1KPHA

Crystal structure of mycolic acid cyclopropane synthase cmaa1 complexed with sah and dddmab
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
283
structure length
283
Chain Sequence
LKPHFANVQAHYDLSDDFFRLFLDPTQTYSCAYFERDDMTLQEAQIAKIDLALGKLGLQPGMTLLDVGCGWGATMMRAVEKYDVNVVGLTLSKNQANHVQQLVANSENLRSKRVLLAGWEQFDEPVDRIVSIGAFEHFGHERYDAFFSLAHRLLPADGVMLLHTITGLHPKEIHERGLPMSFTFARFLKFIVTEIFPGGRLPSIPMVQECASANGFTVTRVQSLQPHYAKTLDLWSAALQANKGQAIALQSEEVYERYMKYLTGCAEMFRIGYIDVNQFTCQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYCLOPROPANE-FATTY-ACYL-PHOSPHOLIPID SYNTHASE 1
publication title Crystal structures of mycolic acid cyclopropane synthases from Mycobacterium tuberculosis
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 106
structure length 283
sequence length 283
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.79: Cyclopropane-fatty-acyl-phospholipid synthase.
pdb deposition date 2001-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02353 CMAS Mycolic acid cyclopropane synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1kphA00
3UJCA 2F8LA 1YZ3A 5CVDA 5FHQA 5DPMA 5EKUA 3KR1A 4FSDA 2I7CA 3S68A 3UWPA 4C05A 4RTQA 4BY9E 1X19A 4GEKA 1R00A 3SSMA 5K0EA 1NW7A 1EJ0A 3GJYA 2PX5A 3KPWA 5ERGB 5B1SA 1Z3CA 3HVJA 5HIKA 2EFJA 1EAMA 2IDJA 3SM3A 5DM4A 4DA4A 2WA2A 3BZBA 3NTVA 3DLIA 1FJXA 2O07A 2PSSA 1L3CA 3G8AA 3QOWA 2G8NA 1JG3A 1L1EA 3DTNA 2P8JA 1NBIA 2ERCA 1MJFA 3G2PA 3HCAA 3ORHA 2P3LA 2YQZA 3ER8A 3CJRA 3R6TA 3PX3A 2C7QA 2IBTA 1HNNA 3I9FA 5FHRA 5K05A 3DMHA 4IKPA 3TKAA 4BLWA 1O9HA 3PTAA 3ME5A 2ZZMA 2YUIA 3LDUA 3B89A 2ZULA 1NV8A 3UFBA 5K0CA 2YXLA 3P9KA 1KYWA 2NP6A 3O7WA 1ORIA 3BGDA 1AQJA 2G72A 3KPJA 1JG4A 2CWWA 2YX1A 3L8DA 1KR5A 5DM1A 5ICFA 5LQAA 5GM1A 2C7RA 4QPPA 3PFGA 4OBXA 2BH2A 2UYHA 1NW6A 2HTEA 3DH0A 3LKZA 1M0EA 5GWXA 1JG2A 3C6KA 2PY6A 2IPXA 5DX8A 4PYNA 4AZSA 3TOSA 5DTRA 3TRKA 4C03A 2IIPA 5CIYA 3HCCA 2AR0A 2G1PA 3BGIA 3P2KA 4EKGA 7MHTA 5F2OA 5GM2A 2VP3A 3GXOA 2EX4A 3KPUA 5KVAA 1YUBA 4KRGA 3TPZA 4RTSA 2P3OA 3ELUA 2AVDA 4YUYA 3UBTA 3IV6A 2E5WA 2V74B 1JTEA 2ZBRA 4PYIA 5EEHA 5EZSA 2HR1A 1EG2A 3FUWA 1UWVA 4WVLA 1KPGA 1KXZA 5DSTA 4E32A 1FP1D 2OB1A 4C4AA 2H11A 1JQDA 4GOLD 3LL7A 4CTKA 3LDFA 4AX8A 5HIJA 4PNEA 5DX1A 1Q0TA 3MAGA 3BWYA 4FS8A 3P71T 4RVFA 1RJEA 2ZIFA 3U81A 2EJUA 4LECA 2B9EA 2Z6UA 3GCZA 2NXCA 2OO3A 1X1AA 1PRYA 3TFWA 5FCDA 3GRUA 5CCXA 1I1NA 1XVAA 3ID6C 2FPOA 3I58A 2OBFA 1X1DA 2KW5A 4PYLA 2G70A 1ZHFA 4MHTA 2ONYA 3FYCA 4KDCA 1YB2A 3UJAA 1EQAA 3AY0A 3K6RA 4PGGA 5F2KA 4CTJA 3DMFA 3EVGA 4OA8A 4X60A 4P7KA 2P41A 4MIKA 2ZZKA 3G88A 3PS9A 1L3IA 4PCLA 4CKCA 2VZ9A 5DTQA 2NP7A 3T7SA 3MQ2A 4GUAA 4QDJA 5FWDA 2PX2A 2JJQA 3CC8A 3LCCA 3M6UA 3BXOA 3UJ7A 5DWQA 1VPTA 5E1OA 5LQJA 2CMGA 2QM3A 3KR2A 2R6ZA 4PONA 3SR4A 2JH8A 4R6WA 4DKJA 3LECA 3K0BA 3Q87B 4E2XA 5EVJA 3SX0A 3PB3A 1XCJA 5IH3A 5EZQA 1YF3A 3SGLA 1EIZA 5E1MA 5MHTA 3I53A 4A6EA 1SKMA 1ZGAA 3HCEA 2ZBQA 2H1RA 3FPJA 1G38A 2P7IA 5P8WA 3MCTA 3UZUA 5LSAA 4U7TB 4X1OA 1G60A 1T43A 3KU1A 3G7UA 5G02A 2NXJA 1RI1A 4GOOD 5DM0A 3EPPA 1N7IA 2PXAA 5BXYA 5K09A 2VDVE 2I62A 4PCAA 1XXLA 3EVFA 1G8SA 2PWYA 1WG8A 5EIFA 2CKDA 3AXSA 3LHDA 3REOA 4HG2A 1P39A 1QZZA 3MB5A 5LR6A 2PV0A 4PYJA 2ZBPA 4QVKA 3FYDA 3FPFA 2PJDA 3LPMA 1RI2A 1P91A 3G2OA 3I5UA 4OQDA 2GLUA 2XYRA 5EG5A 3DXYA 4HSGA 2IH5A 2IH4A 2R3SA 3KHKA 1SUSA 1DL5A 2ADMA 2HMYB 2P40A 5DM2A 2P7HA 1BC5A 4P7FA 2Z6AA 3JWIA 5E1DA 3CJQA 3OU7A 1TPYA 2AVNA 3HA7A 4P58A 4RWZA 1V39A 3GDHA 4RV9A 5F2NA 1P1CA 4CKEA 3O4FA 10MHA 4KVZA 4PYQA 3FPHA 3TQSA 4PWYA 3B7PA 4XUCA 1RJGA 1XJ5A 2HWKA 2AN3A 5K0NA 4HRAA 3KQSA 3UJDA 4DCMA 2ZWVA 4QDKA 1PJZA 3LBFA 3OZSA 2UZ4A 4KIGA 3THSA 4V0RA 1QYRA 2JHPA 2FK8A 4E70A 5GP1A 3DMGA 5LQRA 3KQOA 5HOQA 2UYCA 1SUIA 2NYUA 1VLMA 1X1CA 4MTLA 3HVIA 5DSXA 4E2YA 3V8VA 5FQNA 3FUUA 1AV6A 1RI4A 2OZVA 3UJ8A 5T6BA 1D2CA 2QYOA 3LSTA 1VE3A 2H00A 4POOA 9MHTA 2PX8A 1KPHA 3DXZA 5HILA 3EVCA 3P9IA 5KYGA 3M33A 3R3HA 2IDKA 2G71A 2PGXA 3E23A 3FTFA 3EVDA 5CVUA 1WY7A 1IY9A 2AS0A 4PYKA 5LQKA 1F38A 4ER5A 1D2HA 2PT6A 5H02A 3FRHA 3NWEA 3HCDA 4QPNA 5K0FA 3ELYA 2PBFA 4DZRA 2C7PA 1O54A 2LD4A 2ZVJA 3ELWA 3RODA 2NNWB 3TM4A 3UJBA 2JG3A 4YV1A 3HTXA 3TMAA 2O05A 5DT2A 1DUSA 4AZVA 4BLVA 2AOUB 3OZTA 5EIWA 1KYZA 5JR3A 1ZGJA 5FQOA 3KQPA 3G2MA 2ZIEA 1UIRA 2P3QA 4IWNA 1YFLA 3HP7A 4XUEA 5DLYA 2IFTA 1XTPA 4BLUA 1RI3A 2PX4A 2EG5A 3FUVA 3GRYA 2GH1A 2PWPA 3DOUA 3OU6A 3TKYA 1HMYA 2XVMA 4FT4A 1BOOA 3B3JA 3TR6A 3DLCA 2B78A 4M36A 2HNKA 1RJDA 4YUXA 4RTJA 1D2GA 4B17A 3FUXA 3ELDA 2XVAA 3FRIA 4GF5A 4F86A 4QTUB 4OA5A 4RTRA 2BR4A 4IV8A 4EQZA 1U2ZA 2QRVA 4YUZA 3CBGA 1X1BA 4FGZA 2HV9A 2XBMA 4AZTA 3H2BA 4P7JA 3C6MA 3G5LA 5U4XA 2DULA 2PXXA 1DCTA 1KIAA 3E05A 2WK1A 2AOVA 3DULA 5E2AA 1NT2A 2FYTA 3A4TA 3A7EA 3X0DA 5EMMA 2OY0A 5ICGA 3R9XB 3IHTA 5KQSA 3NDJA 2PXCA 4QTTB 5C0OE 1N2XA 3NWBA 4AUKA 4BP3A 1JQEA 2FRXA 3GRRA 5GIPE 4R8SA 5EMJA 2OKCA 4X41A 1WXWA 5HFJA 4PIPA 1L3BA 1R74A 3SMQA 4KW7A 4DCGA 3BWBA 5E9QA 3JWGA 3A7DA 1OR8A 2P35A 3HNRA 2FHPA 4KWCA 5K0JA 2PVCA 1R8XA 1WS6A 3R24A 4HTFA 1KHHA 1QAOA 2AOWA 1VP9A 3FTEA 5DRYA 5EGSA 2ZTHA 3P2EA 2ZLBA 4A6DA 5ICEA 2YTZA 1M6YA 5DXJA 1O9GA 5HIIA 1R8YA 2QE6A 3G5TA 3KQMA 5EEGA 5BW5A 5E9WA 2ESRA 3D2LA 5DTMA 3QOXA 3M6VA 5FA8A 2XYQA 3V97A 4E2WA 2VDUE 4FR0A 1G55A 2O57A 4JXJA 3DXXA 3IYLW 5FWAA 5E8RA 5IKMA 3CVOA 3HVHA 3UA3A 1R6AA 4HC4A 4OX9Y 3GO4A 1KPIA 3EEYA 1XDZA 4E33A 4MQ4A 4OQEA 5GIOE 2UYQA 2YXEA 3CJTA 4FSXA 4R8RA 2OB2A 5EQJB 1QAQA 4YV2A 5ICCA 5CD1A 3BWCA 3P8ZA 3MTIA 4X61A 2PKWA 3GIWA 4E2ZA 2YVLA 3KQYA 5M5BA 4LWPA 4EVIA 3OFJA 1VL5A 2JH9A 3HM2A 4U7PB 4YV0A 1MHTA 1IM8A 1ZQ9A 2YR0A 3FPGA 5DX0A 1XCLA 4K6MA 4EMSA 5K8VA 3EGVA 2B3TA 3HCFA 1I9GA 4F85A 1BKYA 3TLJA 4RVDA 3TM5A 1G8AA 1ORHA 3E8SA 4DQ0A 3BWMA 2DPMA 1Y8CA 3ER9A 1NE2A 3GRVA 3KKZA 4RVHA 2Z6QA 4UOEA 3LGAA 2AZTA 1NKVA 2QY6A 3LKDA 4GC9A 2AOTB 5E2BA 5KQRA 4FZVA 4YMGA 1F3LA 4GOMD 2N47A 2BR3A 1TW2A 5EC8A 2BM9A 5DXAA 3AXTA 3R0QA 3P9CA 4QQNA 4HH4A 5EOVA 1JSXA 3DR5A 3LCUA 3OPNA 3EVAA 3GWZA 1M6EX 5LQNA 8MHTA 3M70A 5K0LA 4FP9A 2Y1WA 4DMGA 3EGEA 1B42A 5C1IA 4R05A 4ATNA 2JHAA 2B25A 3RIEA 4C07A 1IXKA 4EKIA 3JWJA 4L7VA 1YFJA 3FTDA 3A26A 3GNLA 4GC5A 4BP1A 2Q41A 3HA5A 4GQBA 2WA1A 1AF7A 5FUBA 2C7OA 3OU2A 3NDIA 3HVKA 3M4XA 5FADA 3IEIA 2PT9A 5CUQA 4PGHA 3P9NA 5E9JA 4RTPA 3LX6A 5EHIA 2O06A 3KQTA 2AOUA 4GBED 4DF3A 5KS2A 3HCBA 2VS1A 2NXNA 3UJ6A 4HGZA 5CVJA 1INLA 1JSZA 1ZG3A 2GPYA 2B2CA 3OE4A 4AZWA 5LQUA 3ERCA 3EVEA 5HZMA 3CCFA 3KQQA 5K0GA 3B3GA 3P97A 5CVVA 2YXDA 3PVCA 2K4MA 4X63A 4PYOA 2UYOA 3P2IA 2IGTA 1RI5A 3FUTA 3OCJA 5CM2Z 4YUWA 3OZRA 3HEMA 4RYLA 5K0BA 4KDRA 3VC2A 4RTLA 4RX1A 3A25A 5EMKA 1NV9A 3FZGA 5K01A 2OXTA 4CXMA 1WXXA 4MWZA 3T7TA 1R18A 5DRTA 2VDWA 5FULA 2ZIGA 3C0KA 2FK7A 1YZHA 2OPBA 3C3PA 3FPEA 3MERA 4CKBA 3MTEA 2IH2A 4P7GA 3BGVA 4QQKA 2V7EA 3KQVA 5C9ZA 3GGDA 3NJRA 3DP7A 3NMUF 3EVBA 2EJTA 4DM3A 4FT2A 4V0QA 2I9KA 1NW3A 1P1BA 2XYVA 3GRZA 3OE5A 5E8JA 1XDSA 3SSOA 1N7JA 4LWOA 4RVGA 3M6WA 4ER6A 4M7RA 3VSEA 3EMBA 3DUWA 3EMDA 4IV0A 5FTWA 3JWHA 3QV2A 5GOZA 2GAFA 2ONZA 4RSRA 1UFKA 4ER3A 3GU3A 1ZKDA 3ANXA 5T64A 5EKXA 3LBYA 1TW3A 4YMHA 4Z2YA 4RTOA 5FA5A 4C06A 2ORED 4Y2HA 4ZTBA 3B5IA 2GA9A 2BZGA 4LG1A 4C08A 2ZWAA 3BUSA 3NVMB 3G89A 2A14A 4RTMA 5GINE 2PLWA 3A27A 3SXJA 3KR9A 3EEOA 4R6XA 5EMLA 4O29A 2I6GA 5EHGA 3T0IA 3KR0A 1AQIA 1G6Q1 1L9KA 3AJDA 3C3YA 4EK9A 5T67A 2NXEA 3I64A 1SVUA 2QRVB 3E7PA 4RTNA 4H0NA 2CMHA 3O31A 5CVEA 3M6XA 4PIMA 3SVZA 3CGGA 3EGIA 3HA3A 1NBHA 4G56A 5D1NA 2CL5A 1FBNA 2AOXA 2BM8A 2JHCA 4ISCA 4PINA 1SG9A 5HEKA 1VP3A 4QVGA 3RW9A 4YUVA 3T7RA 4HGYA 1Q0SA 1I4WA 3UJ9A 1KP9A 2ZCJA 3WSTA 3BT7A 3NVKI 1NW5A 4C04A 2ZZNA 3CKKA 4ER7A 2ZSUA 3BKXA 1VBFA 1NW8A 3Q7EA 3KQWA 3MGGA 5D1HA 5E1BA 1JG1A 4Y30A 1JTFA 5LQCA 3UA4A 1FP2A 1H1DA 3SSNA 2ZW9A 4GOND 3THRA 1WZNA 2FCAA 2OYRA 1EJ6A 2Y1XA 4E30A 4M37A 3NW9A 3MHTA 1VIDA 2ZFUA 3AWIA 1BHJA 2AN4A 3G8BA 2GS9A 4WXHA 4XUDA 4CWAA 3B3FA 5K03A 2AOTA 4E31A 5HIMA 3PLAE 4PYMA 4F84A 2IBSA 3KPVA 2GB4A 2IP2A 3F4KA 3BKWA 5EPEA 5BP7A 2P1DA 3LDGA 2BR5A 3KPYA 4HTFB 4M38A 4OBWA 3VYWA 5BW4A 2AN5A 4ER0A 3G2QA 1VQ1A 1QANA 3LCVB 1FPQA 3PFHA 4KIFA 5CCBA 4NECA 3EVZA 1SQFA 3PT9A 5JUWA 1JR4A 1QAMA 4XCXA 3MCZA 1SQGA 1JQ3A 4RTKA 3FTCA 2O0LA 3OFKA 3VC1A 1XDUA 3PX2A 1RJFA
chains in the Genus database with same CATH superfamily
4S04A 1IULA 4ZC1A 4EB8A 4EG6A 1YZVA 3QM1A 4A4DA 2XF2A 2I0FA 2AV6A 1UMCB 2Z9BA 1F8FA 3S68A 1ECJA 1UOQA 2H18A 4FSDA 1LX7A 3GUUA 5F4BA 3EE6A 2HO4A 2QG4A 1L8LA 3EA5A 3GG2A 1CUSA 3JYQA 1E8DA 1YQXA 3IIIA 1LPPA 2WD8A 5B1SA 4R8MA 1ZKMA 1OSNA 4J9UE 2B2XA 3HU5A 3VU9B 4H08A 3AEQA 1TUBA 1PUIA 2PIAA 4XGNA 4MULA 3MILA 3N7TA 3NASA 4Q03A 1ZK0A 1M7BA 1P45A 2HCTA 1ZVKA 4D43A 5JJLA 2V1UA 3VPFA 4MVJE 2ERCA 3EULA 4MPRA 4A1OA 3PDWA 4CN9A 3HWX1 3I09A 1TQ8A 2NU6B 4JJFA 4FLMA 3T5BA 3WL3A 5C32A 2GUWA 4I3FA 5I5GA 4G0NA 4OL9A 3I6IA 4JJ8A 4JDUA 5LKRA 1I2BA 5EE9A 2XADA 2OKGA 3PUVA 4EY3A 4EM6A 2YVAA 1MABB 2YX1A 1WF3A 4Q9JA 5HFNA 3ZY4A 3WFZA 4NYIR 5GM1A 3JPYA 1H2HA 2BJHA 1JDTA 1NQVA 1TZCA 4HPWA 1PZMA 1FL9A 4LVNA 3P9YA 1ESNA 1IIRA 2WTUA 1XMSA 2G28A 2JKYA 3Q9NA 1J0CA 1P74A 2W2QA 3BGIA 3H6GA 1GNQA 2X8WA 5J2UA 1G64A 4MRSA 2E6KA 3E81A 4BJ6A 2F3SA 3G82C 1E79D 5KTRA 4E4TA 2I7XA 1LW7A 1RHKA 3DC2A 1XU7A 3I05A 1FY2A 1M1NB 2IXGA 2P9YA 4NU6A 2P3OA 3TRHA 2ENUA 4BJ3A 3E70C 4MVCA 4MROA 3R5JA 2MYPA 4X3OA 4YT8A 1Z8DA 4XYMA 2OL4A 3T1OA 3H9EO 2H4XA 3OEHA 1NDQA 1YE8A 4W6QA 4Q6WA 4CLRB 2PUAA 2VIIA 3REFA 2ZXUA 3V8MA 3ROTA 4ZV4A 2F48A 1YCHA 3P71T 4N3CA 3SDBA 3UB2A 1QG4A 3DVAA 3IPXA 5A9TA 2AR9A 2IPOA 3H13A 2BGJA 5KNBH 3G9UA 1ZI9A 2GVDC 2X19A 3DONA 2Z09A 2Y2VA 3X1JA 5KYWB 4W5HA 1KAHA 3QBDA 1H4SA 2VXYA 2WWRA 4DMRA 4J2TA 3RSQA 4P34A 3LLMA 4D25A 4Z5XA 2OV1A 2AMVA 3CZRA 3KOWA 3FZYA 4JX9A 4G0MA 3JATA 4NJMB 4D26A 4I99A 1Z47A 5CIQA 1S8OA 3G88A 3QLVA 4PZCA 2YXBA 1G3RA 4XOIA 2ZBVA 3AZQA 3D9QX 2CZCA 4HXEB 3S81A 1WP4A 5DHTA 5EIEA 5GTDA 1RAAA 3C97A 5KX5B 1A9XA 5CT4A 1PR9A 1WBJB 3D31A 1SCBA 2CXOA 4DXAA 1IY8A 4IG9A 4Y7CA 4AKIA 2WF5A 2AFIE 3CX8A 3IXQA 4X1KB 1KKLA 3LY5A 3AY7A 1K4MA 3T9CA 4F6CA 4EPXA 2IY9A 1P62B 1TYCA 4LY9A 4UAJA 3SGLA 1KL7A 5DNWA 1QK4A 5A5EA 2XVYA 5HF9A 1DLIA 4GP7A 4M4SA 2O0HA 4ZVUA 2QVYX 4NH0A 4PEVA 4BQIA 4FFDA 4Q4JB 1JLKA 3I6BA 3KJQA 1DT5A 2WYHA 4B73A 5FUYA 2GD6A 3MCTA 3V6LA 1C1XA 5KSOA 1GL6A 3EA4A 2Y92A 1BA3A 2Y1EA 1TKAA 1BX0A 1PEAA 2W2XA 3A06A 4W1RA 5DZSA 3PCRB 4M2LA 2R6JA 3MPOA 1EMDA 1Q20A 4QOSA 1FVOA 5K3CA 3WLQA 4CIAA 5AVRA 5K4GA 1GWNA 4IIHA 1R6UA 1G8SA 1XLUA 3FSEA 2JFPA 1GPAA 4ZKEA 4QBKA 5IF9A 1NVAA 2ABWA 1SHJA 3DZDA 4DNFA 3VYTB 4BN0A 4W5QA 1EUQA 3EXHB 3W4JA 2G83A 1CR4A 2CLEB 3F90A 2C88A 3BL6A 3H75A 4J07A 1XTUA 4BB0A 4HGNA 1HKHA 3JWEA 4KVGA 1N6HA 1KS2A 2KI5A 2VRBA 2POQX 5K1ZA 1U4SA 5AHWA 2AKEA 1K7EB 1IN8A 4JBWA 4OHPA 1E6KA 2QTZA 4FLEA 3WFIA 4ARSA 2QI9F 5JEDA 3N2GB 2J46A 1YT5A 3EMVA 3IE0A 2QJFA 1U3VA 4Q1BA 1N9GB 3L6CA 2OXFA 4FCCA 4MW1A 3EH1A 2YS7A 1U8YA 4V0ME 1GZUA 1ULHA 5AM1A 4MDEA 5JVDF 1SWVA 3NM6B 4FKZA 4OQNA 4RV9A 1Y3AA 3GDHA 4D0LB 2DKOA 1H94A 3GEEA 1E2HA 2ZM6B 1ZMTA 4PG5A 4WXMA 4B7CA 4IDQA 1LSUA 1XXHA 1FJ2A 4KSBA 4EITA 2PX3A 1KEEA 3N6XA 2GSDA 1VRVA 5BYJA 3RU3A 3COJA 4KXNA 1JDBC 1UXHA 1YZUA 5AH0A 4DSTA 3DYVA 3GDWA 1BFUA 1Q0RA 4HB4A 1QYRA 2JHPA 5GP1A 4WADA 4OQXA 1E5VA 3UIEA 4DV7B 1Q74A 1E96A 3CPHA 5J2TB 3FNQA 3VAYA 4Z4EA 2BMEA 1Q0ZA 4IGIA 3WMGA 1COWA 3KZOA 4CMIA 4G85A 4LF8B 3K70C 3GEDA 3KV1A 1RJ9B 4C4ZA 1DG9A 1WCIA 4F8YA 2H00A 4CQLA 4AJPA 1TT5B 1KPHA 2TRSB 5IZCC 1BE6A 2C84A 2EBWA 1KJIA 2Q4EA 3IKMB 5ELLA 3GN1A 5ARBA 2X5KO 4PYKA 4R2IA 4CM7A 4YMIA 3R7LA 2FLKA 3NWEA 1D4FA 4LGVA 1A88A 3HCDA 2UAGA 5FOWA 1VFPA 3IDQA 4OP1A 3I4LA 3KTOA 2GAIA 3N75A 4OK3A 4EG0A 3GC6A 5DU2A 2LD4A 5TPWB 3RODA 2FSGA 3U6KA 3D3QA 4AO7A 1XKTA 4FGKA 1Q19A 1OFVA 1HLDA 2X3YA 1J2TA 4IDNA 4YJDA 5C5CA 5EIWA 2ZS9A 5KNCA 4YWHA 3T4EA 1WNFA 3FJ1A 3L4JA 2XHEA 1CUVA 2G1UA 4BMVA 1I2AA 2GM4A 3MJFA 3D5QA 2DG2A 1OGYA 1W29A 5KAMA 5LBIA 3VTZA 5BN1A 1NNEA 3OPMA 3N8KA 4M22A 1MAUA 3K8QA 1Y63A 3GX1A 3UK1A 1JWLA 1RJDA 2W2TA 4AJ9A 3AETB 4YUXA 4MKIA 1ZNQO 4GF5A 1T3SA 1D6NA 1LFAA 2IYFA 3O8OA 4K0KB 5IVDA 1E9DA 1VA4A 3WDKA 2X0KA 4QFBA 4CEIB 1EI9A 3ZI7A 4IO1A 2HV9A 2GETA 4XFDA 3BE8A 1YB4A 3C6MA 5JANA 1G9SA 1GXSA 1HDGO 2AZ4A 2A0KA 4FYYA 5JS1A 3E05A 3EBLA 4B4UA 1BFKA 4F96A 4Z2AA 3T5TA 2H52A 3IO3A 2FYTA 2B5OA 3LVRE 2JGLA 3NPMA 3RHFA 4BFTA 5K3FA 4WOPA 2AEJA 2PZLA 1FEZA 2YIJA 3LLSA 2A1TS 3I0ZA 2C4UA 4IDCA 5JMPA 3BXZA 4CCYA 1SRQA 2JEZA 4FOTA 2P6OA 4MRAA 3PQDA 3HBLA 1JUDA 1L3BA 3U5ZB 1G0NA 2WHYA 3BXPA 3ESDA 3R7AA 4JHXA 1HPLA 3JWGA 3QWIA 1PO7A 2V7QD 2X2EA 2AKAB 1NBMA 5DW0A 1GPLA 1MXFA 2B99A 1XMOB 5EQFA 3F5FA 4OYYA 3HY4A 1FQWA 3R24A 3KFVA 1QAOA 5E6UB 1VP9A 5FUWA 4BE4A 4E15A 1G42A 4RD6A 4UVGA 2BGMA 2H59A 3STUA 3EZLA 1IMJA 1L7QA 1NMEA 1TKBA 4PWZA 3NTLA 5K3SA 2PFKA 2HMTA 5G3YA 4GP9A 1NVFA 2BKUA 3UMBA 4B8YA 4WOJA 3QHQA 3RLFA 4Q5IA 3GPDG 3SY8A 1U5AA 4JI8B 3L93A 1DC4A 3BTUA 2OA0A 3E2PA 4CCAA 4HC4A 1VSUA 2IV2X 4R2LA 5TJHA 4E33A 1GPJA 1Z6PA 5EJ8A 4FFMA 4ECAA 1TJ4A 3WGQA 2BYTA 5JO9A 4I8IA 1MO4A 3SM9A 1AG9A 1NHWA 3UT5B 4GWGA 3F9RA 4KQCA 1X1RA 3ZXXA 4B44A 4ZI7A 4QDUA 3SFZA 4FZ3A 1F5SA 2BFWA 4JD5A 2Q6LA 1MA3A 2HWUA 2AFHA 2IZ6A 2QXTA 3IRUA 3LIIA 5CA1A 1UBCA 4LQLA 4PFSA 3S2YA 4LF5B 1R6TA 3PYLA 1TZMA 3HU3A 3AV0B 3N05A 2XMSA 5EZ6B 1TO2E 4DPKA 2PZJA 5B1YA 5JBIA 4U5XA 1AS2A 3QMWA 4EABA 3ENNA 3UGTA 1NQOA 4L76A 4OSEA 4QU9A 3RC7A 3LGAA 1YR1A 3UHPA 4Q93A 4S12A 4FZVA 4I55B 4ZKDA 3F9IA 1I30A 1FMTA 2YICA 1XF1A 4R2HA 4KX5A 3ER6A 3LX4A 1M0TA 4PBRA 1ATIA 3B1XA 3FRJA 1BH2A 1WKBA 3AF1A 4YJFB 2PUCA 1DOHA 2IUUA 1BGWA 4OMFG 4AW9A 3TWOA 2NADA 4FP9A 2Y1WA 4DB2A 2YRWA 1ZINA 3COWA 2BCJQ 5IVPA 1K08A 1W2GA 2B25A 4L0MA 4EUNA 4D0GA 2WIBA 2FEWB 3P52A 4L7VA 4YJ2A 3WLMA 2Q41A 3K6JA 5LWQA 4UOZA 1WKCA 2GYVA 3AL3A 2GYWA 5DMHA 4UOEA 3HVKA 2A5JA 4P84A 5K4HA 3RKRA 3KL4A 1JJBA 3EDCA 3IKJA 3I4CA 1XRPA 1P5HA 5DK6A 1DBPA 1EZZA 1GJRA 1SBCA 2HNBA 1GV1A 2B6HA 1CETA 1OIVA 1IH8A 3IT1A 1ZMOA 3JYOA 1OH7A 1MZPA 2Q27A 2GASA 1O6GA 1TQ6A 3KTDA 4L5JA 2YFQA 1Y4UA 4OHKA 5DN6A 3Q98A 4YJ3A 5HKLA 4I4CA 3VR6A 5CBPB 3E8XA 4PHCA 5AKEA 1T36A 3C5HA 4LHEA 3FUTA 2X7XA 1G21B 4DV2B 3HYNA 1WEHA 1G5FA 2Q2WA 3CH6A 3MTJA 1UAYA 2Z2KA 5BRNA 5A9RA 3KXKA 5EMKA 2X4LA 4WJKB 5K01A 2QZZA 3E03A 2X0DA 5K2OA 1PL7A 2XAUA 2YDYA 1DQRA 4MGKR 5KQLA 2NZWA 4BX9A 5FPYA 3ROKA 4LSMA 3O84A 3VDMA 1ZICA 4KNWA 5KYKA 2Z30A 4LRWA 2QXUA 3RTCA 5C9ZA 5LPNA 2CB0A 4IIJB 1IWBB 2RMKA 3SF0A 4FE3A 4FJ1A 1I6LA 3V00A 2ZDHA 4WXEA 5T4BA 3GRZA 2GFIA 4KGXA 1SQ0A 4O4IA 2ZGVA 3IAUA 4IM7A 3MPUA 2GD2A 2OHFA 3PHHA 2WW8A 2JGRA 4PF1A 1HTTA 1Z7GA 4QXAA 3VSEA 4EX7A 5L3QB 1BOFA 2QV7A 3VX4A 3NEPX 3EAQA 4L5AA 2PX6A 3LT4A 1NPYA 3TNJA 4FZRA 1ZKDA 2NW6A 1RLMA 2ATIA 2H29A 1TJ5A 3MIZA 4WD3A 1ZUHA 4YRRA 1J8YF 2PL3A 5CM8B 1VLLA 3ZDFA 3HVRA 1FVFA 5L4SA 2A9PA 4LG1A 2IYVA 3AVOA 4M83A 4MUFA 1EX6A 4HX2A 1CG6A 2WNIA 5IJXA 4QEZA 1J2JA 2NGRA 2WWHA 4H7PA 3PJFA 3O47A 2BHNA 2B8EA 4O29A 3DZKA 2VAVA 1Q7TA 1KVTA 1XYGA 4RHUA 4AF6A 1PS8A 5SICE 5FYDA 3RTBA 3I64A 5CFNA 2VHZA 2QRVB 3ND9A 4JDPA 3S7ZA 2JB9A 1QJ4A 5ALSA 3V33A 4G56A 5K7SA 5IVIA 1JFFB 3N8HA 3BB3A 1ZBQA 1SVIA 2WWVD 1FBNA 1RLOA 3B1JA 3ZIDA 4E13A 3GD5A 3TEMA 4XXHA 4RS3A 3OLWA 1L4KA 1C4OA 1U02A 3NV9A 4ZXPA 3VM6A 4MAAA 4DR1B 2R00A 3ASUA 3LFTA 1VBFA 3OZCA 1XQ6A 3O8DA 1TTHA 1S2OA 3AI1A 4IDHA 4RIIA 4DUGD 1W19A 3ZBTA 2BUCA 4OAQA 1DNPA 4O4LB 4RA6B 3U49A 4HGRA 5J5CA 2YY6A 4RPGA 1K27A 1YJXA 3F98A 1WUHS 4L5IA 5LLSA 2IYRA 4EO4A 1NU6A 2CVOA 1XRNA 4C9BA 1SXPA 1ZH8A 4INJA 5JHHB 1XKQA 3CLHA 4UW9A 3TL2A 3TTUA 3ZLUA 2IBSA 4H7DA 4L2IA 4AD8A 3V4PB 2IP2A 4WWHA 4ZODA 1VHLA 3U7QB 5BP7A 5KJ6A 4F06A 1TMGE 2X0JA 4PSCA 2DZDA 2JCBA 3OC0A 2GR9A 5LDHA 2XEXA 2WAOA 3HYCA 3UAYA 4BGVA 1GFIA 3IQGX 4KE9A 5FL7A 2CHVA 4JVSB 3Q11A 3K3PA 4YCMA 3E53A 4RXUA 3TAUA 4FPXA 1N2HA 1QTRA 1SCNE 1ULZA 1ZN9A 4MP8A 3GGPA 4BHTA 3WL7A 3VC1A 2A9OA 3A7EA 1XTSA 1S96A 2G08A 2G63A 2J3HA 3MJDA 4NJOA 1PCXA 4HMOA 7REQB 3NBXX 3KR1A 1FSSA 3OETA 3PPVA 4RTQA 3HR4A 4O2BF 2QPLA 5JADA 3EOBI 1IHXA 1VE5A 5CFLA 3W77A 3QUSA 4KC0A 1Z3CA 5EZ5A 3P9PA 4RKEA 2RGEA 1T9HA 3GLFA 5HKKD 5KOHB 3AJAA 1BDIA 5FKJA 3VZDA 1FYWA 3ZZUA 5C8YB 4M9UA 1FYEA 3EY9A 1KKUA 3PUXA 5T4FA 1JXMA 2MU1A 4R83A 2REQA 1NQAO 1XVLA 4HDMA 1IPEA 1W6UA 2P8JA 1J25A 1NBIA 4H3VA 2VAMA 3R3ZA 4MQFA 3VX3A 2JCVA 1GTMA 1UMDA 3LYLA 2X1HA 4QJ3A 3WIEA 3ESCA 3HKCB 3TD6A 3RAGA 2ZRPA 4FNOA 4DCNA 4RMIA 3RT9A 3RRJA 4DBVO 4J29A 1MB9A 2H48A 3PITA 4PQGA 1WMFA 2Q5OA 3RUIA 1Z6AA 1M9NA 5ALOA 3TLGA 3OCZA 4KQHA 4ERNA 1AKMA 4INAA 3HKDB 3P5BA 4D6PA 2OZPA 1NW6A 3BWDD 3LKZA 3SQOA 5ITWA 2RCYA 1M0EA 4OXIA 3REQB 1N1DA 1U8FO 1F2VA 2IC5A 4EW3A 1ISSA 4WNAA 5BUQA 1K98A 5JY6A 1JDNA 2VDNB 1KZ9A 3HCCA 4MO9A 4TV9A 3WLAA 1ODSA 4XVCA 2NLOA 2C9DA 3GXOA 5BNTA 3R9XA 4NFLA 1YUBA 4F9EA 3A3PA 3GR6A 2RAVA 1PVDA 4FILA 1OX5A 4KRGA 2VNAA 1N6RA 2I55A 5JCJA 4A27A 4ZJPA 3QF7A 2ZATA 3NRCA 3PWTA 3D8BA 3QMVA 4D79A 2FW8A 1ADGA 3DHVA 4NJEB 1OW3B 3OZEA 4XIYA 3E1GA 4H3KB 3RIXA 4M88A 5DSTA 2VNJA 2G25A 2ZBFA 1FP1D 3U4GA 4C4AA 4QA9A 1NP6A 2H11A 3VH3A 2IX9A 2HSJA 2AHRA 2XA2A 3K2BA 3LDFA 5G0VA 1HDXA 4M9RA 4M1KA 4U9IS 4AYWA 5KMGB 1A8IA 3MGCA 2Y9PB 4DUYB 1BW9A 3MAGA 1ZA1A 4DLTA 2PBRA 3O4JA 1YC2A 1XPJA 3VOAA 5KDOA 4NBTA 1M83A 1LNSA 3IP8A 3MJVA 2G9VA 2EARA 1KI6B 2O4UX 5AVQA 3WWOA 3T5PA 4HDNA 5DNYB 5CCXA 3DVSX 3D1VA 3QJGA 5FF9A 3DDUA 4MAMA 3COVA 4E5DA 1E1CA 5LWHA 2V54A 1UBGA 4ND7A 2CE2X 1JBKA 2OCGA 1D2EA 2EFEB 4P7KA 4EF5A 5LJLA 2O14A 4F4FA 2GEKA 1VBMA 2ET6A 2C20A 2H4YA 3NZEA 2BUBA 2LNDA 3K71B 3PGJA 2BP7B 1OAKA 4YP0A 1XZFA 1E92A 1Y3HA 1SUAA 4XH9B 2ZRNA 2F4NA 5LQJA 2PPVA 5TQ0A 3JQ6A 3RC8A 2WQ6A 3R7SA 3A6JA 4GGPA 2IUYA 4C76A 3SX0A 4ZEWA 3H1GA 5MFZA 4KYUA 5IMBA 5C1OA 3QU9A 5COAA 1KJWA 3L0ZA 1K3UB 3RFVA 1QRTA 4B4OA 1AO3A 1DC6A 1E62A 3GRPA 1ZGAA 1FZTA 3QOYA 5FLEX 1QHNA 2G1JA 3HYTA 5BURA 1G38A 3FCEA 2WMYA 2ZRKA 4CIWA 1SC9A 5JAMA 3MF4A 1PD1A 1SOUA 3QVTA 3G7UA 4RQAA 9LDBA 1RU3A 2CNNA 1CNEA 2VZLA 3AR7A 2X7JA 4BJ1A 1RQPA 1DX6A 1SU8A 4K28A 4MWCA 4ZQBA 4EJ2A 2OSVA 2O2EA 3KSMA 1C7IA 1PL8A 3SJUA 4LZNA 4YLEA 1N92A 1JV2B 1OZGA 2OHXA 1R4NB 3UPUA 1RXWA 3U62A 2O0MA 3E9DA 2PV0A 1VCNA 2ZBPA 3KB6A 1YOVB 1FBTA 1AZTA 2BVNA 2QRLA 1R6BX 1ESMA 3N53A 4G89A 4K3VA 1DLJA 4PVCA 4W63A 1P0CA 5FOQA 4B74A 3T7JA 2EW8A 3QA9A 4KO2S 1SU7A 1J9EA 1V8FA 4DBLC 4F72A 4BC0A 4DCPA 1MTOA 1LLDA 2XDQA 2YWCA 1JHVA 4V39A 1AZSC 2P40A 2DYKA 4EGSA 1FRVA 4F6RB 1V43A 2QZ9A 1T4MA 5TGZA 2BC9A 4FKBA 4F5WA 1TPYA 3RRXA 3PC3A 1BVHA 4XDYA 2J7PD 4CYMA 3QYJA 4IIYA 1YMQA 3SS8A 2PKCA 4PYQA 3IPCA 2V8OA 1RQLA 3FPHA 3V3TA 1N77A 2XMDA 1TYDE 1NJSA 3D5TA 2HWKA 2PUGA 2MSWA 3H8SA 1A97A 2QU7A 3C48A 4EECA 2CV0A 4Q05A 3OP1A 3WLNA 4BQRA 4TMFA 1OLUA 4TTJA 1K7SN 2H4ZA 5H8WA 1Z6QA 2MDTA 3ENVA 4ARVA 4LDRA 4X7PA 5I9BA 4WFIA 4E70A 1BZYA 4BEBA 4P0QB 1QLHA 4M8KA 2AZMA 2I2XB 5IYZB 4ZTZB 4ZVMA 2FG7C 3OOEA 2M2IA 4PCUA 2KMLA 3DVQX 3VSCA 4AG6A 1K5DA 1NVWQ 1R0WA 2HJWA 3GGOA 4R01A 4POOA 4YMVA 3TGPA 1RWQA 3C7TA 4DDMA 1WDTA 4HRXA 1UPTA 4YT4A 1GR1A 3E35A 3EZNA 1HLPA 3QYPA 1F8GA 3TJRA 5LP6B 4GPZA 2QD4A 2GKSA 2JLSA 3OZBA 2W70A 3K8OE 1NNLA 4TN1A 5LQKA 1HEUA 4ER5A 2Q5IA 3D64A 1ZI8A 2OOKA 1OOEA 1XV5A 3FCYA 3FKJA 3C7CB 1GFZA 2QD1A 4GRAA 4QPNA 4DILA 2WJ4A 1AMNA 1SA0B 3T3HA 5ECGC 1W94A 4U2DA 2CHGA 1Q1NA 1GY8A 1V11A 4N5HX 3V1KA 2B8JA 5F73A 3TMAA 2CYCA 3V1TC 4BZWA 4XJTA 1V45E 2V4UA 3PFBA 2DKFA 3W2TA 3IJ5A 2O54A 3ESYA 3NGMA 1HT1E 4JP2A 2G5CA 1ZN8A 2GBIA 1H2BA 4EMTA 5BR8B 4BLUA 4HNVA 1QCCA 5B4TA 4D92A 3EJWA 3ZHSA 1KSHA 3HPRA 2ISQA 2IBMA 5FBLB 5IJ0B 4DCOA 1BKDR 1L4YA 4H6WA 1NOJA 3VNVA 2YFHA 1YJ8A 1X9GA 3DTVB 4N5LA 4WK4B 2XXAA 3CNOA 2RHHA 3X2FA 1T26A 4RTRA 1RIIA 4Q7JB 2TMKA 1R9NA 1SFRA 3C45A 3K5IA 4P7JA 4AZTA 5AD1A 1GSIA 4P5EA 4Z4HA 5C1PA 2V7VA 4FD3A 1V95A 1RAIA 1N5RA 2QLTA 4O2AF 3ZLBA 2QJOA 2BKAA 2NTVA 3A2NA 3CIOA 3R7WA 2VK2A 3W3AA 3GBSA 1ZM4A 4R31A 4W4TA 2G76A 5CLLA 3FFAA 4ZEOA 3RARA 3X0DA 3IKTA 3KB8A 3MK31 4PBTA 3V1NA 3CNHA 3I2YX 1YCDA 2GPTA 1YS9A 2HQSA 2W22A 1WW2A 1XZBA 3GRRA 4LSGA 1CS0A 1WXWA 3PNBA 1XRSB 2WIGA 5K6AC 2ERXA 3L0BA 1KFEB 2JASA 5IZ4A 3ETGA 4M7PA 3QTTA 1DS6A 5E9QA 4M0EA 4P2GA 2IUFA 4OGGA 3TG8A 2OWDA 1WXQA 1AB5A 2FPIA 2QRQA 3B9QA 3KKKA 3OQVA 4JC0A 3VUFA 4ZFNA 4BPBA 3FSJX 2GF9A 2O8EB 1T1JA 2PVCA 3TVTA 1U8UA 3SIWA 3TR5A 3BGSA 4KN6A 4AL4A 2E55A 3KYJB 4C5AA 2WNHA 4EO9A 4ZHQF 2A78A 3BSYA 2D8MA 4ZAWA 4MJXA 3ROMA 3QVJA 6ABPA 2ZRAA 1EGQA 5FA8A 2FPUA 3EXFA 1B0PA 1C3XA 1G55A 5HSGA 4OG2A 2TMDA 1NUPA 3Q72A 1JQKA 1Z4QA 4M1EA 3S7TA 5IUJC 4PZYA 2Y0PA 3CVOA 2BD0A 3G2KA 3LGXA 4MWSA 5KU7A 3MD9A 2WPDA 2YYYA 4UZSA 1AHNA 4UM7A 5CPFA 4G63A 3JY6A 1MAAA 3GJRA 2P9CA 4ZALA 4NSNA 3TJZA 5EQJB 3DLPX 5FA6A 4R0NA 3TF5A 1PGOA 3DZJA 2J6BA 3GIWA 1IM2A 2OG2A 3WL4A 1MP0A 1DTEA 2NZ2A 4Z1MA 3HY6A 2JDID 2JH9A 3HM2A 3KVRA 4UZFA 4WK6A 3KLMX 3OJLA 4HNAA 1O9BA 4ETIA 5GAJA 5IJZA 1WETA 1VHJA 3H9QA 3TM5A 1ORHA 1EZ4A 1ULTA 1PGQA 3R74A 1Y8QB 3JV7A 3INYA 4UM5A 1E0AA 3JW8A 1XZIA 2PYIA 1KZYC 3CF4A 2I03A 3PC8C 3A9CA 3EZ9A 1FDRA 1F3LA 2G8LA 1XXHE 4MP3A 1HDRA 2P4HX 3KLOA 4NFYA 1IEQA 1FXUA 2JKZA 1AHHA 2FQYA 1GPKA 1EFLA 3K6SA 1RWVA 2EJCA 1SXJA 4KAXA 1ZONA 1HQKA 1VPWA 5J4LA 2KX7A 5C3UA 3BGOS 5FH9A 5C51B 3I23A 1EVKA 1THZA 1U94A 2C8KA 5CT8A 3HN7A 5ALMA 3FOEC 3PUJA 4DLBA 1A96A 4DWOA 1CY2A 2FFAA 3MWFA 3G5UA 3SJZA 1RCUA 3MWJA 4EWLA 4QDZA 3FWPA 4HGPA 4HGOA 3ZE7A 1X92A 3REGA 2XXAB 1B73A 1TQ2A 3W5JA 1NBEA 3CLSD 4IXNA 1A2KC 5HDBB 3A6DA 2HN9A 3FDXA 1K5PA 1YS2X 4REOA 3OU2A 2FW1A 3ZJ4A 1K0FA 1UPCA 3B1VA 3BE6A 3DE6X 5LBUA 2YOFA 5LA6F 3KUDA 1V71A 4MITA 2CZQA 2J07A 1RKQA 2M9MA 4B3RB 3QA3E 2DAPA 1ULUA 1P3DA 4U2CA 4YDHB 1PFWA 2AUMA 2HU7A 2NXNA 4HGZA 4IHJA 5DKFA 3ZS9A 1NF9A 4BMOB 3B12A 3KZVA 3VPGA 3ZYCA 2D1YA 4N4AA 1FNBA 3FYUA 1T8SA 4I4IA 2XX3A 4PIVA 1N7HA 1DARA 4EG7A 5ED4A 5I5EA 4ENQA 5HZMA 4PGAA 2G4LA 3TRJA 5CVVA 1V8OA 1FE8A 3AVYA 1IJKA 1BXGB 3MUOA 3A9WA 3CVVA 4BO8A 3N2ZB 4B81A 5IARA 4F56A 2DWCA 4ZT7A 3VHXA 2NVBA 2DWQA 3MINB 3GA7A 4RIFA 4DCVA 4P22A 4AAYA 4JP1A 3L4BC 1ESZA 2HU5A 4LGMA 1D0VA 2DH5A 2QX8A 4LXUA 1YCGA 1PAUA 3D6TB 2P4SA 3JZFA 3P45A 3LXUX 3PGKA 4MGHA 4DDUA 4G84A 1NN3A 2ZIGA 3QX8A 4XRRA 2GWHA 5FULA 3E84A 2V9PA 2YFYA 4MW5A 5AK5A 1R0BA 3X1DA 2HSEA 4FUQA 4ITUA 4E51A 5H82A 1QGUB 3GNTA 2IHKA 3L01A 4M7WA 1ZVQA 4G0XA 1PV4A 2YNMC 3PR1A 1KDVA 1M3SA 2NAFA 3SQNA 3GLIA 5LFAA 4BN5A 3PFCA 1UBMS 4FQ7A 1PDWA 1QIFA 2IHBA 3CEMA 5AW3A 2NN3C 2X77A 3VNAA 1XELA 1D3AA 3M7IA 5JAHA 4U7JA 2Q4OA 2X2PA 3GVCA 3L8HA 3RJTA 3RIYA 2X0EA 4B4DA 4YMHA 4FHEA 4BQOA 3M1AA 2PD4A 3L3BA 2ZYUX 2GCOA 4LHSA 3VNBA 2E85A 4Y2HA 3V5NA 2BZGA 4W5JA 2ZWAA 5I8PA 1WSAA 4BO3A 2JGNA 1H1LA 1POXA 1IDOA 1NZDA 2CDBA 1S89A 4GI1A 1GLVA 1J8FA 1HE5A 2D62A 3A27A 3RKUA 4CM3A 3EMKA 3NAZA 1RLTA 2EAUA 4DLZA 5GOTA 2NSHA 3IIMA 2BTOA 2JAQA 4R3UC 1F2UB 1USIA 1N0IA 4UU8A 2HDOA 3RVNA 3HDVA 3SOPA 5AOCA 4N03A 3WBBA 1V9SA 2DLDA 5IK2A 3KDAA 3JQGB 1XPUA 2BN4A 1LB1B 4FZ5A 4H1TA 3W5CA 4KE8A 3WHIA 1P1FA 3NDRA 1I4WA 3ZWAA 3I01M 4JIMA 1FVHA 2N1MA 2WHEA 1C8BA 2HZ7A 3DKVA 1G16A 3ORYA 3WSTA 4C04A 1N36B 2B4TO 2ZSUA 1P5RA 3ZHTA 4RJTA 3I1YA 4J0EA 3CUUA 4KYTA 4CV2A 1NXOA 2X23A 3MBIA 3A9TA 1PNOA 4U9UA 1H1DA 1XJCA 2WWWA 2AFHE 3SAJA 4DLRA 2K7ZA 5FBQB 1XZMA 1ZNWA 4M37A 3RUPA 3OQOA 4WEOA 2AN4A 1CULC 3DZ8A 4UHJA 1J5EB 3Q7RA 3BSSA 3PNQA 5FL3A 4F84A 1T91A 1A9RA 1UFOA 5CJPA 3RUEA 5KTTA 1CR0A 1SVLA 5CXQA 4HTFB 2DWOA 1BXRA 1JPJA 1YK1A 4HQRA 5JAUA 1UDXA 3GAMA 3DG9A 1NC3A 1QTIA 3OPXA 1ISRA 2FF5A 4CM1A 3PQCA 3RS7A 3PENA 5TX7A 1DKRA 3VHRA 4NCKA 3VR3A 1HZZC 1CHNA 1QB8A 3LUGA 3RK1A 4QD3A 3L4SO 4DIDA 2DSNA 2E3JA 5J58A 1RRCA 4O4JF 1NYQA 2BGKA 4YXWA 3LBAA 5HJ5A 2J7KA 4X6XA 3TQIA 3ZJ5A 4B3TB 2FP4B 3DTNA 5KYXA 4OH7A 2GBCA 3UJCA 2L69A 3AG5A 1JHOA 3NT2A 2CVFA 2W2PA 3HB7A 1QK3A 5GONF 5JH7A 5LKAA 3Q7SA 1BRTA 3B60A 2WU8A 4A6XA 3FH0A 2WYIA 2D74A 4DMFA 2A5LA 3BEOA 4KL8S 3G0IA 2RGCA 4K6CA 4DYHA 4LF9B 3WIBA 4HQFA 3F46A 1Z28A 1YDWA 3K05A 1Y8RB 2UVDA 5AOAA 2M6RA 5FNVA 5TE9A 3CVYA 1X6VA 4EGJA 1E69A 4HVAA 4M49A 2WWTA 2G8NA 4Y18A 1L1EA 3TI9A 3LPAA 2BKXA 2OHIA 2HSDA 3ETNA 2G0TA 2ATEA 5HHTA 1UDBA 2WMNB 3BJIC 1AURA 3PYXA 1PG0A 1TMOA 2PZAA 4IEFB 3L0YA 4OXYA 1LK5A 5F1PA 1L5KA 1MF7A 2A88A 4B3SB 1E2MA 3CH7A 4AJNA 1XSEA 1NV8A 1J9ZA 3E8MA 3P9KA 3PGA1 2EHJA 4KPGA 1OJLA 1LY1A 1NMXA 3KT6A 3CUWA 3L8DA 4ZI5A 3BULA 4CV0A 5LQAA 3U37A 2J41A 3PFGA 1PD0A 4P3NA 3IOYA 1EX9A 1FTSA 1U2DC 2WG1A 2ZIXB 4NRDA 3DOCA 3IOMA 3R0JA 1IQ0A 4XB1A 1JZSA 5AKYA 3A2KA 1NOIA 5SZJA 3RVBA 2C9CA 3T9DA 1MR3F 3TOSA 1XUOA 3PFKA 2FMXA 1V7ZA 2GXAA 3Q10A 4YCCA 5GM2A 4IGEA 3AIKA 3SS7X 4DQUA 1W0KA 2OMEA 1VM6A 5IMSA 4CQLB 1TMYA 3FVVA 1G3MA 3DKRA 3HCNA 1F6WA 3R6WA 2PMWB 4HLUC 5E0OA 4JYPA 3QSYA 4YUYA 1TF2A 4I08A 4IBOA 4IIGA 1NRXA 3DAYA 3FLAA 3QPUA 2LIPA 3FUWA 1NTOA 1JHMA 1NJ5A 2SHKA 2J3MA 2Z8YA 2DFPA 2NPIA 2CLFB 3DMTA 4P4TA 5G0UA 2WVHA 4ENPA 2YQ4A 5HOEA 1NIPA 4KH1A 1FUKA 4KFSA 1EUCA 2RHRA 2VATA 5ALPA 3UOWA 1VE9A 4PSAA 2PUFA 1NP3A 1TNDA 4LRQA 4AN0A 2DP4E 4W8HA 5K6TA 1TLTA 4JWKA 1BYUA 3C3CA 1XROA 1KDZA 1I6MA 2GNOA 2CVHA 2XNJA 3GCZA 3OHSX 1HNZB 1GZVA 2NU7A 4QOHA 4UJ3A 4QAQA 1QE3A 1GSHA 1C3LA 1XTKA 3T41A 3MRTA 2OBFA 2IYAA 2Q0SA 4IUDS 1WULS 4PYLA 3FYCA 3L8MA 4YRZA 1Z26A 3UJAA 4B5KA 2RFLA 1EQAA 2VI5A 1BEUB 3K6RA 2Q5LA 2HCFA 2UZAA 2QX7A 3O8OB 4G0ZA 4OFZA 1QOPB 5SYNA 5F5XA 2DUMA 3RWMB 3NHZA 4Q4LA 2RGRA 2JIMA 5KWSA 1BJKA 4NEQA 3ZX5A 1BDBA 1GXSB 4Y6GB 4MGZR 1QG0A 1O6BA 2XIQA 2ZR8A 4JROA 1UOEA 5C31A 4R68A 4JA0A 3VVBA 1H3EA 1R8JA 2IIQA 2A84A 4LDPA 3SEAA 4ZVRA 3R8CA 2RB4A 3U3RA 1QIHA 1H0KA 1M1XB 3HL4A 4LJ9A 5K3FB 5ESXA 3STXA 5EA2A 1FU8A 2JJMA 1DBWA 3OQMA 3KLPX 3DAGA 3EQ2A 1E98A 1FNMA 3FXAA 1ZLYA 4YP9A 2VUTA 5FPSA 3KOYA 4QXPA 5AW7A 3KV3O 1PEDA 2PZMA 3AVPA 1F7UA 2GBLA 3L6UA 5CD9A 4MLPA 6REQB 1SKMA 1DKNA 3HCEA 4BMSA 4Q34A 4IS3A 3EN0A 2AX3A 3PF8A 2XCRB 4KXVA 4N47A 2DECA 4UHFA 2VYFA 3IVAA 4LCBA 3TQTA 1AGPA 5HPYB 2A58A 2J6IA 2P6NA 1Q12A 3QBJA 3LF2A 4NIMA 1Y6RA 5JD4A 2NXJA 4OHUA 1QH0A 2MWMA 5L51A 1OH5A 3AUTA 5KNLA 2R4UA 1KETA 1XXLA 4C7BA 4N0DA 1VYHA 3VRHA 4XJVA 4DGQA 4RWEA 5D51S 1IMOA 2FFQA 1VBKA 1NNI1 1FU4A 2I76A 5H3LA 3H6HA 1X87A 3BHMA 3HLYA 1F12A 1WQ4A 2H51A 3FWHA 1G291 4LTNA 3RHTA 3V8PA 5LZ5A 4C14A 2QLNA 3WB9A 3MJEA 1P91A 1W5TA 3SR0A 3ZWOA 4L9RA 3CB2A 5FWXA 2GLUA 1L7PA 4DJFC 2HX1A 2CJWA 1XALA 2IPMA 2VTVA 5AYVA 4CQMB 3BQ9A 3GJQA 3IUSA 3KKEA 4DA0A 4TV8F 2IY7A 5JZ9A 2IH4A 2GDZA 4ZRNA 3LUJA 1L6RA 2C8JA 4H59A 3CU5A 4P4SB 3GLFE 1W36C 4ARIA 2BCEA 4KQIA 5EHZA 4BFSA 1CQXA 4PQYA 3OQHA 3OX1A 4B43A 5BOVA 1W5BA 2EOAA 4RJIA 1W9MA 4RV4A 1NYRA 4X24A 5T5QA 1KKMA 1NVBA 1T3GA 1E3EA 3H8VA 3TQSA 2AYXA 2YIVX 5K0NA 3N2KA 3ZQKA 4CR7A 1GUDA 3VR4H 2R1VB 4G4SO 5ITZA 1EFHA 3O90A 4GPBA 2FQ1A 5I7HA 5REQA 4B3CA 2FK8A 3JAWB 1QUFA 1T8TA 1MAWA 1P8JA 3DBLA 4EHNA 2W90A 4EB6A 5DSXA 3TTYA 4ED9A 1S6YA 2PX0A 3KKPA 4MJ3A 1K88A 4YVFA 1D2CA 3AKEA 2HXSA 2C9BA 3IBTA 1ZJYA 6Q21A 4IXDA 2EKBA 4L5CA 3W8RA 4EUHA 1AHIA 1XIVA 2XMQA 3FA2A 4LQDA 3H99A 3EARA 3NIWA 3K9NA 2FW7A 4UHHA 5K3BA 1U2GC 2JCSA 1GAQA 4UTRA 2Y68A 4DSNA 1M2JA 1Z0IA 1KF0A 3HDJA 1TPZA 2JLYA 3DDWA 3ELWA 4PAGA 1ECBA 2PR2A 3NBFA 3UJBA 5B36A 5KSYA 1Y3IA 2VA9A 2PRJA 4H3HB 4EGCB 4R40A 1EYZA 4TXLA 1QDLB 2H85A 1GUZA 3OFSA 4BB9A 4FOPA 4L0QA 2IS2A 3KQPA 3MELA 4TUYB 2CLIB 4WH0A 2VT7A 4OQYA 1UIRA 5E9AA 4AKEA 4IWNA 5JJ5A 3ZGZA 1RRPA 5EWLA 8ABPA 3F8TA 5BMVF 4U1RA 2R4TA 3G17A 2AC4A 4GQIA 1MO3A 5IX8A 4FWIB 2Y0DA 2F1HA 4NCJA 5HQJA 4FNGA 4DZTA 4TL8A 1X3LA 1J24A 3BERA 2HRZA 4B17A 1BHO1 5DGHA 3UC9A 3LY8A 1C80A 2GHQA 1D4ZA 3IMKA 2INGX 4LJ8A 1MEEA 7MDHA 3IMCA 1LU9A 4F2PA 2OBBA 3H2BA 1GM5A 4M1SA 3W8FA 2X1MA 3ICCA 1OYYA 1RMTA 2O6LA 4HAXA 2L82A 2PXXA 1C9EA 2VP5A 2PYDA 2VPIA 1ANKA 1RWPA 3H1AA 5F35A 4DA7A 4RS4A 1FRZA 1Y4AE 3A4TA 4DA6A 1XWIA 4AJKA 4NCBA 4U00A 2FRDA 2GYYA 2JLAA 2WJZB 4OJKA 4Q9HA 2GF0A 3LWBA 3SDZA 1QP8A 3TPFA 1PZXA 3EX7C 3G79A 1IATA 1VMDA 2M6SA 5DP1A 3TYXA 1VI5A 4YONB 4NQRA 1A72A 1ZD9A 4B6PA 1ONNA 1E2FA 4BYGA 2WUGA 4KW7A 4OUDB 1GRRA 1JPVA 1BA2A 1TM5E 1DMRA 2H9IA 2XTJA 2ZKLA 3TDNA 1V8PA 2EW1A 1UR5A 2VAWA 3DYIA 3DUFA 2FWIA 4YCBA 5K0JA 1RS0A 4C3VA 4CMHA 1OI7A 2G5GX 3PIDA 4UXIA 3LRTA 1FC0A 2HC9A 3B6IA 4H16A 4Y1GA 3SJAA 1TQHA 3GF4A 3DZBA 3IVCA 5ALXA 1QP4A 3FFWA 4XB2A 2XRFA 3M6VA 2ZJZA 4JLOA 2G77B 4NMWA 4P3OA 1WKVA 3GPCA 1AQNA 4WX2B 1T3HA 2GCPA 2IYYA 1L4EA 5EIBC 1EFRD 5K99A 2BEJA 1DRUA 2OZEA 3UWMA 1GZDA 1UC8A 1F20A 1IXSB 3KTAA 4Q1VA 5C1BA 5AOBA 2QMHA 3CJTA 3RIHA 4BYMA 1NURA 1EHYA 1VL2A 1YB1A 2GJ8A 3ETHA 1D6SA 3JQBA 3OE1A 4XB6B 1ZIXA 3KQYA 5I7AA 4YALA 2VJOA 3MQFA 3ZV4A 1NQXA 3AKYA 4ZGBA 1SMKA 3ZY2A 1P6QA 1PQPA 1WSBA 2WFMA 1M1UA 4FYVA 1XCLA 2I6FA 3I52A 4BQFA 4EW1A 3T0GA 3H5RA 4QUBA 2YXNA 3EXG2 2FR8A 3NIGB 1U5BA 1TA9A 1UJNA 4OXRA 4C4PA 4DQ0A 3DV2A 2PAAA 2ZRLA 4RESA 5H81A 3AOEA 4QARA 4BWFB 2YJTD 2BM1A 2DPMA 1SBHA 1ECGA 4DWJA 2I2FA 2AW5A 3I2HA 3UMSA 4BFUA 1MH9A 4NC9A 3C3MA 2J5RA 1UBOS 1RQGA 3FMGA 1JEYA 2OPHA 3FHJA 2OHOA 2R5NA 1BQ3A 2D2FA 2BTEA 2F9FA 3EGDA 5BWBA 3KALA 2JFFA 4PC7A 1D0SA 1M73E 2PBZA 2FJUA 3COSA 4J0QA 4BFCA 2P4UA 3OIVA 3K1TA 1QBKC 2P6UA 1R16A 1X0XA 2OZKA 4MV1A 1GRCA 2CB9A 1BO6A 3GT3A 3RIEA 4D6XA 3H18A 1UMKA 3ZNOA 2RGUA 2FPXA 2XNKA 3EIFA 4IJWA 4JSTA 3SBEA 3GEBA 2PAFA 2Y1OA 3SZLA 2ZSHA 5A9SA 5LYJF 2HJHA 2ZTLA 1JW9B 3PG5A 4FW9A 4HTAA 3OWXA 4LBZA 5ESRA 5I01A 2PT9A 5CUQA 3ZCRA 1I10A 1RM0A 4K05A 2XE6A 5LXTF 1HWYA 2X86A 2OORC 4CN8A 5EZYF 2QYTA 4L9WA 4DF3A 1P73A 4N8DA 5CDTA 6GPBA 2NNLD 2VH5R 4AU1A 4IDPA 1G2QA 5EWMA 1JSZA 4EBFA 5ITVA 3GT4A 4LFAB 1AGNA 3AM5A 4HNQA 2NUAA 3UJHA 4UTPA 5A2QA 1T10A 2PGAA 3SHTA 4CKEB 2VYQA 2WIFA 3ERCA 2VQSA 1T4CA 3HB0A 1PL6A 4HDMB 4MQFB 4LZJA 4I4TB 3RU2A 2K4MA 2QLJA 3QU5A 3U31A 3B51X 1F0KA 1KHTA 3DEZA 4GPTA 4Y2JA 4XLLA 1KYVA 3DV0A 2VEOA 3CW8X 4JCOA 1TM4E 3D4IA 4J3NA 3THWA 4XARA 3R76A 3HK2A 5KSZA 4B45A 1ODCA 5CB8A 5GJCA 4W5RA 2C3YA 4REQB 2ZUCA 3N76A 1JAYA 4H7HA 4YCJA 4DADA 5LM3A 2DQ4A 4CM9A 4TYNA 5B6JA 1VHTA 1LS6A 2D1TA 3GLVA 5CRIA 3TZ6A 1OX6A 2ZCVA 1LZKA 3AW9A 3SS9X 1BHSA 2HPAA 2VP2A 2DUNA 3WJ1A 4CKBA 1T5LA 3CNLA 5JU6A 3LJKA 4OHRA 4LF4B 3FPCA 4RF4A 5C34B 5A2GA 3ETEA 2XCOA 2VXCA 4NG4A 2M98A 1KI4A 2ZSFA 3UH0A 2AD1A 1TI7A 3PEEA 4BJ5A 5JQGA 3SSOA 2HXYA 1Z4NA 5TRTA 3A28A 3BMOB 1P31A 4HMPA 4C7XA 2VNKA 1FS6A 1P72A 1Q1QA 3OVMA 4IV0A 5FTWA 5AXDA 1PTJC 3A6LA 4I6JA 1UFKA 4YJHA 3Q9LA 5CX4A 4U7FA 5H83A 2QTFA 3DC7A 4QBHA 1PYOA 3WQRA 2H4FA 4GLOA 5EIXA 1LWOA 2DBYA 3AEYA 4QIHA 5K3DA 4ASUA 1F9EA 1U6JA 4BKQA 2XUKA 1V26A 1AGYA 3I0NA 2LDXA 2RHTA 4RTMA 2IQIA 3OKAA 1Q15A 1U0EA 1W0CA 1KXJA 2H6EA 2HPHA 2ID8A 3I83A 3KZNA 4FBGA 3S70A 4MUMA 1L7VC 1GRVA 4HDSB 4F97A 4YCLA 2AHOA 1S3GA 2IDZA 3RTGA 3TVYA 3WR5A 4AYTA 5F5LA 3P4XA 4QTYA 2CZGA 4J9VA 3E7PA 5B1IA 1XGKA 1CQIA 1WNTA 4HDNB 3U7FB 1U8ZA 3CGGA 1I5OA 5AUNB 1P77A 4J0HA 3QLUA 2H2GA 3MWDA 2IY8A 4MDYA 2YFKA 5ALQA 2XV1A 3CS3A 2W4IA 5BYAA 2QNBA 1E3DA 3ZWWA 4IWYA 1Z4LA 4N8SA 1KQNA 3QKUA 1NW8A 3I42A 4RVNA 5BVHA 4L5BA 4RLSA 2PR7A 1F8YA 4UM9D 1WMSA 1ZEMA 1WJGA 3A31A 1Z73A 4M0DA 3SSNA 2PK3A 4MEBA 4ICIA 3WLHA 2NWQA 3NW9A 3TSWA 1JS1X 3G8DA 5K03A 1JWBB 3WWDA 2AOTA 4CM8A 3L02A 3U4HA 3I32A 2D1QA 2CMKA 5CNKA 1J8DA 5EKSA 3IUQA 1W76A 3WGYA 3GLSA 3Q6NA 1EVEA 2EP5A 1N0VC 3DSRA 3D8HA 4I7EA 4J91A 4D80A 1Q0LA 4ERXA 2VOEA 1ADCA 3K73O 4LYEA 3WS7A 4D56A 2ZE6A 1D4AA 4ZCRA 3PEYA 3LUKA 1FPQA 1QORA 2VOJA 4FDLA 3ZD8A 1XLTC 2V5VA 1MTZA 1GPNA 3ACDA 2JFXA 4RGYA 2Q6KA 3PFNA 3ANLA 1U0OC 4ZD6A 5DNUA 3EY4A 4LV5B 4O4HF 1OA1A 1AQJA 4RH3A 4TS9A 2X0FA 2AT1A 1IL0A 4KQ2A 5FHQA 1IY0A 4CL3A 4BQQA 4TLBA 1J23A 1GO2A 1OXUA 3RUAA 5FWNA 4KK4A 5HKBA 4ZVNA 4WN3A 2WSYB 2FU5C 2E4YA 3HVJA 1HG0A 1JE0A 2EFJA 1II8A 1MH1A 1ISHA 2P30A 4DBZA 5LZ4A 3RSSA 1CPYA 3UEOA 5J2UF 2AXQA 3H05A 3UY4A 2RKWA 1YA6A 1TAQA 3WAGA 3TBHA 5FFFA 2R4QA 3H3XA 5EXTA 2W37A 2FN7A 2QVLA 1ODIA 3IP5A 5A3VA 1EWVA 3ORHA 1AQLA 4ZHSA 1BMDA 1AHPA 4WXYB 1ODKA 1N0HA 1N2SA 2P62A 4AUEA 4KPFC 4NCAA 3BCRA 2HSZA 3CNEA 4FDAA 1THMA 5BSRA 4M6WA 1NXWA 1REQB 1X80A 2HFJA 2W6MA 3SSAA 5EJ7A 3EXHC 3BK1A 4Y0AA 1OZAA 3C6QA 3PRYA 3AJ9A 2C2HA 4MW2A 5HJ2A 3FHOA 1SKAA 4Q7KA 4J16C 1AKEA 4N3BA 4OBXA 1YR8A 3BRQA 2LBPA 3ODGA 1FX1A 1WW3A 2WD7B 1B74A 4YCNA 5CK5A 4YCAA 3HM9A 1E9AA 2FFBA 3KKNA 4C2UA 2JAPA 2R6R1 5F64A 2QX4A 4PRZA 3ORSA 3TRKA 1FNNA 4JITA 4UTOA 3U9LA 3MJSA 1YQWA 1ZXBA 3P2KA 4GXTA 3ZKWA 4EVQA 3AONB 2PKXA 1I5EA 3WB1A 4DSUA 4WJZA 3I1JA 4YDQA 1ONPA 3NDPA 2PS0A 3P9RA 1QYXA 4X20B 4M7OA 4LOIA 1XDWA 1CB7A 3O26A 4QRDA 4F4UA 4RTSA 1HKUA 3GLIE 1T9DA 5KCZA 4RHTA 1YDEA 2QF7A 3UUEA 4NICA 2E5WA 1HDYA 1N8TA 3HHEA 3NKLA 3PDHA 4HRYA 4XTRA 2HQBA 1COWD 3MVEA 2I71A 3I4FA 4B3JA 4QJBA 1QE0A 1PT9A 3ONEA 4AJJA 4X85A 2F4VB 2JEYA 1XTTA 4FC7A 4CTKA 4JR0A 5HIJA 4OOEA 2C96A 2R0QC 2RJ3A 3BWYA 1XPOA 1VMEA 4RVFA 1RHMA 2ZIFA 2IF0A 3B48A 1KAGA 3OTIA 1Q0QA 3HGMA 4Y2YA 4BDTA 3O2QB 4KZPA 5BR7A 1YL7A 3JQAD 1EBBA 1LDBA 1UOPA 1Y9DA 2W6ZA 3DAPA 5IBQA 5DBHX 3OKCA 2R9VA 5AKGA 5HJ7A 4LQCA 3V7WA 4YR9A 2JBAA 3OQ1A 1BTOA 4FQ5A 2QLMA 5KNCD 3KL2A 3D6HA 5AK0A 3L7IA 3DMFA 1L5QA 3VZSA 3BE4A 3K96A 2QLFA 4PXSA 4JLWA 1X9HA 4S05A 2YQ5A 4ZOLA 1WSDA 2XRMA 3PS9A 4UNRA 3ADKA 3AF3A 5B3KA 2NP7A 1YRBA 5KVVA 2V0NA 3AUUA 3MQ2A 1CRZA 4HUTA 4BZPA 5LMCA 1E4EA 4HF7A 1VL0A 3IEKA 2D06A 3CTPA 3RF7A 1E8MA 1TUIA 3PFFA 3D8TA 4AWXA 1GGJA 5D00A 1EXVA 3I9KA 2CMGA 2NZ8A 4DKJA 4LVUA 2JH8A 3AFNA 2JW5A 4R6WA 2X6RA 4ZCQA 3ZWVA 5FAKA 1LK7A 1HZJA 2Q1TA 3ES9A 3EH2A 5EVJA 1K92A 4KK3A 5DMXA 1APBA 3GZJA 3RC3A 4LY0A 2QAJA 5ILQA 1OQAA 4DMCA 3DZFA 4EI7A 4WJLA 3F3SA 5IRCD 1D04A 4NOMA 5CLJA 3W6UA 3K1YA 3M6FA 4B6QA 4OGWA 4BV8A 2JVKA 5JT1A 4P3KA 2FPIB 3VPXA 1NPDA 1Z15A 1KC3A 4ID9A 4QAJA 4UREA 4GLJA 2D0DA 1OV6A 1H0SA 4IKOA 5AHOA 1N7IA 3KQKA 1SH7A 4X84A 1PHRA 2VDVE 4LNHA 3GHYA 2O52A 3OQBA 4RK1A 3E4DA 1XP5A 1QYCA 2JIBA 3F3MA 2O1EA 1CZKA 1L8XA 3E7XA 3U7GA 1S02A 1W85A 3GLUA 4US2R 3TNFA 2DTEA 1P39A 3VYSB 4LYJA 1T24A 1CDEA 2FEXA 4OF4A 3MB5A 4KV9A 2FCRA 5A1JA 2XKBA 5AVOA 4AY3A 3WQHA 4BXOA 5F3RA 4KSCA 3SNKA 3MG9A 4HB3A 2IXFA 3OCXA 1PQUA 4LJ6A 4ZREA 5FORA 5JAQA 5CEFA 4FGUA 5EWJA 3RGWS 1DL5A 3KUXA 1VJGA 1DCMA 3N3BC 5DHSA 4I2NA 5DM2A 4M1QA 1M2KA 4DR4B 1MPXA 2JS7A 4B83A 1UDWA 1XZAA 2F1RA 2WRZA 1KSGA 5IBPA 1LDEA 4RWZA 4EG5A 4Z7QB 4G0WA 4QQRA 1NVXQ 1V2GA 2FPSA 3WY9A 1DC7A 1EK0A 1RCFA 4GBGA 1XVVA 1NL3A 1A76A 3LSYA 2IIVA 2Z08A 5F21A 2WJ6A 4DQKA 3BCUA 2QMYA 3E0XA 1M6HA 4ETNA 4EA8A 3R20A 4GMFA 3W2GA 4LXGA 3Q3GE 4MWGA 3LBFA 2MMGA 5JAOA 5MN5A 2B82A 1WF6A 2J3QA 3DKKA 5IFLA 4JJIA 3HR8A 3LA6A 1QFMA 2VWQA 3L1VA 2AIRA 1IYZA 4JU8A 5JFTA 3HVIA 3K8ZA 4WK2B 1SXJB 3QKRB 2REXB 4ILEA 4DDHA 1Q7GA 1DKOA 1WVIA 2A9FA 2YIDA 4S0XA 1W52X 2YS6A 4RNDB 3FOWA 5HILA 1OFHA 2CW5A 1NVVQ 2JRLA 4C89A 3CEPB 1GDTA 3BRWA 2VBIA 2QIOA 4WZBA 1N2IA 5CVUA 1WY7A 3SG0A 2OVBA 2ZSEA 2PT6A 1W44A 3TUZC 3NBYC 1AE1A 3R6GA 3MMNA 4ONEA 4YMSA 4DLNA 2W83A 4DZRA 2D6FA 3P0IA 3GPIA 1JEQA 1YZQA 1RRVA 3HV2A 3QU2A 3HTXA 5KHOC 2O05A 2XGGA 3N2LA 5FI0B 4CI9A 1WMDA 4HLCA 1LSOA 1XA3A 4M1OA 4V2UA 1BN6A 3DW1X 4KFTA 1RJWA 2ZIEA 2GESA 2JI6A 3CV3A 3OD1A 2BEWB 4XEUA 2NSDA 3ONNA 1UDAA 3GJZA 3NBAA 1EVLA 3C41J 1BOOA 2QG6A 2FY8A 1QHIA 2VDJA 3SEQA 4YMWA 4W9RA 1B26A 1PSZA 1M7GA 4R7ZA 5EUBA 1SCUA 4YRNA 5IPFA 1W7AA 3GFPA 5TS3A 3VHXB 3L1IA 3K1ZA 4ZYYA 3OIDA 4FGZA 1MIOA 4A3SA 4RZIA 5BUSA 1YQQA 3WB2A 4NABA 5DN6D 3VR6D 3ZXYA 1SBZA 3R4VA 1MENA 1D6JA 4RY9A 4V24A 5TC4A 4ZARA 3AUAA 4FONA 3TNYA 3AF4A 1CU1A 2X8BA 4Y2VA 1MGPA 2BFMA 2W4MA 3BVPA 1G20E 1GA1A 3PQFA 2WT8A 1JQEA 4IVRA 4MQMA 1X1SA 3UT6A 1RM5A 4BLPA 4OI0A 4ZI7F 3DXFA 4XVHA 3CX7A 1X7XB 1RKUA 4ZMSA 3I62A 4DANA 4Y2TA 5CA1F 4KQ1A 3BWBA 3BHIA 3CZMA 2W6OA 4GICA 1A50B 4E5VA 2XIJA 3PL5A 3GARA 1KDYA 1GYQA 3GJ6A 1SURA 1MD9A 4CQJA 4J76A 4HWRA 1KK1A 4JUBA 4TRNA 4TYPA 5AW6A 2H31A 4CEJB 3QI2A 4FD2A 4AP6A 1KNXA 2H7CA 4XA8A 4WIAA 1QQTA 2R1TA 1DMSA 1BMTA 2MYNA 2NO7A 2VSQA 4D9EA 4RZSA 1KOLA 1S1CA 3QELA 2FG6C 3QOXA 4NZOA 3B2QA 2OMKA 2P2NA 3IIKA 5DFAA 3MWYW 3C1TA 4B75A 3NPAA 1SIBE 3B20A 2DBVO 3AY6A 2PLNA 3TD9A 3C3KA 1AMUA 4FSXA 4R8RA 3VYUB 3ZU6A 4CKCB 3BWCA 3P8ZA 3VO9A 4AMYA 4X61A 4HVLA 4JYZA 1EUYA 4QG7A 3T3IA 4Q7EA 3GT0A 4EVIA 1VL8A 3K0AA 5A62A 1MHTA 4IGFA 2HT1A 5KC8A 1F1BA 3IMGA 3E2IA 4JQZA 5JSKA 2Y77A 2B3TA 1IWOA 1I9GA 2KHZA 2NYRA 2ZWMA 3IVMA 3Q2KA 1LEHA 2C4KA 4UCQA 3GOHA 1Z7EA 2CCGA 3CLRD 4TS4A 3Q8WA 1JLLB 4LBWA 1QQBA 1T3TA 2BHTA 1JLHA 5E7QA 4DZZA 5EJIA 1BS2A 4RE5A 2QEQA 2OO5C 2DFDA 1P7CA 3GL9A 1JB9A 3ROQA 2PKQO 4JVOA 4A2CA 1FXWA 4NG5A 3PNYA 2N47A 1KMIY 3GLHA 4YJ3F 2CNOA 3IAAA 1W4ZA 1VOTA 2JHFA 2O2DA 2VTEA 1LRLA 2XQJA 3FCXA 1ZQ1A 3U3ZA 4DLLA 1EZ1A 4NWIA 2QRZA 3G9XA 3ANYB 4WY5A 4EFDA 1HDZA 2C1ZA 5B4VA 5CA0F 4RKWA 3N0XA 2VRWA 3MCAA 4MV7A 1XNHA 3HNPA 1ZIDA 4PQFA 2XDAA 4CKYA 2RHCA 1NJ2A 1B42A 221PA 2Q1YA 5JSYA 4H0CA 4Y8VA 4H1VA 4HZUA 3K9FC 3QPBA 1BCRA 1C4WA 4ESOA 1YFJA 4BP1A 3ZV7A 2Y1CA 5HXAA 5KYXB 4ZU3A 1AD2A 3X1KA 4GQBA 5G1NA 3C4JA 3MMPA 4MV0A 5FL7D 1EFPA 1QGED 3D6JA 1EE2A 2WIDA 2EEZA 4K9OA 5JH7B 5JYEA 1T9GR 1Z82A 2KBFA 3L40A 3AIMA 4JBHA 4GBED 3GAZA 3D3WA 4N8EA 5L3VA 2R8BA 4QYWA 3C3JA 3IX7A 1L5HA 4DHEA 3D1JA 2FVXA 2GRUA 2TMYA 2XGMA 4MI9A 4ZJZA 5JDCA 5KPJA 4ZVTA 1C9JA 3TQRA 3PNPA 3UWOA 1L7BA 3WIDA 4X63A 3MMXA 1U0BB 1BDMA 2FUG6 2IGBA 2XBUA 3IERA 3PQ8A 4UU7A 1GN9A 3HEMA 1E2KA 2XA1A 3IDOA 1W88A 4UPDA 2O9JA 4KWTA 3G2JA 2GHTA 5PGMA 4B7UA 1AH2A 4GU5A 4DG5A 4RMNA 2XE7A 1NV9A 2R7AA 2VZ8A 4MWEA 3FNEA 4N5NA 1ZJJA 3OZVA 3LL4A 3UF0A 4A2QA 1M2VA 5DVZA 1OC4A 4PNPA 4M8IA 5H0IA 4RQTA 2NIPA 3KZMA 4E11A 1VCOA 1ETUA 1D2MA 2WT9A 2E7ZA 4F3RA 2ZUBA 3VAAA 1DP4A 4YP5A 2R8YA 2QSZA 4KGVA 2J9ZB 3QX7A 2VUHB 2WU3A 4A9AA 4UAGA 3BXGA 3OE5A 5IKEA 4IPTA 5B7GA 2CSXA 4EHLA 2PFSA 2RE8A 5DDIP 1XDSA 3MCUA 5F7ZA 2UUCB 3CRRA 1AB6A 3HZZA 1G9TA 2WAYA 1GCGA 2ZPAA 3KAPA 4K03A 2BBWA 3C39A 4YGYA 3NANA 5L40A 2IW1A 3X43A 5SZHB 1P75A 2QD3A 4DV4B 3DL0A 3IH5A 2D2IA 1HXHA 4RTOA 4CG3A 2LUOA 1U04A 1QPGA 3BIJA 1SVMA 3TFQA 5IAGA 3R2JA 4P53A 4YEDA 2D3WA 4BMNA 1EUCB 3THYB 2IYSA 1U7UA 1V7PC 2Y1GA 2YZGA 3C4VA 3CLTD 3OIFA 1RFGE 4INZA 3SXJA 2WIJA 1QDEA 2K2WA 5CNMA 4MO2A 3BZWA 5JJCA 2IWRA 1V6AA 4EK9A 2Y66A 4XSHA 4BBAA 3NEAA 3BDIA 1NN0A 4NK5A 4M3NA 3RRYA 3TECE 1ZJ6A 5DIZA 3JQ9C 3ZPXA 1NBHA 1DO8A 1NG1A 2BM8A 3P1JA 3VVMA 5HUHA 4DUPA 4MB2A 4M46A 5F9HA 1W1WA 1S9HA 1C4KA 1YU6A 2QYHA 3JZIA 5MFPA 4PS1A 2UXDB 3FKQA 3LOUA 2ZI3A 1Z75A 1VG0B 4P0PB 1L1QA 1QC5A 1WDWB 3WGOA 1WZNA 1C2TA 1K8ZB 3NHBA 4H1HA 2OYRA 1GG8A 5IKOA 3D0RA 4XYLA 4X0EA 3N0RA 3ZNPA 2PMFA 2ASVA 1E3TA 3D0OA 3A10A 3RS9A 1HE3A 3VTFA 4BO6A 3W4KA 3X1XA 3ABZA 4A0QA 4E21A 2H5JA 3KPVA 1D03A 1SCAA 3AP1A 3PRHA 4PFKA 2QOEA 4WFJA 1Z8NA 4BNDA 4CM4A 1II9A 4HDAA 3WWEA 5KNCH 2EGHA 4QVIA 3ZVLA 1BD3A 3J81k 2GPBA 5D5QA 1ATZA 4MW9A 1VQ1A 1ZVVA 1OX4A 4WLOA 2ZJ4A 5CCBA 2ZYIA 1GKYA 3HFSA 1AA9A 2UXCB 2CCKA 1DV2A 1FDIA 3R44A 2GM3A 3ZGVA 2PUHA 1SQGA 3AKCA 4YNBA 2QNRA 4YXFA 3LC1O 3NJ4A 5EUMA 4HDRA 4MA4A 3GEHA 5AT1A 5EJ6A 1VXOA 1XC7A 2GEVA 1Z4MA 1H0HA 2V4MA 2FWRA 2JAUA 1QS0B 2ZAGA 4R1OA 4B8ZA 3VNUA 1Q3HA 3ZH2A 3UATA 1U0RA 2GSWA 3OEEA 1EP2B 2CF5A 1UFVA 1WDMA 2HJRA 4Q7LA 1OF1A 4TV9F 4L27A 1L4LA 1J42A 1K2VN 4PLFA 4C4YA 1XMVA 1R5JA 2NX2A 3UCXA 1LGYA 4CPDA 2QLLA 4MR8A 4OJMX 3JZAA 4AN4A 2IL1A 1W0JD 1H85A 3AEUA 3TIGA 1J9GA 3LFHA 3RUHA 1YKGA 1G9XA 5G1OA 1P4AA 1RAEA 2XKAA 5KNDD 3PKJA 3PUWA 1CY7A 2PO7A 3WXMA 4EHIA 2G6BA 1E4YA 3EUWA 1EP1B 2QHXA 1E79A 1MT0A 4L4YA 4LJLA 2B21A 1QIJA 1VDMA 3DMHA 2FZKA 2D1FA 5D3QA 2WM8A 621PA 4J4BA 3PTAA 3P94A 5B2FA 1I32A 5IFKA 3THOA 3EDRA 3KD3A 1EPUA 3Q9SA 2OCLA 4IQGA 3VZPA 4BNYA 4O3MA 4B7AA 2DWPA 3NORA 4K8OA 1X8KA 1QH9A 3N2KB 4ODIA 4AB1A 4F4IA 1H2FA 2E4AA 2FWJA 1LC3A 1P2SA 2NT3A 4DEXA 1KMMA 3QTLA 5REQB 4JJAA 1UPXA 2QX6A 3HXTA 3AV3A 2IPXA 4E1AA 3U3JA 2XLCA 3RR2A 4MQ6A 3V4OA 5DTRA 4L6CA 1JBEA 1TUGA 3DBLB 3H3JA 1HRDA 1KA9H 3K32A 4MQLA 3V8EA 3GFGA 1E9CA 2VYVA 1X7YA 1TK9A 3M4NA 3KPUA 1DAIA 3EPHA 4PQRA 1L5GB 3TPZA 4KHZA 3WTCA 2BZ1A 1R4MA 1F8XA 4FCTA 2ANCA 2RAUA 4IR7A 4Q4HA 2IE8A 1YKSA 1WLYA 4L8GA 2B6NA 4XQEA 4Z9AA 4RSHA 3LV8A 3DT9A 3WVNA 1JAHA 3R77A 5BQOA 3RS5A 1QGOA 3EUAA 3BTVA 3C14C 5AJVB 5ESWA 4L3VA 5F77A 3HYSA 5DLDA 5CNIA 2FW9A 3O1IC 2C97A 4KDFA 2OUKA 4RFLA 4NMMA 4P32A 4RV5A 3BIXA 2C83A 2Q3CA 5AM5A 5BSHA 2HK6A 1R4ZA 2H9YA 2NXCA 3ZUGA 4L85A 2FEMA 3TFWA 5EWLB 3PV0A 1K5GA 2HSWA 2VVTA 4NE2A 1XX6A 1Z0UA 3N3AC 3WG9A 1DG1G 1UP4A 3I04M 1LW6E 2KW5A 3K0CA 3I12A 1M6NA 5LP6C 1KY3A 1WVMA 1ENOA 2E87A 3AUSA 3M6MD 5HCUA 3MAJA 5JNSA 1BN7A 4ZO6A 4N0MA 3OWOA 3CY6A 3GQBA 4RUKA 5GMOA 2OHGA 5ICMA 3KEGA 3PXBA 5TXGA 1R9JA 2P78A 4ND2A 3H84A 2CUKA 3O4VA 1G7TA 4ETMA 2XXBA 1MNAA 1CLUA 1K7XB 1I3NA 2AR7A 4K6KA 1M1YA 3D3JA 1ZXLA 2OCIA 2PG3A 3D3KA 3OZWA 5H1YA 3ST7A 1EJ2A 1AMOA 3DE1X 2XPCA 1T2CA 1XN1A 2QM3A 3IEPA 1UUFA 2F3PA 4CIXA 2R6ZA 5U9CA 1OZHA 4KHPB 5B3JA 3O2NA 4FFSA 2FSHA 4IJVA 2DFKB 3IVGA 2UZ0A 1M34B 3BMXA 1VHQA 1BROA 3W3AD 2OHJA 1PT5A 1X7ZA 3DF7A 1DXYA 3KRTA 4MS3B 1T29A 2Y1FA 3FPJA 4OYHA 1AK1A 2G9QA 2WYWA 4GFDA 4NU0A 3A2LA 4UPVA 7YASA 2UUPA 5D6NA 4LFCB 1CIVA 2AMFA 3EB9A 3IUNA 3I72A 4NV3A 3VR6H 3ZWKA 4Q00A 2CVZA 2GTIA 4HYTA 3D54D 5J40A 3I73A 5CEEA 1TOAA 1GQ2A 2D0IA 4OEHA 4PCAA 1Y9AA 1JDZA 4MCAA 4ZDKA 5EIFA 4QLOA 1Q44A 3ZQJA 3VSDA 1HDOA 3ETDA 2NV0A 1DB3A 1MVOA 3MN1A 4Y1RA 1U8XX 3K35A 2CEAA 3QGMA 2FN4A 3RVDA 4QOIA 1TEZA 1W73A 1KVRA 4BZXA 4D0RA 4F4HA 4KFRA 4UBOA 4TLMB 3G2OA 4OQDA 4RGQA 3ZN2A 1CCWA 1VMKA 3FMVA 3KTAB 2D7CA 5DNAA 1I3LA 3U4QB 3CNBA 2OXEA 1V3VA 1M7HA 2O1XA 4XR4A 2XMGA 3OUTA 3W2IA 4BO0A 2QM7A 1EU1A 1R88A 3B1ZA 5C2JB 2ZTUA 3K09C 5DBEX 2EF0A 3WYGA 2G9NA 4ZEMA 1Z2AA 3ZU2A 4Z7NB 2J5BA 1JFTA 2LXNA 2WPDD 1LH0A