CUJA 3N9IA 4Q9AA 2VQ6A 5E9JA 2O50A 4JJGA 1NDQA 4G07A 3SVZA 5J58A 3PJFA 4B74A 3DAOA 2XCQA 1WCWA 2XQKA 2E4AA 3CLSD 3P2OA 4IJVA 4HFRA 2AC2A 5GOZA 3SR0A 4JBWA 5JH7A 3KVYA 1D2GA 4JFRA 2JRLA 1YZUA 4OIMA 4CIYA 5KVVA 4X62B 1EFUA 1OU0A 1L5HB 1RYBA 3ANLA 4ZCLA 3P9ZA 3LFUA 3HSSA 4I8XA 4B6EA 4K2HA 5HKKA 3CZQA 3ZNNA 1SCJA 3GFOA 1ZL2A 2Q46A 1MC1A 2LKDA 4QLBA 1ESDA 3QRWA 4F2PA 4JYAB 3CM0A 3TNFA 3ZVMA 1E2HA 4HTFB 5EE0A 4KQEA 1QFJA 2Y1CA 3T06B 1O8BA 1YVUA 4L8YA 1GGHA 3OEHA 4RIIA 4W5QA 5FA8A 3GT7A 4Y0VA 1QLJA 1Q12A 5TMPA 1X7WB 3IDOA 4EKNB 2CSXA 1OIXA 5GM1A 3IEMA 5DGHA 2HA7A 3T4XA 5T5QA 3KYCB 3NAGA 4PN3A 3CNBA 1XMSA 1T5IA 2DPLA 3QEAZ 1NQUA 4MS4A 4KPGA 1XZAA 1IQPA 3DPIA 5ITZB 3DP7A 2AQKA 5LXTB 2FPGB 4ZVKA 2XWPA 1A3CA 1G64A 1RYHA 4JA2A 1D2MA 3L4KA 3CZPA 1KHTA 5F3WB 3MWLA 4UUNA 4DPLA 2QT1A 3Q7TA 3DO8A 1N6NA 5IX8A 4U6NA 4ZAVA 4E5UA 4GYWA 3T9FA 2HWWA 3B12A 3QUQA 1NNUA 3R9IA 3TRKA 2CB0A 2C5BA 3LVQE 4AN4A 4OOFA 1F3LA 2QTLA 3DT6A 4ZI5A 1RM3A 2D5LA 1I1HA 2W6CX 2WP8J 4X41A 5FNVB 3OFVA 4DA9A 1QO9A 3UPTA 4P4NA 3C4VA 1MX3A 4RDHA 1FDUA 4LMAA 5CDTA 2ZZMA 1UEIA 3LNTA 3ZWAA 3HH8A 4L0QA 5HX7A 4TT3D 2ZRIA 4B6QA 1U3CA 3KQOA 2JLCA 4LRYA 3M4ZA 1L4KA 1TKRA 1ODKA 1PEAA 1NRXA 2QRHA 5LQKA 1NX6A 3HKBB 5A6SB 1QDLB 4WLOA 3TSCA 4DREA 2Y4NA 1VLQA 5CG1A 2Q5OA 2IOHA 3B3QA 3BF7A 3ZV4A 2WU0A 3NHJA 4WV3A 3N2EA 3TLEA 1GOTA 4KAXA 1MV8A 5FJIA 4EI8A 2ACEA 3AB3A 3SU8A 5SZIA 5FADA 5CIYA 1M1YB 2J33A 5AD1A 1XZJA 3BHMA 1ZRMA 1FRZA 3FFBA 1KQFA 4CM9A 4HKTA 4Y2YA 1U9JA 2GESA 3CLHA 3K6JA 2B78A 3ASZA 3C97A 3ND8A 4AB1A 2J9FB 4BB9A 1OH7A 3LC1O 1C7FA 3LPLA 1RSZA 2J6IA 2OCDA 4UHKA 1KO4A 4U7TB 3MWGA 4X6LA 1SCDA 1EIWA 3SBXA 1V11A 4Q37A 3PXBA 4BNGA 5DOVA 1T5BA 3SX4A 1NE7A 4M7PA 6LDHA 1ZVVA 3NZEA 1VMKA 3T15A 1BN7A 4IY1A 4GQAA 3ZDDA 4UZEA 5HIIA 3UB2A 2GRUA 2XWQA 3DMPA 1P1JA 3COPA 1NT2A 3PK0A 2VF7A 2G71A 2JFXA 2HEGA 3FNHA 4RS3A 3VTKA 2AI1A 4Q19A 1R6DA 2X8AA 5JEEA 4I5DA 3N7TA 1GTRA 4X1OA 3WLEA 3CUVA 3E22B 4Q9DA 2DOKA 3QKRA 4EDFA 1IN8A 4R3NA 5IJ0B 2BCEA 3U7IA 3V8EA 1YS9A 4BO7A 3CHYA 2NSJA 5GJVC 2RHTA 3C5EA 2ZIFA 3GEGA 3K35A 3KHUA 2LNDA 4WERA 1Y8RB 2O8FB 3G17A 1UZAA 3BX1A 3QPWA 3RSFA 3WV5A 1K8QA 2EAUA 1ZXBA 2OZLB 5K3OA 4WXPA 3WQHA 3OLYA 2I2CA 4HB2A 4UU8A 2H4WA 2JHAA 3J81A 1R66A 1QWOA 4MO2A 4MV4A 5JSYA 2IOQA 1OV6A 1KK1A 1QRAA 2KLBA 3KL2A 4CM9D 2W58A 3RK4A 1N5IA 1WTAA 3FN4A 3GUZA 1W7AA 2XUPA 1YASA 1POWA 1VKZA 1DJQA 4O2AB 5GOTA 3VTAA 4YQFA 1TO6A 4FR5A 4HFMA 4DLAA 4P58A 2QXYA 2FN8A 2ADOA 2IYVA 3IQEA 1IOVA 4DSOA 1Z5ZA 3OIFA 1N2OA 3KLNA 3OMLA 3VBCA 3VX3A 2ZYRA 3RM3A 4Z9XA 1NQTA 4GPBA 4OJYA 1JWBB 4J9UE 4ED9A 5HIAA 5IKXA 4LHEA 4BX0A 2M6KA 2EL9A 1W8IA 4V24A 5GIOE 3FNIA 4RO0A 4CLXA 5LLTA 4MARA 3U61B 1I14A 3C24A 2X5JO 1NRWA 1OPRA 2JZOA 2Q7OE 3WRVA 3LO8A 3HL0A 4I4IA 2JJQA 2ZBFA 1YR8A 4AO8A 3K6KA 3EUAA 3ACDA 3FFTA 3PWTA 1EDZA 1Q20A 1IG0A 1Q7TA 2FPUA 2IYAA 2X7JA 4J0IA 4KACA 4TL7A 3UM9A 1R4MB 3JCZA 4GZ5A 1KQNA 4JUDX 1NQOA 1HH4A 4AY4A 4BO0A 3M4XA 3IBCA 5B5SA 4B35A 1BXGB 1PFKA 1NMQA 2IPXA 3DEYX 4MQEA 4JP8A 2RHLA 1U2SA 2XH8A 4RA6B 4B45A 3PR3A 2PRKA 3FUUA 2P9FA 1XAGA 4P4UA 3T3NA 2HGZA 4XWTA 3M83A 1THZA 1E94E 3NFRA 5C5EA 3GDOA 5IKEA 3TIIA 1L8XA 3CW8X 4MWTA 4XUDA 2GB4A 5KYKA 1SBNE 2PBRA 1LKZA 1TCVA 3IKTA 4TQGA 1H0HA 2I87A 1XQ6A 4ML3A 5HFAA 1FDWA 3DZJA 4NU0A 1XZQA 5AICA 4DYHA 4OH7A 3U7QA 3CO5A 1L5FA 1Z6XA 1A4RA 1I9CA 1LRLA 1ZC3A 2E3JA 2FSSA 4ZVSA 5FORA 1OXBB 3B52X 3CURA 3E58A 4IHKA 4WKNA 2TECE 3RC3A 3O90A 3GRUA 4RVNA 3WLQA 5D5PA 2ZYUX 3VPSA 5JZVA 3VGPA 1DXYA 5CVUA 1HO3A 1WCYA 4QYTA 4KPUB 2OM2A 3OD5A 4IZOA 1UC4B 3CUWA 4UU0A 2FLWA 5EUCA 4IDPA 4CE6A 5CDHA 2JIRA 3GAFA 3LQYA 4UM9D 3WLLA 4LRUA 5HDQA 3AVUA 1XKQA 13PKA 4QGAA 4Q34A 2P30A 4OJKA 3BRWD 4XQ0A 5AQ1A 4NYMQ 3TGPA 3JQCA 3M0EA 1ISGA 1CNFA 2QMYA 1OHHA 1M2HA 1HG1A 5EOVA 3O8DA 4R83A 4UU7A 1NWHA 4BWGA 2P5YA 5AJWA 5TJHA 3ID6C 4H31A 4EBBA 1GPWB 3BBLA 2G9UA 4RY2A 3WWPA 3QVGB 5IMSA 4MVYA 3ZG6A 5C3MA 2EFYA 1Z56C 1KVUA 3UXHA 1DQYA 4L2IB 1C9DB 3T7SA 1E2QA 5AVJA 4BNNA 4B2LA 1M1YE 4EB8A 1S4MA 2O1EA 1N7IA 3IEKA 1RI5A 1C5KA 4G89A 3BS4A 3C0KA 4FSXA 2EQAA 4KH0A 3N2LA 5EN4A 4TKVA 2JGAA 2ZZNA 1KORA 3O91A 1NNI1 3VKUA 5G53C 2O54A 3I5MA 3Q7IA 4MVJP 4Y0AA 2QVZX 2Y99A 1RYFA 5E2IA 2BFFA 3VSEA 3G1TA 1A69A 2OGSA 5ALUA 1OXKB 1VSQA 3GVHA 3RBVA 1SHJA 4ENUA 5KQMA 3QXCA 3WSVA 1FEZA 1G6OA 1MGPA 3QXHA 3KQQA 3QVXA 3FUTA 2WLSA 3M5CA 3O1HB 1DLJA 4KJXA 3CWQA 3VO2A 3RYIB 1HTTA 3QOXA 4KAJA 4PLZA 4PGFA 1ILEA 5AHXA 4C7XA 1WPGA 3JQGB 4LF8B 4D46A 2NT3A 3EZGA 3NC4A 4IL5A 5DTIA 5KPJA 4G0ZA 2O2DA 4UCFA 5FEMA 4L5JA 1EDEA 8ABPA 2JAWA 5DBIA 3TPFA 3UC9A 1G17A 2OY0A 3LHIA 4YRZA 4OJTA 3FOFC 3HDGA 4RTKA 1W2GA 1AQLA 1L7PA 1LQUA 2QF7A 1NTRA 5I8PA 1WUJS 1PZFA 4F9TA 2OEPA 4CUKA 4WJKB 3RFUA 4XVQA 2HZ7A 1OSNA 1AS3A 2IIQA 1YBVA 1KK0A 5BXQC 3UJDA 2W2KB 2XMRA 4P83A 4YRBA 2HMUA 5U9CA 2JVIA 4JODA 4LVOA 1K6JA 2EEZA 3MLBA 3NATA 4V2IA 3K2BA 3C8ZA 1QP7A 2O2YA 4TN5A 4GOLD 2J4CA 4PIMA 1WW3A 4C06A 1QH8B 2H85A 1RNLA 2ZIXB 5EMHA 4GKAA 5FPSA 5FPYA 3ZKWB 2Q3JA 2ZVPX 3JYNA 1VCNA 2FMFA 1EVQA 3CJQA 5BSGA 3PHLA 3CT6A 4PZAA 1J7KA 1JBEA 5AVYA 3C45A 1TKAA 1DEXA 4KWIA 1FXUA 2ZS9A 1OREA 1U2ZA 4MVJG 1UOOA 2ZJ7A 2A9JA 2I2XB 5ILGA 1JG3A 1M6HA 4FJ0A 1T8WA 1GHTA 1Q1GA 2FG7C 3KAPA 4U0KA 1ZL0A 1T1IA 3FLEA 3C74A 5F78A 3ORYA 5EHQA 5FBLB 3ZHRA 2G04A 3PQDA 1ZP6A 1UOEA 2F43A 2E89A 1PCXA 2GK7A 3PNYA 4RQAA 2AUTA 2EZ4A 3L5OA 5C34B 3EIWA 4RJJA 2VHEA 2AZ4A 2JCSA 2W2OA 4HFNA 3BULA 2P9EA 1D9ZA 3FJYA 4E03A 2PZLA 3NX4A 5CD1A 1KSJA 5DBOA 3EUFA 3QIAA 2IE0A 2DJ5A 2VKQA 2OCKA 1FUIA 5K8VA 1I5EA 1XELA 4IH4A 3WMWA 3D0QA 4Y2JA 1UMDB 1Z47A 4MQ4A 1ESEA 3ZHVA 4GX0A 2I3BA 2V7UA 3JZIA 3VKWA 2C2GA 3DHNA 4INJA 3JQPA 1BH2A 3AI7A 3AVQA 1PEDA 3RUIA 2GEBA 1GP2A 4HNRA 1RRVA 2OBNA 4EVSA 2VHZA 5DNAA 1UCFA 1BS1A 2GUGA 5LQDA 5HM8A 1MO2A 3X2EA 2B20A 3GNSA 1ZCFA 2ZUUA 1DC3A 5BW6B 4CEJA 1PTKA 3KVNA 3CEJA 2FXVA 3U3XA 4DMKA 3EXIA 2EC5A 1Y4ZA 3H9BA 1TA0A 4FU0A 4B80A 4DBLC 1ECBA 4C0JA 5KWIA 1PIWA 1KEVA 4FR0A 3C16C 1GRQA 3H7AA 3VR2A 3KYBA 3MHTA 3GQVA 4B71A 3AR8A 1KO8A 2OCIA 1KH1A 2DH5A 2IU6A 4L72A 4PO9A 1WLYA 2YRWA 1G20E 5LBIA 3SC2A 2F3UA 3R75A 2BH2A 1W581 2O8CA 1J8FA 3JVIA 1KDOA 2FW6A 3WDLA 2JI8A 3D4LA 4L3VA 4LNHA 1OU4A 3WDSA 4JI4B 3F3KA 2A9FA 3AY7A 3H5RA 1R9NA 3IIMA 1IM5A 1OCEA 3O8OA 4PANA 1DOZA 1U9YA 3L6DA 3QTLA 3W5AA 2V5UA 5DYYA 3R1IA 1RXIA 4DV0B 4E11A 1OB5A 4C04A 1CUCA 1N1GA 1WUTA 2JBAA 4EQ6B 5KKAA 2EFCB 1COZA 1XDGA 3JAWB 4F97A 2WHPB 1Y7TA 1XIVA 1EX1A 1N6LA 4UHDA 3TK1A 1V2GA 6REQA 3FHCB 3UTDA 4R1MA 5AKHA 1CY0A 1KKLA 2JASA 2WM3A 1W85A 3GJQA 3FTFA 3ZCUA 3LUGA 3I30X 5GV7A 1ITZA 1MRNA 3WYEA 2VSNA 4PZPA 2AV6A 1F7VA 1UC9A 5LWHA 4MEAA 5FI3A 1E7YA 4FMPA 4WK6A 2BFDA 2HSGA 4N6NA 3VR2D 1MD9A 4NULA 2O1WA 2J48A 8OHMA 3E9MA 4FBMA 4G5RA 1NYQA 5K3FB 1ORDA 5PGMA 4NQRA 3UWSA 4A8HA 2D2VA 3LM8A 4HGYA 1YZVA 2P9YA 2VCYA 3JWHA 4NPAA 2GRJA 4CKWA 4LW8A 1L3IA 2XXBA 4WEOA 5EJ7A 3MMPA 1LD3A 4KYTA 3R7LA 1A5BB 4LXYA 2XF2A 3AVOA 4BN4A 4LK3A 4LFCB 2BC9A 5I9LA 4QT4A 5LZ4A 1CF4A 3PNQA 4ZMBA 2D0OB 3AU8A 5EJGA 4ISBA 3FXAA 4JYBA 1TQ6A 4ZTBA 3VOBA 2V7BA 5JW6A 3AVYA 5IN5A 2Q2VA 2AR9A 1TUEA 3AYZB 1P73A 4PVCA 2O0MA 3IUMA 3ZLUA 4XVRA 1OUMA 2RKOA 3DBVO 3BQMB 4WASA 3EGDB 4X54A 2BEVB 3Q0TA 1Q2UA 3O2JA 3W5CA 1XRPA 2YXLA 3RHSA 1E1NA 3I01M 1O7JA 4YT8A 1U0OC 4WFJA 3THWB 4WL0A 2WJAA 2VYNA 1O89A 3AP2A 1IN4A 1P1BA 2AOTA 1NJ2A 4MQMA 4QQNA 4GM4A 3ZJVA 3AR5A 1BDIA 1M1NB 3L7IA 2XCLA 2AJ8A 4L07A 4ZMSA 4G26A 3KJGA 5TT1A 3TOSA 4Q1BA 1HFEL 3ZJUA 1BW9A 2QAGB 2PKEA 1QANA 2KJQA 4RS4A 2FSGA 3E9ZA 5IVPA 1Q7EA 5IC5A 4OV6B 1II9A 5T4HA 1RJ9A 2L0XA 1CUHA 1ISMA 5EP2A 4DEVA 3EEQA 1EXVA 1QMGA 1VCHA 1J00A 4GX5A 1Q7BA 1KOJA 3A05A 3FW1A 3S2SA 4DLYA 1OAOC 4HQOA 5TQ0B 3A27A 3D43A 4TMKA 4D80A 1GM5A 2YBDA 4MDHA 4RWEA 2GPNA 1PYDA 3G9QA 5FL7D 5B57C 3V4FA 3L3BA 4BAZA 1UEJA 2A9PA 2IDMA 1QRSA 2O7RA 3KT6A 3WWOA 4LZNA 4XRRA 1QFSA 1XAHA 2OV2A 4K6FA 4L0DA 4PRZA 3DE7X 3GFPA 4QXQA 3IUBA 4RDCA 1PJAA 3GH3A 3VPHA 1BFDA 4RTMA 2PUFA 1UKEA 1JZSA 4WCFC 5J2UF 4X9XA 3LQ2A 3VU9A 1SC6A 2ONZA 1QZXA 3WNBA 4DBVO 5LNK1 1L4YA 2FUEA 2W4QA 1XXHA 4P4SB 5LIRA 3GFTA 1KK3A 3F7TA 4PZUA 3RAJA 1WQ3A 4XX1A 3QE3A 3L04A 2HT1A 1JIVA 1OE0A 2REOA 3B20A 4M1OA 1P5HA 1Y1LA 4FP9A 3WZ2A 3LNCA 1THMA 4K40A 2J8ZA 3AHIA 1X7XB 3G3EA 3ZVLA 1PW5A 1LPSA 2I7TA 3WTBA 1GZ6A 2H1CA 4YREA 1QTRA 3VU8A 4LIPD 5IZ4A 2VA9A 2EGUA 4DJFC 4GI1A 4P0QB 2PS0A 2PPLA 1A7AA 2A3NA 2FR0A 3D2CA 1FU7A 2ZU0C 4PQGA 4AJPA 3NBQA 2GUWA 1M7BA 4LDZA 1FF9A 1UIMA 3PL5A 4BWYA 3IAAA 3R6GA 2G07A 4F7DA 4EJSA 1XHFA 1B76A 1SUBA 2O48X 1SFRA 2XGOA 1FTQA 4J0QA 5T41A 4D4LA 3CB2A 1E1KA 2AT1A 3TEJA 4E21A 4TXNA 3S70A 3SP1A 3DLIA 1CNMA 1RJWA 2BZ1A 2I4NA 3IVCA 4FDVA 4UDXX 4LN1A 2P27A 4AJ1A 4ZYTA 1VLJA 1SKQA 4WECA 4WGGA 1KEPA 4F6CA 3HV0A 4IV5A 5K8LA 5K4AA 3LW8A 1DAIA 3HP1A 4GHWA 4JY7A 1DQZA 1S7GA 2CLCX 1QZTA 2R1UA 4NZ9A 3GLGA 3RT1A 4UXJA 4ZZ3A 2P9BA 2VJYA 2XADA 3I34X 4JWKA 1Q1EA 5C8VA 4JI8B 4DV7B 1UKYA 1UM8A 3H1BA 1RXCA 5ADVA 4W8HA 3AUYA 3U1BA 4JB8A 1EQUA 1J8QA 1V71A 3LAWA 3N39C 2CHUA 4GI3A 4HCJA 4LG1A 3USCS 4CLOB 4UDNA 5B37A 2VH1A 1V8BA 2VDRB 3EMDA 3ZDAA 1NRIA 1OA0A 3C41J 1LDGA 2WNIA 1JL3A 3QTTA 3X1MA 2VTBB 2ATIA 2YCBA 1SA0A 3K0CA 1V6CA 3C5VA 1WQ4A 1UKCA 1Z8HA 3BQNB 1N5DA 3IDFA 4GQBA 2MR6A 2FWBA 4JR1A 4O4IB 2XRMA 5FYQA 5H3CA 4YAGA 2ILVA 4JI6B 4LI3X 5WRFA 3VNSA 2CXNA 5J5AA 1D4AA 2G6TA 4DGSA 1BJKA 3ROGA 5KX5F 1ULTA 1I80A 2VUIB 3KWFA 5FOQA 2B69A 2EQ5A 5KYUB 4CF3A 2JD0A 4ZMRA 4WJZA 4J16C 3EG9A 1MTOA 5CH8A 1CVIA 2FEWB 121PA 4X93A 1IK4A 1C2YA 3MJTA 1CY4A 2FUKA 2Q2OA 4K03A 1Z2DA 4OGGA 3ZE7A 4DVJA 2Z2YA 4UE3S 5KSOA 2AXQA 1YZLA 4KO1S 3PDWA 3VUFA 2J0SA 4GI7A 1TZKA 2AFIE 1DRKA 2G6BA 2HJSA 3LWDA 5J2UA 3EVAA 5E1BA 1FDRA 3B7PA 1E6MA 2D2IA 3H9EO 4Y9UA 5G0VA 1PR4A 1YSCA 4PAGA 5EJ4A 9LDBA 2HO5A 3KDAA 3CNLA 4P35A 1VB5A 5DV9A 1I3MA 2YVLA 3EVGA 4YUVA 2ZR0A 3COZA 3WJAA 3DE3X 3ILVA 4BKQA 5IDQA 4P54A 3N2KB 1EWQA 1Z4MA 3AK4A 3WY9A 4DIOA 4ND2A 3AHHA 1SK9A 3MCTA 5EMLA 1AZTA 2AH5A 1KI3A 4F6RB 3LF1A 1V3TA 2W6OA 1YGPA 5AHRA 4MJXA 4MJLA 4B40A 2XTZA 1R0BA 4X1IB 2XUZA 4P7GA 3GP3A 1H2ZA 3CNHA 1Z08A 2J3LA 3CX7A 5HDBB 1ZMBA 3LUKA 4G5GA 4TVKA 5AVOA 5JAMA 1AH2A 3DR3A 2BHNA 4OHCA 3SYRA 3JVDA 2RGNA 3QBJA 4J3JA 3T52A 3UHFA 4B3RB 1UBSB 3DAPA 4PZCA 1HE8B 4TKMA 1ZGBA 1AY0A 2Y0PA 1Z88A 2IDZA 1PD0A 3JASA 4TLEA 4AMVA 3QVOA 1NUUA 3VPBA 2O06A 4YP9A 5JSQA 1CZKA 2WG1A 2WUWE 2VP2A 3I53A 1KJ8A 4OY3A 1AMUA 3UMMA 4RZQA 1ZSYA 1IFXA 3SJUA 1E62A 1TAGA 2ONYA 1NJ6A 3L7OA 1FP4B 2Z3ZA 4BQIA 2CWDA 2B98A 2WQZA 4ZV7A 2IZZA 3WK5A 1U0LA 3A58B 3BZUA 3EVDA 4B3SB 4LWZA 2QI9C 2VK2A 5T57A 4AKTA 2C97A 4A27A 3R77A 1TQ4A 4BVAA 4FCWA 5B55A 2GLUA 4IQ4A 2Q2WA 3I05A 3FTPA 4DAEA 1N2XA 2WAYA 3W8EA 1AO3A 2PX8A 5IWCA 4E6EA 1VG1A 5K8IA 1VTKA 1NWCA 4AKHA 4HXFB 3PRKE 2BIFA 1UMCA 2J07A 3NHLA 4LTMA 2BKXA 1RLOA 4QWMA 3WKBA 3BE4A 3ZIAD 1J97A 2ZT8A 5IKPA 4BNUA 1U0RA 3CEMA 3KSZO 4CKYA 5AM2A 5JMOA 4CNBA 4ZFNA 1PT7A 2B5OA 4JKOA 4TRNA 4D4IA 1OLUB 1XKTA 3RYHA 1JWLA 4QSHA 4TTIA 3SEFA 2QIPA 5KX5A 4FB4A 4NOLA 4FZVA 1DIBA 1J0AA 3PHGA 3E3LA 2UYCA 1XTKA 4R8SA 3UOGA 3U7GA 1ENZA 2I33A 2HA3A 2X0FA 3LBYA 2DPGA 3N0WA 3NGLA 4L22A 3IPAA 4YJGA 1XBTA 4ARSA 3L40A 3EZLA 4HNVA 4FLMA 5KQSA 4NEGA 2V58A 2YOHA 2OHJA 1NXPA 1KSGA 4KBGA 4ZVPA 3U44A 4YCBA 1FSFA 2V1UA 4LSGA 3OF3A 2D2FA 3UAZA 4LWOA 4UUBA 4B84A 5C35A 3QHAA 3T1OA 1RLIA 2CZGA 5CAEB 4OF4A 4DQVA 4JLBA 1RXEA 1KP2A 2PCLA 3M9WA 1NXXA 2BBTA 2PX6A 4MQ6A 4X1YB 1UR5A 4ETNA 3RUDA 4DCSA 1NUSA 2OSVA 3PQEA 4TV8F 2PGLA 1KEZA 9GPBA 2NQ2C 5JTTA 2DQYA 5AXBA 2Y1GA 3IEPA 4JJ4A 2XCRB 1A7KA 4B2IA 1TEXA 2XDYA 1EBUA 1FMTA 1WABA 3P52A 5KOJA 1JI3A 3GJ8A 5LL6P 1X1BA 5DXFA 3ICEA 1WDWB 2Q5QA 4DA0A 4JBYA 4UE2A 5B1HA 1ARZA 3PFHA 5LU8A 3W7VA 4EUNA 2NSYA 4TMZA 3UG7A 1TF5A 5HKLA 5H82A 4DLWA 4LFAB 3UAVA 1NF9A 2ZRBA 4I1YA 4URFA 1QAQA 4B6GA 1U1IA 3T1HB 2ONKA 3BICA 2H07A 2BGJA 4XVHA 1YCGA 4P38A 3WICA 1GZ3A 4LOIA 2NXCA 3T1TA 2FZVA 1N9GB 3RUCA 3PQ7A 4RD2A 2A5LA 1PQPA 2ZULA 2NZWA 2FE1A 4JLOA 1SBQA 1GQSA 3FMFA 1XOIA 2IODA 4GFDA 4RBNA 3ZLTA 1WKCA 4K7JA 3S7ZA 2QP9X 2NUTA 1Q0LA 2VAPA 4E2XA 1G3QA 1QOQB 2C4NA 2CNBA 1TYAE 5JY1A 4AXXA 4YP7A 2HLDA 4W9NC 1N6OA 5D1HA 2FLKA 1UJBA 5J63A 3GT0A 4S1VA 3TTXA 5C8YF 2ZS7A 1ZPDA 1U0NA 1QIGA 1NYLA 3K2EA 1JAXA 3FBWA 4JT2A 3RC7A 4AROA 2H1FA 3E9DA 1ZY2A 2HFKA 2Y9PB 3OHPA 2HHCA 2WG0A 4N12A 2HSWA 4JI3B 1CERA 2ISCA 4FMCF 4MYSA 4B7XA 4IXDA 5F52A 1YK0A 5DULA 2GK3A 1LX6A 1N7GA 5HJEA 1NN3A 5K3BA 3CNQS 1C1DA 1DO8A 3EASA 2CK3A 5CJJA 3JARB 2AB0A 5ULLA 5AW5A 4LE2A 2IY8A 4B3FX 4HFJA 1M2KA 4U00A 4P34A 1GG9A 3B1WA 1NJGA 4MLZA 3EY9A 1VJ0A 1W47A 3DE2X 2DFKB 1OC2A 2XB9A 2ZBRA 3NPAA 2SBTA 3SQWA 4AZSA 4KPYA 1JVBA 3COSA 3JZMA 5D3MA 4TWIA 4FWBA 1C1YA 2YJTD 2ZTLA 1QLWA 1Z5WA 3LWZA 4ARVA 4HLUC 5I7HA 1CDZA 4Q1EA 3AHFA 1LWNA 4WY2A 2V3CC 2OB1A 4OHBA 4ER0A 1QC5B 1ZUWA 3DKPA 4WFQA 5D51S 3REQB 3GLFB 4HXYA 4W5RA 1SCNE 3B9RA 4IUYA 4DQUA 4GO1A 4Y98A 2B8JA 2Q27A 4DR5B 4NARA 4WZAB 1B93A 1DKLA 3C1UA 1U7PA 2AA3A 3GCXA 3FJ1A 1YNSA 1QX3A 3IBGA 4FD2A 4N7RA 5EXXA 3ZWYA 4BX8A 4CF7A 2EF1A 2WJ3A 1M6EX 2WKQA 1K4YA 1JQDA 1D2HA 3EZ7A 1DC5A 4R6XA 1GPMA 2Q5IA 3CIFA 1VCOA 4TV8A 2R8EA 2JLYA 5DGIA 5AQEA 3RV4A 1AZLA 1X70A 3SFZA 1FU8A 1PN3A 4DA6A 2BEUB 2IHZA 2CK3D 1ZKDA 2QM0A 4Y9SA 2A9KA 2ATXA 1VG9B 3HWSA 5TQJA 1RHQA 3ESQA 5KYWB 3H1TA 3Q87B 4FGSA 4M1ZA 3RODA 4IZIA 5H1YA 3O21A 4HQ6A 5I7VA 3EIOA 3IUQA 4QVGA 3G2IA 3GZJA 4E70A 1AKMA 2H7CA 1YR7A 3UEOA 5D84A 5AW3A 1ZBDA 1Z73A 2WTEA 3GVPA 3DGFC 4JJKA 4KXYA 4X6UA 3ZWQA 1GIAA 2JGLA 4NYJQ 1EVIA 2JEYA 2V8OA 4EHHA 1WB9A 4EB0A 1CTQA 4MYDA 4G8CA 5THXA 4R9NA 3DFFA 1OT5A 4FKZA 3ICPA 2DT5A 4N8DA 4B1FA 4QUDA 4L5YA 2FH5B 4HUQA 4I9HA 2OVFA 4UHJA 1WXHA 3ZCXA 4F9FA 5HZHA 5DM70 2AVDA 2HW8A 1SC3A 1OILA 2QRVB 1H4SA 3BSYA 3S2YA 1RT9A 5CPBA 3TVTA 2FSFA 1O0SA 5