1KPHA

Crystal structure of mycolic acid cyclopropane synthase cmaa1 complexed with sah and dddmab
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
283
structure length
283
Chain Sequence
LKPHFANVQAHYDLSDDFFRLFLDPTQTYSCAYFERDDMTLQEAQIAKIDLALGKLGLQPGMTLLDVGCGWGATMMRAVEKYDVNVVGLTLSKNQANHVQQLVANSENLRSKRVLLAGWEQFDEPVDRIVSIGAFEHFGHERYDAFFSLAHRLLPADGVMLLHTITGLHPKEIHERGLPMSFTFARFLKFIVTEIFPGGRLPSIPMVQECASANGFTVTRVQSLQPHYAKTLDLWSAALQANKGQAIALQSEEVYERYMKYLTGCAEMFRIGYIDVNQFTCQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYCLOPROPANE-FATTY-ACYL-PHOSPHOLIPID SYNTHASE 1
publication title Crystal structures of mycolic acid cyclopropane synthases from Mycobacterium tuberculosis
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 106
structure length 283
sequence length 283
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.79: Cyclopropane-fatty-acyl-phospholipid synthase.
pdb deposition date 2001-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02353 CMAS Mycolic acid cyclopropane synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1kphA00
4RTPA 1KHHA 3AY0A 2ZSUA 5DRYA 4EK9A 4RTOA 4PYQA 3G2PA 2GAFA 3C3PA 5DTRA 2PSSA 3FTCA 5LSAA 3HVIA 5P8WA 5KQRA 1B42A 2PKWA 3FUTA 4C05A 5E8RA 3F4KA 3NTVA 2AN4A 5FA8A 5HZMA 2K4MA 4YV2A 3AWIA 5CUQA 3SMQA 4C03A 1KR5A 2CMGA 5EIFA 4EKIA 1L1EA 4RVFA 1RI3A 1ZGJA 3KKZA 2ZW9A 3HA7A 3BKWA 3KR1A 3OPNA 3OU2A 5DXAA 4PYKA 5EG5A 3DH0A 3LPMA 2PWPA 5HEKA 3GRVA 5T6BA 2VDWA 2PX8A 4OQEA 3U81A 3B3GA 2EJUA 2V74B 3VC1A 1RJGA 3SSNA 2HTEA 1P1CA 2VDUE 5ICGA 2ZFUA 2FPOA 2BM8A 5EHIA 4C04A 1RI1A 2P3OA 1ZG3A 3Q87B 3NMUF 5EZSA 9MHTA 3E7PA 2IIPA 3G5LA 5LQAA 2VP3A 1WZNA 2CKDA 1PRYA 4LECA 4LG1A 5FWAA 4GF5A 2G1PA 2ZIGA 5LQCA 2NXEA 3TM5A 3LHDA 3CGGA 3HA3A 4BLVA 1ORIA 2G8NA 5DM2A 3UJDA 4HGYA 4ER6A 5K0GA 3FUVA 2B3TA 2FK7A 2I7CA 2GA9A 2QYOA 2PXCA 1KPHA 3P9NA 3P2KA 4E33A 2P7HA 5GIOE 1DUSA 1L3IA 2XYRA 1EIZA 2FHPA 3R6TA 1NW6A 3P9IA 2ORED 3HVKA 2ZVJA 3KPYA 2O05A 2KW5A 1YUBA 3LKDA 3NDIA 3Q7EA 4FS8A 4KDCA 4P58A 5K0CA 2H1RA 3T7TA 3HA5A 1VPTA 4GC5A 3G2QA 4FZVA 4MWZA 2GB4A 4EMSA 4QPPA 2ONZA 4BLWA 4LWPA 3BWYA 2P3LA 5D1NA 5EIWA 3LX6A 4QDKA 1JQ3A 4DZRA 1TPYA 3ELUA 1HNNA 3C0KA 3GGDA 3A26A 3M33A 4HH4A 2EFJA 5CVDA 3RIEA 3T7RA 3UFBA 3V8VA 1L3CA 1NV8A 10MHA 3MCZA 3C3YA 3R3HA 5E8JA 3ORHA 4RVGA 1Z3CA 2B2CA 3KPWA 3G88A 3NJRA 5K0NA 5K03A 1XDUA 2N47A 1NBHA 3CVOA 3MCTA 4QVKA 3CBGA 4A6EA 2PX5A 1NW5A 5HIJA 1ORHA 3EEYA 5LQKA 2PT9A 1NV9A 3SX0A 1XXLA 4DQ0A 3TMAA 4RVDA 1PJZA 5HIMA 1SG9A 2IH2A 2OY0A 4EQZA 4R8SA 3RW9A 1QAMA 3P9CA 4RVHA 3QOXA 4KDRA 1N2XA 3GJYA 5GOZA 3OCJA 5LQUA 2FRXA 2PV0A 3FPEA 3TLJA 5DT2A 5EKUA 4YUYA 1G38A 1DCTA 4ER5A 1G60A 3HNRA 3O7WA 1ZHFA 4ER7A 1NE2A 2JH9A 5CVJA 3UJ8A 2HWKA 5GM1A 3SM3A 2ZWAA 4ER3A 3NVKI 3E05A 1M6EX 5ICFA 4PYMA 1UWVA 3FRHA 3TQSA 4RTSA 2Y1XA 2IBSA 3EEOA 2AVDA 2ZCJA 3VC2A 1D2HA 1QAOA 2EG5A 3S68A 1YF3A 3LKZA 2C7OA 4QQKA 2GS9A 5EMMA 1KP9A 3BGDA 5DXJA 3EVZA 3OU7A 2BR4A 5DSXA 5GWXA 4GEKA 2HMYB 4RSRA 2O07A 1YZHA 3HVHA 1N7IA 2BR3A 2IP2A 1NW8A 1YZ3A 3I9FA 4ZTBA 5EZQA 5EMJA 2AN3A 5LR6A 2OKCA 4A6DA 4B17A 3CCFA 2NXJA 2A14A 4FT4A 2XVAA 4NECA 4IKPA 4WVLA 3T0IA 3TM4A 5EHGA 1ZQ9A 2VS1A 3I64A 3KQTA 1JR4A 5EC8A 1YFLA 3R9XB 1G8SA 3DMHA 3LDFA 3OZSA 2B9EA 3OZTA 4G56A 2C7PA 5DX8A 5HIIA 1IXKA 3GRYA 3P2EA 3KPUA 1KYZA 1VIDA 4MHTA 3BXOA 5FA5A 4U7TB 2Y1WA 4MTLA 2ZIFA 3FTDA 3G89A 4WXHA 2UYOA 4RWZA 3JWHA 1Q0SA 4QPNA 5EOVA 2AOXA 1FPQA 5EVJA 4PCLA 3GCZA 3T7SA 3HEMA 5E1BA 1XJ5A 1SUSA 1QANA 4E30A 3OE5A 1NW7A 1QAQA 3LECA 3I5UA 2CMHA 1FP1D 3EMBA 3DLCA 3KHKA 1D2GA 2P8JA 3KPVA 3TOSA 5CM2Z 3B5IA 1QZZA 3FPHA 5CD1A 2I9KA 5DM0A 2IPXA 4FSXA 4BLUA 3NDJA 4DCMA 4DF3A 4X60A 2I62A 4RTQA 2Z6QA 4P7JA 1RI2A 2BM9A 1UFKA 3MERA 4PONA 5CVEA 3ER8A 2P3QA 2BH2A 1YB2A 1O54A 3NVMB 1WG8A 4IV0A 2IDJA 5BW5A 1XCLA 2UYHA 2PX4A 2P40A 3CKKA 3DMGA 3M6XA 4CXMA 4PGHA 4H0NA 4RTRA 4PGGA 4C06A 3FPGA 4AZWA 5CCXA 2ZIEA 3BGVA 3MB5A 3BZBA 3OU6A 4PYNA 5DX1A 4YMGA 1XDZA 2PY6A 3V97A 3P97A 4RV9A 4EVIA 4KIGA 3DP7A 3HTXA 3M4XA 1SQFA 3HCBA 1EJ0A 4HSGA 4CWAA 3FYDA 3MTEA 1OR8A 4F84A 2P41A 2EJTA 3I58A 3PX2A 1MHTA 2LD4A 2AOWA 4YV1A 4X1OA 1Y8CA 1BHJA 3PFGA 3TKYA 1VP9A 5JUWA 3G7UA 4DA4A 1Q0TA 2YXEA 3GXOA 4PCAA 1MJFA 3A7DA 2UZ4A 4XUEA 1O9HA 4KIFA 5F2KA 4KRGA 5B1SA 3ELDA 4P7GA 4C07A 2ZBQA 3O31A 4HTFA 2G71A 5KVAA 4BY9E 1NW3A 1BKYA 1RJFA 4YUZA 1T43A 3RODA 5HOQA 1G55A 5EEHA 1N7JA 2G72A 3PT9A 1XCJA 5F2NA 3LL7A 4PNEA 2ZBPA 3B3JA 3DLIA 5HILA 1WXXA 2G70A 5DTMA 4DMGA 5M5BA 1YFJA 2OB1A 4U7PB 1NT2A 1TW2A 4E2WA 4GQBA 4CKCA 3HVJA 1RI5A 2YTZA 1JG3A 3G2MA 2AS0A 3AJDA 5KS2A 1UIRA 3ID6C 1L3BA 3PLAE 3JWGA 3UBTA 3G5TA 1JTEA 2JHAA 3QV2A 5DPMA 5FULA 5C9ZA 1R8XA 3PX3A 2UYCA 4HTFB 3KQSA 2IH5A 2GH1A 2ZZMA 2GPYA 1AQJA 4QDJA 1F3LA 3LCCA 3A7EA 5E1MA 2BR5A 2IDKA 1IM8A 4PIMA 4R6XA 3FZGA 4YUXA 3OZRA 1NBIA 1I9GA 5E9JA 4YV0A 3B7PA 4L7VA 5C0OE 3PTAA 2YVLA 4AZSA 2B78A 2QY6A 3SSMA 4AZVA 5K01A 3CJTA 3TR6A 2HNKA 2YXLA 3DOUA 3G2OA 2NXCA 3FPFA 3P9KA 2ZLBA 3DULA 5E1DA 3HP7A 4YUVA 5CVUA 3FUUA 3TFWA 2JH8A 5BP7A 5FQOA 2Z6UA 2ONYA 2PLWA 2XVMA 3CC8A 4YMHA 2NNWB 1XTPA 4FP9A 2IFTA 3EGVA 1KIAA 3KQWA 4IV8A 1WXWA 4GOOD 2NYUA 2CL5A 3IHTA 4R6WA 3SXJA 3FTFA 3FUWA 1AV6A 2VZ9A 1P39A 1R00A 3C6MA 4FT2A 8MHTA 4GOMD 2O0LA 3BT7A 3EVEA 4R05A 2C7QA 4QTTB 3GWZA 3SGLA 4LWOA 4M37A 5K0FA 5CCBA 3KR2A 4PWYA 2QE6A 5EQJB 3EVCA 5K8VA 1EG2A 2JJQA 2XYVA 2H00A 3DXXA 2DPMA 3EVDA 3KQPA 1INLA 2YUIA 1AF7A 2YX1A 2JHPA 3B89A 2QRVA 3LBYA 4KVZA 4C4AA 5KQSA 3OE4A 4DKJA 2C7RA 1M0EA 3ME5A 1O9GA 4F86A 1V39A 5EMLA 3EGIA 4GOND 1P91A 5DM4A 1R6AA 3UWPA 2AVNA 3HCAA 1FBNA 2VDVE 3FTEA 3NW9A 4RYLA 2ZZNA 1JQEA 3CJRA 3DMFA 3P8ZA 5CVVA 3UJBA 2PWYA 2EX4A 2PJDA 5LQJA 2ZBRA 3CJQA 5IH3A 4ISCA 3QOWA 1R8YA 1VLMA 5G02A 3KPJA 3LCUA 5HFJA 4XUDA 1JTFA 2WA1A 3E23A 3PB3A 3THRA 3WSTA 3TPZA 1ZKDA 2OZVA 3NWEA 2WA2A 1X19A 4BP3A 3ELYA 3UJCA 2E5WA 5DTQA 5GINE 1JG4A 3E8SA 5E9WA 5EPEA 2PXAA 1BC5A 3GRZA 1U2ZA 4HGZA 4Y2HA 4Z2YA 5U4XA 4MQ4A 4FSDA 4QQNA 4QVGA 4CKEA 4E70A 4UOEA 3MGGA 2OYRA 2O57A 3GRUA 3MTIA 4R8RA 2ESRA 7MHTA 3UA4A 2PBFA 4JXJA 3THSA 3DTNA 5BW4A 5K0EA 4OA5A 3KU1A 4V0RA 3TKAA 3SR4A 3DR5A 2CWWA 3OFKA 4XUCA 3KQVA 3UJ9A 1FJXA 1FP2A 5EMKA 3FRIA 3DXYA 2ZULA 4CTJA 4E2XA 1VQ1A 2WK1A 3BGIA 3PVCA 2ZZKA 3OFJA 3M70A 1TW3A 2YQZA 3P2IA 4GBED 3HCEA 4M7RA 3HCDA 3ELWA 3A4TA 3VSEA 5MHTA 3UJ6A 4AUKA 2OXTA 1JQDA 1IY9A 3KQYA 1HMYA 2JHCA 4GUAA 5F2OA 5T64A 2AZTA 4QTUB 3L8DA 4RTMA 1X1DA 5K05A 2HV9A 2F8LA 1KPGA 4KWCA 4OBXA 4K6MA 3MHTA 5E2BA 1G8AA 3EPPA 4ATNA 2B25A 3M6UA 1EJ6A 3M6WA 4HC4A 1R74A 3LGAA 2AN5A 3GDHA 1JG2A 3MQ2A 4HG2A 3VYWA 4DM3A 1XVAA 3R24A 2ZTHA 5FHRA 5T67A 3PFHA 4O29A 1I1NA 2P35A 3IV6A 3TRKA 4X63A 4F85A 4M38A 3K6RA 2AOUA 2YR0A 5D1HA 3HM2A 4RTNA 2IH4A 3KR9A 2HR1A 5DWQA 4AZTA 5EKXA 4FGZA 5DSTA 4EKGA 4OX9Y 2ERCA 3R0QA 5IKMA 4E31A 3IYLW 1RJDA 2NP6A 5EEGA 2PXXA 3EVFA 1F38A 1G6Q1 2R6ZA 4GOLD 3BKXA 1KYWA 1XDSA 3C6KA 3SSOA 2Q41A 4AX8A 2BZGA 2AR0A 5FQNA 5K0LA 3EVBA 2Z6AA 4RTKA 3REOA 2FCAA 2XYQA 5ICEA 5GIPE 4YUWA 1SKMA 4GC9A 1DL5A 2IGTA 2XBMA 3GU3A 1JSZA 3IEIA 4BP1A 3D2LA 3SVZA 2P7IA 3A27A 1X1AA 3HCCA 5FCDA 3ER9A 5E1OA 4RTJA 2AOUB 5FADA 1EAMA 3G8BA 1L9KA 4CTKA 2GLUA 3GRRA 2YXDA 2NP7A 5FHQA 4C08A 2O06A 3EMDA 3UJAA 1VL5A 5ICCA 3AXSA 5E9QA 1RJEA 4PYJA 3K0BA 2PT6A 2AOVA 4P7KA 2V7EA 3DXZA 4X41A 4FR0A 3FYCA 3LCVB 4RX1A 2PVCA 3ANXA 4Y30A 5EGSA 2JG3A 2UYQA 1EQAA 4PINA 4DCGA 4RTLA 1H1DA 4PIPA 5JR3A 1SVUA 3UJ7A 5KYGA 3NWBA 1X1BA 3I53A 2PGXA 3KQOA 1VBFA 3DUWA 5K0JA 2AOTA 4OQDA 5BXYA 5CIYA 3KQQA 3LBFA 5DRTA 1WY7A 1JSXA 2P1DA 3BUSA 2I6GA 1WS6A 3BWCA 3BWBA 4CKBA 3FUXA 4P7FA 3X0DA 1QYRA 1R18A 4PYOA 2IBTA 2DULA 5DLYA 4XCXA 5C1IA 2ADMA 5FUBA 5FWDA 1KXZA 1VP3A 5K09A 1AQIA 2NXNA 1M6YA 3PS9A 2PX2A 3M6VA 5DM1A 1D2CA 2OBFA 3AXTA 3KQMA 2ZWVA 3MAGA 1NKVA 2FYTA 3GO4A 3LSTA 3GIWA 5FTWA 4OA8A 2H11A 4E2YA 5K0BA 1X1CA 1KPIA 4E32A 3FPJA 4M36A 2OO3A 5HIKA 3EVGA 1P1BA 1BOOA 2OPBA 4POOA 4MIKA 4PYLA 5H02A 1SUIA 3G8AA 3GNLA 4ER0A 1JG1A 1I4WA 2AOTB 2QM3A 3JWIA 4V0QA 3A25A 4HRAA 4X61A 3LDUA 5DX0A 3ERCA 3BWMA 4PYIA 3LDGA 3UA3A 3EGEA 5LQNA 5GM2A 2OB2A 3B3FA 1VE3A 1ZGAA 5ERGB 2QRVB 4E2ZA 3UZUA 2R3SA 4OBWA 1RI4A 4IWNA 3JWJA 3P71T 4KW7A 1SQGA 3HCFA 5E2AA 5LQRA 5GP1A 3KR0A 3EVAA 3H2BA 2FK8A 3O4FA
chains in the Genus database with same CATH superfamily
4BC0A 3QBJA 4I1UA 4EHFA 1U02A 3DZIA 3BJRA 3C3PA 3EPRA 3MWKA 3OO0A 5EWLA 1ACMA 5LSAA 3FLAA 4EUEA 1NZFA 3O4HA 1B42A 4RIGA 2OXRA 4R3NA 2A0KA 4XI9A 4YJ2A 3MYYA 5KZMB 1BWQA 4LHEA 2FPRA 4ZO4A 1GOTA 1ZVJA 4HRYA 1Z7YA 2F55A 2YWCA 1WV1A 3KKZA 2VBGA 2CE2X 4HAXA 1EGAA 5AI5A 3R4VA 1DMSA 1GAQA 4KRXA 1JQKA 3B85A 1ULBA 3CG0A 3QKTA 4NESA 4M9RA 3GRVA 2PKQO 7GPBA 5HQJA 3LI2A 3RYHA 5FYDA 5CA1F 2N1MA 2DTEA 4W8GA 5AKLA 1C3EA 3VVLA 1P6UA 5FUVA 2WYIA 3WICA 5ENDA 1H4QA 2MSCB 2GYWA 3V48A 5KJCA 3CURA 4GXNA 1XFDA 4D26A 4IXWA 2EIXA 3O74A 4AUEA 4E09A 3AFHA 3TRFA 1T5LA 2P9HA 3PJEA 1CUBA 5DO9A 4P6VF 1WNFA 3WMWA 4YRZA 2LV8A 4IGIA 1V5GA 2YBDA 1DO0A 3HN2A 4MV8A 2JKVA 4RQAA 2HWXA 2ORWA 4ZVRA 5B1EA 2J7KA 5A05A 3OQ1A 2F67A 3NHUA 1L3IA 4FIDA 1CUJA 1Q1GA 2W8BB 2BI8A 4YECA 4D3SA 1KDZA 2XAAA 2MYPA 2E21A 4BRWA 5IUJC 3V3TA 1N6OA 4P58A 1HC7A 1QCYA 3ZI4A 4DTCA 4RNCA 2PKEA 3PNOA 2MMCA 2RI1A 3ZUGA 3EPHA 1U0SY 4EMSA 4ZRMA 3U0BA 2LUOA 4QPPA 4YIHA 3B3AA 1QRTA 3FFTA 2UUAB 3HHPA 1LBHA 3LBIA 4BV8A 3P0IA 4L15A 5ED4A 3D2BA 1QIKA 3IT1A 3WTBA 4DZRA 4ERXA 3I0ZA 3NM6B 3NRBA 3UFBA 5I9LA 4KJZA 3KQUA 1KP2A 2BGNA 1T0JB 4KQ6A 5E8JA 1Z3CA 4K9OA 5JZBA 2XCRB 1X8KA 3ST7A 3NDPA 3N76A 2N47A 1NBHA 3R0JA 4GR5A 4Q16A 4TXLA 2RGXA 1C7FA 2HPVA 5LYJB 4WIAA 3ESZA 3DEKA 4MMXB 1CEYA 1I3LA 1NV9A 5JOQA 2NSJA 2AK3A 1A9ZA 3QVMA 3VU0A 4BVAA 1HQCA 1FDSA 1SCJA 2YWEA 4OLHA 1I0LA 1O96B 2J0UA 2VHTA 3NBYC 5D84A 3GN2A 4A15A 3DFUA 1KFKB 1F7UA 3PZBA 1RWVA 2BT4A 3W4IA 2PUTA 1Z5OA 5NULA 4ZRDA 2IELA 4YX9A 3KQLA 2DG2A 3MUNA 1EFPB 3FFWA 3WIDA 1ZW6A 3GLHA 4U9UA 2WJVA 1F2TB 1ZUNA 3C1AA 3R9XA 2EFGA 3FPCA 4QYIB 5YASA 2CSXA 2ZWAA 2JCBA 3RJMA 4UTVA 2RKBA 1CZRA 3AVWA 4MPRA 4TS1A 4LJAA 3O2SB 1U8UA 2FCRA 5G0WA 3GZTB 2O52A 4U5XA 4YV7A 4GLLA 1DCFA 4AN4A 3QKRA 4LXIA 5EMMA 1QV9A 2HZ7A 1SXJB 4PSCA 5KAMA 4A7PA 5JJCA 1E4EA 4JYCA 2O5RA 5AIBA 2VJLA 2IP4A 4OH1A 1E3LA 4IIGA 3CINA 4ZTBA 3QLEA 3BL8A 3I9FA 2M6KA 1SU8A 4QSHA 2LDBA 5F23A 3TFQA 1QUEA 3RH0A 1K5PA 1DG9A 1HLFA 5BUSA 1H5NA 2QIPA 4FHGA 1GARA 3RAJA 3D5EA 1PGPA 4E5UA 1R6VA 4MUAA 4PFSA 5EHGA 3KQTA 2AL7A 3BIJA 3TQHA 5HKOA 1VSQA 1QRRA 2R7NA 3QE0A 4D9EA 1ZL2A 2PJRA 5KHAA 2OV3A 3TLCA 4LBYA 2Z2IA 3PQ7A 2YZNA 3MRSA 1CUFA 1XP5A 4FKBA 5GONA 5EIXA 1LPOA 1JEEA 1DLIA 4XTCS 1HDOA 1C50A 4N3GA 3JWHA 4JC5A 4LZLA 2HC9A 2YS7A 1T9GR 1YMUA 3PRJA 4DLTA 5A4AA 1C0IA 5BRNA 3C1OA 3T5GA 5E1BA 4RWEA 4ARBA 3U3JA 4DCUA 3SK0A 1FB5A 4LRSB 1VMAA 3HYCA 4EW3A 1DG3A 4JIGA 4Q4JA 3GP8A 1DAMA 4Q7QA 2YMQA 1Y3BE 1E98A 1IAQA 4N3AA 1RIFA 3G1UA 3ZE1B 5COQA 4Z4CA 2HCFA 1DUIA 3DLHA 1PZNA 2PYZA 4IDQA 3SSAA 5T5QA 3AV3A 1AN0A 1J21A 2PGIA 3HC7A 1BXGA 4FSXA 5E38A 4K46A 1QGAA 1R4AA 2H0QA 2GZHA 2P1ZA 4HUJA 1MQAA 2D1QA 3SMVA 3WXBA 4ZEMA 4BJ6A 1FS4A 2J3EA 4JP5A 1E69A 3BREA 4HYTA 5C7LO 4PPFA 2X2OA 5BOSA 3ER8A 1T13A 1EA5A 3UK7A 1KOFA 1R0XA 5CA0A 3S29A 2XWPA 1USIA 3RTBA 1QKKA 4HNVA 1P0PA 1S1CA 4LBVA 3HY4A 3KXDA 4FD2A 2V4MA 3GEBA 4QL3A 1GL9B 5K4AA 1I94B 3H9JA 5IRCD 2B4YA 2VWHA 3CX3A 4X6YA 3ZE8A 2EYUA 2IF2A 3ZQUA 3E9MA 3GZ4A 1E2NA 2ADFA 2YY7A 5ESXA 1G17A 1U2QA 2PRJA 4GD3Q 4N9WA 2Q50A 2QQEA 2XEXA 2GM4A 1U28C 3TNJA 1C81A 2AC2A 4LXUA 3DOFA 1H3FA 3LP6A 5KOHA 2JGKA 4BYGA 4ZDIA 1RPAA 5LP6F 4NENB 4DA4A 1LSOA 3S7ZA 4Y0VA 3CXRA 3U5ZB 1XNGA 4QUAA 3EIUA 3DKIA 1N5RA 5HF5A 5MN5A 4LDZA 3PD7A 4IUBS 2B4TO 4V03A 3INYA 4NU5A 1K98A 3L6DA 2OD2A 3MQFA 2E48A 1NP7A 4XFKA 1U0TA 4ZAWA 1EESA 2G71A 1E79D 4DEYA 4EPXA 3RV4A 5L40A 3RU7A 4N48A 1QH0A 3KZMA 2PCJA 1GPAA 1SUAA 3QNMA 4G1BA 1WP9A 4DLWA 4CKXA 1JHXA 1XCJA 1VG8A 3TF5A 2PWAA 1CUGA 1ECJA 2F1OA 4ZQBA 4WESA 3K2IA 2ZT8A 5BR7A 4UAGA 3W8RA 3MW8A 1QWSA 3FPKA 1E59A 3A3YA 1RRMA 1YUMA 1SM4A 4UM9D 1HZZC 1PR4A 3DE0X 5EJGA 5LU8A 2WE7A 2BBWA 1PK7A 4IYJA 4X24A 1CZHA 4LYFA 1G2PA 3EHDA 5BSRA 3PLAE 5AOAA 1N1MA 1GDHA 4IDOA 5JD5A 5BSUA 3OQNA 4GNKA 2HT6A 1P62B 5DPMA 1TAUA 1FUYB 5DK6A 1F3OA 5C9ZA 2GD6A 2CVFA 4MR8A 5D8DA 1JR3A 4M99A 3VJLA 1JKXA 1Y9DA 5IDVA 1AQYA 4P83A 3A1FA 3MF4A 3ZLUA 5CEFA 1XPRA 3TQFA 4LXYA 4HDSA 1YHZA 3H86A 2EKZA 3I1YA 1EBFA 1E8NA 1II8B 2BR5A 3JYHA 2A1UB 1Q0HA 1WHTB 4ZOBA 1D1SA 4KXMA 3BH0A 2BV3A 1MTOA 2EHJA 2ZYSA 3EGXB 3I39X 4Z9XA 1PL6A 3OCCA 4KG7A 1P1FA 2QRNA 2I4IA 4MR7A 3AB7A 4IOMA 1CUCA 3P9KA 3WISA 1FRFS 4YCSA 3DLPX 3M3DA 5JS8A 4H35A 3GLGB 4QO8A 4XIYA 3TFWA 5CB8A 1IY1A 3I9V6 2CUTA 4RHYA 5AVOA 4YMHA 5LMCA 4DSNA 1MPXA 4OPMA 1SHZA 4ZAXA 4XD2A 3FYUC 2AJDA 2XE6A 4A8PA 1EXVA 3BD6A 3FKSD 4OV6B 1DBPA 4GX0A 4BQNA 4TTQA 4C87A 4R8MA 4C88A 8GPBA 1QTRA 3GLVA 1E2PA 4DRZA 1K06A 1XRMA 1ZIYA 5EJ4A 3EMKA 4JU8A 3G7SA 3VOTA 4CQMD 1E9BA 4L8VA 3TZKA 2UUBB 5KNDD 4GHWA 1E3IA 4M0EA 1XC7A 4W9RA 1RKUA 1E6KA 4MUHA 2QYTA 5KX5A 4AY3A 1WMAA 3BS4A 3BQ9A 4AZ0A 1Q7RA 2CDAA 2XMPA 3FCCA 4ZEXA 3TLYA 4QKQA 1SXPA 3ZK7A 2WV7A 4HXGA 2E89A 4ARAA 2GSWA 2ZZNA 5DI3A 3FWNA 2H06A 1Z4LA 1C4KA 3C8ZA 3CJQA 4B6JA 1ENYA 4PPQA 3DE2X 1E1QA 1PUIA 3N2KA 4OG2A 1OBOA 2ZGVA 5EWMB 1ODFA 1BDJA 1MNQA 4DE5A 5F7ZA 5KNBD 2P9ZA 3KBBA 4K6CA 3THRA 3FVWA 2HSDA 2WTEA 1SB9A 2TRSB 5FL7A 3ESQA 2R8EA 1VBNA 2WA2A 5I8ZA 3PQ5A 1JB9A 2WFLB 1N2GA 1JG4A 1BU5A 3FGPA 1NUPA 2ZRBA 1RFLA 2DF8A 2VBCA 4FLEA 2NSYA 1ST3A 1KDYA 4ENWA 4YCAA 1ZBDA 3VR3A 1P0QA 3JY6A 4AJJA 2WJJA 3MGGA 5FTKA 4PSVA 2JIZD 4CLDA 4Q01A 4YRTA 1J8FA 1T3SA 4I5GA 3TJMA 3X43A 2Z2XA 3THSA 2XMSA 5AQEA 2C4TA 1L1QA 2WT9A 5AM1A 4EW1A 3F9IA 3Q5DA 1R5OA 1V7ZA 1ZGGA 1EFDN 2UXBB 5BUCA 3BMNB 2COEA 3OA2A 4KLAA 5TJ9A 2AQ8A 3DXYA 1IG0A 4WJKB 2NXWA 4X85A 4B3JA 3GXBA 2ONJA 2WUVA 1GO2A 1DXYA 3L3BA 4JJ8A 2YYSA 4D7AA 2K7FA 3BGIA 1CQJB 2VNHA 2ZZKA 1YQXA 4Q66C 2VK8A 5ILQA 1BRMA 3HCEA 2OBXA 1LTKA 4N5IX 1E6MA 1WXGA 3RVSA 1SZJG 4CTKA 3OTHA 3ODGA 1NXQA 3GZNA 3FZNA 2CJWA 4OYRA 2P2CA 4JXKA 1S3GA 4BECA 2XHEA 1XA3A 5I7SA 3EA5A 2UYYA 1HRDA 4RC9A 4WADA 4X9XA 1XQ9A 4M0FA 3E48A 4Q3BA 4AKIA 1G2IA 4Q7JB 4X97A 5CB0A 4I50F 1R74A 1BEUB 1JG2A 3S1AA 2DPXA 1I1NA 2X5KO 4MS4A 4RETA 4AS3A 3TRKA 2WAAA 1ZXXA 2C0QA 5C31A 2V9CA 1E5LA 3IVAA 5TPWA 4Y2YA 4RMJA 4ETNA 1VE1A 5B3JC 1UOEA 4DOMA 2YR0A 4DA7A 3Q40A 4R84A 2Z56A 3QYFA 3OEWA 4TSFD 3VR0A 2HZBA 1R37A 3A6KA 4NARA 5G0SA 5TQ0B 1TLTA 3E84A 3Q7IA 1Z5WA 5BY2A 1GWNA 2EKBA 1L4LA 3IOBA 3O1HB 5JAOA 4XPZA 3R7AA 3L8HA 4Q1CA 3M3HA 4GP9A 4B31A 1XD2B 4EHBA 1DG1G 1M8FA 1JXMA 3T3OA 1GZSA 2XDQB 2MSNA 3DZCA 3D4IA 2XYQA 4GE3A 4UNPA 2IYPA 3HGTA 3B1WA 2JFYA 2C20A 4PC3A 1DIOB 1N4DA 1RU3A 3W4KA 3UM9A 1J23A 3U4QA 1UJCA 1DLJA 1KMIY 2R7MA 2VXOA 3H18A 3JU3A 3LX4A 3K6SA 1QH8A 2HHCA 2NMVA 1K75A 5E1OA 5ICSA 4A82A 1OD6A 1IQUA 1V7PC 1L9KA 3EODA 3G8BA 2CNBA 1CSEE 3JD0A 4KBYA 1AF4A 2W2PA 1ZNYA 2L2QA 3SAJA 1JHZA 3D8BA 3LT4A 3MB8A 4DMRA 5JFTA 1LFDB 3KFXA 1YR9A 2OMKA 2HXSA 4U7FA 2LCFA 1KMNA 1E2EA 3AXSA 2QL9A 3RABA 3EXEB 3QEOA 1HNZB 3EXAA 3VA7A 1OBVA 3K0BA 1NN1A 2FPPB 2CNWD 4TM8A 4P7KA 3K1AB 3TNYA 3ZY4A 3H3JA 1X6VA 3OLWA 2XB4A 3CZ9A 2WDZA 4QHYA 4S12A 4LRYA 4CL2A 2X8JA 1YL7A 2B8NA 1ZMXA 3FNFA 3PNPA 2J3IA 3O8CA 1VL8A 2O50A 3JZAA 1H8ED 4J3JA 4QWMA 5CLIA 5KCMA 4HV4A 5J58A 2E7ZA 2X0DA 1T6ZA 5CX1B 4C0WA 5KYGA 3V1TC 5CRIA 2IE0A 1AV7A 1DCKA 4J16A 1XVVA 3BA6A 3KQQA 4NQRA 4Y6SA 5DWVA 5JCJA 1AGXA 1V0JA 4DLUA 1G3RA 2VYCA 1M6VB 1FNMA 4Z8YA 4CKBA 4R9SA 1I80A 3BWBA 3LUPA 1E1CA 5A4IS 5KQMA 2FR1A 5LOVA 1LCIA 1B14A 4MYTA 3TW8A 3ZOKA 2JLXA 1ZL0A 1VP3A 2B5OA 3L7AA 2NXNA 1RE0A 2IJGX 1S2IA 1QF7A 3KT3A 2OBFA 2ZJ4A 3AXTA 4J9UE 3F90A 1EVKA 4UVDA 4Z7QB 1X7XB 2Q3FA 3JD2A 3E22A 4E32A 4DA6A 1QH1B 2JGAA 2W98A 3PSHA 4V39A 5FYQA 1EP2B 3L92A 4ZK6A 3I9KA 1N9ZA 2VH1A 4H08A 5FJIA 3LK7A 4JT2A 3NHPA 1Y7IA 3DVRX 3T9BA 1N6IA 4OY3A 1U04A 2ZR7A 1XXHA 3VV3A 1UDXA 4Y1RA 2P3SA 3A25A 5JFGA 2QTCA 1O58A 3BWMA 3F8TA 3VOAA 2IF0A 2YJTD 4PHCA 1DAGA 1PYDA 4QDUA 3GP5A 2QYHA 4UXHA 1IIRA 1I6WA 4KAFA 2YZGA 5ERGB 3SQWA 1JALA 5IN5A 1FL9A 4R2LA 2R65A 2NU8B 4NWIA 3OIYA 4EB0A 3AIMA 5HW0A 3H1BA 2EOAA 3ZD8A 3RUCA 4BTEA 1HL7A 3C39A 2C5LA 2REOA 3MWLA 2FK8A 4R6XA 1GV0A 1M34B 2QVBA 3N87A 4W82A 1YCDA 4BJHB 2W6ZA 1PHPA 1Y34E 2CGEA 5BVGB 4O2AB 3WGIA 3V6LA 1SG6A 1LDMA 2PSDA 4MYSA 2A9FA 1Y5RA 2X1HA 4UEQA 3K0AA 1QGZA 1KO5A 3DP9A 1N6NA 1KBOA 2OESA 2WYVA 2X77A 3R5KA 4EHAA 5IJ0B 2P90A 2VH5R 4X44A 2K4MA 1H3EA 1E1YA 1PJ8A 5CUQA 3SMQA 3K6JA 4PFJA 4CR8A 1VZ3A 3KUKA 1QXSA 1QU2A 4M9XA 4ED9A 3ML1A 4YCMA 1A4RA 2HMSA 2HWWA 4KGVA 4C6TB 2C3PA 2X9LA 4DCPA 2VL7A 4HX9A 4HNHA 4L4UA 2DU8A 2VUIB 1YZQA 3FPAA 2PV7A 4Q1VA 2PX8A 4OQEA 4KMMA 1BS9A 1CDEA 3DOCA 5CDFA 5BW8A 5JSHA 1EQ2A 2Y0EA 1LS1A 3PQFA 2JFGA 3N0VA 1WCIA 1UBSB 4TUYF 2P3OA 1CJSA 2RD2A 1YA4A 3WJ1A 4NFLA 2QD2A 1W88A 3KV3O 1WZNA 5G41A 3VKWA 2IU0A 4PM4A 1SXIA 2LWIA 2H2DA 3LHDA 4BLVA 1NURA 3HA3A 4JP8A 2YWHA 3DMYA 1PN3A 1EGMB 1TOAA 1XAIA 2R00C 1VJ1A 2GR9A 3A28A 4RKRA 1E3SA 3DGEC 2V0CA 1KR2A 3RCBA 4D4LA 3PDHA 4EPYA 1SUFA 2EVWX 3FD8A 2QYOA 2PXCA 3GLQA 3LKVA 3L5KA 3MPUA 2YWJA 4H7EA 4JFRA 1HETA 2YDYA 1DUSA 2CXHA 3VO9A 1P74A 3NU1A 1NJSA 3AEUB 1ZHHA 2QL6A 4HD8A 5H59A 5A4JA 1FFEA 1CY1A 1IYZA 1FDVA 2G0NA 3TTVA 3U60B 2QLJA 3DVAA 4II2A 4QXMA 1YBHA 3IAHA 2WSBA 1ES9A 3KKMA 4IEFB 1JUDA 3SHOA 1JIXA 1OT5A 4FZVA 2F9FA 2NUPB 4MDEA 2J8ZA 4O2BA 1JVNA 1QGUA 2B4RO 3ZE2B 1TCBA 2NO9A 2OLJA 1RJ9A 2ETXA 2R79A 3PENA 4H3HB 3BJIC 5KNBH 2A4MA 4ZP1A 4MRVA 5CXQA 4RCVA 2J6IA 2QN2A 1UADA 3EQ6A 2ZREA 1IHUA 2F6RA 3QVTA 3KL4A 1Y89A 2B2CA 2ID4A 3QYPA 3PJGA 3VR4H 1PNTA 3AHHA 4KFSA 2I5PO 2VAXA 3FUCA 3HU3A 3TVTA 2WEKA 3V55A 2HSZA 3UPDA 1I3OA 2JANA 3NCTA 3SLKA 4BX8A 5CA1B 2Q7DA 2OQIA 2B21A 4IFIA 4E1AA 1V43A 1Z0ZA 2CFSA 3T5AA 1VGVA 5HIMA 4B73A 3FGZA 4IH4A 5H1YA 1ISFA 3ZVLA 5LNK1 2R6FA 5JQGA 4JA0A 2FEWB 2W0SA 2C5GA 4PGGA 5KTMA 3OLYA 1XWFA 2I80A 2VPZA 2FRXA 3I09A 1SQSA 3AFIA 4FHFA 5EKUA 3NYQA 1G60A 5ALFA 4ZJUA 5M29A 3TZQA 2Q4EA 4HDMA 2GAAA 2GEJA 2ZWMA 3EHEA 3IDFA 5TT1A 4P4LA 2R8BA 4EYSA 4LTDA 5F77A 1AKVA 2H0RA 3WIOA 2D1TA 3DO5A 4PYRA 2XUOA 2CMKA 2J9RA 1PZEA 2ZCJA 3N59A 1SVWA 3LKZA 2H59A 3F3MA 3I6IA 1SMKA 1UOOA 5I5EA 2WIDA 3TRHA 3G9QA 4ZV9A 5TEVA 3TB4A 4G0WA 5CDHA 1QDLB 1BQ3A 2NOAA 4RSRA 1IATA 2O07A 2Q2OA 3ZJ4A 2BR3A 4OQLA 3OQOA 2BUBA 1RXVA 1B6SA 3ZR4B 3VTZA 2GI4A 1E9SA 1IU9A 1RJWA 2PFGA 3CM0A 4KGXA 4KQGA 4Q6WA 5F76A 3U0VA 1EFVB 3TLZA 1LNQA 1N2IA 1MX9A 3I01A 4X1IB 4FUQA 2V5VA 1S3FA 3S70A 1W2HA 4MR9A 4DM7A 3QBTA 5EQTA 1GZ6A 2A2ZA 2VJNA 3HSKA 3GRYA 1VL2A 5IDXA 2JAPA 4D44A 1J06A 1JJBA 4ZN6A 5KYXA 4YONB 1KDPA 1OBHA 1UBRS 1USGA 2GHRA 2Y1WA 2P4UA 1BGVA 1D0SA 2RB4A 2V0NA 3ABSB 3GN1A 3N8IA 4XW2A 1OC4A 3ZD6A 2AOXA 3QLUC 1AUQA 3VBCA 3GCZA 2GGSA 4H4CA 3KU4A 3T7SA 4BZXA 3PNSA 3EXFA 1CF4A 1QPZA 3EEFA 4EJSB 3RHFA 4C6SA 3EPKA 2Y1LA 3LAWA 3UV7A 2QG9A 2Q6TA 3QSYA 4RL6A 2ODAA 5B1YA 3FKQA 5CT5A 4L27A 4YQZA 4ZC8A 3TZBA 4KPGA 4KX3A 2E6KA 1P2GA 3DCJA 4B6SA 1T9DA 4PAGA 1Z39A 5DLDA 1AGYA 3QXXA 2CNNA 2XNKA 3AJAA 4G9GA 4QBKA 5AXAA 1PTJA 3VPFA 1IM5A 3U7IA 4DXAA 4J94A 1N32B 1NPDA 2H29A 1KO7A 3AX6A 1PBTA 3AJEA 2HBRA 2W6MA 5AKKA 4IIEA 2DFKB 2IV7A 2H18A 1L7XA 3BK2A 4LGMA 3C7DB 1PNOA 1OXKB 1I30A 1T5TA 5FOXA 3BQMB 4X3OA 1GITA 3QKWA 2OV2A 5DFAA 1T1RA 4QFCA 1CQIA 2AI3A 3D0RA 1RHJA 3LF2A 4MGIR 5AM5A 2X1VA 4BX2A 5I8WA 4A26A 3FWYA 1WLSA 1DT3A 3GFBA 1YI0A 2W00A 3DW1X 3AR7A 1K8ZB 4DZZA 1SELA 3KJZA 4IIFA 3VPDA 3OETA 3UTCA 3IPCA 4HH3C 3LUAA 2G40A 4Z53A 1W36C 5JFOA 3LC1O 2HQSA 3E0QA 2EATA 2P8SA 2OHJA 3NHFA 1OGIA 2J08A 5DYYA 4U2CA 1PQ4A 3NR2A 1ZD9A 3TDKA 1S8AA 2JCXA 4LQ4A 2VQ3A 3UAVA 6NULA 2IY9A 4OL0A 4CUZA 1N2CA 4DQKA 1MJFA 3KXPA 4XUEA 4FTWA 1KRWA 3IQFA 4QOFA 2XMQA 3FN4A 4NBKA 1TVEA 3Q11A 3R1IA 1YRAA 1O95D 1NW3A 4CMGA 1LI4A 1SCBA 3ZJ5A 3Q2KA 3I32A 1V8OA 2HUPA 3SJZA 3MRTA 1S2LA 4IDAA 2E3JA 2Y2VA 2CBZA 2HWYA 4LJ5A 3MXTA 3KYBA 1OYYA 3QUCA 5ALTA 3BA1A 5JAZA 3D54D 3HJCA 2R84A 3IODA 4YASA 3BIWA 3DBRB 1G3MA 1O5OA 4RLSA 1XJ0A 4QREA 4EHDA 4ESEA 4UOZA 4RJIA 3GUHA 2WU0A 2C2OA 1I7LA 1ZI9A 2VVTA 2QUAA 3STXA 4I19A 5JNWA 1Z5UA 2FSGA 1KEKA 3OZEA 1NNLA 1SIWA 3KZNA 3JVDA 5IKEA 2XY4A 3ECCA 4WVFA 2AKEA 821PA 1AH2A 4L0DA 3PX3A 2FSIA 4MMZB 1FDRA 4ZJZA 5LBUA 1Y1TA 1NQAO 3WRYA 3IEVA 3VR6A 3N0RA 2AFHB 1G2OA 2BEVA 1JZTA 2HREA 4BE7B 1CNEA 3PGLA 3LV8A 3LQYA 1F8GA 1X7GA 4BX3A 4G5RA 1E3DA 1PFWA 5C8VA 2ZBUA 5LP6B 4OAQA 2QQGA 2VT3A 2N75A 4TKVA 3FPFA 1B0UA 1N3IA 4YJHB 1U5BB 4UCWA 3RVOA 1GPJA 2GKSA 2F1IA 3UEOA 2HPHA 2NNWB 4FP9A 1WV0A 2GFQA 5LCXA 2GVDC 1V9SA 4D3FA 2JGMA 3K6KA 3SC2B 4Z7JA 1OB2A 4GOOD 3EBLA 3B70A 3N2GB 4NBLA 1ZUWA 2GEUA 4D8XA 2WG0A 1LVUA 2W2KB 2WM8A 3MSXA 2C4HA 3D8TA 3E3AA 3I3SR 2PZEA 4MWDA 4NBTA 2GN1A 4MB2A 1M7GA 2IDZA 2BI7A 3PSAA 4NR0A 1QHNA 1TU0A 4R1SA 3SGLA 2JATA 3ZWPA 1PT7A 2QRZA 1HYHA 5JWRA 3DXXA 1K7XB 2YUIA 1IN6A 2B83A 1OUMA 5EJIA 3ME5A 2A5DA 2H5EA 2X7JA 1YCHA 2H8KA 3GPBA 4D8YA 2NZVG 2CBXA 3CSSA 3W1EA 4DIEA 4R2MA 4H7DA 1FBNA 1NQOA 5EGNA 1U0OC 1AKTA 5EXXA 2XCQA 4LDPA 4D3ZA 3QKSB 1MR3F 2PJDA 4OYYA 3MAJA 2BHTA 1P81A 1U8FO 4Q1FA 2WKWA 1QRSA 1XWIA 1SKUA 2ZIUB 4TZ6A 4H6PA 3KPJA 3L4BC 4FLFA 5HFJA 5EJ6A 1V5EA 3MOSA 1X38A 5KDLA 3VO2A 1PQPA 3B12A 2GRJA 2VYVD 2RAUA 2I3DA 4LWZA 5TS2A 5E9WA 3VSAA 3KYCB 2PXAA 4N6OA 2J45A 3HGQA 4Y2HA 4OXRA 4ZKDA 4G0VA 5FAKA 5HXAA 2JEYA 3ECSA 3ZQJA 4CMCA 1FEZA 1M0SA 2I6SA 1QGDA 1ZN8A 4LYEA 2AFVA 3HJBA 1J7KA 4XDZA 5BQXA 5KDDA 4JLBA 4IFBA 3UMYA 4C2AA 3KOMA 2Z5GA 5KNCH 3JAMA 4PZAA 4PAMA 2ZI6A 1ENOA 2QS9A 3W04A 3VJRA 5DBHX 1Y4DE 4QGSA 3CG4A 2QRUA 2XGSA 3HJHA 4H7HA 1FP2A 4HDCA 2FZ5A 4BWYA 1YDMA 2M98A 3DTVA 3U26A 2CL6X 5GY7A 4C2BA 4KAXA 5EI5A 1QU3A 1V4VA 4JJGA 1RC1A 3LA6A 3C5WP 3OLVA 1M2HA 4CGYA 3BMOA 1F8XA 1C0KA 3ROXA 1MG5A 2VTDA 4EELA 2JVJA 1DKRA 4JASB 2BM1A 3RRFA 2A4KA 4JI4B 1EDDA 1VZ2A 3IVXA 1RYZA 1Z2EA 2JHCA 2WUDA 3LXMA 1FMLA 4UUAA 4DG8A 3D1LA 4B8WA 4DMMA 3SICE 4ABYA 1GIAA 1KPGA 1TB4A 2FN4A 4IG9A 1QQTA 4F2WA 2G0AA 4P82A 3VYRB 1LD3A 4UU8A 4B3FX 4EPRA 1W0CA 5H16A 3WLMA 4X64B 3V1LA 4CNBA 1XVAA 2BFPA 2LE0A 1ZFNA 5TB5A 3T38A 1D03A 2XTAA 2FW7A 1S02A 4I66A 1EIWA 1GV1A 2HQBA 4J0KA 5ALHA 2A33A 2GZ2A 3B38A 2OSVA 3FM9A 3ZDXB 3GDGA 3C8DA 4A2CA 5JY6A 1QLHA 3E3LA 2ODQA 4HO1X 4HS9A 3T7KA 4EHNA 2QR5A 4G8JA 5IKMA 2VHYA 4GZ3A 1HDZA 3I42A 4EO7A 2G7ZA 1RLMA 3M1AA 4R1PA 4AWBA 4B2LA 2X0RA 1R3DA 2EV9A 4RS3A 4IIYA 3GLIA 4L8WB 4RTKA 4ZCIA 4WLOA 3P9SA 3VHXB 2AHRA 2DAPA 3EEQA 3F7OA 1HSZA 2IGTA 3A32A 1P9LA 2Q4DA 3AETB 3FSGD 1YH3A 3GU3A 2B6NA 3PDWA 4WT7A 4G4JA 5CIWA 5LZ7A 3CLTC 3UKOA 4BXOA 2CJYA 2R11A 1HQDA 5BN1A 3KZXA 5ALQA 3NIFB 3WDKA 4DLRA 1TM3E 3QGMA 4U2GA 4LZAA 2YZMA 1PT5A 1FX0B 2XDWA 4LGVA 5ECDA 2IDMA 3PXEA 1N0HA 2FF5A 1O77A 1HOTA 2QT1A 3P96A 4LOAA 1RLUA 4UE6A 3WMRA 5KTKA 4DV1B 5E9QA 4QBIA 2PGDA 4JLJA 3K0HA 1JXOA 3A9VA 4I50B 3T0GA 1OI7A 2A67A 2BKXA 4R5MA 3U3DA 4A27A 5ERYA 2BGGA 4TRNA 3ANXA 3AF3A 4NCIA 2VHCA 3WGHA 4URXR 2C0CA 2FVXA 4Z4QA 4I4LA 1JN0A 1H1TA 2GDJA 3DHWC 1KMHA 1YCFA 2PWBA 4ZOQI 2AQHA 2PR2A 5M34A 5AJVB 1ZJJA 3HCOA 3D3QA 4CIDA 3GYGA 3UJ7A 3NBMA 2GX6A 3OPXA 4O33A 2G5GX 3ZZTA 1YA6A 1XN4A 3A9WA 5GGYA 3DHYA 4ZYVA 3EXHC 4FBGA 1IJBA 3TNFA 1QQ6A 4OUDB 1L4EA 3BWCA 2WYWA 3UPTA 2A7QA 4PGAA 3PNMA 4DV0B 4P86A 1RCFA 3VH3A 4GX2A 2R96A 3D7KA 4RMHA 3QPUA 3LYHA 4RDIA 5AVTA 3HZRA 5FWDA 1GZ7A 2CVHA 4OQYA 1R0BA 1T8PA 4S1NA 1RM0A 1DFGA 4HDKB 2QTZA 4G5SA 2IITA 5HK9A 4M36A 1ZLYA 3OCYA 5K3FA 2IYOA 3RPEA 1VRWA 2V8OA 5IXSA 1GNQA 1FFXB 2ZSFA 4WE3A 1IDN1 2DZDA 1MHPA 2OGTA 3FAZA 1P75A 3M5PA 5PNTA 1Q7GA 4UHJA 4ER0A 5KTTA 1C1XA 1H8HA 1MNAA 4E5SA 3DBLA 4KCGA 3S28A 4DXHA 1TK2A 4C5AA 4U7HA 3A8TA 3U7HB 3N8HA 3W2FA 1RP1A 4LBWA 1ILEA 2J33A 3B3FA 3W5DA 4N41A 2UXDB 5A3JA 3OCXA 3LUJA 2VQFB 3QPVA 4R69A 4ZIRB 1MV5A 3CUYA 4TXMA 5E2AA 1V8FA 3E1SA 3WGYA 4AROA 4BKMA 4EHLA 3I2JA 2BELA 2POCA 1YRLA 4C7OA 2Z8YM 2Q5JA 1DKQA 4FEEA 2UZ0A 1WZ2A 1JLRA 1QYDA 5DSZA 1RWXA 2PSSA 1D4AA 2MYTA 3VPHA 3GRFA 3RYCB 1YRQA 2W7TA 4TV9A 2XCUA 4LV6A 1GL7A 4XGIA 3IAAA 2RAFA 2FQXA 1W1IA 5EXEA 1FFSA 1WAMA 3R0XA 4NEHB 3F67A 3IFSA 1CU1A 1Z6GA 3OUTA 1DIGA 2JL1A 3LM8A 5J4LA 1FDUA 2PGAA 1LPPA 5EXSA 1CJCA 4PYKA 3W5AA 3MSCA 3RFCA 4DMKA 4PZEA 3L6RA 2ZUVA 1QCZA 1YZFA 1ZJ4A 3PNYA 1PJCA 4PLVA 1HORA 1ICIA 4RHFA 1VFPA 3U81A 3VC1A 1Y63A 3N75A 4KQFA 1WA5A 1L5SA 4WGGA 3SG0A 2WTMA 2ZT7A 3BF8A 1ML4A 2AG6A 2NVBA 4IY1A 2GARA 4ZQCB 2C3UA 3L82B 5C3UA 3V1YA 4RACA 4LECA 4LG1A 1B2LA 2JLQA 2JLWA 5FTLA 1W5TA 3GOHA 2CZGA 4XQ0A 4XSHA 2QD1A 4AO6A 2X42A 2MR6A 4LVCA 4HGYA 1KK2A 1U7TA 1V8BA 4ZDKA 1KIMA 4JXZA 2PM8A 1DUVG 1UR5A 1JAYA 5EKDA 721PA 3TD9A 4U2EA 2ZSDA 1T1GA 3HV2A 4E4TA 3K09A 3LUCA 4IDDA 1AVTA 3P2KA 4CKWA 3LQRA 2QMUA 3JZDA 4Z86A 5F64A 5JRDS 1DIRA 4I1YA 4L5YA 4QOGA 1F6WA 3VO1A 4D02A 3LBHA 2O05A 4GDFA 3LZCA 4KDCA 4QA9A 4P80A 3B52X 4MJ7A 1JKIA 2RHHA 4DNXA 2CHEA 4PRZA 4YVFA 5C4GB 1RXSA 3IQXA 3RUEA 5ARDA 2ONZA 3ADPA 1Y6QA 4BLWA 3BWYA 4FD3A 3NBXX 3WRXA 1JHQA 2RC6A 3DDNA 4HXFB 2H4FA 4UHFA 3WWPA 4HFMA 1J6UA 2R68A 3HJAA 3F6SA 2JGEA 1NL3A 2NV2B 3GGDA 5CVDA 2ET6A 1YFKA 5A5GA 9LDBA 1EZZA 5FI0B 3OFVA 2YOGA 3ZCUA 4FCTA 5IF9A 1O1YA 4JU9A 4DMHA 2Y0BA 1W6RA 4MQEA 3KLPX 2BJHA 2WSIA 1QF9A 1C41A 4UTXA 1QB8A 3UJNA 3BTSA 2BOVA 1M1YA 1RXUA 4XQ9A 3SX0A 4N7BA 1XXLA 4ASUA 1TGYA 1Y1RA 3KZVA 2AI2A 2GJ8A 4TUYB 1K8XB 3T5PA 2IH2A 1N33B 2PD3A 2F62A 3BB3A 5I9TA 1QK3A 1E3EA 3TOVA 3U44A 5AK0A 2R4UA 1NN5A 1BDIA 5JMPA 3I5AA 3F73A 1L4HA 1KKUA 5E6RB 5TGZA 5INTA 4R7TA 1WKCA 2R66A 4HWRA 3CVVA 5D00A 3SM3A 4PLCA 1I2AA 5DHTA 1ZCAA 4DAOA 4MDYA 1L7VC 1NY6A 3KSUA 1E6LA 2O3JA 3FRHA 5FO0A 3ROKA 2LW7A 1Y4SA 1ZJYA 1T2NA 1WWKA 1NLMA 4GYKA 4MIOA 5H82A 3SXUB 2O5VA 1BHQ1 3UOGA 1XMVA 2WG2A 2OA0A 4M0MA 3GLUA 1T2UA 3EVZA 1QC5B 3SHWA 1DBSA 3OMWA 4EF4A 4YXWD 3ZHZA 1NW4A 2FE4A 1KTIA 2ASVA 3FYUB 3NHLA 4WASA 5CCDA 3TL6A 3I12A 3UUFA 1UC9A 2OKCA 4HYYA 1UZNA 2DBRA 1DU4A 1ZN7A 2MR5A 3L0YA 2FV8A 3F6YA 4B75A 1L5HB 1VMIA 3FSJX 3DDHA 2AC4A 4FCCA 4J1TA 2C7PA 2R5FA 5CHYA 4V3CA 2VPWA 4BKRA 1KZ4A 3P2EA 3EIHA 3PT5A 4TL8A 3KPUA 2PKQP 3PG5A 4KH0A 3RK1A 4OJYA 2WSMA 4TLDA 4RVOA 3V80A 2DWUA 1IWOA 1B00A 2ZIFA 3DAPA 2TMDA 1LPMA 1ZOIA 4R9RA 4RWZA 4ZCMA 5CT8A 3H5RA 5L3QB 2ZVPX 4W5NA 4QUDA 3B8EA 3BHMA 3TK1A 5IJZA 1XJ5A 2WTUA 3PEVA 2W6OA 4E30A 4IBOA 2IY7A 2D2IA 3RT1A 1R3UA 4MS1A 2HIGA 2O59A 1YS9A 1Z8FA 3CW9A 3G6WA 5KSYA 5AW0A 2RK3A 1Z7BA 3ZWWA 3RVQA 4DUGD 1NXOA 4K9QA 4M49A 1MIOB 1CP2A 2H2WA 3REFA 4PBRA 2EBWA 5H68A 1LDEA 2IHZA 4E14A 3IOMA 3UK1A 3FFXA 1WMDA 1WF6A 5CITA 2P3QA 2ZR8A 3A6LA 4CF7A 4HLUC 1AO0A 1YULA 4M1TA 5IT0A 3K0FB 3CKKA 1C30A 4RV5A 1NWHA 1WTCA 4G09A 1K3TA 1UBGA 2D2XA 3M1LA 4PZUA 3RFXA 4RPGA 5ALLA 2XYPA 2EHDA 3B82A 4WI1A 2ST1A 3LCJA 3R9IA 5JSZA 2DUUA 1RSZA 1EP3B 1NQVA 4NJOA 1Z0FA 3MRVA 1Y8QB 3NM5A 1JRLA 2RK6A 1AKRA 3HU2A 3FYDA 1AQ6A 3KEMA 2ZKLA 4OF4A 2EJTA 3I58A 4ZVPA 1PV4A 1UAAA 4YY3B 2V7QA 3JAWA 1T3HA 3K8ZA 4P3OA 1M2WA 2P9YA 5IC6A 3WMXA 3PHLA 1D1QA 1C0LA 1UM9B 4IHJF 4D0LB 1NVFA 3OTWA 3R3UA 4UU0A 1Z0IA 2NNLD 3W5VA 3VZPA 2BFFB 1L5FA 1IMOA 3FZQA 4KIFA 4M1OA 4MPPA 3FCUB 4C07A 3CH7A 1V41E 2PUAA 2I87A 2ZBQA 4FM9A 4DDWA 1M2OB 2P6NA 5T3YA 3MIIA 2KBEA 4LF5B 4ENPA 4HZGA 4MUMA 5HOQA 2QZ4A 2G72A 1J00A 1UMKA 1VBKA 3CKLA 5DI9A 1MC1A 2WP8J 1S5PA 1RFGE 3ZWCA 4YAFA 1UAGA 4ZT5A 5DTMA 2P9GA 4BFVA 4CPDA 5I7UA 4BO0A 4CM1A 3DHNA 4LBZA 4CKCA 4NJEA 1EM8A 1NIPA 5P21A 4YT5A 5CFMA 5KMGB 4R9UC 4CM8A 5FOQA 3IS3A 3RS4A 2QZSA 4EPVA 3ZDCA 1N92A 2CLEB 1C0EA 1LSJA 4JL8A 2WQ7A 1JTEA 4RIHA 1BE0A 3EGCA 4A6PA 1TT5B 3BZUA 4TTSA 4F4HA 3PX7A 4WCDA 1TIPA 1YQQA 1KOGA 5B6JA 1YTUA 1CRPA 3WWDA 4HMQA 1DFIA 3MCWA 3OWOA 1E9FA 1FX1A 3SBXA 2Q3JA 3PHHA 3QYJA 4GG1A 5T4FA 4D57A 1G6KA 5HZGA 5M2QA 4LVOA 1BDMA 2NT4A 1XKLA 2GBLC 3RROA 3IEPA 3RTGA 4YH1A 2BEJA 1JA0A 3B7PA 3CUKA 5C35A 4BLRA 2GXAA 3I4CA 3T3HA 3UUGA 5L3SA 4LJRA 3KUUA 1K3FA 3K4PA 1E9CA 5AT1A 3U7EB 1Y81A 1YDGA 4IXMA 4MZDA 5H81A 3TTTA 1Y8ZA 1Y9EA 2ONCA 3ZV7A 1QHIA 4IUDS 2X3FA 1QRDA 2P2DA 2A78A 2I6UA 2XVMA 4V1CB 1NBWB 3ZWNA 5K0FA 1H9CA 2IFTA 2OOSA 4MWOA 3IBGA 3HN6A 3FUWA 2YZ2A 2VXYA 3K35A 2WF5A 3DAFA 5CLFA 1HYEA 2QAGC 3W9YA 1ZW1A 2O0LA 2NVOA 4OHCA 4G5YA 1BH2A 5H70A 1Z0AA 2EU8A 4Q7KA 2FP4A 2DP4E 1IXZA 4P54A 4QC2A 3MT8A 4YJ3F 4TVSA 1ODLA 1P33A 4M4SA 4PWZA 2IHBA 3RSFA 3JQQA 4MV7A 3H5LA 1Q20A 4UPDA 1EJ2A 3H0KA 5HRCA 1UEXC 3EZ9A 1NUUA 1CJTC 1SA0B 1EFLA 2PS3A 3DKKA 2PRYA 3PJDA 5AVKA 1XCOA 3KUCA 3W2EA 4F8JA 3NW9A 1XKTA 3OJ0A 4RYLA 2WFMA 4Z7OB 5JS1A 4OHFA 1B6RA 4XLTA 4U0JA 4ODIA 4DR7B 1K5DA 1IB0A 2Q0QA 3KAJA 3MBKA 2R6GA 1A2OA 1MABB 2ZWIA 5G0UA 5A1JA 3HDJA 2CJPA 3HSYA 4I4NA 1KKLA 3UY4A 5EHZA 1E1DA 4IS3A 1J5EB 4EY8A 2YW9A 1YNOA 4CMHA 1MXHA 2R1ZA 2ETVA 4FNGA 4LDNA 5A7FA 1T5BA 2J46A 4D5GA 2RK4A 4OFBA 4BP3A 4E12A 4QULA 4UEOA 1YDEA 1GQSA 4QUHA 5FOTA 1PVVA 4MMYB 2OYRA 1NM5C 3OJXA 1MB4A 1KY3A 1THGA 3VXKA 2WZDA 5F52A 3RSSA 5KVCA 3OEYA 4JXJA 2QLBA 1IEXA 3NAZA 3Q4GA 1Q6YA 1QIJA 2DUMA 4FDLA 1Z6XA 4E22A 3VH4A 5HS4A 4YCCA 2PUWA 1VPWA 4Z4GA 3ORSA 1CS4C 4MUJA 5AWFC 3VDNB 1KAQA 3A6PC 3ENZA 4WEOA 3SLGA 1WUJS 4XWTA 4UTRA 5AVXA 5K4GA 2H3HA 1WPQA 2H17A 2VRCA 1NC1A 2WK1A 4KQIA 5IBRA 3NT2A 3S2IA 3P2IA 4NP6A 4NU0A 4D8UA 1EFTA 3A4TA 3SP1A 4YWJA 1FTYA 4IQ8A 1JQDA 4D8VA 5KEIA 4HDNA 1M7HA 3U37A 4XIJA 3ASUA 2DFDA 1Z0DA 4RTMA 5EWJB 5DMXA 4G5OA 3ZZMA 3T3IA 3SC6A 3FMGA 3F1KA 3AVYA 1YR3A 4B0PA 2O8CB 1QP7A 1WXIA 3T15A 1ZXLA 2ADOA 4G5FA 2ZTHA 5A9SB 4RGQA 5EL0A 3B6KA 2FSVC 4MB0A 5JBIA 2F1KA 5EIBD 4DWOA 4BLTA 2O2IA 1XROA 3P45A 4ZYYA 1PE0A 1F60A 4YB8A 1FYWA 1T9KA 1TKAA 3ED5A 1VB3A 2VJCA 3DT9A 3IP3A 3P4UA 2OBMA 2QV0A 4EM6A 4L3OA 4NYMR 1E18A 2IEDA 3BE4A 4XGQA 2FKNA 3GGGA 4Y2RA 4L9WA 2HBYA 3JASB 4YEDA 4TWAA 5AJTA 4ZV7A 5E95A 2Q41A 5F2EA 3RVNA 3TTWA 1Z4QA 1NNI1 4ZTUB 4UUBA 3KWMA 1W59A 2YJ4A 1JS1X 3HLKA 5EP3A 4DANA 2DPYA 3QX9A 3I1JA 5SY9A 5F12A 2QAIA 2VTVA 2H2IA 3PVSA 1WZIA 2I1LA 4C0LA 4ITUA 4Z8XA 3ISTA 2X8AA 4CM5A 4DLAA 1Z34A 3MGCA 2ZTLA 3GRCA 4ETMA 4ZMRA 2QN6A 3ETCA 3EFOB 1E1KA 5FADA 4M21A 4C4OA 4DEVA 4UCXA 4OREX 1XMXA 4AJ2A 3HB1A 5LMUB 5LBTA 3BEDA 1NLUA 4C08A 4ERNA 1U1FA 2CHUA 1G21E 1RRVA 1U3WA 3IAFA 3NUZA 3A3NA 4RF3A 4EG0A 3A3OA 3KLBA 3IPYA 1RJEA 3RJZA 3QEAZ 1IAVA 3Q3GE 1PFUA 5SYAA 2B8WA 3ANLA 4X41A 3SJBA 4HL6A 4HFNA 1GFIA 1A88A 2PVCA 3AR3A 3KT6A 1F8FA 1LY1A 1TZBA 3L79A 4YFYA 4YAEA 5DKFA 1ZK0A 1VJGA 3WLEA 1KY4A 3IR6A 5B1IA 5HMMA 1KETA 2Y1GA 3DG9A 4BATA 1IONA 3R5XA 2ZE8A 1K89A 1UODA 4OB8A 4RY0A 3L1VA 3NHRA 3DUWA 1HY3A 1MAVA 3H99A 1JXAA 5IC4A 4DR3B 2FPIB 4MWGA 1IBRA 3MGKA 3W5BA 1ZIDA 3VFDA 1VJRA 3DSRA 1R12A 3PE3A 3EOBI 1V7QA 3UCXA 2HWUA 1Z82A 4PYOA 4WK6A 3GPCA 2C9YA 5KYVA 3LP5A 3L4EA 2BMEA 4KQHA 5D6NA 4DSUA 4BNIA 2WHXA 3HKBA 1QS0B 2PX2A 2FQQA 2B36A 3G2KA 3CIOA 4AIIA 3MAGA 4CMAA 2FYTA 4OA8A 1X7YB 1H05A 3SYRA 2C00A 1KZYC 2P2YA 2CXTA 3L0PA 1NVKA 2VOEA 1ACLA 1UBEA 3CU5A 3M82A 3NBAA 2M6LA 2HLPA 4PSUA 2ON6A 3CIFA 4QDOA 1L7EA 3GDOA 3W1VA 5AM2A 1RHKA 3DOHA 4RVSA 4RXMA 2AOTB 4K86A 5ADWA 4OP3A 4ZCRA 1JU9A 5AI9A 5HCUA 1U2DC 1XU7A 4V2UA 4UUQA 5GM2A 2A9OA 1FUEA 4A5SA 4IO1A 4Q7LA 4CN9A 1XZHA 4LC9A 1XI2A 4CTNA 1PT9A 2H5JA 3DV2A 2RH8A 3PDJA 2QRVB 1VLZA 4H7IA 4CHTA 1DEXA 3NBKA 1AMOA 3TBFA 5FEUA 4HNRA 2H7XA 4OBWA 1LRJA 3P2JA 1WB5A 4W1PA 4AX4A 4RK1A 4AKTA 3I62A 3THOA 1XJWA 3TAUA 2PZ8A 1DJQA 1O0CA 5LFAA 3HJRA 3CEHA 4MUBA 4UTZA 4EK9A 3S2EA 4LUCA 1JFSA 3DMTA 5ES3A 3ACDA 3AKEA 3R6GA 4LPSA 1TTHA 4E51A 3FUTA 3G8YA 5HE9A 4GLBA 3OFNA 1UPAA 3PP8A 2FPLA 3QELA 2R47A 2CFOA 5EIFA 3MCVA 4KQMA 4ZAFA 421PA 4TMXA 5JZMA 1K88A 1N2EA 2OO5C 2QG6A 5K3BA 4YLEA 1ZR4A 2FF7A 3KR1A 5I7WA 4P4SB 3VMFA 4CIYA 2W8BA 3W1WA 5TMPA 1FS5A 3KX2A 4YRGA 2PLAA 1KI7A 4TTTS 3GEDA 1GAEO 3A1EA 3B3GA 3ZHCA 1CS0B 1T2AA 3AP2A 4BNVA 2H07A 3F0TA 4GI2A 3VH1A 1ONOA 3ZYZA 3OLXA 2PSJA 4WY5A 1H6BA 3NMUF 4Q1EA 5F9MA 2W2MA 3WGKA 1HEYA 3DDZX 4TLLB 1FRNA 2FXVA 1RD4A 4D82A 4KBGA 4H1VA 4KLRA 4YS6A 4GF5A 1ZNWA 1PJTA 2XA2A 5D7NA 1N6LA 1P2BA 4YRMA 1CYEA 4AM8A 2O8DB 2XBUA 2XB6A 3WJ7A 5AESA 4DJTA 3FI0A 3AR9A 4FK8A 1J0XO 4M7PA 1LEHA 1B0ZA 1N9KA 3AG6A 5TEWA 4E11A 5EYPB 5AW2A 1I0IA 1OX5A 1EFUA 3R6TA 4NCNA 4IH1A 1O96A 1X9HA 1L7PA 2XVZA 3W4JA 2B92A 2C04A 3H19A 3KKNA 3AINA 5L7TA 2JZCA 3FPBA 3JQCA 1Y9JA 4D3DA 5LUAA 3K9LA 2FEKA 3W8NA 5CBPB 3VGJA 2BFBB 4L50A 3PPVA 4FDTA 1VECA 3PUHA 5EIWA 2Q2VA 3RBAA 3WKDA 4JROA 3RUPA 1FFHA 2HXGA 4KXWA 1HNNA 1KC3A 4QYIA 2D5LA 2Y27A 3GEIA 1JGTA 1TUGA 4YO7A 3TR0A 4EY6A 5EHXA 1KNQA 3AF4A 3R0IA 5ANRB 2CUZA 1CVRA 4PXAA 1CHNA 1C7JA 2AQIA 1KDRA 2CVPA 4LX8A 3X1XA 5IFKA 2ZI4A 2DR3A 4FZ5A 2Q1TA 1OXVA 4LQCA 4K7JA 1U4SA 4UDNA 3GVPA 2HDHA 1CDZA 2WYUA 2W2LD 3GARA 1SG9A 3C7AA 3H5VA 4ND7A 3ZU3A 4AP5A 2PX0A 1M75A 3MGBA 4O2LA 5ALKA 1DAKA 4B2PA 1NWCA 4F60A 2DFNA 2DQZA 2I2AA 3AFNA 3GJYA 1AKMA 5TGDA 3VPBA 4BMPB 5JI2E 1IZ0A 2I8CA 4N0DA 4QNRA 1P2FA 2D4HA 5IDYA 3HNRA 3N6RA 1ZHFA 3WL8A 2GILA 4MVCA 4OMUA 4B87A 4ER3A 3CNQS 4G4SO 1RMTA 2ZRIA 3EE6A 3IUNA 1AY0A 2FPXA 3EXIA 4FXPA 2XUGA 3BTOA 3JQBC 4COKA 1U3GA 2WUWE 2XECA 4UJ5A 1U11A 1USVA 5DN9A 1IWBB 1VRCA 5DNWA 3IDZA 4DS3A 4DC0A 1K7FB 3P2MA 3R6LA 3G59A 3IA2A 4XIGS 4CMIB 2GPNA 3HVHA 3TD6A 5EMJA 2BH2A 1RXCA 4UBIA 3NIGB 4NYIQ 3Q3IA 3WAKA 3R8FA 1QONA 3E7WA 4KO3S 2YRXA 1T6XA 2YHUA 2J32A 3T0IA 4X66B 1VKRA 1B93A 1X15A 1PWXA 2PKRA 4JLOA 4QTYA 3C3JA 1T0UA 3LDFA 1EHCA 2B9EA 1XNQB 1LJLA 5F1YA 4WPGA 1KYZA 3UAWA 3VR1A 3KDAA 2J07A 2HU8A 5DHSA 3ZGLA 2BRUC 5BV1A 1U9JA 4RSHA 1F2VA 5BNFA 2V55B 5EVJA 3HXMA 4MVYA 3HP4A 4G37A 5TARA 1XEAA 4ETIA 1OAOC 1Z2OX 3FBTA 3LRXA 4Q4HB 4RNDB 4TWIA 4YRDA 3PQEA 3MWDB 2H54A 1CHDA 4G41A 4JJAA 4KKVA 4Y6LA 4RCYA 1AK9A 2ZVQX 5KSZA 5FBWB 4L6CA 2CMHA 2IHVA 4QPZA 1FF9A 2R9VA 3W5UA 1M1ZA 1UXJA 2MDTA 3JQ6A 1QK4A 1QIFA 2HUNA 3W6UA 1B8VA 5KQSA 3ZZ0A 3DZKA 2ZSKA 2UAGA 3HJTA 1ZH6A 2QLTA 3B5IA 3MAAC 4BLSA 1HKHA 1LBEA 3Q98A 3FW1A 4QRHA 2IPXA 2WJPA 4Y9DA 3HZOA 3O2JA 1I6MA 4HATA 3ZCRA 3KJHA 4BKQA 4XQEA 2EAUA 4M1YA 3D64A 3GH1A 1W2GA 1N1EA 5F1OA 4DF3A 2FEAA 4YYZA 5TR9A 1WOMA 1JYEA 2VTEA 3BH7A 5LNK6 3BTUA 1EZ4A 5KSOA 3D81A 1TCAA 2ARKA 3OZDA 5BW5A 3DMPA 5ALZA 2WLTA 3ET4A 1E2QA 2OD7A 5AKYA 5JO0A 1Q44A 5CCXA 4EJ6A 5AVVA 1KSHA 2XDAA 3URMA 3B6ZA 1XDZA 2GCOA 3IP1A 4CGZA 3EQ7A 4I4IA 1DAHA 3DC7A 1NXXA 3SZOA 3OO1A 3GAAA 1OT3A 4GPBA 4AF8A 2N0SA 3K3PA 1H93A 4I1VA 4OD0A 4WECA 3OCWA 3L07A 1WZUA 1WQ3A 1Y0BA 2XUAA 2D1RA 4MV6A 1W52X 2VHUA 5A02A 1VIYA 4F96A 4C4XA 4I8IA 4QGAA 2YHBA 2FQWA 4MAMA 1VP9A 1TYAE 4XLLA 4L78A 4Y0AA 2L18A 1U98A 4N0QA 1T6BY 4L8GA 4KP7A 4EKNB 1JEOA 1TA4A 1YB4A 3QVGA 4JMLA 2FZLA 3HB0A 5G1NA 3JD3A 4MV3A 4DLPA 4H6WA 3ITKA 2GWHA 1A71A 2BFMA 2PUFA 4FOSA 1C3JA 2FSPA 4NYJR 4CCWA 9LDTA 5KOYA 2LPMA 4JC0A 5CT6A 2YRFA 4RPJA 1N7JA 2A1UA 4DIMA 1WHTA 1LF5A 2AEMA 3RQIA 4HQOA 4YP7A 3HXPA 4MVJG 3IJRA 2NUTB 2OCAA 1X42A 1OYWA 2CXSA 1RI5A 3B8HA 3K2EA 3BMCB 1K97A 1JG3A 1NMQA 2VATA 3V2GA 1LJ8A 2WKQA 5BR1A 5CURA 3GLGA 3CLUC 1O94A 4I5EA 1GPBA 1E7WA 2PMWB 4NF2A 1J9EA 1Z3IX 4DBLE 4MV1A 1YACA 5FULA 1R8XA 5GVRA 2ASEA 4DLLA 3DCYA 4JOCA 4AN1A 3U3XA 2VSQA 3CZCA 4K1LA 4QLAA 2I1QA 4Y6RA 1IOZA 1I4OA 2AFIA 1ZMBA 3QOYA 1LWOA 4M9UA 3CN7A 4ZT4A 1TTPB 1AD2A 3P52A 5JXHA 1VI6A 3O8QB 4G67A 2GZ3A 3PTAA 4RPHA 2VYFA 2DT5A 1XRQA 1L4YA 2IHTA 2ZSAA 5KREA 4DNOA 1S4QA 4X8LA 4C78A 5BWNA 2ZUUA 3O3MB 2C88A 1TUBB 1Z37A 2BDUA 4IHJB 1ESEA 1B41A 4MPDA 2FUCA 5DGHA 4LEIA 3WGVA 4E07A 3U4AA 1YJBA 4F1KA 2ZLBA 5CYPA 5BNTA 1J8MF 3RF6A 2Q4TA 2B61A 4ONEA 3PNVA 4WNAB 1L6RA 1QR6A 4KJXA 1XZCA 5B7QA 4F6RA 1A4UA 1KIAA 2CL5A 1E1QD 2FMFA 1RKXA 2FZEA 3KEGA 4P4NA 5EWMA 2VZ9A 3O82A 4O5AA 1DJMA 1RWNA 2C31A 3C6MA 5TSDA 4OK3A 4M6WB 1ZD3A 2QW8A 1ZQ1A 2H7VA 4IIBA 3RNOA 3JQPA 4J6FA 4MUXA 2PX3A 4LWOA 3RASA 2WVGA 3KKPA 2Q6KA 4OQXA 5FL7D 4QJ3A 3WL7A 1PFVA 5JARA 3G0HA 4HDOB 1VE5A 1MH1A 3FBWA 1EUYA 1W8IA 2P2NA 3P0EA 4WZAA 5DNAA 3LBYA 5MGBA 4L1KA 4JLKA 3JAKB 3ILHA 5HBGA 2ZYUX 3TSOA 1IK4A 2ODTX 4EJ0A 5IJ9A 2O3RA 4GOND 1IQPA 2QUZA 3QWHA 2Y1DA 5A3SA 3F3SA 2DHQA 1XO1A 4IV5A 4EI9A 2VDVE 2FPMA 2J6BA 3AM5A 1XRRA 4BOYA 3DMFA 5AUOB 3BMNA 4LIPD 5DNYB 3EWAA 4G25A 1MVNA 1ABBA 1IN8A 5IH3A 4DW8A 1QORA 3OT1B 4OO3A 2J5KA 5G02A 4KO8A 5F4BA 3LU1A 1NJ2A 1CQJA 1B1AA 1LGYA 3ITNA 3O2NA 3HADA 3L1IA 3QK7A 3QV1A 3UIEA 3D4BA 4NZYA 1EUDB 3TPZA 3T4EA 3M2TA 3X44A 3UJCA 2VLBA 3BE6A 2QJWA 2YN4A 4TKMA 2FSFA 3RKRA 5EPEA 5EP1A 2FRDC 2GHTA 2QRGA 1OTHA 2OAEA 3MTDA 4KUEA 1XF9A 5ADHA 3VC7A 3ASYA 2G76A 4DREA 3K1JA 4N6NA 1H0KA 4X84A 5JSYA 1JG6A 1XDDA 1F0KA 4OMFG 4RL4A 3DTNA 1XZPA 2IUUA 4ZODA 2XCTB 3KOYA 2VDPB 2JJ8A 3QUTA 3GQVA 5EMKA 1GTVA 1R4NB 1B3BA 4ACBA 5K51A 1RYNA 4IIUA 4CUJA 4EG8A 1O4WA 4URFA 4Q9HA 3GVCA 4FWTA 3LRPA 2OBNA 4H7PA 2OBYA 3KL2A 3KNZA 3HCDA 1CTQA 1CUWA 3DDCA 2H9IA 4L95C 4YJ3B 5TQ0A 4ZDJA 5C7IO 2V7UA 3C15C 1UZLA 2QVCA 3AFGA 3CB4A 4IZOA 4MO9A 3SJAA 2VF4X 2VTBB 1TM2A 1ESDA 2PZBA 1PGOA 2XNCA 3IMEA 4LXQA 2QI9C 1ISPA 2AZTA 4XYMA 4CM9D 5CFLA 2AF4C 1X1DA 1XD2A 2O7NA 1UM8A 4J7AA 4JQZA 1WSAA 1U9CA 3HUTA 3UKJA 4X7MA 3UT5A 4B9EA 4CHGA 3ETDA 2XDQA 1YFZA 1OFIA 4NZOA 2G67A 2Q6VA 3FF4A 2HU7A 3KAPA 2M1XA 4V0NA 2JAQA 3CLSC 3D3WB 1TKCA 4P35A 2A0UA 4RY9A 1ULAA 4DQLA 3PEFA 4EUFA 3KQNA 3PCRB 4EVQA 2XXJA 3DFMA 5LKRA 4OGKA 5KYYA 5LDDC 4KR0A 3AUTA 1YVDA 4INOA 4MZXA 1TRKA 4WZBA 4K9RA 4URVR 4UUOA 5CBKA 3ET5A 1J97A 3TEFA 3TKLA 3FMPB 4LYJA 1QFZA 3LC2O 1MAHA 3PA8A 1GLNA 2GN2A 2ZJZA 3EXEA 1TD1A 3FGNA 4GP7A 1KP3A 1QMPA 2YHIB 3J7TA 3K1AA 2H7YA 3MWGA 1F8YA 4BCCA 3BE5A 1ONBA 2YBEA 4P9NA 3BFVA 4E1BA 1FXUA 1PV1A 2X2EA 3E7FA 2BMVA 4PHFA 3ZHYA 1MDBA 3I5MA 5HYVA 1PS9A 4FEGA 2ZTMA 1G6OA 2Z04A 1XD8A 4Q9AA 3RC9A 1GGNA 2G5PA 2OCDA 1W29A 4GC9A 3O8BA 3GAFA 2QSYA 3MMSA 2ZI5A 3O8OB 4WCFC 2FY8A 4NI5A 2D8MA 4EMUA 2P7IA 2DWPA 3A27A 1G66A 2D4AA 2NU7B 4ID9A 1DOAA 1QHSA 2QL5A 4L5BA 4QOEA 4D99A 1G5HA 5FPTA 4HFRA 4UD6A 4TS4A 3AJ9A 1C1HA 1ZH2A 4Y2VA 1COWD 1ANKA 1KTVA 1NVWQ 3U49A 2W42A 2HKIA 2VDKB 3EMDA 4WUTA 3B9RA 4YROA 4N7JA 5BPHA 2YYAA 5FH9A 4U63A 4PO8A 1CUXA 2FWJA 4QU5A 1FOEB 2W4MA 2PT6A 4LVNA 1XBTA 4ZU6X 1XTUA 5TMDA 6YASA 3DXZA 1C3XA 1X7XA 4XWOA 5TT0A 5FLKA 3WQHA 1PZHA 3U3OA 3FTPA 2J5QA 1QH1A 4LYDA 5DBOA 3K70D 1XG5A 5M5BA 1G64A 1U0EA 5KBYA 4QE3A 1G9XA 4I8DA 1XVLA 1E2BA 3JYNA 2R6DA 2PGXA 3GROA 1DEAA 3I76A 4QLOA 5THXA 1CJKC 3ZIAA 1E5VA 3UFXB 5K0JA 5F35A 3UK2A 5IC5A 1F4VA 1Y5MA 2C9DA 3JATB 3KO8A 4J29A 1U65A 2P1DA 1JAZA 3QLVC 1SEPA 4PANA 4LGYA 4P34A 2VQEB 4JR2A 1JDUA 1M2EA 1P61B 5IBQA 3KEOA 1WB9A 3VZDA 5FPKA 4MW2A 4EW2A 1JG7A 1ECPA 4UM9B 2IYFA 5DM1A 2C94A 1IUKA 1H4TA 2PSHA 4TTPA 4BO8A 3BHJA 5JANA 5BRJA 4P22A 3LKBA 2ZIXB 1PLJA 1Q19A 2ORIA 3CO5A 1JIJA 1E4YA 4WN9B 3VPAA 5DGTA 4WGFA 3CVYA 1R6XA 5BVGA 2YN0A 3UWOA 3OTOB 3CKMA 1S96A 4LYYA 4O2AA 1KSGA 1EK6A 3DB1A 1BDBA 3UN1A 3GLHE 2OLEA 4RA9B 3ROMA 1ADGA 1U94A 1XQ1A 3VYVA 3BRSA 5H02A 3F49S 4JT8A 3EGWA 2RJ3A 5HUJA 1SUWA 4MW1A 5IJ0A 2QROA 4C0QC 3HWWA 4XDHA 7REQA 2WOOA 3ZGOA 3IUQA 1Z4PX 3FIUA 4MVWA 2JKZA 1K66A 3E9ZA 1QH9A 3AEZA 1ORTA 1DIBA 2NQ8A 1ZOOA 4OP1A 4RO0A 5ICEA 2QTAA 1HL3A 1GA1A 3E82A 1SUEA 1QIIA 4M0UA 4TWBA 2HK6A 2O1XA 3RHZA 3C7KA 3F3KA 5L6LB 2FEOA 2RGAA 3VRHA 4BNFA 1ZONA 1CZOA 3OZBA 3F5DA 3D1VA 3PPIA 2NQTA 1XNJA 4ZHSA 3E03A 3SBOA 4G1MB 1MC8A 2G4VA 1Q1QA 2QP9X 2ZIZA 3A37A 3GJZA 4JS0A 2O1SA 1Z15A 4B5KA 2R97A 1KARA 4C05A 1SHUX 5DASA 5ALSA 5FLXA 1UKAA 5DGCA 3EDYA 4EEKA 4EYGA 1G4HA 1YZNA 3BIOA 3PFKA 4PBSA 1KSJA 4XOIA 5AJZA 3AW9A 4IDNA 3K0CC 1L1EA 1N9GB 2CJFA 3PHJA 3UMJA 1L9XA 3KSDO 2QD3A 3HA7A 2O2EA 3MINA 2Z9DA 4DLZA 2HJVA 5JDCA 3AEUA 3Q6MA 3GG2A 4M3NA 4ZQHA 2XGMA 3LY7A 3EZXA 1V9CA 3D6VA 2AMYA 4U9IS 1I7NA 2EZ8A 5ICGA 4FOTA 4PN3A 4OLBA 1ZG3A 4P3PA 1IBCA 3H3XA 1V4NA 1TADA 4UE3S 3JVEA 3BSSA 3ETJA 4FE7A 4UAUA 4XYEA 3UHOA 4PG6A 4B45A 2NZ2A 1G7TA 2ZIGA 3ZNOA 1I8TA 1RZ3A 2JHGA 4W1RA 2R1UA 4AYWA 2OKGA 1DSSG 2DBYA 4QUKA 3CRRA 1L7QA 1H6CA 3BHIA 3IH5A 3OCVA 2J7PA 2H63A 1V35A 3W6PA 2NG1A 2I7CA 2ISSD 1IVYA 4XPIB 1N0VC 2CDNA 3P9NA 4D80A 3QPWA 5BMVF 3TLBA 5BNIA 5CA1A 4HI0E 2BEKA 2P9EA 3PFIA 3UHJA 1ZDMA 5IT9A 3KE8A 5K8JB 1Y8AA 2NM0A 3KJIA 3ETGA 1EM6A 4OMDA 4KFUA 3D1JA 4ARCA 5FLYA 1T36A 1IXSB 2BMWA 3S2UA 3COVA 1WABA 2DXIA 1C4OA 3C87A 1JAHA 2EW2A 3GH3A 4RQUA 4KQCA 3SNHA 3PE6A 2ZPUA 5BOVA 4RELA 2Q2WA 1POWA 1OXSC 3HJGA 3H6KA 3T94A 4P3KA 2D3WA 5HQ3A 3AVQA 5DGIA 4IXNA 2VDOB 4CFSA 3AJRA 1D2MA 2C5AA 3GFPA 2Y9MB 1XD9A 3UMFA 3L6EA 5GVSA 1P9RA 1E61A 5KVSA 2IOHA 3KPWA 3PKZA 2MU1A 3AP3A 1GNRA 5K0NA 3WNCA 1Z2AA 2E49A 4OB7A 1JIQA 1Q1BA 1Z8HA 5LQSA 1FFBA 2ACEA 2Q2NA 2PX5A 4TT8A 1ZP6A 2PT9A 4MA5A 1NX6A 2OFOA 2WQZA 1TCUA 3JTEA 1FVHA 2J9GA 4WDRA 1TZMA 2C2YA 4CQLA 5FX2A 1PHRA 2GF0A 3UICA 1B74A 2VJMB 4M1WA 4MDHA 5B36A 3NS7A 5AVSA 5JASA 3N53A 5C5EA 3V8EA 5BSVA 1Y5IA 2II6A 2VEOA 2R8ZA 3DBIA 3KFLA 5L9AA 3M1IA 3BTVA 2ZUDA 1ZAYA 2DQSA 3G2JA 2DERA 2X1MA 1NRJB 4C4PA 4RJKA 5I7HA 2AFRA 3CH4B 4F2HA 5CW2A 4JAVC 2NYAA 3EA0A 3L40A 5KQLA 4MICA 4MI6A 1ZMTA 2WF7A 3TQSA 4IDPA 4R1NA 3ZJUA 4LF4B 4DV6B 1VJTA 3V9PA 3VTKA 2UVPB 1CRZA 5J59A 5KVQA 1JILA 1UDBA 2QA5A 3O4VA 4WXMA 3S68A 1DWQA 1JR3E 3DL7A 3GVIA 4I4TF 3JD1A 4ZQEA 2HMYB 1BKDR 2EF1A 4E13A 1NAIA 1OVGA 1B73A 2NVWA 1MB2A 5TF4A 4EJSA 3TGPA 1MT3A 1OREA 1U2TA 1OI4A 2J4FA 4PHHA 5GV8A 1UDRA 1RRCA 2QN1A 1V2GA 2G1AA 2ZI9A 1QO0D 2CVOA 2YHSA 2QAGB 3SJUA 1KBZA 2DBVO 5FA6A 3TM4A 1C3LA 1PD0A 4BNLA 3HQ4O 3DHVA 3MT9A 3A6FA 2IE8A 1XF1A 3H8VA 1A7JA 3OZSA 4BFYA 5F1KA 2Z4RA 2Q49A 5JRZA 4NULA 1A96A 2XVYA 3H2GA 1DHTA 2HCJB 4C1BA 4MHTA 1Z7GA 2DOKA 2YIMA 4X0EA 4MIEA 4MYUA 3FOCA 3I52A 3ITDA 3KJGA 4O4IF 2REBA 3H0EA 1ADBA 4GUDA 1MOZA 3VZBA 2QI9F 3TD2A 1G7RA 1NSTA 3ZDDA 4OI1A 4KQXA 1YQTA 5LZ8A 5COBA 5CTAA 2XKJE 2VNKA 3L05A 4Q4DA 4RORA 2LCIA 3QG1A 3FKSA 1ZYUA 4IJUA 5SZIA 3H2KA