2Y99A

Crystal structure of cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase (bphb)from pandoraea pnomenusa strain b-356 complex with co-enzyme nad
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
275
structure length
267
Chain Sequence
MKLTGEVALITGGASGLGRALVDRFVAEGARVAVLDKSAERLRELEVAHGGNAVGVVGDVRSLQDQKRAAERCLAAFGKIDTLIPNAGIWDYSTALADLPEDKIDAAFDDIFHVNVKGYIHAVKACLPALVSSRGSVVFTISNAGFYPNGGGPLYTATKHAVVGLVRQMAFELAPHVRVNGVAPGGMNTDLRGPSSLGVPLADMLKSVLPIGRMPALEEYTGAYVFFATRGDSLPATGALLNYDGGMGVRGFLTAAGGADLPEKLNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords CIS-2,3-DIHYDROBIPHENYL-2,3-DIOL DEHYDROGENASE
publication title Biochemical Studies and Ligand-Bound Structures of Biphenyl Dehydrogenase from Pandoraea Pnomenusa Strain B-356 Reveal a Basis for Broad Specificity of the Enzyme.
pubmed doi rcsb
source organism Comamonas testosteroni
total genus 86
structure length 267
sequence length 275
chains with identical sequence B
ec nomenclature ec 1.3.1.56: Cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase.
pdb deposition date 2011-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2y99A00
4A27A 2O4UX 3NUGA 2JD0A 4JXKA 4D45A 4IBOA 5CG1A 3G1TA 4DTIA 1BW9B 4DA9A 1YQDA 3JQAB 3JQBA 4AJ4A 2B5VA 5LDHA 5C5IA 4GGOA 1P1HA 1ISJA 4GAEA 1ARZA 1C0IA 1Z45A 4DQUA 2EWMA 3UUWA 4BO2A 2BGMA 1BHSA 3K30A 3WSVA 3CEAA 5F5LA 4JLWA 3PXXA 3VPFA 3WGHA 4J43A 4FB5A 3PFWO 4OXKA 3ZHBA 1YJ8A 4UEOA 4I5FA 1XGKA 3NYWA 4XYLA 1O5IA 2YV1A 1PGPA 1VJ0A 3ONEA 1A71A 3P2YA 4XB1A 1DRWA 1VC2A 2NM0A 4AJKA 1L7DA 4EGFA 2O4CA 3PZRA 1QYVA 1Q1NA 4QX6A 4IMRA 1Y8RA 3RC7A 4FFMA 3AJRA 1LDMA 4PZCA 5AVOA 1UP6A 4O6VA 1LUAA 3L6OO 1E7YA 2OXIA 3OJEA 4CMCA 5TLSA 2DTDA 1J5PA 1JWAB 3F46A 4P4GA 5G0VA 4QFDA 3KBOA 5THKA 4CM7A 5EN4A 3JD4A 2WYVA 1W0CA 5DP1A 1HLPA 3AFMA 1H93A 4XD2A 4JBGA 3I1JA 4CMEC 3ICCA 3WBFA 1MGOA 3DWFA 3AI1A 3AY6A 1TXGA 2O3JA 1YVEI 3EC7A 3SX2A 2AEMA 1F17A 4H7PA 4RF5A 4AJIA 1DC4A 2QRKA 1DOHA 2BFOA 2IZ1A 3FNHA 1JVSA 1E3EA 5G4LA 5BSFA 3ST7A 3D3WA 5CFZA 3PQFA 4IDBA 1E5QA 2VUTA 4NG5A 2AQ8A 1SEVA 1U8FO 3ZZNA 2O3TA 5LDGA 3D3WB 3K96A 3FN4A 3W4IA 5AQ1A 1ML3A 1ORRA 4PVCA 2HO5A 4Z9FA 3G17A 2QZZA 4A26A 4CMJA 4GSLA 4NK5A 2RH8A 1PS0A 2PKQP 5IZ4A 5L95A 3M2TA 2P9GA 4M55A 4RL6A 4IM7A 4YQYA 1OFGA 2Q1TA 1XEAA 3OMLA 1R0KA 4OKNA 2FPPA 2OUIA 2QX7A 3D7LA 3ZHXA 4ALNA 3AM3A 4XGIA 4TVOA 4WOJA 4JN6B 3RSHA 5BNTA 4PRKA 1D1SA 2R00C 4B8WA 1GQYA 4JX8A 3KSUA 3D4NA 2Y1EA 1GPDG 3ANNA 3GOHA 3K8ZA 4B7CA 1SOVA 4L74A 1DRUA 4YRAA 2DLDA 3AU9A 4YJFB 4FGWA 1JN0A 3JQEA 4RCVA 1QV6A 1ZK2A 4EEXA 4HY3A 4AFNA 1IE3A 2X0RA 1HETA 4BGVA 2YV2A 4EUEA 1RYEA 4IY1A 2HDHA 2Y0EA 2EW2A 4JNKA 1QV7A 1IB6A 2RCYA 1DB3A 1ONOA 5JDIC 4XEHA 3ENKA 4ALMA 2GYYA 2FMUA 3GLQA 4WLOA 1GEGA 4MVJI 3OJOA 2YFHA 1I01A 3B1JA 3A14A 3VKVA 3EDMA 2D8AA 1NQ5A 3ITKA 5G2OA 4EJ6A 5KJ1A 4GVLA 1HXHA 1VKOA 3U09A 5HRUA 2CD9A 4E3ZA 3C3XA 2GUGA 4R1SA 4QXMA 2Y1OA 3GNQA 5FF9A 5FWNA 2G1UA 4BV8A 1NWHA 4EEZA 3NJ4A 4BL5A 4L4SA 5CDTA 1MA0A 4J7UA 1LDNA 3H5RA 4CL8A 5KJCA 3IKVA 1QYWA 3GVCA 3AU8A 2FZWA 3F4BA 1DXYA 3IDSA 4JGBA 5U9CA 5DDIP 2TMDA 3MJEA 3TZCA 3QWFA 4N5NA 5BSGA 4WECA 1YWGO 2FR1A 3M6IA 3WQSB 3ANLA 1PL6A 1S7CA 1SZJG 1JAYA 1TI7A 3QWIA 3ZW8A 4RLHA 1U5CA 5T67A 4NJOA 4NI5A 4L8VA 3H9EO 5DZSA 5C3MA 1VRWA 4J4TA 4B79A 2PK3A 3WFIA 2OORA 3DHYA 3H2SA 2B83A 1JKFA 1YL7A 3TZ6A 3DAGA 1YH3A 1Q0LA 1H5QA 4MVJA 3SJ7A 2H9IA 3KSDO 4CM4B 2C07A 2VYND 4LMPA 4BNGA 3V1UA 1IZ9A 3CMCO 1HT0A 1LDGA 3OETA 3ON5A 1MB4A 2AEFA 1YS4A 3Q9UA 2X4GA 1ZSYA 1JW9B 2VN8A 3O4RA 4YJGB 4OHUA 1U28A 4HBGA 3WMXA 5L53A 1PJ2A 2W98A 4II3A 5TSDA 3UFXA 4BNNA 1GQQA 5GZ3A 1GR0A 4U0KA 2ZTMA 4XCVA 5ITWA 1N2SA 2BGLA 3F9IA 4XIYA 4CLHA 4XIJA 3L9WA 5I9NA 4WLEA 3FCOA 3ABIA 3TL3A 2C5EA 1WAMA 3RFTA 4CM9D 4RGBA 4GMFA 2P4QA 4AJOA 1W73A 4Y98A 4CMHA 3G49A 2JAHA 2Q99A 1Q7CA 1DIRA 1ISFA 1KVTA 1XYGA 3R6DA 4YA6A 2V6GA 3HE3A 4BGUA 4E5NA 5G0UA 1WZEA 3PWZA 4UUPA 4Y8VA 5HBRA 3GQVA 4K28A 1PS9A 4BV9A 2CF5A 5TRTA 4YRBA 5L7WA 4ZRMA 3BTVA 4LSMA 5KJ6A 2JFFA 1RM5A 3GDGA 4CM6A 4JP3A 3QRWA 1KEPA 2PGDA 3F6YA 4GI2A 2B4RO 5HA5A 8ADHA 5L9AA 2Z95A 3HFGA 1H9BA 4WLVA 2Q2QA 2C54A 4ZQHA 3GNSA 1EQ2A 3WFJA 3D64A 3E9NA 1TT7A 2B5WA 3OECA 3OEWA 1SOWA 1NM5A 5F1KA 4AG3A 1T24A 2NU8A 3GY0A 5A9SA 3WIDA 1WMAA 3IMFA 2JD1A 1U2DA 4N54A 2YHIB 4PG7A 4CM5A 2VRBA 4GLLA 3ROPA 4RVUA 5A9SB 3V1YA 4GX5A 3Q9NA 4UVEA 4IXTA 2PH5A 2G17A 4BIIA 1CJCA 2AA3A 2OZPA 1Q7GA 3AI3A 3CSDA 4YAJA 4Z9XA 2ZB3A 2UVDA 4EW6A 1T2AA 1HZZA 3ASUA 1E3IA 4AJLA 1XU7A 1GL3A 1NR7A 1B3RA 3RBXA 3QA9A 3GGPA 1GTMA 2VTDA 1DPGA 3HNPA 5DN9A 3VDRA 3ZNOA 3WGTA 3WQRA 1PJLA 1BRMA 1P1KA 1QLJA 1BVUA 1MG0A 4ND1A 3HJAA 4W82A 1O8CA 3C85A 4RVDA 3NKLA 1X1EA 1V0JA 3JV7A 3KRTA 3Q6IA 4XDYA 4AJNA 3BHIA 3EYWA 1C1DA 3MCVA 4K26A 2PLAA 1C14A 3MJ4A 5AXBA 3JQ8B 3OBBA 1XG5A 1NHGA 4ESOA 1YJQA 2XXBA 3KXDA 4NMHA 2HMTA 2FSSA 5BNIA 1ZXLA 1MV8A 1YB5A 3DOOA 3RU7A 1JAXA 4MKZA 2CDCA 1AHHA 2J5KA 2YDYA 5EL0A 4U0JA 3DZJA 3OHSX 4P8RA 1WW8A 2E82A 5C37A 1GQ2A 5LCXA 1VSVA 3NAQA 1F12A 3RUFA 3DO5A 3VH3A 4YWJA 1Y5MA 2I9PA 2UAGA 3DOJA 2PZKA 4I08A 1ZSNA 1YGYA 5BSEA 3IKTA 3GN2A 1EBFA 3TWOA 1RPNA 3MWDB 5DF1A 1NBOA 4TKLA 1E6UA 4CV3A 3HDJA 1KVQA 4YAKA 2WTBA 3G79A 2BLLA 4A5OA 2PA3A 4CUZA 3QSGA 1PU2A 1NAHA 4M54A 5DT9A 1VLLA 3I6IA 4ND2A 1GD1O 4DPKA 1LLQA 3A28A 4J1QA 5IN4A 3ROQA 2W8ZA 5KNLA 1DAPA 5I7EA 1EUCA 1V3UA 3JD1A 4QSMA 2HU2A 3VH2A 3EMKA 3DAPA 1RJWA 1ZK1A 3GEDA 4II2A 3C7DB 5J23A 2CZCA 2VT3A 1DAOA 2Q4BA 3LSYA 3UICA 3WOHA 1O0SA 1ZXBA 4U6QA 3TDKA 2BFPA 4OYRA 2GN8A 3VAZA 2WYWA 3ETEA 4Q39A 1J49A 4TZKA 4RVFA 1WDKA 1DO8A 5CP8A 5JCJD 1C0KA 3K6JA 3DONA 2IXAA 2A9FA 5L7TA 5CG2A 3S2FA 1L7EA 2HMUA 2ZB7A 3ZU2A 4ILKA 3OQ6A 2EP5A 2BFAA 3E8XA 3HFSA 2XAAA 4LW8A 4RVHA 3C7AA 5JO9A 2F00A 2Y0CA 1PZGA 5TIIA 4YXFA 1DSSG 1LLCA 4MKXA 2EKQA 1FMCA 3BMNA 3V8BA 4ZU3A 4RPKA 4YCAA 4CM3A 4CM8B 4U7WA 4RJTA 3LC1O 1PWXA 3AM5A 2EXXA 4PLHA 3Q2KA 4GWGA 1SNYA 4GX2A 4XZ3A 4R51A 3RD5A 3I3OA 4AJ1A 1TA4A 1Y8QB 3GC6A 3INRA 4A03A 1FJHA 3WMWA 3DC2A 4GBJA 3O8QB 4B3JA 5EQDA 2NLOA 3L6DA 5A3VA 2NNLD 2V65A 4XYMA 1UXIA 2X0JA 1LQTA 5A3JA 3HQ4O 1MXFA 4ND3A 3UCXA 3DQPA 1NPYA 3DAFA 3I83A 1NTOA 1ZZEA 3I9JA 4KOAA 1ULSA 1MX3A 2E6UX 1B26A 3VC7A 3E82A 5JMWA 4BOYA 2CVOA 1HE5A 1FDSA 2VZ9A 5AXDA 3DBLB 4N5MA 4R68A 4YAEA 2P2SA 4NDNE 4BMSA 4CQLB 3TZKA 4R69A 4BB6A 2PZJA 3X2EA 3ADPA 3ZWWA 3RUAA 4R9RA 2Q2WA 3BXXA 3GNTA 5CDSA 1KC3A 2OL4A 4XRRA 3ZDFA 4F3YA 1CYDA 2ZQZA 1A4IA 5JBIA 3CZMA 4H15A 2QZ9A 4I5DA 4YYZA 5G4KB 2Y68A 4NFHA 1UAGA 3DHEA 1M67A 4JBIA 1P31A 2CVQA 3WGGA 4J0EA 3RUEA 5KWEA 1J6UA 2D0IA 3WS7A 4RPHA 4Z6KA 3I9MA 1ZEJA 5FEUA 4YR9A 3TZQA 1BXGB 1IPFA 1IL0A 2FSVA 2HRZA 3QQPA 1F8FA 2FN7A 1M66A 1SB8A 4IZIA 1LLDA 1UP4A 3JCZA 1GEEA 2B4QA 1H6CA 3WG9A 2FWMX 1HE2A 1I3LA 1HF3A 2Y1FA 3JYQA 2YDXA 4FCCA 3GH3A 3FWZA 3FSRA 1LXCA 1QRRA 4K1LA 3ZWYA 2FRDA 4NJMB 1GAEO 2HUNA 2OBNA 1TT5B 2I6TA 5T6BA 4B3HA 1A9ZA 3AOGA 2GDZA 4JJIA 3HDQA 1BTOA 2AQKA 3UF0A 3QIVA 3W8EA 5HWSA 2P4HX 2E4AA 3DZBA 3DBHA 4GMGA 4DBZA 4DC0A 3NDJA 2O3SA 1ONPA 5I8ZA 4BGIA 2RIRA 3BMOA 2RH4A 1U1IA 4AJEA 5HM8A 1S6YA 4R3NA 4WUVA 4OO3A 4O1MA 1E3WB 1LQUA 3GUCA 5F3RA 1QR6A 2CNBA 2DBZA 3GZNA 5JYEA 1GZ3A 3IUPA 4J1TA 4QQRA 4EYEA 3NV9A 3AUUA 3IOYA 3GEGA 1I0ZA 4FFLA 4BS9A 3UHAA 3U62A 1NR1A 2X7HA 5CHEA 1T2FA 1ADBA 1KC1A 5G0TA 1IY8A 2DM6A 3GAFA 4P4LA 1E1KA 2AQIA 4ZQGA 2EV9A 1C0PA 1HL3A 4OH1A 1SEPA 3WXBA 4MP6A 1UJMA 4R16A 1B16A 3CKYA 4DMMA 1VM6A 3BTOA 3LZ6A 4MJLA 2VZ8A 4L0QA 4FFRA 4FR5A 5THQA 1M6HA 2RHCA 4J90A 1ZVMA 5U4QA 1E77A 3NDRA 1QYCA 4IMPA 1QG6A 5BR7A 3OQBA 4LISA 5JY1A 1HE4A 2AE2A 3IC5A 3ZN2A 1BDMA 4J7XA 2XPCA 1ZCJA 2GR9A 4FBGA 2OGUA 3V2UA 3PHLA 4EZBA 2YFQA 5TC4A 3NEPX 2HCTA 3GN1A 4OKIA 3GVIA 1N5DA 3RWBA 5JPIA 1RM4A 1K0UA 3C7CB 3PVZA 3RVDA 5K0ZA 3QHAA 1NWCA 4UULA 5T8KC 1NQAO 1HDXA 3DR3A 4PRLA 3PDUA 4NBWA 5JCXA 2WJPA 1U5AA 2X5JO 2GPTA 2VQ3A 2NQTA 1XU9A 2BD0A 1E6EA 1QKIA 1H2HA 1EE9A 3LF1A 3UKOA 3I52A 4PLGA 4YTEA 4YT4A 4M89A 3RKUA 3EHEA 3H3JA 1Y1PA 3JQGA 5ILGA 2P5YA 4D41A 3R0IA 1GV1A 1VPDA 1M76A 3JQGB 1O89A 4RPGA 5ES3A 1O9BA 4Y9DA 4BB5A 3ITDA 4D42A 3JQ6A 3K9QO 2A4KA 1BW9A 3HADA 2UYYA 3JQAA 2X86A 3EVTA 3IAHA 1I2BA 3KZVA 4OMUA 5G0WA 5A1TA 3MJTA 1IPEA 4UAGA 1PJTA 2I67A 3ADOA 1D3AA 3LLSA 2WWRA 4Q3DA 4WPGA 3KEQA 1DJQA 3U4IA 1VKNA 4BO5A 3VH1A 1VE9A 1GDHA 1PGOA 2D4AA 4IINA 2CY0A 1ENZA 1R16A 4M1QA 3ICPA 1AHIA 1QMGA 1VSUA 4Q3NA 2YYYA 3PLNA 1DIBA 1KEUA 2O50A 4CQMA 5ICSA 1ID1A 3AW9A 4BNJA 4CLEA 1Y6JA 2W2KA 1LNQA 2ZJ1A 1N9GB 4DMLA 3JQBC 3VZQA 3ZGYA 1NVMB 1E6WA 3GG2A 5A05A 2FR0A 4NBRA 4CQMB 1YQGA 1EBUA 2W2KB 1KBZA 1XKQA 1DBVO 3JD3A 4BO1A 1CF2O 3EAGA 4KDEA 1N1EA 3WDSA 5IDXA 4MKRA 2YV3A 5I7SA 4QTZA 1HWYA 4BNIA 3ENNA 2Y1CA 3ASVA 3NT4A 5FI5A 1OMOA 4BNWA 5T57A 3MOIA 4HFMA 3RKRA 3U0BA 4D3SA 2WE7A 3F47A 2DBRA 3H5AA 3DFZA 3I9KA 3JTMA 1PWZA 4LCJA 3QWAA 3O03A 1YQXA 1UAYA 5JNLA 1QYXA 4ZQFA 3ONFA 1E7SA 1KVRA 2DUWA 1JWBB 1YOVB 4BNTA 3O9ZA 1V3VA 4KUHA 2O3QA 2GZ3A 3RC1A 1P74A 2IODA 5DULA 4BNUA 3GK3A 1NFQA 1WNTA 2F1KA 3OFSA 1D1TA 3ZWCA 1XR3A 4KTVE 4R4JA 4CJXA 1T2EA 3WQQA 4EI2A 3SC4A 1U7HA 2C2XA 3EW7A 5ILOA 1DC6A 2QRLA 3AM4A 2Q50A 2DFDA 2I3AA 3D3EA 4ZICA 5ICMA 3KM0A 1SC6A 1NYTA 3QVXA 3E5RA 5JMPA 1XIVA 2EF1A 5IZCA 2C5AA 4FIZA 4ND5A 2LDXA 5L4LA 1H6DA 4MP8A 2WD7B 1I30A 3NT5A 1P1IA 5EQFA 3H4VA 4E31A 1Z82A 3MWEB 1DIAA 4DLBA 3AFNA 3BHMA 4TRNA 4CLRB 2YUTA 2V6FA 4FN4A 1R12A 1VJTA 1U3VA 5ER9A 1KY5A 5CDGA 2CSUA 4G2NA 3CMMA 3PYMA 1M6WA 4H3VA 1NQOA 1GCOA 3L0DA 2ILTA 4YJFA 5EPOA 1WP4A 2C7VA 4FDAA 1R4NB 1KEVA 3VKUA 4X54A 3BMCA 4C7KA 2IYPA 2PFGA 1H0KA 4XQEA 1XQ1A 4NU6A 3BMCB 1F14A 3I4FA 2DU8A 4FJ2A 1PQPA 3ROKA 1BMDA 2EKLA 4B4WA 4CL3A 3LDHA 5KVSA 1DFGA 3F4LA 4ALLA 2C29D 3CIFA 1W4ZA 1NPTO 3D4OA 1PJQA 3LVFO 2O7SA 5IN5A 4YB8A 1LSJA 1ZSVA 3DZGA 3D5TA 4ZQEA 2BF7A 3H2ZA 1ISHA 3Q2IA 2VRCA 3GPIA 1EUZA 3TOXA 3INTA 3UW3A 5U1PA 3WGOA 1BXZA 5DP2A 4J3FA 3DBRA 2BH9A 3GG9A 4BNMA 1ISGA 3VZSA 2UDPA 1N7GA 3RUIA 4L9RA 1NX6A 2VOEA 1B7GO 3DBRB 4J2OA 3DZKA 5KOIA 1YDWA 1F0YA 2E49A 3BYZA 3COSA 1IYZA 3C8MA 4FC6A 4IDFA 4TRMA 1HYHA 4YT5A 2OFPA 4ZA2A 1KERA 5A9RA 3KYCA 4HUJA 1Z7EA 4DC1A 3IJPA 2W90A 5DCWA 4B4OA 5DOZA 4LVUA 3KYDB 5JAIA 4WLUA 2FPIA 3KYCB 2H5LA 3PJGA 1PJSA 1DC5A 3KEOA 3E9MA 4UUNA 1H6AA 1VJ1A 4L4RA 4KQWA 5HTOA 1EE2A 2JCVA 3L9XA 2Z1MA 3H8VA 2VUUA 3E48A 1E7WA 2J8ZA 1HDGO 3Q3CA 2H63A 1UDBA 1ZKMA 4IXWA 4RPLA 5TX7A 4CLXA 1F8GA 2EHDA 3QJ5A 5JW6A 1B8PA 1NAIA 1E5LA 2IEBA 3E18A 4CM4A 4K6FA 2NU9A 5JSFA 1H2BA 1KS9A 3VVBA 2TMGA 3BA1A 1IULA 2GF2A 2J3JA 4MVJD 1L1FA 4KWIA 4E32A 1RYDA 5JDCA 3GUYA 4YJGA 3WYCA 3JD2A 1HTBA 3ZWVA 1CERA 3OIFA 4E30A 1SBYA 4WCFA 3GGGA 4J7CA 3E6AA 1E1LA 2JHFA 2NU6A 5KKAA 1SMKA 1LRKA 4LRTB 4NR0A 4WCFB 1UZLA 4R5HA 3AK4A 1ZJYA 3HDHA 1KETA 3ZHZA 3HN7A 4TRRA 1YO6A 4L75A 1DFHA 1WDLA 4TSKA 2ZB4A 3WICA 4UEJA 4K9DA 2WD8A 5TQVA 4RZHA 4A73A 2PKQO 3ZWBA 3ZV5A 1CDOA 4R3WA 2VNSA 1E7MA 1K6IA 1Q0HA 4IIVA 2DAPA 1A72A 3PWSA 1KY4A 5I9LA 4WEOA 3CE6A 4YEDA 3H9QA 4DIBA 3G3EA 1XQ6A 3GVPA 4FW8A 4NU5A 1N7HA 3KLMX 4A2CA 8LDHA 4ITUA 4RQTA 2P91A 2IEDA 3UVEA 1U3TA 3UXYA 3WYEA 3RASA 1E3LA 2VHVA 1HKUA 1BWSA 4BKPA 3ZNPA 2DKNA 9LDBA 5JE8A 2ZTUA 1MC5A 1NP3A 4PLFA 1EUDA 1YRLA 2FP4A 5JAMA 2YHIA 3ZCXA 3ETGA 5CEFA 2B69A 4MVJM 2BMAA 1PS8A 1MUUA 3INGA 1I32A 2GD1O 2VT2A 3BTSA 2BI7A 3D4PA 2V7PA 5CDYA 1FDUA 1ZW1A 3B1FA 1JA9A 4IDGA 3QV1A 4ZQBA 1Y5RA 3JQ9A 3OSUA 1UR5A 1SCUA 5GZ6A 4BNLA 4CR6A 5COBA 4P38A 1DRVA 4DLAA 1W8DA 4IQGA 2IE0A 3K2BA 1IUKA 3F1LA 3MJSA 3QP9A 4F45A 3WJAA 5C7LO 4M87A 4D44A 4WLNA 4GQAA 4NBUA 3RFVA 2AXQA 4GX0A 4BNHA 3AUAA 3DZIA 1KYQA 2BRUA 3IJRA 2GERA 4TMFA 6LDHA 2EERA 5LC1A 4OXYA 4O0LA 1LC0A 3C1TA 1LC3A 4PZEA 4OXNA 4E13A 4WNIA 4OQZA 1DIHA 3JQ8A 4MO2A 4D46A 1E1MA 3PQEA 4JQCA 2DUUA 1A4UA 1NFFA 2BELA 3OJLA 4CUKA 2ZATA 4NNJA 4BO7A 1HEUA 1GCUA 1V3TA 4E2WA 2G0TA 3QY9A 2O48X 3DEYX 2Q1SA 2W2LA 4Y6PA 1T25A 4YDRA 2GSDA 3TFOA 4RO0A 1WWKA 4BNVA 1E3SA 1AN9A 5T64A 4BNXA 3QVWA 1PR3A 3QW2A 4NBTA 3FTPA 3KB6A 4J49A 3F1KA 4IUYA 4OAQA 3RQSA 1MFZA 4LCEA 3PPIA 1UXJA 2VWGA 2JD2A 2YHUA 1T2DA 4GLOA 4MDHA 4L76A 3FR7A 1AUPA 3V1TC 4R9SA 5L7YA 1T2CA 1DJNA 2VHYA 1Y7TA 4XYEA 2BHLA 2GZ2A 2JHGA 3SC6A 1PR9A 2Q45A 3PJDA 2PZMA 2V6BA 4IJWA 1P3DA 3N7UA 3C1AA 4BO0A 1ADCA 3R1IA 2YQ5A 4N18A 1U3UA 1UH5A 3GHYA 1X7HA 2DPGA 3PI7A 3R3SA 2I76A 4DL9A 4NHEA 4DIFA 3HDYA 4XR4A 1BDBA 5JYDA 4JIGA 1JLLA 1B3BA 1LI4A 1JKJA 4RPJA 1IZ0A 2FOIA 1PEDA 2WDZA 2NVBA 1H6BA 2CMDA 4ALIA 5A9TA 5I7VA 2VTEA 4ZVVA 4RORA 4LVCA 3U4HA 4E2XA 2H1SA 3NRCA 3OJ0A 4LN1A 4HNHA 4ALKA 1EZ4A 4BNKA 4E5KA 3K2EA 3AOEA 4R1NA 1PJCA 2YW9A 3GVXA 4XJSA 3ZW9A 4KDFA 4CR7A 1ZK0A 1EVZA 2X23A 3Q1LA 3DHNA 1WVGA 1NVGA 3NX4A 1C1XA 2OP1A 4WKGA 4BO4A 1BG6A 4GGPA 2B4TO 4JJFA 4EDFA 2WM3A 4U8GA 1C1XB 2VNAA 1B15A 2C7GA 3AOEC 2ZKLA 1LTHR 1K5HA 1WMBA 4CM8A 5TF4A 4A10A 3PGXA 2ZIZA 3DB2A 1OI7A 1EFLA 5JCJA 4DBVO 3GMDA 4YJHB 5CEEA 2NACA 4NPCA 3TRIA 4G81A 4DREA 4L73A 3WIEA 2IDZA 1Y8QA 3WTCA 4QT0A 4E2YA 1UZNA 3O8QA 5ITVA 2PTGA 2B36A 2HMVA 6ADHA 1Y9AA 5IAAA 1VL0A 5H82A 3U3XA 2V6MA 3T4XA 4ZHSA 3LC2O 3UOGA 7ADHA 4NFSA 3S8MA 4N7RA 3LYLA 4RDHA 4CMGA 1CEQA 1OZAA 1PTJA 5CAEA 2ZQYA 2ZB8A 4FOSA 2D59A 4CMBA 2J6IA 4PN3A 1UXKA 3E1KA 1ZIDA 3DBLA 1OBFO 3QVTA 3PLRA 1P1JA 3OICA 4CQLA 2YY7A 4NFYA 1E7QA 1B8VA 5DOVA 3M2PA 2JJYA 3PJFA 4MP3A 4NK4A 3CH6A 5ENVA 5L4NA 3B1KA 3ZV4A 1U7TA 2J3KA 1Z6ZA 2CFCA 3C1OA 2CDAA 2POQX 5IDQA 4PG8A 4QEDA 5G4KA 4BKUA 1PZEA 4ZGWA 1Y81A 1HLDA 2PD4A 4KUEA 1TEHA 1MG5A 3PGJA 2G82A 5TNXA 1YBMA 3QVSA 4MPDA 2HKIA 4P4NA 3WNVA 1AXEA 2J5QA 3DZFA 1UP7A 4E4YA 5JAZA 1BXGA 2DC1A 5IXYA 4Z0TA 1YKFA 1BSVA 4J9VA 4CLOB 3LQFA 3PDJA 1VI2A 3TL2A 3IUSA 4Z0HO 1XLTA 4R41A 1X0XA 2GLXA 3S2EA 1LDBA 1CQIA 4JBHA 1I3KA 4HFJA 1EVYA 2ZCVA 1I2ZA 3N74A 2R6JA 4UVGA 1DC3A 4NJMA 1MLDA 3PQDA 5EERA 1EFKA 4FSHA 1TT5A 4PCVA 3OIGA 5DBFA 4OGWA 4BHTA 4YRDA 1EK5A 1EMDA 1U2GA 2Q1WA 1K6JA 2HJSA 3PK0A 1ZNQO 3GFGA 1GY8A 2NQ8A 3JD0A 4QFCA 4WLFA 3PP8A 3M1LA 4YACA 3LF2A 1JVBA 2Y05A 1E3WA 1R0LA 3E5MA 4XQCA 2CF6A 5DNAA 3FNEA 4JCOA 2PWZA 3E03A 1E1NA 2NTVA 5ENDA 3ULKA 4Z3KA 4IJUA 2Z5LA 1I3NA 3M1AA 4J2HA 4MIEA 3WYBA 4G65A 3RBVA 2P9EA 1WDMA 4TKMA 4GH5A 1LX6A 3JQDA 1IHXA 4BUCA 3B6ZA 4QO8A 4CV2A 3DBVO 3H5NA 4J4HA 3FPLA 3TNLA 4TVBA 3WGZA 4FFNA 5AXAA 5COAA 1ZFNA 5B1YA 1KEWA 3HWRA 3LLVA 5B4UA 3JQFA 4JP2A 3JYPA 2WMDA 3JSAA 4J0FA 4M49A 3V5NA 4OSOA 4W9NA 1DFIA 3VPSA 2VWHA 4Y6RA 4OL9A 3S55A 3KO8A 3DTTA 4E21A 4KP7A 1EVIA 1NASA 2GASA 1P33A 2Y99A 1TVEA 1MFPA 1A7KA 3QWHA 4B4UA 3JQ7B 3H3FA 3RAJA 1YXMA 1F06A 4J6FA 5TT0A 4RF3A 1R4MA 2DBQA 4W9NC 1DIGA 2NTNA 2GNAA 4FJ0A 5JAQA 4YAGA 3DZHA 5FYDA 1HZJA 3VPHA 4P22A 1PX0A 1R4MB 1IOLA 3PHGA 3I5MA 4DQVA 5IDYA 1DEHA 3FNFA 2GN9A 3T7CA 4OSPA 4W99A 3WWYA 1LRJA 1R0SA 4U5QA 1AXGA 2ZYAA 5F1OA 5I9MA 5GY7A 1GFSA 1K89A 4OOEA 4E12A 3FRJA 3ZNQA 4BNZA 2Y93A 4F6LA 1UZMA 2I3GA 1P0CA 3CXRA 2NVUA 4EUFA 5JY6A 5KJEA 2C0CA 1CQJA 3LK7A 3ZWMA 4Q3BA 4Z3DA 1E3JA 1P77A 2NVUB 3NGLA 3TF5A 4UEKA 5K6AA 1LU9A 5A5FA 4UUMA 5ADHA 1GU7A 4UREA 4CV1A 2O7QA 3E9QA 7MDHA 1LBEA 4E6PA 1B2LA 4RF2A 5KVCA 4A7PA 4BGEA 2D1YA 4F46A 2AEJA 2OO5A 4DPLA 2I99A 4AJJA 2NVWA 4WE3A 4DLLA 3LC7O 5F5NA 3RUCA 1A5ZA 2DVMA 3RC9A 5IFLA 4XQ9A 4HFRA 4XWYA 2X0IA 1A7AA 1G0OA 3IP1A 5H81A 2I65A 4DIOA 3JQAD 1FK8A 4I9NA 4IZHA 3QVOA 3GGOA 2O2YA 1YBAA 3AY7A 2FR8A 4QECA 4FFPA 2I5PO 1R37A 3RUHA 4DRYA 4D3DA 2Q1UA 1WZIA 1YDEA 2B35A 2AW5A 2VZ0A 5DBGA 4I9HA 3F5QA 4BKRA 4CMIA 2FPGA 2HQ1A 1N9GA 1SAYA 1P1FA 1YBVA 2VYVA 5AOVA 1N1GA 3SVTA 4CMIB 1V6AA 3ONDA 4CQMD 3UN1A 5B4VA 2BI8A 4HNGA 4MVJE 4Q3EA 4I8XA 1FF9A 2J3HA 1I8TA 1X1TA 2E37A 2SCUA 3KTDA 2WE8A 3BAZA 2PH3A 3EGOA 4IGFA 5BT9A 4CR8A 2QQ5A 2ZCUA 5BNFA 3RCBA 3ZWOA 3GAZA 3VTZA 4R1TA 1XWFA 2GRAA 1I3MA 4HX5A 3JQCA 3SXPA 3MJVA 4Z0PA 3T4EA 4UVHA 1OAAA 4B7UA 2AG5A 3WR5A 3GEMA 1YOVA 1D8AA 3CTMA 4I1IA 3WNQA 5DBIA 4FPXA 3F5SA 4Y6SA 3CINA 4J9UE 2E48A 2WYUA 4TQGA 2Y66A 3FBTA 3WGYA 2G76A 3GRKA 4DPMA 4DXHA 3HG7A 2PKRA 3V2HA 5F21A 1ZBQA 1LSUA 3OA2A 4ID9A 4CMEA 4FOOA 1Y8RB 1I10A 2O3UA 3W8FA 1PGQA 2Y1GA 3RUDA 3DXFA 4OIMA 4WNCA 2CDBA 3FPCA 2C2YA 1NPDA 3TN7A 2GO1A 3OA0A 1PL8A 2C59A 2WD7A 2B37A 3PHIA 3I9NA 4PIVA 1O94A 4YJDA 3H6KA 3K31A 4O59O 4YBZA 2NV6A 2X22A 4CLRA 3UGKA 2GGSA 3GF4A 4PLPA 1RWBA 3VH4A 3L77A 3HSKA 1U3WA 3FR8A 1KIFA 1HDYA 5KVQA 5IZCC 1R66A 3A4VA 2XOXA 5FI3A 1R4NA 2DTXA 1HE3A 5KKCA 4HWKA 2BFMA 1OC4A 2NUAA 4YPOA 4FQ8A 2FY8A 5DCUA 2DT5A 4JJGA 4XB2A 4HV4A 1N8KA 2R00A 5G0SA 2ZK7A 2NTJA 3PWKA 4I9UA 1DHTA 1PQUA 4QO7A 3GDFA 1KVUA 1B0AA 2GCGA 3OQ1A 5A06A 1QXSA 3PHHA 4U6SA 1WLYA 1X13A 4IDAA 4XKJA 1UDCA 1VL8A 3WLFA 3OJFA 3A06A 2ET6A 4GPD1 1W6UA 3PTZA 4Z9YA 4YT8A 2QYSA 2EGHA 1T4BA 3OM9A 3TFQA 2QIOA 3H9JA 1JDJA 2NU7A 2XXJA 3TOZA 2NSDA 1T26A 2PR2A 3KV3O 3Q11A 2VRCD 4J16A 4XA8A 2VOJA 5JDIA 5JO0A 4JK3A 3JYNA 4BVAA 2IXBA 2VUSA 3GHHA 4E33A 1NVTA 1XHLA 2P9CA 3CUKA 3TPCA 3EVNA 5CPFA 5BSHA 4XR9A 1N92A 3VDQA 2J3IA 1PGJA 1PZHA 3DTYA 1VL6A 2IZZA 4IJKA 5AYVA 1SPXA 4UVIA 3A1NA 3KYDA 4R5MA 5KTKA 1J4AA 1O95A 1MC4A 3FBGA 3UCFA 1LSSA 4GWKA 4BNFA 5JFOA 1EDOA 3AI2A 4PLZA 4PLYA 2ZTVA 4KWHA 5A02A 2XF8A 1G0NA 3ZWPA 2DTEA 3B20A 1ZJZA 2D5CA 1V9LA 4XDZA 1GZ4A 2IRWA 4OM8A 3WTBA 4IQ8A 3MJCA 3ZI0A 4D43A 2X1HA 5A4DA 4KTTE 3UAGA 3ZU5A 3W4JA 2O3RA 2X58A 4A0SA 2FZEA 5GMOA 3KHUA 4URFA 1YB1A 2PNFA 2EP7A 2IZ0A 1P1RA 1T4DA 1YE3A 1QLHA 2ZYDA 4RF4A 2R2GA 5I7FA 4IGEA 4TRJA 4AICA 4WCDA 4GSKA 4RVSA 1ZMOA 3GMSA 1LA2A 1Z74A 2PV7A 3K73O 3AWDA 2PD3A 1ENOA 2EKPA 3HZZA 2YQ4A 4J4BA 1ZUD1 3BIOA 1NFRA 3PIDA 3LT2A 4MIOA 1XELA 3SEFA 4DWVA 1RM0A 1M2WA 1HYEA 4ZRNA 5JDCC 1HDRA 1ADGA 1PGNA 4IJVA 5DCYA 1QSGA 4TZTA 4WCFC 2VYNA 4RDIA 1GYRA 3K92A 3WLEA 4DQXA 2GZ1A 3ZV3A 3U4DA 4EBFA 5COQA 2ZTLA 1YL5A 3AUTA 4D0RA 3SLGA 3W4KA 3L6EA 3RIHA 3S1LA 4J91A 1GYQA 1JQBA 3I23A 1LDEA 4L4XA 4CV0A 1YB4A 2EG9A 3U4CA 2Q49A 1PIWA 1O6ZA 3R3JA 4BO8A 2HSDA 1PQWA 2O2SA 3EZLA 1R6DA 2DBVO 3KOUA 3NGXA 2YZ7A 4CM9A 3CZRA 4WASA 5L45A 3H65A 1GPJA 2AG8A 4KUGA 3WGIA 4AVYA 3N58A 3T7EA 4CMKA 4LGVA 5JXWA 4HADA 4CODB 3U9LA 4C4OA 5IJZA 4EITA 1GYPA 2B0JA 1ADFA 1CWUA 3IQDB 3OP4A 3FNGA 1A27A 2PGJA 2ZYGA 1G6KA 1HYGA 2UUOA 2Q3EA 4XGKA 1OOEA 3W6ZA 4E5YA 1HDOA 4ONEA 4R1UA 4PGFA 1I24A 1DLIA 3HB4X 3LT1A 3G1UA 3ROMA 3H9GA 2JFGA 3NJ8A 3W8DA 3JQ9C 1ZK3A 3WSWA 3GFBA 3KSZO 4PVDA 3GT0A 4YT2A 4BMVA 2P5UA 1EDZA 4BKQA 5HS4A 3P7MA 4B4VA 2NWQA 3ZWAA 4MVJF 1Y9EA 4DGSA 4ND4A 3OEYA 4EJ0A 9LDTA 2D5AA 1LLUA 3X2FA 1XDWA 4D7AA 3ZU4A 1CIVA 1KOLA 1Q2XA 1WPQA 1B8UA 3OIDA 2Q2VA 3KETA 1G1AA 4E0BA 3L4SO 4RLSA 5GZ1A 1D7OA 3G0OA 3WBBA 3TSCA 1FDTA 2Y67A 3GZ4A 4MVJG 1SO8A 2Y0DA 1P0FA 4F6CA 2OOSA 3FTNA 3IL2A 2W2LD 5AXCA 3RU9A 2VCYA 1J0XO 4PG4A 2FHSA 4ZD6A 4W7HA 3GR6A 2A92A 1ZH8A 2OHXA 1U4SA 1EK6A 1C1DB 3I9OA 3QWBA 4B7XA 3HB5X 2HLPA 1BGVA 2VWQA 4XYGA 5L4SA 3VVCA 3RFXA 3F3SA 1HRDA 3L4BA 3W1VA 1P45A 3BZUA 4UUOA 1H94A 3RC2A 3GRPA 4FS3A 4PFJA 1QP8A 4YVFA 1PJBA 4B3IA 1EQUA 5TGDA 4J1SA 3ZWNA 5IXSA 4NQZA 2C20A 4OOFA 2Q4EA 4DVJA 1UXHA 1Q7BA 3RI3A 4BO9A 4W4TA 1PZFA 4NIMA 3L4BC 3WX0A 4M86A 3MTGA 3DDNA 3QE3A 5TJ9A 4E5PA 2X9VA 1AGNA 3BTUA 3RJ5A 4NZ9A 1ENYA 2DPHA 4OQYA 4D79A 1I36A 4BMNA 2GN6A 2UUPA 2HRBA 3TJRA 3FD8A 1FXSA 4FFOA 1MXHA 3GA0A 1X14A 2VHZA 1ENPA 2HMWA 2QRJA 4MINA 4CLDA 4FJ1A 3PIIA 1HDCA 3NDIA 1LSOA 5B37A 1UUFA 2X5OA 5JLAA 3VZRA 4E2ZA 3GDOA 1U9JA 4XQGA 2Q46A 4Q3AA 1ZK4A 5TT1A 3NTOA 5F1PA 4DYDA 4PLWA 3KVOA 2DQ4A 3FWNA 4H16A 5B12A 4RV9A 1JKIA 5IF3A 3H7AA 2PY6A 4K6CA 2X0NA 4DYVA 1JU9A 1HSOA 4PZDA 4BO6A 4EJMA 3O38A 2RAFA 1ZO8A 4YJHA 2CVZA 3K5PA 3HN2A 3WB9A 3VOSA 5C7OO 2QW8A 2X6TA 1H9AA 1BXKA 4HFNA 1TB4A 1RKXA 4I5EA 1EEHA 1PSDA 1PL7A 4PLTA 4CM1A 5EINA 2RHRA 3PFFA 2HK9A 1LDYA 1QYDA 4ZJUA 5KJFA 4AJHA 5JS6A 1HDZA 2IYOA 1NXQA 1OC2A 5MDHA 4GKVA 2UV8A 2VHXA 4IDDA 3EUWA 2J5RA 3A9WA 3D1LA 3I4CA 2HK7A 2C82A 4HXYA 4LSWA 4PG6A 5EESA 4C7JA 4ZN6A 4CPDA 5A5EA 2EGGA 4N5LA 4PLVA 2A94A 4R54A 5T5QA 3D5QA 3DMTA 3SLKA 1I2CA 3WWZA 3EY4A 5KIAA 4IPTA 1ISIA 3VTFA 1NQTA 4HKTA 2OBYA 3BMNB 4Y67A 1KVSA 2JAPA 5C7IO 1A9YA 3O26A 3I6QA 1TLTA 3RBZA 1V8BA 1X15A 3ZHYA 3DOCA 5MGBA 1K6XA 4IDEA 4IS3A 2JKVA 1WXDA 3DMTC 1JTVA 1Z73A 4LMRA 3Q0EA 4TROA 4DUPA 4MOWA 2CUKA 2D3TA 1QORA 2H6EA 4CUJA 2G5CA 2QHXA 5ER6A 4YQZA 3P5SA 4R01A 3FHLA 1GADO 4S1VA 4IDCA 3NT2A 3V2GA 1M75A 4WJZA 1E92A 4WK6A 2X5KO 5EIOA 3PZBA 3DL2A 2X9GA 3WJ7A 2PZLA 4MVJH 4FGSA 1GUZA 4CLOA 3QLJA 3PYXA 3CPSA 1T1SA 1DDOA 1IHYA 1FDVA 3S2GA 3ZV6A 3S2IA 2HMSA 1EVJA 3TQHA 2JCYA 4S3MA 1C3VA 1E0DA 4XX0A 2OP0A 4RQUA 1R15A 3BHJA 4NBVA 4WGGA 4GKBA 4MVJP 4O63O 3HUDA 3VPGA 3VPXA 3FF4A 3PYLA 4BNYA 5K9ZA 3H9UA 2EW8A 2JFHA 3ZH2A 3GPDG 3LT4A 4CMAA 2X9NA 4GVXA 2D2IA 4AJ2A 3L07A 1D4FA 3KYBA 3PEFA 1RM3A 3EZYA 4KMSA 3PHJA 4GX1A 2BKAA 3AUSA 3WGQA 1BVRA 1FDWA 3BMQA 5A03A 1P44A 4BO3A 2NADA 1HSZA 1YL6A 3UH1A 4UVDA 3RJ9A 3BMQB 1ZEMA 4BQPA 1ZMTA 5EJ2A 3NTRA 4O5OA 4XRGA 1GUFA 1I33A 2JL1A 4LK3A 5JC1A 4NH4A 3IS3A 3STHA 4KQXA 2A35A 4ALJA 3MZ0A 2HAEA 4M8SA 3ZNNA 1PJ3A 2RBEA 4W6ZA 1GZ6A 3LT0A 1LJ8A 1AE1A 1K2WA 5KVVA 4RVGA 4WEQA 5IDWA 4I5GA 1LEHA 5TS3A 1CRWG 3MTJA 4INAA 1X0VA 4MIYA 1MP0A 5L3ZA 4E5MA 2HJRA 3ZU3A 3P19A 3AY3A 2O23A 3JYLA 3DBHB 3C24A 4WOKA 4XJTA 2VHWA 5CPBA 1NNUA 4KZPA 4J1NA 2ZJ0A 3BMOB 4AJPA 4G5HA 1XCBA 5IG2A 3B70A 4JROA 3JQ7A 5FFFA 2AHRA 4QUKA 3GZNB 5EMHA 4EUHA 3P2OA 1U8XX 2BGKA 3OH8A 3JQFC 2LDBA 5JC8A 4OJNA 3ANMA 4TWRA 4BQRA 1DLJA 1I5RA 1SB9A 1T1RA 3MOGA 4IIUA 2OMEA 1UDAA 2DFVA 5KCZA 5L51A 4Q9NA 2AMFA 5B4TA 3W6UA 1K3TA 4XGNA 1LRLA 4D3FA 1ISMA 3RROA 4YAIA 2QYTA 4IQ0A 3IP3A 3PJEA 2WEKA 1E7RA 1B14A 4FC7A 2AQHA 2I66A 3GVHA 3I9LA 5CEJA 1NHWA 2EJWA 3KUXA 3DMYA 4W7IA 3U5TA 4PLCA 1GV0A 2PD6A 5T8KA 3U49A 3EK2A 3HHPA 3FI9A 4GL4A 5I8WA 2EJVA 1X7DA 3KLPX 3DFUA 1Q0QA 5A04A 2Y1DA 4ROSA 1X7GA 1V35A 1ULUA 1UXGA 2HK8A 4XYBA 1GUYA 5BQFA 4D0SA 3D0OA 3ORFA 4Q3CA 5HS6A 2PGLA 5H83A 3ETDA 3VZPA 1Z7BA 3JYOA 2YJZA 2VWPA 3PRJA 5TJHA 5CDUA 5K6AC 1U4OA 2P68A 2Z1NA 2QG4A 3VHRA 2WSBA 3OF2A 2EIHA 4PG5A 4AL4A 3IIEA 2AE1A 1CETA 1YONA 4IS2A 2JCXA 1XA0A 3TZHA 3ZWXA 3SBOA 5L40A 1P9LA 4B8ZA 1XSEA 1Z75A 1C0LA 2GN4A 2W4QA 3LU1A 1DHRA 2VYVD 1PJ4A 4FD3A 3NTQA 1ONNA 2X8LA 4HP8A 3MEQA 2EEZA 3SJUA 3UCEA 4BKOA 4RZIA 4LRSB
chains in the Genus database with same CATH superfamily
3NUGA 1N2CB 4IBOA 2A33A 2X3UA 3E9EA 3RDPA 4DTIA 3TLJA 5CG1A 4KITB 1YQDA 2AC4A 3JQBA 3U5ZB 1TUIA 4X1KB 1E5TA 3TRKA 4CFSA 2Q2OA 3SWWA 3QKSA 4BAUA 2Q5IA 2CBXA 1ISJA 1L7RA 2B1GA 1FOEB 5IUNC 4PYOA 2VAPA 5FNZA 2EWMA 5KNBH 4BLVA 2VPWA 2BGMA 4UCWA 4GPZA 3CZPA 5BSVA 4AKSA 4BP8A 4S24A 2QDXA 4JLWA 3PXXA 3ISVA 1Z0JA 2ZT7A 2OCAA 4EHIA 3WMFA 5BV1A 2WIJA 1OPRA 1VMIA 2MOKA 4UEOA 2ZJZA 3Q6MA 3OLWA 3HCDA 4XYLA 4B9EA 3C3PA 1PGPA 1VJ0A 4RVNA 4RZQA 4EA6A 3P2YA 1PCXA 1YK1A 1WY5A 1XAIA 2WPDD 2XF2A 4DWOA 1L7DA 1TOAA 1Z34A 4OB8A 1IOWA 3PEUA 3RC7A 4G5GA 4NXNB 5HW0A 1V1MA 4MX8A 2QVCA 3DP7A 3ZLJA 4Y2HA 3HA5A 1JG1A 4Z54A 5DN6D 1LUAA 1QIKA 1FFDA 3MTEA 2R84A 2JLCA 4CMCA 1J5PA 1OUMA 3V46A 1D6NA 3IBFA 2FG6C 2IIVA 4MYUA 1ZICA 2J08A 4X65B 3IULA 3M9LA 4GSYA 3VR4A 3ESQA 4D8XA 1W0CA 5DP1A 1COWA 1U7WA 3AFMA 2FN8A 3I1JA 5JAHA 3CNHA 1MGOA 1P2UA 3DWFA 3AI1A 3M5PA 4ZWNA 2J59A 4LY3A 1UMCB 1PYDA 3SG0A 3BSWA 1UJNA 4RF5A 2O0HA 3A70A 3FFWA 3ZD9A 4A3SA 2BFOA 3FNHA 3ACBA 4GVPA 5G4LA 1MDBA 4MUKA 3B6KA 3AV0B 1FRNA 2LCQA 3AUFA 4IV0A 2JI8A 1P8AA 1RHUA 4KWCA 4P7KA 1O94C 1BWRA 2IXEA 4JHXA 2BFEB 2Q0XA 1T4GA 2QRUA 2IH2A 3I09A 5AVXA 3D6UA 1Q14A 4C0BA 3FN4A 2MHCA 4PVCA 3FDZA 2HO5A 4AZVA 4CMJA 4R40A 3U4AA 2XVZA 4GSLA 3VR0A 4DDKA 3HJUA 1PS0A 2X7XA 2XA2A 4GPIB 5FB3A 5JS8A 2YXDA 5IZ4A 1P4SA 3C5WP 4C6HA 3OZXA 1JALA 4F93B 1OFGA 3S68A 1X7YB 2I2XB 5GJWC 1S2OA 4J8PA 4UOZA 2FPPA 3IBGA 1E0SA 3TPZA 1IY1A 4AMBA 3D7LA 3NQ41 1M5RA 4H77A 1HI9A 4D6XA 3RRYA 4JN6B 1IN4A 1AVTA 1SOUA 2MMGA 3AR3A 3CX8A 1D1SA 2R00C 2WRZA 3HKBB 3IQGX 4QFBA 3H7IA 3WGUA 3N39C 4ERXA 1B2RA 5H9WA 5HR5A 3EXIB 2HB6A 1P9OA 2VF4X 3ANNA 2I6QA 4OHPA 2Q7OE 1FLNA 1GAQA 2EJUA 1SOVA 1DRUA 4MRVA 1OI2A 3JAWA 2RHBA 5AVZA 5IPFA 1ZM9A 4AKTA 2IT1A 1NMEA 3QVGB 3DCNA 4FGWA 1QV6A 1ZK2A 4MZDA 4RCVA 5TQ0B 1YFLA 4F5YA 1GSOA 1GTSA 2REOA 2M1XA 2YV2A 3V32A 1ESDA 1RYEA 3E7FA 3SHFA 4IY1A 4EUEA 3EARA 1ZRMA 2Y0EA 4N5DA 1K68A 1B1CA 3PT9A 4H7EA 5DNWA 4F7DA 3M1YA 3VR6A 2J9FB 1IB6A 3AEQA 1U0BB 2RCYA 1K6EA 1ONOA 4MR9A 2YZGA 3LCMA 3NHSA 4NMWA 4XEHA 5CDFE 2GYYA 1MOSA 2A1UB 2R96A 4WLOA 5DH9A 3MWYW 5EC8A 5FV4A 1R4ZA 2J6HA 3ESZA 4I4TB 1JJIA 3VKVA 2NXWA 2VDQB 3G82C 1MNQA 4YMGA 4IVNA 4EJ6A 3WV5A 13PKA 2NTEA 3HVUA 1ODLA 5KJ1A 2VQDA 3DOHA 4ZAYA 3UG7A 2R3SA 2Q5QA 3ENVA 4V03A 4R1SA 5E3IA 2L82A 3NHWA 3IEXA 2CJYA 1P62B 2G88A 1W88B 1PL0A 4XB6B 2FXVA 4EEZA 1IUOA 2FE4A 4D4IA 3OD1A 3NHBA 5ELLA 3IKVA 1QYWA 3NETA 1DMSA 3GVCA 5CX4A 2JI9A 1B74A 3IDSA 4RKEA 5U9CA 1TIPA 5DDIP 1VE1A 2OV4A 5BSGA 1KAGA 5AJWA 1Q0UA 3WQSB 2ZT8A 4B46A 1O97C 2R60A 3BH0A 3PNMA 3COZA 1DKUA 2OV8A 3BG5A 2PTHA 4NI5A 2X5XA 5DZSA 3B6JA 4YJ2A 3HP7A 1XALA 3HCEA 1L4KA 1RI1A 2IPLA 1CU1A 2W2PA 2KBEA 1NJ1A 3OWXA 1UANA 4LBWA 2PUWA 1FTQA 4C08A 2HBQA 3GLHA 5FDFA 3TZ6A 4FFDA 5EKXA 1QVWA 1DJOA 2F62A 2I6FA 3BXFA 4OHFA 4UPEA 4QSHA 4OU4A 1G3IA 2AZMA 3RQIA 2VYND 1RCFA 1TAHA 4XM0A 3V1UA 3PPXA 4ER7A 1ZRHA 1QFMA 1GQFA 2XKJE 3OETA 2V3CC 3GBPA 2GXUA 4MPTA 2WUDA 3Q9UA 4FE7A 1W2HA 4XTRA 1TM2A 5AO9A 2RONA 3NTLA 1JW9B 3PT5A 2VN8A 3FI0A 3O4RA 3ZYZA 5HXAA 4OHUA 1BAPA 4HBGA 3WMXA 4ZHQA 2QE7D 4M7RA 5L53A 2C5BA 3A3OA 3O4FA 3UFXA 1K97A 5D01A 3LFHA 4GD3Q 3R0ZA 1GR0A 4FILA 4C0AC 4JS0A 4DT1B 1O03A 1N2SA 1XEXB 4O4LA 3VZDA 3C4JA 1Q7EA 4XIYA 3EOAI 3P9IA 1XVLA 1LV7A 3OWOA 4JBLA 3FCOA 1S8AA 4MSUA 2BFWA 4MQ6A 4RGBA 2P4QA 1OX6A 3DP9A 2FFJA 3K4PA 4GZ5A 3DLIA 2GN0A 2ZUVA 4ND8B 3EGXB 4US2R 3DUFB 1ZD4A 4YA6A 1KQ3A 2ZBUA 2V6GA 2ZYWX 3FVQA 3ELDA 5CNKA 5M3BA 3T3HA 4Y8VA 4WZAE 5HBRA 4K28A 5HP4A 3PD1A 3KIPA 4PW0A 4CBVA 4DMHA 3AERB 2IZ7A 2CF5A 3JZFA 4PZ0A 4YRLA 1VPTA 3M6MD 1WW2A 2PGXA 3RF7A 5TRTA 1OSNA 1NBMD 4LPKA 2R86A 3PVSA 1XK6A 2BM1A 2BGUA 4FDVA 2C7PA 2JFFA 1RM5A 4RTLA 4WZBB 2VPYA 3ZZ0A 5HA5A 4LQCA 8ADHA 1OFIA 4MWDA 3DNMA 2V4UA 3MYYA 3GNLA 2QKYA 4BB9A 3GI1A 4WLVA 1W34A 3FTQA 2C54A 3TLYA 2G7ZA 2JGMA 4OQLA 1EQ2A 1M34E 3E9NA 3FNQA 4EX6A 1R50A 2WWHA 4GYJA 4E15A 4DZZA 1SCAA 3AVXA 1OA1A 3B3AA 5AR1A 2NU8A 3DNPA 3LIPA 5A9SA 3HBFA 5CH5A 2CXQA 2FP4B 3EQ9A 3IMFA 3Q9LA 4GI3A 4PG7A 2VSOA 4R1LA 4PHTA 1JIVA 2VYCA 2VRBA 4QELA 3PTAA 1Q1GA 5E6SB 1N0IA 3OPVA 1HE1C 2HFKA 4GX5A 4UVEA 1T8UA 4LZNA 3S44A 3JPWA 1QVRA 5THXA 4LJ8A 4KAJA 3AI3A 3M7IA 1SC9A 2ZBQA 3M81A 2ZUWA 4EW6A 1FYEA 3RVPA 1MBZA 1SCUB 1XU7A 4RANA 5FOXA 2JLAA 1B3RA 3RYFB 3V1MA 1CLUA 2JAQA 3GGPA 1GTMA 4FHFA 3DE1X 5HEKA 4PS1A 1OBCA 1RJ9A 3MRVA 1Q7TA 1A76A 4ND1A 3O2NA 1MB3A 1FYVA 1X8KA 2OENG 1N9KA 4E4RA 1LPOA 2MR5A 1X1EA 3NKLA 1V0JA 1PG2A 1QLWA 3HBAA 2OSVA 3QYAA 1RXVA 2DXIA 3Q6IA 2D00A 4XDYA 1IIBA 5AOAA 2J31A 2ZT6A 3C14C 4CN8A 4G5XA 3L1IA 4L3WA 4MQFB 2PLAA 3VVLA 5ED0A 3LCRA 2PXXA 1XN4A 5AXBA 2FSIA 3AHIA 2DERA 3G0HA 2Y1KA 4GM4A 2BHSA 3DE7X 3PV0A 4QL3A 1NHGA 4DY4A 3KXDA 3F97A 2XCQA 4PYIA 1OGIA 3K9CA 1ZXLA 1BH2A 2Z5FA 3I8SA 4PTYA 4URXR 4MRPA 4Y2YA 1MV8A 1YB5A 4NC9A 4FNGA 1G8HA 4UM9B 5J1TB 3W05A 3BEOA 2C9ZA 3VR4H 2EKDA 2PGIA 1DU4A 3BH7A 3QEMB 4LY6A 3G6WA 3HCOA 1UM9A 1XE3A 2O0JA 3WRYA 3QMWA 2GLTA 4RELA 4DY6A 1FEZA 3IH5A 1GQ2A 3IMEA 1PT5A 2IHJA 1WUTA 1IXZA 2G63A 3W8NA 3DF7A 5EXSA 3JQQA 2NOAA 4JOCA 4QOHA 4AZ3A 1P0QA 4HNVA 5B57C 1JDPA 2R5WA 3AIOA 3P9KA 4YWJA 3WK4A 2WZCA 2PZAA 1S9DA 5JFTA 3KJQA 3QKWA 3RV3A 3CLSD 3IVAA 2UAGA 2PZKA 4B6OA 1LBTA 2X5NA 3RRXA 3GMTA 5TQJA 5BSEA 3D7MA 3VC3A 1FPQA 1UIRA 2AZTA 3C6QA 3DVQX 2Z9CA 3FG9A 2RGNC 3N6VA 5DF1A 4TKLA 3UV6A 1E6UA 4CV3A 1BH6A 1KVQA 3EXEA 2H0AA 4YAKA 2YZMA 1PFYA 4DA0A 2WTBA 4MS1B 4YJ3B 5I9IA 2WWWA 3AEUA 3FJ1A 1NJ2A 2LIPA 4CUZA 5HIJA 4S12A 2A0FA 5DT9A 1R18A 4L15A 4B6EA 4QVKA 4DPKA 2R8RA 2HA3A 1WEKA 3B7PA 3RLIA 1NI4A 3C45A 1JJFA 4GLFA 3RARA 2W42A 2QJWA 3OUUA 5I7EA 2M98A 5BXYA 3W5DA 1Y1KE 2FMKA 1S2GA 1EK2A 2BEVB 2IYSA 1E5DA 2PWBA 1ZHOA 2BKVA 3THRA 3D8NA 4UFPA 3GEDA 4TUYB 4EMBA 2AJBA 3C7DB 2CZCA 1DG3A 2IFTA 3KR1A 3DVRX 3THWA 4TYNA 5FD8A 1G8GA 1J7JA 1Q91A 3EN0A 3UICA 1GSHA 4DYHA 1X9GA 1ZKDA 3NWEA 1P72A 2K7ZA 2R97A 3EEFA 3QLUA 1ONBA 1RP1A 2QTLA 3KZOA 2GEBA 5B3AA 2GN8A 3VAZA 3HPRA 4JXXA 3ETEA 2QPAA 4Q39A 1EM8B 3AKZA 4Q12A 3KU1A 1IDN1 1J1ZA 2AG1A 1HMYA 3DONA 3OURA 3VR6H 3RANA 1VCHA 5L7TA 4Q16A 1FDOA 5CG2A 5IF9A 3TLKA 3FZGA 1Y4SA 2BISA 2HMUA 2IUFA 2ZB7A 4MTCA 5F52A 2FFAA 4JMPA 3ZHVA 4EFLA 2PUVA 3A1SA 3SQMA 2GBCA 4KMOA 4OA8A 3W5SA 2AVDA 4J03A 2Y0CA 1JQ3A 1VHDA 3NCHA 4Y6LA 1PZGA 4I36A 5FP0A 3UKDA 1DSSG 1BZYA 3EVEA 4KXWA 8ABPA 4CL2A 2QR2A 1BJTA 4PYRA 4R8VA 2G3YA 3MM4A 3PC6A 1ODCA 4KK4A 4F38A 2HMAA 1EAMA 4U7WA 5TB5A 3OESA 1VQ1A 3QF4B 1PWXA 3DEIA 4DJFC 5F9HA 2EXXA 2RHDA 3PX3A 1G64A 2H1CA 2PQMA 3HACA 1E0KA 1P7WA 1X92A 2A0YA 3IUQA 4TV9F 5LBTA 3ICWA 2Q3HA 4KO8A 4NDZA 5C5CA 5K0GA 5IVKA 4H0NA 3DE0X 5CB4B 4GBJA 3O8QB 4EJ2A 4L57A 2ZSHA 4WZAA 3TMKA 3VR1A 1SUAA 3L46A 1CD5A 5BN5B 1RI2A 1UBRS 4EB8A 2FX2A 5JNUA 3HQ4O 4P3OA 4H2DA 2REQB 1E9SA 3DQPA 7YASA 3ZE7A 4UKDA 1A77A 4JB8A 5IT0A 5IJ9B 1LS1A 1SUWA 1CUFA 2CXHA 2UVPA 3NM6B 1QO9A 1Z5UA 4KOAA 1B26A 3QBDA 3VC7A 5CTAA 3GRUA 4F6RB 2O54A 3RABA 4OUKX 1C7ZA 4WK0B 4DLTA 2Q6LA 5C1BA 2Q3MA 3KT0A 3DEAA 1M34A 1RPJA 3K71B 1OCEA 1A3CA 2QMYA 4JZYA 2ON6A 4MKHA 4ZVUA 4R68A 2ZROA 2Q5JA 1Z5WA 3TZKA 4P92A 3B85A 1GRRA 2GO7A 2F8MA 4Q9IA 4YASA 1BFUA 1YU9A 4QU5A 3X2EA 1DWQA 3VISA 2IYXA 3AYZB 3U2QA 5LNK1 2COKA 2P3OA 1KSFX 2C9CA 2NV0A 5HF8A 3I58A 4R9RA 3BXXA 3ID6C 2OL4A 4RJKA 4L3OA 4F3YA 2XX3A 1A4IA 2VH2A 2W6MA 3C5CA 2YJTD 3S1AB 3VSAA 3VFDA 5GVSA 2HUPA 3K1JA 5KSWB 5JBIA 3CZMA 4CKCB 1RKVA 3JQPA 5HF5A 3FB1A 3OTWA 3MQ2A 1UAGA 4NFHA 1AOXA 2CLDX 2OEPA 3DHEA 3EIEA 4JBIA 1KJZA 4DSZA 1JYSA 1WHSB 2G1KA 3K1AB 3MWJA 4MEJA 1ESZA 3AKCA 1J6UA 4XQ0A 2D0IA 1ETUA 4ME6A 4OAPA 1P6UA 4M1WA 2AKYA 4YR9A 5C8VA 4C6TA 3N7TA 1VG9B 3KKQA 1HH4A 4GICA 3HU3A 4P32A 5JLJA 1DC7A 2HRZA 1DQNA 1JHUA 3QQPA 3D6HA 1F8FA 4L95C 5F2OA 1SB8A 5CD9A 4OFWA 1UT5A 2ENWA 3IERA 3JCZA 3ZLTA 2QD4A 1UBCA 5FAKA 3C41J 3SSAA 2XD4A 2JGDB 2Y0PA 4PIMA 1W5EA 4UTPA 3D0RA 3EMVA 1G291 4RK7A 1A50B 5LDDC 2GHIA 3GH3A 1IBSA 3FWZA 3WKCA 1LXCA 2YASA 3SEQA 3HS3A 1W36C 3ZWYA 1JX6A 1OILA 1Y1LA 3HI6A 2O7NA 1YZTA 3R44A 2G9NA 1NVVQ 1JJVA 2BFNA 2I6TA 3EE6A 3WDKA 5IVHA 3W8EA 1RYNA 2AQKA 2D8MA 4ZCIA 2EX1A 2DFTA 3S28A 1PRYA 2E4AA 3DZBA 1RRPA 1HOTA 3M4XA 4DBZA 2V0NA 1IMOA 1BXRB 2B98A 3ZKWA 2QSYA 3FMPB 2RH4A 4JEHA 2Z2XA 2NYUA 1FLAA 3R6GA 1USUA 2Q5HA 2VUIB 1CQPA 5F3RA 1E6LA 2DBZA 3NTUA 5JYEA 1NIJA 2I3BA 5KNCA 1P60A 1V9CA 1QHEA 1WP9A 1GPLA 2RKWA 3AUUA 3FYUB 4UNQA 2P8SA 3OQPA 5HQTA 3QX8A 4K9KA 4XWAA 4XTCS 1I0ZA 4FFLA 1HORA 2J30A 3U62A 3TTWA 1IMJA 1P2VA 2YWDA 1Y7PA 4YRMA 5CHEA 4KYVA 3WWEA 4ZJZA 2GM4A 4JT2A 4YPFA 5CGQB 1IY8A 1UJ6A 3GAFA 4P4LA 4FT2A 4ZQGA 3VHXB 1D2EA 5BN4B 3W5CA 4OH1A 1Z2NX 3IVMA 1E8DA 1SEPA 3WXBA 1J0EA 3U26A 4AQ7A 2FK8A 3Q3JB 2WFLA 5EGSA 2V4MA 4OXQA 3K6RA 2QMZA 1YKSA 4KQMA 5BOVA 4UM8B 4L0QA 2EFHB 4P7FA 4DWWA 4WN3A 3V3KA 1JHMA 4MGYR 4HN2A 1KJ9A 2CXUA 2GTIA 2VHEA 3M34A 1ZVMA 1E4EA 4JQZA 4QPZA 3LDFA 3S7TA 4E14A 4EUSA 3CT6A 2QV7A 1Y3AA 1Q12A 1NBAA 3B6MA 4A0FA 3E3AA 4DBLC 4DIDA 4QU8A 1JRLA 3COWA 4G3XA 4IH4A 2DR0A 4JX9A 5BR7A 5D3ZA 3RYHB 1M1UA 3ZN2A 4CCWA 5JSUA 3EG9A 3WYGA 4Y2TA 4DSOA 1ZW6A 4FBGA 1VKJA 1Y9DA 2P6PA 1ZJWA 4M0FA 2BLNA 2V7UA 4HZUA 3L8FA 4JLKA 4DSNA 3MGBA 3UXEA 3ZZTA 2HPHA 2HCTA 4M98A 4OKIA 2FRXA 3GVIA 5JPIA 3C7CB 3T7KA 2GN2A 4GKJB 1EBBA 5K0ZA 2INGX 1XZLA 5T8KC 3DR3A 4PRLA 2GRJA 3PDUA 1UEJA 1RE1A 2BGNA 2NG1A 2GPTA 4HDSB 2ODEA 3LGSA 4R7ZA 4FYJA 1DRKA 1RZRA 3U6BA 1CRZA 1H2HA 1EE9A 2E89A 3LF1A 4EUKA 4NXMB 3LW8A 3TYXA 3VGPA 4PLGA 1NOKA 5EZYF 4Z2YA 3EODA 4YT4A 3GJ8A 1AGRA 2D1QA 3A1TA 3H5OA 5B7NA 1BOFA 1Y1PA 4ADSG 3B7GA 5AHWA 5D1NA 4AMGA 2ZI5A 3HB0A 3TUIC 1SJ9A 4D41A 3QFFA 5JCOC 3EF1A 5FUBA 1J5EB 3JQGB 1FQKA 3NHLA 2BGWA 4RPGA 3DAHA 4Y9DA 4GOLD 1GSIA 3ITDA 2CCGA 3A6EA 4O0MA 2E6KA 1XOIA 3K9QO 2KW5A 3HADA 1RLOA 2IXGA 2X86A 3JQAA 3OCZA 4QRHA 1I2BA 2E0IA 3C3BA 3FKSA 1ZH0A 3GZTB 4O4JB 3UWDA 4ZVMA 2HSGA 3LLSA 1NULA 4Q3DA 4B83A 1Q0TA 3QVKA 1DJQA 3U4IA 1VKNA 2A86A 4MCIA 5AW7A 2C2BA 1W5SA 1JHVA 1PGOA 2D4AA 2VXYA 1H0RA 2WV7A 3DFKA 3FPSA 1R16A 3NW9A 5DWQA 5HCUA 1CUIA 4XLTA 4Q5IA 3LZCA 5JPCA 1VSUA 5EIXA 3G68A 1C7EA 2JG3A 3R09A 4GO1A 3PLNA 5JS2A 4NX2A 1PUJA 5IWAB 4CQMA 5L6LB 3LRTA 1LNQA 3AV3A 3JQBC 3ZGYA 3TTSA 3F7NA 1N2ZA 3NANA 4GPAA 3GG2A 3CURA 1YQGA 2XRFA 1WDTA 1GA1A 1EX9A 2W2KB 3A9SA 4NZYA 4P4TA 4I1YA 3R9IA 3RK0A 4BN4A 2QD1A 4JJZA 1XVTA 3NMUF 1VJRA 5KTPA 1KMHA 5BMVB 1OROA 2AFIB 2VRWA 2SKCA 3FSGA 4GXQA 4H7HA 4WXEA 2YV3A 4F0JA 1ABBA 3THYB 2SCUB 1C4OA 3KFLA 1VCOA 1WIWA 4QTZA 3TCXB 1KYTA 1GM5A 1B76A 3CR7A 2XVAA 5AQEA 1ZPDA 2FKAA 2EJBA 2HNBA 4QBHA 1E4VA 1P2SA 3M49A 5T57A 4HFMA 3K15A 3RKRA 4ZMBA 3BRQA 2DBRA 3I9KA 4M9CA 1PWZA 1TZJA 4F72A 3O03A 1RQ7A 1R0YA 3ETHA 3WQBA 4E5VA 1Q3HA 3ONFA 2Z8ZA 2AMYA 2Z04A 1W2WB 4YRPA 4B6JA 4BNTA 4DSUA 4PNPA 3MXOA 1M33A 1IY0A 1JR4A 1P29A 1WUYA 1YRWA 1K4MA 3PRKE 4KUHA 1JSXA 4TQAA 3RC1A 3TQOA 1RAFA 4EKDA 5IM4A 1D1TA 5ABPA 3DTVA 2W2QA 1X38A 3UHJA 1UM8A 5E3JA 4EI2A 1IWBB 2C2XA 1QIFA 4FWIB 3D3EA 1GG9A 4R1OA 4EHHA 5LMUB 2AKAB 4EI7A 5I8PA 1CLEA 3IV6A 2RK3A 1B73A 3PNSA 2DZDA 1NYTA 5TEVA 1DC8A 3ZWKA 1KKUA 1G42A 4AF6A 5K05A 4YHHB 3AVUA 5DHTA 1XIVA 5IZCA 2W2OA 4ND5A 2IPXA 2LDXA 1AK2A 1J00A 1R3UA 1QHSA 1UK6A 5JD6A 4LJ5A 2WD7B 4KEAA 1OVGA 4Q4JA 2A3RA 1AF4A 1KJWA 4X0EA 1Z82A 3DV2A 1DIAA 4V39A 3GRZA 1EH5A 3ZTWA 4EJFA 2JGEA 4QDJA 2O8DB 4TRNA 4L4UA 4B6RA 4ND7A 3TH5A 4Z1OA 2PIDA 1VJTA 3A3PA 5CH8A 5EIWA 1FDIA 1KY5A 2OECA 1N5JA 2HA5A 4G2NA 4PGAA 1KI1A 1Y3CE 3SM3A 3OOEA 1QE5A 4YCCA 2ZVPX 1QGUA 1VIMA 3LUFA 3N7AA 4YJFA 5ALXA 4TL6A 1L3CA 1DXHA 4A6XA 2C0QA 5HG0A 4X54A 1GL9B 2E7ZA 3D2CA 1LKZA 3KZCA 3KWJA 1TGVA 3B3JA 3PDWA 3WRVA 4DNQA 2IYPA 4J0QA 4MHSA 4KG7A 2NUAB 1XQ1A 1PFUA 4DMGA 4FJ2A 2FN4A 3ROKA 1BMDA 2EKLA 2BKXA 1SC4A 3PICA 4DG9A 2V7WA 2WVHA 1KMNA 4BMOB 3EEOA 3GLGB 2G4VA 3NM4A 1THGA 3LDHA 5KZMB 2J4FA 3EGEA 3X1KA 5KYKA 2C29D 4KXXA 3CIFA 2DCUA 3QENA 4JKIA 4K87A 3ASZA 2QUBA 1PJQA 3D4OA 3DEKA 3ETJA 4Q02A 5IN5A 2ECPA 1ORDA 1RYFA 4ZCSA 3TX2A 2V1UA 3V8NA 5IU6A 1RQPA 4XVUA 3D5TA 2BF7A 3H2ZA 1ISHA 2C3MA 1AKWA 2FQWA 4Y9UA 3K8YA 2RFLA 1CUGA 3UZUA 1EUZA 2QOEA 3TOXA 3INTA 1JT2A 3WGOA 1BXZA 4L22A 2F55A 4J3FA 6Q21A 3HUFA 1CUUA 3JVDA 3OUZA 5CT6A 3SCZA 2L17A 2RG7A 2Q2NA 3KWMA 3RUIA 4ZI3A 5A4IS 1V2GA 2JDIA 4P4SB 1Z6QA 2OZLA 3Q8XB 4RCYA 3DBRB 5KOIA 4KQFA 2AL7A 4TRMA 5DK6A 1HYHA 3I92A 3L2OB 3SHWA 3U13A 1EFVB 1O97D 1W94A 5A9RA 2HPAA 4KLAA 2QR5A 4Q01A 3KYCA 2BFDA 2W6PA 3SMVA 1EWTA 1DCTA 4G0YA 5K5EA 2H7CA 1Z7EA 2W90A 2JGKA 3OZTA 1QIDA 3Q7PA 5DOZA 4KFSA 5KNCH 4TZ0A 4F8EA 2FPIA 2FKNA 2IYWA 2HEIA 1C0EA 1M10A 5FO0A 3IRVA 4UUNA 5CVDA 2ZSAA 4C6RA 5K8VA 2WWFA 1GLNA 1EE2A 2JCVA 3L9XA 2PKYX 2Z1MA 2MSDB 3GV0A 3H8VA 2VUUA 3LWNA 3PDHA 5BW4A 3IEIA 3AL0C 2H5IA 4LZLA 2AMJA 4IXWA 3KTAA 1BRTA 1F8GA 2EHDA 3QJ5A 3H1GA 1B8PA 1NAIA 4NCIA 2IEBA 2V03A 1BJKA 5EEHA 2NU9A 1WTAA 3FOAA 4X00A 3NVMB 5BRNA 4P3XA 1PD1A 4F9EA 5JSFA 1SKQA 2TMGA 1N9ZA 1Z39A 2GF2A 5EXPA 1CR0A 4MVJD 1LPAB 1OFVA 1ZH2A 2CFIA 2JGLA 3DGEC 4L5CA 4GMKA 3RS7A 2BM8A 4OKSA 4RSGA 2XMBA 4FZ5A 4GRIA 3RAFC 4YJGA 3BDIA 3W34A 1RFLA 3EWAA 1CERA 3OIFA 5EKUA 3C87A 2HJHA 2HY7A 5CHYA 4WJLA 5JHHB 3SIWA 4B3RB 3GJ6A 4P7GA 4TTTS 3KZXA 5IBCA 1B23P 3F5DA 4LRTB 3P20A 1RXYA 4M22A 4MR8B 1UZLA 5AUQA 4FZJA 1WO8A 4R5HA 3AK4A 3IV9A 4D3YA 3TQSA 4DHWA 3I8XA 2HX1A 1SXJA 1UBKS 1ZOLA 2QTBA 1ZQ9A 2QRNA 2R68A 3HDHA 3OEED 1Z38A 3A9TA 3WIBA 3Q7IA 4I55A 3TBHA 4L75A 1DFHA 2XWBF 1DZIA 4YCJA 4QWWA 4WXPA 1Y63A 3WICA 1V1JA 2P8JA 2WU8A 5HKOA 4F11A 5TQVA 1C9YA 4EY4A 4RZHA 2PKQO 3OM1A 3ZWBA 3HYSA 5FULA 1QO7A 4HLUA 3N2GA 5ALEA 5LXTA 1I14A 3UBMA 4LJRA 1EVQA 2Q6VA 1E7MA 1Q0RA 2FMXA 2IOFA 1IZYA 3QGMA 2VPIA 4PYJA 1Q0HA 4IIVA 4BUZA 4BTEA 1NXTA 1RRKA 1KY4A 1CDEA 4MUBA 1NNLA 4RE6A 4UTZA 4OV6B 2VDKB 2HW8A 1AS2A 3GVPA 4ZVQA 3TZLA 8ATCA 1UDWA 3AR8A 4ITUA 4MUNA 5KTSA 1QAOA 3TLZA 1YR6A 4G86A 1U2TA 1HKUA 1LI7A 2R1TB 4QJ4A 4TM7A 4EENA 2FP3A 3CCCA 2QN1A 4FSXA 2AR9A 4EA7A 5IBPA 5BSMA 2PUAA 1O6BA 1YK0A 2F17A 4PLFA 4CE6A 1EUDA 1YRLA 2P6OA 4MCHA 4D6YA 5JAMA 1GL7A 4OAOA 1PYOA 3ZCXA 6GPBA 5CEFA 1ISSA 2B69A 1OBHA 2R62A 1UKEA 1K7YA 2XKKA 4MEAA 4P54A 1BD3A 1I32A 1YJ5A 2GD1O 2VT2A 1MQ9A 3BWYA 3BTSA 3DWGA 4IJ6A 3LKVA 1O5TA 3B1FA 5MGBA 3QV1A 4W8GA 1Y5RA 3OSUA 1UR5A 1VLQA 1KF0A 3KKZA 3GJZA 3P2IA 3LQ2A 1VXOA 1PDWA 2P78A 4YWHA 3VDMA 4DGQA 1JEQB 1K06A 4DLZA 1KNXA 3LFTA 2VHJA 3F1LA 4ES6A 5BV2P 3L05A 3FWYA 4MA4A 5I3ZA 1U9YA 2C57A 2CMGA 5BVGB 3MTQA 3B51X 2JASA 4C7VA 4D44A 2XMDA 1PJ8A 4NBUA 4JJKA 5DYYA 4C30A 1L7BA 2FSHA 2VHQA 1CULC 1U90A 3MN1A 3UHPA 5CCXA 3FOZA 3AHGA 2BRUA 1TE2A 2O1EA 3IJRA 2HRRA 5IASA 1U5BB 3A3NA 2A7XA 4FDMA 1AUQA 4PNHA 1U0NA 3LUKA 5LC1A 1V4VA 4LI0A 1L4GA 4O0LA 4X44A 4PZEA 1G18A 3AXTA 5J9FA 5D3KA 1IXRC 2GJAA 4WNIA 4I66A 4D46A 2IC5A 2W70A 3FMIA 4AB1A 4HGNA 3GCDA 3SF8B 5L3SB 4EF6A 3CO5A 1I4EB 4FFVA 1VB3A 3T3NA 2GFIA 1PG5A 3IQIX 4MR7B 2UYHA 4NZMA 3OJLA 4LRQA 3QX7A 1FUEA 2QBYB 5A5DA 3I9V6 3GJRA 3AMVA 4NNJA 5EMJA 1UAAA 1CEYA 5IH3A 2WZBA 2W83A 1OREA 2QNRA 1QQ6A 3E7WA 4FNAA 3UJ6A 2HNKA 2J6BA 1QH1B 3IIKA 1DDIA 1N0HA 2ARKA 3KKNA 3NIBA 3PRYA 3PGLA 4FUTA 4J2TA 3UMCA 1SCNE 2G80A 2O48X 5E1MA 4LC9A 4MRMB 2YWXA 1R27A 2W2LA 3L8DA 3OE7D 4MS4B 1GTRA 1T25A 2GZHA 2GSDA 2ZWIA 2R1VA 1I4LD 3NP9A 3QU9A 4YDRA 3TFOA 1X7ZB 1Z22A 1WWKA 2AYXA 3M3DA 1PSZA 3DMDA 3WYNA 4AZ0B 4YP9A 1PR3A 4G0WA 3KB6A 3RQSA 2PYDA 4IUYA 4HNAA 4PPYA 4DJEC 2XV1A 3ZCSA 4LCEA 3WRYC 1UXJA 1F20A 4BC0A 5BQXA 1XNQB 2WV9A 2YHUA 3HB1A 4AX4A 1RBZA 4C3UA 3L7YA 3V1TC 5AJZA 3NNDA 1CS0B 2MINA 5A4KA 5JQGA 1X7XA 1XZNA 4HCJA 4P5PA 2XCTB 3H1PA 5EOVA 1G17A 3KSRA 4XYEA 1L6RA 3LXMA 3A1WA 4IIGA 3T1OA 3UB2A 1Y89A 1XCOA 2G8LA 2QSZA 1Z0DA 2CFOA 1ZYUA 2BGIA 2PZMA 4JYBA 1QNFA 2YNMC 5FPHA 1M6NA 3VYVA 1P81A 4IJWA 4DC9A 1NL3A 2R8PA 2ZIGA 3N7UA 4DQ0A 2B61A 2ETVA 2Y9PB 3EXG1 4OIFA 1L5HB 1I6LA 4N9WA 4PSDA 3SR4A 3HUTA 1UH5A 3WL6A 5IUJC 3PI7A 2Z6UA 5CM8B 1IXYA 1CHNA 1P4JA 2IY8A 1ESMA 2VJQA 1NTRA 3NNSA 5IKXA 3SR3A 3LOQA 2FGJA 1BDBA 5I4CA 3GLFE 1OXSC 1JKJA 3CG4A 4RPJA 2FOIA 1NLUA 1XL1A 4G25A 5E9WA 1SUIA 1UWLA 1NVBA 3PXBA 4H7KA 5TPZA 3O3OB 1H6BA 3ND7A 4JLDA 5A9TA 5T4BA 1MAUA 3EFOB 2AX4A 5KNBD 4YV1A 4G5RA 3WVNA 1OKKD 3BFXA 4LN1A 1HNWB 1L4MA 5B6JA 4G0XA 4BWVA 4BNKA 1MRNA 2ZIXA 1IQUA 3OOHA 1GGHA 2I71A 2ACKA 4QM6A 5FPSA 3UMFA 3AR9A 3SQXA 3VJKA 5F98A 1UBJS 4JLNA 4CI9A 1KEEA 1EVZA 1CQXA 3DLTA 3TAHA 1L4LA 1UBNA 3DHNA 4G89A 5HKLA 3U56A 2HH9A 2QPOA 3NX4A 1ULAA 3ZI4A 1BG6A 3KR9A 4GGPA 2B4TO 3DZDA 3E0XA 1QF9A 3N28A 3R0VA 1EESA 2C9OA 4U8GA 1C1XB 1P2BA 1B15A 1F2TA 2VNAA 4R2HA 3G9XA 2D74A 1FXWF 4U7FA 2ZJYA 5GGXA 1K5HA 5FWXA 3HLYA 2PRYA 5HJ2A 3HLTA 4G56A 5TF4A 1NYRA 4FR0A 3OG9A 2HGSA 1Y8CA 4CM8A 1J24A 2ZSDA 1OI7A 1G6Q1 5JCJA 1OX4B 1UBTS 5E2BA 1J8DA 4DJAA 2JIPA 5A7FA 2IYTA 1OLUB 5CEEA 3T5AA 3MGKA 4L73A 2J9ZB 1NF9A 3OCYA 5C34B 3Q85A 4PWZA 1IN1A 3I6BA 1XRRA 2V3WA 3WTCA 5A0VA 2XVYA 5ITVA 1P0IA 1R64A 6ADHA 3CXUA 1Y9AA 2AOUA 1IZ8A 1JP7A 2O8VA 3AW8A 3Q72A 4RNCA 5DLQC 3IEMA 1GAXA 3IHWA 5AM4A 4QYIB 1AQIA 1DPFA 3BCHA 3UOGA 4ODIA 7ADHA 2IHZA 2QTFA 2WQZA 3D7SA 3S8MA 3LYLA 4Q4LA 4CMGA 1BC5A 5E4FA 1OZAA 3PA8A 5CAEA 4EKEA 3ZDCA 2ZB8A 5D87A 1G8FA 2AT1A 4YV0A 1ULZA 3E27A 3UPTA 1YD7A 2J6IA 1J97A 4XOUA 3LHSA 3T1QA 3ILXA 4PZ9A 3QVTA 4UBLA 1CIJA 3H19A 4J3NA 3HBJA 1YZ3A 3C48A 4AXBA 5HK9A 4CQLA 2WUGA 1ACMA 2YY7A 4A23A 3ICQB 4U8HA 4NFYA 2BFCA 1LB1B 4G0UA 1A4XA 3LCJA 3PJFA 1G6OA 2XB8A 4NK4A 1X8XA 2X1LA 3P2JA 4E1BA 5L4NA 1KI6B 4AU1A 3UAOA 1U7TA 2D7JA 1X39A 2B8JA 1KBOA 1Z6ZA 3NBFA 1OI3A 4BJHB 2OLKA 1ZI9A 3OC6A 3PC3A 2POQX 2OLJA 3PEEA 5IDQA 3MTBA 5G4KA 3JWHA 4KX5A 3GLRA 3TLCA 1Y81A 1HLDA 2IW3A 4EECA 2PD4A 3FUVA 1MZPA 2O8FB 3FMOB 3A36A 4G5YA 3PGJA 1GZHB 3R3UA 5TNXA 2OD9A 1XNHA 4UPDA 4B2LA 3LUDA 2FFQA 4AZWA 5EWLB 5MFZA 1AXEA 3DZFA 2IUTA 3JR7A 3MJHA 4MQ4A 2Q07A 1J0DA 4X97A 4DCMA 5IWCA 1JR3E 1SZCA 5DYGA 5FWDA 1THTA 3BWMA 1PO7A 3IEPA 3NAMA 5CU7A 5JAZA 3NCTA 3THSA 1YKFA 4CLOB 2QLBA 3TL2A 1A9XB 5G41A 3UAXA 1RLJA 4G0VA 5CA0B 5IKOA 3O1LA 5E2AA 3S2EA 1LDBA 1CQIA 1TA0A 2WAOA 3PGMA 3SS7X 1B1AA 1DXOA 4QYMA 3ZW7A 4V2IA 3UANA 2EU8A 1I2ZA 1H4VB 4LI3X 3Q15C 1FJ2A 2W5UA 3IO3A 1M2GA 3IVGA 1DC3A 4UVGA 3VNBA 2SKEA 5A1JA 5JYCA 4UMEA 3PQDA 3F71A 5FI0B 1TT5A 4M9ZA 5DGIA 1W0KA 1CUYA 1EK5A 3CGWA 4JFRA 4DB2A 3AJ9A 3TVDA 1Z13A 2HJSA 5ITSA 3N0WA 2FMFA 3PK0A 2HC9A 4C78A 2HXSA 3OY2A 2NQ8A 2PFSA 3L92A 3QEKA 4YACA 3DOIA 2PUBA 3D1VA 3LF2A 1UMBB 2HLDD 2O8CB 3S99A 1E5XA 1W36B 3E5MA 1YRBA 3LY5A 1U2PA 5DNAA 2WWYA 3DV0A 4KV7A 4JCOA 3E03A 1E1NA 2NTVA 4UQOA 4IJUA 1JIXA 1O96B 2CXPA 2FAXA 1E2PA 2Z5LA 4KQJA 4HN9A 1IBRA 1ZI6A 3BJMA 4PYMA 4R2MA 3UUFA 1XPUA 1WXEA 3DAOA 4EY3A 4G65A 1TQ4A 2A88A 5AK3A 4MUHA 1RKBA 1QFSA 1WDMA 3AHDA 3BD7A 2GX6A 3TMYA 4GH5A 4RGVA 5KYXA 1KFKB 1OWLA 2MT9A 1NQWA 1T1JA 3SDSA 4TSFD 4MW6A 4QO8A 4BUCA 1UT6A 3DBVO 3H5NA 5AVUA 1QQTA 3FPLA 4TVBA 2WP8J 3SN6A 1ZFNA 2CE2X 3LZDA 4M0UA 5CB6A 3VC1A 1M1YB 3DHVA 3DDHA 3VSBA 1KEWA 5B4UA 2WU3A 3F3KA 3JQFA 2CV2A 5LMNB 2WMDA 1R2QA 3FGZA 3JSAA 3SOZA 3D8RA 4J0FA 1E6MA 2B92A 4DLUA 5KPJA 3V5NA 3CLRC 1OLXA 4W9NA 2PN1A 4D57A 3FMVA 2VC2B 7MHTA 1X87A 4LWQA 1CUCA 3CW9A 4QPJC 4LFAB 2YZNA 4HDRB 2A8YA 1FS4A 2IUEA 2GASA 2L0XA 3BXPA 4LDZA 1Q95A 1EWKA 3PPVA 5D3MA 3ZTYA 2R7LA 4EZIA 2K7FA 3CFYA 2QI9C 3FDIA 1HDEA 1AKRA 1JFFB 1RWMA 2NXCA 3JQ7B 3SAJA 3WNZA 5ESXA 3QBTA 1F06A 4LQLA 3LQYA 3WLIA 1QOQB 2QL7A 5DHUA 5DRYA 1F2UA 1AH2A 1R8QA 3CY6A 1C7FA 1N32B 2BMJA 4F71A 2WSSA 3MWLA 4P22A 1PX0A 1R4MB