1KPHA

Crystal structure of mycolic acid cyclopropane synthase cmaa1 complexed with sah and dddmab
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
283
structure length
283
Chain Sequence
b'LKPHFANVQAHYDLSDDFFRLFLDPTQTYSCAYFERDDMTLQEAQIAKIDLALGKLGLQPGMTLLDVGCGWGATMMRAVEKYDVNVVGLTLSKNQANHVQQLVANSENLRSKRVLLAGWEQFDEPVDRIVSIGAFEHFGHERYDAFFSLAHRLLPADGVMLLHTITGLHPKEIHERGLPMSFTFARFLKFIVTEIFPGGRLPSIPMVQECASANGFTVTRVQSLQPHYAKTLDLWSAALQANKGQAIALQSEEVYERYMKYLTGCAEMFRIGYIDVNQFTCQK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYCLOPROPANE-FATTY-ACYL-PHOSPHOLIPID SYNTHASE 1
publication title Crystal structures of mycolic acid cyclopropane synthases from Mycobacterium tuberculosis
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 106
structure length 283
sequence length 283
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.79: Cyclopropane-fatty-acyl-phospholipid synthase.
pdb deposition date 2001-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02353 CMAS Mycolic acid cyclopropane synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1kphA00
2GB4A 3BWCA 3SX0A 1JG1A 3LSTA 4EKIA 4X1OA 4MHTA 1D2CA 3ELYA 1N7JA 3EVAA 2HWKA 2IBTA 2DPMA 2Y1XA 5FA5A 2FK8A 2PGXA 1X1CA 1VP9A 3I58A 4MTLA 3HCDA 3M4XA 2G71A 5E1BA 5E8JA 3FTEA 2P3QA 1Z3CA 3P9NA 1JQ3A 3B3FA 4GOOD 2V7EA 4RVFA 3FYCA 1RJDA 1VBFA 1FP1D 2I62A 4C03A 2OY0A 5E2BA 2NXCA 4NECA 7MHTA 1INLA 3G8BA 2I7CA 5CM2Z 3GXOA 4R6XA 2Z6QA 3GRVA 5LQKA 1NBHA 1P91A 5U4XA 1G60A 3UZUA 5D1NA 1Q0SA 3I5UA 2O06A 4XCXA 3FPEA 3GJYA 3EVFA 3C0KA 4AUKA 1WXXA 3C6KA 3PVCA 1EJ0A 3PB3A 1N7IA 3ELWA 3PFGA 2VS1A 2GH1A 4RVDA 4DCMA 2BR5A 2YUIA 3LX6A 3G2PA 3PX3A 3QOWA 2IGTA 3BXOA 1QAQA 3ID6C 2AZTA 2JG3A 1XJ5A 3BKWA 2ZIFA 4ZTBA 2ORED 4L7VA 2ZW9A 2AOVA 4OBXA 2A14A 4XUEA 4YUZA 5GP1A 3SSOA 3E05A 3IHTA 1Q0TA 3OFKA 4F86A 2ZBPA 1NW3A 5K8VA 2NXJA 1BHJA 5DTMA 3KR0A 4ER7A 4DA4A 4BP1A 2ZVJA 4YMGA 5BW5A 3ER9A 2JHAA 5DRYA 4FS8A 1B42A 3OFJA 4PYMA 3TFWA 3VSEA 2YVLA 2B3TA 3GNLA 4GUAA 3TOSA 3TQSA 4E2YA 3IV6A 5FADA 2AN5A 3BT7A 4F85A 3TKYA 1RI4A 3L8DA 5LR6A 2AOWA 4QVKA 3MB5A 2PKWA 2O07A 2IH2A 4HRAA 4LG1A 4H0NA 5DLYA 2IBSA 1IY9A 2CWWA 2ZSUA 3M70A 4CKEA 1RI2A 2I9KA 2PXXA 1F3LA 3DXXA 3S68A 4A6DA 3SMQA 3EVZA 3TM4A 4B17A 1XCJA 3JWIA 3OU2A 4KDCA 4RV9A 5C1IA 3SVZA 3V97A 5K01A 4ER3A 3BGDA 3DUWA 5DM1A 5F2KA 4A6EA 5CCXA 1JSXA 3D2LA 2OB2A 3B5IA 4PYQA 3DR5A 3PFHA 5FUBA 2C7RA 3UWPA 2ZWAA 2PX5A 2OKCA 1P1CA 4RTNA 5CIYA 4EK9A 1YF3A 1SKMA 5F2OA 4AZTA 1WS6A 3DULA 4GF5A 2V74B 4ER5A 2AR0A 2PBFA 4E30A 5HIMA 2PXAA 2ZBQA 2FYTA 3EMDA 2G70A 1I4WA 3T7RA 3EGVA 2AS0A 3FUWA 4QQNA 3UJ6A 1L3IA 3VYWA 1YZHA 4RTPA 2WK1A 4KRGA 1XDZA 2NNWB 5GIOE 1HMYA 4EVIA 2AOUA 5GIPE 2C7OA 5E8RA 2YXLA 1O9HA 4X61A 3T7SA 1N2XA 3TR6A 3DTNA 2QRVB 2Y1WA 3CVOA 5FQNA 1QANA 1DCTA 3MHTA 2YTZA 4PINA 5FA8A 3LECA 4IV0A 3RW9A 2IP2A 5LSAA 2H1RA 5KQSA 3G89A 1JQEA 1WG8A 3CKKA 2DULA 2IH4A 5LQNA 3EGIA 2PVCA 5T6BA 2WA2A 3NW9A 3VC2A 1QAOA 4AZWA 1VE3A 3HVJA 4PYKA 2PT9A 4PIMA 1L1EA 3KQMA 4PCAA 1JTEA 2FCAA 3O7WA 4P7FA 3UJAA 2EX4A 3B3GA 2G1PA 1MJFA 4E33A 1D2HA 1TPYA 4HGZA 3KQQA 5FULA 5EIFA 1NW8A 3BWYA 3LPMA 3OZSA 3KQYA 5DX1A 5EVJA 3AXSA 3O31A 3FTFA 3KHKA 3FRHA 3GRYA 3CC8A 5FWDA 3BKXA 3E8SA 4U7TB 3KR9A 3G7UA 3RIEA 4U7PB 2C7QA 3WSTA 4GEKA 5EHGA 5CVUA 5EMMA 3DP7A 3DXZA 4RVGA 1RJFA 4HC4A 4IWNA 5T67A 3MCTA 4FZVA 5KYGA 4RTOA 5EZSA 3I53A 3HA3A 1I1NA 2FPOA 3O4FA 4KDRA 3HP7A 2ZFUA 4RTRA 3EEOA 2R3SA 3ORHA 1JTFA 3FUXA 4R6WA 1R6AA 1I9GA 5EEHA 4KWCA 1SQFA 3P2IA 3KPWA 4CWAA 1WY7A 5FTWA 2Z6AA 2PX4A 2NP6A 3GIWA 1FJXA 3DMGA 3UJ8A 1JG2A 4JXJA 2ZLBA 3UJ9A 3MAGA 4AZSA 5K0JA 3FUVA 3G2MA 2Q41A 3DLCA 3A7DA 3DMFA 2BR3A 3I64A 5HIIA 4DF3A 2WA1A 3FUTA 3LCVB 3P2KA 2LD4A 3PX2A 1KXZA 1VPTA 1DUSA 5EMLA 2PX8A 3KQSA 5IH3A 5K0EA 3DH0A 4RTKA 1QZZA 3MQ2A 5K0BA 2ZIEA 3LHDA 4G56A 1PRYA 4GBED 2ZULA 5CUQA 3RODA 3OU6A 3AXTA 3CJRA 3LL7A 3UA3A 4E2XA 1EJ6A 2XYVA 3EMBA 2OO3A 3CGGA 1VL5A 2P41A 2BZGA 4RTSA 4M37A 3UA4A 1G38A 3FYDA 4R05A 3UJDA 3BUSA 4PGGA 2IH5A 5D1HA 5DM4A 1RJEA 1AF7A 3KKZA 3EGEA 1QYRA 2O57A 1KR5A 1M6YA 1SVUA 1KYZA 1WZNA 10MHA 3CJQA 1YZ3A 4IKPA 4FT2A 4YUVA 4YV2A 4RTJA 3M33A 3E23A 4HH4A 2YQZA 3HEMA 2F8LA 2IDJA 4GOND 5C0OE 5DRTA 1G55A 5E1DA 1AV6A 3EVGA 1F38A 2JHCA 3KQVA 4UOEA 3P2EA 3IYLW 3K6RA 5GM1A 3MERA 3GRZA 3MGGA 4PGHA 4CTJA 2OZVA 4OX9Y 2GA9A 2ZIGA 2EFJA 5DT2A 3G88A 3DXYA 1R74A 3I9FA 4KIFA 1KYWA 5E9JA 4AZVA 5C9ZA 5LQRA 2ZZKA 1P39A 4PYNA 5CCBA 1RI5A 3TKAA 3PLAE 3LKDA 2B25A 3IEIA 2HNKA 4DZRA 2H00A 4PYIA 3FTCA 9MHTA 2Z6UA 3HCEA 2QRVA 2ZWVA 2HV9A 1OR8A 2ZZMA 2B78A 3B89A 2AN3A 1VLMA 1XTPA 2JJQA 3G2QA 3FPJA 1RI1A 3OZRA 1JR4A 3VC1A 4BLUA 5M5BA 3G8AA 4PWYA 4ATNA 2XBMA 1ORHA 1ZQ9A 3G2OA 4FP9A 3KR2A 4IV8A 5K0CA 3C3YA 4OQDA 1AQJA 1NBIA 2GLUA 4HTFB 5DTQA 5K0NA 2IFTA 3GDHA 4POOA 4X60A 2IPXA 3KU1A 3HCBA 4P7KA 1BOOA 4QDKA 3M6VA 5EPEA 5CD1A 3A4TA 1O9GA 3E7PA 3DOUA 3HCFA 4BY9E 1YUBA 3LGAA 1PJZA 4CKCA 2GS9A 2VZ9A 3QOXA 4PYOA 5E1MA 5HIKA 2PXCA 1L3CA 2JH9A 3FRIA 2PT6A 4DMGA 3SR4A 1ZGJA 4HSGA 3KQPA 3HTXA 5GWXA 1IXKA 2CL5A 3P71T 4QQKA 4E70A 5EKXA 2EJTA 5EMJA 3MTEA 1P1BA 4PCLA 3C6MA 2G72A 3PS9A 3THSA 2HMYB 1EAMA 3HVKA 4KVZA 5EGSA 5GINE 4FR0A 5DPMA 4E31A 4QVGA 4V0QA 2JHPA 2AVNA 3KPUA 3R0QA 3TMAA 3NVKI 4P58A 1YB2A 1ZHFA 3C3PA 3CBGA 3BGIA 5LQJA 3V8VA 2PX2A 2P3LA 2VDWA 3QV2A 5JR3A 5HFJA 3H2BA 2PV0A 1YFLA 1ZKDA 3MTIA 2XYQA 5EMKA 4OA8A 3BWMA 3GCZA 4C08A 4YV0A 1JG3A 5HOQA 4FGZA 3DLIA 4LWOA 5ERGB 2NP7A 4M7RA 3HM2A 1EG2A 1NKVA 3OE5A 4CKBA 3GO4A 4MIKA 5LQAA 1HNNA 4OBWA 1UFKA 3JWJA 4OQEA 4BLWA 1L3BA 4PNEA 3SM3A 5ICCA 3FPHA 1KPIA 4ER6A 4RTMA 3LDFA 2IDKA 3ANXA 5MHTA 5FHRA 4E2ZA 2ONZA 2QM3A 2VP3A 3M6UA 3OZTA 2K4MA 1NE2A 5DTRA 5EKUA 1NW6A 5FWAA 3HVIA 1RI3A 5LQUA 4QDJA 4ER0A 3SSNA 3KPVA 4GOMD 3R3HA 1NV9A 1XVAA 4PYLA 2GPYA 3UJBA 1X1DA 5G02A 1R8YA 4Y30A 1ZGAA 1V39A 4YUYA 5LQCA 2CMHA 2GAFA 5BW4A 3X0DA 4AX8A 2AOTA 1EIZA 5BP7A 4QPPA 4F84A 2PY6A 3UBTA 4M36A 4CXMA 3HA5A 3EVDA 3NDIA 5KQRA 2OB1A 3MCZA 1YFJA 3LDUA 1SUSA 2ZBRA 4GOLD 1R18A 2VDVE 5E2AA 4QTTB 4PIPA 5F2NA 2H11A 4X63A 1TW3A 2E5WA 1Y8CA 4YMHA 2UYHA 5DXAA 4XUCA 1ORIA 2OPBA 5CVEA 3Q7EA 3KQTA 2BM8A 3EVEA 5EHIA 5DX0A 3P8ZA 4Z2YA 1X19A 1BKYA 2ONYA 2UYQA 3OE4A 2AVDA 2AOXA 5FHQA 3TM5A 3PT9A 3LBFA 3LBYA 3NTVA 2P7HA 4QTUB 4FSXA 4RSRA 5HZMA 2EJUA 3P9KA 3NWEA 1ZG3A 2PJDA 3P9IA 1EQAA 1BC5A 3THRA 4HGYA 3M6XA 3LDGA 2P35A 2YXDA 4HTFA 3A7EA 5E1OA 5FQOA 4K6MA 3CCFA 4WXHA 2FK7A 4XUDA 2AOTB 2P40A 3T7TA 4EQZA 3CJTA 3BWBA 3F4KA 5EC8A 2ZCJA 3G5TA 4O29A 5EG5A 4C05A 3GRRA 3EVCA 2P8JA 5B1SA 1VP3A 1RJGA 3TLJA 5DWQA 1G6Q1 4FT4A 4RTQA 5K05A 2BR4A 4RWZA 4V0RA 3GWZA 3OCJA 4X41A 5CVDA 3UFBA 3KQWA 3AY0A 4HG2A 1KP9A 1KPGA 2PLWA 1X1AA 4WVLA 5K0FA 3ELUA 1IM8A 3OU7A 2EG5A 5DM2A 2PSSA 2OXTA 1FPQA 1JSZA 4EKGA 2B9EA 5EQJB 3FPFA 3EEYA 1WXWA 3DMHA 4OA5A 4BP3A 1MHTA 5FCDA 4ISCA 4R8RA 1JG4A 3FUUA 5EOVA 1DL5A 5DXJA 4DKJA 3U81A 3FTDA 2G8NA 3SGLA 5ICEA 5IKMA 5K03A 1O54A 1SQGA 1H1DA 1D2GA 1XCLA 4C06A 4LWPA 4GC9A 5HIJA 2PWPA 2FHPA 1NV8A 3HCAA 3Q87B 2QYOA 3NMUF 5KS2A 1G8SA 2P7IA 3HVHA 4M38A 2YXEA 5EEGA 4P7GA 3PTAA 5HILA 3LCUA 2OBFA 5DM0A 1R00A 5HEKA 3R9XB 2QE6A 4YUXA 4E2WA 5EIWA 2UYOA 3NJRA 4MQ4A 5BXYA 2XVMA 2C7PA 4RYLA 3T0IA 5E9WA 1VIDA 3P97A 4MWZA 2BM9A 2KW5A 4C04A 4EMSA 4Y2HA 5KVAA 3ERCA 5H02A 1XDUA 5GOZA 4BLVA 3A25A 4E32A 1M0EA 3UJCA 3TRKA 2UYCA 3ER8A 4KW7A 3BZBA 3GGDA 2ZTHA 4DCGA 1M6EX 5K09A 2I6GA 1UWVA 3A26A 3UJ7A 1VQ1A 4FSDA 3ELDA 1TW2A 1QAMA 4RX1A 5P8WA 3FPGA 2HR1A 3EVBA 3JWGA 1FP2A 1SUIA 3G5LA 4RTLA 2XYRA 1SG9A 1G8AA 1XDSA 2R6ZA 5ICGA 4C07A 1JQDA 5ICFA 5CVVA 4PYJA 3KPYA 1NT2A 3P9CA 2N47A 3ME5A 3HNRA 3OPNA 4P7JA 5EZQA 2ESRA 3AWIA 4KIGA 3GU3A 5JUWA 2XVAA 3HA7A 3NVMB 5DSXA 4C4AA 5K0GA 1R8XA 2ERCA 2PWYA 3R24A 3REOA 3M6WA 4QPNA 1XXLA 3FZGA 3KQOA 2BH2A 2O05A 3EPPA 2B2CA 5DX8A 4RVHA 1KPHA 3LCCA 2AN4A 2JH8A 3SXJA 4PONA 2FRXA 5DSTA 2UZ4A 3NWBA 3GRUA 2QY6A 2NXEA 2O0LA 4GQBA 3B3JA 2P1DA 2IIPA 5K0LA 2NYUA 5T64A 3JWHA 3R6TA 3AJDA 4DQ0A 4R8SA 3TPZA 2ZZNA 2CMGA 4YV1A 4DM3A 3BGVA 3NDJA 5E9QA 3KPJA 2YX1A 1KIAA 1AQIA 2CKDA 2HTEA 2VDUE 3SSMA 4YUWA 5GM2A 1KHHA 1X1BA 3A27A 4CTKA 5CVJA 1T43A 2OYRA 2ADMA 1NW5A 2NXNA 2P3OA 2YR0A 1UIRA 3K0BA 4GC5A 2AOUB 4LECA 1FBNA 1NW7A 3B7PA 3HCCA 3LKZA 3KR1A 1L9KA 1U2ZA 8MHTA
chains in the Genus database with same CATH superfamily
3BWCA 4GWGA 3ZH9B 1KDVA 2IOFA 4DT1B 3HB9A 1G42A 2P65A 3LSTA 3ZJTA 3PWZA 4MR7A 5E4YA 1N7JA 2YVAA 3PDHA 2E21A 2I7XA 3RKUA 1ZIXA 4MYRA 1D2NA 1P5ZB 1DFGA 4HY3A 5C8YF 2Y1CA 5BOVA 5CD9A 4F6RB 1KYVA 2Y76A 3OPQA 1BEZA 4FLMA 1DIGA 2Y1KA 4PZ0A 5TV2A 4W9NA 2NTYC 3VGJA 3PQ7A 2Y0EA 3LFHA 1FMLA 1DXOA 1E5XA 1X94A 2AI1A 2QE7A 2WOOA 4QYIA 3GRFA 3U60B 4J1SA 2J0UA 1CUIA 5GONB 1GFZA 2Z58A 2NXCA 2YBEA 3EQ6A 3IPLA 2R6DA 1H8HD 1EFUA 3NAMA 4LWQA 2JFQA 4PXSA 1RAHA 1W88A 1JAIA 3IRVA 5CM2Z 3WNQA 4NMWA 4P5DA 4FFSA 1U81A 3QLTA 3PRKE 4I55A 3DYBA 5HKKD 5JNLA 2C2ZA 4MVCA 3BMOA 3AKCA 4I4IA 3FCOA 3KJHA 1VKZA 5HPYB 5JY1A 4DB4A 1JAXA 2J41A 4IS2A 4E21A 1H0HA 2HSGA 3C45A 1C9MA 4BV9A 4REQA 2QX6A 4L7VA 5AO9A 1WAMA 3NHUA 1AZLA 2LWIA 3LX4A 2XJ4A 2VAWA 3K2EA 3HB5X 5IUJC 4QEZA 4B9AA 4GPAA 1ZM7A 4Z0PA 2ZBPA 3DNPA 5K3BA 2H57A 2X8AA 4DA4A 2H0RA 3WHIA 2ZI9A 1E3LA 4X54A 1AS0A 4BV3A 1Z12A 4EJSB 2PMWB 4NEQA 3TKYA 3LOPA 3L8DA 2J6CA 1X3LA 4EATA 3OSUA 4F5EA 4AY6A 4N7JA 3QUSA 2OCIA 3I5YA 2JNWA 4LTNA 4OIFA 2YXNA 4ARZA 5JS1A 1QZUA 4C0SA 4ME6A 2Z30A 2QORA 4HWTA 1FX0A 1N6RA 4JUCA 1S6YA 4HVAA 4KIUA 4L08A 4TQGA 1C9NA 2GK6A 4IDAA 2AA3A 2QXYA 2GTPA 3WLLA 3EVZA 3GPDG 2GRAA 4Z9AA 1L1QA 3G23A 4OP3A 1KAOA 5I7WA 1E5VA 2P27A 4U2DA 3E22A 3HCOA 1JDPA 1XQ6A 4L6CA 4AZ3A 1IPFA 1SY7A 3EMVA 1TOAA 3V42A 4CCSA 1FXUA 1RWMA 3LWZA 4ND6A 4MUYA 1YS1X 1K9VF 4WXRA 1JZQA 1D7OA 1AKMA 1LUAA 1OYYA 4IDHA 4J0EA 3T4EA 3EMDA 3B9RA 3SR0A 2WAAA 3QPWA 4BO0A 4LC9A 4DILA 4BX2A 3EZ6A 1XDZA 5CB0A 2FUCA 3S1SA 3GGJA 3ESXA 1N9KA 1EVKA 4OSPA 2Y2VA 3Q4GA 5ULLA 2O7SA 2GF2A 5JAZA 4MAAA 4JP1A 3L41A 2FX2A 3CZQA 3FLAA 1PFUA 4YR9A 5JJ5A 1PYOA 2ZJ4A 4O4JA 3PGJA 1EX1A 1NHGA 5TPZA 5LU8A 2NLOA 5KOYA 3NYIA 4GM1A 3HXMA 4PAWA 1QB7A 3KZMA 2ZSBA 4HB4A 3A9TA 4GSLA 5LQNA 1WBBA 2AG0A 1KNXA 2PVCA 1FRNA 5FEUA 4HH3C 1GAXA 3CUEF 1FVFA 4DIMA 4D74A 4TQ9A 4X0EA 2IS2A 1J99A 4PCAA 1W1IA 4P7FA 2ZSKA 4Y2JA 5DTIA 3TBKA 3VR3A 5F9HA 2WJVA 3VAAA 5DNYB 1RWNA 1W93A 2AEEA 3KXLA 4LOKA 4UXIA 3SC4A 4CF4A 1U0NA 3GJRA 4UUNA 1P5RA 2WUDA 2XGSA 4M21A 1L4HA 1Z33A 4HSEA 4D25A 4D0SA 2ODQA 3ORQA 2DUWA 1PR1A 3E8SA 1GRRA 3C7KA 3KR9A 4UEOA 2QTMA 1ZZEA 3S5UA 4D7AA 1V4VA 3OTIA 1E2GA 4IOKA 2A3RA 4BFWA 6GPBA 4LHYA 3CVUA 1RJFA 1Y7TA 2A9OA 3OE7A 2HQBA 1I1NA 5JXWA 1E0KA 1XA4A 4NJEB 4RKRA 4RTRA 2WYIA 4MLZA 1A8IA 1NGSA 2AW5A 3NEPX 1EVJA 1PG2A 4LXIA 5A3VA 1IH8A 2Z5GA 4RGQA 3V3TA 4W5WA 4DWOA 2VLIA 2GM3A 5CT8A 1JKIA 2N9UA 4RV4A 4S1WA 3QNMA 3WBJA 4RY0A 1EFKA 1EP9A 1G291 1TF5A 4S0ZA 4D9IA 3A31A 4ZHQA 5HIIA 1KERA 2J3MA 1AY0A 1UC4B 2FF5A 1M76A 4E5DA 3D7MA 1OIVA 3W0LB 3ABOB 3IUQA 3SJCA 3GJZA 2E4XA 3VC3A 4UKDA 1PRYA 3U49A 1O57A 1IK4A 4D1YA 3CQ9A 4DKJA 1I5EA 3QUCA 4X20A 5J2TF 2VNIA 4YXFA 1Z2EA 5B7GA 4P0PB 3COWA 3QUTA 3RFVA 3EH1A 1A8UA 4LRWA 4RMJA 4N3BA 4V0KA 1VL5A 2LCQA 4NR0A 3S2FA 2ZPUA 3S1AB 4QTYA 2KWIA 5FOQA 2XOXA 3JYOA 3HYSA 3K9QO 2O8DA 2JATA 2JGNA 4J7CA 2AF4C 2ATIA 2IJGX 4KQJA 3VM6A 4BYMA 4MW4A 3N87A 2VLBA 4Q1AA 2AI2A 3KYCA 1B8VA 3UK6A 1L0BA 3WGVA 2POQX 4PC6A 5AK3A 1E4EB 4IMPA 3F3MA 1ONNA 5C0OE 2OK7A 2RGNA 2IDJA 2X0RA 1EGHA 4JI5B 2MMCA 2FN3A 3VA7A 3A4MA 4E6EA 1B6GA 4AU1A 4WLNA 5DBGA 3VNQA 3W79A 5JQGB 4WL0A 1WB4A 4UQOA 5KJCA 4DV0B 4MB0A 2I7VA 3MMSA 2W2OA 3G2KA 3CTMA 3NHJA 4YJGB 3RUFA 1U9IA 1UINA 3JQ8B 4AG3A 1AMUA 4HDSA 2RGGA 4CDMA 3WP0A 5DF1A 1KYWA 2G9QA 4J16A 3TKAA 3PLAE 1ADCA 4OXNA 1NQUA 1FVHA 2G9VA 3ZJ5A 3BWXA 3UGTA 2GXUA 1P4HA 1S4QA 1UOOA 1SK9A 2VJOA 3PCXA 5I8ZA 3UYKA 1T2FA 1HPLA 4X1YB 1MZVA 3GPCA 1NJ2A 2B4TO 2NO9A 2R6CA 2JDID 1ODTC 1QWOA 1AN9A 2ZJ1A 2BM1A 3WK5A 1W0JD 5JSQA 5M5BA 4ATNA 1NDHA 5KNDD 5KZMB 2ZJOA 3KWMA 1Z74A 3PSHA 4B85A 4EYQA 1QQAA 4XYEA 2JIZA 5KSWB 5DTQA 2R6HA 4Z4GA 1KEWA 3LT2A 4YRQA 4Q6WA 4LYJA 2VNSA 4EDHA 2DB3A 3HCBA 1ZPDA 2VEOA 1VMDA 4X5OA 1I3KA 1UKYA 4YV7A 1LA2A 4EG3A 1Z07A 3F90A 3HDGA 4KMOA 1CR1A 1JHDA 2WM8A 1Y82A 1YQXA 2WT8A 3PR2B 4K1XA 3NT2A 5T6MA 1M2GA 4AX4A 2JFUA 2COUA 4BNLA 1NAHA 3L7DA 1H2HA 4IF4A 2JH9A 2JGMA 1H8ED 1QKIA 2H1SA 2WNIA 1RHUA 1KGSA 1G5QA 3QX9A 4V1CA 1Q1ZA 2I8AA 2YJ5A 5BNFA 5IWAB 5AXCA 4LYEA 1E7RA 2C95A 3RRBA 4CL8A 3CX4A 1DKUA 1GDTA 4IMJB 5FAKA 4L8VA 3ISJA 1G9SA 5H3HA 4BVEA 3IT3A 4BFVA 4BBAA 5GINE 3MD9A 4Z9FA 4AN0A 2REQB 4FR0A 2W6PA 3PGA1 2D2FA 1PUXA 1IZ9A 3WLMA 3R0QA 3AONB 3CUWA 1FP7A 2Y0CA 2ZOSA 4TKUB 4H7EA 5JSUA 1A8HA 2FAXA 4P58A 1H5UA 3W4JA 5CT4A 3LHFA 1KE1A 4UVEA 2CFTA 3EZLA 1GKLA 1Q7CA 4PLTA 5EXPA 5JVDF 5HF8A 5L6MB 1BE0A 3QV2A 4TKZA 1VOTA 2OG2A 1GNSA 5FORA 1C30A 3NPAA 5IARA 3V7WA 3M2TA 3LWBA 3NKVA 3WKEA 3SY8A 3ESQA 3VR4A 4IDOA 3L92A 4DCUA 4H3VA 3LUPA 2PKQP 2BI4A 2OHFA 5EE1A 3WHLA 2WE8A 2WNSA 4KK4A 4WTOA 1GV0A 1UBGA 1QTQA 3QI7A 4ZHSA 2Y2UA 3V8NA 1FBTA 1Z37A 2VDJA 2YXPX 2Q6IA 3ZE8A 1E1NA 5ICCA 1ADYA 3JWJA 1UPFA 1EDDA 4KEAA 2SKEA 3E3LA 4FHCA 4H7DA 3A1UA 4BEBA 3L0DA 3WMGA 2VP3A 3M6UA 3QH4A 5DTRA 5FWAA 3TI9A 4B5KA 2HIHA 2ECPA 3HY3A 5AUOB 4ALIA 3P9SA 3KPVA 4MW5A 2H16A 2RBGA 4L4ZA 3VI3B 4DGQA 4F11A 4CDGA 5B3JA 2XW6A 1F4VA 5G4KA 3AEUB 3ENKA 4G0NA 3CTPA 4BFXA 1QIGA 2PZLA 3J81A 1TMGE 4RDHA 3O4HA 3UBTA 4CXMA 3BSWA 1EEXB 4J7XA 3BL5A 3IDOA 3O74A 2QZ4A 2IOHA 2GMWA 4CM9A 3OF3A 4BE4A 1E1CB 2WQZA 1VRCA 4U3JA 4QQRA 1PJRA 4P22A 4EL5A 5CA1F 4RPCA 1YJ8A 3GLHA 1MUUA 3A4VA 4TTRA 2XRYA 3P8ZA 4Y2RA 3PXEA 3OAAA 2JJ1D 4OGKA 3MPUA 1YQQA 4DV3B 3KKQA 3P9KA 4XDGA 5I7AA 4HT3B 2GETA 3OQBA 1QF6A 3K6SA 3CF2A 4UBJA 1H2AS 3WLFA 5FPQA 4CM3A 1SVMA 1H1LA 2OCPA 1NT4A 1JN0A 1OTYA 2RGUA 1I3OA 2VJPA 3ADKA 4H1HA 3UCFA 1QG0A 5ALKA 1LSOA 2QN6A 4C4XA 3GHYA 1YVRA 3I05A 1DAKA 4IS3A 3S2SA 1BVHA 2PT7A 4BZWA 2ZK7A 4C05A 1D03A 1Z9BA 1E1YA 3O4JA 1ZITA 3QU2A 2GEKA 3G8CA 4PHFA 5KU1A 5ELXA 4DQVA 2GPAA 2WSIA 1XEWX 4D8TA 3I52A 4UDNA 4UE2A 1ZN9A 5KYUB 3MGAA 2G8LA 4OJQA 5EP2A 2HMWA 2IK8A 3C1OA 1E1KA 4D3SA 4TYMA 4RCZA 4WOCA 4EKGA 5T7BA 3PNOA 2WQ7A 3U4QA 4GE3A 1AF4A 4ZO8A 1JR3A 3IKJA 3B48A 1SVNA 1U1CA 2PLAA 5HE8A 3DHYA 3CF4G 2P4HX 2FUEA 2CNWA 1JG4A 1I4DD 2WWIA 1UPAA 5EOVA 5LA6F 4Z7OB 5LJLA 2IUTA 2WILA 3SGLA 3CMMA 4F97A 2ZREA 4XVUA 1MMFB 1H1DA 2BFAA 3R4VA 1FQOA 4ALNA 4QZVA 3DT9A 4LWPA 3NIWA 3HTXA 2OLJA 4Q34A 2XQGA 3IAHA 4IZIA 3C39A 2FP4B 3PXGA 5KMGB 2YXEA 5EEGA 1TADA 3RYIB 3S4YA 2WWRA 3B5JA 3T7KA 2KE5A 1K9SA 3WLTA 4YRKA 4YCJA 621PA 5K3OA 2BUBA 3WJAA 5JQWA 1QSGA 3PWKA 2WUFA 5C2JB 5CX4A 3AVYA 4LZZA 3ANTA 2IHBA 4HAZA 3CVWA 1QHHA 4MWZA 1LD3A 1HQYE 2A35A 4Q3CA 1G3MA 1L5FA 2R1TA 3PWSA 4F9EA 2JA2A 3ROFA 4Y8VA 3UVEA 4YXWD 1VL2A 2UKDA 3HEBA 5AHRA 3ER8A 3K35A 5IZ4A 1YCHA 2JFZA 1F17A 4JT4A 4QYTA 5CH3A 1U2TA 2QBYB 1P6QA 3LGXA 4PBTA 4Q3EA 5LOVB 1DAHA 3AB7A 5C80A 4B2LA 3K1ZA 4DLKA 1E9AA 5EQDA 5JC8A 1G9TA 1FY2A 1C9DB 2A5GA 4QU5A 3F3SA 3JU3A 4HN9A 5B37A 2CJWB 4HDQB 4NJMB 3HNRA 4ZVLA 4QXMA 5TQJA 4PLZA 5JUWA 3MINA 4D9BA 5DSXA 2JPDA 3IVMA 4RWEA 1MC4A 3C43A 3H3FA 4CKEB 2PKXA 3TEJA 4X1IB 1E7WA 3A2NA 3REOA 1EXWA 4KKXB 3M6WA 3Q8XB 3HP1A 1O5OA 4D79A 4IIJB 4UNRA 3RU9A 1YZKA 2CZGA 2BH2A 2OUIA 2B2CA 5DSZA 3GNSA 2MYUA 1Q1AA 3UK7A 4NHOA 3K8YA 4YROA 3V1YA 4H0FA 2AFIE 4RIIA 1SVIA 2IPLA 5HP4A 2MSCB 5DGXA 1QTRA 1C0IA 4ESEA 1VYTA 3SVTA 4QHSA 4AKHA 2ORWA 1EHIA 2WDPA 2XB4A 4V2IA 5AVKA 1I3NA 3QE4A 1CUFA 2JAPA 4LXUA 1K27A 4CEIA 3MS2A 1G8MA 4ZJZA 2PO5A 1RLTA 2VNAA 3HCNA 1QV6A 2XZLA 1KIAA 3O93A 1CQWA 2HAEA 3OSZA 3ANSA 3CONA 4N47A 1IY2A 3NUZA 4GS5A 4GKVA 4OJNA 2IP1A 4YMSA 4TWIA 1D7AA 1Z15A 5BRNA 2P3OA 3BIOA 1USWA 4EFLA 4LECA 1KKLA 4PG7A 4RKQA 1GPBA 1S9HA 1ZCAA 1RLJA 4ITUA 3VOBA 2YWRA 3FFXA 3CT6A 1KIMA 1MXHA 1RZUA 1HEYA 3EXG2 3P9ZA 1WW3A 4QFMA 3WNVA 3DUFA 1D6NA 4BNTA 2FXIA 1JMVA 1XMOB 4ZAZA 3IMEA 3INNA 3E2PA 3L0ZA 3NEYA 4O4LB 3EAGA 1UBNA 4DNOA 5MF6A 4RS4A 3EZ2A 4XWWA 4FHDA 3ZVKA 1EVZA 3GZNA 2CK3A 1WUHS 3I5MA 4N3CA 4XEUA 3WBKA 3B3FA 5LQSA 4NU8X 3FYCA 3MRSA 1Y1PA 2D1YA 3C3XA 3QELA 3KXIA 1D5WA 1U0LA 3U56A 4RM2A 3HKEA 4HV4A 4RVNA 3ZV6A 3K71B 5JH7B 2Z6QA 2XBLA 3EOBI 3RD5A 4TM7A 3ZGYA 3S8EA 1P9RA 2Q50A 3R41A 4RYDA 1KP3A 1Q12A 4TYWA 1YB5A 3B6MA 4JQCA 1NOKA 2WZDA 4XCXA 2ZB2A 2B36A 4M0CA 2BMDA 3WLPA 4F1KA 2ERXA 5BUZA 3PVCA 1ZD8A 3GVPA 2VPXA 2WICA 5KDDA 1A27A 2G88A 2AZ4A 3OPVA 3OJWA 1TEXA 4BGEA 3K30A 1E3WA 3TRFA 1DC3A 1HTTA 3ZY2A 3FSGA 1TPZA 1Z34A 1EBBA 4KXXA 1Y9JA 3G8DA 4OBXA 3ROMA 4DCCA 2GGSA 4PO1A 3DDZX 2Q1XA 1Z0JA 2VPQA 4WZ6A 2IHNA 3M3PA 3DMTC 1Z16A 1BHJA 4ER7A 5JS8A 1C3OA 2FPKA 4FDTA 3EXFA 4LOHA 5JJIA 1FSSA 4K9PA 3INRA 3CR3C 2H0AA 1N2CA 3IGFA 4ITVA 3JR7A 4B6FA 3RFTA 3ILSA 3SSAA 2AN5A 2XMSA 1TYZA 2E48A 4E6PA 2GFQA 4XIJA 1Y4SA 1Y8RB 3KVYA 5HUHA 4NXMB 3MB5A 4B8ZA 1RKUA 2IQ5A 1NNI1 1EUZA 4DLLA 5LPNA 4Q9HA 4RC9A 4PRKA 4MB6A 3O84A 5KTYA 2R2GA 1ZK2A 1N7HA 4ZYZA 3NANA 5T5QA 4YJ3B 2PMFA 2W6JD 1MOQA 2WFLA 4C21A 3BHJA 5LD2C 1T91A 1ONOA 4O2BA 2M32A 2NTJA 1LDNA 1CEXA 5U1PA 3CW8X 1ORRA 5IC6A 3MLEA 5A4MS 3QYFA 3GLGA 4PN3A 5FI0B 4GBMA 2E6UX 4C3OB 1Z0UA 1W5FA 4CR8A 1TM7E 2BH9A 2BFPA 3DR5A 2FEKA 2ZWAA 3V8BA 4LF5B 1RP7A 3OOEA 1T6XA 2XXAA 4G25A 5BMOA 4KQGA 2HCFA 1FF9A 3W5HA 1CJSA 5BV2P 5JBQA 4G26A 1T3LA 4QULA 2CXXA 2QVGA 2FYTA 4PS1A 1GITA 4QQNA 2AS0A 4KITB 1L3IA 1W8DA 1YZHA 2ZI5A 1WW2A 3BWVA 2X4DA 3IAUA 5LBTA 4AO8A 5EHZA 1TVMA 1CJMA 5MFZA 3FXAA 3JD0A 1TGVA 2BP7B 3IUMA 3KZNA 3WHKA 2F1RA 5IK2D 7GPBA 2QAGA 1XRJA 1L5MA 4RD6A 5P21A 3L82B 1V8DA 2AD5A 3ETDA 5D51S 4C89A 2PS1A 2VK4A 3I30X 2BMEA 1Y5MA 2A9QA 3UC5A 1XPOA 1W2HA 4RO0A 3HKCB 1DCTA 3SAJA 2ZTSA 1MX5A 4MKZA 4FILA 5TMEA 1PG5A 4AJ2A 3O2JA 4PLWA 2DFPA 1MORA 3R77A 3F8SA 1JQEA 5CA0A 1NVAA 1TK2A 3T1VA 3X1XA 1NVFA 2NZWA 1ECPA 1LBIA 2RGXA 4M6WA 1EUDB 4N12A 4RHFA 5F4BA 1A1VA 2Y77A 1JWBB 1ZUHA 1F60A 2A5DA 4RK4A 4AKTA 4Y9TA 3WGNA 4Q1FA 1A5TA 1OXSC 4RL4A 3OX1A 5FKJA 4JASB 1CRLA 1TPYA 2YIVX 4JR2A 1ISHA 5KHOC 1AXRA 1NI3A 1QB8A 2XRZA 2RI1A 5EIFA 1RRCA 5IAEA 3CH5A 5FEMA 2R8BA 2G6TA 3K3PA 2RBEA 3TH5A 3TIGA 2E55A 1G63A 3BKXA 2P67A 4HAXA 5J4LA 4XJVA 3D3QA 2Y8EA 4GOJA 4CYMA 3PPXA 4AMVA 4NCHA 4BLQA 2GBGA 3ZU5A 3ZHRA 3LH5A 3LHKA 1TJPB 1I2BA 3E1KA 1U3WA 4RY8A 4Y6LA 1C1YA 2QU7A 4Z7JA 5K8UA 2J33A 1OWNA 1SCKA 3I9OA 3B60A 3L6UA 3O26A 3Q6MA 2CNNA 3ZCQA 4M0KA 1LLDA 5MN5A 5EXEA 3E7FA 3VKHA 4W4TA 4DLBA 4RGYA 2WM2A 1E9DA 1JG2A 5BY2A 1VC2A 3OIGA 2RIPA 1AKTA 2BONA 2NSDA 4HUQA 4A9AA 2HYDA 1XX6A 3GLKA 4C78A 4Q00A 2WKWA 4YWHA 3CEHA 5GV7A 1YRHA 2LD4A 1JDZA 1PD1A 5AKEA 3MAAC 1EUQA 1C7IA 3R3ZA 4WJKB 2H1IA 4BNHA 3A6KA 1GILA 1RBZA 2X1VA 5AVUA 2B61A 3DMYA 3OU6A 3CJRA 2QGZA 3EE6A 1ENPA 1EJ6A 2G82A 2CLLB 1J2EA 3M5DA 1FRVA 4RANA 2I78A 5F35A 5B2EA 2C0PA 5KNBH 1PNTA 4EKYA 5SYMA 3UA4A 3W1VA 1O77A 1EAYA 3GOHA 3ED5A 3PE4A 3ONDA 4M8LA 3U3KA 5K4AA 2B4RO 4OH7A 5KU7A 1JEQB 2PZFA 4A1FA 1SD5A 2YV4A 5H8WA 5AP9A 3P7MA 3EFHA 3LLCA 3PF8A 1PL7A 2FMXA 4LSZA 4CF7A 1W0CA 4UNQA 3VR6A 3E23A 4HH4A 3VOSA 3QFSA 1AIPA 3NAGA 4PGAA 3UJNA 2ZE6A 2CL7X 1FYWA 1G55A 1XCGB 4MKIA 5E1DA 1XZJA 3N76A 4IDFA 5KYYA 1R4MA 4NQZA 5C81A 5IXYA 4OLFA 3GQBA 1DQNA 4EFDA 1W85B 2F8TA 4DG9A 5KYNA 3CSDA 1GFIA 5GM1A 3FDXA 1PTKA 4ENWA 1GTL1 2WWYA 3UMYA 3G68A 3H5RA 1QHIA 4RA6A 4QBGB 1TCCA 5LQRA 4GI2A 3X2SA 4KE9A 1F20A 1KI2A 1RI5A 2HLPA 4XJSA 5ESRA 2XGOA 3LKDA 3OQ6A 4QODA 1TTHA 2DBQA 5JIBA 5JZ9A 1L5VA 2QRVA 3K16A 1RMQA 5LZ5A 2ZZMA 4G2NA 3NBKA 2C8VA 3A1TA 3AEQA 3G2QA 3Q7SA 4HQRA 5CNKA 5LNK6 3VC1A 5C31A 4WA8A 4MRMB 1JHRA 3DOJA 4PIVA 3CUVA 2DKOA 4E5SA 2O52A 3NC0C 4G85A 1FW6A 3M2PA 4H1VA 4IV8A 4I5GA 2IZ5A 4WZBA 1H4QA 1DPFA 2IFTA 3OTQA 3PDIA 1PDWA 3OZEA 4F8YA 2FF7A 2VYNA 3FPSA 1KZGB 3KKOA 3WDKA 2V7UA 3JZFA 1W59A 4FNOA 4DR5B 2JIDA 2XOEA 1TCAA 1WULS 3E9EA 3HJGA 5KX5A 1SG6A 1DBPA 3LWNA 1K0UA 4MA5A 1PZHA 2ZR0A 3DNMA 1NVXQ 3MXTA 4L3WA 3CZCA 3HO8A 1EX6A 2GYYA 4N9WA 4DCNA 1ZGJA 3FSEA 4AY5A 2BGIA 1UJMA 1L2TA 3CB2A 2XKJE 3NPMA 1C8VB 5DGIA 3H19A 3V55A 1FW8A 4TROA 5EKXA 3RT1A 4KWTA 1FFHA 3WYBA 5J4YA 3WI7A 1T3SA 1ZK1A 1J0CA 2Q4DA 5J5AA 3KE8A 2VZ8A 1VDMA 1B8UA 3RRMA 3ZWCA 4B7CA 1M54A 5CHEA 2DHRA 1VCOA 1KZ6A 4Y2YA 3N7TA 2VTBA 2FI1A 3LX5A 3AVVA 1KF0A 2I33A 2WOJA 1CT9A 4WY2A 2WAOA 4IIHA 4HXGA 1FFAA 4C1NA 1G6KA 3A9VA 4RL6A 4K9OA 2IZ6A 2J6IA 1EVYA 4NVRA 1JEEA 3BGIA 1AM4D 2NO5A 3PNMA 3H2IA 1CDEA 4PNPA 3QF7A 3RS3A 5E3HA 4FE3A 3LX8A 2XTZA 4EA6A 5KQPA 3O94A 3OKPA 2AMLA 2PRJA 3ZV3A 3MWLA 3I0MA 3GVCA 1Z0SA 3JVUA 3C2QA 2NU9B 4DCJA 1GSAA 1WVMA 2XAUA 5LLDA 1Y3DE 1L5QA 3E6AA 3NGLA 1F8GA 2EL7A 1KTVA 3OZUA 1O03A 2NN3C 1LV8A 1B3BA 3W3ZB 2M1XA 5LU9A 2QTVB 2BJWA 1WXDA 3V8MA 1UC8A 4BJ1A 1GLNA 4BLWA 1M6WA 1UM9B 1TZJA 2J09A 3ANXA 3EBLA 1HV8A 1A77A 3HU2A 3DAHA 2NU8B 1SA0B 2ZJ3A 1NE2A 1ZD3A 4XIIA 3OPXA 4GP6A 4M8IA 5TJHA 4DBVO 1K8QA 1SOAA 4G5OA 2WD7A 4LKRA 1E99A 4QUEA 2I80A 2NU6B 2ZANA 2IZ0A 1R66A 3N8IA 3AEKA 1PJ2A 2VPYA 1YQWA 1CRZA 2QUHA 2ZRLA 3JAWA 4AJIA 1G2PA 4KXLA 3H8WA 9ATCA 3KZKA 4L74A 4DWWA 4ENRA 3VO8A 3GP5A 3OX4A 2AOTA 1DLJA 1TB4A 2CF5A 3LCMA 4QUJA 3X1ZA 4IZHA 4CPDA 1BH2A 4D9KA 3HA5A 1YFJA 1IJBA 2AK2A 4V02A 3GLFE 4Z3OA 1WZEA 2P0YA 1KI6A 1V1MA 1R18A 1TT5B 2GLTA 2JGKA 4G5GA 4Q03A 3H86A 4K6GA 1CFJA 2H11A 2ID4A 2IPAB 2JI6A 2KSQA 5D6OA 2BGKA 3FVWA 2BEWB 4CMBA 1AHPA 2HPZA 1JEOA 1SKBA 2OPBA 5HS4A 1PDOA 3W7VA 4EZEA 3EVEA 1QYIA 4JJIA 1XAIA 5FTLA 1JHXA 4AULA 5DTEA 3SJZA 3O8BA 1BKYA 4ZALA 1HK7A 5DE3A 4UTZA 5FHQA 4QTUB 1CY8A 1FYFA 1Y8QA 3BF8A 1WJGA 2H7XA 3FKSD 4P7BA 4UC0A 1JH9A 1RKBA 1UKZA 4OYLA 3J81k 3C70A 4JB8A 5FOVA 3MQ4A 2YXDA 4ZDKA 1XLTA 2DAPA 4BRSA 3UGQA 4MW9A 4A0FA 5IT9A 2P40A 2SICE 2X0EA 5L9AA 3DEHA 3BWBA 2AYYA 1A8QA 4WKCA 4EX6A 4D4MA 1KA9H 2ZTVA 3PHIA 4Y1RB 5IBCA 4NOKA 2O2GA 5I7UA 2F3QA 1A2KC 2BM0A 3AG5A 4Q6BA 1L5HB 4RWZA 3HZOA 4LQ4A 2ECKA 1JFRA 3KKKA 3KC2A 4I4TF 3WWEA 4NF2A 2GO7A 4YI5A 5HE9A 1Q7TA 2PE5A 3RJZA 3A6ZA 3MTAA 1AURA 2AJ8A 1PTJC 4E88A 1NSTA 2H7VA 4RSMA 3PXCX 4OQQA 4MQFB 2P6UA 2GRJA 1SJ9A 2DRIA 2PL9A 1R0LA 3N59A 1PX0A 4O3FA 1CVIA 2E82A 4MYSA 1BU5A 1I33A 2QQ0A 3IH5A 3V48A 5LP6F 1O54A 2QMEA 5BVHB 3MCAA 4XLTA 1Z6ZA 1N3BA 4PFQA 5C35A 5EZYF 3UWDA 3WFIA 1J2UA 3WMEA 2PEZA 3PCTA 2OZEA 5BPFA 1U3CA 1Z7BA 3K8ZA 1NR7A 4GHWA 3E9YA 5K3CA 4CKYA 4TL7A 1JEJA 1AXEA 2QSJA 3CLTC 3FI9A 4MZXA 3MM4A 1KFCB 2D5IA 4NEGA 4ZANA 5FBHA 1BCRA 2AN1A 4UD2A 1WZ2A 1KBOA 1VIDA 3P97A 1Z2CA 1NF9A 5J63A 2IHZA 2NO1A 1MZPA 3RG8A 1A9ZA 1F0KA 1RE1A 3HFGA 3PIIA 1XMSA 1P7VA 3JQQA 4CQLA 3SQNA 3TRKA 5JBNA 1ZZGA 4GQAA 4BVFA 3IAS1 3A1CA 4JJ7A 4TLBA 1WDMA 3C3BA 4LDNA 5I3CA 2EGUA 3TGPA 3FPGA 4UU1A 4AWBA 3GN1A 3R7BA 1FP2A 2HU5A 4EGAA 4MDEA 4UCXA 3ECSA 3IMFA 1GXSB 1NN3A 3WMXA 1L8AA 2WF6A 4XFKA 3TG8A 4L9SA 4MS3A 4ASUD 3AB3A 4QBIA 3W1WA 1KJIA 2PUBA 3RU3A 1DKNA 1UQTA 4OOEA 1GWNA 1T9AA 2GYWA 4OUKX 4IDEA 3ZQ4A 4D0RA 2FHSA 4E5YA 1NI5A 1A96A 3AHGA 4TVOA 3K1JA 4UQLA 3BHIA 1R8XA 4U0JA 2PWYA 2GTIA 4GO1A 3RVDA 1WHSB 1CUXA 2MSNA 3G7SA 3EG5A 4MP8A 1AOXA 4QHYA 2IXFA 3S6JA 5B6PA 4FD2A 4P3KA 1E3DA 1WZCA 1RR6A 2XDAA 4RSHA 1M6VA 1N1DA 2NYUA 5CEJA 4DQ0A 4ANFA 3KM0A 5BWCA 1SQ0A 1U3TA 4I46A 4I7EA 3ZWKA 5AD1A 4OI0A 2NACA 1O6CA 2SCUB 4PS0A 4NY1A 1LZKA 3ZHCA 2BMWA 5CFLA 5B3KA 1J09A 2BFDB 2CNKA 2NOAA 3EZ7A 3TN7A 5JJCA 2PYZA 1RW4A 5CVJA 1QRUA 4FBLA 1ESEA 2WU3A 3LUKA 3B7PA 3FHCB 3OOYA 4CCYB 1U2ZA 3C24A 1SQ5A 3FETA 4XQGA 2XMQA 3QLVC 2FOXA 4DHWA 2W4MA 4LJ4A 4CMIB 1P1JA 2BYTA 3ZWWA 3V4SA 1DB3A 1HA3A 1WCYA 2EWMA 3HHEA 4IR7A 4XWYA 4KRXA 4UAVA 3DFIA 4FEAA 4KAXA 1JVBA 1R4ZA 2V0NA 3LRTA 4JUBA 2B8JA 3WLOA 5I3ZA 1UBTS 4GYJA 1GP2A 4FOOA 1PGJA 1TAHA 3OIVA 1BGWA 4JLMA 4JLJA 4RPKA 2G71A 2NW6A 2VH1A 2C83A 2BCEA 3CZAA 3IX7A 4PVCA 1RZRD 3WZMA 3LY8A 2BBWA 1PL8A 1SXJB 3LXMA 3UKJA 3IBSA 3U7EB 3T5TA 4KIWA 1RJDA 1MG5A 6PFKA 1S8OA 1EFTA 4UU8A 2DWQA 2DCMA 4V3CA 3FGPA 3W9YA 2VDQB 3EWIA 1OXMA 1SVSA 2VRCA 2X8WA 5MFPA 2HBZA 5IBRA 2X1HA 4D3XA 1ULAA 1U8CB 1NBHA 1O2DA 3DFUA 1LFAA 2HL6A 3I9LA 4TLAA 3RQSA 2VYVA 2VTKA 2C3MA 2HH9A 4LZJA 1ZN2A 3FPEA 1M2FA 3TL2A 1BX0A 1B2LA 1WPQA 3P94A 4L5YA 5K45A 3QVGB 4W1RA 2PK3A 2ZRNA 3IQFA 3HRKA 1TO6A 4RXUA 3MCWA 4YP5A 2GH1A 1WMAA 2VKTA 4Z0TA 5EESA 1CK4A 1N8NA 1JU3A 1XKTA 2CJFA 4RA9B 2AZTA 3VPHA 2QVXX 4IDQA 2H31A 5A5VA 4S2EA 5DYYA 1J0XO 3TLBA 2XE8A 2JJ2A 1MAVA 1KY4A 4JL6A 2NUPB 3TTTA 2A14A 4YBRA 1ZY2A 5CB8A 1MXFA 4OB7A 2ZUTA 3E05A 5C46F 4TUYA 2AKYA 2YN2A 2JBWA 3L9XA 1THTA 2FWIA 2DWUA 3HYTA 2JI7A 3L49A 4K3UA 3RUAA 4CM7A 4DUPA 1BDHA 2H2GA 4B31A 4X45A 2Y1FA 5C7LO 1QQTA 2E1RA 1L4UA 4W7SA 1YHZA 1E5LA 3HUFA 2R8OA 4FPXA 4RESA 2HIMA 5M34A 1JUDA 3KKNA 3UHPA 4OH1A 2Q8QA 2OHOA 4P31A 2J0EA 2I03A 2ODEA 2EEPA 2OK8A 2I5PO 2PU7A 4A73A 3R8FA 3AVTA 1K8ZB 4BNIA 1D1TA 3AMVA 5DLYA 4UHHA 4J49A 4BGIA 3AHJA 3STVA 1MAUA 4F2PA 4MO9A 3R40A 2J7PA 2J85A 2BDTA 3ADBA 2I9KA 1U8ZA 2HA3A 1A97A 1I0IA 2LR0A 2OHGA 4OVKA 4ZT7A 1RFGE 1I1OA 2I4OA 4A6DA 4EEKA 4MYUA 1S2LA 4KXWA 2X0FA 3WNZA 5AHOA 2GZHA 4FWBA 5K01A 1GDDA 4CMEA 3ZE0B 1YAJA 2EKDA 1N6OA 4Q19A 3FGZA 5DCYA 4DTIA 1J23A 1QUEA 3LBNA 4Q7QA 3H9UA 5JU6A 1H2BA 4UHJA 5CYFA 1E7MA 2NT4A 1P31A 2HJHA 3LQFA 2JB9A 3SIXA 1YF3A 3QVTA 5CYOA 1Z6AA 2GCEA 1GRQA 3EGDA 3NX4A 3ZWBA 4C6TB 1LX7A 3OUTA 1AUOA 2OVBA 3L4SO 4JP2A 4MUNA 2A4KA 3BXEA 4FIZA 1QFXA 4ZEXA 5JD3A 4E30A 5IRCD 1I4WA 4DCVA 3WRYA 4H2DA 1TZCA 3JX9A 1CUVA 2MYNA 1NUQA 1E94E 2ODBA 1O7JA 3DPUA 4KWEA 3TLGA 3KETA 3N9IA 4Q3KA 4JI1B 4I3GA 3INGA 3SHFA 3CIOA 4EW2A 1DC5A 2ZIXB 4GPD1 1AA6A 1BHQ1 1SHZA 3F3YA 1H2FA 4IM7A 4XPIA 1NP6A 4GP9A 2XNCA 4PNHA 5TQVA 4NDZA 4DT1A 1C4OA 4YPOA 2WSSD 3BIJA 3VU3A 1C7FA 2C99A 4LDJA 4LHEA 4FW8A 2VEDA 4I81A 3CNHA 4FDAA 2B35A 3CUKA 4N0EA 4FSHA 2H3EA 2GBLA 2VN8A 4P9NA 4F6RA 1GTSA 1K86A 1WG8A 4J0HA 2DULA 4S0XA 3AM1A 1Q3HA 1KFKB 3G1UA 4BMVA 4YI3A 4W5TA 1YO6A 2B8NA 1AUVA 1K6IA 1E1MA 2C00A 2G4VA 4J03A 1W34A 4FMBB 5GONA 2OTCA 1IBMB 4KDFA 5JAQA 2VOJA 4FFDA 4CGYA 4C88A 1MJFA 3ANMA 3BSFA 1KI9A 4PBRA 1KJ9A 4Q3BA 4RXMA 4TV9B 1MV5A 4D3DA 5FULA 3DDHA 4HQKA 4KQ6A 2JLWA 3VH3A 1A5SB 2WM3A 1JW9B 3V2IA 2AFHB 3KHKA 1JYFA 4AVYA 3KJEA 3EASA 4KVGA 4HQLA 2NPOA 3PQFA 4COOA 1ABBA 3PLNA 3IKLA 5DW0A 1QO9A 2YWCA 4C7KA 4YRCA 4HWGA 4AF6A 3Q3GE 2DGDA 4GDMA 4Y6OA 4FZVA 2OBLA 3MUEA 4KG7A 3HP7A 3ZD9A 1JHAA 4GM0A 4HNHA 4LS3A 5B4UA 2QTNA 3OPYI 5BV7A 2BFBA 4R6WA 1TT7A 1EFDN 1TL7C 2ZUBA 4LEIA 4R1OA 4DM4A 5KB3A 3R5FA 2MINB 2NP6A 3NBUA 3L1IA 4QOGA 4WKPA 2COEA 5DP1A 3SHTA 3I1FA 1NVGA 1G20B 4FR5A 1XZMA 4ZEOA 1JKMA 3UJ9A 2VDWB 1JEDA 1V8BA 2AQHA 3D2AA 4NFYA 4MWBA 4QPDA 3LCVB 3ORSA 2CVOA 4EJSA 3CU5A 1L8QA 3T4UA 2E7ZA 4RTKA 2QN8A 3AFMA 2Z3WA 3KB6A 5GPBA 3HYNA 4JC0A 4NH0A 4C0WA 4AF7A 2FA9A 4RY2A 3TZLA 5I5EA 3ZLBA 1GNLA 1NJFA 1GUBA 4Q9LA 4A8JB 3EMBA 4OHZA 4DFDA 1A7JA 2OCAA 2C2GA 2QMHA 4KN8A 3BUSA 2J4DA 4BV2A 4PWZA 2FZWA 5D1HA 5I9MA 2QD3A 4ZU1X 4EAAA 4HVTA 3THXA 1PW5A 2RE8A 4O4JF 3OLZA 4FMCF 1QPZA 1WP4A 3IVRA 1KYZA 2VHTA 3DFMA 4J6EA 2B7LA 3OKFA 2E5LB 4WN9B 2IX9A 4MYHA 3QXCA 3WE7A 2OQRA 4EABA 5F3WB 3OZWA 1FDIA 5B3AA 1NBWB 1QP8A 3FDIA 1SKYE 4GRDA 1I2AA 1KZ1A 4K5QA 4HL6A 1A9XB 1B8PA 1G7SA 1SKYB 1XMIA 2W2VA 3ORFA 5SYNA 4ZCQA 1U0BB 2GYUA 3KUCA 1RDFA 1V4NA 4QQFA 2Z8ZA 2XT6A 3ROXA 4KE8A 2GFIA 2A9JA 3OZFA 4LJ9A 3HV0A 1JDBB 4ENSA 4CQMD 4L9RA 2J07A 1I1QB 4GBGA 2IXAA 4NFSA 2V0GA 3BMXA 1OWPA 5DT2A 2VWGA 3ZWOA 3SYTA 1R74A 2WP8J 3P45A 1GG2A 3EHDA 3SE0A 4GGOA 3V6LA 4F3TA 4P3NA 2Z09A 1UK9A 3IEIA 4W9NC 4J4TA 3JQFA 1LLFA 3Q10A 2JC3A 3SKXA 3A2MA 1KYIA 2QMYA 1DQYA 1KZYC 5LZ8A 1T1EA 1WTCA 2Z57A 3C16C 3H7IA 4EJ2A 2AZXA 1Q1BA 2X42A 2XNDA 2FFAA 4ZEVA 5EFZA 3WGQA 4UBIA 3QHAA 3SG0A 2QLMA 1N0HA 2OP1A 3KWFA 1H1TA 4X44A 3SEAA 3SEFA 1SM4A 4LFAB 3ETHA 4ZRNA 2QYSA 3BX1A 1FE8A 3OMWA 5IEJA 1IIBA 1CUUA 4X60A 2N1MA 4DDTA 2ASEA 3IESA 1NBEA 1E61A 4TXHA 1SHLA 2YRFA 5K99A 1O9GA 3N5CA 5TT0A 2W0SA 5HOEA 3QA9A 4M2LA 4MWEA 1YUBA 3EX7C 2Q1TA 1VIYA 2BT4A 2PR2A 1SXPA 1CJBA 3GBSA 1NR5A 2VJMB 2FSGA 4KUEA 1S8AA 1SCUB 2N1BA 1XQWA 1JR6A 3KQPA 4JYMA 1BO6A 2BRUA 2PL5A 4QQKA 1JJAA 2X86A 4WCFB 5JANA 1GO2A 2GK3A 4WNYA 2QP3A 2QVYX 4G4IA 4EKDA 2MSDB 1B7GO 2QPLA 3EF3A 1YUNA 1L4YA 4OXYA 4PF1A 5C5IA 4AO7A 1DCKA 2EP7A 4LOIA 4OHXA 2PSDA 4DV4B 1L8LA 4TPKA 1CTQA 1I9CA 1M6NA 1Q0ZA 1P2SA 2FQWA 2KB0A 4F4CA 2QI9F 3PUKA 1N77A 2PX2A 1XGKA 3BN3A 1X0VA 2HWYA 1XL1A 2P11A 1T2VA 4FKBA 4EG7A 4UU0A 2VTEA 4ZO6A 2LW7A 3GQVA 4ZYLA 4GRIA 4K6OA 2IBMA 4ZVQA 2QK4A 2XYQA 4R3UC 2C8KA 3D7LA 3GJSA 3I6ZA 5HXAA 5EUBA 3DHWC 1A4XA 1JHYA 3RHFA 2CLMB 3ITDA 4XX0B 4NENB 1MA0A 4M9SA 3LP5A 4F4DA 1YULA 2NUBA 3BJIC 4DANA 4RULA 1L4KA 1RRVA 2ECQA 3KJGA 1NA5A 4JLSA 1F8FA 3LCJA 3GLIA 4A26A 2DHDA 3KYBA 3S1AA 2IYWA 4OQEA 5DZSA 2FR0A 1P19A 3HB0A 5JZBA 2MYPA 2QRZA 3G0DA 4N54A 3DM5A 4NG5A 4MI3A 1QG6A 1VPWA 2ZJ2A 2EAUA 3H16A 5CXSA 4CM6A 3PFFA 5BT8A 1SQ6A 3MSCA 3GJ8A 2CN1A 3UW3A 5AW3A 5AFSA 5ILGA 3LOUA 4OQXA 2VQSA 3E84A 3FTPA 3WGIA 1BWPA 2DHQA 2EHDA 4NK5A 2V54A 3EGXB 3O91A 4Y2VA 3UUFA 1R5BA 3QVXA 2L82A 2O7RA 3KB2A 4LKOA 3LM8A 3U17A 1T9ZA 3VO1A 4W99A 3WGJA 1PZNA 4AX8A 5I4KA 5TGZA 3SC2A 5JQGA 2P75A 1CBUA 2GWRA 3OCWA 2PBLA 4LTMA 4XQ9A 4FQ7A 4YJGA 3PHLA 1Z4NA 3JQ8A 1VL6A 1DRVA 1YZLA 3V8PA 1TM1E 4GOLD 4DC9A 2R00A 2BEKA 4PIPA 1N5MA 2GD2A 2YHAA 3NETA 3D31A 2LDBA 3AVXA 2O5CA 1Z47A 2H4FA 1VIVA 4UUQA 2QV0A 5F52A 4MHOA 4BAGA 2G07A 2JFHA 1X19A 4LDZA 3VZCA 4IFTA 2P0EA 2UUPA 3NBQA 5AW1A 3VPDA 4Q1VA 5BQPA 1V9LA 2YJGA 4JLBA 2J3IA 1CNFA 3PFKA 1UFQA 4PR0A 1IM5A 3HBMA 3UOWA 1H4VB 1VCIA 1XJWA 3CCFA 4XUDA 2IHTA 3PTAA 2WBLC 4OLAA 1HQCA 1UKAA 4URZR 1LGYA 5HR5A 4KLNA 4GKAA 4O29A 1NXQA 1AS3A 4CRWB 4AROA 1O94A 1M2WA 1QYWA 4XGRA 2IWRA 4FT4A 5AM4A 4HAOA 4F5YA 1ZUNB 4BUZA 3DO8A 5KNBD 5ALMA 5SZJA 1O58A 2PUJA 3NIGB 4MVJI 2W71A 4Q7EA 4PX9A 2OC4A 3K0AA 3FB4A 3OOSA 1OX6A 2OXTA 1R9GA 4AK9A 3JYPA 2QZPA 2FLVA 3W5SA 3PPYA 3EVTA 2IU3A 4FN5A 3OIWA 3U2QA 3DMHA 4DA8A 1Z68A 2YOHA 4DYVA 2QRJA 2BMJA 2GO1A 2REQA 1H8EA 4R8RA 5KINB 3PIRA 5DH9A 2HCBA 4WSOA 1L1FA 3TLXA 1M2EA 2FZLA 4JP5A 3VO2A 1QGOA 4CV2A 5ICEA 2DQZA 2FQQA 1A76A 1RS0A 2VBCA 2VWHA 1XJQA 4ZT5A 5HIJA 5J47A 1ZN7A 3ZKAA 2ZSJA 3PC2A 1XRPA 1VE7A 1W5TA 4EG6A 1YB4A 3IUYA 1QBKC 5AW2A 3UUEA 1NVTA 1FUUA 3H6HA 2UYOA 3D6TB 4J4BA 4NZMA 4WXMA 2WJJA 4K1LA 2DTDA 2JEOA 4QUHA 2GD1O 4WNIA 4IXNA 4I0WB 4KQFA 2WJYA 3GMDA 1RXYA 1W1UA 3A6FA 3MJCA 3IEPA 5H3CA 2PZ8A 3WDSA 4E32A 2B7BA 3U7GA 4QDXA 5JY6A 2K2WA 2UYCA 4LF6B 3ICEA 1H5QA 3JRWA 2FMHA 5CTJA 5JVDB 1TFUA 2XNJA 4L6IA 5H59A 3UXYA 1UFOA 4WOKA 2DR0A 4RKWA 1ZWKA 5B4VA 4B9EA 5JAUA 5KSPA 4O3MA 1C9KA 1NZJA 1GADO 5ICFA 2IHVA 5ARBA 4IOJA 1U9IC 3KXPA 3SZMA 1XPUA 1DEXA 3Q2IA 4Z86A 1KDYA 3UXMA 1D4ZA 1KL7A 1KKMA 3AU8A 5J4VA 1LW6E 1ODLA 4J16C 4D57A 2B20A 4B7AA 4H7HA 1JR2A 3RTEA 3M4NA 2JI8A 1I80A 1P77A 3GA7A 5H70A 1S2GA 2BSXA 1Z6PA 3A05A 4WLUA 3EWSA 3DF7A 2YINC 2ZI4A 3B3JA 2C61A 3IMGA 2C4MA 4XWGA 5E4FA 4DR4B 3ZD7A 3T9CA 3QEAZ 4IQFA 2QR2A 4DRYA 3O4GA 4QJ4A 1SBQA 1X13A 3LKBA 1LQ2A 3CWZA 2QP9X 1B74A 3PPWA 4Q9JA 5AVOA 3SK0A 4EPWA 1LU9A 3H9CA 1QRRA 1GTZA 4QOJA 3OKCA 2YJZA 1BQ3A 3DKIA 1G8KA 4CTKA 3WLRA 4MULA 1ZBQA 4JKYA 5IN5A 3H0EA 3TXYA 3T38A 1ZJJA 4DSUA 2Y4OA 2ZVPX 1MW8X 1Z2PX 5TXGA 2R62A 3U3OA 1MF7A 3PDCA 2W90A 8MHTA 1WXFA 1G19A 3NRBA 4IIYA 3T3GA 3DONA 3JRXA 1XCPA 3L77A 3ZNNA 3CSUA 2RK6A 1RWVA 4XYGA 1Z13A 2Y1XA 3KALA 2XLBA 3EAQA 2D59A 3HJNA 3OM8A 3WXBA 2FVYA 3RS8A 5C8VA 4E94A 3ICQB 4RABA 5TJ9A 2P3QA 1T9DA 2ZRFA 5KYUA 2YMLA 1E1RD 2A8YA 5KPDA 2V7XA 3QX3A 1GQOA 4PLFA 3TQTA 1NFQA 3T12A 2X13A 3A70A 2OQIA 2Z5VA 4OMDA 3RQIA 1TJYA 3JW8A 5JHHB 4UQPA 4L15A 4KR9A 4C87A 4DIEA 4ZI7B 1KO7A 3GXOA 3OT1A 3H1EA 4TSRA 1J1ZA 4JENA 1P91A 1G60A 1GRNA 1MGOA 4G1EB 1Q0SA 3I5UA 1NN5A 1DG1G 4NAVA 3GJ6A 3N39C 1UJBA 4GVPA 4N49A 1XF1A 4U00A 2X6RA 5J2UB 4BNUA 3AIOA 2ZJ6A 1YL7A 2JLSA 1HNXB 4YAWA 2COKA 1T9HA 1QV9A 4R8LA 5KYTA 5AI5A 3KAKA 2FP4A 4PXYA 4XQ0A 4FHGA 1OD6A 2AR9A 1YFZA 4WBSA 3QFTA 3E61A 3QLJA 3RYIA 5IG2A 1DQPA 2J5BA 2EG9A 1NC1A 1IN4A 1TM5E 2A3NA 4ZTBA 1LWOA 5F21A 4B44A 1Z0ZA 1FOEB 1YRLA 1XLVA 2DPGA 2WSMA 3B1KA 3SXUA 4YUZA 3HFRA 3WMWA 5LA6B 4V2UA 3O0TA 2Q5IA 5JFGA 2EGHA 2C03A 3K2QA 3TOZA 1DTEA 2QA5A 3S2UA 1MDFA 5CB4B 2XECA 5LLTA 2PJZA 2BBTA 3RSZA 4M9ZA 3BHNA 5IAKA 3VKWA 4A03A 3CNNA 3R74A 4YMGA 3ER9A 3NORA 2JHAA 121PA 1M7GA 4QTXA 1IXRC 4M53A 5DNDA 2QKYA 2V3CC 2LKCA 4OATA 3D3WB 3E48A 2QBYA 1QO0D 4MQBA 2FPGA 1J56A 1ZH6A 3IDFA 3C98A 3K9WA 5LOVA 3COJA 4WVFA 4UJ3A 4LHWA 4YXWA 3M4JA 1DRUA 5I9SA 2CJWA 3H9JA 2TMKA 3IULA 3KOYA 3EEIA 4NJMA 2JBAB 1IEQA 1P33A 2R4UA 3AOEA 3RS9A 2ZSUA 5B4TA 3QM1A 4URWR 1FP4A 2YV1A 1PR6A 1ZDMA 3BVPA 2JGAA 3C3MA 3D8TA 4IQ4A 4GP7A 3TLYA 4I4NA 4X1IA 2NT3A 3TQHA 4A2PA 3ZCPA 1FUIA 1ID8A 4FDVA 5LVAA 1T0UA 3LZCA 4I9GA 4IIJA 5FWYB 3VVBA 3TXXA 2ZUDA 4WBNB 2BUAA 1DHTA 1SBCA 1XZCA 2QUIA 5CBPB 1CRWG 4TTQA 1PDVA 4PR3A 4JBNA 1XALA 5ARCA 2GR9A 1OH5A 1G7TA 1PR9A 1YMQA 3AP2A 3S70A 3W90A 5C1BA 3UPTA 4I6JA 3ZIAD 3LW7A 1SCIA 2GZ3A 3BB3A 1BHSA 1MH1A 2M98A 5F2OA 3DULA 4ZVOA 1NVVR 2JIQA 5JPDA 4HPWA 4N3GA 1VYHA 4IDNA 4K8RB 4M0EA 5HIMA 4RDCA 1X7GA 3PQ2A 3OTOB 1T15A 1VGQA 1KWGA 2I3AA 2ZUUA 1GZ4A 2Q27A 4CHTA 5K8TA 5FBQB 4DQDA 3UJ3X 3ZHYA 2GVZC 4DAOA 1GSHA 3AT1A 1ABEA 3E9MA 2X40A 1EB9A 1NTRA 4OY3A 4P92A 3ZUPA 2FH5B 1B14A 4MVXA 3GN2A 1RHRA 1IOLA 5ILQA 3FCXA 4AP6A 4EY4A 1TNDA 1ZJZA 2FWJA 4X61A 5F1YA 4B0OA 4C14A 4NICA 3TR6A 3FR8A 4Q21A 1DMSA 3RRZA 3MHTA 4PZCA 1EKXA 2PO7A 1DJLA 4O4LA 4Q4JB 2XGMA 3NO4A 4BN0A 3QI2A 3Q3EA 5ISMA 5LSAA 4KR0A 4JYZA 3PYLA 3AR6A 3CF4A 2ZYWX 4HLNA 1TLLA 3AYXB 1JQ5A 3TPCA 3UWOA 5AVZA 3DCJA 4XWKA 4N6OA 1Z5WA 3O73A 1K7FB 3UJAA 5CJPA 3R3JA 4U7GA 1ISRA 3VHQA 5FJJA 2DKFA 4D4IA 2R97A 4ZV9A 2FMFA 3BMCB 4E33A 1FIUA 3FHTA 2DFLA 3P4YA 5B53A 4O4HB 4IYRA 1XCBA 4BO6A 5L53A 1N2HA 1NBOA 1M83A 3HL0A 3ES9A 3PFWO 2VDKB 5IASA 3IIIA 4HK4A 4HDKB 3NNSA 2NTEA 2R84A 4QO8A 4B6PA 1MN6A 5ADHA 3ZNOA 4A0QA 2Q3HA 4RK1A 4DIUA 4E5PA 3HA3A 1GZ7A 3GL9A 3LMKA 4O2BF 1IOVA 1NXXA 2YFHA 1R6AA 2QQFA 3GLSA 2R0QC 3ZX4A 3L18A 4H77A 5TDHA 1I4EB 1N75A 2OA0A 3ONEA 2XCLA 3WIBA 4MUBA 3V4OA 4PU0A 4Q4AB 5EJGA 3DLCA 1XC7A 4HOYA 2VBFA 3CH7A 3LLUA 4LIPD 4Y0AA 1F2VA 2ZS9A 5A71A 4F46A 2QG9A 3M5PA 2QU8A 4GPTA 1DUSA 2Q6LA 4MO2A 3QTBA 2DMRA 1TQHA 2B0JA 3PFIA 4KLRA 1Y8RA 1U6JA 5CUQA 1SKQA 4ZA2A 3WAJA 4ZCIA 4HP8A 3WYCA 4NE7A 1K3FA 1PSZA 2GAIA 1V6AA 4LMPA 3CGGA 1KBZA 3BIWA 1WQ1R 4M37A 1JSCA 5JYBA 5KYXB 3AUTA 4YJ3A 2IH5A 1V26A 1F51E 3N8HA 1AF7A 1JXQA 4LF4B 1I2DA 2B7CA 1BS2A 2O57A 5F1PA 3AOGA 3LA8A 2GPTA 3L0CA 1MT3A 2HA6A 2JLVA 4IX9A 2WMYA 2G7ZA 3IAEA 1T1IA 1PGOA 1V41E 3HEMA 5DHFA 4F3RA 3DLBA 1N2IA 1Z2DA 2ZR9A 2ZRIA 2BVNA 3IUJA 4RMNA 3TD6A 4KQHA 5IT0A 1TE2A 4K9RA 1ULBA 4DABA 4TMVA 2B5VA 4HQFA 4LE2A 4C30A 4AJPA 3U1BA 1AV7A 2GN8A 2XB8A 3KAPA 2EYUA 2X3FA 2XE6A 1VLHA 1ZESA 3AR9A 5NULA 4Z53A 1V6SA 3PKJA 2YV3A 2W4QA 2BHRA 2BTQA 2PA0A 3DXYA 4QD3A 2Z3ZA 1B1AA 1D5CA 5E9JA 3OJFA 4AZVA 2BP7A 5HK8A 5LFAA 4RK0A 3G3EA 3UFXB 3EPRA 2HB6A 1PN3A 2I22A 3W4IA 1IK6A 2BFEA 2FP3A 2G4CA 2QTBA 3DAOA 3GEDA 4UHCA 3R7SA 2GOYA 1JIUA 4MVJP 2W6ZA 2ZWVA 3TTVA 1OR8A 4JBIA 4GBJA 3KP1A 5A6SB 3HKCA 2Q0QA 2JEZA 4JDUA 4KN9S 5DLDA 1G3RA 1S8NA 4PAMA 1J97A 4WLOA 1X80B 3G8AA 4L4YA 3RTBA 5F51A 2G04A 2BTOA 5IT4A 1EUDA 1YCFA 1J0BA 1Y33E 2HDWA 2YHUA 3EXAA 3LIPA 3OECA 4L16A 1R6DA 1D2AA 3W4KA 5C7OO 3I92A 3A58B 4YRRA 4RIGA 1M9NA 1CUDA 2CLCX 1N5LA 2IVFA 2XUJA 3L6CA 3D3NA 1LFDB 1TJ3A 3HCFA 3P9PA 1V43A 3RYFB 5DOVA 1XMXA 2CFIA 1IB6A 4ICIA 5ICMA 4OQLA 2XMGA 3CRNA 2GKGA 3UV3A 3WB1A 1DSSG 4DMGA 2ZKIA 2JFVA 2GM4A 3E4DA 4B83A 4HLUA 3M83A 1GA4A 1SEVA 3EIHA 1YVDA 3E53A 1PHPA 1X39A 4ND8A 4B46A 4D4GA 2QPTA 1FSGA 1WCWA 1XZEA 3ST7A 3BXGA 4NCAA 1QS0B 4PVDA 3N8KA 3ZEIA 2ZAIA 1DAGA 5B3LA 3IPAA 3TMAA 2ZYDA 3TQOA 4JQYA 3F6BX 4XDZA 4DLYA 2P5YA 1TF7A 1Z63A 2VQDA 3ZYCA 2EKBA 2E5FA 3V8VA 5EHXA 1XZDA 2FW9A 3M8KA 4NZNA 2PTGA 4EFNA 7AT1A 1P0FA 5DMXA 2C3YA 1P0PA 2QZJA 5BNIA 3GUVA 4TVKA 5FR1A 3ZY5A 5EMKA 2IEIA 1JALA 3LI2A 1NQ5A 1RMTA 4JKOA 4UM9B 1N8SA 2HNAA 1T8UA 4G1UC 1SD1A 1E2KA 4FFRA 4B8WA 4RNDB 1COWD 3MPOA 1KMNA 3BQNB 4FGZA 2HN9A 3ETLA 1GU0A 2EJVA 2VK1A 5DHPA 2AB0A 3PDUA 5BV1A 1I32A 4C29A 4BXOA 1TM2A 3PU6A 1CYEA 1MHPA 2XTJA 1BAPA 4TTSA 4ZVUA 1YCGA 4D56A 2C96A 3EUFA 4C0HA 1NYQA 4LE1A 2IZ1A 3DWFA 5B58T 4RF4A 4A82A 2JGEA 1MB0A 3GLUA 5KC9A 1JEQA 1MNQA 1NW6A 1FZTA 1SC1A 3VSCA 5HBRA 3B2QA 1DOZA 3CG4A 4FU0A 4S1NA 4YASA 1XVUA 1LDYA 5A3RA 4RPJA 3K5HA 3U3MA 2ZIVB 5JATA 5G02A 1QFSA 3PI7A 1BDJA 3G1TA 3ONWA 1KVUA 2NVUB 4NV1A 1SG0A 3LHIA 3TDMA 4KAJA 5HZKA 1RADA 2L69A 1N5OX 2UZ1B 2XD9A 4PPYA 3GELA 4YDRA 2QAGC 2I99A 3UV6A 1CFZA 5L4NA 4JX8A 1JBKA 1DX9A 3GMTA 5KX5F 3IEKA 3NDIA 4HVLA 3MCZA 4DLUA 5G3ZA 4XRGA 1SUSA 3SYKA 3NDRA 4YN3A 1QCDA 1UCFA 4P0TA 3A32A 4QTTB 4JJ8A 2CDNA 3H75A 2E5WA 3FSRA 4RF2A 2C9BA 1YDEA 2PRYA 1IEWA 4JCOA 3PG5A 1EWYA 4DLNA 1NXOA 3DHEA 3PNYA 4FOPA 2GPBA 1OI4A 3SQMA 4PN7A 1UKEA 2V8OA 1OWLA 1IMJA 1YQGA 5DX0A 4YRPA 5EXDA 2ZT6A 5A5EA 3U1TA 3DNFA 4WW0A 2XA2A 2AVDA 2B30A 2ZB3A 1B6TA 2QX7A 2H6EA 3DEJA 3H65A 3KOOA 2YRXA 4RSRA 3VYSB 4G9GA 4QICA 4MRMA 1YXMA 1JIIA 2V98A 1F48A 3VSBA 4ZIRB 3I8SA 1RBYA 3WQQA 5GJWC 4HEQA 1WMEA 2OBBA 3MSXA 4G6ZA 5E1OA 5CVTA 3L40A 5JMTA 3QEBZ 5EJMA 3LDHA 1RQLA 4NBUA 2Y6UA 3V2HA 4G5YA 4U4AA 3I42A 5DHQA 1TYBE 1IN1A 2MSEB 4EI8A 4B87A 1KK1A 1CUGA 1XHFA 1Z6TA 5CM9C 3GARA 3TTWA 1KQGA 1CCWA 3OCJA 1RRGA 2F3SA 2I0FA 2P78A 2PPVA 3AR8A 4BRWA 2RK3A 1KPGA 4P4SB 3RSQA 2HT1A 2XUHA 3TFOA 3R3XA 3IHKA 5A4FS 2Y1GA 2CCGA 5CEEA 1RYYA 3ZN2A 4QNNA 4M1QA 2FLWA 3LTEA 1SURA 4IHAA 4OA5A 3V8RA 1E0SA 1SVLA 2VP6A 5FCDA 4IEEA 4BWFB 5AKIA 3N7UA 2AEJA 3K0CA 1BFUA 1E9EA 3DVAB 2PZKA 1U8UA 1RBMA 1XCLA 4KU4A 3M0EA 3SQDA 2J9RA 2OLEA 4KACA 2VP5A 5J5CA 2EU8A 4I1OA 3CN7A 2ZETA 3WLHA 1QE5A 2YWDA 2J59A 4BO9A 3DZHA 4FIDA 3I5XA 3DLHA 2NU9A 4C3ZA 2BTEA 1FFEA 4FFWA 1GNTA 1G3IA 4AO6A 2GI4A 2XOKA 1KEVA 1USIA 1KXJA 2W11A 5E9WA 1B8NA 5TNXA 1YR8A 3KOXA 4EMSA 2LE0A 3MRXA 4QAQA 3W34A 5HKOA 2F8SA 3R23A 4A8PA 2Q3CA 3DAYA 4QPCA 2JLQA 3M4YA 4ZAXA 2G9RA 1M73E 5FH9A 2JS7A 3A0RB 2O2CA 2VRWA 4PLGA 2JCGA 1UM9A 3V2UA 4NMMA 2PVPA 2NU8A 4BKQA 4E11A 5U4QA 1SA0A 1A50B 1T4DA 1NXTA 4I8XA 5E9AA 1VMIA 3AF5A 1JQDA 3CUUA 2NU6A 2WPDD 3KHTA 5J1SB 3WRXA 4M3NA 3GZTB 1R37A 2Z2IA 1TYAE 3I2JA 4M1ZA 2ZAMA 4P7JA 4X1KB 1T5IA 1V96A 1UXGA 3LXUX 4PPGA 2PCLA 3TVYA 1G64A 3CLVA 3II6X 3OIDA 1CP2A 4JSYA 3GR6A 4L5AA 5CNMA 1IQUA 4KR2A 2IDMA 3EHEA 3DTVA 2I1VB 3WB9A 2ZM5A 4DMMA 1IZ8A 4R2JA 2G1AA 1G21E 2O05A 2VVTA 2ZSFA 4OYRA 3VVMA 2D2XA 3IP5A 3C8DA 2IP4A 2R86A 3PUZA 3OCYA 5AJHA 4DLZA 4ZCMA 2QY6A 5K3DA 4TSFD 5BSWA 3LY7A 3WTBA 2V5VA 3I9V1 1GEEA 1N6PA 3TB6A 3DFKA 3DVQX 4IAOA 1L7DA 1Y7IA 2BEWA 3HB7A 1OA1A 5ALIA 3OQHA 3Q88A 3RJTA 2GFHA 3W9SA 4FBGA 1UXJA 3QU9A 4DLAA 1L7NA 4M0FA 3F1KA 1GZ6A 1TZKA 5AKXA 5CDFA 5B6JA 1USKA 5FUMA 4TM8A 4KVAA 2FEMA 2WFMA 3A6HA 5DNUA 3V3KA 1BFDA 2AMVA 2QT0A 1H0RA 4ZREA 3HU1A 2C4NA 1QOZA 1FBNA 2JD1A 1YA4A 2PSJA 1HYQA 4LRSB 3V00A 4BVGA 1U7HA 1TK9A 2X5JO 1UOEA 3GFRA 3ZD8A 2Y0BA 3Q7PA 1HM5A 4RZ3A 2OGSA 3DAGA 3VNBA 1DELA 3FKSA 2ZRDA 2DPMA 1V8FA 4Y1RA 3M1YA 2J8ZA 2FR8A 3I4CA 1U2PA 2YFYA 3GFGA 3QLEA 1YZUA 2VG8A 4Y2UA 4ZVTA 1L5HA 5K6RA 2QVBA 1ZGZA 3ENQA 1CLEA 2HA7A 5EP4A 2I62A 4C03A 1OZ0A 1ZS9A 3E58A 4NWIA 1OIXA 2E4YA 3WJ1A 4Z54A 1M8KA 1IXSB 5I7RA 2VT6A 4D3YA 5HTOA 5AOVA 4MQFA 1HO3A 3L2OB 3C8HA 2GHQA 1DOHA 1WABA 2EFEB 1C8KA 5DBIA 2C9CA 1RYFA 2KJQA 5K3SA 4BPBA 4RPLA 3JD2A 2IXBA 4F92B 3LZDA 1LNQA 3OZ7A 1AK1A 5BVHA 4I4TB 3DBOB 1FNBA 3KUDA 4KH1A 4DCOA 1HSOA 2Q5QA 2QP4A 3DT6A 3WYGA 3O8CA 4TXNA 3U9LA 5I7HA 1KY3A 1QNLA 3H3XA 2DQSA 4GT1A 3C3EA 4Q15A 2X0DA 1RQGA 2BKEA 2QXTA 2VJBA 1XRNA 4FONA 3HV2A 4B3CA 2WYVA 4AMUA 4EHDA 5LP6B 2AW3A 4MP3A 2Q1SA 2CVPA 4L02A 2VSOA 3TGWA 4ZGWA 3IT0A 4H1WA 2W42A 2PGJA 2IEZA 2VF8A 3AQ4A 5EZYB 2EZ4A 2ORYA 5JMOA 4FS8A 1ZD4A 1CUYA 3D8HA 4CG1A 3NBYC 4Y6RA 1N5RA 4GUAA 3DV0B 4A23A 5DGTA 4AY2A 7REQB 2BF7A 3MZ0A 1CQJB 1GXSA 2ZIUB 3AERB 5LR6A 1S2DA 2AOWA 3MC1A 2J0QA 4FOSA 1TCBA 2GKSA 2O07A 3NNDA 5CM8B 3QTLA 2I76A 4GI3A 1CKEA 1ZSYA 3JZMA 1U8YA 1GGEA 4NBLA 3BD8A 1UQRA 1E3IA 2IIQA 2ZJYA 1Y81A 2C5SA 3DBIA 1RI2A 1TTQB 5EHNA 3TUIC 4CTMA 4BNZA 1AK2A 4M1TA 1WHSA 3DV9A 5ILOA 1H42A 3LE8A 4MWCA 2XUAA 1ZQ1A 1G8YA 3SMQA 1JA0A 4M9RA 3EXEB 3HMKA 4IIGA 1ESCA 4FCWA 5L4SA 4XB2A 3ILHA 1M2VA 3L1JA 1P4RA 1IUPA 1OFVA 3HJCA 4D42A 4WXPA 1P61B 2TECE 1P1CA 3LZ6A 3QY0A 4G89A 4R0VA 5DI3B 2IYRA 4LTDA 2A1TS 4Z49A 1Z29A 4OM7A 3D7NA 1PQUA 2SCUA 1XLTC 1E3TA 5AKJA 4F7DA 2ZBQA 3ABZA 4G65A 3QSYA 3FYHA 1WZIA 2BFDA 4LJKA 1PGPA 3AJ9A 5JYEA 3SS9X 4O1IA 2O0KA 4G5HA 1X38A 5BYKA 4J29A 7MDHA 3EWAA 4M1WA 5GIPE 4UASA 2C7OA 4CCYA 1KQ3A 3Q3IA 2DEUA 1L7OA 1IY8A 2Q5OA 3Q7IA 5FOTA 2XE4A 4CMIA 1WQ3A 4XB1A 2Y1WA 4YCBA 1Z7WA 2DKNA 2H4JA 3FYUB 1BVRA 1GPMA 1YE5A 3KBBA 4HWPA 2C2OA 4EA9A 4P54A 1XMQB 3OC0A 5LJIA 2IP2A 4UMEA 3RJMA 4J8PA 1E92A 4D8YA 5KQSA 4BHTA 5CG2A 2W2TA 5DCUA 3WGLA 3C1UA 1SXJA 8GPBA 2P91A 2ZI7A 4Q16A 5T6BA 1QAOA 4HAYA 3JQAD 4E7PA 1G5TA 3BZWA 3W7AA 4HEJA 1E0JA 3NV9A 5JYCA 1JILA 4J07A 3U7QB 3DQPA 1Q95A 4B82A 1O8CA 3I04A 3VKGA 1R8QA 2B1QA 2EEZA 2IF0A 2WVGA 3KUKA 4WEQA 4JT8A 5JCOA 3B1ZA 2H59A 3CNQS 3W5IA 3RK4A 1WP9A 4HMOA 4O08A 3MYRA 5JJBA 3BMNB 3GAMA 3JQAB 2QAJA 3QKSB 4CF3A 4DWJA 1Q7EA 3WIUA 3OF5A 4JEIA 2X3YA 3QVGA 3AL2A 4ED9A 2WYOA 2NO4A 1BRTA 3ZY3A 1H9BA 4FFBB 1FJ2A 1M6HA 1XD2B 3SOPA 1GUFA 4RA9A 1PX2A 3VUFA 1B0ZA 1TMOA 2V6MA 2VPTA 2R3SA 1T5DX 1XT6A 2ZS8A 3AHHA 2NUPA 3KHUA 4BKRA 1IDOA 5TLSA 2UUOA 2ZJ8A 4MAMA 1ELOA 2C54A 1T35A 2B34A 3G0OA 3HJUA 4N5NA 3NBMA 3RC1A 1C4XA 3TLAA 1KU6A 2JZNA 3DJYA 4ARUA 3MWEB 3AYZB 4DIOA 2D7CA 4DV5B 2D1TA 1R0WA 4DF3A 1U5BB 4O2AF 1HGXA 3PENA 4JJZA 3KFXA 1E96A 4J43A 5AOBA