1KPHA

Crystal structure of mycolic acid cyclopropane synthase cmaa1 complexed with sah and dddmab
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
283
structure length
283
Chain Sequence
LKPHFANVQAHYDLSDDFFRLFLDPTQTYSCAYFERDDMTLQEAQIAKIDLALGKLGLQPGMTLLDVGCGWGATMMRAVEKYDVNVVGLTLSKNQANHVQQLVANSENLRSKRVLLAGWEQFDEPVDRIVSIGAFEHFGHERYDAFFSLAHRLLPADGVMLLHTITGLHPKEIHERGLPMSFTFARFLKFIVTEIFPGGRLPSIPMVQECASANGFTVTRVQSLQPHYAKTLDLWSAALQANKGQAIALQSEEVYERYMKYLTGCAEMFRIGYIDVNQFTCQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords CYCLOPROPANE-FATTY-ACYL-PHOSPHOLIPID SYNTHASE 1
publication title Crystal structures of mycolic acid cyclopropane synthases from Mycobacterium tuberculosis
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 106
structure length 283
sequence length 283
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.79: Cyclopropane-fatty-acyl-phospholipid synthase.
pdb deposition date 2001-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02353 CMAS Mycolic acid cyclopropane synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1kphA00
3KQPA 1VPTA 3I9FA 5FWAA 5E8RA 5ICCA 1F38A 4P7JA 3G2MA 3DR5A 4Y30A 2Z6AA 1BHJA 2O0LA 3CJTA 3GO4A 2YXDA 2JHAA 4ER3A 4BY9E 1Z3CA 3LCVB 5DX0A 2KW5A 3MCTA 5E2AA 2O57A 3DTNA 2P7HA 5KS2A 5F2KA 5IKMA 4OA8A 4XUDA 2ONYA 3P9CA 1XVAA 3MCZA 2PWYA 3HNRA 4BP1A 3CKKA 5JR3A 1BOOA 3A25A 4X1OA 1N7IA 1G55A 2P40A 3L8DA 3EEYA 4YMGA 5KVAA 3OFKA 4RTNA 3BGIA 3PLAE 1XCJA 4CXMA 4AZSA 3G88A 3GRUA 1JTEA 3UJDA 3P2EA 1L3BA 5ICEA 3GDHA 3LBFA 4V0QA 1KR5A 3EVEA 1AQIA 2NXEA 3LKDA 5DM0A 2B25A 3HVJA 2EG5A 2UYOA 4PCLA 4RWZA 3HCAA 4OBXA 5LQNA 2Z6QA 2NP7A 3UBTA 2AZTA 2NP6A 4GC5A 2XVAA 2YXEA 1I1NA 2C7RA 1ZG3A 5DX1A 3EVGA 4XUCA 5K8VA 5CVUA 1RI2A 5ICFA 5H02A 5FCDA 3KPYA 5U4XA 3TKYA 5K0FA 2H00A 1N7JA 3OZRA 2P35A 4RSRA 3AJDA 5DWQA 3UJCA 4RTJA 2B2CA 4QTTB 3E05A 3R24A 3EVZA 2PXCA 5K0LA 1NV9A 3LX6A 2AOXA 3ELUA 2ZBPA 3AY0A 1HMYA 5GP1A 3SR4A 1DCTA 3PFHA 1F3LA 3FPHA 3UJ6A 5GIPE 1UIRA 2PX2A 3I58A 1SG9A 5E9JA 5T67A 1R6AA 1X1CA 2YVLA 3KQYA 4DCMA 5CD1A 4X41A 3A4TA 4E32A 5EQJB 3UJ7A 2EX4A 3EVAA 1TPYA 2C7PA 4DKJA 2P3QA 2AOVA 4U7TB 3R0QA 1HNNA 1L9KA 2AR0A 2HWKA 5ICGA 1ORIA 1VP3A 3PB3A 3PS9A 3M4XA 1YB2A 1L1EA 4M36A 3ORHA 5DM1A 3LDGA 5GWXA 2CWWA 1FBNA 1RJDA 4HTFB 1KPIA 3UA3A 3P2KA 3JWJA 5EKXA 2QRVA 2IH2A 3A27A 3LKZA 2PGXA 3ELDA 3FUVA 2VS1A 3NWBA 4G56A 3THSA 5LSAA 1NE2A 2BZGA 1WY7A 2P3LA 3NDJA 5DSXA 2C7OA 3IYLW 2OBFA 3KU1A 2ZZNA 4BLVA 1G60A 3UFBA 1KPHA 1MJFA 5EGSA 4PYNA 5E9WA 2VDVE 2AN3A 1OR8A 4KDRA 4R05A 5EMJA 5HIKA 1NV8A 2NYUA 3JWGA 4KW7A 5DXJA 5K01A 2YXLA 5HEKA 3EVBA 2QY6A 4POOA 2P8JA 3B3FA 1NW3A 3QOWA 2LD4A 1NT2A 1NBIA 2GAFA 1P91A 1SUIA 2V7EA 3P9KA 4RYLA 3TMAA 3VYWA 2AVNA 2OB1A 3OU6A 3PX3A 3M33A 3LDUA 3OFJA 3SSNA 3F4KA 5CUQA 2R6ZA 4KVZA 1ZGJA 1M6EX 3G8BA 3MTEA 4R8SA 1AV6A 5EMMA 2ZZKA 5BP7A 2PJDA 2ZW9A 2NXNA 3DMFA 1AF7A 2IDJA 3C3PA 3NVMB 3Q7EA 2PKWA 3THRA 2ADMA 3CVOA 4HTFA 2ZWAA 3X0DA 1MHTA 4MHTA 3KPUA 3E23A 2WA1A 4YMHA 5F2NA 2HTEA 3GRRA 3M6XA 5DM2A 2E5WA 5HOQA 5K03A 2I9KA 3I53A 5K0BA 5CVEA 3G5LA 3EMDA 3PTAA 1YFLA 5B1SA 2PX4A 3G8AA 4KRGA 4BLWA 1WZNA 5DSTA 1NKVA 2JJQA 3SMQA 3EVDA 5FQOA 4MTLA 5BXYA 5EMKA 2GS9A 1R8YA 3OE5A 5FTWA 4CKCA 4OX9Y 1UWVA 3ER9A 2EJUA 3LBYA 2PBFA 3KPJA 4YV1A 3BXOA 3P9NA 4X63A 3FTEA 2H1RA 2QE6A 1KXZA 3G7UA 3K6RA 4YUVA 1O9GA 3REOA 5BW4A 5LQKA 2YUIA 3FYCA 5EZQA 5CVJA 1XTPA 1VL5A 2ERCA 3KR2A 7MHTA 5CCBA 3ME5A 4FS8A 3IV6A 2IFTA 2PX8A 3KQOA 2YX1A 3GIWA 5GM1A 4B17A 1EJ6A 2AN5A 4PINA 3MTIA 3O7WA 3BGVA 2FK7A 1QAQA 3OPNA 3T7SA 3UJ9A 1PRYA 1ZKDA 4GQBA 2DPMA 3LCUA 4ER7A 4YUXA 5M5BA 4E2XA 3S68A 2C7QA 9MHTA 2OYRA 3HVHA 4RTOA 3DUWA 5EEGA 2CMGA 3KPVA 3QOXA 5K0CA 4U7PB 3HA5A 4C4AA 1I4WA 2IP2A 3TPZA 3BWBA 3RW9A 3M6VA 3TQSA 5LQRA 5EMLA 4CKEA 3HEMA 1D2CA 3A26A 4YUYA 2I6GA 3HVIA 3P71T 3AXSA 4PIMA 3MHTA 1M0EA 3ELYA 4V0RA 3EGEA 4DMGA 3B3JA 2IBTA 1RI3A 3KR0A 4HRAA 1P1CA 4PONA 3KR9A 1JG3A 1QAOA 3G2OA 2DULA 2VZ9A 5DTQA 4DCGA 4KIGA 5EPEA 2IH5A 2G72A 4P7FA 2QRVB 4HSGA 3V8VA 5JUWA 2EJTA 1KYZA 3HA3A 5E1BA 3C6KA 1FPQA 3WSTA 4O29A 4PNEA 4P7GA 1FJXA 2UYCA 5HIMA 5EHIA 3FUXA 4GOOD 2Q41A 3FPFA 4PCAA 1YZHA 2PXXA 3DXYA 4GF5A 3AWIA 4DA4A 1G8SA 1VBFA 2JHCA 5E1OA 3MAGA 5D1NA 2YTZA 3EVCA 4FSXA 3FTFA 5C0OE 4YV0A 2H11A 1B42A 3BWMA 4HH4A 3HVKA 2I62A 2GLUA 5C1IA 3KQSA 1YFJA 4E31A 4FT2A 4ER6A 1IM8A 2XYQA 5K0EA 3HTXA 3LSTA 1NW6A 2ZFUA 3R6TA 3NVKI 4CTJA 1WXWA 4E30A 4PGGA 1JG4A 1ZGAA 3P9IA 5KQRA 2HV9A 1KYWA 2Y1WA 1R00A 1INLA 2IGTA 2PXAA 3FPEA 3FUTA 3I5UA 2JG3A 2BH2A 3ER8A 3FZGA 3EGVA 5HZMA 1NBHA 3DH0A 4EKIA 3OCJA 3FTCA 3MQ2A 3E7PA 4LWPA 3TFWA 2G1PA 1I9GA 4DF3A 2IH4A 5DRTA 2ZBQA 5GINE 3IEIA 2B3TA 5G02A 1EIZA 1DUSA 3ID6C 3BUSA 4LECA 4QVKA 5DM4A 1ZQ9A 3BT7A 3LECA 1SQFA 2CKDA 2ONZA 3KR1A 4RTMA 1JSXA 1JSZA 3GCZA 1L3IA 1EAMA 1P39A 1Q0TA 5CVDA 10MHA 3CCFA 4QQNA 5T64A 5CCXA 5EHGA 2Z6UA 2QYOA 3VSEA 4YV2A 3KQTA 1WG8A 1NW8A 2FHPA 3BZBA 5E1MA 2AOUA 1JG2A 2O05A 5DRYA 3SSOA 4C03A 3QV2A 4RVDA 3LGAA 3KHKA 1SUSA 2FPOA 3MB5A 4QDKA 2G8NA 2AN4A 3OU7A 5D1HA 5HIJA 3EEOA 1O54A 1R74A 3UZUA 4P58A 1G6Q1 3C3YA 2ZULA 1EJ0A 3P8ZA 4AX8A 3FYDA 5FADA 2OKCA 2I7CA 2UYQA 3NMUF 4RVGA 3GXOA 3CJRA 3LL7A 2R3SA 3DXZA 3CGGA 4ZTBA 3SXJA 3PVCA 2PT6A 2PV0A 4RVHA 5K0NA 1X19A 1SQGA 2P7IA 4M37A 4F86A 2XVMA 1NW5A 5EEHA 4RTPA 1JTFA 3T7RA 5FA8A 1H1DA 2P3OA 3GGDA 4GOND 5EC8A 4PYIA 5FHRA 4IKPA 5IH3A 1IY9A 4Y2HA 3VC1A 4MQ4A 2GB4A 4OBWA 1ZHFA 2ZIFA 1TW3A 3GNLA 1RI5A 2QM3A 5LQCA 1KPGA 4M38A 1JR4A 3RODA 3FPGA 1EG2A 4F84A 1X1BA 2Y1XA 3DOUA 2PY6A 2ORED 5EOVA 2N47A 4PYJA 1DL5A 4RVFA 4CKBA 4KIFA 4QDJA 3TLJA 4M7RA 3UA4A 4E2ZA 2K4MA 2YQZA 2AOTA 3BWYA 3DXXA 4PYMA 1KIAA 2ZIGA 1P1BA 1XDUA 4HGYA 4P7KA 1XXLA 8MHTA 1T43A 2F8LA 3E8SA 4MWZA 3Q87B 5DLYA 5K0GA 1FP1D 4OA5A 4MIKA 4FT4A 3EMBA 4LWOA 4EK9A 1U2ZA 3OZSA 2JH8A 2P41A 2AS0A 4RV9A 3EPPA 4E70A 1G8AA 4ISCA 1SVUA 2IIPA 2B78A 3TKAA 3A7EA 2BR4A 4AZVA 3ANXA 1X1AA 4GC9A 1RI4A 5DTMA 4FZVA 1JQEA 2YR0A 3KKZA 1QAMA 1G38A 2BR5A 3CC8A 3HCBA 2FYTA 2JH9A 3BKWA 3KQWA 4NECA 2ZLBA 1BKYA 4E2YA 2PVCA 3FTDA 1RI1A 1RJGA 1YUBA 4PYOA 1M6YA 4ATNA 2NXJA 1VE3A 2ZIEA 5F2OA 4PYKA 4L7VA 4PYQA 1JG1A 5FWDA 5EKUA 4RTSA 5ERGB 4X60A 4C05A 4F85A 5EVJA 4OQDA 5FA5A 4PGHA 1XCLA 4IV8A 3LPMA 4QPPA 4EKGA 4A6EA 4BLUA 1V39A 3ELWA 3OZTA 3GRYA 4X61A 3BKXA 3G2QA 3HA7A 3P97A 3B5IA 4QTUB 5EIWA 3I64A 2B9EA 3PT9A 4GUAA 4QVGA 5CIYA 4HC4A 2OXTA 2IBSA 4C07A 5EG5A 3GU3A 4E33A 2BM8A 2FRXA 2AOUB 3DP7A 3LHDA 3R3HA 2OB2A 5HIIA 2OZVA 3SSMA 4YUZA 2HMYB 3H2BA 2VDWA 1KP9A 1XJ5A 4C06A 4EVIA 1TW2A 3MERA 1RJFA 3SVZA 3MGGA 3EGIA 1IXKA 1N2XA 5FQNA 3FUWA 5BW5A 2PSSA 4OQEA 4PIPA 2HNKA 1NW7A 3OE4A 3TOSA 4AZTA 3GRZA 5GOZA 4KWCA 4FR0A 1YF3A 3T7TA 4GOLD 4H0NA 1JQ3A 3NDIA 5HFJA 4C04A 3PFGA 5DPMA 3GJYA 3A7DA 3M6WA 2OY0A 2ZBRA 1VQ1A 2PWPA 2A14A 4K6MA 4ER5A 5EZSA 4RTQA 4Z2YA 3SX0A 3B3GA 3KPWA 3V97A 5KQSA 1XDSA 3SM3A 1PJZA 3NWEA 2IDKA 2ZWVA 3HCFA 2VP3A 3DULA 5FULA 2XBMA 3CBGA 2ZCJA 4XCXA 2BR3A 3DLIA 5LQAA 2ZSUA 3FPJA 4A6DA 5E1DA 1D2HA 2VDUE 4WXHA 2FCAA 5E9QA 2ZVJA 1Q0SA 3HCCA 1SKMA 5FHQA 4QPNA 2G70A 1R8XA 2IPXA 3HM2A 4YUWA 4DZRA 3GWZA 3DMGA 4DM3A 1VLMA 1WS6A 3NJRA 4GEKA 3KQMA 1R18A 3FRIA 3D2LA 3M6UA 1AQJA 3U81A 2WK1A 5HILA 5MHTA 5EIFA 1XDZA 3C6MA 4ER0A 2G71A 5LQJA 2UYHA 4CWAA 3O4FA 1RJEA 3G89A 2BM9A 3GRVA 3KQVA 3UJAA 5GM2A 4RX1A 2EFJA 5K0JA 2AOTB 2V74B 4RTRA 1VP9A 3R9XB 1JQDA 1L3CA 2ESRA 2P1DA 4KDCA 2FK8A 1QZZA 3JWIA 5E2BA 3NTVA 1VIDA 2CMHA 3UJBA 2CL5A 4LG1A 2AOWA 4WVLA 5FUBA 2NXCA 3PX2A 4FGZA 3G5TA 3HCDA 4RTKA 3B7PA 3K0BA 4EMSA 4IV0A 4BP3A 5K05A 4PYLA 1BC5A 3LDFA 1X1DA 2PT9A 3HP7A 1ORHA 2O07A 2GA9A 3BWCA 1YZ3A 4RTLA 5DXAA 2PLWA 3P2IA 2XYRA 4HG2A 1O9HA 1Y8CA 3DMHA 4HGZA 2PX5A 4PWYA 3ERCA 4IWNA 5T6BA 3TR6A 3BGDA 4FP9A 4JXJA 4R8RA 4XUEA 5DT2A 3RIEA 3SGLA 3UJ8A 4C08A 5C9ZA 4GBED 3VC2A 5CVVA 3G2PA 3C0KA 3TM4A 2GH1A 4CTKA 3CJQA 3O31A 2WA2A 4E2WA 4FSDA 3T0IA 1UFKA 3LCCA 4AUKA 4QQKA 2HR1A 2AVDA 3M70A 3B89A 3TRKA 1QYRA 2XYVA 3EVFA 2O06A 3FRHA 5DTRA 4DQ0A 5CM2Z 5DX8A 4AZWA 3NW9A 3DLCA 2UZ4A 1KHHA 3FUUA 5P8WA 3TM5A 2NNWB 2ZTHA 1FP2A 2ZZMA 3HCEA 3OU2A 4GOMD 4EQZA 5KYGA 1D2GA 2OPBA 3IHTA 3UWPA 3KQQA 4R6XA 3AXTA 2GPYA 1WXXA 2JHPA 3JWHA 5LQUA 2OO3A 1QANA 4R6WA 5E8JA 4UOEA 1EQAA 5GIOE 5K09A 5LR6A
chains in the Genus database with same CATH superfamily
1KU0A 4TVBA 1WMSA 1K86A 3WZLA 3SI7A 4UTPA 1GKUB 3EBPA 3JZAA 3IMKA 3G2MA 3F8TA 1FFDA 3I9NA 1BHJA 2WTAA 3OZBA 1F6WA 2H51A 3P0IA 2GRAA 4WL0A 5GMOA 1W7AA 3AR7A 3L84A 4MGZR 4UARA 3D0OA 2MWMA 2VRWA 1E1QD 2CNWA 2MINA 2Z1DA 3KD3A 4G4SP 1ZIYA 3NR2A 4UVDA 5C8VA 5EAIA 3SC6A 5IKMA 5EIBC 5ESWA 4EA6A 4D25A 4C4OA 4EPYA 4BP1A 4UAGA 4I5IA 1K4MA 4MVYA 1G5PA 1ENYA 1HO3A 1D09A 3QU2A 4V0KA 4GH5A 4BO2A 3W0LB 1UBNA 1NT4A 1G41A 3BA6A 1LV7A 5C1PA 2QVXX 1RWXA 1AQYA 3WAGA 4DB4A 2UVPA 1CB7A 3I9V6 3KTFA 4AY5A 4CN8A 1Q22A 1E2EA 3TZHA 1RLUA 3DPUA 4G65A 4G1UC 4MRNA 3HKEB 5DM0A 3E5RA 5H5JA 1DAMA 3DG9A 1HUQA 2Q1YA 1C4KA 3PUVA 4TUYF 5FJIA 3ZS8A 1SKQA 1ZJZA 1XRNA 1JT2A 3HCAA 1WXIA 2FKNA 4UPEA 2Q6OA 1P9LA 2OHJA 4HH0A 1KO5A 1KOFA 1U4NA 2ZUVA 1J0BA 1GT91 2YXEA 4FFMA 4HJRA 1OBOA 3EB9A 2M2IA 1PJQA 1CXZA 4FCWA 1N6HA 3R23A 2FSHA 4KIJA 5DEIA 2A6PA 1EB8A 2JAPA 3M82A 2QSUA 3OZRA 1KKUA 3IIKA 4RTJA 4FYIA 1Q2UA 3REFA 5IS2A 2BP7B 2FFJA 4DCUA 1KTIA 2BCJQ 4Z0NA 1GFIA 3VTAA 4MUKA 1WZIA 4BWVA 4PYRA 1PV4A 5L95A 2C5BA 2AOXA 3ELUA 1V6AA 2OBYA 4XVUA 3OWHA 2ZS8A 4A8HA 4DNFA 3CT4A 3VH2A 4ETMA 4LI0A 1F3LA 2I71A 3UJ6A 1OAKA 1XYGA 3THYA 1YDHA 2XB9A 1K7YA 4EX6A 1BCSB 5HQ3B 2QPTA 4XR4A 4ZVTA 4TS4A 3VHXA 5A4MS 1BJRE 3BWEA 1H4SA 4IFBA 1H8EA 5BV2P 4LSMA 4KFSA 5JV5A 4YIKA 3FCAA 4IDPA 4F1JA 1RBZA 2AR0A 1SBHA 1U4OA 3MSXA 4WTOA 1GN9A 3PS9A 1ZUHA 1B4DA 1AGRA 1ZD5A 2D6FA 4Q9HA 2YHIA 1FBNA 3FNHA 3EODA 2C61A 1JKIA 2RH5A 1TM5E 4HADA 3P2KA 3P2JA 4IQFA 4ZMSA 2R5NA 2WV9A 1IVSA 3Q3GE 3WFZA 1E64A 3DE7X 2O3JA 1A4XA 3AM3A 4JJAA 1OASA 4LYGA 4BNDA 4OHRA 5A3SA 1MJGM 4M55A 2ZZNA 4WRRA 3OF3A 1LX6A 3C24A 2Q5CA 4L74A 3VPFA 5CB6A 2FOLA 1I94B 1GL7A 5K51A 4N6NA 2BEUB 4ZICA 4K8OA 4BN4A 2NU8B 1TOAA 4NFSA 2J45A 3OC6A 3NEPX 4IVQA 4L5CA 1N75A 4N5MA 2QY6A 2QT9A 2P6RA 3Q5DA 2VPYA 2W93A 4DMHA 1J2RA 1DFGA 1VE5A 2O9JA 1QRAA 3JQGB 3O9MA 3UK6A 2QYSA 5HGXA 3MCAA 3B1FA 1SELA 3L7NA 2ZROA 4R8SA 1D6NA 1BYUA 1QLHA 1IJFA 4F91B 2ZTVA 4URVR 1JUDA 1N2HA 1E1KA 1TKRA 2VPXA 4HQRA 1P7PA 3DMFA 1UDXA 4J0DA 1UMCA 1AF7A 2X1MA 4XPIB 3Q7EA 3THRA 2FW7A 4AUNA 1XUOA 4DC9A 3KUCA 1PBTA 2BGKA 4KQCA 3OOYA 1EEHA 3L41A 4CETA 2E5WA 4DC0A 1N2SA 2NAFA 3QPAA 5CVEA 5JNSA 1VMEA 2HY7A 3SMQA 3EVDA 2FZCA 2FMFA 2G5TA 3N7TA 1XCOA 5SYAA 2GN4A 3ICWA 4WLUA 3VU9A 5KVCA 4HLUC 1LKZA 1NW4A 1XZEA 2YWRA 3PHIA 1M83A 2H08A 3IKTA 4XB2A 1B41A 4MRMA 1WDKA 5G1NA 5ICSA 2P9TA 3NVAA 2AFIA 4I55F 1P5JA 3A1UA 1QH9A 2YOHA 2GVZC 4ETNA 2RJ3A 3G7UA 4JP5A 2B8TA 4A82A 3P9XA 3M81A 3U1TA 3FTPA 3WAJA 2M9MA 1AHPA 5TNXA 2ERYA 2Z9BA 3PKZA 4CUZA 4JUIA 4B17A 4R8LA 5GM1A 2ZIXB 4HWRA 4U6SA 1DC7A 2ZSKA 3M4ZA 4LJ9A 1XP5A 3THXA 4DR3B 1DQRA 4TXNA 5C4MA 1M5TA 8ADHA 5LZ2A 4JCCA 4MI9A 2YWCA 5A7HA 3VH4A 2J5KA 1WW2A 2BJHA 4FKMA 3GN2A 4TMWA 4GX5A 4BMYA 3T5DA 4N49A 1JP7A 1PJ2A 2NZYA 4JEIA 2QW8A 3ZI7A 2H3EA 3U39A 2BE9A 3GVIA 5TJHA 5BT8A 1EHIA 1I4WA 2AXNA 3Q2KA 1NVUQ 3PDIB 3Q11A 4YRZA 2PGJA 4EP1A 1D2CA 1R10A 4UQOA 5K0SA 1QNLA 2WVGA 2I1LA 1FUEA 4BRSA 2YIJA 2WTEA 3AUKA 4BUJA 5KAMA 1F6DA 1GY8A 4CR8A 2Y6UA 3JAKA 4JX8A 2Q3EA 5B6PA 1J8DA 3QLVA 7ADHA 1Y4ZA 1P1CA 2YDXA 3QMMA 1A76A 1SWWA 1ZH2A 1F48A 1T5BA 4TTVA 4YCAA 3SYRA 1GRCA 3G2OA 1KH3A 1L7EA 1QPBA 2DULA 1OI4A 5TV2A 2H17A 5TE9A 3DB1A 2NU7A 2AMYA 2B4TO 1J25A 4B44A 5JUWA 3QSYA 2CL0X 1EK2A 1FJXA 4TYWA 4AAYA 5A7FA 2XADA 1GLVA 2AFHA 2OLKA 4FFVA 4PW0A 1YZHA 2QZZA 3SC3A 5E4YA 1NQXA 3PIIA 5BQFA 1FOEB 2PUBA 1U94A 4CMBA 3ICOA 5D1NA 2F17A 4EY4A 2AV6A 2BUBA 5IVPA 1F17A 1RT9A 2Z30A 1JAIA 3RJTA 1B42A 5T4HA 1ZR4A 2QD3A 4NYIQ 2VFAA 3DAGA 1M7HA 2NACA 2IZ7A 3ONWA 1UDBA 1RLJA 1L4FA 1JBEA 2A9OA 2V8OA 4DLTA 3VVMA 2XR1A 3PUJA 2P2DA 2Q7XA 3I37X 4Z9BA 5F1OA 2GZSA 3AP1A 2WIBA 4GPZA 2ZG6A 5BN4B 3RI3A 2WV7A 4QDTA 2PXAA 2W2LA 2AJLI 4C4SA 2WU0A 1TK2A 3VNAA 3DH0A 1CUFA 5EYPA 4MP3A 3WC4A 4I1PA 1JLHA 4ZJZA 2WYHA 1C30B 1KVQA 5GOTA 3K09A 1FNNA 5TPWB 3HLTA 2GASA 4MKIA 1P44A 1H5NA 2I8CA 1GRRA 4I2VA 5EUBA 3BSSA 2RHTA 1AKUA 1E99A 4WBNB 4LECA 2QRZA 5G53C 3BT7A 2CLKB 1EWRA 4A27A 2OC4A 1L6RA 3KBOA 3P0JA 5DV9A 4Y1RA 1U1CA 1VLVA 3GK3A 2GPNA 1JHQA 4BTLA 2VHYA 2OCYC 2OVFA 2WYVA 4QQNA 4RLSA 5F76A 2Z6UA 3ZLTA 5KSWB 2CLDX 1QVZA 1AKYA 2PTGA 4FFSA 3SSOA 3U4HA 3VSAA 5LJIA 1XA0A 3QZUA 4BBAA 1VA4A 2IIQA 1MQ9A 2WIJA 1HV8A 5A1JA 2PEYA 2EG9A 3OM9A 4J0IA 2II6A 3T3PB 1SCBA 1GXSA 2PGDA 1KYVA 3DYIA 4RDHA 4PZYA 2EARA 5TS3A 4MVJE 1OPRA 3N76A 4OI1A 3T7CA 4P58A 3WFJA 1FFXA 2NNLD 5E9AA 4LFBB 1W46A 3BB3A 4IHJF 2FG6C 5FADA 2Q6IA 4FMDB 4S2EA 4RVGA 4RMHA 4RK4A 3STYA 3PJDA 2WD8A 1XRJA 4KCGA 4PQEA 5K0NA 3EEBA 1JFLA 1VJ0A 3RVNA 5AUOB 3I62A 1DKNA 1P5FA 2V3VA 3MMXA 3KTAB 3OJXA 4QYIA 3K96A 1N9GA 1XX6A 2DWCA 2EKQA 3O8OA 4TLCA 4R0MA 1ENOA 4LK2A 3NOXA 3GGDA 4MYSA 3Q3VA 3R9WA 2F9FA 3HB0A 4C2TA 3GNLA 3OP1A 2O8CB 3TQQA 1SXJB 3WA7A 5I6DA 1XEXB 3AQ4A 2BJWA 3RODA 3K1AB 2H18A 5BWNA 1AH2A 2OA0A 1CR1A 1LRKA 2R60A 1KAGA 4JBGA 2FY8A 3IUBA 1FRZA 2XD9A 3FNBA 3P4XA 5F78A 1T5TA 3ITEA 5TX7A 5LMZA 3WWCA 2GHTA 3IJ5A 2JIMA 1II9A 2DKFA 3IPCA 3JASA 1P9WA 1YB1A 2XX3A 4U5QA 2GXSA 4AL4A 1V7PC 1ZRSA 4YQEA 1E3WA 2ASEA 1CZHA 8MHTA 5A3JA 4GGOA 3V1UA 1YD7A 1T3SA 2PSFA 3V4SA 3WNVA 4MS4B 1YZNA 2VLBA 3M9XA 1BU8A 1RPAA 2OZPA 1YJBA 2YOFA 4FI3C 4V02A 2C1EA 3UJ3X 2GUWA 1KMMA 4LF8B 5C34B 1DXQA 2RHLA 3G8CA 1A8IA 2KLBA 1B00A 2IIPA 4UOQA 2GDZA 1N4AA 1GGMA 4E3WA 4B3FX 1XEWY 3ANXA 3ZHXA 4A2PA 1W5AA 5DTMA 2XWBF 3FYUA 3IOYA 5AVSA 3KKZA 1I10A 1QH1A 1YKGA 2GN8A 2G9RA 3U80A 3BOSA 2AJCA 1VHTA 1Y4AE 3RKRA 1YRAA 1FTQA 2A4MA 2Z2JA 1HYQA 1ORVA 3B1WA 2Q07A 3DTYA 1QLJA 2QS9A 4XOUA 2VBGA 1LVUA 3O6VA 3NFYA 4GOXA 2FSIA 4WBXC 1EUDB 4CG2A 1EB9A 3I61A 2X0NA 4F8JA 1JG1A 5FWDA 4EPXA 2AF3C 3AEKA 5EKUA 3OJFA 4N7MA 4KJZA 4F6CA 2FPSA 4GL2A 3NO4A 4NDNE 2A5LA 4UC0A 5DJ5A 4CCSA 2IEZA 2RGWA 4N0DA 5IF3A 4HWKA 2P77A 3AGQA 3F3YA 1SCQA 1US8A 1W9MA 3P97A 4RPHA 5C5CA 1XMQB 2B9EA 1RBQA 2O7SA 2W71A 3R0VA 4NU0A 3LO5A 4LPSA 1DBIA 3GJ4A 2OXTA 4DY4A 2A1UB 5JS7A 1M5UA 1EE9A 3ANYB 3OMWA 3KZMA 5I9SA 4CM7A 1L5RA 1A1SA 3QBJA 4J1NA 4MEBA 3IDAA 3RB8A 4V39A 1KP9A 1PR6A 7AT1A 1SIBE 1XPUA 3P9SA 1N2XA 4CMEA 4YR9A 2PSSA 3EZLA 1GO2A 3GROA 5AI5A 3NRBA 4B76A 2GJKA 3EY9A 4EJSB 5L6LB 2WF8A 2W8BA 5EN4A 4ZYTA 4GKBA 4NCHA 4G2TA 4MUFA 3TNJA 1TTPB 4JJZA 3W2TA 5CB4F 721PA 3BRCA 3WQHA 5FO0A 4FNMA 4OFBA 4WFJA 4L9RA 3CVYA 1JYEA 5A9RA 3FVVA 1W5SA 5DW3A 4ZXPA 1K2VN 1QIIA 1ULTA 1ACJA 4HWPA 1WCWA 4Q21A 3SX0A 5JARA 2IDKA 3TOZA 2JC3A 3HQ4O 1CERA 5A5DA 4G09A 1AY0A 2I4RA 2Z43A 4MV8A 4ICIA 4KSBA 2VDPB 1DDOA 3ENQA 4J2HA 3PZBA 2JAUA 5SY9A 4WPGA 1POXA 4HQLA 1TUIA 2RC5A 3V2UA 5K45A 1NDHA 3RR2A 4HUTA 3TW8B 4B6FA 3A6EA 3CIOA 4ID9A 4JYPA 1DG1G 4FZRA 4PXYA 4I4TA 3EISA 3E3MA 4IO0A 2RG1A 2BBWA 3P9YA 2PYDA 2Y2UA 4DUZB 3DUFA 2G71A 2VZEA 3UKDA 4C6RA 4EB8A 2UYHA 1M3SA 2GI4A 2POCA 2MYUA 1WEHA 1ZU5A 2R25B 4GWLA 4NV3A 2QNBA 2WSSA 3RAGA 5EIXA 1QZZA 2IYQA 2OBBA 2BMWA 4AXXA 2QB5A 1LF0A 4OM7A 1JWLA 2QUZA 3RBXA 4I8IA 2RB4A 3VSDA 1H69A 2DCUA 4FC7A 3P2MA 1M8GA 4H2DA 4Q4AA 2IV3A 3W8DA 5JS1A 4FGZA 3AR5A 3T6KA 1I80A 1UPUA 2JLCA 4WZBB 3IHLA 4MUJA 5AM4A 2XBLA 3F2VA 2H7VA 2X8JB 1Q2XA 2WG0A 2HBRA 1PW7A 2GA9A 2GBPA 2ZYGA 3A1CA 3H2IA 3UUEA 2ODTX 2A0WA 3EN0A 1QYCA 1HLDA 3OQVA 1ZIDA 3RTDA 3BAFA 2QW1A 4CV3A 2ON6A 2XXAA 3BEDA 3O3OB 4JXJA 1LTKA 4OJTA 1PHRA 1JKJA 5CVVA 4A91A 1ZXXA 1KBZA 5EJIA 2OD7A 1FFBA 2NSDA 3FWYA 3WHKA 4Q0MA 2CK3A 2QN9A 3KWMA 4KJXA 4OH1A 3SFTA 3E22A 3IX7A 4F2HA 3D3JA 2XLCA 1Z7YA 4HNRA 4NF2A 4QTXA 2X77A 4OFZA 3K9NA 1W49A 2GOYA 3HUEA 2ZTHA 2RH9B 2OGSA 821PA 1GTJ1 1U8TA 2UZ1B 2E82A 5C1DA 4CIYA 3EGDA 5CYPA 1DOAA 2GPYA 1WXXA 1XN1A 2ORVA 2IUEA 1YOVA 3BE6A 4Y6QA 4QSHA 4YROA 3TQHA 4BQOA 2PJUA 2GZ1A 2GHIA 4KZPA 3E15A 4JVNA 5F5LA 3ZCUA 5JNLA 1ZUD1 2NYVA 5AW5A 2BMVA 2ZE8A 2ORYA 1N0IA 2OCLA 4IILA 4N5IX 3CNOA 1Y3HA 4HEHA 5CM9C 3ZVNA 3A6GA 2O0LA 2QL6A 4EQ6A 1HDZA 2IKSA 1Y9ZA 3ITKA 1Z22A 1E4VA 4NP6A 4Q3AA 2JLQA 2H54A 5DCWA 3KQUA 5IP5A 4H7JA 3U7IA 4Y67A 4KIWA 2VJLA 4RLHA 2GF0A 2W2TA 1KZ9A 1OFUX 2FR0A 3AT1A 1FFSA 1MIHA 2F8MA 2ONYA 2GSDA 2Q45A 3AHFA 3PPIA 4WZAE 1NFQA 1CY2A 3F5QA 3CKKA 4PZAA 2I2WA 4HQFA 3MWFA 1BOOA 1CQXA 1N7IA 1G55A 1ZNXA 4FE3A 4DOMA 3PLAE 1JNYA 2HCTA 1JFTA 4LHEA 4CXMA 3DP9A 3ON5A 3DFMA 3OP4A 2CXSA 1PK7A 2C5SA 1C2TA 2PG3A 2O8VA 3E2PA 4NL4H 1LBTA 1VPDA 5BQOA 2JPDA 3S1AA 3WLSA 2O8NA 3UWOA 1WF3A 2ZOSA 4C7OB 1EXVA 1X7YB 3ZXXA 1S2OA 4O4IB 1AGXA 4N5NA 3C2QA 4HWSA 1ZVJA 3R09A 5BRAA 3VDMA 1O08A 4I9GA 4RZUA 5LQNA 4KB5A 3QSGA 1U7ZA 1V9LA 3ZCQA 1EK0A 4ZV7A 3IKVA 1JU4A 4JYCA 3J80A 3C8HA 1BNCA 4YRIA 1C81A 1XAGA 4LA4A 3QV1A 2B83A 2P35A 4AG3A 4D0NA 1NBEA 1VMDA 1XCBA 3RPEA 3HM9A 2O19A 4ZO4A 3QVXA 1MMFB 3EEQA 4ZO8A 3DM9B 4RFSB 1O58A 3EC7A 2PNJA 3RS0A 4AJOA 1VIMA 4TVKA 4QU8A 1PZNA 3PHBE 5DNEA 3U3MA 1G4AE 1W4LA 1BVYF 5AT1A 3C48A 1RJ9B 1XP8A 1DRVA 3IKJA 3R7WA 4BAGA 1CS0A 3A4TA 1W0JA 2J6HA 4KV9A 4P4TA 4I1OA 1XRMA 2EX4A 4QC2A 4YJDA 5KNDA 4LFAB 3K94A 2Q4EA 2C7PA 4FD3A 2LP4Y 1XRQA 4G4IA 1XQYA 4L22A 1FJ2A 3C39A 4YJ2A 1FL9A 1GA1A 1WKCA 2KX7A 4D98A 4I1UA 3PTLA 4W5JA 1IUKA 1CZRA 2DJIA 3B2EA 1BHO1 2AXQA 5IJ0A 4MVJA 4HLQB 1YCDA 2FPKA 3NGXA 4NJEB 2ZB4A 4UCWA 1ACLA 3BE4A 4J76A 1PP4A 5F2EA 4HAVA 1V1RA 2DWOA 3EFBA 3PPVA 4R7GA 3GPLA 4KDEA 1VE1A 1Q7RA 2X2FA 1DAOA 1AG9A 3PUYA 4J4TA 2AN3A 3H8JA 1CUCA 4C89A 2PCJA 5IN5A 4QGAA 2VZ8A 4M0KA 4EJ2A 2QPAA 1H2EA 2H8KA 2Y4NA 4HDNB 1KRWA 3W9UA 1ADCA 4UZEA 1W85A 2IHVA 2GN6A 2VATA 1R5JA 3ETNA 4OQFA 2P3SA 4TQ9A 5AW0A 1UR5A 2W98A 3MMSA 4LPKA 4NS1A 1YR6A 3VOAA 1SZJG 3RTEA 3SSNA 1NBMD 4MQEA 2Y67A 3EQ9A 4NMXB 5CUQA 2PX6A 3O83A 3B9QA 1DV1A 5DYTA 5HQJA 2PK3A 1I3KA 3IMFA 4PG8A 4KAFA 1DHRA 4CR7A 1EVYA 2IDJA 2J6IA 5DYNA 3KYDB 1ZK0A 4JI1B 1S0UA 4KLAA 4MHTA 3DE1X 2C31A 3KPUA 3Q7QA 4L2IA 1CYEA 3ZE2B 1K7EB 3GRRA 3H18A 4X45A 1OX4B 3OZVA 4KH1A 2HK6A 2XQIA 4RVSA 1RAGA 2VP0A 5IUJC 1F2TA 2B5WA 1HURA 1CIJA 5DSTA 2OC9A 4H7HA 1Z4OA 1BA3A 4ITVA 1J0CA 1TJYA 3UC9A 4AKEA 3GRCA 4YMTA 1U2GA 1IM5A 3BCUA 3MN1A 5FTWA 2G80A 3RGWS 1KYQA 3RROA 4B87A 2Z2ZA 3FN4A 4IIGA 1C0PA 3ICCA 1YQDA 1GKLA 2ISQA 2CCKA 3E2IA 4YV1A 2H1RA 3DPIA 3R5HA 3SQMA 2W9XA 2J3KA 4W7SA 5AW8A 3BWXA 3M3HA 1FVHA 5AVTA 2FETA 1RVDA 3IUSA 3KR2A 1VYTA 1WV0A 3CF6R 3PSHA 3VHQA 2DLNA 2I54A 2V7QD 2QLFA 3GIWA 3LXXA 2OXEA 3DMRA 4R9NA 1TAGA 3D54D 3EZXA 4HCJA 2YNMA 1CJCA 3EG5A 4G5SA 2G6TA 5FBZA 1PRYA 2A8YA 5DNDA 3UN1A 2I1QA 4FGSA 3G9TA 4FGWA 4INJA 3ZQ6A 5CXXA 4H1WA 2I65A 5IHPA 3FG9A 1SCIA 3I83A 3M5CA 1C50A 5JVDB 1P31A 3TPZA 3WY9A 2WJ6A 1Z4KA 4Y0NA 2FPXA 4W9NA 1OAAA 1DKPA 3A9RA 1HFWA 3D3WA 1WNTA 1TZ2A 4IX1A 3ZJ4A 1GG2A 3K5HA 1G7TA 4PIMA 1XAHA 1T2FA 3USCS 4J0KA 4DMGA 1PD1A 2XOKA 3ADOA 1KOJA 3BL5A 2K6GA 1PV1A 4DJEC 4M0EA 4RNCA 1D0IA 2PWAA 3RSSA 3AFGA 5FNZA 3MJVA 5G2OA 5CFQA 1FNSA 2Y8EA 3EXG1 2GCIA 2YXBA 5ALOA 2PCLA 3CYFA 4YS6A 3RC1A 2YV4A 3SNKA 3UWDA 3WRYC 4MPDA 5LM3A 1N3LA 3FZYA 1JE0A 2NYRA 5DHAA 5JXJA 1QFXA 4RPCA 5MGBA 4W1QA 3FPBA 4LCBA 1YVPA 3BMNB 2Q4DA 1NQAO 3L1VA 1G8SA 4ZOCA 2PLNA 1EWKA 5FOTA 5G4KB 3GI1A 2QUJA 3KL4A 3EXFB 3KHUA 5C0OE 4RFLA 5FWXB 5KYXB 1NXWA 1MJ5A 2BFWA 3EXEA 3L6RA 1ARZA 2VT7A 3HVKA 4BNUA 3FOZA 1CR4A 1MF7A 3PQ8A 3KQSA 1JLLA 3TZQA 2ANCA 3DKVA 3O03A 1P0PA 4FJ0A 4TV8A 4M0LA 4OXYA 1E5VA 4GQIA 5DBFA 4KRFA 2WHEA 1NU8A 3W05A 1U0GA 4PGGA 1RXWA 1Y5MA 1P7CA 3FPEA 1IG3A 2Y05A 4CU5A 2BTEA 1NRWA 4BOYA 2DVMA 2PAAA 1FXWA 3OWOA 4NS4A 4PNHA 5IX8A 5JISA 4XQEA 4EHNA 3IBYA 4KR0A 2YUTA 2E4ZA 1S4MA 2G1PA 5KVQA 3X2FA 1FTWA 1C7QA 2VYFA 3LE8A 4P4NA 4CMIB 1QBGA 1V5EA 4G23A 1XO1A 3FSEA 3DFZA 5EJ6A 2GD0A 4M1YA 3PF8A 5COQA 4ALMA 1ENPA 1P4JA 1UJ6A 2ZJ4A 3OQHA 3I2HA 3IAAA 3NRCA 4X8MA 4LDRA 5BV7A 4PO8A 4G07A 4P84A 3G49A 1P39A 4DQVA 1K5DA 4UBNA 1FLAA 4ZU6X 1TLFA 3COYA 3RSQA 2NTVA 2VHQA 2XXJA 5EHGA 1N2JA 1T6YA 3KKQA 4UM9B 1FC0A 4P4GA 1QYVA 1RKBA 1YQQA 2AOUA 4GGPA 1SXGA 3B7GA 4QBKA 1KVSA 2EIXA 3OCUA 5CGZA 4N47A 4EHJA 5HG0A 1IB6A 3I6YA 3SE7A 2FPOA 3ICEA 2BVNA 4BLTA 2Q3LA 4PEVA 2QROA 3LLVA 1O54A 1NNUA 3QI2A 1H0KA 3AKYA 3G85A 4X8LA 3DDWA 4JI7B 4GLOA 1FPMA 5E6SB 4FCCA 3QG1A 4EPTA 3OQOA 4KRXA 2HPZA 1EVZA 2OKCA 1MV8A 1Y80A 1TIPA 3I05A 3GLTA 4XGIA 2B1RA 4DBLE 2H1OA 2UXCB 3IV9A 3NYIA 4HH3C 1KMCA 2PV0A 4NWIA 3AHHA 2KWIA 2P7IA 2QQEA 5JQGF 4B6JA 1T5DX 1XTBA 5ETJA 1K6XA 2BN4A 3T7RA 4EG1A 4TVOA 2D0IA 5ILGA 4MRAA 3V4VB 2Z57A 1K8RA 1N0VC 2Y27A 2C78A 1ZM7A 1FXSA 4G8BA 4OG2A 4D44A 1ZNZA 4JP8A 2V7BA 4Y9TA 4BMXA 3B6IA 1OUMA 4DYHA 4NMLA 1DJPA 2VH1A 3U3KA 5TIIA 4F04A 2VPPA 2YMMA 3WKBA 1UKVY 4M3NA 1QLWA 1XCPA 1GNLA 1RABA 1T6BY 1TU3A 1ZWLA 5CW1A 2D1RA 2GEUA 2N47A 5JYBA 2EKBA 2WE8A 3ZCVA 4P8RA 2CZCA 2IXFA 3UA4A 2B1JA 1GQQA 1XDUA 2WDPA 2YIMA 4LRYA 1GTRA 3MXOA 4MGYR 4IYRA 4L57A 1YRWA 4WZAA 1PJ4A 3HB7A 1GRVA 5FFNA 3VAYA 4FDUA 1DAGA 5E6UA 3HBAA 2EEPA 2XT6A 1HE1C 2F8SA 2DHQA 2L18A 3TZKA 4FU0A 1RZ3A 4P34A 3QU9A 5EFZA 3WWDA 4F60A 3DW3X 4G5XA 5JSYA 2JD1A 4EVRA 4HNVA 1PNRA 1F4LA 4HSEA 4LOAA 2AKEA 4FHFA 1U0RA 2CEAA 1BXZA 1SUEA 4DZTA 1HGXA 3LBHA 3TBKA 1Y37A 3UUFA 3AL2A 3GJXC 4QODA 4BQSA 3K8ZA 3M2TA 3P19A 4YMWA 4JUAA 3ZW9A 1CLEA 2H65A 1IK6A 3D02A 4ZANA 1UODA 3UO8B 1VLQA 1E2QA 3WYCA 2ZUWA 4CLOB 4FE4A 1RI1A 1A8UA 1XEWX 2HF9A 1UL1X 4K9QA 4KXVA 4O4LB 2Z3ZA 1TTTA 2ZIEA 3GMSA 1MORA 2GXAA 3LT0A 4KE9A 1PN3A 4NSNA 1NXPA 4ZDJA 4K05A 4E6EA 4WN9B 1II8B 2I6XA 2BUCA 4I4LA 1Q14A 2HDOA 1Z2PX 1OOEA 2YVUA 3E3LA 3MLAA 3IPRA 5H80A 5TPZD 3AOGA 2AG6A 2HHCA 5EWMA 2EZ8A 4A6EA 3GT7A 3UVEA 5D5HA 2NQTA 3BKXA 2H5IA 1KOGA 1AKNA 2A0XA 4HBGA 3H9CA 4Z3DA 4J9UE 5LDGA 1HT1E 5CB4B 3HK2A 1RXIA 1NOIA 4EFNA 2A3NA 2I2DA 3NTXA 1LEHA 1X7GA 1H2HA 2FZGA 3K0FA 4MHSA 5HZKA 3U7FB 4LOIA 2DP4E 1DTWB 3VO9A 1WIWA 3CSSA 1AQLA 4ENWA 5K3DA 1XJ5A 2XE7A 2B4AA 2B61A 3X1ZA 1M2WA 3ORQA 3HLKA 3MGGA 4Q00A 2EVWX 3HWWA 4REQB 3FUWA 4YYZA 3A1NA 4HVLA 2WKQA 5GOZA 2JCGA 4XDZA 3COVA 4MYCA 5SY6A 5EA2A 1DEHA 3V80A 4C04A 3PFGA 1QPGA 3BA1A 1VQ1A 4RABA 2C8VA 4BNFA 4J2OA 4RSGA 4HVAA 1NVXQ 4OHZA 1K3FA 3SP1A 3TRIA 1QX4A 2XE4A 3VKUA 4DRXA 2DCMA 5CA0B 3V6LA 3TXYA 3FOEC 2XBMA 3F97A 1MA3A 2VSOA 3DMNA 2CBGA 4ME6A 5L3QB 4IJ5A 1U7PA 3CSDA 1FX0B 4QD3A 4YP0A 5KKCA 2QJTA 1HSZA 5E9QA 4DLSA 2O1XA 4JT2A 4AKTA 1GARA 1ZYUA 4IXNA 1G20E 4FVTA 4HZIA 1I36A 4B4WA 4DM3A 1YIAA 4O4IF 1D0VA 4OQMA 3TBFA 5K3EA 1Z2EA 2FF5A 1XXHE 1RHKA 1S8NA 1COWD 1NVTA 4KGDA 2SECE 4NJMB 1ZITA 3P0EA 3QELB 5FWYA 4F5YA 3IEPA 1G8JA 3ZHUA 5MHTA 1D2AA 1M2FA 1U5CA 4PF1A 1X7ZA 2I1WA 2LPMA 1W4AA 2QTNA 2QUHA 3QTTA 3ZWWA 2IUTA 4IWYA 1SUDA 1X6VA 2V6JA 1L3CA 4GKAA 4KDCA 3UGKA 1GR1A 1T8WA 3K0CC 1ZNYA 5FOSA 1FP6A 2UUAB 4MIOA 3BC1A 5FI0B 4AJKA 3HJUA 3K70C 2XCOA 4R41A 2VXYA 1G8FA 1IATA 1F06A 2GEJA 2F8TA 2WWFA 1NBME 1QZUA 1SHTX 3L1HA 3K0BA 2JBWA 4UNSA 1N8TA 5EQTA 4Y2QA 1AT1A 2EX0A 1BC5A 1J8VA 1KNXA 1TF7A 3FHTA 3DZCA 1I6WA 5CDGA 1F8UA 1P80A 4JCOA 4N0QA 4TQUS 4X00A 1UDRA 3WLIA 3DMHA 2R7AA 2CL6X 4PWYA 4QGSA 3LUDA 1SVIA 2QN1A 3JZMA 2JNWA 2XHEA 4IWNA 4OMDA 3S99A 5AW3A 1RE0A 1SZPA 1JHMA 1K06A 2SCUB 4LIPD 4V1CI 1W52X 2PR2A 4I1YA 4Y2UA 3N0WA 1I24A 4C6TA 3CJQA 3BK2A 2EBWA 1GAQA 4NCIA 2Z2XA 3KSZO 3QYJA 4ZJYA 1M6NA 2C94A 1KJIA 2DH6A 5IEBA 2Z5LA 2ZBVA 3ASUA 2A57A 2O06A 3X1MA 2WUVA 3V8PA 1EFLA 4PM4A 3IKMB 5DX8A 1I7LA 5CTAA 5JROA 2UZ4A 5JCOA 3QVVA 3R9XA 4GZLA 4UU1A 4EQZA 3QM1A 4N0PA 2Z0MA 1ZIPA 1U28A 4ZOLA 3S5JA 3JWHA 3BXFA 4FQ7A 4V3BA 3WP1B 3C3KA 2C58A 3SFVA 3EYWA 1OE0A 4ZK2A 5GIOE 4J43A 4BV9A 3EDOA 5KMGA 2FWPA 3FAKA 4KDFA 4A6PA 3T5PA 2OO5C 1FP4A 3QJYA 2IYTA 4LOJA 2JGDA 3NIGB 3ESXA 4JLVA 1Z0FA 4QOJA 2D0DA 3KJFA 4ER7A 1OZHA 1XTKA 3LT5A 4CJXA 3RHZA 1T34A 4I1IA 3AUTA 3R4VA 5CFPA 4XDHA 3IP5A 4MA4A 3L43A 2CLEB 2NTYC 3NHMA 3U49A 5KNCH 3IO5A 1TL7C 3N8HA 1IYZA 3C1AA 3MCZA 4I99A 3VDRA 3L7OA 2MTBA 4UDNA 1YF3A 3FCUB 2TS1A 1CETA 4EZBA 1JVSA 1Z07A 5A7GA 3V8NA 3FLMA 2BKUA 1DMRA 3MTDA 2HRDA 3UCXA 3ADDA 3GZ4A 3D8SA 4XM2A 1CNEA 3OTQA 4JEUA 3ND6A 4P3XA 1VL0A 2CXRA 5JIBA 3DAFA 3DVAB 2H4FA 4D02A 4CF6A 4QEKA 4K88A 5JH7A 4I50A 3LKDA 3CF2A 1M2JA 3R6DA 4IHKA 1CDZA 4MS1B 1SXJE 9GPBA 1YQGA 3JV7A 3PGKA 3JATA 4JIMA 5ERXA 4ZEOA 1JHPA 4YNBA 3ZHOA 2BEVB 4RKFA 4GC5A 2HO5A 4NMWA 4G0XA 1NAIA 4UHFA 1CR0A 3UATA 5AW1A 4IX9A 1NJ5A 2AX4A 2BHNA 3A9SA 3GJ5A 4O25A 5LYJF 3I2KA 2LVBA 1WD5A 1E7QA 5CHYA 4CI0B 3AK4A 4RSRA 1I6KA 2BLNA 2ZBUA 3QLJA 3AUFA 4YJGB 3KOWA 3TQIA 4R2IA 1Y1LA 3KOUA 5A3RA 1Z0JA 2W22A 5GTDA 2W11A 4HUJA 1TYZA 5MFZA 1KYTA 1VGVA 3FPHA 3G9ZA 1BYIA 3KOYA 4KO3S 4YI3A 2O2HA 2VYVD 3EC2A 1S89A 3PUIA 4MUHA 5DNVA 5JVDF 3MF4A 4WV3A 1VTKA 1R0SA 3CXRA 1OHHD 2H4WA 4BVHA 4ARZB 4E30A 3IESA 4MUXA 3OSUA 3DMYA 1GZUA 1XGKA 3IQIX 2IT1A 4KKXB 2ZTLA 1NY6A 4EW2A 1SCDA 3A0UA 1U65A 1IVNA 2QG6A 5FUYA 1I2DA 2WC1A 5BN5B 3PE6A 1P7YA 3E4DA 4BNHA 3SXUA 5DM1A 1M2OB 2GK6A 2CWWA 2ODEA 4FHEA 4GZMA 4QGHA 2BMDA 3ESZA 4REOA 4F2WA 5FTLA 2J0UA 1ZOIA 5KQPA 3HBJA 4PZ9A 1SA0B 2HSJA 2JS7A 2X8AA 3LKZA 5BOSB 5JYDA 2IH2A 3JPWA 2WU1A 1TCVA 5DSXA 1TYDE 4CEHA 2QTZA 1EYZA 4UE6A 3QOFA 4DMFA 1H22A 3NWPA 5KREA 1WUJS 3QIAA 4JJFA 5HCNA 1XPOA 3U31A 4WK0B 1G8HA 4HXGA 1NV8A 1BA2A 1GFWA 2HM7A 2Z09A 4G67A 3H9QA 3DS8A 3L7JA 2IXGA 4JQCA 5CM8B 5CIWA 3UPDA 3O93A 3WV5A 3SHVA 3V5NA 4POOA 3CEHA 2H4HA 2GAFA 3FSRA 3NTLA 1QDLB 2NZ2A 4PS1A 5GZ6A 1AKEA 1K1EA 1S9HA 5HHTA 2PLAA 3D6AA 1PYGA 2ZSFA 3NU1A 4W8HA 3NIWA 3MTEA 2O7VA 4KE8A 3GZNA 4N6OA 3GNSA 2VO1A 3ZE6A 4TRNA 4B4VA 3E6AA 5DTEA 1J8MF 5LCXA 4F9EA 4G8DA 5F4ZA 3OY7A 1DFHA 1J9EA 1CS4C 4JUFA 4NDZA 1W4BA 2VPWA 1LLUA 5BY2A 1XTRA 3I53A 2KI5A 2EQAA 2HT6A 1FU4A 3G8AA 1PDOA 5HA5A 1EXMA 5LOVA 1NUQA 4KHPB 2J3IA 1L2TA 4ZRDA 1E7YA 5JJCA 2HHHB 2JI8A 4XSHA 2WJ3A 2XE6A 3BBPA 4UBOA 2A58A 2EKPA 3ZHBA 1DUIA 3P9QA 1DXOA 2JH3A 5JFGA 2PN1A 1Q84A 3DD1A 1QK3A 4M6WB 1NR7A 4LVUA 2RHCA 1ATIA 4N8DA 4A6XA 1M6VB 3FHOA 1QTRA 2OAGA 4OBBA 4PC6A 4ZEWA 4YJKA 4URFA 3TLGA 5IZCA 1ILEA 3VZCA 3F73A 3H1EA 1KXZA 3H9EO 4MV7A 1XJCA 3TS1A 4BAZA 2HF7A 4DABA 4YXFA 5BW4A 5ARCA 1OVGA 2ZWIA 4H7KA 5IVKA 2YJ3A 3TF5A 1ITZA 1K27A 1NJ6A 3I6BA 3OJLA 1UXIA 1V1MA 1XTPA 2DBVO 3ACBA 3OTGA 3P2YA 1RWKA 4UREA 5E0OA 5HBGA 3TL2A 1CK4A 3IV6A 3V4ZA 4TMZA 3GLSA 2QTVA 3KUUA 3DBRB 2V9ZA 1V71A 2AJDA 4H3KB 4CM4B 1JZSA 2IYEA 3I2FA 1QUEA 2VT2A 1NMEA 4FEAA 4WEQA 4C88A 4L85A 4RHYA 1HLGA 1NJ1A 3M6FA 3RWMB 9MHTA 4RKYA 3DBLB 2FWJA 3DUWA 3JQDA 3HH8A 2FZ5A 4HNUA 3ZGXA 2C2MA 1CULC 5P21A 4X90A 4Z1OA 4YTEA 3A37A 5GJCA 3QFCA 2V7PA 1DNPA 1ZU4A 2WM8A 2HFJA 2TMYA 2WF5A 3RLIA 3UT0A 2WNSA 2QX4A 1IK4A 3F3SA 4V03A 4WY8A 3ZE0B 5LIPA 1TVMA 4B71A 2WR8A 4P4LA 1PSWA 2IVFA 4IDOA 1RWNA 3P71T 4DIUA 4B6PA 5CX1B 1JIUA 3TDMA 4EGCB 5LUAA 4LCEA 4RF5A 1YBVA 2JBAA 4PLCA 4HFNA 4AUEA 3OZIA 1OCEA 2OWDA 2I0FA 3H5TA 4ZVVA 4E07A 2WOJA 4QXRA 3ZWYA 4WOBA 4PONA 3TSAA 1C7IA 2ID4A 1V5FA 2GK7A 4CM3A 1OB2A 5CT4A 5JSQA 1XLTA 3MYRA 2ZTUA 5DTQA 5LMUB 4Q5IA 4INOA 3HY4A 4GI5A 1JR3D 4P7FA 3W8FA 1FQKA 2EQBA 1E9RA 4TKUA 1PWYE 1TQ6A 3MWDA 3JQFA 3O2SB 4Q37A 3QQPA 5ALMA 5HM6A 1DHTA 2JJ2D 2VQDA 3F1KA 4M49A 1D4FA 3W6ZA 4PCAA 2QQ0A 1XNHA 3JQPA 1VBFA 1E0JA 1MOPA 3HYRA 1SIUA 2PT7A 1KI7A 1NXXA 2WFZA 3OFVA 1ZISA 2EIHA 1AB6A 1OTHA 2WNIA 1S3SA 2IKQA 1XQVA 2OFOA 2ZJAA 5TMEA 2QVCA 3QXGA 4KXWA 3AV3A 1IY8A 1H93A 4HEA6 3QPUA 5JLJA 3F6EX 3IBSA 3W8EA 1XDDA 5HDQA 1NW6A 3WTCA 3AHGA 3AOEC 3U4QB 1G20A 5A9SB 3PEFA 4IUBS 1E9EA 4Q7EA 1OIVA 4UM8B 2ZR8A 1F12A 1XXHA 4CCYA 1MB0A 4BX3A 4XTRA 4O63O 3ZNPA 3C41J 3Q98A 4IHAA 4RV4A 1FUKA 3TTVA 4BB6A 1CG6A 1I9GA 1TVKA 2HUNA 4OLBA 5DYWA 1C80A 1QSGA 4O4LF 5DRTA 1M72A 2QAGB 1PLLA 3WE7A 2FSVC 4GX2A 2BFDB 2CMFA 2YFQA 5G02A 2WY2D 2WZQA 3JSAA 5K8CA 1G5FA 3N74A 4RTMA 2VHZA 4D26A 1JSZA 4LE0A 3PUWA 4DIMA 10MHA 3GT4A 4JMPA 5ELLA 1NBMA 3BD6A 4IY1A 4OP2A 5K3OA 1VRWA 2H4JA 4K9NA 4P5DA 3T5CA 3WLJA 1TQ4A 1OGIA 4KE6A 3DZBA 3WYAA 4Y3UA 3FFXA 5ALDA 1Q1EA 3QFFA 3VX4A 3WQBA 1JEDA 4MW7A 4AMUA 4B4OA 3TDNA 1E3SA 1SUSA 1YU6A 4NYIR 4HT3B 1Z4MA 2YWHA 4NC9A 4JL8A 2V6FA 3FB4A 4O0MA 5BORA 4LC9A 3GFBA 5B7PA 4IH1A 4KR7A 4B2LA 1KO7A 2BMAA 3LCMA 4UHKA 4EG0A 4FBGA 3FPAA 1ESNA 2FWBA 1TYBE 1WHTA 4A9AA 4YJ3B 1JXOA 1K89A 1KRXA 4UBMA 1BG6A 2UYQA 4YWHA 3HKDA 5CW2A 1ECJA 1KVTA 3IP6A 5EIHA 5EUMA 1KZ7B 1P4AA 4D3XA 3FI9A 3CR7A 1OKKD 3KEFA 4UTRA 3NNNA 3HMKA 5CA0F 1VLHA 2ILVA 2JFGA 4BNWA 4WBNA 2DC1A 2C5GA 3I1IA 1WD7A 3HU3A 3IOMA 3N39C 4X94A 4L3VA 1KETA 3AH8A 3L4EA 2FKAA 1JILA 4MS3A 3WLFA 4IIJB 4WXMA 2H31A 2XCSB 2XMCA 1L7BA 2VAVA 2V7QA 2G82A 3M3DA 3RV3A 1ZD3A 5AXBA 5C8XA 1COZA 1EZZA 1RWBA 3RS3A 2PZMA 2PMKA 3GFQA 5SZKB 1JBQA 4BN0A 1E0SA 5A4FS 3SQOA 4EYGA 2C9ZA 3DOHA 5DOZA 1AO3A 3VO2A 1NBAA 2J3LA 1UAYA 2VVTA 4ZZ1A 3SICE 3O92A 4KIFA 4MI1A 1VZ2A 4WKCA 5LNK6 1KTVA 4M1ZA 1XKXA 2WJAA 1DRKA 2ZIGA 4XQ0A 1L5MA 1MG5A 2EJBA 3F8WA 4PE5B 4CN9A 3PGJA 3LRTA 5ITSA 1C3OB 1UINA 1T2UA 4DN6A 4DYVA 1ZGZA 4WX2B 2IYOA 2P9YA 2QKYA 2CFCA 4XVQA 2XDAA 2HIAA 3RRNA 1XBTA 2HF8A 2O4CA 2PRZA 1G8AA 1PKXA 4DCJA 1RRMA 1RRCA 1A8PA 1LQTA 4J0HA 5DT9A 4MYHA 4OJYA 2BCEA 4GDMA 2WTNA 5C51B 3DC7A 3ONEA 1XZLA 1P19A 1L7MA 1WDLA 4WUTA 4E6PA 4AKHA 3IQEA 3JQQA 1SXJA 4ABYA 1DQYA 3R40A 2BRUC 4RXTA 3SYTA 4TV9B 4RHEA 1BMFD 4H60A 4HVCA 2I76A 4Z53A 4C4PA 2YYAA 2PRSA 4PYOA 4Q9DA 4BE7B 4ATNA 3AJ9A 3EE6A 3FSJX 3L8HA 2OGTA 2PFSA 1V3VA 1I51A 1J2UA 3C3AA 3PFIA 4PYKA 4R01A 1A9PA 4BBZA 4PYQA 2XZLA 1FS5A 1W9HA 2ET6A 4P0PB 2VI5A 2R8YA 3IUEA 4OXNA 1OLUB 4YA6A 4OQDA 4LGVA 1WDWB 3CZ4A 4Y7DA 4LY0A 4RD0A 4QKQA 3DM5A 2V9PA 2YS6A 1V39A 1DWOA 1ZJ4A 3CINA 3CH4B 3GRYA 3DCNA 3JS5A 1SC6A 4L15A 2D0OB 3B5IA 4OMUA 3LVRE 4QVGA 1JF8A 4U2GA 2Y99A 3HL4A 3QXCA 4H1HA 4HC4A 4UHBA 3UXMA 4JBLA 3S1SA 3HRKA 4M60A 1P7ZA 4RM2A 4RY8A 2Z58A 1PVVA 3D3NA 2H7YA 2Q3MA 3LHDA 3WNZA 4ZI2A 1VCNA 5FOQA 4UW9A 2GKGA 4PC1A 3HWSA 1B2RA 1VE7A 5NULA 4F46A 3OPMA 1RJFA 4EYKA 4OREX 2XWQA 5BW5A 1GGHA 1GA4A 2JA1A 1ZH8A 3K2IA 2JZCA 3L0ZA 5EXSA 5LXTB 4EHBA 3IAFA 4R2HA 1P6UA 3R3XA 2G9QA 4IHQA 4KWCA 4B3CA 3PQDA 1SU7A 3PDWA 2VUSA 3T7TA 2HO4A 2OILA 4KV7A 4RE5A 3TIFA 5IM4F 1U63A 2ZUEA 3W6PA 1G2IA 1VL1A 2SKEA 4TLEA 5ER6A 1EUDA 3MTQA 4D4LA 2JIOA 3OSZA 1XDSA 1RM3A 3QWFA 1NUHA 4AWBA 4C2AA 1LTHR 4S1OA 2O48X 3LC0A 4CQMD 2R8PA 4GO1A 5DP2A 3G8YA 4W1SA 1PT5A 2VT6A 1E6KA 2NV2B 2PQ0A 4UULA 3LRPA 3IDOA 5EUQB 3T0FA 1S02A 1XZJA 4BX8A 2FE1A 2QX7A 3DHVA 1SZDA 4OX9Y 1A8SA 3ZYCA 4Q1FA 1FFGA 2ADFA 2QDKA 3LC1O 3KQMA 1R4MB 2WJWA 2XBUA 2D2EA 3ANSA 4LBWA 1NI4A 3RYFA 2ETVA 2W48A 1GAJA 2YXPX 3BXHA 3FHJA 3L04A 3KAJA 3FKSD 3LI2A 4MQMA 4BO8A 1ZI8A 2R00C 1U7XA 2G9VA 1AHHA 3CN9A 4NU8X 1SU6A 4ZA2A 3PEWA 4QHTA 1UFVA 5GM2A 1G7RA 5BNFA 1ULAA 1E96A 4BPRA 4CM1A 2O5RA 4CLHA 3UXEA 3UUGA 1XAJA 2RD2A 3J7TA 1S8AA 3D0KA 2FWIA 2V5AA 2QU8A 3ONDA 4KPGA 3JR7A 3FMPB 2E1PA 3AF3A 3HV0A 1RYMA 1Z26A 1URPA 4FI3F 4PCVA 2Q2NA 2XD4A 3B7PA 2HHAA 4XCVA 3EXIB 4R4JA 4E03A 4N48A 1Q7EA 3C5VA 1JDPA 1HG0A 4BLRA 5AO9A 5J1TB 3ZI0A 1RQ7A 3LUFA 2XYRA 3OZEA 1O9HA 1Y8CA 1B6SA 1CDEA 3L0SA 4R9RA 5LPNA 2HD4A 4KEAA 3TTWA 4D5EA 2GQ0A 2ATVA 3W78A 1W4RA 1AZTA 4ZAVA 1MTZA 3JVIA 3OQIA 1M74A 4LDPA 1WDMA 2IP1A 3IBCA 2NU9B 1A9YA 1EE2A 3DFKA 2FPGA 2IOFA 2Q5OA 3M70A 4I9HA 2AIRA 4IDHA 4MUBA 1YJCA 2AFVA 1BZYA 1ZXBA 4CEIB 5U9CA 5LFAA 1ECBA 1R3DA 3VQTA 3ADBA 5J4VA 4GMFA 2HRCA 1O7JA 4OXQA 4YY3B 1MVNA 3PJFA 2CYCA 2QAIA 1DIRA 2YWXA 4G5OA 1Q20A 3SN6A 2Y3IA 2C77A 1KJNA 2JI7A 1E0DA 1JEOA 3S3TA 4G0YA 1IOLA 1QANA 4G0PA 3NALA 1BDIA 1Z5NA 2DGDA 2ZAGA 4ZVOA 5JPDA 3AVOA 2FSFA 4H3HB 1W8IA 4K2AA 4HJXA 2PX0A 4J91A 2J31A 2X8JA 3K2BA 4IDFA 1CZOA 4WECA 4YH1A 2WYWA 2FSPA 3OVMA 1NHGA 1UBOS 3FNGA 3A58B 4DQLA 3PTZA 1PDWA 2GN9A 2JHAA 5EUCA 5EKDA 2CBXA 4QUDA 1KK3A 2AN9A 3QPDA 4H31A 3ED5A 2KE5A 2R6DA 4UATA 1GUBA 1H66A 4P5EA 2CNKA 5KTYA 3S8MA 3R5TA 1QS0B 4YMUA 1WVMA 4Q9AA 1J1IA 5TPZA 5JAUA 3WIVA 1VRVA 3ZWDA 3V8EA 2Q3JA 3BGIA 1YOBA 4HX9A 1X0VA 2CWDA 4BNNA 3B48A 2BMJA 1LA2A 4N5LA 4ZCIA 4EPVA 4BASA 1M8PA 4WESB 5B1HA 1SQ5A 2O3SA 1RWWA 4YV7A 3WL7A 4KMOA 4LSZA 3WLTA 4AMBA 5EERA 2IX3A 3AUUA 4FR2A 4MV9A 4HDSB 1Z8HA 2PS0A 5B58C 2YWEA 1R0ZA 3HN6A 1X8LA 3A05A 3L1JA 4HLCA 4EW1A 2XF8A 2ZE5A 4NARA 1DC6A 2IZ1A 3BFJA 3BS4A 3GD7A 3NONA 2XIJA 3R41A 4WKPA 4B9EA 5AVWA 1RI2A 5SZHB 2DR3A 2PM8A 1TA0A 4RH3A 5IYZB 2C2GA 5A71A 5JJKA 1B16A 1GZ5A 4I19A 1LNQA 2GPAA 1FDTA 1T3TA 3QPVA 4CQLB 4NXMB 4MKZA 2RGAA 2XEXA 2CDAA 3DDZX 1M0SA 1U1EA 4UUOA 2NUPB 3EG9B 2YV5A 2AMJA 1HMYA 1Q50A 4YRQA 1CYDA 2GNAA 4M98A 5JBIA 4CM8B 4EB6B 1GQOA 4PBTA 3I1JA 3FGNA 3S2UA 1U90A 1Y9EA 5FR1A 4C20A 4RIFA 2PZAA 1UFQA 1C3XA 5EJ2A 4AP6A 1COWA 3MFYA 2GERA 4MPPA 4LV6A 3JCZA 4GE3A 4QICA 3S7TA 1QFMA 3UMMA 4C7OA 1D9XA 4LDAA 1TPYA 1X7YA 3E0XA 1P33A 5CK4A 1CJTC 1V8OA 1BJTA 2OBXA 2P3QA 1MT0A 2ZRPA 3LZ6A 3OHPA 1HQKA 2GO1A 3ASZA 1RFGE 3CVVA 3M4XA 3SJZA 3RADC 2QRHA 4QUGA 3BHNA 3LDGA 4JT8A 4FILA 3TLCA 3RSGA 5HS4A 1V7ZA 3HRHA 1KPIA 2ZYVX 4KK4A 2F43A 3AR2A 3G0GA 4TL6A 4L1KA 4U3JB 2IXEA 1VG1A 1Q19A 4Q9NA 4BC0A 1NE2A 2E55A 2P3LA 3WHPA 3WDMA 3GUZA 4KUHA 2VQ6A 1K0UA 3WIBA 5KQGA 4RFSA 1AA9A 5EE0A 5CGQB 1UEIA 2E6KA 3RUPA 4D9HA 1YC2A 1ZAKA 2XYPA 1SOVA 3UIEA 1NZFA 2XA9A 1Z5ZA 3OPVA 1YMVA 1QHNA 4ARUA 1RJ9A 2Y77A 1T3LA 1UMDA 4MLDA 5FNVB 3COJA 4N76A 4XI9A 3A3NA 4EWLA 2G4VA 1VI5A 4LN1A 1ZVVA 2BW0A 4M8SA 3TEMA 1U11A 3EMVA 4L51A 4LNHA 1LWNA 3EWAA 4O2BB 5B57C 4XQCA 3FUCA 4OGFA 3IERA 3IQHX 4HQ6A 3LX5A 4KXNA 4O4JF 3SJCA 2AL7A 4AIRA 4E5SA 3R5FA 3RT1A 1YMQA 4DCPA 1DC8A 3CVOA 3FBGA 2CXXA 5ALWA 4YP6A 3RV4A 3OURA 4GT1A 1A7UA 4BQNA 3E9RA 1C7EA 1Z6XA 2PMCA 4PHHA 4BBPA 1MAAA 3PTAA 1XJWA 2FPIA 2Q9AA 4GPTA 1NG9A 1MH1A 2HCBA 4AFNA 5G0UA 3N28A 2ZQ5A 4EA9A 5CNIA 4JLPA 3E2MA 1JA1A 3EF0A 5BW8A 2GS9A 1ISMA 3CZQA 1VDMA 1R4AA 2JHGA 1M7BA 1QFZA 1WPGA 4RMIA 1B1CA 2X8WA 2ILTA 4PLWA 1S2GA 4ZV9A 3K6RA 4HDNA 4R1TA 3HKCA 3KWJA 1E9CA 2YUIA 4KQXA 3G0OA 1C7FA 2D59A 3L77A 1FDOA 2WG1A 4MV4A 4V0NA 5EZQA 3JQ8A 2E0IA 1DFIA 3DF7A 3N87A 1Y6QA 3AY6A 1IBLB 2IPLA 3B9RA 3FLBA 3N70A 3ZZNA 3NWOA 5DM60 2Q46A 3ZK9A 1VB3A 2WAAA 4GDFA 2AN5A 3H9UA 3MZ0A 4XWYA 3OPNA 1QAQA 1U2DC 1YRLA 1UPTA 2QRNA 5DBOA 5JG7A 4G97A 5B3AA 5BSMA 2XF2A 4R9UC 2HRZA 3LCUA 4WWHA 3TGWA 4YUXA 4DR1B 5IFKA 1TM4E 5JYCA 4ES6A 1SRQA 1SHLA 2PMDA 1QO7A 4YJ3F 2DWUA 3AHIA 1VKNA 1OX4A 2Q8NA 4QBGB 1DX9A 4TKLA 3REQA 1WW3A 2ZUTA 3ZWKA 5T4FA 4BCCA 4QXOA 4RPJA 4JUCA 3RW9A 4HD8A 1XALA 3G2LA 3KXKA 5DWVA 1OYYA 1W4ZA 2VJMA 5HWSA 1EINA 1C41A 1R8JA 2O8BA 2OEPA 5J43A 4IZIA 2HJVA 5HYVA 2FUG1 3HNPA 4NAVA 4FS3A 2WWGA 5FPQA 2HCJB 2VWHA 3B3JA 2FG7C 3EXAA 3GEDA 3DV0A 4IIJF 3OPYA 4OAQA 4S0XA 3PP8A 4BHTA 2WZCA 3QENA 5HMMA 1N9KA 1PNVA 2HMSA 1UOEA 3MYYA 4FHZA 5HFNA 1E63A 2DFLA 5FTJA 3GRAA 2DX7A 1PCXA 2A5YB 3GHHA 1IHXA 3K5IA 3HA3A 4MIYA 1NQWA 3C6KA 3BZWA 3RFXA 5HIMA 2G77B 3VVLA 2VYVA 3ZY3A 4BV2A 2ACVA 2IDZA 3FPFA 1XPRA 4NV0A 1KSGA 1T6XA 1OHHA 1C1DA 2DKOA 3B1XA 3G9UA 1EWTA 4LYHA 5A06A 3AYXB 3SC2A 4NHEA 1K3UB 1U8CB 2VQ3A 2YMPA 3OOHA 1MZVA 2I62A 3QH4A 2W0SA 4D42A 3H1PA 3CWQA 1AUOA 1PZEA 4YACA 1G5RA 2O3RA 2QG4A 4IXWA 4EW3A 2JFNA 2Y76A 4G4GA 4CFSA 3DMPA 1KEZA 4CTJA 1UC5B 3S2ZA 2GUGA 4ZIRA 4BQRA 4PAGA 2XWSA 3I5UA 2O4UX 5F1PA 2ZRQA 4YCJA 3UBMA 1NHWA 3KL2A 4AP5A 3F6BX 5I8ZA 2C3UA 1U8UA 3OBBA 3M1LA 4TV9F 3MQ2A 4D92A 5C8ZA 3R8FA 1MFPA 1KWKA 3PT5A 5F77A 3ROKA 1KA9H 2QYHA 3RUFA 5K7SA 3COWA 4I0WB 4ZVKA 2J07A 1R4NB 1WV1A 2O0MA 5AKIA 4MWSA 4TKZA 4B3XA 4LF7B 3DZHA 2W0MA 1SOMA 3CRZA 5C3UA 2DUMA 3FDFA 1A88A 4KPYA 1PJLA 4MI3A 1KVUA 1Y0BA 3AONB 2OZKA 1STOA 4Z9AA 2ZXUA 5B2EA 5FBLB 4LAFA 2VJCA 3NPAA 4I8DA 2QVBA 5T64A 2X0FA 1R5BA 1PV2A 3KT0A 3TRJA 3KSBC 2YN2A 1AS2A 1AKQA 1RC1A 2BLLA 1SCUA 4PC7A 4JOSA 1YJAA 2R7MA 4LYJA 2ZI9A 5H3LA 2ASVA 4CKWB 2GK4A 2EJWA 5DNUA 3KJQA 1Y5LA 4AQ7A 1J99A 1TCCA 4F5ZA 4TLLB 4RKRA 1TJ5A 4QUBA 3NHYA 1K4YA 5DGCA 4Z4CA 5LP6A 1RM4A 4OATA 1W88B 3CW8X 1J1UA 1ZSNA 2FW8A 2WYOA 2Q3HA 3GLRA 4RZHA 1U1FA 4BJHB 5ADHA 4IGEA 3HJRA 1IWPB 3GXOA 4TYPA 1Y1SA 3FIUA 3GQBB 5BV8A 2VKQA 3QEMB 5JTTA 3PVCA 2YVAA 4QNNA 1F0NA 6CHYA 2I7DA 1Y8RB 4EEXA 5KB3A 4IVPA 3JQRA 1J8YF 1GWNA 2PGOA 5ITZB 2IXAA 4LS3A 4DLYA 5K6RA 3QX9A 4PLHA 4ZTUB 2QP9X 1GT6A 4TKMA 1XL0A 2VHUA 3CX8A 1IY9A 5DGHA 3MJEA 1ZVQA 2FJ0A 2LNDA 2QRPA 1Z75A 4J1QA 1ZHFA 4UJ3A 3TE7A 3D8BA 2BRUA 4PR3A 5ESRA 4AJPA 5CLHA 1X86B 1GDTA 4RD4A 1U0NA 3VKFA 1Y98A 3D0RA 5LKRA 5J2TB 4MUEA 1YU9A 1Q16A 2VAPA 2XB4A 3C1UA 2O2CA 3W4IA 3L2OB 1ZS9A 3NBQA 3D31A 1NDQA 1TDJA 1RSZA 1XTIA 3AFIA 1VJCA 2X6TA 4WK2B 2QLLA 5DN6D 3SF8A 2QLMA 3JRWA 3AHDA 4W1PA 3QEJA 4M46A 3WTBA 3HUFA 2VH5R 2H0AA 1XD9A 3S44A 4RQTA 3I2YX 5F9FA 3LO8A 2X19A 2ZM5A 2QIOA 4IDGA 3R0JA 4J0CA 1D1PA 4HKTA 4Y1FA 3THOA 4B84A 1RXVA 4XGRA 2DFPA 4LZPA 4S05A 4B33A 5IJWA 4EAQA 2BEKA 2LCFA 3BHMA 4GP6A 4RS3A 1QJCA 1ZH4A 5CURA 3RT7A 1WF6A 4HRXA 4TZTA 5FTNA 1L4NA 2OORC 2YC4C 3WLOA 1X0XA 1GEEA 2I5PO 1XPJA 1ZN8A 3LT1A 6LDHA 1QAMA 2BFNA 1T2EA 4CR6A 3RM3A 1E32A 2W2OA 3ZHYA 3GGPA 4FOOA 1XYVA 1IEQA 3HCBA 3PXBA 4R2MA 4Y6SA 4Z51A 4EFDA 2JJ2A 3B36A 5JEEA 2I4MA 2WMYA 1EDDA 2C00A 1EFPB 2P5UA 3CNBA 4TLDA 1R6TA 3C4QA 3VFDA 3DT9A 4BEVA 6REQB 2GAAA 1R0RE 2CKMA 3PC2A 5I5EA 4HAYA 4L7VA 1Z2AA 1SR8A 3Q6MA 4ZT2A 4IF6A 4HMQA 4U02A 3TNFA 6PFKA 2FMHA 5IC6A 5IVHA 1TECE 3IRUA 1XCLA 2A9RA 1FTYA 2HK8A 3DAYA 3H3XA 4EKGA 1OXSC 1UEJA 1YZUA 2ZETA 4K9PA 4RPIA 5EG5A 1Q44A 2ZJ0A 3V1NA 2QD4A 1J7KA 3EAQA 4DKXA 4Y6LA 3CE9A 2PMEA 2HLHA 4O0LA 3R7BA 2PHZA 4CE6A 3IP9A 5KYWB 1I7SB 1KZHA 3T95A 3SVZA 4UU8A 2PXHA 1ISJA 4QATA 4DIFA 3TNLA 3QE9Y 1TKCA 4KACA 3M6AA 2XAUA 3GRZA 4PLPA 4FR0A 5ERYA 4CLOA 2GAJA 5CU7A 5DNCA 3AI3A 2XUFA 3N53A 4GOLD 3ZZ0A 4OGWA 1XU9A 3D5TA 1Z15A 4AU1A 1OV6A 1Z0KA 3U3RA 3H16A 1GKKA 3AILA 4JGGA 4CT5A 5H4GA 1NONA 4LOHA 1CY7A 4M87A 3RU9A 5KDLA 3CX7A 4N0MA 1PEAA 2WEKA 3V4LA 2WJZB 1TKAA 1SBYA 4JK3A 2GEFA 2OSBA 3EVNA 1V8BA 4X62B 5D3MA 2DWQA 1EVQA 5C7OO 1FYVA 1CVIA 1HDOA 1NVAA 3ZNNA 2PVSA 1E89A 1SVOA 4EF6A 1OPXA 4AECA 4GEKA 1CHDA 2R1TB 1QQTA 3AMVA 4NBKA 3GOQA 1A2BA 4LXUA 2YWJA 2FFQA 4PVDA 4RIGA 4Y2GA 4I9NA 2ZSBA 2PUCA 2XGSA 2D5LA 5EIFA 2EOAA 3M4JA 3QI7A 5JLAA 5DB4A 4Z2AA 4REQA 4DC1A 1SC1A 2CLHB 1F14A 2AOTB 2OK7A 2XCUA 3BDIA 3G23A 1OKKA 2XMDA 3AERB 4KPUA 2R8ZA 5IYZF 1QQBA 1IXRC 4JKYA 4JFRA 4OHMA 4NNPA 1MUUA 3JAWA 4MW5A 5JYEA 1YDEA 3ZTWA 4NCJA 2XHZA 1FMTA 2AOWA 4ZC1A 3W5VA 2ZJOA 2UU9B 2J3DA 4JUDX 2OG2A 2XTJA 3E84A 3K73O 1G63A 1WWKA 5TQ0A 3ZWNA 1DAIA 1X1DA 1UJ5A 5T8KC 4JWTA 4FHGA 2A3RA 1U81A 2W6ZA 4R5HA 4L5IA 1GTSA 4D3YA 2PA0A 3ZLJA 3WDLA 3ERCA 1XTJA 3AEQA 1HZZA 2QHXA 4X8OA 3E0QA 2CLCX 1DWUA 1DEXA 3MBOA 4IGAA 4IDDA 4GBED 4WXPA 1YIDA 3MT8A 3P52A 4GRAA 3A4NA 1YB6A 3HO6A 3JX9A 3QELA 4ZP1A 5A6SB 3D6JA 3GD5A 5A05A 1CQWA 3NAQA 3TCKA 4F0JA 1N6PA 3SOPA 4JWKA 5BMOA 5M29A 4TV8B 1NUUA 4ITRC 2HJ9A 3TM5A 1R6UA 1EBFA 1R5OA 1ZK2A 3GRFA 3RIXA 4LZZA 1L5KA 3WWPA 2H07A 1B15A 2NXWA 3UWPA 4R6XA 2WDZA 3AF1A 2HNAA 2FA9A 1QQAA 3CR3C 2JZOA 2BDEA 3L01A 2ZWPA 3ZLBA 1VFPA 2VHWA 2JK1A 5AQEA 1NP3A 1U5BB 3UANA 1Y6FA 2D2FA 1WABA 1TK3A 2FPUA 1OH6A 4TWBA 3SKVA 1BMTA 1BMFA 3I9MA 4TPKA 1MRSA 5FNVF 2JJ1D 2HUPA 3SJ7A 3M6IA 4UUBA 3DC2A 4C0WA 4BY9E 3TR0A 2QTLA 3MD9A 4U00A 3LCVB 4HNSA 2KW5A 2H63A 2CHVA 13PKA 3B3AA 1CUYA 4O2BF 4MCJA 3CCBA 1SRRA 4Y6PA 1CSEE 1DJMA 2CNLA 2NUTA 3UMYA 1KXJA 1ECFA 1XVAA 2RGGA 1TT7A 4C4XA 4HVTA 4UASA 5AVUA 4FOPA 3B52X 4GRIA 3BBLA 1GN8A 1VHJA 4AZSA 3G88A 4D46A 1QX3A 5GADl 1H5QA 1XRSB 2P0YA 3AKEA 1JFVA 2A5DA 1K9SA 1BJKA 1ADJA 1U9IC 2BGMA 2EP7A 2FQYA 3A1DA 4UTVA 3EARA 2R66A 1QGZA 4J0EA 3DKKA 4V0QA 3VPAA 4CUJA 4I4IA 1IPHA 1CLUA 1WLYA 4RHCA 4EPWA 2FJUA 1JHDA 3RF7A 1YB5A 3SQDA 4V2IA 4PHTA 3BGWA 3OZDA 3LS2A 1DDGA 1XROA 5DSZA 1HMPA 3FMIA 4BGEA 3MJFA 1QKJA 1DIOB 3MINB 4O6VA 5CH8A 5C18A 1QKIA 1UMBA 3TKYA 4V2UA 2XKKA 1Z3IX 2DBQA 4BGDA 3U7GA 2HCFA 5KZMB 5K3CA 2OCPA 1F3OA 3RS4A 1VFNA 3AB7A 4CF3A 2GXQA 5JECA 1M1YE 2FZKA 5AK6A 5KINB 3OZ7A 1XDBA 3DOFA 4BB0A 1NV9A 4CQMA 3C97A 1PVOA 1GUAA 1K3TA 3KAPA 4C3UA 2OHIA 1MAUA 4ASUA 1ZNWA 1EK1A 1Q7BA 3ELBA 3MELA 4EBFA 4EI8A 2FXVA 2J0VA 3FM9A 2JGKA 4KQWA 1SG9A 2J7KA 2YMQA 5HRCA 16PKA 3WGQA 3OZWA 2R2AA 3QY0A 4TN1A 4II7A 4WN3A 4XKJA 4HGOA 5B64A 4DDKA 4E32A 4JNKA 2JI9A 3EVAA 3FKSA 1GSOA 1KVRA 2VPTA 5BPFA 1G6HA 2G83A 1HNNA 1GPLA 4PRZA 2P9ZA 3R75A 3W06A 5JY1A 3WLMA 3IDQA 1SQ6A 3B5JA 1GPUA 3QVMA 1T15A 4INPA 3U44A 3HXOA 4Y9RA 2YIDA 1RJDA 4BGIA 3H5RA 3IPAA 5TT1A 3COPA 1E2PA 1UOOA 3JWJA 3Q7PA 3RUCA 4AG6A 4BNMA 1EZ4A 2JAXA 4QJ5A 1FW8A 4QT4A 1HOXA 3TG8A 1KP2A 2J30A 2BF7A 1FEZA 4QDZA 5H16A 4ERXA 2PKQP 5HUJA 5G1OA 3ZWOA 1P1IA 3HBLA 3P7MA 5JNRA 1NM5C 2R5FA 1KEWA 4GXNA 4YRCA 4YASA 3UFBA 1WXFA 2AG5A 3IR6A 3BILA 1B26A 2VDVE 2HN9A 3FWHA 1P8JA 1YONA 3FZQA 4OB8A 2HZBA 3WLAA 5IWAB 1F8XA 1P3Y1 1WR8A 3AM4A 5EWLA 4A23A 3CVUA 1CP3A 2WIFA 1UXKA 3EASA 4KXLA 4G1MB 3T38A 4H4CA 2RBEA 3UAGA 2V7EA 3BFKA 3CEAA 2PBRA 5D01A 1DO2A 4Z0HO 3HDYA 3R3VA 2BFAA 2PZFA 1GZDA 3CX4A 3QYFA 4HF7A 4ND8B 1MV5A 2PKWA 4RO0A 3U37A 1T25A 1ADYA 3E23A 5K8JB 1WU8A 2AJTA 3FCSB 1UQTA 2VJKA 4LJLA 4RVUA 4YRNA 4CFZA 5MN4A 1Z36A 4WSOA 2Q5EA 1KZYC 1RCUA 2FPPB 3LOUA 3BSWA 4ISBA 3ZGZA 4AF7A 4DM4A 1EP9A 2H1HA 3BMCA 2HIHA 3D3QA 2A0YA 3RS8A 2B98A 1UWVA 4PQGA 1YS1X 3YASA 4C7XA 2DFTA 1PR4A 3IUNA 3LBYA 4RQUA 1BE8A 5HKKA 3P9NA 3DKIA 3QBTA 1THGA 3GLUA 3H75A 3D0QA 4JYZA 5KSZA 5U1PA 1XG5A 2IE0A 1WTAA 3FROA 5JSZB 3T9FA 4I5EA 5A03A 5IULC 1K6MA 3ME5A 2X2OA 2XGGA 4LC0A 1ZKMA 2H16A 3WHLA 4LE1A 3UJ9A 5TF0A 2Q4BA 3D7RA 1HM5A 4KU4A 2E1RA 4N3BA 5K5EA 4AZ3A 3OETA 4DA9A 3Q8MA 2E49A 2IRWA 4MR7A 3TMKA 2PE5A 3ET4A 3KPVA 1XWFA 2FF7A 3QOXA 3NKVA 1KKLA 3KJHA 4PPYA 5L51A 2PZLA 2PTHA 3OH8A 4JROA 4B3DA 3CE6A 1GVNB