1V9SA

Crystal structure of tt0130 protein from thermus thermophilus hb8
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
208
structure length
199
Chain Sequence
MRITLVDHPLVQHKLAHLRDKRTGPKDFRELAEEVAMLMAYEAMRDLELEETTVETPIAPARVKVLSGKKLALVAILRAGLVMVEGILKLVPHARVGHIGLYQYYIKLPPDIAERRAFLLDPMLATGGSASLALSLLKERGATGVKLMAILAAPEGLERIAKDHPDTEVVVAAIDERLNDHGYIVPGLGDAGDRIYGTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords uracil phosphoribosyltransferase
publication title Crystal structure of uracil phosphoribosyltransferase from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
total genus 47
structure length 199
sequence length 208
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.9: Uracil phosphoribosyltransferase.
pdb deposition date 2004-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14681 UPRTase Uracil phosphoribosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1v9sA00
5HIAA 1W30A 3O7MA 2H06A 4RHUA 1G9SA 4P86A 2P1ZA 1DKUA 4RQBA 3DAHA 1I0LA 1R3UA 1GPH1 1QCDA 4RADA 3DEZA 3LRTA 3NAGA 1UFRA 2DY0A 5EUCA 2HCRA 4PAWA 3MBIA 5KAPA 1DQPA 1VCHA 2H08A 2JKYA 5JSQA 1XTVA 1XZNA 3GGJA 4MB6A 4P80A 1O5OA 1P17A 3ACDA 4RABA 1MZVA 1L1QA 4PFQA 5BQPA 1BD4A 1G2QA 2XBUA 1ECJA 1A96A 1HMPA 4LZOA 4WMLA 1I5EA 3ACBA 4WN3A 2JBHA 3ACCA 3DMPA 3N2LA 4RANA 2VFAA 2GEBA 1STOA 3OZFA 4P84A 1ZN8A 4X44A 4M0KA 1A3CA 4LZNA 3S5JA 1NONA 1P19A 4IJQA 5IPFA 1A4XA 4RHTA 3OHPA 5K51A 1UPUA 2EHJA 2YZKA 5JV5A 1XZ8A 4RAOA 3OZGA 1XTUA 1OROA 1XTTA 1ECGA 1G9TA 1P4AA 3LPNA 1Y0BA 1I13A 2E55A 4LYYA 4Z1OA 1BZYA 3QW4B 1LH0A 1QB7A 4RHYA 1YFZA 1U9ZA 1ZN9A 1ECCA 3M3HA 4QYIB 4QYIA 1G2PA 3EFHA 1V9SA 1QK4A 2FXVA 2C4KA 2PRYA 4P81A 4RHXA 1QK5A 4P82A 5KAMA 1J7JA 3HVUA 5HKLA 5ESXA 4RQAA 4RACA 4ZFNA 4TWBA 3MJDA 1OREA 1Z7GA 1JLRA 5E38A 2PS1A 4P83A 1DQNA 1CJBA 3GGCA 4QRIA 1P18A 4FYMA 2WNSA 1TC2A 4S2UA 2AEEA 4LZAA 2JI4A 1DBRA 1OPRA 1ZN7A 1QK3A 1D6NA 1I14A 1HGXA 4F8EA 1UPFA 1ECBA 1DKRA 1I0IA 1O57A 4M0PA 5BSKA 1IBSA 4LYGA 1A98A 1FSGA 5IAOA 5BQOA 1JLSA 1QCCA 4RV4A 1A97A 1U9YA 5BRNA 3GEPA 1WD5A 1GRVA 2H07A 2IGBA 3G6WA 1TC1A 3KB8A 1QB8A 4JITA 4OHCA 4RAQA 4M0UA 2PRZA 4KN6A 1PZMA 1BD3A 5ESWA 1AO0A 1A95A 4JLSA 1ECFA 2JKZA 1L1RA 1VDMA 4P3KA 1NULA 1VSTA 4X45A 3H83A
chains in the Genus database with same CATH superfamily
3LXRA 4K9PA 3OSUA 3NS7A 4EMBA 1FMLA 2JCXA 5K0SA 2WMYA 3JZDA 4CKEB 4D9NA 5JSYA 2CUZA 2CBGA 2R4QA 2XSZD 1OF1A 2IEBA 3ENZA 3OM8A 4WFQA 3SZUA 4P2GA 3X43A 5AD1A 2XQJA 4MYRA 3PFWO 4DQUA 3WBBA 9MHTA 3D5EA 4BP9A 4EEKA 3SZGA 3BH0A 5ULLA 2EIHA 1GCIA 2DKNA 3NDIA 4R9SA 4IWYA 1CRWG 2ID8A 5JR3A 1N78A 5KWIA 1INLA 2C88A 1QRSA 1NXWA 3C7DB 1F7VA 4M1WA 5K4HA 5TF4A 2NZ2A 1XROA 3BYZA 4U2KA 4UMFA 1XVIA 2FQYA 2WVJA 2ZE7A 3HO6A 5LC1A 4FONA 2UYQA 2AFIE 1OCEA 1IB0A 4BVEA 2YV5A 3C2QA 3RRFA 1RMQA 4ZVOA 1J9EA 4S35A 3RRJA 5JZMA 3EHDA 4CU2A 2H9IA 4RD0A 3UKDA 5B3JC 1T3SA 5FEUA 4Q7LA 1DRJA 3CPJB 4IKPA 2QL7A 1GGHA 3MCUA 3WHIA 5FV4A 5CCBA 2HT1A 3PQ7A 3H2JA 5SV2A 4EBBA 1U2SA 4QELA 3I01M 4Q3LA 4A3SA 2DR0A 4WGGA 4ZOEA 3RTEA 3WYFA 5IPFA 1JKFA 2V7QA 3EG5A 2GYYA 1M6HA 2YYSA 4L0MA 4AQDA 4PYRA 3HCRA 4J1NA 4JVLA 4PXYA 1TGVA 2ATEA 3D8SA 1LLFA 1QANA 3T3EA 2D0PB 4M9XA 3PHGA 2WTNA 1XA3A 2AH5A 2H00A 1YD7A 3EVZA 4UUOA 1DL5A 1UBNA 2A0XA 2EEZA 3WK5A 4F06A 4RNCA 4C7BA 3CVVA 1T9BA 4HEA1 4P98A 4BB9A 2WV7A 3DSRA 4AJJA 4S2EA 2JHAA 4AF8A 5F7XA 4O02B 2WIFA 1QR6A 4GDMA 4KQGA 1UDBA 1WMSA 3OJLA 4QYIB 3TCKA 1FRFS 5IEJA 1MU0A 3FCSB 4O0MA 1A7JA 2Q4DA 3AYZB 4UHJA 3CU5A 1ILEA 1KZ1A 1RU3A 4JT2A 6GPBA 3AHDA 5FIUA 3IP6A 1CQIB 1XLUA 4DRXA 1MJGA 5TR9A 4J0IA 4P1ZA 4PZYA 1EG7A 1X1CA 4DG8A 3MTAA 3ILVA 4Z6KA 1C9YA 2ORWA 4FILA 5EXTA 4H9GA 1WBJB 4I8XA 1QR2A 1V4VA 3CSDA 4OUKX 3T7EA 2CZGA 4UUQA 2Y2VA 3TZBA 4WBNF 3GGCA 5CXXA 1Y33E 2HSZA 4RL6A 4BKUA 4YV1A 2OQ2A 2PV0A 2D1RA 4R2MA 2H5LA 4B0OA 2B1GA 1OFGA 3DZDA 4RTMA 1MG0A 1H69A 3LGXA 1QS0B 3AHJA 2FE1A 4MVXA 3ZLUA 1TQ8A 3ILXA 3WWZA 3ILYA 5IU6A 4AJPA 3IEIA 2XR1A 2HX1A 3DLIA 4TMTA 3G5MA 2Y1WA 3JQFA 4NEGA 5SY6A 5JCOC 5KPJA 1JZQA 3QMMA 3SGLA 4ZODA 1R5OA 2GH1A 2ZJ5A 4N5IX 4BAGA 2ECQA 3D0OA 4OQYA 4CWAA 2QUZA 4RIIA 4KE8A 3QVLA 1Z16A 4DXDA 3AO0B 1KKUA 1GGJA 3U62A 3ZHQA 2F2TA 4LDPA 3AW9A 4QJIA 4QAQA 4NFYA 1KZ9A 2WAMA 3EC2A 4G1CA 2TYSB 1E60A 4MWEA 4Z4IA 4FFPA 2VPWA 4YJGA 5LQJA 2BFDA 1QO0D 2ONZA 4FFWA 3K9GA 3R3WA 2I6FA 1L7AA 2JFBA 2F8MA 5GZ3A 1N25A 1Z3IX 4IVQA 3PXBA 5B30A 2FLKA 3OIUA 3MWJA 3WWCA 1L7QA 4A7PA 4ZYTA 1P9WA 4ZI2A 4X6LA 4PG4A 1HEIA 4MV4A 2JAHA 2VJOA 3FLMA 3O31A 1P5HA 4BMOB 4E88A 4KTVE 2H4HA 2K7ZA 5ENDA 3I12A 2LCQA 1J21A 5C32A 1G55A 2JAPA 2WUGA 4QOSA 1KVSA 3L79A 4YP0A 5J9FA 1QIIA 4C08A 3WYDA 1H2EA 4ZHSA 4HXGA 4NICA 5GVSA 3LWZA 3ZQKA 4D8VA 1E0DA 1NT4A 2TMKA 2FHSA 3SWWA 4RE6A 1WCXA 1LBIA 3WGGA 4U02A 3AEQA 3LMKA 3WLQA 3ZXIA 2LPMA 3EA4A 5C81A 1EVQA 3HZZA 3GLVA 1PUJA 3HCEA 4JBLA 1N2OA 1JTEA 4WAUA 1JVBA 5JH7F 5LLDA 2P65A 4AN1A 4ZRDA 1NUSA 2WU4A 3A1CA 5DN6D 5AOBA 2NO0A 3OFSA 4KYTA 3GH3A 1KAOA 3KZMA 5EE1A 4UNPA 1FU7A 3EUWA 5EE3A 4R2KA 1NZJA 2ENWA 3IA2A 2X86A 4R54A 1C9KA 1WSWA 4MICA 5FWXB 5SY9A 1KYYA 1TT5B 4I55F 4P4NA 2X1LA 1G66A 3EH1A 4JJAA 3AKCA 5G1NA 3OOJA 1AKEA 1JMYA 2ZKLA 4LVCA 2PZKA 1J2TA 1OQAA 3L5OA 1AZLA 1PQYA 1TUBB 3DOFA 3M5WA 3O21A 3DQZA 3W6ZA 2ZCJA 3LY5A 3I3SR 5H8WA 2ZI6A 2WTBA 1KO1A 4KVZA 4P22A 1IJEA 3ITDA 1SUPA 1MIOB 3U7RA 2BE9A 2NQ8A 5EP1A 3X1KA 4G97A 1CEYA 4U6QA 4KZKA 4LYDA 3K7EA 1KDZA 1WDLA 3H7AA 3ZE7A 1OBVA 3CN9A 2UUCB 1DKLA 4LRUA 4R5HA 5J2TF 1SK9A 4QRIA 1YJBA 3K9WA 2JAQA 3L2OB 3FTNA 4DV5B 3VM6A 3K0CC 4TTIA 5C8DA 3O1LA 3TQSA 1XRQA 3ZNPA 3SHTA 4WK2B 4G4GA 1Z4OA 3BHJA 3FWKA 2R4UA 2YUIA 4YRZA 3FOFC 2VRNA 3H8VA 4U1RA 1P33A 1ZK4A 4GOND 3T5MA 5C51B 1D2EA 4B7XA 3DLBA 1RVV1 2C5SA 3F96A 3ROMA 2IOQA 1ZRSA 8ATCA 1LC3A 1E2EA 2R1TA 2OHVA 3DBOB 3H4TA 3DBHA 3ICWA 4GFDA 1KGDA 2XGOA 1LVUA 3V2IA 4D2IA 5KIAA 5JS8A 1G18A 1VFPA 4Q3CA 3GXBA 1KWGA 4QUBA 2Z3ZA 5IKXA 1L5QA 4JX8A 4DY6A 2GVDC 2ORVA 3FJOA 2YRXA 2HA2A 3OZXA 4JL5A 4YDHB 1J7KA 5AQEA 3VH3A 2R60A 5LXTB 2XV1A 2OLKA 4GH5A 3S2FA 3AB8A 3S99A 3OE7D 4B82A 1CV2A 1P77A 3EXIB 3R3VA 3GAMA 2YQ4A 3VPSA 4BZQA 2P4SA 3JD3A 2WJZB 5LP6F 4DLSA 3OQJA 2QSZA 4FSXA 4TMVA 3V1MA 3LC1O 4JYMA 2NYVA 1Z4QA 4XQEA 3RVNA 2UZ1B 1K5GA 1NQVA 1MO5A 4KRGA 4NCXA 4UKDA 1NA5A 1P0QA 3JWIA 4X63A 1O95D 4KGDA 5CA0F 3FWYA 2VDJA 4WD3A 3PLAE 1P61B 1XVTA 5G40A 4OQXA 3I5YA 2UZAA 4FP9A 4J16A 1BXRA 1XTVA 2G17A 4LY6A 1O5OA 2AX3A 3L1JA 1KZ7B 2Z2JA 3PBKA 4OLFA 4PYNA 1U8TA 5A0VA 4G63A 4IUBS 3GPBA 2EBUA 5AHRA 3JQ9A 3K2IA 4UXJA 3LS2A 1RMTA 3JARB 5F5XA 4MVJM 3S68A 5AOCA 1D8TA 2OC4A 5DHAA 1ESDA 3A26A 1IZ9A 3HA3A 1X92A 4DSOA 2FAXA 1Q50A 4MRRA 4UZFA 4NYMR 2ZJ1A 1NUUA 1TVKA 4JH0A 1P9LA 4XFJA 3WK7A 3ELYA 3NHRA 1IOWA 1X7XB 2XW6A 4PAOA 1M2NA 4CTJA 5TPWA 4R2WA 2CXOA 3FPLA 3QQPA 4TRRA 1ZO8A 2P2LA 3BGSA 3UJHA 1FW8A 2I22A 4M1KA 2HU5A 1NYTA 3IULA 1DXQA 4UHKA 2WJWA 4W63A 3ZCVA 3Q4GA 4FE4A 1NHWA 3DL7A 4K5QA 4P6VF 3H5WA 4BMCA 5EEHA 3GLHB 2ECKA 4GMDA 5A5FA 4G0YA 3W4KA 4W5OA 9ATCA 2GK4A 4X54A 5LWQA 5AVXA 1DLJA 1CTQA 1AUOA 4I14A 3VR6H 1MVOA 2YS7A 1E7YA 1KSGA 2XXAA 5T8KA 2PKQO 2DR2A 1GVNB 4JC5A 3VU3A 4F4FA 3ECAA 3MD9A 1ZXXA 4FYXA 3GCGA 4XSVA 1ZJ4A 1RHRA 4Q4JB 5IYZA 3NEAA 1F0KA 2YV3A 4EARA 4L5JA 5ICMA 2BM9A 2C78A 2LE0A 2VCHA 1OAOC 2NUTB 3HDGA 1GQYA 4TV8A 4YYEA 4FE3A 3FRIA 2RHLA 4Z2AA 5DLYA 4BLUA 4DCSA 1QYXA 1MKYA 3ZKWB 2ZBQA 1OREA 1Q20A 4OXKA 1GPNA 2F43A 7MHTA 3U39A 3O38A 2CNNA 2OXRA 3ELDA 1N7IA 2VO1A 2B0CA 4KE9A 3NDJA 5AM5A 3W3ZB 4LBVA 3WV5A 3ZCRA 4Q9NA 2XB4A 3TKAA 1UBSB 4LSZA 4M0DA 4IDDA 4LNUA 1QDEA 1NN0A 2OO7A 3WK4A 1WMFA 4K05A 5HBGA 3SXPA 1P0PA 5JROA 2AZXA 3VNQA 4CEJA 3AILA 2YRWA 1J0AA 1J8QA 1QFJA 3N53A 4HYYA 1SRRA 5T57A 3AHHA 1ISPA 1KYXA 4JAVC 2IHKA 3R3YA 4YTEA 3KFXA 2JIRA 4ZZ2A 3R7FA 4F2HA 5C1BA 3EQZA 1PR5A 1P7PA 1K98A 4LY0A 3L7IA 3DWIA 4P92A 3KB8A 4L78A 3WL6A 5J4VA 2AFVA 3OOEA 5CT4A 4P3XA 1KMCA 1ODSA 3LF2A 2H1RA 3ADOA 4G37A 1P5ZB 2AVNA 2C1XA 1HDXA 3JVUA 4KQIA 2RBKA 4X60A 5BN4B 1TCVA 3KQLA 1V43A 3L4EA 1GHTA 4J1QA 4UTNA 2Y6UA 4FZ3A 1B8OA 2FMUA 1OH8A 2GN9A 3DZCA 3AEYA 1NULA 2FFHA 3PNVA 4L28A 4MWGA 5AKIA 1VSTA 4GMKA 3SHOA 4GZ3A 1NJ1A 1EUYA 3FIUA 2X3FA 5M2QA 5LYJB 1NPYA 3KU4A 1MO2A 1BWQA 3KT3A 4O4IB 5AH0A 4ZAGA 5C5DA 4HLNA 1B43A 1N1EA 2PTHA 2VK4A 3K9LA 2NPOA 5AUNB 2ZZKA 5CPBA 1HLGA 1QIHA 1UMCA 5DNAA 3AZOA 4ZT5A 1U0OC 4L07A 3DAFA 2V45A 1KDOA 5EKTA 2KWIA 4H3KB 1P6XA 1RKQA 1WXIA 2G72A 3MJCA 4UVHA 3K0EA 5H70A 1GPYA 1CB0A 3PF9A 1JBEA 1HWYA 3TIVA 4EGQA 3GEEA 4DSNA 1IAVA 1SHUX 2NTYC 1PVVA 2Z30A 4EJ0A 5EHQA 1NX6A 5A2QA 3NJ4A 1RBQA 1C5KA 3C8HA 1Y6JA 2GNAA 1TJ3A 1DRWA 1FYEA 2L42A 4HLUC 4RTOA 4MUJA 4DRZA 1X42A 3F6RA 3IEPA 4PQRA 2HMVA 4MPTA 3L4SO 4G81A 1VIMA 4DKXA 1UAAA 2XUGA 4UDXX 4DIEA 1Z06A 2FSVC 4A0QA 1LPBB 1NI4B 1EVIA 3PFHA 5J1TB 1F60A 1LY1A 2QIOA 4Z4CA 1GCAA 5CDUA 2YZMA 1JPUA 4UNIA 1HYBA 4V3CA 4DLRA 5HK9A 2HV8A 4M1SA 4XPIA 2GF0A 2R5WA 4EY7A 1VCOA 4WBNA 2HA3A 3PXUA 2QE7D 3WC4A 2O54A 3QUAA 5D7NA 3BEOA 4CM1A 3UB3A 2QP4A 1RWOA 2A67A 4I7EA 1KDPA 4Z1OA 5B6IA 4YRFA 1AJEA 1T9ZA 4EPXA 1HEUA 3MTJA 4NAHA 3W05A 1FFHA 4MR9A 3Q2KA 3TH5A 1VL0A 3EMVA 4DCVA 1A7UA 1Q0PA 1SR8A 1ODCA 2XTMA 4ZU6X 1O96B 1Z68A 5BNIA 4UAUA 5IAAA 1AQNA 2DUNA 2WYOA 1W6UA 4R1OA 5JCJD 5IWAB 1NVAA 3D59A 4IHJB 4RSGA 3IQWA 3U0BA 2DULA 4AG6A 4MKHA 3RARA 1CQPA 2ZI7A 1UP4A 1OA1A 1F12A 1I7LA 1E7QA 2DPHA 2ZWOA 3A4IA 3ETCA 3PS9A 3QKRA 2B0JA 4R0VA 5FTKA 4H7KA 1W85B 3UVEA 5LIRA 3II6X 1TLFA 4GLJA 4N48A 3DZFA 1R18A 1E3JA 1KZ4A 1MABA 2CDBA 2IXAA 3B85A 2GO1A 4IYRA 1Y6QA 4OEHA 1RKBA 4QDTA 3RVDA 1WTCA 1GOTA 4UPEA 1M7BA 3SM9A 2R5FA 2LCFA 1S2GA 5DX8A 4Q1DA 2JI7A 1NOJA 2PH3A 3IEUA 3NHFA 3NM6B 3IPRA 5FLYA 3O8DA 4LGMA 1EK2A 3E58A 2BHRA 2D8MA 4R1QA 2LV8A 4AO7A 1XNQB 3L8YA 3W5SA 2B34A 1DX4A 4GR4A 5J4LA 1MDBA 3R9XA 3R7SA 5JQGF 1MAWA 4DR5B 4ZQHA 4RF4A 1RE1A 2C2HA 1U7PA 5FADA 4EHIA 4RFSB 2C4HA 3U7HB 5E0KB 2OT3B 3D31A 5AW0A 4B3XA 3M6LA 4F9GA 1TIBA 2OV8A 4LWOA 1YQQA 4OBEA 4TLAA 5IAKA 5JPCA 3OTQA 5DBEX 3FYDA 1VJTA 3DPUA 1K7XB 4H08A 5FUXA 4BCCA 5KYXB 1PNOA 1UODA 1BMQA 4QUKA 4GVLA 1VYHA 4MUIA 2I2CA 3UN1A 1P81A 2A8YA 3GFPA 3JR3A 2IV2X 1Z37A 4AZ0B 1YAHA 1XR3A 1TUEA 1VC2A 1WABA 2QZ4A 5FOWA 1JEJA 4BGEA 2FZ5A 1MPTA 2Y1GA 4PYKA 4DIMA 5IZCC 1PR6A 1FDWA 2ISCA 1ZLXA 4RUKA 1KOGA 4KKVA 3I30X 4R8MA 4L9RA 4PM4A 4BDSA 4Y18A 5TT0A 2YHIA 1TMGE 1I4EB 3D6VA 4EUSA 3TG8A 2C83A 1I3MA 3DONA 5JH7A 3FGOA 1KPIA 1DWPA 1GKKA 1NW7A 2H2AA 2P9ZA 2V9ZA 3LIIA 3HXQA 5E3JA 3O2SB 1W36B 5ALSA 4WXRA 4ATNA 1UXKA 4MB6A 4D79A 1QVZA 4BNUA 3HUUA 1OKKA 2NV0A 5FPTA 2QLJA 2FSGA 3F49S 3RJTA 4E4RA 3B9QA 4M8SA 4AS1A 4YAKA 3NLLA 1AUVA 5IC6A 1C3XA 4I55A 1A8UA 4ZYWA 4QOFA 3DLTA 4E46A 4XGNA 1T1SA 1I9CA 2VFAA 1N77A 1VBNA 2IU3A 3AQ4A 5ALJA 1IDN1 2CUTA 2K4MA 2POCA 1ADBA 3ED5A 4YWJA 3TD2A 1SO8A 4GQIA 3URKA 1SVOA 1CK4A 4IJQA 3DLAA 3FSGA 3ZQ4A 4O4JB 1KI6A 2O8VA 1FUYB 4BGUA 4J2TA 3R6GA 4OMDA 5IT9A 3KKNA 5G0UA 1U0JA 4YJ2B 5ARCA 3O8OB 2C4WA 2P4UA 2VAMA 3ONFA 1UH5A 3BF7A 1OROA 5JI2E 5ICCA 2DWCA 5J2TA 1KOJA 3GJZA 1M1ZA 3LGAA 2ZFUA 4E4YA 2QGNA 3L6OO 1P4GA 1D07A 1NF2A 3E7DA 3BILA 3KYCB 3RKUA 5BMVF 4H3VA 1JW9B 3ESCA 2OM2A 3QW4B 221PA 4I99A 3AUJB 4DPKA 4QUGA 2WDZA 3KUCA 4PU0A 3ZYCA 2X8AA 2I7DA 4PSAA 1QU3A 2P79A 3HI4A 4FXOA 1FXSA 1QBKC 1RBMA 2OV6A 2QY6A 3PUWA 3AU9A 4LDNA 1SZCA 2HWYA 2FETA 1KJNA 2AK2A 3OJOA 3QQ5A 3PQ6A 1GPUA 1ZRHA 4W5QA 1BKSB 4C7OA 1DTWB 1A5ZA 2E4ZA 1PS0A 2F62A 2ANBA 3ZDFA 3DH0A 2R68A 3ZGLA 4XWGA 4NXNB 3MLEA 1POXA 3K2BA 4RK7A 4B4OA 5C5IA 3T1QA 1YGPA 4X94A 3E4DA 1G2IA 2Q9BA 4CLXA 3CTPA 4UOZA 1FQKA 5KX5B 3D7SA 3K15A 3LT2A 2G9QA 1SXJC 3L8MA 4K9RA 4QXOA 4HX5A 1EIZA 5K3FB 1CG6A 4RMNA 1DADA 4LCJA 2O2YA 4AXBA 1ECBA 3EZGA 3VR3D 2ATXA 3V4FA 4EJSC 4PGAA 3OO1A 3RVSA 1E63A 4K6KA 3D3WB 5IKMA 3KQVA 4B3SB 3ADDA 2HIMA 2PBZA 5CA0A 1CQXA 3DKRA 3ZDQA 3EDMA 2J6IA 3TTWA 2G6TA 3W78A 5E7MA 1C3VA 1E32A 3HPRA 5JNUA 2V7GA 2NO5A 1Y3BE 4AB1A 3T5PA 2ZLBA 5ESWA 4EQ6A 2QPTA 1SUCA 4O2BB 2ZUEA 1GNQA 2J6BA 3A6GA 3KSRA 4MKZA 3TXYA 1QU2A 5J58A 4L5CA 1H2HA 3JQPA 2A30A 4UPDA 2PO5A 4F5EA 2R6FA 1ZI8A 5I9NA 2VP3A 4A0GA 5BN5B 4KGXA 2YJ5A 4BFTA 4GI1A 3H9CA 3LFTA 5AKEA 1K2WA 2HMAA 1QP4A 2YN0A 5E6RA 5CDTA 1AV6A 1B6TA 4R7ZA 4FFBB 1TO1E 4F5DA 1DC5A 1NM5C 2HJ9A 1NBMD 4R69A 4UFNA 4DLNA 2DEUA 4O8ZA 4DB4A 2B8EA 1LRKA 1G6Q1 3K1JA 3E5MA 5DI3B 1QGYA 3PLRA 4PLZA 4BMPB 1D04A 5EYPB 4LJLA 2AJ8A 1EJ2A 4JBWA 1ESEA 1CWUA 2VTKA 3ELWA 2IEZA 5D2CA 2QN6A 3RYHB 2XUAA 4TROA 4Z51A 2V0GA 1M5UA 1EFPB 1AK1A 3AJ8A 4HEJA 3Q98A 1I5EA 1CY7A 4OK6A 1QKKA 3HKBB 2ESRA 2H1LA 3ACCA 3BMNB 1PE0A 1TPYA 3O92A 4MW9A 3K0AA 3OETA 3OLQA 1HETA 5KREA 3SJ7A 1J97A 3IR5A 3VR4H 3QKUA 3AJ9A 1WP4A 3MB5A 5FOSA 5LKAA 4GI7A 3G68A 4YRCA 4C1BA 1Z6XA 3E81A 1E9CA 2UYGA 5JBQA 1WJGA 1FRNA 3KG2A 3OJWA 1GJRA 4AP6A 1QLJA 3CE6A 5T5QA 1DZIA 1KI8A 3E15A 5AW4A 1A8QA 4KFSA 3OY2A 4IIXA 4I3GA 4TN5A 2OVFA 2QTZA 3O9MA 3IBGA 5ESDA 4I5EA 1GZ6A 4U6SA 1JECA 4EO4A 1E5DA 1L6RA 1KRWA 1SRQA 2PRIA 1WM1A 4PPFA 1E2JA 2FMTA 2FRVA 1C3OA 2R1VB 3OE5A 3MD0A 5CVTA 2JFYA 3ZDZB 3GDOA 2RBGA 4KDEA 2WJYA 4I4CA 2X58A 4FOOA 4M87A 5EZSA 2Q5CA 1T13A 4BNMA 1EDDA 4HLDA 1PJCA 3BUSA 3G2PA 3F7NA 2O5EA 2X40A 3PK0A 4DVGA 5KTSA 3U40A 2EQAA 1ZH2A 2IU4A 1LPOA 2L69A 3OIVA 3RRXA 3VR5D 2VHQA 3NYQA 2GEJA 2Q4OA 3MT9A 5HDQA 1NNUA 2QNBA 3OP4A 1SVMA 3ITEA 4YMIA 2VVTA 5AJHA 5IKEA 2FU5C 3TL6A 3KELA 1K92A 3NT4A 3P2EA 3GRAA 5A3VA 5DHFA 2YJNA 3EQ8A 1VE3A 4NKRA 2GM3A 2HNAA 3CA8A 4LJ6A 4X0EA 4HAYA 4UDNA 5LD2B 3CMCO 1TYDE 4YB8A 1BEEA 1MC1A 2XWPA 4FHZA 1KJJA 1R5NA 1CIJA 2O1EA 3EAQA 3OO0A 1CYDA 5C3UA 4MQFA 5K0CA 3CHYA 2H31A 4YLEA 5CLGA 1H8HD 1SOWA 1AF4A 1PR4A 5GZ1A 4ZVNA 1DT3A 1HKUA 4GKJB 5J2UB 1Q74A 1Q6ZA 1PSDA 2I33A 3SSMA 5AW7A 3OKFA 4FEGA 2RH8A 3C43A 5GGYA 1I2DA 3LX8A 4RPJA 5F5NA 4ZWNA 1QDLB 3ZU2A 1RJEA 3UT6A 2F3QA 5B7NA 1I3NA 1QNLA 3LH5A 1I5RA 3FVWA 4N3AA 3RK0A 1C3LA 1FDVA 1QGAA 3OKCA 1UFOA 1E20A 3N39C 4M38A 3WGJA 4D3YA 1N2BA 2W43A 3FA2A 5DV9A 7REQA 1QE3A 4HZIA 3J80A 3JYNA 3EC1A 2VWGA 2VHCA 3AUSA 4M1QA 1J6UA 1EUCA 2H16A 3QG5A 3CH5A 2EG9A 3EBLA 4EI8A 3FYUB 4EYKA 3RIMA 2Q4EA 1CNFA 2HIGA 5BW5A 4LJ7A 5MGBA 4QEDA 4XZ3A 4LEIA 1PJRA 2UVDA 2VDLB 3G17A 4L7VA 4P80A 4PG5A 1U7XA 3IVMA 2MOKA 1BU8A 3H8SA 3WAGA 3AF6A 1OIVA 4KAFA 1XXHB 2R2GA 4WLVA 4UNRA 3KOOA 1MCZA 1T9HA 1YU6A 1NSYA 2MWMA 4QODA 4G0OA 2Q5OA 4CMBA 3ZGYA 3MS2A 9LDTA 4HNTA 4BGDA 1H1DA 4BIIA 2IRWA 2H8GA 2I4NA 3F7MA 3NHWA 3KU1A 2W2OA 4TRMA 2WTEA 2AZDA 2C0QA 4M0KA 4M46A 4MROA 5BV0A 2PIDA 4ETWA 2YC2C 2AK3A 3U7QB 3QYJA 4LCBA 2R0QC 3IIEA 3P9PA 4FI3C 3GY0A 4BLPA 2C9BA 1GFSA 4FW9A 2PXHA 3TVYA 1R6BX 4D74A 1A27A 3AUFA 3ZBTA 1Z4NA 2WT9A 2ZSBA 4KPEC 1NW5A 1DX9A 2PPLA 4UC0A 5IJZA 5EZ5A 1G9TA 2QR2A 2AA3A 3DV0B 1OLXB 5NLLA 4TVSA 4LJRA 3DO5A 2GLTA 5L3SA 4KR7A 3M2TA 4TYMA 4EUNA 5FWYA 4X00A 4CN9A 1NKSA 3L0BA 3ASVA 1E5VA 1OBCA 2BFAA 4QBKA 5D3ZA 3W1WA 5JQGA 4DLYA 2F67A 2O3QA 4BMNA 3KJIA 5KU7A 2QL9A 1EFVB 2WAAA 1X74A 1OLUA 3GJ7A 3GLTA 4INJA 4OHKA 2XYGA 3ZE2B 1E2BA 1JPJA 2X6RA 4YP7A 4QL3A 3ZVLA 1XHLA 4D0SA 1GQRA 1Q1EA 2C4MA 3HJHA 4HNQA 2GEVA 3ODGA 4G6ZA 2HR1A 2QP3A 4KITB 2P3LA 5JI3E 5TB5A 1LDYA 1IVYA 4LBZA 3THSA 3GT4A 1KKMA 1C7JA 2VNKA 3IUBA 3N5CA 4G4IA 1LDMA 1MFPA 4INPA 4NVRA 4CGZA 5CTJA 1EGVB 2HUPA 4EUEA 5LMUB 5HF5A 4I0WB 4Q9DA 5C4GB 3ZCUA 1BE0A 4FLFA 3SF0A 2I91A 3P9ZA 5C8VA 1FUUA 1GRRA 1HE5A 3ZI0A 3H9QA 1XZDA 3ABOB 3DOCA 1B0UA 3CXUA 3QXXA 2HY7A 3EGCA 4YMVA 5CG1A 1DWOA 5EKUA 5LQNA 1DUSA 3RO7A 3QJ5A 2JBAA 1E6KA 4NH0A 3ZDYB 4FCCA 3GNSA 3W8NA 3KYJB 4A5OA 2HHHB 5E9JA 5FCDA 1N8TA 2YXLA 1SXJB 3CUSA 3H04A 4WY8A 5D87A 5KQRA 3TGLA 2IHTA 1N5KA 1YDGA 4NBLA 3WB0A 4OJYA 1M2OB 2RGAA 2IIBA 4OA8A 3T8YA 4D56A 4AIRA 5MGNA 2J48A 3ZVKA 5HE8A 4M0UA 3V3TA 3U9SA 4C01A 5LIPA 1GAXA 4RCZA 2CYCA 2DLDA 3GN2A 3B5IA 3A14A 1EM6A 1LRLA 2O0LA 3IDQA 4RD6A 3BSYA 4TL7A 5AK3A 1U0EA 1UEXC 4YBRA 4PV7A 1UK6A 5F64A 1XMOB 1IEXA 2DP4E 4XB1A 5IG2A 2FPMA 1XDDA 1R6UA 1VQ1A 1XK7A 3HRKA 4FKZA 1SUWA 1WPRA 1JKMA 1SCKA 4K86A 3AG6A 4XYMA 3W6NA 2G25A 1ZA1A 1Z22A 4BEJA 3X2SA 1J2JA 1KEEB 3D7MA 4MUYA 4JSTA 4UJ5A 2BSAA 2VR1A 3GZTB 1QIEA 5ALEA 5A03A 2I54A 2BLLA 1R2QA 2BY4A 1BA3A 1HRDA 2ICAA 3L6EA 1CZLA 1OU4A 2GK6A 1MPXA 3ONDA 2BGKA 4DMMA 3Q3IA 4HWSA 1LRJA 1T2FA 2H1WA 1Z28A 3D64A 2CFIA 3P20A 1JLLA 4BDTA 4GGMX 3K94A 5JAOA 2JA1A 2REXB 4MGHA 4BQEA 5BMVA 4GPD1 1FBNA 5K8LA 4WCDA 4DTIA 4TMXA 1BKDR 1XDZA 4RGYA 3CISA 2GI4A 3QWHA 2CNWA 2GEBA 3MILA 4UE2A 1ZN8A 4K8RB 4QULA 4B74A 3GFFA 4JA2A 3LQ1A 2NU6B 4ZDJA 4PICA 5KYYA 3JAKB 4V0OA 1JEYA 1TEVA 3LPCA 3UQYS 3AUYA 4NJOA 2O2HA 1K8ZB 1RI5A 1MENA 1LV8A 1F14A 2PRKA 1N92A 2PD3A 2YZKA 4I5DA 2BM1A 2OXIA 5A9RA 1K08A 1EB8A 1XT6A 4OU4A 1PJBA 3PDUA 5CVVA 1NR5A 1ZWLA 5KYUB 2A0FA 4UEQA 3IMFA 4D9EA 2WV9A 4L8LA 4OJKA 2WK1A 1FTNA 3AX6A 1R6TA 2MHCA 3ILSA 1K5HA 4M53A 3COJA 3RNOA 4DMKA 4KLRA 1VRVA 3FH0A 3IAFA 4GPAA 3ICOA 3R77A 4ND8A 5BWCA 4E1VA 1FJXA 4ZVQA 1OD6A 2B5WA 2IY8A 4IJKA 1G7RA 5KQGA 2NPIA 3P26A 1NMZA 2V6BA 3ROZA 1RHMA 2Z2KA 5B57C 1ZIDA 4KVAA 3RC7A 4G9GA 5THKA 2D4HA 3ESDA 3SIRA 3NMUF 1UKYA 5AK4A 4OQMA 1OTHA 1PFKA 2CD9A 2C4KA 1YS2X 3LCJA 2AE1A 4MRMA 4HFRA 4URVR 3N05A 5IVIA 1P0CA 4ZPXA 5T6BA 2Q07A 4GP7A 1Q2XA 4A8HA 3O03A 4YS6A 4B45A 1K4MA 1TECE 2BSXA 4K9KA 3VUFA 3W8RA 4YV7A 3V2UA 5EVCA 4C2AA 1EXWA 2QRVA 4Q4LA 5AXDA 1CY8A 1IL0A 1KTVA 3KJQA 3KKOA 5KUTA 1B23P 2P8SA 1F2DA 2ZIAA 5I8WA 4G5SA 3TLXA 5HCIA 1AKWA 3ETEA 2WFMA 3HKDB 3TSYA 3ZJ5A 1V3TA 4HRVA 2D2EA 4IIBA 3TLBA 2XNKA 3OPMA 4H27A 2F64A 1V4NA 3ANNA 4DE5A 2Z4SA 3U0VA 1YQXA 4RZHA 1SCUB 3ZGVA 2GZAA 3JTMA 2RIRA 4UHBA 4KR6A 1W8DA 4J76A 3DD5A 4TTJA 3G0BA 1U3GA 1YR2A 2BONA 4GL4A 5I7UA 2PJZA 1XTQA 3IUPA 3CZPA 4OLJA 2I2DA 4MPPA 2CV0A 1G3RA 2JH3A 3PIIA 5CG2A 1IVSA 1KQ3A 1U8YA 2W8BA 3AERB 3OJ0A 5ALGA 2O7SA 5A3JA 2RJOA 1ZNQO 3LCCA 4X45A 2BEVA 5T4EA 5K3DA 5FFNA 3WAJA 2OKCA 4QE3A 4RH0A 4LPSA 2I7VA 3D6MA 3ZW7A 4CQLA 2DJIA 4O2AF 1I33A 4IMRA 4CKEA 1DAFA 1U98A 5KYTA 1AUXA 2AEJA 5IC5A 4AKIA 1XO1A 4XWWA 3EIXA 2PUVA 4Q9JA 4DA6A 3C3YA 4EABA 1RLMA 4MWSA 3ZDCA 1Z5UA 1ZKDA 3GPLA 1M67A 4TVBA 3UPDA 4FXPA 3QE4A 4HTAA 3NC1C 2EFJA 4LDQA 1XBTA 4PYMA 4ZAVA 2OQRA 5F78A 4CKWB 1RXVA 4QSHA 3MC1A 3P5BA 1O95C 3NH9A 5J23A 1YMQA 2A9PA 2KYRA 1N3LA 4AZ0A 1KMHB 2ZR0A 2X19A 1T6ZA 4L2IB 4IJVA 3VR6D 3FWPA 4ZQEA 1B1AA 2I71A 4AW9A 4C9BA 1JG3A 4HMPA 5K3CA 1LNZA 5KHLB 5LN1A 1VB3A 2D0DA 3MUEA 1C4XA 3PKIA 4N03A 1FFYA 1E59A 4BJHB 1D4AA 5TT1A 4BO2A 1YBHA 1IMJA 3PT5A 1NJ6A 3F78A 4QATA 4O4IF 2Y27A 5FTWA 1CUDA 3QVSA 4MRVA 3H2HA 2DHEA 2RKBA 2WW8A 3QM1A 5HGXA 3FWZA 5AW6A 1A71A 4PIMA 5CM8B 2NSHA 4ALJA 4S1NA 1HT2E 3FYSA 1N7JA 2VF7A 3KT6A 5BMOA 3VNRA 2F1IA 3LKBA 2V7PA 5G0TA 4S3MA 3GMIA 1DBVO 4BO1A 4HAVA 4GYWA 3JW8A 4NV3A 3D1JA 1ZOOA 4HDSA 2FN8A 2B9EA 2QM7A 4W8HA 1IHXA 4CG1A 2I7CA 5F21A 1YFJA 2QU7A 4DJ5X 1EGAA 2G4CA 3O26A 4LOJA 5EJEA 3ZDRA 4XAQA 1P1CA 1SULA 3KK0A 4QYIA 1WBBA 2YWRA 1NJ5A 1VYTA 5HE9A 5CIYA 4GZ5A 3DL0A 2IEGA 1ISGA 2BE7A 1I2CA 2BI8A 1Q92A 2JLYA 2L0XA 1CQIA 3JVIA 2QX6A 4P81A 3L02A 4R1TA 5HM6A 3VH1A 1U9JA 3CZ4A 4EF5A 1QGUB 1V5EA 1T6BY 3GHHA 1GY8A 4R84A 2BKLA 3D8BA 4RH1A 1GU0A 3DMGA 2CXNA 1GAQA 2J31A 4R9NA 3ZK8A 2ISQA 4GOJA 2AOTB 3GFRA 4A91A 1AIPA 1Q57A 2YMPA 4S05A 3Q7RA 1PDOA 1QPZA 2H17A 2OO3A 1NX9A 1F9EA 1FK8A 4IF4A 4OP1A 4DLXA 4XWOA 1PK9A 1S2MA 3QNUA 3V7FA 4COOA 4X20A 1QS0A 1U3UA 2FZGA 1L6IA 2O2JA 4MDHA 1XPOA 2JJQA 5HF9A 1VJCA 3IOEA 4LRYA 1M6WA 2PD6A 2GKSA 4MKRA 1DIAA 3J81k 1IN5A 3NNDA 2PKQP 4A8TA 1X7DA 1ECLA 3G0HA 2IEDA 3MJ4A 3LUAA 2FPPB 3BIOA 1SVNA 3KL2A 3SNKA 3L0IB 4NDNE 2CCKA 5DBOA 1YS7A 1LX7A 2DWPA 3FNRA 1KRXA 2FA9A 3WDSA 3ZK9A 2SBTA 5FQNA 1C80A 4C3VA 5B12A 1HOXA 1L3CA 2GNOA 5K1ZA 2GK3A 3VTAA 2FDXA 4WLOA 3CX8A 2ZDQA 5A3RA 2FVXA 1OGYA 1V45E 4PX5A 3ZS8A 1C1DB 4FNAA 2I7TA 4PCUA 2FJ0A 2O59A 5F1KA 3VSEA 3O47A 2Q1SA 3DM5A 2XT0A 1A7KA 4YACA 4B2PA 2N46A 1Y6GA 1EHYA 2WPDD 4W99A 1WCIA 4JHLA 2C3MA 3JU3A 5JNLA 4DLVA 2OM6A 1N8KA 3THYB 1CS0B 2X2OA 2XYVA 3DLCA 1X2BA 1UMBB 4ZYLA 4WINA 2QDXA 5FI1B 1ADGA 2EF0A 3NZEA 3R7BA 2IYRA 1AB5A 4DR6B 2OHIA 1UINA 2IHBA 1Y3AA 1SU7A 1J23A 1PNVA 3JYQA 3PJDA 1L1QA 3LLMA 2C7QA 1SQ5A 4R98A 5T3UA 4BEVA 1JFRA 1WZUA 3SQWA 4YRDA 4B3RB 1NVGA 4RJJA 1Y7PA 1ENYA 3QUCA 2R8RA 1K86A 3O95A 4GBED 3FUTA 2Z3VA 2CNLA 2RH5A 2DQZA 3I6QA 3DE5X 4RY0A 1D5CA 3L7KA 4X1OA 2JKVA 3NBUA 2IYYA 3WWEA 3L8FA 3R3JA 4BS9A 3AUKA 4L9SA 1PZHA 3ZNOA 2I4LA 4EZBA 1B16A 2FDRA 1E3EA 5IVPA 1ABFA 1UBHS 1EWQA 1RFLA 4CT4B 3V5NA 5KC9A 3T61A 3C3JA 3GUUA 4C6RA 2P75A 2PIAA 3ETNA 1MB3A 4W9NA 2EJVA 1E9AA 1KDVA 3RUDA 1PRYA 1VKOA 3QHQA 4FDAA 1Y3IA 2NZYA 3L49A 5DGTA 1ST3A 2HSDA 3HY3A 5JMTA 3U5TA 4TV9F 1EB9A 3CKLA 3DB2A 3CO5A 4XQ0A 3O3CA 2ZBFA 1NC1A 1HE4A 1NZDA 1JDBB 4TT3D 1PYOA 3BTSA 5UKDA 5FWXA 4MYUA 2UKDA 1ESZA 1QG4A 1TT5A 4ZCQA 5AW5A 2ZUWA 4DJAA 1C30B 2ZTLA 3UJ8A 3JS5A 1DAKA 4OLHA 3WNVA 1YJAA 3N9IA 3TN7A 1ZK3A 3GJYA 1QGOA 4TKUB 3D5QA 4UE6A 1TUBA 2Z2IA 4XJVA 2ECFA 2GZ1A 2I03A 1U3TA 1L8AA 4LF5B 3Q7QA 2YWHA 2B5VA 4QRDA 3U60B 4RTKA 2BSQA 1YCGA 2CWDA 4ZT2A 2HYDA 2XA1A 1MIOA 3UWPA 1MB2A 3EWNA 3KV1A 3TRFA 4ZFNA 4C4OA 3EX7C 1H66A 1JLRA 1I7PA 3WKDA 3GP8A 3ZV3A 2CSXA 2CXUA 1QP7A 1F4VA 2RGDA 4CFSA 4GX1A 4GPBA 3GEDA 2EYUA 5B1DA 2PVCA 2ZWVA 3BHNA 3T0FA 1WMDA 4P0TA 4EY4A 5LBIA 3OQNA 2P6PA 2NVUB 4I08A 1U65A 2D5BA 4UBNA 4K1LA 1QRTA 3ZY3A 3BFJA 4TTTS 3FPHA 4V2UA 3UK2A 4GEGA 3ZK7A 4EPWA 4MKXA 1MHTA 1H94A 3Q6IA 3SP1A 4S12A 5KU1A 3BWBA 1YZQA 1PYDA 3A58B 1WD5A 2GEKA 1PHPA 4XI9A 4B1FA 4EG8A 4YCBA 2OGSA 2XMRA 3QI2A 1C9DB 4M49A 2QUKA 3FDJA 3I2YX 4W5JA 1U6KA 4Q12A 2OKGA 5JDCA 4XA8A 5F3DA 1RCTE 4Y0VA 4B6GA 4QGAA 1I1OA 4RH3A 2O7VA 4F9FA 5G1OA 5KX5F 5DLDA 4QQRA 4TWZA 3EZFA 3B48A 2BMVA 1C29B 3EXIA 4KWIA 4DNOA 4HAOA 1GTG1 1EJ6A 4FR0A 3G79A 3MGAA 1T35A 4UVDA 4F3NA 5AVJA 4PSKA 1NUPA 2UZ1A 1RKVA 4YUVA 3NAGA 1MA3A 2FMFA 1ZINA 4IQ0A 3T34A 4ARSA 4F71A 3CVXA 5BSUA 3HFSA 3M6AA 5KVVA 3NGLA 3UMSA 2CJWB 1T2VA 1MRNA 4ARBA 1ND6A 4R0NA 3O4VA 3M4JA 2W4IA 4PTYA 4S04A 4HDCA 3TQCA 5C4IA 2RD2A 3CNNA 3IURA 1E79D 4O2BF 2VK1A 1SUBA 1MGPA 4Q19A 3SXJA 4KQJA 1DQYA 2ZR8A 3JARA 3IQIX 1D4FA 1Y1QA 5K4GA 4GICA 2BFCB 4PR0A 2EBWA 4IGKA 3CUEF 4RTRA 3CM0A 5FAXA 1AQYA 2BRUC 3WOVA 2WAXA 4PTZA 2HBZA 3DAOA 3HQ4O 5BR1A 5IANA 1X7XA 5B3JA 2XQIA 1L5OA 1WSBA 5JIBA 4QM6A 3LPMA 1SXQA 4LE2A 3RTBA 3IODA 4CT5A 1AX9A 4BASA 2LXNA 3H6GA 1L4YA 3L6DA 4WI1A 5KTRA 1A4RA 4KYUA 3BSSA 4J6FA 3S2SA 2W2NA 3GLHA 3OLWA 4JOCA 1AGPA 2RJNA 4N39A 1TZJA 5FHRA 4FWTA 3T7KA 2CFOA 2PZBA 5KCZA 2GRUA 2WLSA 5EJMA 2WU0A 3HJUA 2F9FA 3U9LA 5FOTA 4BJ3A 2G80A 4DNPA 4IDGA 2CVHA 4HDKB 2ZJ2A 3CLRC 5CIWA 4P7KA 3AVVA 1Z2EA 4Q4JA 2EZ9A 5ALOA 3CZQA 1LX6A 2IC5A 5CFPA 3WK6A 4DJDC 1GILA 2NUTA 3D6NB 2X8BA 4K8OA 1DGQA 2D1YA 2PYIA 2ZYGA 2H0AA 3ZKWA 2Q3LA 3PGJA 4QJ5A 3VZBA 1RQ2A 1G42A 2F3SA 4FQ8A 1Q0UA 3UWSA 4F11A 2COKA 3IKVA 5GZ6A 1T9GS 1R6XA 3K30A 3I9LA 3R09A 3RBVA 2RFLA 2F3UA 3GJRA 4A92A 2EZUA 5BOVA 3GRYA 4RW0A 4UVIA 4GGOA 3HL0A 4O2AA 1A9OA 1V96A 2HJWA 1NYLA 2ST1A 1VM6A 3CX6A 3WLMA 1CUXA 5K3BA 4IM7A 3V48A 3O90A 2BEUB 2YFHA 4D92A 1N6LA 4UEOA 4EF6A 2P6NA 3AP3A 3D4PA 2VDWA 3CMMA 4Y9DA 1IPHA 2C7VA 4ZYVA 5FNVB 5EWLB 1BS1A 5SYAA 1NVDA 1QB8A 2P9JA 4HDAA 2V7QD 2JFFA 2UVQA 2IV7A 3DQPA 4LZLA 5CB6A 3W8DA 3RU7A 2Q3CA 1HA3A 1CQJA 3IMEA 4GUDA 1OFTA 1EMDA 2B30A 1XJ0A 2AG1A 3QU7A 3PYXA 3BVPA 1T0PA 2FOXA 2VCEA 1SC9A 3MINB 4QPDA 1BHJA 1MZPA 3AK4A 4XGRA 2IWRA 1BKYA 3VR4D 3ROFA 1WHSB 1YZHA 3L05A 2Z9CA 4LOLA 4Y6GB 1JFSA 4IR7A 2BEKA 5LYJA 5ALVA 1HKHA 3A36A 4YJFB 4O4IA 3DDOA 2EG5A 1MB0A 2OZEA 4BVFA 1AMUA 2MYUA 2PH5A 4QGBA 4UHDA 4MWDA 1EA5A 1XCLA 5KDLA 5BRJA 1TKRA 2C2WA 1XKXA 1DNPA 1JDNA 1G8SA 1CUEA 2JD1A 1JFFB 2VF2A 1JKXA 5H5JA 1TQHA 5EFOA 1JG4A 4NBKA 4B2IA 4LC1A 2ACKA 3DG9A 5J2UF 5CUQA 4GUAA 8AT1A 4D6PA 1MHPA 4QPCA 2ZUBA 1EQUA 1HG1A 4OBBA 1T1JA 3WMRA 5B58C 3OQPA 1PL7A 1K9VF 4MUGA 4Z86A 3A9RA 1MIHA 1QP8A 2ZTHA 4ZAWA 5WRFA 3AU8A 5LZ4A 4WDRA 4FMBB 3TUZC 4Z53A 1MXHA 4LF4B 1K7SN 4K7JA 5LB2A 4ENQA 1ZJ6A 5JD4A 1DKQA 4P32A 5ALYA 4E5VA 2F4VB 3LWNA 1K2VN 3FCYA 4LDAA 1Q0TA 1JLMA 2O9JA 4B33A 3EVCA 1EP3B 3HK2A 1NNLA 2FF7A 3SJAA 5G3YA 2WNIA 3S2ZA 1NI4A 1FP4B 2RI1A 3R3XA 3TMYA 1H6DA 3IAM1 1SZPA 3UW3A 1APBA 4IDCA 4DV0B 3TDMA 1USIA 4MV9A 3QEBZ 1EGMB 3DFFA 3F8TA 4JC0A 4KBFA 2SHKA 3T7JA 5HZKA 3DBRB 3PR1A 4G3XA 4LC0A 5HJ7A 1IZ8A 3G2IA 2O3SA 2P0AA 3B3QA 4DF3A 1S3SA 4JKOA 2GM4A 1O9BA 3I1YA 3WGLA 1PT6A 1YDFA 1AUPA 4P4GA 3LCRA 1JAZA 1QFXA 3OF5A 1U9ZA 1ZUIA 2EJCA 3HVIA 3LSYA 2P9BA 3QXHA 4WA8A 4Y2GA 1T3ZA 3WNDA 1DIHA 4JZKA 4Q3DA 4UXIA 3T1HB 1O96A 4LSGA 1RNLA 4XEHA 3MGBA 3Q3VA 4E11A 3RS8A 2QYOA 4DDTA 3OQBA 1UBEA 3BGDA 5JXGA 1BGWA 5TDHA 2IXTA 5K8TA 1R88A 4HI0E 3H1BA 3KQQA 3SS7X 2QM3A 2W8ZA 4MO9A 2C00A 5EE9A 1W85A 2FFQA 4KO1S 2XDAA 1GD1O 3UO8B 1HE8B 1O5IA 2GHIA 5JMOA 3L7DA 4JN6B 1TW2A 4ALMA 4G5XA 4YMWA 4NDAA 4PRKA 1UQRA 3DXZA 1N5DA 2OHGA 2Z5VA 3GR6A 3A27A 1CS4C 3GN1A 2ZVPX 4WZ6A 2AF3C 1EP9A 1GZ3A 3EGWA 3P2YA 4X71A 5EA2A 3VYTB 4AS2A 3I5AA 3WDKA 2H0QA 3K0CA 1ONNA 1MOQA 3R23A 4RFSA 4URZR 2CL5A 4OCZA 1QCCA 4MW6A 4OI4A 3ZX4A 1DS6A 2DWOA 4GP9A 2V6FA 2YCBA 1VHQA 3Q5EA 3QF4B 4L3WA 1T8PA 4UUMA 5CX4A 3RNLA 3BQNB 5KYXA 2YQ5A 1NAIA 1SFRA 2HQSA 3SQOA 5JRZA 5FRDA 3TE6A 4AZ3B 5E3IA 3RG8A 1GNVA 4DIUA 5AKHA 3K6JA 3KAPA 4J91A 2OCKA 5CT8A 2UVPB 4OGKA 2C8VA 3C6BA 5FWAA 3WICA 2E4VA 1KWKA 3HEBA 5K2MA 2EL9A 3PL5A 2CMHA 4FYVA 2PX8A 2IELA 3GJQA 4HDQB 4HP8A 2H63A 4XUDA 4WE3A 4Y7DA 3Q9SA 1ICEA 3N0XA 4PZ0A 4WZAB 3VSAA 3KVNA 3O8BA 3AVYA 3AEKB 4I36A 5F51A 3IVCA 4BYMA 5CT5A 4BFVA 1T0HB 3VJMA 1XCBA 4Z4FA 2YJ4A 3CPSA 3NJRA 3EGOA 1Z75A 2ZYIA 3JQCA 1XQYA 2XADA 4JMLA 1XMXA 3ZBQA 4ENWA 3GLFB 5LOVF 3CRZA 3K20A 2QPOA 1HNWB 5IWCA 1YQWA 1PGJA 2QX4A 1D2RA 2XA2A 4ZD6A 4B4KA 1E69A 3GFBA 3MT7A 4U00A 1UJCA 4C4TA 1L5KA 3QUQA 1QH1B 4PWYA 4BHTA 4JUCA 4FDVA 1EIWA 2H7VA 1J06A 1GTL1 4ZYUA 1EFCA 1E9FA 2HCJB 2K6GA 3B8EA 3HXOA 4Q15A 4RGBA 4EHFA 5HJ2A 4JXZA 3OWOA 2AMLA 5ITWA 4NOMA 4E1BA 2X9VA 4U5QA 2CF5A 4EY5A 3WK9A 1U80A 4G1BA 4RWZA 4KLZA 1QH9A 4O4JA 2PA0A 2PYZA 4E51A 1S2IA 1QTQA 2YBEA 4YCNA 3NIDB 1I80A 1SNYA 1UR5A 3X0DA 5M29A 3O8OA 4C05A 2CUKA 1RP7A 4UU7A 2JJYA 3GRZA 3M9XA 4LOHA 5CFLA 3AF4A 1XP5A 2AEFA 4QBTA 3RF7A 3WL3A 1BDMA 3IAAA 3NBFA 3PGMA 3TTXA 3DF9A 4D44A 4P54A 4A36A 3B38A 1KL7A 4DC9A 5JDIA 3FCEA 1AF7A 2RJ3A 3R5TA 5J40A 4OMUA 4BNDB 4R3UC 4O5AA 5ALXA 3UWOA 3RYIB 4L7QA 2HCFA 1RJ9A 3RVPA 4B83A 1ULUA 1KSHA 1D03A 1Z6AA 2XUQA 4TMFA 4ETNA 4Z9AA 2VK2A 4UREA 2D62A 4O6VA 2GBCA 4KG7A 3ANLA 1GCOA 2VJCA 3PF8A 4KACA 3THOA 4WA7A 5ERGB 5GP1A 1L3IA 3F74A 4TS3A 5L6LB 3E05A 1DTWA 1MG5A 2PO7A 3G8AA 4XH9B 1U99A 2L18A 4FGZA 5FUVA 5DM0A 4E33A 1N33B 3HU5A 1FNCA 2QTVB 2AJLI 2PS1A 4FB4A 3UBTA 1YZUA 3F4LA 1U04A 2HUNA 2MINB 1JGTA 2F7SA 3S8MA 1JLHA 1OAOA 3NHKA 4GGPA 4KQKA 4A0RA 5KX5A 5C1OA 2VHUA 4B79A 2VS1A 1P1FA 2VQ3A 4TXHA 4F4HA 2AFHE 1Y8RB 1B73A 5K3FA 4LFAB 1MLDA 4FX2A 4D9GA 5EUQB 2YWEA 5JG7A 1NXOA 4FWIB 1Z5ZA 2PSJA 5EINA 1L5FA 3AYXB 3QYAA 1P1RA 2XT6A 3D3WA 4I9UA 4LYGA 3VDXA 2JEYA 3EWIA 4BIMA 1AG9A 2VUHB 3LHDA 5HSGA 1BE8A 3GD7A 5ALQA 3X1YA 2ZCVA 1XEAA 4FFDA 1N1GA 2R7LA 4ZYYA 2OP0A 2DFTA 1X8JA 2DH6A 4FHFA 4O2BA 1AURA 3P9RA 2EDCA 2OHJA 1PV1A 3BGWA 4YPFA 3VHLB 2CMFA 1OXSC 2W0SA 4NYMQ 4EGSA 4F45A 5A2GA 1T6XA 4W5WA 3C7KA 1N2CB 5HMLA 2ZUCA 5BN5A 2P9GA 3RHZA 2J1LA 3EA0A 1BRMA 2HDWA 2UYCA 3UHAA 4X1KA 4MA0A 5TQVA 1FQOA 1HLPA 1T4BA 1EBBA 2QX7A 5DI3A 3AUUA 1XA4A 2E9SA 4YCJA 5EYPA 2CE7A 3A9TA 4DQLA 3G7NA 1GADO 1K0UA 4BNIA 2NP6A 1QVWA 3AJDA 3DVLA 4E15A 1K5PA 3BJZA 9LDBA 1X15A 3W4JA 2YYAA 5KZMB 2XZLA 3RYHA 4CQNA 3FZQA 3DZHA 2DH5A 1V5IA 4MR8B 1EFPA 3OPVA 4HSGA 1Y4SA 3UAOA 1PLKA 2PH7A 3HCWA 3HKBA 4LTNA 5EEGA 3BZBA 2FKNA 1F8YA 3BMNA 4PG8A 4UBKA 1V6SA 1O8CA 4NL4H 4L4YA 4ALNA 3ZVMA 2RHOA 2BT4A 4O4LB 1ZGGA 3VO2A 1A3CA 1ZC3A 3VRHA 1NVWQ 1O6CA 1ZYUA 1HURA 5LQSA 4BJ1A 2D0OB 3FD8A 3VMMA 4R71A 3WSTA 2B9VA 5HQTA 3T7RA 5HW0A 2X7JA 4ND2A 1Z0ZA 3P0EA 4HCJA 4BBAA 4HLUA 4B2LA 1L5ZA 1LTQA 3LUCA 4K9SA 1XYGA 2B6HA 1EEXB 3GBVA 3QY0A 1NJ2A 1IYZA 4WADA 1MVLA 1UP7A 5KWJA 3S5UA 3FDXA 4R1MA 1KZ6A 2FSVA 1HUQA 1L7RA 4JB3A 4QNNA 1NE7A 2C4NA 1HNNA 4DNQA 3U4IA 2PGNA 3DDCA 1G20E 4R2XA 1KOFA 4MQBA 2AF4C 4RVCA 2FDCA 3KXLA 4RVSA 3MAGA 5FWDA 2R1VA 4F56A 2NVOA 4N4AA 2HO4A 1IMOA 3IXQA 4ZHQA 4AJEA 3L8DA 1NYQA 1EGHA 1GUAA 1WXFA 2GWHA 2DRIA 3KUDA 1XTSA 4JP8A 4Y1EA 5E9QA 5IJAA 1OT3A 2ZRIA 1K27A 4OIFA 1RKXA 4AVYA 3WGMA 2MJLA 2FR8C 1G3QA 1KSFX 2IDMA 4HNSA 3KT0A 5ADWA 4LN1A 3MJDA 2C9YA 5K99A 1OASA 3NRCA 5KC8A 2PT6A 3KJHA 3N2IA 2VPPA 3OZVA 3F2IA 3ORSA 4FI3F 4MQMA 5B7PA 3CNOA 2HI0A 1N5IA 4YRLA 2JJ2A 4BKPA 3ABSB 3KDAA 2NUAB 5HFAA 5DJ5A 3WLTA 3H0EA 1THMA 2FCRA 5LJIA 4GOLD 3BAZA 1DKOA 1IIRA 3HXMA 4IIDA 2WHYA 5D1HA 2G1KA 4TMYA 5BSVA 2VQFB 2HZBA 1SOMA 5DF1A 5F76A 2ET6A 3AI1A 1JLSA 3BEDA 3GRPA 2BBWA 4JLJA 3WZMA 1GUYA 1NDUA 3OCWA 5DW0A 1QE0A 3GA5A 1P31A 3D4BA 2H29A 1KXZA 1WAMA 4Q4DA 4R6XA 3ZV6A 5J2UA 2C9CA 3ZHBA 1SA0B 2IHNA 2LW7A 4AKGA 1X7HA 3MSCA 4WLFA 2JKZA 3VX3A 4RTNA 4B40A 4NY1A 2VZEA 2ZYDA 3UT0A 4AP9A 3G82C 1Z4LA 4HH3C 2PUEA 4RORA 4RVDA 1W73A 4HZUA 3PDCA 4MNTA 1RRCA 1DAIA 1J70A 2PBFA 2IODA 3CYFA 4HTFA 4RQBA 4DIBA 1U7OA 2PKWA 4DLLA 1RXUA 2XMGA 2ZSEA 2XCQA 4RFVA 4G9EA 1JDSA 1DO0A 4M7PA 5IZCA 2CBXA 1NQWA 1B93A 2Z6UA 1PJAA 1DKPA 3RS5A 5CLIA 2QT1A 3HNOA 3GNQA 3QA3E 3DEYX 2R8BA 3EMDA 1ZICA 3E22B 3HMKA 3JASB 4PIVA 1XXHA 2ATVA 3FNHA 2FWMX 2HHLA 4EUFA 4ILKA 2VDRB 1U0GA 3KOWA 4DTCA 4CPDA 2JI6A 1F48A 1NXQA 3ZJVA 1OYYA 2Y8EA 1J90A 2V7BA 5HWSA 2ORED 2OYSA 1Q7EA 4FQ7A 4E14A 2P41A 5LJLA 1ZCJA 2VHTA 2VTDA 4AQYB 3U7QA 2P2ZA 4GU5A 2RHDA 3EPRA 1NHGA 2D1TA 5JADA 4IXNA 3OSZA 4MARA 2B98A 2QD1A 1RPJA 2PZEA 3V4PB 1KQPA 1T9DA 2Y1LA 5EXEA 1Z63A 5GJBA 1VRCA 3LV8A 4I9NA 4DA4A 3EVFA 3HUEA 4HD8A 1MVNA 1XLVA 3DVAB 2NXWA 5EY5B 3NAZA 1DI0A 3E4CA 3DV0A 1OLXA 3KLNA 3G02A 4MWCA 1RMYA 1GZ4A 3OHMA 1RWVA 2WE8A 3USES 4KR0A 2D6FA 2QTAA 3A9WA 3H18A 2ZDHA 3GEIA 1Z0KA 5JS1A 4LZWA 3WMXA 4BPRA 5C4MA 4TTRA 4AQ7A 2QTNA 2VJAA 1DQSA 1EFVA 3I32A 1QC5B 3HYTA 3JZIA 4US1R 3WE7A 4ER7A 3ML1A 1ZM9A 2FMXA 1F8FA 2COEA 1VCNA 1EUDB 1KVQA 1U1IA 2GKOA 2HJSA 2J59A 1S2NA 2OGWA 3OX3A 4K46A 4YO8A 2OA0A 3WLKX 5I7VA 3EZ2A 2O14A 1QX3A 3BIJA 3DV9A 5KKAA 5DNWA 1E8NA 5EQFA 4JT4A 1I9GA 3ZG6A 1G8GA 4QZVA 2FZEA 4JL6A 4KIFA 3KE9A 2BZ1A 2PMCA 1CW2B 2HIAA 2ZRDA 1J5XA 3LKVA 2CZCA 3PX3A 2X6QA 4XGQA 1J33A 1SK8A 1R5JA 3A4VA 4LGYA 1OKKD 2H6EA 4PINA 4Y9UA 3WGYA 3T0GA 1CUBA 5K0TA 4TSRA 1D1SA 4B5LA 3GV0A 1XRPA 4QYWA 5J5VA 5LA6B 4BMXA 4NV0A 2G28A 3T1VA 2GHQA 4EPTA 1O57A 2C2MA 2GAIA 2FZVA 3L8ZA 2R6CA 1KORA 3EXG2 3QWBA 2CXRA 1IHPA 4L5AA 3BWEA 4KC0A 1SXJA 1VGQA 2V7EA 3FX2A 2EDAA 1LLUA 4QNRA 3IDAA 1VL6A 3I72A 1M2OA 3HN7A 4F21A 2BGWA 5LDGA 3G6WA 3FSGD 5KNCH 5CB4B 4PZCA 5H16A 5LOVA 3PUKA 5AXAA 3O2JA 4FCVA 3G88A 1B4DA 5B2ZA 2IX9A 2IZ5A 3A1DA 4XUCA 3NTXA 3SM3A 4BQSA 1BX0A 1RP1A 2C8JA 3STUA 3M9WA 3HE3A 4RMGA 4EW2A 1JHMA 4GX0A 5FBHA 2ZUVA 3CVWA 2QSUA 3HZRA 3QV2A 4QXRA 2EAUA 3HJRA 1WE2A 4ZVRA 3GLGB 4KH0A 3W7VA 1MAVA 1VPVA 4MR7B 4MUAA 3T5AA 3AF5A 3E0XA 5HF6A 2YVAA 1A9QA 4RQTA 1KEEA 2YWJA 1NN5A 4JLWA 3ZUPA 4IKEA 5DK4A 1V16B 4G4JA 2DY0A 3SPXA 2J4FA 3UJDA 3OBBA 3CWZA 4BV3A 2VJPA 3JVVA 5TMBA 2GK7A 3SZOA 1FNBA 1ZPDA 3MEQA 4GKAA 3W5DA 2HL6A 1NM5A 2O3RA 3LGSA 2BHTA 2ZBGA 3M1AA 3LYHA 4G25A 4X95A 5DLEA 5DLPA 3ORYA 4UXHA 4XQCA 3SYLA 3IXLA 1LZLA 3SHQA 2JRLA 1RAEA 2YWDA 3ESQA 1AM4D 2VUTA 3BMOA 3KTOA 3WLOA 2D7DA 3THXB 3LYUA 4I1RA 4J07A 2B1RA 3JQAB 5JNWA 2OP1A 4WECA 1LTHR 5B2FA 1VLZA 3C6QA 3TQTA 2GESA 3JAKA 3VDMA 3AM5A 1DRVA 3QU2A 4HVCA 1HYEA 2Q3FA 4FDMA 4EKGA 1C9MA 4EOGA 4EB3A 3RB8A 3W8EA 3O83A 4DADA 4EQZA 4B87A 4Y1RB 2V6MA 3LUKA 5DRYA 1MQ9A 1RRFA 5CTAA 1TK2A 2IVFA 1G9XA 2X0NA 2P5SA 2ZITA 4HAWA 4HNHA 2Q1WA 3QE2A 4ZV9A 1USKA 4Z2YA 3C6ZA 5KYUA 3AB3A 3STVA 1QYDA 3UOAB 5BWMA 1ZAYA 1DVRA 4ENSA 821PA 3KSAC 2AWNA 4HNUA 2NTJA 1CR6A 4YAOA 4M8IA 4ND4A 4WY5A 5AHWA 4CMJA 4RHEA 3VU8A 2FW1A 2IP4A 3MUOA 3WAKA 4WACA 4ARAA 1ECCA 4QJ3A 1C0EA 3PXEA 2WVHA 3E9MA 3FZNA 4G41A 1L8LA 5AUOB 2L82A 3RCBA 4DBLE 2H4ZA 1XQ1A 2QTTA 3HWX1 5COAA 3Q7TA 5D7BA 1IXZA 1BEUB 1A9ZA 3QHAA 3SOPA 2B1IA 3STWA 3WMFA 3ZV4A 3CH4B 4BB6A 1JKJB 4YMTA 5KQSA 2ANCA 1WQ1R 3TIGA 3CR3C 3F0TA 4IWXA 1H3FA 1YOVA 3HZHA 5BPFA 1V3QE 3HSKA 4UTRA 5EIOA 2I9KA 3EY4A 5KYGA 1WBDA 2BKXA 2IE8A 1PAUA 1WDMA 2UUOA 2PS9A 5COBA 3UOGA 5I4IA 3HKDA 4E5MA 4XLTA 3L6BA 3NP7A 4PPYA 5BN1A 3I2JA 1KBQA 4F46A 3Q41A 4NH4A 1P1IA 3DYBA 1ZHHA 1Z5WA 1IWOA 4WBXC 3HCBA 3IBFA 1G98A 1H0SA 4A10A 1ULHA 3AETB 4OJQA 4YREA 3CVYA 1SCUA 3AJEA 1H2BA 3NWPA 3N0RA 2BMEA 3MN1A 3WMGA 4D5GA 1T25A 3I4CA 1NLFA 4MVJF 1FX0B 3GXOA 2X7XA 3T3HA 3OAAA 4HQ6A 4Y7CA 1M2HA 4QREA 3IJPA 5DGHA 4H60A 1VLLA 2UUAB 4BNTA 3M6WA 1OGJA 4QTXA 4ZVUA 5HS4A 2ZJZA 2QL6A 1CZUA 5EJAA 4B8YA 2XGMA 3VFDA 3ZNQA 1ODFA 5CDFA 2IXGA 2HXGA 3QEJA 4MEBA 1M0SA 2IH2A 1AN0A 3U3OA 3URMA 1O3YA 3BQ9A 4DAEA 2P7HA 2IE0A 2XAAA 1QQ5A 3QFHA 3KVOA 3P96A 5AJTA 4RZXA 5DGIA 1AB6A 5JZOA 1YCHA 2G07A 3WGIA 2E18A 4K03A 4PVCA 5H80A 3D7LA 1ZCAA 2ZBUA 1O9GA 4B44A 5EJ9A 1PUIA 1I2BA 1G5QA 2R00A 4KX3A 2DCMA 4Q7MB 5HKKA 1FA9A 1NBIA 2C1EA 3AONB 2JLUA 2VJBA 1GTJ1 2IXBA 2V7TA 1PKXA 3CO0S 1W59A 2PYDA 1I10A 4Q93A 1ORIA 2I9PA 5CYFA 3ZQ6A 4CKWA 5DASA 5KSOA 1UFQA 5ILOA 1UPXA 4U2GA 3OTGA 3KAQA 3T9FA 4C04A 5JOQA 1KMHA 1Q0SA 3DVQX 4L2IA 1X80B 3F5DA 2G7ZA 3AKDA 4M9UA 1VE5A 4R1SA 5CR9A 4PEVA 4RLQA 4Q9KA 4UQLA 2CVPA 4IZIA 3FBGA 4TMWA 3P97A 2AQIA 2LR0A 1FFCA 1PNQA 5EPEA 5EPUA 3RU9A 5HK8A 4R9UC 3SYKA 1TKCA 2PS3A 5ITVA 3DCNA 3F1LA 1PS8A 4ITUA 2M6LA 3AFMA 1OI7A 2Y0CA 1ILWA 4YGYA 3GWGA 2A5FA 3UOWA 4DRYA 3PTAA 3T5TA 4NI5A 5CCEA 3L18A 3DMTC 5D6NA 4MAMA 1UBLS 1JSCA 1Q91A 1KSJA 2ZRQA 3KUUA 3KQNA 5SZIA 4EK9A 4IOJA 1O0BA 1L4GA 1RWQA 3RT7A 1IZ0A 4ADSG 5LQUA 5IBPA 3TLJA 4RV5A 2C0PA 1O0CA 5BVHB 3RVOA 2PJRA 4UU8A 2CMGA 1AKQA 2DTDA 5M04A 1SVKA 3FN4A 4YRRA 4U7JA 3HJTA 4AWAA 3S1SA 1W46A 4FGLA 1SD2A 3TWOA 3G9TA 9GPBA 3P0FA 4CL8A 3GK3A 4FT2A 2VC2B 1YL6A 2OSVA 3ABQB 2ZBEA 3NCTA 3OFJA 1JKIA 1YRWA 1JFTA 5IBQA 3WQHA 5BNTA 4K9DA 5ALIA 3BJMA 3TTYA 5F1PA 2DHDA 1EXVA 1QGUA 4LZPA 1TPZA 2J33A 3E1SA 3W5HA 3Q7EA 4EAQA 4HVTA 1YJXA 4F5ZA 4L8FA 1DARA 1VPLA 2V65A 1H9CA 3I01A 5FTMA 2UZIR 2ODWA 2QAGB 2NXJA 1Z6ZA 4HAXA 3WYCA 4GZLA 2XZOA 3EVGA 3R4CA 4E1AA 3AUXA 1DAEA 1WWKA 5AOAA 2W6QA 1U5AA 3K2EA 2ZVDA 4ZT7A 3W77A 3I9MA 4KIGA 2P6MA 2XECA 1H3NA 4RGQA 5HYVA 2NSJA 1HDYA 4HQLA 3ROQA 1V8PA 1ZCBA 3FF4A 2PUJA 3RM3A 5B1YA 2H3HA 2EC5A 3RU3A 1ISHA 4LBYA 2IYTA 1FP1D 1OJLA 1W87A 3MQ2A 3UA4A 1WXHA 1C41A 5DLQC 3CW2A 2Z5LA 3E9YA 4XEUA 4EZIA 5JXIA 2FPPA 3MWKA 4GD3Q 4R51A 4RVGA 4JITA 4A03A 2BR4A 4OQFA 4WBNB 2H7XA 3NJ8A 1SU6A 2FW0A 3JY6A 4YCDA 1ABBA 2RARA 3CB4A 3D0QA 4WTOA 3H9EO 3RJ9A 3MRTA 4XWKA 5HKAA 1BQ3A 1UZNA 3B3GA 3TW8A 1KFCB 2R66A 1C1DA 2YIJA 1C1XB 3TR5A 3K6SB 1OVMA 1N4AA 2ZRPA 3CRMA 1GQFA 2XNHA 1KH3A 2VDMB 4XFDA 5DX1A 4D9HA 2XOXA 2ZUSA 5DOVA 2G0TA 5B4VA 5K7SA 4KR9A 1D2CA 1MJ5A 2H11A 5H0IA 1GZ7A 1CS0A 3UFXB 1GPH1 3THYA 2R8ZA 5EZ6B 3PQCA 1UMBA 2HK7A 3BOSA 4E21A 3LVFO 4UD6A 4B2YA 3VKHA 5BSGA 2Z6QA 1X1TA 1YB7A 1Z47A 1M5RA 3QOXA 1T4MA 3A37A 4C0QC 4KQCA 5HRAA 1SG6A 1EHIA 2HA6A 3HLKA 3OT4A 3Q8XB 3QMVA 4B3BA 5AKLA 5DBGA 5C52B 2P2DA 1RCUA 1TYBE 2PX6A 3DDHA 4LI0A 3R75A 1QO0A 3B3FA 3LP8A 1UWVA 2JH8A 2ZUDA 4K9OA 5IDXA 3ZD7A 3ZBUA 4DMRA 2C5LA 3ZOZA 4F6LA 3SYMA 5A4AA 2GZDA 3AEUB 4REQB 3AVWA 4X85A 1XD2B 1E8DA 4WRRA 2H85A 2PLRA 5I9MA 5TQ0A 1JFVA 2EKQA 2WFLB 3DWGA 3AEXA 4P4SA 4D9FA 1NLYA 3UGJA 3LCVB 3HVHA 1EFAA 1ZMOA 2CF6A 4UEKA 3PC4A 1JHQA 1CEQA 3NCHA 2RGXA 2FPGB 3CLTD 4Z1MD 1O6BA 2FMKA 1W88B 3HDYA 2Q5FA 4PHFA 4WFIA 2GYWA 3ZQJA 1B15A 4ZXPA 3E8XA 3SNHA 1VKZA 3V8QA 1KS2A 1XTUA 1X7YB 2P9FA 4C4YA 3P0RA 1Z4IA 1C0KA 1NXXA 1QJCA 1P4HA 1L5YA 1D6SA 3VOBA 4JASB 3ZHSA 3C0KA 5CK5A 3G5UA 2QMQA 5JC8A 1HDRA 2OCYC 1VJ1A 1L3BA 3JQFC 3HUTA 4FEYA 4GWKA 1ZGJA 5SZHB 1PLJA 1ORDA 2QF7A 5CITA 3KR1A 4TPKA 3PDIB 4FFLA 5IKPA 5I7WA 1C30A 4AMVA 1Y7LA 2ZANA 2ZSKA 3LDGA 4XLZA 3KPWA 3W79A 3ZY6A 4GS5A 1ID8A 1YTUA 3OCUA 3T3PB 4YI3A 4WNIA 3N87A 2IUSA 3QVXA 4HMOA 1IY0A 4TKUA 4W7IA 1YIAA 1FDOA 2PZAA 1MEJA 1AKYA 1TOAA 5L8VA 4UCXA 3NWOA 1PR0A 1UXJA 2LIPA 4UFOA 4DDHA 4RTLA 2VDPB 2IX3A 4ZV4A 2FP4B 2PL9A 3PDHA 4JSYA 1HDZA 3I6MA 4RPHA 1Z74A 4YO7A 3LQYA 4I3HA 1CJBA 2ONYA 3HV0A 3UWKA 4UTVA 2FVYA 4ZCPA 1SOUA 3HB1A 2GRAA 2Z0MA 4I2NA 4BO4A 1ZMXA 2B1QA 1R9GA 3EQ9A 3TO5A 2KJQA 2WT4A 3G2HA 1EPUA 3MWFA 3DNMA 4FOLA 3A6KA 2NVUA 4RS3A 3I0NA 4ARCA 2B69A 2FI1A 5BSKA 2CNWD 1A9RA 3T1TA 1UJ4A 2PQMA 5DGXA 1XRJA 3EVTA 2LDBA 1TCUA 3O4IA 1TO6A 4G0NA 4CM7A 2MT9A 1YVDA 3U13A 5HZGA 2PTGA 2YWCA 1L5LA 2HNKA 3KUKA 2C42A 3QVMA 4H1HA 3D6HA 1P4SA 3LWDA 1U81A 4HNAB 1R9JA 4J4BA 4WLUA 4KN6A 1UDWA 2MR5A 4C06A 4WIAA 3PENA 5AM0A 3LZDA 3RVRA 1UIRA 1N34B 3CLSD 4CF3A 1CKEA 3B70A 2QW1A 4LJ9A 2MYPA 4MA4A 4P3KA 1CJVC 2BJVA 4G89A 4R1PA 4MHTA 1GEGA 2HWWA 3OE4A 5KWSA 2Y92A 2H9AA 2VI5A 3NO4A 4KK3A 4ZPJA 2GERA 2FW7A 1YC2A 3A2MA 3U1VA 3MBKA 3KQHA 4K6FA 1G4HA 4NBNA 4BMYA 5KKNB 2G04A 3W3AA 4QO8A 4URWR 4RC9A 4Y67A 3VI3B 2BYTA 4TQ9A 2B4TO 1DUIA 3K1ZA 3OA2A 4KXYA 4TZ6A 1QYVA 1Z17A 4R6WA 5FF9A 3C3PA 1A4UA 3KJEA 4Z4HA 3I61A 1E1RD 4Y3UA 2W2PA 2Z8ZA 3UFBA 8LDHA 1UJMA 2YIMA 1BE1A 2NTEA 3CR8A 3GUVA 4WZZA 2D06A 3N8IA 5AO9A 3ABIA 3GD5A 4NZOA 1WEHA 3DT8A 3KYDB 2QX9A 2ZU0C 3C5EA 2FK7A 1JT9A 4OOFA 4WUTA 1DOAA 1QVVA 2EKDA 2RGGA 5IH3A 5EJ7A 1YVPA 4XQ9A 1R0KA 3Q8LA 4BMSA 1L7OA 2BFCA 2FW9A 2VP6A 3DEIA 3JYPA 4ZO7A 5ALFA 5ALWA 5EKSA 5FUWA 5K45A 3PPVA 3DFZA 3AKZA 2PKYX 1DMSA 3EXHB 2YXPX 3NVAA 4NULA 4RF5A 2OV4A 1U2EA 3OHPA 3CNHA 1D2HA 2IKQA 4FHDA 5EWJA 4GG1A 4V0SA 1KI3A 1YKGA 1XNJA 3L8GA 4R2IA 3OZGA 3IPCA 2H2WA 2HF8A 4GSKA 5G53C 4KMMA 4ZALA 3EVDA 4AUEA 5AJYA 3G7SA 5BYBA 4GHWA 1LU9A 4PBSA 2EP8A 1NMEA 3LUGA 3GBSA 1VPDA 3R24A 4AJLA 2HRDA 4KXXA 1N2HA 2M9MA 2VSXA 3PG5A 4MK4A 4B3GA 4Y30A 3W0LB 3Q3GE 4CG0A 2FUEA 3OHSX 4R40A 1EDOA 2PMFA 4KN8A 1LDGA 4O4LF 4QX6A 1ZN2A 4JJ4A 4XVHA 3TB6A 1M0EA 1DB3A 3BH7A 1QTRA 1Z07A 1KVUA 4KIWA 1KDYA 4HVLA 1EG2A 4MVJA 1QQBA 1M6EX 2XZPA 3T7CA 4ZU3A 3ENQA 5BXYA 1NTOA 5AXBA 2P9QA 2AOUB 1BAPA 1ABEA 4IGEA 1RPZA 4N9QA 4LYHA 5CT9A 4FYMA 5I7AA 1TZMA 4Y9RA 5KOJB 5K0ZA 3A6ZA 1L5WA 3REQB 4YUWA 4MV5A 2Y68A 4OF4A 1RLUA 1L9KA 1YGYA 5DYWA 4A1OA 1PX0A 4B71A 4N12A 3TCNA 3QFSA 2N1MA 3I28A 4IYJA 1WDTA 1B42A 4R8VA 4ESVA 4IV0A 4DR4B 3B2NA 3KHKA 4FW8A 1K4KA 3LLCA 1E2MA 3D6UA 2BEUA 5HFNA 1KO7A 5L7TA 5LL6P 5EIBD 4A27A 3CT4A 2ZQZA 3UF0A 5C37A 2ZRJA 5EWLA 3MHTA 4CIAA 4N5LA 1SBHA 1CR4A 2YY6A 4PNPA 2PWBA 3MTGA 1CUWA 1VKHA 2B8WA 2QROA 3WLSA 4L0CA 4EHLA 1I24A 8MHTA 1T6YA 1SBCA 4DLTA 4CIXA 3CF0A 4LXIA 1J9ZA 1XHFA 3AP1A 2IK8A 2NWQA 3FKSD 3WZ2A 3LZCA 3MINA 1WHSA 3TZEA 5EJ5A 4IW3B 3KLMX 1K63A 3E70C 5ICGA 2IYEA 4YJFA 2ONCA 4EMUA 5CJ2A 1G9SA 3OLVA 1VGRA 1K75A 3WGNA 5TVGA 4ZN6A 2XWQA 1TZBA 3QK7A 2JAOA 1OWNA 1P2FA 3E82A 2DFNA 3VOSA 1JFFA 3HG7A 1SBZA 4QAJA 3U6BA 4I1UA 1YF3A 1P2UA 1DDOA 4JJ6A 4H7IA 5BV1A 4XDYA 5LSAA 1A2OA 3A06A 3ACDA 3PHJA 3ABRB 4KIJA 2SCUA 1K88A 5LNK6 4Z8YA 5ETJA 1BCSB 1NC3A 4KVGA 4KAAA 2WIBA 2RGNC 3CX7A 5HHTA 3FHTA 1P29A 1Z0FA 3ZWYA 3FUWA 3JATB 3NIGB 1S1MA 4L1KA 4PRZA 3BXHA 4DLBA 4DZZA 1DO2A 2ZJBA 1HE3A 3GVPA 2H9YA 3MOGA 4JR2A 2I6SA 2BGIA 1QP0A 2I4TA 3MPUA 1HZJA 4X5OA 2C4UA 3F5FA 2X5NA 4YCMA 3JWPA 1DBQA 3A9UA 1EFDN 4A6EA 2EKPA 3GRCA 4HB3A 2ZK7A 3DBRA 4EY3A 2X4LA 3CLUD 3HYNA 1CUJA 2XWBF 2VKQA 1CDDA 4D42A 3GPCA 4ZTBA 2GDJA 3SDSA 3RQSA 1EP1B 5LQKA 1E4OA 2O0KA 3ES9A 1QYWA 1V8DA 1Z2CA 4BNZA 2J0UB 4IUDS 5EXSA 4DWOA 4ZVMA 4I1PA 1NY5A 2UZ4A 2IS4A 3G59A 4PSUA 2FEXA 5FA6A 1MO4A 4GECA 2XCRB 3LA8A 3LT5A 1A5BB 1MN6A 2W22A 4MV6A 3UICA 2XCTB 1CUVA 3ETJA 2DQ4A 3G5TA 5ES4B 2JRCA 2P3SA 4LGVA 2O6HA 1Y4ZA 4ND5A 5LFAA 4GZMA 3ZLBA 4DIDA 2YMQA 3IP5A 4UM7A 1KEVA 4YR7A 4YJ3B 5K03A 4IOLA 3FOCA 3N8NA 5DNYB 4IUYA 2UV8A 3V1NA 3SJBA 4M83A 2CJFA 4OO3A 4DUYB 1Y89A 1AD2A 1J8FA 5AI0A 2VT6A 3UK0A 4AJOA 4KYIB 3U1TA 9ABPA 5L53A 4O3FA 5C7YA 5JCJA 2C2BA 4M0LA 3I9KA 4ZYZA 5JJIA 5CJJA 3M1IA 3PFNA 3T7DA 2I3DA 4V0KA 1PWEA 1K0FA 4EECA 1RZUA 2GJ9A 1E1LA 2IY7A 2XCUA 5B5SA 2NSLA 1TJYA 2BCJQ 4ZICA 2VHEA 1RYFA 2ATIA 5FAKA 1GPKA 2I66A 2WM9B 3LD9A 4GMFA 1VL2A 1CUFA 2HJVA 2H2GA 2VNAA 1GRVA 5D5QA 2BUBA 4OH1A 4CMAA 3QF4A 3H5LA 5ERXA 4H17A 4H7DA 4F8JA 3PE4A 5F9FA 3AR6A 1A0OA 3KJGA 3MLAA 1EK1A 3Q0IA 3V1KA 4FHCA 4AZ3A 3S2EA 4BO7A 5K2OA 3PVZA 4Q48A 4OM8A 1E4VA 4GQAA 2UVPA 4GEKA 5AR1A 5FOUA 1TFRA 5I4KA 4CF5A 4EHJA 1IONA 1NBME 2HU2A 2PDAA 4R05A 5EIEA 1XWWA 4TM8A 2QVBA 4CM6A 2H06A 1T91A 4NZ9A 2GJAA 1PD1A 2C54A 2WDPA 3A4TA 4D4IA 1KQFA 2J4DA 5LA6F 1GA6A 3GOQA 1B74A 1NY6A 2XHEA 2RK3A 4JOSA 2IXEA 4MYHA 4P4UA 3WB2A 5E6UB 4WZAA 2WT8A 3GNTA 2Y66A 3AEKA 4PN7A 4IXTA 3K32A 4YT8A 4LRTB 2LBPA 2AI3A 1H2AS 2X3UA 2C77A 2RHRA 2WAYA 1W6RA 4BRUA 1AA6A 3U48A 2GZ2A 2M6KA 1RXEA 1J42A 1F2TB 1HLFA 4UU1A 3GLFA 2JH9A 3LW7A 5KNBH 5KHOC 1BX1A 3IQDB 2ZR9A 4PGFA 3CKYA 2B2CA 3LLVA 3ZE1B 3N2ZB 2DY1A 2DHCA 3ZD8A 1QH1A 4BVGA 4HX2A 4B8WA 4CJXA 3W5CA 2AN3A 3AQIA 3F73A 4JI4B 2A9JA 3TKLA 1XU7A 3ZWAA 4NEQA 3WL7A 4X44A 4UDYX 3CFYA 3INYA 2VYCA 3QXGA 4G0XA 1GPLA 2V9PA 4TMKA 2AE2A 5C5EA 2GPJA 1GGVA 1Y5LA 3R0IA 1Q3HA 1W34A 4A82A 3I4LA 4ODIA 5JARA 3HB0A 2O19A 4F3YA 4EKEA 4RAOA 4CTNA 1HBJA 1N6OA 2NACA 2GX6A 3QVVA 3QXCA 5CFOA 2BRUA 1TU4A 4ZJZA 3GFTA 2DBQA 4B09A 1ZUNB 4PC2A 4TOIA 1U0BB 4NG4A 2N47A 1I13A 3P0JA 4RZUA 2BBOA 2YW9A 1S2LA 1XUOA 5DTQA 2W98A 1XJWA 1GA1A 4JY7A 3TZCA 4LJKA 3RYIA 2WSBA 2D0IA 1NV9A 5AUQA 5FI5A 2R86A 3PHCA 4B17A 1Z5NA 5AIAA 1TM2A 3BFXA 3G3EA 3NTOA 1UDCA 1LI4A