1V9SA

Crystal structure of tt0130 protein from thermus thermophilus hb8
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
208
structure length
199
Chain Sequence
b'MRITLVDHPLVQHKLAHLRDKRTGPKDFRELAEEVAMLMAYEAMRDLELEETTVETPIAPARVKVLSGKKLALVAILRAGLVMVEGILKLVPHARVGHIGLYQYYIKLPPDIAERRAFLLDPMLATGGSASLALSLLKERGATGVKLMAILAAPEGLERIAKDHPDTEVVVAAIDERLNDHGYIVPGLGDAGDRIYGTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uracil phosphoribosyltransferase
publication title Crystal structure of uracil phosphoribosyltransferase from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Transferase
total genus 47
structure length 199
sequence length 208
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.9: Uracil phosphoribosyltransferase.
pdb deposition date 2004-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14681 UPRTase Uracil phosphoribosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1v9sA00
1GPH1 2WNSA 1U9YA 1TC1A 1A4XA 1UFRA 1FSGA 4IJQA 4OHCA 4M0UA 5BRNA 1PZMA 1TC2A 5E38A 1OROA 2H07A 2C4KA 1ZN8A 5HIAA 1BD4A 1I0LA 4TWBA 4RQBA 5EUCA 3DEZA 4RHYA 1Z7GA 1DBRA 3GGCA 2E55A 5BQPA 1UPFA 1VCHA 4RABA 1G2PA 2DY0A 4PFQA 4QYIB 1I0IA 1ECFA 4P83A 4RHTA 4RADA 1NULA 2JKZA 1G9SA 4RANA 5BSKA 1QK5A 5HKLA 3QW4B 1P18A 4RACA 1I5EA 1YFZA 4RQAA 3N2LA 2PS1A 1G9TA 3ACDA 2H06A 4P82A 3OZFA 2HCRA 5KAMA 5IPFA 3LPNA 2AEEA 1WD5A 3EFHA 1UPUA 1DKRA 4X44A 3NAGA 4JLSA 4JITA 1L1RA 4LZNA 5IAOA 1ZN7A 1XTVA 1G2QA 1A96A 2XBUA 3OHPA 1A97A 1IBSA 1XTTA 2H08A 2IGBA 2YZKA 1V9SA 1U9ZA 5JV5A 4LZOA 4QYIA 1HGXA 2P1ZA 4Z1OA 1XZNA 4RAOA 2JBHA 3KB8A 1Y0BA 4P84A 4P80A 5BQOA 4F8EA 1GRVA 3MJDA 4M0PA 4LYGA 1ECJA 1A95A 3H83A 4P81A 4RV4A 4P3KA 1STOA 1P4AA 3ACBA 1XTUA 4MB6A 2PRYA 3M3HA 1O5OA 4LZAA 1O57A 1BZYA 1OREA 1QK3A 4RHUA 3HVUA 2JI4A 1ECCA 1QCCA 1DQNA 3MBIA 1OPRA 3O7MA 2VFAA 4S2UA 1W30A 3DMPA 1ZN9A 3GGJA 5ESXA 1QCDA 4QRIA 5JSQA 2JKYA 4X45A 5ESWA 5KAPA 1VDMA 4RAQA 3S5JA 1P19A 1MZVA 1A3CA 2PRZA 1QB8A 4ZFNA 4FYMA 1HMPA 1ECGA 4PAWA 1BD3A 3G6WA 1L1QA 1VSTA 4LYYA 2EHJA 4M0KA 1D6NA 1J7JA 1P17A 1QB7A 3LRTA 3OZGA 1ECBA 1JLSA 1QK4A 1I13A 4KN6A 4RHXA 1R3UA 3ACCA 3DAHA 4P86A 2GEBA 5K51A 1A98A 1CJBA 1AO0A 1DKUA 1NONA 1DQPA 1JLRA 1XZ8A 1I14A 2FXVA 1LH0A 4WN3A 4WMLA 3GEPA
chains in the Genus database with same CATH superfamily
1P8JA 3HH8A 3VR6A 2AJ8A 4BMDA 3GRUA 3OJFA 3SS8A 3WBJA 2NPOA 3QIVA 1U0SY 3JAKB 4BCDA 4K9DA 3GLRA 5LYYA 4GMXA 1DB3A 3ABRB 4P7FA 5LQDA 1DJMA 5DOVA 3MILA 1UQRA 2GN8A 3LX4A 2D0OB 5BR7A 3TXXA 1QV6A 1TQ6A 3STYA 1Q2XA 3U7QA 5IKMA 4EMSA 4RTRA 4NYIQ 1E1LA 4G5XA 2NWQA 2YTZA 3EK2A 4CU2A 1CJTC 1XROA 4CDRA 3TTTA 2H59A 3OE5A 2B2CA 1JNYA 1JYEA 2HSEA 3IP3A 3M82A 4NI5A 2AC2A 4G0QA 2QN9A 1GWNA 1ZZGA 2QTRA 3A04A 1XSEA 2YMLA 3MELA 5CVEA 2AQHA 1E4VA 2HNAA 1NLMA 3TKLA 4PHHA 3FCOA 1BDJA 2VAWA 2GA9A 3ZJUA 1PV2A 3GLGB 1CUJA 2BGLA 2YJ4A 5F1KA 2QTVA 3MFYA 3C1UA 3C74A 3GL9A 2FR8C 4X1YB 3ZE7A 5ERXA 4G09A 1KJJA 2ID8A 5H1YA 3IJEB 3CXRA 1A1VA 3NVDA 3E5MA 2YW2A 1DSSG 4UBIA 5LN1A 4HGQA 1M0TA 1DLJA 4RZUA 4IUYA 1V3TA 2WE7A 4MS3A 3TUJC 1FSZA 3F9RA 2V5UA 3OLYA 3OFJA 5FUMA 3AQ4A 1N2CA 1CZNA 3GT0A 3WNBA 3WFZA 2F1KA 1BDMA 2WF6A 3L0DA 2Y1EA 4MUAA 1XYYA 3B53X 3TOCA 1VCNA 4DV4B 1ZD4A 2WKRA 2FKNA 4P3XA 1SXJE 1ISPA 2BFEB 4HUTA 9ATCA 2FZ4A 3QXJA 1YRYE 1UKVY 1NKTA 3HY4A 1Z74A 3Q0TA 2GN4A 4GDFA 3WSTA 1AKVA 1GGVA 1YOVA 1L5FA 4CTOA 3GMIA 1GCUA 5FO1A 1N5JA 4CTJA 1NXQA 1U04A 3OT4A 1H66A 1BTOA 2REQA 4F86A 1W0CA 4IAOA 4MULA 1XEAA 4KLNA 5DJ5A 4LJ7A 3UC5A 4EENA 2IBTA 4S2UA 1QKJA 2RH4A 5I4CA 3PLRA 3HUUA 4CDGA 2COUA 4WPGA 2E4AA 5DU2A 3ICEA 3RSFA 3GFGA 4Q3BA 2DT8A 2C1EA 4BCBA 1BKYA 1E60A 1MZVA 2G6TA 1X1BA 2FEMA 3ILYA 1S2OA 4HMQA 4KXXA 4QVIA 5AT1A 4IVPA 3PFFA 2PEYA 1UANA 3I5UA 4BNYA 3AHGA 3O8RA 4FMDB 3B52X 1ADJA 1E1NA 5BSEA 5WRFA 4YYZA 2NGRA 1MAVA 4WXMA 3V1TC 4DQVA 2OM6A 1HDRA 2C77A 3LY5A 4C07A 4GKBA 8LDHA 3KWFA 1ZX1A 1SCUB 1EP3B 1P29A 1ZRMA 4ARSA 3MQFA 1J5EB 4KPUB 3KT8A 3OEEA 4V1CA 3GJ4A 1D2GA 1ODFA 4ENSA 3IXQA 3UB2A 1DAMA 3W5SA 3ZVMA 5LIPA 3ZY2A 1VYHA 2VYQA 1AMUA 3NHLA 4BO8A 4I4CA 2O2SA 4I6GA 2VHVA 2BEVB 2A1TS 4X3PA 3FYUA 1VBNA 1T4GA 2QN7A 3R20A 1LJ8A 4NENB 3LKZA 4OXYA 5UKDA 3INYA 4QXAA 4ER3A 3NP9A 1Y7IA 3CUVA 4AJNA 4ZOLA 4E2ZA 4WNYA 3TQCA 2VHYA 1RBQA 4R8VA 1C7FA 5JG7A 4LHYA 1Q84A 1WHSA 1MAHA 2PL5A 2I3BA 1A71A 3LL4A 2O2JA 3H5TA 1H4QA 3ABIA 3Q9SA 5F4ZA 3MEQA 2ZUEA 1G5FA 4S1OA 1TRHA 2GEVA 4QU8A 5BSUA 1Y42X 4QHTA 2I6UA 3KHKA 1YZHA 2B21A 1H05A 3LHKA 3RV3A 3A05A 4OUDA 4JI6B 1VIYA 1QC5A 2GMWA 3ZHSA 2FRVA 1F8XA 3M3PA 3RSSA 3TAHA 5LDDC 4XJTA 9ABPA 4ESVA 1EWVA 2NU6A 2WTXA 3E3MA 3HQ4O 1RM4A 1WY7A 2H4FA 1ONBA 3LFUA 2AUTA 4I1UA 4QPJC 3D59A 4YRJA 5BW8A 1PZFA 3RM3A 4JJ6A 2P2NA 4AXBA 3RYCB 4ZCSA 4WXEA 2BBTA 4QNNA 2JFUA 1EPUA 2CJPA 3BGIA 3OZFA 4NFHA 2QY9A 4BFUA 2IUEA 2C2OA 1TEZA 1EINA 1YMUA 4EKDA 1RI1A 1RZUA 1C81A 4G07A 1ATIA 1TF7A 3I9JA 5IC5A 1QQBA 1BWSA 2C0PA 3A1WA 2XKKA 2BDTA 3WK6A 3L07A 3JYHA 3N2NA 1TDJA 1J2UA 1NW5A 1RYBA 2X5JO 4FOSA 1JILA 4R31A 5ALDA 3SBEA 3SY8A 3KJEA 5A05A 2HOQA 4JVSB 5AHXA 4YPVA 1ORTA 1DO8A 3Q8XB 4DDMA 5L3QB 1MAUA 1LF0A 3LUBA 2BKAA 3AP1A 3H5AA 3P2MA 2ZUFA 5F3WB 1LLQA 2IY8A 3DWGA 4H1VA 5H80A 2YMPA 4G1FA 1HE4A 4MW1A 1LSOA 5EJ2A 5BPFA 1HFEL 1GUBA 1NHWA 4EUSA 1IULA 1MFPA 1TA0A 3P1JA 3BD6A 1RMYA 3ASUA 3CF2A 1AUXA 3PYMA 1ZUWA 3PD0A 1HKUA 3PV0A 3SE0A 4DR1B 2C9MA 4TT8A 2J0UA 4Z5XA 5DE3A 5E3IA 5FX2A 1K3TA 1V5FA 2PZ8A 2HW8A 1RJGA 4MRAA 3B12A 3F9CA 1WXIA 2J6HA 3ZDBA 1YOBA 4G0UA 1U7HA 4XJVA 2GTHA 4DV1B 1SXJA 3O4GA 3OC6A 4AMUA 2FV8A 4EW3A 1O0CA 2CLHB 1JH8A 4A3SA 4HTFA 5HXAA 4YJGB 3Q5DA 1A04A 1R74A 1UJNA 1GSHA 4DBZA 3K9QO 4MQ5A 5LB2A 4JP5A 1MX5A 2Q6VA 2QV0A 3O82A 5DMXA 2R79A 5FOTA 4N39A 1UFVA 2DSNA 4UM9B 9LDTA 3L40A 5IT5A 2IH4A 2GBFA 4UEOA 2X5NA 1S5PA 3T7RA 3AZOA 3DAOA 3R5TA 4QBFA 1YQEA 3DHEA 3HSYA 1R6BX 1C80A 4MWZA 5BMOA 1Y3HA 1YQGA 2P9EA 2PFKA 3H2YA 4CR6A 1YJQA 5FBHA 3RO7A 1JHZA 3EY4A 2J3DA 1TJ3A 1WMFA 2AX3A 2EYUA 1WW8A 1D2AA 1GV1A 2CKMA 4M7WA 5EAIA 2OCGA 5JAIA 1VBFA 1I2DA 2HGZA 3HABA 4BECA 4HKTA 4CKEA 1JFVA 3O2NA 1P0MA 1TYBE 1W6RA 1Z0IA 5JS6A 4S1VA 1YCFA 1KFJB 2ICAA 2N0SA 5AKLA 5JFGA 3OOHA 4KN9S 3SFTA 4Z8XA 3EJ6A 5H5JA 1XCPA 1YS7A 1T1RA 1JE1A 1ZM4A 3JWPA 3R6GA 4GLJA 1XZCA 3BF7A 3C6XA 2I1VB 1V96A 5K8JB 2X14A 3TOZA 1PFQA 5GONA 5DZSA 3N0XA 4FQ8A 4CG1A 4X62B 2Y4OA 5FI1B 1IZ0A 3C6QA 3U4QA 3VHXA 3RASA 3GRPA 1GTZA 4U2GA 1WMAA 3OOEA 4CKBB 3F9IA 2E4UA 1EM6A 2GS9A 1JMYA 1W9MA 1AQJA 1D1SA 2HA6A 3I6BA 2R1TA 3A6EA 3LWDA 3PX7A 2E55A 4IR7A 5GAJA 1JIJA 5FOVA 5IJAA 4BE4A 2EKLA 4EZEA 4ED9A 4RABA 2F6RA 3OD5A 1HDGO 1N5MA 3H3FA 2J9XB 1TADA 4E6EA 4XCXA 1RC1A 5BWCA 3SKYA 1T1EA 2Y67A 1XRJA 5CURA 2QVCA 1IH8A 5JROA 4YRAA 3D3KA 1ONSA 3AVOA 2XF2A 3PBKA 1DIAA 1CY4A 5DBGA 4AWAA 2VDJA 5EWJB 4N01A 1FJHA 2I4NA 4FBLA 3LW8A 2RGEA 5EIFA 2XHEA 1KDPA 3AIIA 3NHRA 4B3SB 3U3OA 3AF5A 2FMKA 1LPNA 3NPAA 2GCPA 2QG9A 3AX6A 5CA0F 2JBWA 4CG0A 1D2HA 4CCYB 2JFGA 4Q3EA 1LVHA 1WV0A 4JITA 1VJRA 4YV2A 3FWNA 4BQOA 2O1WA 1RQLA 2H1WA 1AN9A 4DEVA 4DV7B 4W7SA 1RYNA 4U1RA 1L4HA 4CM9D 4RTJA 1YGPA 3OE1A 1EVYA 1R00A 4IEEA 1UF9A 3RREA 3T3MB 1NQTA 5LXTF 4KZKA 3NOQA 2L2QA 4V02A 5IKXA 4ALKA 2FZKA 4DTIA 421PA 5I5GA 4C3UA 2PKQO 1I7PA 3AEZA 2D7DA 3SZUA 3KCNA 1OMOA 2GJAA 4CF3A 4BGDA 1JX6A 2P5YA 5DV9A 2VJCA 2O5RA 2X3FA 1YQQA 2WD9A 5FT9A 2VDWB 2PUGA 1W76A 3PHJA 1EVJA 2QVBA 3LDUA 4MVJI 3TW8A 1TF2A 1V3QE 3L6DA 3CINA 1J8DA 2QG6A 4PYQA 2WSSD 1QHNA 1IU9A 4OXNA 2PUDA 2HFKA 4O25A 4TTQA 5CFLA 3PPVA 1CY6A 4BLRA 4ENPA 1NN5A 2C61A 3QBJA 5KYNA 2A7QA 1D5CA 3VJMA 5BWMA 4LHSA 3LV8A 3ZHZA 2JD2A 2NT4A 1U0OC 4UHJA 3TIGA 2GD1O 3KWJA 2VPIA 2IYQA 3B6MA 3PHHA 2C58A 2G4CA 1NVDA 4IIHA 1JIKA 1F2TA 3CS3A 3LWNA 4OM7A 1XWWA 3GA7A 1Z4LA 4N65A 4YRFA 3SQOA 1TGVA 4DANA 2F64A 3JSAA 3GW8A 4MUHA 4OYHA 5EKUA 2ZI9A 3HDHA 4X65B 1RFGE 4J16C 3RVBA 1N0IA 3I73A 3E15A 3D7MA 4PSDA 4YAKA 1YASA 1SHKA 2NP7A 3A4YA 5DHSA 3C3MA 3ELUA 1V39A 1TQ2A 5KTMA 4DVJA 2A78A 4TROA 2JATA 3IP7A 1UJ6A 1DKUA 4NZZA 4YN3A 1I01A 1PGPA 2FEAA 4PU0A 1XZIA 1EG2A 3BE5A 1OXSC 3BYZA 2OZLA 3A2MA 1SVIA 3HCFA 2BBSA 4R98A 4RS4A 3VZQA 3KQQA 3MA0A 3C6YA 1SY7A 2G0AA 3MWJA 2HDWA 3DL7A 1N3IA 2P41A 1BX1A 2XCSB 3C7DB 1QR2A 2OV4A 4LJLA 4AP9A 2OB2A 2ECOA 4IIBA 3WTCA 1T9BA 3KEFA 1A2OA 1YRQA 4UQPA 3AC0A 4D1YA 3UHJA 5DCWA 5JVDF 5LP6B 4PM4A 2IOHA 1HEYA 2HC9A 5JI2E 5FQOA 1B43A 3NTRA 4GZ3A 1LS6A 4O2BA 3QE4A 4LGVA 1MB9A 6GPBA 2P68A 3PGMA 4ZQGA 3ETCA 1ENYA 1DC8A 5AM0A 2O19A 3FLAA 5EN4A 1J1UA 1PR3A 4S24A 4OJQA 3TZEA 3F6PA 3PK0A 3BTUA 3H2KA 3JASA 2CSUA 2P6PA 4I4IA 2LCFA 3HYCA 1EEXB 1YVEI 5E3JA 4LF6B 4DHEA 3QJYA 4TL6A 4IDQA 2GHQA 1MT3A 1QWSA 1SUSA 2BFFA 1TZBA 2C8VA 3EQ7A 5LMUB 3FPAA 3BAFA 3WYEA 3ZCXA 3O0DA 4R7GA 3FHTA 1EGVB 1TTPB 2H7YA 2O7QA 3GVCA 5C1OA 4PNZA 2KWIA 1ZR2A 4X8OA 1GNLA 1TD1A 2X4GA 3PHBE 4N5NA 4RMNA 3UK0A 4C6TB 4P7JA 4X7BA 1PEAA 1MDBA 1YDHA 3QPAA 5BWOA 1BEZA 3C7CB 3JZMA 2Z9CA 3NYRA 2EP8A 3R4CA 1WQ3A 3OHPA 2XZLA 4HG2A 3PR1A 1ULSA 3Q7RA 1VHWA 3IP1A 3K09C 4ASUD 3LA8A 3PEEA 4ETIA 3R1IA 3K9HA 4PBTA 4TZTA 5EQJB 5JCJD 5HKBA 2JGLA 4Y6LA 1D0SA 1E1KA 5E6UB 1TU3A 1NMXA 2CD7A 2OV6A 3M5WA 4JBXA 5CRIA 1L4YA 4GW3A 4MQLA 2BGWA 1C9MA 1P80A 2IPAB 3P4YA 4JCOA 4N9WA 4U8GA 3TQSA 3W3AH 4KE7A 4AG3A 1JEYA 5AK0A 2C97A 3QEOA 1T9AA 4CMGA 2EDAA 2VHXA 3WGMA 2M1XA 2J7PA 1QSGA 2VG8A 1NAIA 4NHOA 4OIMA 1W0JD 3CKYA 2Y1DA 1XTJA 3PUHA 1DL5A 1EDEA 3S8EA 1OXXK 1T26A 2ZR0A 3VUFA 1OB5A 2GNOA 2MYTA 2O23A 4PNHA 4I5FA 4YDQA 3WO0A 1RLIA 1QS0B 1K8XB 4HWGA 2PWZA 4Q37A 1M3SA 1W0KD 3LZCA 1NJGA 4RULA 4HPXB 4BAZA 2N46A 5JIBA 2ZWAA 1NBOA 1IUOA 3ESRA 3GDOA 4HEA6 4JEHA 5F9MA 2WU3A 5BURA 5CDTA 2GXSA 2LV8A 2O14A 1AT1A 1EUDA 4MA0A 4OVKA 4NCIA 4E5KA 3UANA 1B0AA 3HFRA 2CJWA 2AN5A 1Y5IA 3V42A 2AR7A 2QIOA 1J49A 3FVRA 4FX5A 2OPHA 2AYXA 4MMZB 5BNFA 5A9SA 5K03A 4KAJA 5DT9A 5HE9A 1NYQA 1XJ5A 4FHGA 2W0MA 1AXGA 5EP2A 3X1KA 2RHLA 4M37A 5TMEA 3WYAA 2H1IA 1KI2A 1FDWA 3GVPA 4EJ6A 1UODA 1KHHA 2J5KA 3T4XA 4KTVE 5BNWA 2UZ0A 1EHCA 3GAFA 2PHZA 4BQIA 4UU1A 2LWIA 3N28A 1O54A 4AY4A 3OLWA 4A6PA 4Q6BA 2RGAA 2Z83A 3DV2A 4BGIA 3TRJA 1FBNA 5KYXB 1DBQA 1TEVA 4MIEA 4N5HX 3EGOA 1HY3A 221PA 1FDSA 2QGFA 2ZRIA 4F2PA 1F2DA 4CI0B 1AHPA 4BB6A 2IE8A 4N8DA 2R3SA 3O38A 3UWKA 2V7TA 3A3OA 2JK1A 3ICCA 2OOKA 5FWYB 3OJCA 4EGAA 4IFBA 5IDWA 2DUUA 4ZCPA 1RJDA 3CR3C 3RU3A 4NAUA 1DJNA 1E0DA 4YJ3B 1KEEA 1TM3E 2NQ2C 2UDPA 3LPDA 5HTOA 1W46A 3SS9X 1DS6A 4ACAA 1AKMA 3LUHA 1HTTA 3N6RA 4OQDA 4LF7B 3A4TA 2JW5A 1O6FA 4G3XA 3PYXA 2B8JA 3O8CA 1UBUS 4CPDA 5JYBA 4JYZA 2UUPA 3AKYA 3PGXA 4NKRA 1YFZA 4DCSA 3MIZA 2H2DA 1U3FA 3OP4A 3SJUA 3IMEA 2IODA 1Z4QA 4ECEA 4CWAA 2AEEA 3DZHA 3Q7PA 3TNYA 4AJ9A 5I8WA 3IR5A 1G64A 1MVNA 3Q3HA 3T95A 3WWPA 1E8MA 4D4KA 2OXCA 2Z4SA 3MUNA 1DUSA 1T5LA 2NZJA 2ZIGA 4BRZA 5BSVA 2ENWA 1WP9A 1IWPB 1GNRA 4F2HA 3HCOA 2AMLA 3GZTB 2YVUA 2MSKA 4JC5A 4Q47A 2WYIA 3NKFA 2Z2XA 1E2EA 2V65A 5FWXB 1U8XX 3ROMA 4D9CA 4DJ5X 5JASA 2P4QA 3T0FA 3WJ2A 5IZCC 1MC5A 2CXHA 4GMFA 3AXSA 4P4NA 5JISA 2NXJA 1QGZA 1IZZA 2FSHA 3AFOA 1OH6A 3FFAA 1NP6A 3A4MA 1JPUA 4GPZA 3RIHA 2C54A 1U7WA 1M2GA 3WA6A 4GEGA 4OREX 1R9MA 2QUBA 4YJ2B 1C8VB 2CDNA 1XLUA 5CB4B 1JEQA 3DB2A 4JP1A 4LZPA 3CTMA 1P5JA 4F45A 5CBPA 2H4XA 2D62A 3KVNA 3QWFA 5DXAA 1MKYA 4CE6A 1U2PA 2TMDA 2XE4A 3IUBA 4IV8A 4JYBA 1DQZA 4NBVA 1KZ6A 1C5KA 2E87A 3WOHA 1NU6A 3NOVA 3HYTA 1VL6A 2JEOA 4Q12A 3LVFO 4BMYA 1J0XO 3NBZC 3TJRA 1ZNZA 3NV7A 3DMNA 3VSBA 4TMFA 5EG5A 1NWCA 1KR5A 3S5JA 3WYBA 2XKJE 4RTLA 3EGXA 2E9SA 2L0XA 5KJ6A 4V24A 4YEDA 4H16A 5F9HA 2Y1GA 2LKDA 3FSRA 4L76A 2W8BB 1ISGA 3OCZA 5GM2A 1G21B 2AZMA 3A9WA 4CTNA 4FSHA 4KPYA 3OIFA 4S0XA 3VNRA 5M04A 3B9BA 1M6EX 3K0AB 1I7SB 1GNTA 2CLKB 2HIAA 4OXKA 4AO7A 2GRUA 4L73A 3CX6A 2XWPA 2BUAA 3O3MB 3I32A 1R4NB 3RWOA 1Y8ZA 2FX2A 1Y8AA 4KHZA 3AY0A 4PYRA 2BTEA 4KREA 4N0EA 3R7WA 4D5GA 4OJMX 3GUCA 2VJOA 3DVAB 3VH4A 4O2AF 4W9MC 1PYDA 2OCPA 2OLJA 3KTAA 2XUKA 1IWBB 2QT0A 3PIDA 2FY8A 2YC2C 3FNHA 4FFOA 1GTJ1 2IZOA 1YDFA 3GJ8A 3T41A 5JI3E 4Y9UA 4MOWA 1TZJA 2HWWA 1XLWA 1S1MA 1OR8A 3N58A 2WNSA 1OH5A 1XQYA 1V35A 1AN0A 1D1PA 1EBBA 1TM7E 1WW2A 1VLLA 3DPUA 3GUZA 4LXUA 1T8TA 4WLOA 3RGWS 4D4JA 5C37A 1UK8A 3S81A 4NDZA 5IK2A 4N0MA 3OX1A 4BC1A 1IDOA 1N4DA 2CL0X 4GGMX 4GX1A 2JIBA 2AOXA 1E7YA 5ALWA 2J67A 2X8AA 5JE8A 1MX9A 4X97A 1NQAO 3DE3X 3AR4A 3QEMB 1MRZA 4FT4A 4HCJA 3B20A 1NJ2A 2ZR9A 4B3HA 4Q4CA 3Q88A 1IQ0A 3WAGA 1W4RA 5ERGB 2X0NA 3U4CA 1AQIA 1CDOA 2OV2A 4DB4A 3NS7A 2X86A 4LGCA 1GRQA 1WABA 1Z22A 3HJHA 5FIUA 4A2CA 2CSXA 2F1HA 3U09A 2BEJA 2EFCB 2WYUA 3IV9A 4AXXA 4AN0A 3H8WA 5L3ZA 2R7LA 2EBHX 3N8IA 4I1VA 1LK0A 1AD2A 2Z4TA 3CWCA 4JZYA 4GL4A 4JBHA 4DRXA 1I2AA 1TA9A 5K8TA 4JWTA 5FKJA 1A5TA 4A8PA 5DHAA 3COYA 4NG5A 2Z5VA 2LUOA 1DQYA 4Y2PA 2YY7A 3EBPA 3WNCA 3EYWA 3LBYA 3UG7A 3KU1A 4HZGA 4IIUA 4LZZA 4CF6A 1C3JA 4ISBA 3ZCUA 4S1WA 2DWPA 3SU8A 5AVXA 2WT4A 3HEMA 2DT5A 3V8VA 2YICA 2QRVA 3IP9A 3TQFA 1AQNA 1L5HA 3K0CC 2JJQA 2XBUA 4RD2A 1SBTA 1UFKA 2CBGA 3P9RA 2Y1LA 4JI1B 3UJHA 4FLFA 4BKOA 4I14A 3R0VA 4Z4FA 1RWNA 3ZWPA 3G2IA 3A1UA 5CA1A 1A4IA 1H9BA 1N9GA 3SAJA 4ZU3A 2H0QA 1WUTA 4EYKA 3C2QA 1VL8A 3E22A 2OO5C 4KV9A 5JZSA 5SZHB 2DH5A 4ZQCB 3KWMA 2I8CA 3H5WA 4QXPA 4UZSA 3CH6A 3BRWD 1NJ5A 4L07A 1VPLA 3SF0A 5HRAA 2ASEA 1UP7A 2VZEA 5FAXA 5TIIA 3PNVA 1ECLA 1FLNA 1ZNQO 1KL7A 2VKQA 4N3BA 3RTBA 1TO6A 3PLNA 3PT5A 2D5AA 1W93A 2IIPA 3HRKA 3ZI0A 1TCBA 1MOSA 1VA5A 4GUAA 4L15A 4NEGA 5A3SA 4MWOA 4UCXA 1ZC4A 3SS7X 1SUDA 2K7ZA 2ZPUA 4YXWA 5FBVB 2XUJA 3A37A 1LUAA 1UQUA 3OPYI 3EDOA 1HRDA 1NW4A 1NW3A 2YVLA 4RMIA 4MLCA 1GG8A 2VDRB 2JLXA 1WZ2A 5A7GA 2V0NA 3A2LA 3I3SR 3Q7IA 4CL0A 2O2IA 1C1DA 4D8XA 4DMCA 4FD2A 3OX4A 1IZ8A 4A8JC 3DAHA 4S35A 1UINA 2NZWA 4JJ4A 1OLXA 3G1WA 5DB4A 3RQIA 1FPQA 5KNCA 3AF1A 1ZMXA 3A1DA 2GHTA 1J0DA 3BSYA 2JB9A 1HX7A 3MT8A 1EKXA 3AI3A 5IMBA 3O94A 1UZMA 2DP4E 1P7ZA 3JTMA 4RIHA 4TX1A 3TPCA 4YMSA 4BQNA 4QGSA 4YY3B 2QN6A 1KA9H 1F8GA 2NPIA 3D0KA 4J4TA 5TE9A 3DCYA 2FRDC 4KPGA 3RUIA 3C70A 4PRKA 4BV2A 1JTEA 2G1AA 3RD5A 1EVKA 2VSOA 3OX3A 3OZIA 5DW3A 1L4KA 1B42A 3D81A 1HG1A 1B3BA 4H7EA 1PLKA 4KIUA 3T4UA 1EB9A 2NXWA 4G85A 1Y1KE 4LMRA 1JQ3A 1N7JA 1NYTA 2VJLA 3QU4A 5SV2A 1M0EA 3ITKA 1Q15A 1R18A 4DLAA 2BM1A 1E4OA 3T9EA 2XIQA 4LJ8A 3KT0A 5CLIA 1WXEA 4LOHA 4BASA 3FNEA 1YV9A 5L7TA 1X2EA 3LQ4A 3MINA 3HC7A 4FUTA 3GLGE 3RADC 5AW1A 3CSSA 4S2EA 4OQEA 1HDEA 1AH2A 1ISMA 4U5QA 1HDIA 3CZQA 3VGPA 1TF5A 3K70C 2ACVA 1VCIA 3PJRA 3AM4A 1FX0A 1EFAA 2HRBA 1UJ5A 2ZUDA 2PD4A 3QKWA 2CN1A 1ZD9A 4JQZA 4KCGA 1M33A 2QYHA 4RD0A 1HYEA 2YFKA 5K0BA 5AUNB 3AFIA 2A0XA 3L79A 1KORA 3BERA 3F5MA 4IZHA 4OJKA 4Q4LA 3FTEA 5F7JA 3ED1A 1O9HA 2OQIA 4UJ5A 2B37A 1JLLA 2OZEA 2L82A 2EJBA 2YQZA 5JSFA 1QIIA 2H7VA 3B3FA 1SVMA 2WJAA 3L77A 3QWBA 2V3WA 2WMNB 2W6NA 3L3BA 1XZFA 2FPMA 3P2IA 4FT2A 4PO1A 3RIXA 4BNLA 1UC5B 3GGPA 4FFPA 1RJEA 3FUUA 3COVA 2DJ5A 3EQ6A 1MCZA 1FFWA 4FGKA 3ASYA 4ENWA 1DBWA 3WGHA 1T0IA 1CVRA 3QBTA 2OV1A 2EJWA 3S44A 3R0XA 3ZZUA 1SXPA 2VTKA 2AL7A 1U0BB 3QELB 2XPCA 2OENG 4RH3A 5DTRA 1WMSA 4CUZA 1E5QA 1HE2A 1I2MA 1NVVQ 2NQTA 3BBLA 3JALB 1PNRA 4BWGA 4BFLA 121PA 1CZHA 2GNAA 4QRIA 4QAQA 2A0WA 4DMGA 3AK4A 1RP1A 4HLCA 1ZQ1A 4JLDA 4D2IA 1ID8A 2Z08A 1TAHA 3E9YA 3GRRA 3ZNPA 3HNPA 5BMVB 1SJ9A 5A62A 2VRWA 3P20A 2WSLA 1TZKA 2NVBA 3HL4A 1FX1A 1YSCA 4LECA 2R8RA 5AUQA 2WSMA 4EKNB 5A0TA 1V1RA 1LA2A 1V3UA 2I65A 2EJTA 1PT8A 3GDWA 4KP7A 4LNUB 3B1JA 4RIFA 3VR4D 3LC2O 4P0PB 4BLQA 2BISA 3RJ9A 3VOSA 3WWZA 5LKAA 3GFTA 1AGNA 2B7BA 4Q3OA 4X20A 2QM7A 1O08A 1O95C 1VZ3A 2PMBA 4GYYA 3BRSA 4P08A 1SOVA 3IOMA 4FS8A 1N7GA 2QM8A 5JWRA 2AKEA 4UAUA 2FPOA 3DKKA 4JCCA 3FWYA 1S02A 1E66A 2ZXFA 2BHNA 3DBRB 1YQUA 2HR1A 2XXBA 4IOJA 3AT1A 3R3XA 2RAVA 3QVUA 1O9BA 5DBHX 2O8NA 4K9LA 1A69A 5B64A 1UPBA 3QQPA 2GILA 3FLMA 3GG9A 3DKRA 1JR3E 2NUPA 1QZXA 2WJ3A 3CH4B 3TLEA 2BGMA 4BJ1A 4BS9A 2JJ2A 3QUTA 3ML1A 2D2IA 4GR9A 1UBJS 1RHQA 1N5RA 1UJMA 4UE6A 1B2LA 1ZN8A 2WM8A 1DEHA 3RKRA 5L4NA 2GBCA 1GLVA 4AIRA 2HO5A 1C30A 2QT9A 2EQBA 1YQTA 3O83A 4OFBA 4WFKA 5DBEX 3ZX4A 2YJGA 4B87A 4R2WA 1RHUA 1TD9A 1J09A 3L0CA 4JASB 4R69A 3JD1A 2F3PA 2GBLC 2GJSA 1VLZA 3OOJA 5T6MA 1B0PA 3FHJA 4YP5A 4BMNA 4DLSA 4N76A 3P97A 3PXBA 4YT2A 4DSNA 3WYCA 3DEYX 5F52A 3EA0A 2NU9B 5A4AA 2RHDA 3B9RA 3HU1A 4FTWA 4QE3A 3VKUA 3ZV6A 5IAAA 1KZGB 2NV2B 5DI3A 1CQIA 3K6SA 3NBKA 5B3LA 1A9XA 3IRUA 1CHDA 1U7XA 1CR6A 1QCZA 2XOKA 3BK1A 1HE1C 2XB8A 3BWCA 5TRTA 3RT1A 3TCKA 4C4OA 3I2HA 5FDFA 3L01A 4HNAB 4J1QA 1GDTA 5AJTA 2ODWA 1XEXB 2VDKB 2PKRA 3CNOA 1XF9A 2GXUA 1IQPA 4I46A 3ZDFA 5CVUA 4WBSA 4HN2A 2I55A 4PG6A 1L5KA 1KC1A 4MAFA 4PF1A 2XAUA 2I4RA 2ZIZA 3O8OA 4JT9A 5FLEX 4S0ZA 3AHIA 4LXIA 5K4HA 3EIXA 2I91A 1G60A 1G5HA 2XCOA 2BHLA 3BWYA 2ZIEA 3FBTA 3I8SA 3QXHA 1OF1A 1AZSC 2HJSA 3E4DA 4XX0A 2VUHB 2C96A 2G72A 2IXFA 4XPZA 3NJRA 3N7AA 3SJBA 4BU0A 2QQ5A 1J70A 1DDGA 4TT3D 1U5CA 4WKCA 4WNIA 4IMRA 2RGRA 2QRQA 5LU8A 1ARZA 5C8ZA 5JHHB 1IXYA 4CFZA 1G7SA 3WAKA 5CXSA 1ZJ4A 2ZYRA 1E4EA 2EHDA 3QWIA 1GUFA 1M1ZA 4OAQA 3WRWA 4D3XA 5KKCA 5KQRA 2WQ7A 3DTVB 1F4PA 4RGQA 1RAGA 3K6JA 4BNJA 3F47A 3ZGNA 4DBLC 4KYUA 3IHLA 2ZGVA 4WLNA 4C6SA 2QMYA 3I42A 2GPBA 1J8YF 3VYTB 3GZNB 2CYCA 1OYVA 3CSUA 2F8TA 5EHGA 5L4SA 1VDMA 4QDTA 2C7GA 2H6EA 2O8BB 1OXBB 3O8DA 1CU1A 4XX1A 3V4PB 1JFFA 4TYMA 1EX9A 1KVTA 1Y80A 3E9NA 5AKIA 1UT5A 2R68A 4K9SA 4X3CA 4A91A 1O4WA 2XTAA 5LA6A 4LYYA 3VYRB 5LNK6 2PANA 4MIYA 1SVUA 2CBZA 2EFEB 2FSVC 4LDZA 3U2QA 4CTKA 1MHPA 1DCMA 5LMNB 1IE3A 2DX7A 3ZCRA 4MS4B 3OT1B 2WIFA 3ZOKA 5HIMA 1KMHB 2GEBA 3GWZA 4KACA 4LRWA 4OXQA 1RXYA 1XHEA 3L6EA 4JP2A 5CT6A 3G13A 1FY2A 3N8DA 4AB1A 3RPEA 3ZV4A 4UUQA 3CZAA 3Q7QA 4J29A 4EKEA 1U0TA 2B69A 3O8BA 4UUAA 4K9NA 5G02A 1JDBC 3ZD9A 1WMEA 1CIVA 4RADA 5KOYA 2UVDA 3PC3A 1CUEA 1FJ2A 4XIJA 1H85A 2ZTVA 3MAGA 3UIEA 3FETA 4E32A 1NR1A 1J6UA 5JPDA 1G2OA 1TLTA 2V7EA 1EUCA 2F9FA 1APBA 1IY8A 1ENOA 2DF8A 3IV7A 4MNTA 1G291 2ATEA 3WLFA 1KVUA 3MLBA 2YOHA 4N0QA 4ZVNA 1MO6A 3RRZA 4RLHA 1EFPB 4TV9B 5EE1A 2P8SA 1ADFA 3WYGA 1LWOA 4MW5A 1URPA 2VAXA 3L6CA 1JKJB 3I9FA 3O1LA 5BPHA 1ZRHA 4L8FA 2YDXA 4BNFA 2BVNA 3AOEC 1N2JA 2I99A 4ND5A 4OSPA 3TLCA 4PPFA 5BSKA 1NTRA 5LPNA 1OV6A 3AJEA 2OP0A 2GB4A 4RENA 3TIXB 1WOMA 4BWFB 3WP0A 3AVXA 3OWOA 3QX3A 2QVGA 3F98A 4MHOA 2ZSEA 4YP1A 4P3YA 1F8YA 3R76A 2QBYB 2NADA 3L49A 3ZQUA 4PGFA 2OKGA 3AJ9A 2RGYA 2VDLB 4Y9DA 2V9ZA 2BW0A 4AW9A 3QP9A 4JVLA 2HWKA 3PXXA 4IRUB 3K2QA 3JRWA 2GAFA 3QUCA 1N6IA 2WVGA 5ALLA 4Q66C 2D0IA 2EFYA 4CLRB 1INLA 3P45A 4F1WA 4GD3Q 3CQ9A 4WH0A 3GEGA 2H31A 4IOLA 4W5TA 3EZ6A 4IHAA 621PA 1Y3BE 3ZXIA 4Z4QA 3VU3A 3BD7A 3HHEA 1XP5A 4LX0A 5HPYB 5DM2A 5L3SB 2WAMA 5FXMA 5AO9A 2IT1A 1V47A 1TT5A 2FTKE 1NN1A 1UDCA 2BE9A 5IYZB 3I4FA 4IDGA 4S1PA 4CNBA 3H16A 3IBYA 2PGDA 1K98A 2AK2A 4HH4A 1YZGA 4X6XA 3K9GA 4EFMA 4W5JA 2GCOB 5JPIA 4ADSG 4P38A 3MQ4A 4UCWA 2P3QA 3EXAA 4HATA 3OQNA 1HFWA 3ORQA 1J0CA 3QV2A 4X1KA 3A7DA 2XCUA 3E58A 1XYVA 1GUAA 1P2TA 3V4RA 3FNRA 2WIBA 3HDVA 1PEYA 5KNCH 2QRUA 3DV9A 3WYFA 4BKPA 4O63O 4WASA 1V25A 3K5WA 2FPKA 3HSSA 4Z0HO 4CV0A 3ZWWA 4F04A 2JFOA 4NOJA 2R65A 2X8JA 2AB0A 1JHDA 2VDOB 4KE9A 3AEKA 1V8BA 1ESNA 3H05A 4XR4A 4AO8A 1W29A 4E14A 4JA2A 1UBMS 1HT1E 2IV3A 2WILA 3ZDZB 2BFCA 3MD9A 1IWOA 3L6UA 3SZRA 7GPBA 1E6KA 2O2CA 3H2IA 1XU9A 4J9UE 4NRDA 1DQPA 1MOPA 4YLEA 3T9DA 4AG6A 5KC9A 3DZDA 3DLHA 3PFHA 4RJJA 1CVIA 2C8JA 4PX2A 4U6QA 1QH8B 2HXYA 2JANA 1RZ3A 3K0BA 5F7ZA 4XRGA 3KKEA 4M6WA 2R1VA 2V8BA 4JC4A 1BDHA 4I3HA 1P2GA 3O03A 4E5DA 1ATZA 3DV0A 5ESDA 4BKUA 2AZTA 1TOAA 3JQQA 3INRA 3OZBA 3VU9B 2A58A 2Y0CA 2ZYAA 2WD7A 4M8NE 4JBGA 2HBRA 2C4KA 3WGUA 3ZXYA 1N32B 3Q9UA 1BD4A 3GFVA 3PNPA 3KSZO 2P77A 4B85A 5KVVA 2A1TR 1KSFX 1SK8A 4ASUA 4CKCB 3IKTA 4X84A 1RDFA 3TFWA 1JLKA 1MG5A 1H1LA 4JBYA 3TXAA 4YFYA 4U0JA 1NUQA 1RYEA 4O02B 1ZLXA 4ZIRB 4CIAA 3QVGB 1OWPA 2QAGB 3IQIX 3SX0A 2Q3BA 4ZC8A 1L6IA 1N33B 5JH7B 4XE5A 2GK4A 4CKXA 4MUIA 3UJPA 4KX5A 1DOZA 3OP1A 4Q48A 2W2PA 2C9CA 2ISCA 3FPFA 3JQ8A 2M6RA 3AIOA 5A4DA 4AZWA 5C4MA 3FXAA 3KT3A 2CUTA 3PWZA 1RZRA 2AV6A 4EA8A 4I6EA 2I03A 5FI0B 5K6TA 1NURA 4MROA 3OQIB 3UBTA 4FGSA 4PINA 1Q0QA 4XVRA 4A1OA 3I6QA 1J56A 1AB6A 2R7MA 4EY3A 5ALOA 3ZWKA 2A4MA 2IP4A 2J3LA 1RRKA 1DFHA 5EIBC 1C9DB 4DIOA 1I1NA 4Y7DA 2JFBA 3FROA 5M2QA 1LD3A 5C52B 3CN9A 1UP6A 1I36A 3A1SA 3HNRA 1WEHA 2NX2A 1Z6PA 4HDKB 1XTBA 5IBQA 1NNSA 2SECE 1KQ3A 2MWMA 1PFGA 1J25A 1I1OA 2IU4A 2R25B 3BWBA 4JY7A 4WL0A 3SLRA 3R9XA 3ILHA 1ESMA 3QG5A 3HCNA 3KHTA 1MEJA 4H18A 4DCJA 3USZA 5A3QA 5HJ5A 3OU2A 4GI7A 5I7HA 3N2GB 3ZU5A 3WWCA 3SHOA 1STOA 2WV9A 3FA2A 4QDZA 2F3UA 3KOMA 3PJDA 5ER9A 4BKRA 1M54A 3FGZA 1L5YA 1QK3A 5EMKA 1Q1BA 1FZTA 3TVYA 1JUDA 4LRXA 3VKVA 4B44A 3KZKA 5DLDA 2ZZKA 4D3SA 2ADFA 1PUXA 4ZOLF 2ID9A 4Q7EA 4X7PA 2W2KB 3BIOA 4ZT6A 4JLVA 1Z4NA 2GDZA 4ZDWA 1QP7A 1O0SA 3IJ5A 1V11B 1VG9B 4HHEA 5ES4B 4MW7A 3DEHA 2QLFA 2P0EA 2GM3A 4YMIA 4J0EA 1Y6GA 3FDFA 5EWMB 4N0PA 5JCPA 4BGEA 4HEHA 4KK4A 4RW0A 4R51A 4DWWA 3R7AA 1IQRA 4YUXA 3DOHA 5ED4A 1P73A 3NTQA 1PAUA 4ZICA 4OHYA 1XXHB 3MLEA 2QTFA 5GZ3A 4BFSA 2HA5A 1I13A 2IUTA 5LM3A 5D01A 2JDID 3T7CA 3UJAA 1DEXA 3KAJA 3ZHTA 1Z47A 2GZMA 2FEOA 2J9GA 4XUDA 3HK2A 4MS1A 1BU8A 2AXNA 2VZ9A 5IAKA 3NHKA 3UO8B 4PGAA 1M2NA 1ST2A 4IOKA 2WTNA 5FAKA 3W5IA 4RHCA 2XGSA 3OAAD 5TMPA 3QPWA 1GCIA 1X7ZB 5EKDA 4IUDS 1YA6A 3BMOB 2GCNA 1L4LA 3EMBA 2TS1A 4RGYA 2FLWA 2QTLA 4Q9AA 3R41A 4B5LA 5KPDA 3LX5A 5EKTA 3THYB 1UBRS 1YJXA 1YQWA 5EMNA 5AUOB 2ODBA 4WXPA 5JBNA 3RVMA 5TF0A 1GFZA 3OICA 4E6PA 2Q0HA 1CW2B 4MKHA 1VMEA 1EA7A 3EARA 5GJCA 2GEDA 2OG2A 1OXUA 3SIRA 3ZNOA 1E9AA 5CA1B 1NJ1A 4O33A 3TUZC 2CHVA 2AHOA 1DC4A 2W43A 4YFVA 2WFZA 3VJRA 5J47A 3VR3D 2VRBA 1Y8CA 2IHVA 2J07A 2ZJ5A 3LOQA 1T29A 4HLUC 4ZT2A 4BNNA 5FPSA 1G7TA 1OX4B 4FDMA 1N2HA 3VSAA 1UXIA 2LBPA 2Q6OA 1WB9A 3OLZA 3AR9A 1NRJB 4BO6A 3BB3A 3EPRA 1DC6A 1R6VA 1CEXA 2JPDA 4DZTA 1T2VA 4HDCA 3VNVA 4H77A 2J4FA 1ZH4A 4JFAA 4B2PA 3KKMA 1GGEA 1THTA 2Y77A 3BAZA 4PLVA 3SC2A 3COJA 4EGQA 1PKEA 4HLNA 1N5OX 1OTHA 1DBVO 3QLVC 1SBZA 2PH1A 3KYDA 3RVOA 2JLCA 4EL0A 1QXSA 2B1GA 2GPSA 4TTAA 3KLMX 3RSCA 3PNSA 4XYLA 2BGTA 1ZICA 1KP3A 2YCLA 3CO5A 1TK3A 4CMHA 1WBBA 4PQYA 1GQRA 4A7PA 1ZCZA 1KMMA 3UWMA 1PNQA 1Q21A 3PQ7A 2ZRCA 4ZAGA 3AUTA 3EQ2A 5EZQA 2GO1A 2B83A 2G1UA 2GK6A 1NNI1 1UMBA 1K9VF 2Q0QA 2WUVA 2D8AA 4KO3S 3MJVA 1U2GC 4XXHA 1P4HA 3MMNA 2GEFA 3SBDA 1U2ZA 3P0FA 1W4AA 4D9NA 5HX7A 1XZJA 2ZYUX 3F0TA 4NZNA 4F4JA 2BZGA 3R5KA 2W6CX 3U9SA 2BFBB 1AA9A 3E3OA 4TXJA 4V0LA 5J5VA 1JHXA 5IZCA 1COZA 2VEOA 2VNIA 4NCHA 1E7QA 3ELBA 4F5YA 1I3KA 1M8JA 1B8VA 4ZYVA 4BNIA 5LP1A 5KOHB 3F1LA 4FFLA 1L5OA 3IKVA 3I9LA 5A71A 8ABPA 5JXHA 1KQOA 4ROTA 2OECA 5GONF 3WB2A 3Q0IA 1Y4SA 4XCVA 5MFZA 1C7EA 4WK2B 5B3JC 2NTEA 3OIWA 4CRWB 4FI3F 1UC9A 3IQXA 3EIQA 4EFKA 2BOVA 1D6JA 2I7TA 3UXEA 2EW1A 4RTOA 3K7EA 4G63A 4KQFA 5EVCA 2GERA 1Y48E 4Q9DA 4TM8A 1KZ9A 1NUUA 1ZK4A 4X60A 3H5RA 4BGVA 4JJAA 4NS1A 4A8TA 5AVSA 2B4RO 2AZDA 2PS9A 3QFTA 1RRGA 2RGGA 3ED5A 4RCZA 1ZHHA 1B1AA 1KS2A 5C8YB 5JHGB 1M5UA 2GZ3A 5ILOA 1ZCFA 1W581 2JVIA 1ZRNA 4KQIA 2JIOA 4NYMR 5BRAA 3ZDDA 1U0RA 1RKVA 1Z7WA 4M49A 3Q11A 4Q9HA 2BMFA 4GSLA 1U5BA 5KOJB 4CBVA 4DQXA 3GN1A 5DLQC 4JD5A 4Q19A 4NJEB 5KTTA 3RCBA 1ODLA 3TB4A 5DH9A 3RVDA 1YL5A 1Z5WA 4RA6B 3ND9A 3QOXA 1EDZA 3MJHA 4KDRA 4HQNA 3FX2A 2AH5A 5DULA 1R64A 1HQDA 3S68A 4JBNA 4QTZA 4YAFA 4JDPA 3BCHA 3OM8A 2GN6A 3RSZA 2B78A 3RK0A 4YP9A 2BC9A 2WU8A 2H07A 3BSFA 5KSOA 1VE7A 3JWGA 3IV6A 3SM9A 1NX6A 1WW3A 3AHEA 3SFVA 4EB6B 2PV7A 3FCEA 2GRAA 2FP3A 5JNTA 5JYEA 2Q2QA 4LE2A 4L7QA 3ZCVA 4RJKA 3F46A 3R7LA 4CLOA 3AJ8A 3EXEA 2F1IA 2XJ4A 3JATB 3AUKA 2UZAA 3U3DA 2W6JD 3WVNA 5F7XA 5DTIA 2XVYA 3MYYA 1PK8A 3ZV5A 1T36A 3F3MA 3NUQA 2PLAA 4IOMA 4ETMA 5EHZA 1LDYA 1KVQA 1AURA 4YAIA 4AULA 2F8LA 1QIDA 3EWIA 5A7FA 2Q9CA 4J9VA 4B6QA 2HU8A 4BIIA 4N3GA 1AQYA 2EKZA 2V45A 3BHIA 2PS0A 1QQ7A 2Q4DA 3OPYB 1O96A 2D1YA 1ISSA 3DNMA 4GQBA 1EVZA 4KO4S 3H1FA 2BM8A 3CY6A 4OO3A 4B6OA 2FYTA 2R4TA 2FUG6 1BKSB 3M0EA 1F12A 1O77A 1UPUA 2MT9A 4ND4A 2HX1A 1E8DA 4JYAB 4OKIA 2PL1A 4Q9JA 2QRGA 1N36B 4JH0A 3KKKA 3NW9A 5I6DA 1Q83A 3QFFA 2HB6A 1QRUA 2BR3A 4RFSB 4CW7A 3E61A 1ONOA 3K0CA 4CF5A 3NT4A 2J6CA 1NUSA 2ZRLA 1RI2A 2PVPA 3ZI4A 4AKEA 2H2WA 3OIYA 2ZI3A 2EQ5A 5CH8A 3STWA 4CM8A 2AUNA 4D42A 1FUYB 3UHAA 4JJ7A 2BJWA 1Q92A 3FCYA 2ZS8A 1H8HA 3U40A 1U28A 3JQAB 5TXGA 2ADMA 1U0FA 3OEWA 4HWKA 4F5WA 1EHIA 3D0QA 3C24A 3T1NA 1XD2B 2H2IA 4O4JA 2R6AA 1PR5A 1LBHA 1W44A 3DP9A 4GRIA 5IVDA 3D6HA 4JUBA 2NUAB 4F4UA 4GMHA 5B6IA 2W6MA 3F6YA 3RU9A 5KQSA 1CEEA 4G0NA 4ND8A 3QHQA 4FONA 2NW6A 3G7NA 4D4GA 3WL3A 3E18A 3HJFA 3O9VA 3SBOA 1LSJA 3PC4A 3OFSA 1KI6B 3G0BA 4HP8A 1Y8QA 4U7JA 4HXFB 4JHXA 4O2BF 2IY9A 5E7IA 2IXGA 5G40A 3EFEA 4YQYA 1ZCBA 2ZSIA 1W73A 5KVCA 5KTYA 3NHWA 1L8LA 4E5YA 5JS8A 1C2TA 1OI4A 4ZTUB 2Y1XA 1R3UA 3K0AA 4WKOA 5EWLB 2C2HA 5FBRB 1G5PA 2DFDA 2FFQA 2Z2KA 3C14C 4G0ZA 4PTZA 5AWFC 5HE8A 3W1VA 4DCCA 2ZSHA 2ZJ0A 3DOIA 4CQNA 4CODB 1NPYA 3QMMA 4K6GA 4WRRA 1ICEA 4A8JA 1VXOA 1PWHA 1ACMA 1OILA 3ZJVA 4M9QA 4U7GA 3UH0A 2Q0XA 4EGCB 5KTRA 5A2QA 4UXHA 4HAUA 2AXPA 2GHIA 3A9RA 3ECCA 1FFXB 2C4VA 2OGWA 2AR0A 3ZV7A 1PZHA 3CA8A 3BB4A 1CF4A 1U3WA 4IJ6A 1T2FA 2YHIB 1XR3A 4B32A 1X42A 4A36A 4ZVTA 1PZMA 1Z13A 5FA6A 1TW2A 2FRDA 3PQDA 4L3WA 1JKXA 4ALMA 4E51A 3HV2A 1Y33E 1XMSA 1XZBA 5FV7A 1E4YA 1BXGB 1GVHA 3H9UA 1JIQA 2DKFA 4HH0A 4OB7A 2ZT6A 3SI7A 4EQ6A 2CZQA 1MX3A 3N9IA 4X7RA 4D02A 1KYZA 2Y2VA 1DRKA 1R9JA 4Q18A 5DT2A 5B3AA 4TTTS 3A3NA 1B93A 5L51A 3K0SA 4DUPA 1XPRA 1NSTA 2R5NA 1Y1SA 1Z0JA 1TU0A 3OM1A 1E9RA 1T24A 1OFGA 3R3UA 4HC4A 4QQRA 5KB3A 1L9XA 4DLUA 2RFLA 1RQPA 5ICSA 2IHNA 2E2WA 3K5IA 4NBKA 3P0JA 4QPDA 1PW5A 1U2EA 1U7PA 5FLKA 4D0NA 5JARA 3WLOA 5I51A 2XKAA 4IIDA 2HMAA 1ULUA 3IVRA 4ARZB 2QWXA 4QELA 3UJCA 3KOYA 3IB6A 3SLKA 3GYGA 5REQB 2JAWA 2HCRA 5E4TA 1AK1A 2G82A 2NG1A 3HP4A 3TOVA 2EZ9A 3W6OA 2UXCB 3IOCA 1E1YA 2JGFA 2WWIA 1TUBA 1IPEA 2B9EA 4DLWA 4F9EA 3O4VA 5CT5A 3O3CA 5T5QA 2I6FA 5CMLA 3TR6A 5A02A 3DAFA 4I0WB 2CMDA 1GHTA 2W7TA 4D57A 3U7HB 1BH2A 1SHTX 4QTUB 4FOOA 2WWWA 1CLUA 3FNQA 4C0LA 3B8EA 5TS3A 4CM5A 2DBYA 5LYJA 1FTYA 5BN4A 5EE3A 5IM4F 2FZ5A 1ML4A 3ASZA 3JQ6A 5D00A 6CHYA 5JJBA 3U6KA 5G3ZA 2ZLBA 5D86A 3W5VA 1MABB 1OAKA 2Y6UA 3GPBA 3AF3A 2D2VA 3IKMB 2YRFA 2EP5A 1SC9A 3FCAA 3O6VA 1T5DX 2KYRA 3HDGA 3M6AA 3WGQA 4D9EA 4GE3A 3SCZA 4JIGA 1KNQA 4DBLE 4F3RA 4MW6A 3ICOA 1A76A 1PN3A 4HN9A 3V32A 2NO4A 1P9LA 1X2BA 2XWJI 3IE0A 5GWXA 3CVJA 5DASA 4EJFA 5BN3B 3LBHA 2MINB 3B6JA 1UFQA 3RFTA 3WK7A 1SG0A 5JJ5A 3Q2KA 3UFXA 3RK1A 1W30A 1U11A 2VDNB 1IZYA 4I08A 1L1FA 3H3XA 3IHKA 3CVUA 1VBMA 3G3EA 2QQEA 3E3AA 3MXOA 4UUPA 5M29A 2O5VA 1QVVA 2O0KA 2ZWVA 5HMMA 5HRUA 3BRQA 3R0IA 1GAQA 3D4PA 2XWQA 1M83A 3HB5X 3N2EA 4NMMA 2PLFA 1ISFA 1FP4B 4IXNA 1V2HE 1KFBB 5DM0A 3SDSA 2J09A 3QA3E 4C4SA 1SXIA 1J9GA 4PWZA 1D6NA 2X9QA 4D9JA 5JBIA 2IEZA 2VHQA 4R6WA 4ZJYA 1WB5A 1XD9A 2O2HA 4EF6A 3KXDA 4E1BA 4R7TA 4ZZ1A 2UZ1A 4BGUA 1V1MA 1SK9A 1YWGO 2PN1A 4QL3A 2WV7A 2NO6A 1J07A 4YJFB 5TQ0B 3DZCA 5TPWB 3OZUA 5EJ8A 5B1HA 3FY4A 2VJQA 1SVNA 4OHXA 1CBUA 5TJHA 4ZQHA 3UMJA 1O95A 4MKRA 4LYHA 4X61A 2XQVA 3A6DA 7REQB 1POWA 4P31A 4JVOA 3EWSA 1PUIA 1M2OB 4QFMA 2H51A 1FLVA 5DWQA 3RYFA 2WHQA 4UHEA 3V8BA 4BQRA 4WBNA 5AIBA 2YWBA 2QMZA 5IXYA 2PD3A 1ZIXA 3AR6A 2B6HA 2C1ZA 2R6R1 4LN1A 1OFTA 2RJNA 2H1OA 3CLHA 2C2YA 1CR1A 1FUUA 3MWEA 4LRSB 2PU7A 1PL7A 2EEPA 1TKRA 3DVQX 3FR7A 5AVWA 3I8OA 1CV2A 1UDXA 4K87A 3HKCA 3KDAA 1R2QA 4TRNA 1M8PA 1XZKA 2Q8PA 3GLHA 3MTEA 4YP0A 3UC9A 3VNQA 4EAQA 2YVKA 2IH5A 1H0SA 1VCHA 3G2PA 4FDLA 4J1NA 4EK9A 1SUCA 3HUDA 2DY0A 5IC4A 3B8HA 3B5IA 4BNDB 3PTZA 1LJLA 4NJMA 3T7IA 3ZWBA 2GBLA 1JF8A 3NTOA 2WICA 3VC1A 1G9SA 5LLTA 4RK7A 1HEUA 5BQXA 1A7KA 3DE0X 3KXIA 1F6BA 1ZS9A 3ROTA 1BE6A 1MBZA 1EFVA 3EEBA 2NYVA 3TKYA 5C53B 1ZNYA 4ZAZA 5T57A 4A10A 5DPMA 4UFOA 1DC3A 2OKCA 4POOA 3RWBA 1ZJJA 2IH2A 4C78A 3D3EA 3FPSA 3BA1A 4HVCA 3RYHB 4RWEA 2H85A 5DCLA 4L4ZA 2H8KA 3VO1A 4MGKR 3HTXA 1EDBA 2WWXA 2I6GA 5LQAA 4TRMA 3NFYA 3SYTA 1ZH6A 2B2NA 5JSUA 1XTTA 1Z45A 5AH0A 3LT5A 4OL0A 4A82A 1H4VB 2Q1XA 2QY6A 3VZBA 3KOUA 5CA0B 5IBCA 2WUWE 1ZUHA 4TTPA 3DC2A 3PRYA 1YIDA 1YZFA 5D3MA 4GP9A 2OFPA 2VO1A 1AGYA 3G9TA 4XPIB 1QVWA 3LCCA 4LZLA 2QI9C 4S1NA 2R6JA 1YO6A 2G04A 3JVDA 3O2JA 4TLCA 4UMDA 2NT3A 2J5RA 4WLFA 4IDCA 3WIUA 4LIPD 4GOXA 3VR5D 4KMRA 2NUTA 3ESBA 1Y34E 3AL2A 1E5XA 1Q7TA 5ARDA 3LPAA 4QGGA 1HLPA 4RIGA 4UTVA 1BS1A 5LXTB 2GUGA 2D4AA 2GZHA 3TZHA 1PJZA 1AU9A 3MQ2A 3ILXA 3C3EA 4FR0A 3OZXA 4OJNA 5SY4A 1JXMA 3U1BA 1TUGA 2L17A 1FA9A 1F5NA 3LNTA 3T5TA 4BX9A 3VSEA 2O2DA 1Y4AE 3ZCQA 5JAPA 4U2KA 1S2IA 1N0UA 5CDUA 2Z1DA 3M1IA 4MQFB 4QVGA 4UD2A 3L4KA 1YJBA 2TMGA 2WIDA 2PYZA 4NU6A 5B30A 4Z2AA 1NV8A 1W9HA 1KEUA 4WK6A 3NNSA 1G7RA 2EXXA 5CK5A 4H0CA 1YD7A 3BMQA 1MFZA 1CF9A 4I19A 4EF4A 5KCMA 3AKDA 2MSLA 4R0NA 4X93A 3T1VA 2Z1NA 1S4QA 2IXDA 4TWRA 2FSVA 2PA3A 1F3OA 3WQRA 4JT2A 1E6WA 4B8WA 4R2LA 1GNPA 4GDMA 2BKXA 1PTJC 3KQWA 4Q9LA 2ETVA 1QJ4A 4UU0A 1D4OA 3E5NA 4W5HA 1YZLA 3KEMA 4BTEA 2WJPA 1C0PA 5KYTA 3BICA 1QU2A 1HLGA 1OZ0A 4A4DA 5J1SB 4G1CA 4QEZA 4NJOA 3MS7A 2AN9A 1LWNA 4U2DA 3E9QA 4D26A 4BY9E 4JA0A 1RVDA 4QGBA 5NULA 4FYPA 3HJTA 1ENPA 1GR0A 1RJFA 2RGBA 3REFA 4MR9B 4IGKA 3ZE9A 4EQZA 2XUPA 4J2HA 3LIPA 1TEHA 4JB2A 1MIOA 4E21A 5AW0A 1RTTA 3IEMA 3ZVKA 2J32A 4MUMA 3AUYA 3G89A 3GEBA 4MVJE 1DV1A 1R10A 3R6DA 2X9VA 1I94B 1WCXA 1A8PA 4AAYA 1X77A 1FYWA 2F90A 2IXEA 2V55B 3KX2A 4FBMA 1CY0A 1N3BA 1XU7A 4G65A 4H1HA 4WCFC 4JB8A 3VDMA 4I3GA 1ZITA 2PUAA 4HRAA 3B9PA 3RAJA 4DADA 2YXBA 2FPPB 1BRTA 4LMAA 3W7AA 1IN1A 5E6RB 2D0DA 3PZRA 1RE1A 5JVDB 4IV0A 5IX8A 2AKYA 3BJMA 2RARA 4RVUA 3G02A 4BN4A 1HT0A 1HG0A 3I9V1 1EAMA 1AF4A 1HLDA 1ZW6A 3AOEA 1GGNA 3HLTA 2W83A 3WG9A 4U2EA 3L1UA 3RC7A 3TDNA 2BFDB 1Z2NX 2Q5LA 5C1IA 3VZDA 4GE0A 2W6OA 3I1JA 1B8OA 4PLCA 3JWHA 3IT3A 3WGJA 5J3JA 2GZSA 2IIVA 3CRMA 5KDLA 4XGNA 4DM3A 3W79A 2GJ8A 2CWDA 3Q4GA 2HIGA 3ZWCA 4FU0A 3T5MA 2X8WA 4IMIB 4PEVA 3NBMA 3HKBB 1E0SA 2ET6A 4Q7QA 821PA 3JRNA 4M88A 3W8RA 3CZ4A 4QNRA 4DW8A 3CE6A 3NASA 5AW9A 4QJIA 5G0TA 2PVCA 3AINA 3FUWA 4FKZA 1R88A 2A7XA 3MWFA 5CAEA 1NG9A 1HGXA 1SCJA 4RTNA 3GQBA 4YCDA 2PUHA 4DCGA 1YRAA 4OYRA 1QH1B 3L8YA 3KHSA 2NYAA 3ZK8A 3ZY3A 2BH2A 1QTIA 3CTPA 4Q4DA 3GCWA 1UAGA 2QE7A 3KJZA 2D8MA 3M4NA 4AROA 4COOA 1M0SA 1A95A 4INOA 2QIPA 2HY7A 5CCEA 1YR7A 2BZSA 4C4TA 4M7OA 3NVKI 2IYEA 5MN4A 1YC5A 1Q0LA 1NPTO 2BSXA 2J85A 3BB1A 4LYDA 1GTG1 5AHWA 4K6KA 1Q1QA 2RAUA 1I4DD 4IP0A 4NOLA 4Q24A 4Z9XA 3SIWA 3H4VA 1SC4A 1T15A 3OKCA 3R40A 2IPXA 4RE6A 1P1JA 5EUBA 3V2IA 4ML3A 4W9NA 1AUPA 2BAGA 2Q62A 5L3RA 5KTPA 5I7RA 2JJ1D 2NP6A 4I9UA 1JV2B 4RTMA 2HN9A 2V7GA 3LY8A 3TLMA 5BYKA 3DP7A 3KUXA 2IUFA 3CZ9A 1D5WA 1LK7A 4KLZA 5A03A 5K8VA 1TTHA 3TECE 4OMCA 1R12A 1X39A 3SYRA 4H6WA 4PLTA 1FNDA 4KQGA 4HWSA 4OQZA 2QX6A 3ECAA 2JFHA 1U94A 1ILWA 4KTTE 1IK4A 1CQZA 4MVJM 1MD9A 2DFTA 3G23A 1KK1A 5E1DA 1F14A 3IMGA 3ZD8A 2VP3A 1SXHA 5GOZA 2X2PA 3U7JA 1UMCA 2HJWA 2B36A 1WBDA 3LQRA 4Y1RB 3JYQA 5B2ZA 5B1YA 4KWTA 4P33A 2V1UA 4QGFA 1SBYA 1ZM9A 2N75A 4ZCQA 3IRVA 1LH0A 2ENUA 2OG1A 4WINA 2QZZA 1W48A 1WDTA 1SQ6A 4KOAA 1JVBA 2A2ZA 4XFJA 4YO8A 5BN5B 4CCAA 4GQIA 4AY3A 2DPGA 3DQQA 5JQGB 3HCEA 3NI2A 3FUTA 4AURA 3T1HB 1U0GA 1OYWA 1QIFA 1SZJG 2YMMA 1HL3A 5E38A 5I4KA 2J3KA 3KAPA 4UVEA 4V1CI 4UVHA 2R84A 2GT1A 3AGPA 2H16A 1IHXA 1PKXA 1P2DA 2PTHA 1DOAA 2P9BA 2XKBA 4GAEA 2LD4A 2OHVA 3OA2A 4I5DA 2OYRA 4N47A 5CXQA 3PZBA 3EWAA 3QEJA 2R9VA 2CHUA 4GVPA 3RRNA 2YX1A 3GB9A 4GO1A 4UBNA 3C6MA 3V1LA 4X6UA 4BPRA 4KXYA 2APJA 3GDGA 1C4KA 3PGA1 1Z8FA 4PRYA 3ENVA 3GFBA 3QM1A 1WEKA 4HR7A 4YMUA 1H9AA 2P2SA 3THXB 1SUPA 4QDJA 1NVXQ 1PZGA 1SB9A 10MHA 3VAZA 3COZA 1J2YA 3N0VA 4UE3S 8OHMA 1VPDA 4KB5A 4HVAA 2NM0A 3AIMA 1E6EA 3FJ1A 1RWBA 1IC6A 1GQYA 3VPGA 1KKMA 2VTEA 4GX5A 3Q98A 4B7AA 2QJFA 1UT6A 5TT1A 4AZ3B 1H6DA 1IN7A 4WFQA 4RVFA 1GZ5A 2JCGA 4QRHA 3OTQA 5BSMA 3DLIA 4JKYA 3FMVA 4DDUA 2OGZA 4NQZA 4R1OA 3OUTA 4Y2SA 4ZOBA 3WGZA 5I7AA 3AFHA 3EC7A 3Q5EA 3RVPA 1QTNA 2JD1A 3DPIA 2FF5A 3SZGA 4DSAA 1VP3A 3DXYA 2QMQA 2BBOA 3ULKA 1R6TA 2ZIXA 3O3NB 2F4NA 1U6KA 3FIUA 3HI6A 4RDHA 1Y1PA 4RAOA 4BPBA 3GRYA 1XKXA 1E8NA 1CYEA 2P27A 4QUGA 3EDQA 4RZXA 4M8SA 3JVUA 3SC4A 1N6PA 4JLBA 4TTJA 5KJEA 4N5DA 5BV7A 4QM7A 2IHTA 4REMA 2AGVA 4TWIA 4Q3AA 5CM9C 2GZAA 1SQGA 4LJSA 3FFTA 2PSHA 1P2VA 3DDHA 1Z68A 2H92A 2VRCD 3QMWA 4WZAB 3WICA 4U9IS 4Q7JB 3M3HA 3H2SA 6ABPA 5KNBD 1TK9A 3C97A 1BZYA 4HQFA 2VHWA 3RS8A 3UJ7A 4D79A 1A9TA 3CEJA 4DJDC 5EJIA 3WV5A 3QF4B 2E5LB 3E5HA 3SHWA 1JHAA 1DEAA 4O29A 5CVDA 5J43A 3F3YA 4S12A 1JWAB 3CWQA 4LXQA 1MTZA 2UUCB 3HVIA 1Y98A 3LTEA 4WWHA 1X8KA 1XXHE 3RAFC 3ON5A 2I2CA 1IOVA 1XBTA 4CU5A 2EYQA 3K9NA 1GOTA 1H65A 1Z5PA 4BYMA 4B2IA 4DUGD 2GNPA 2W2OA 3QHPA 4MVJP 4RY9A 1SXQA 5AJHA 1KZYC 3RRFA 2VNKA 2B0CA 1D0VA 3DOOA 3T38A 3DBHA 1JXQA 3IPAA 1JU3A 3UV6A 3HM2A 1YI0A 1L5RA 3K1JA 4EB8A 4ECAA 2OR3A 5IJ9A 2FWNA 3A1FA 4KI7A 1UXHA 5T4EA 3R7SA 1N2OA 1Y4DE 2EZTA 2OCAA 2QUIA 3EZYA 4G23A 3RIYA 2I2WA 4DARA 4YRBA 1PJ2A 3QENA 4KFUA 1OA0A 1GKUB 5CPFA 4EUHA 2R1ZA 2RC5A 2XSZA 2ZULA 3MVEA 1RAEA 2OAQ1 4K03A 1KH1A 3NHUA 3NTXA 4FFWA 3TPFA 4AKSA 4E1AA 5JCZA 1ZSYA 2JCBA 5CT8A 1BN6A 5D2CA 4D4LA 5COQA 1E63A 3NAZA 4O2AB 5ALGA 3UJ8A 2BCGY 3UXHA 1M1XB 2DHDA 2VNJA 4IBOA 3UJDA 4PZZA 3VH3A 1IZ9A 4G36A 1Q7GA 4RLQA 2PIDA 1M2EA 4HJXA 3ZGOA 3HO6A 1ZVKA 3KU4A 3W2IA 2FUEA 4RETA 5A1TA 2I3GA 1XMPA 3T9AA 4DLBA 2GCEA 1AKWA 3O95A 4BO2A 5HK9A 5F9FA 3SX2A 2GYWA 2CHFA 1BA2A 1UMDA 2ZTLA 3CZPA 1OVMA 4HLUA 5E0KB 5F5XA 3HCRA 4RFLA 2YHBA 4DWJA 4OQQA 3C6KA 1FVHA 2O0HA 3R8XA 1K5PA 3VHRA 1DELA 3BILA 1MU0A 1QO0A 2QAGA 4NPCA 3S70A 4KG7A 1FDVA 1L4BA 1XK7A 4FYKA 3UA3A 5JH7A 2IHJA 4FYJA 4V0KA 4P8RA 1BJTA 5JWOA 4GUDA 3DB1A 4I5IA 1B15A 3DSRA 3LQ2A 1FXWA 2BHTA 3WWEA 1RKUA 2C29D 4FFVA 1NZDA 2V6BA 3G85A 2OV8A 5KVSA 3UHPA 2AQIA 3UW3A 4D8YA 1L7RA 1Z6YA 3RS4A 5H4HA 5JW6A 2R7AA 5LA6F 1LTKA 1YKFA 5DCUA 2Q3EA 1U6JA 3QWAA 1SUIA 5K0FA 3Q9NA 5F78A 3OJXA 1XDDA 5JMTA 1Q0TA 4ZKDA 3FYSA 1T2EA 4P5EA 4XM0A 1XLTA 1VLQA 1PSZA 3H86A 4O1IA 4RE5A 2EKQA 2ONZA 1TTQB 3SJAA 5THXA 1PFUA 2D74A 2R6ZA 1RRVA 1U2GA 2VJBA 3O31A 3LPLA 4XDYA 4DJFC 3UT5B 4M7PA 4X8MA 1N3LA 2B7LA 2C20A 4GZ6A 4HDNA 2YIMA 5TQJA 2B1IA 2WAAA 3ND7A 1EGQA 3CLUD 1U4SA 1XWFA 2VXCA 3OPQA 3EOBI 5KBYA 5C8YF 2C59A 2EFDB 3JW8A 2Q5FA 1LBEA 5LQMA 1GG9A 2CF5A 2F2TA 2VHJA 3MCTA 1DWUA 4WXYB 1DIBA 4DXAA 3L82B 3H1EA 3P2KA 4GZMA 4H3VA 2XWSA 3WLNA 2QMOA 4PANA 4B17A 5GIPE 1UKCA 4QATA 3V2GA 3WKEA 3IFSA 1CUZA 3PC6A 2A5YB 4CM4B 4UTNA 1JIIA 1MRSA 4M54A 3TN7A 5KQMA 1LNSA 1WU8A 4RK1A 5B3JA 5C1PA 2UU9B 4H17A 4RAQA 1NXSA 5AKJA 4B4DA 2R85A 3CURA 1EUYA 1XO1A 3DZIA 1RKXA 4AQDA 4MDHA 2DETA 3IUEA 2OVFA 3WMWA 1MH9A 2H52A 5KTOA 2FKAA 2Q1TA 2P67A 5CFRA 3NEJA 1QB7A 4FSXA 4TS3A 4R9UC 2W00A 2HRZA 4RA9B 4RH0A 4W99A 4C76A 4NS4A 1O7JA 3REQB 3ZZMA 4D8UA 4KVAA 1T91A 2WA2A 1U4NA 3O74A 2ZJBA 2OK7A 1KDZA 5JZVA 1Z7BA 2H9YA 3ETNA 4JX8A 3VC3A 4A1FA 3HXTA 1CZUA 1WPXA 5DLPA 4F3KA 3IVCA 5CVJA 5T7BA 3M70A 1EE1A 4II2A 2DULA 2FEXA 2E49A 2DPHA 2IP1A 3CEHA 5KJFA 4QPCA 4KVGA 3KUUA 5IARA 3U9LA 1GAEO 3I6ZA 3W1WA 2BGRA 4OOFA 2QZ9A 1H0HA 5TEWA 4Z4EA 3P0IA 4GEKA 2IZ5A 3DBLB 3ZHQA 3EPJA 4UNNA 3ESAA 1PTKA 1VSQA 2PD6A 1NN3A 2XDAA 4L9AA 1N78A 3EIHA 2ARKA 1EGHA 1LB1B 2FWMX 3EB9A 1QHHA 2JK0A 3DEZA 4TQ9A 4XDZA 5KTNA 3KQUA 1Y1RA 4L1KA 3G2HA 4UXIA 2J9RA 3KM0A 1CVLA 5IKOA 1OX4A 5G41A 3X1MA 3JRXA 4FHEA 1P5RA 5G0VA 4WERA 3R9IA 5EIOA 3U7IA 3OLVA 1S8FA 4G4SP 3TBHA 2F9LA 3I12A 4CNQA 4UCFA 2WM9B 5D87A 1Y7LA 5ALEA 1QQTA 5BY2A 1GG2A 1SEVA 5ALMA 2TYSB 3CLKA 3QX8A 1SVKA 1U81A 2PS1A 3NHAA 4LFCB 3VSCA 3DYIA 4OHRA 1C9YA 1JG2A 3MJTA 1IPFA 4ZJZA 2CUKA 3ENNA 1U1GA 4Y0AA 3COPA 4ZQEA 2AFHB 1TPYA 4Y9SA 4BVKA 5ALIA 2H11A 1XEWY 1DKRA 3IJRA 1L1RA 4B7ZA 3FDXA 1ZN7A 1M1NB 1W88B 1SD2A 3HO8A 5D5QA 2R8ZA 4BO0A 2IXTA 2WF5A 3FH0A 2Y6VA 3PL1A 2ZE5A 1REQB 1DG1G 1R0RE 3BSWA 3T3GA 4DLPA 4ENVA 6REQB 2D5CA 2JAOA 4BB0A 4YT4A 4B3GA 3OMXA 3QBVA 3UWPA 2FR1A 4CR7A 1VSUA 5AM5A 2DERA 1JE0A 4G4JA 4M89A 2BFBA 3WFJA 4UTXA 5D3ZA 3DMTC 4HRVA 3TMAA 4TTSA 2CYBA 2XHZA 4G5YA 4QODA 3WMEA 3GH1A 3TNLA 5JATA 3FOAA 5DF1A 5E7JA 1JHOA 1H8ED 5HEKA 5KJ1A 5LWHA 1A1SA 1RFLA 3C5CA 3QU2A 1JI0A 4ID9A 4RHUA 1KEKA 1CRZA 3QK7A 3PX2A 4H7PA 4JB3A 2HSWA 1GL9B 3HGTA 3AHDA 3N6VA 1J2RA 2YWJA 1Z6QA 1L3IA 2IYUA 2D6FA 1H9CA 4OV6B 1AUQA 1IXRC 1J4AA 3DVLA 1HMYA 5ICCA 4DLRA 4NK5A 1DAPA 3OQBA 4HYQA 4ZGWA 1QG2A 4F96A 1BA3A 1JHMA 5TT0A 1II8B 1GXSA 2QMUA 1IBKB 2X19A 5CCDA 1U3VA 1EK1A 2G67A 4MR7B 4BO4A 4UDNA 2CXUA 3G2QA 3NHSA 4H0NA 1ZBQA 2OC9A 4G8CA 5AM4A 4NYIR 1VCMA 1NE7A 3KQHA 2O8EA 4BKMA 1ZOSA 1T9GS 1ADCA 2B35A 1JDVA 1LFDB 2CDCA 3DLPX 3LCRA 3H2JA 3H9GA 2FDRA 2WSSA 1QE3A 4FR2A 4TL9A 4F72A 1NL3A 2FU5C 1T1IA 2FWJA 3L5KA 1A4XA 1ZNWA 4QC2A 3T3NA 2HQOA 5T3UA 3SXJA 4Q9KA 4M9CA 2ILVA 1V43A 4MVJH 3TR5A 5H9WA 1AKEA 2VC2B 3KYIB 3ZUGA 3QVWA 4XUEA 1RHKA 4P92A 1TMKA 4RDIA 2XUZA 1M10A 1ETUA 4LDNA 1Z18A 2A9JA 2B5OA 4Y98A 4PX3A 5IKEA 2QMHA 1NMZA 3L02A 1WZEA 3MCZA 3MMXA 2W90A 4M1YA 4LXXA 2Y27A 3V4FA 1GZSA 2ACWA 5IT9A 1N6LA 5FL7A 4DR6B 1EZ4A 2ZRDA 3BXPA 3HHPA 2YYAA 3FTCA 2BMEA 4JMPA 5B7GA 4DIEA 4ETNA 3LA6A 3B85A 4KV7A 3DCIA 3DL0A 4ZI7A 3X44A 2VDMB 1NPDA 1FRNA 3CXUA 5JADA 4Q4HA 4OK3A 2BI7A 4DT1B 5GJBA 4U9UA 2O3RA 2WU0A 3UJBA 4RSHA 2J5BA 4DIUA 4LZJA 4Y6OA 1CXZA 2OQRA 3EG9A 5BWBA 2DQYA 3N87A 3LQQA 3PKIA 3KVVA 3B89A 2PQ6A 5H3HA 3ZIAD 3AFMA 4YVFA 2C98A 4LZNA 2FFJA 4FFNA 2ERYA 1XTVA 2FW1A 3OESA 4S05A 2PZAA 3JQCA 2LP4Y 4FUQA 2QLTA 2YZKA 1M7BA 4G56A 4L7VA 3KPWA 2W4MA 4GICA 3RANA 3SR4A 4ZXFA 4LNAA 4NCXA 3SSOA 2K4MA 4RFSA 1H42A 1ZOLA 2R66A 1OI2A 1C3OB 1EG7A 1T6YA 3L9WA 3BIWA 1BOFA 1N8NA 1UKYA 2ZTHA 2ZYDA 3MT9A 1P7PA 4J4HA 4JLAA 5HQ3B 1X0XA 3DFIA 4IDDA 4KODA 4WJZA 5J4KA 1ORVA 2IBMA 4LJ4A 4P84A 4D9GA 2ZDHA 1XNQB 3QF7A 1C0KA 1Q1AA 1OVGA 2VSYA 4GYWA 4ETWA 3JQAA 4G26A 3ACBA 1TIPA 4LE1A 1RS0A 2WHXA 3OWXA 3K96A 3OJWA 3PJFA 1YFLA 2SCUB 2AFIE 4UBMA 1F2UA 1XD2A 4K05A 3G17A 5ENDA 1E3LA 2FSPA 1JDTA 1Y7TA 1UPTA 4R2HA 2VHCA 5JYCA 4NCKA 2VTBA 2DAPA 4FEEA 3VBCA 3G9QA 4RLSA 5JSQA 1MJFA 1P5FA 2ZJ3A 4OHFA 1TQDA 2H63A 1R37A 1TM5E 4PLFA 3FRIA 5FNZA 5AVVA 3GGSA 2ZRBA 5GPBA 3KSUA 1KY5A 2ZE7A 3GHYA 4BCCA 3R3SA 4WGFA 4H3SA 1YVPA 1AE1A 4RPHA 1PK9A 1VSBA 1JEAA 2OBMA 1X7XB 2ZFUA 1LQ2A 4IDEA 1KR2A 4UBLA 5EZ5A 5EINA 4TKMA 4L9RA 4REQA 3S2ZA 4OB6A 1OT3A 1I3OA 1NUHA 4LBYA 1YULA 4II7A 5D3KA 3AF6A 1T4CA 3KQNA 4GOND 2IITA 1ND6A 5I4BA 3T4EA 3OBBA 2F1JA 3ZCPA 3QPUA 4KR9A 1UOPA 1NONA 4Y2QA 3OUZA 1L5NA 1TAUA 2RHRA 3AEUB 3G5LA 3HVJA 4ZP1A 4DVGA 1X7YA 3BT7A 3B1ZA 3PHIA 1DIGA 4FHFA 4ND3A 4WECA 1K4YA 2YXEA 3BTVA 5C5IA 1C1YA 2OORA 2BGGA 4UHCA 1VIAA 4N4AA 1QE5A 2RH5A 3IPRA 1OTYA 4X7MA 3NNDA 1GPH1 2AG1A 4ZT3A 3TZBA 3LYAA 3WDMA 5I47A 3KVYA 2VQ6A 3GAMA 1R8JA 2QM3A 3JTEA 1DXHA 1J22A 1P31A 1BMQA 3U44A 1ZSVA 3ODPA 3QTBA 1GYRA 1Q44A 1BCRB 2TMYA 2W2QA 4ERNA 2ATCA 4CZ2A 3UMFA 3ZQKA 2VSNA 3FPGA 2W2XA 4M3NA 1J8MF 1KIMA 3K0FA 4MX8A 5CFOA 1EZZA 4AQ7A 3ROPA 3LHIA 4BVFA 1FL9A 1K7SN 2GD2A 1BXGA 3G79A 1EGAA 2PPLA 3GLQA 3OZEA 4D9BA 4EGFA 3GBPA 2RGNA 1UWCA 3GRCA 1GPKA 3VYWA 2QDKA 5LQKA 4ABTA 1VKRA 5EKXA 4AS3A 1IY2A 1J0BA 2I4TA 2IC5A 5F2KA 2OXTA 2FMUA 4MLZA 1T25A 5I7UA 2PUJA 4IG4A 2WMYA 1AUVA 1TECE 4NXNB 3KKOA 6NULA 1FSFA 4OLFA 5DGHA 4Q4AB 3LC0A 1OCEA 3PF9A 4AP5A 5D5PA 2ODQA 2ZG6A 3LW7A 4U3JA 4UFPA 2JLWA 3EGVA 1CS0B 3D6FA 4KXQA 1XNJA 4EUNA 1IRIA 2E85A 2X41A 3NPMA 4FXOA 2XXJA 3ZEIA 3VO2A 3EW9A 4BFVA 4XAQA 4F46A 3K30A 2HXGA 3KT6A 3HJAA 3GVIA 3EFHA 1O8BA 4GZ5A 3U7EB 5KZMB 2Q5JA 2CV0A 4EJSC 4GLBA 4BRSA 1SD5A 1CP2A 3EOAI 4CMIB 4V2UA 2QD2A 2CK3A 1YTUA 2AOTB 1SEPA 4JELA 2BD0A 2AG5A 3ME5A 4MWTA 5JPCA 4EPVA 1UEJA 1I24A 5CM2Z 2GM9A 3ITEA 2NAPA 3NHBA 4EA6A 2C2BA 1N77A 3QKRB 1EK5A 1O94A 1KOFA 4H1TA 1NMQA 2RK3A 2ECKA 2FZVA 5THQA 2BFPA 2ZM6B 3OETA 2ODEA 2WG1A 4CHTA 1QGAA 4P4GA 5TPZA 1T5IA 4FXPA 3BE6A 2NTJA 2Y0DA 1CIPA 1TYEB 1W5FA 1NRWA 3HCAA 3V55A 1D6SA 3DT6A 1JMKC 4UHBA 1J20A 2PX4A 5FEUA 1FDRA 2XQKA 1ESDA 3DKVA 1IVYA 1KC3A 3PC8C 3A3PA 4U7HA 2WWTA 2XF8A 3EMDA 3ZOZA 3U7FB 1JAHA 3W4KA 1NDQA 3D43A 1HZZC 1K4MA 1JKFA 2K2QB 3DMYA 3QH4A 5DM60 5IULC 3S1LA 5BN3A 3P4UA 3UMSA 3HEAA 4QT4A 3UUGA 4B5KA 3PNYA 5DTJA 5BORA 3M6XA 4JSTA 5GV7A 1Z06A 4Z0PA 3V8MA 5DN6D 2AFIA 5ICFA 1RYZA 2HM7A 4QQNA 2IYFA 2V9PA 4X94A 4X91A 1SHLA 1NVEA 1HMPA 4AC9A 1GU7A 2PX3A 3HV0A 3QFRA 4ARCA 4PXYA 3T0GA 4XWKA 1VSTA 3NLLA 3IKJA 4OYLA 5H81A 1C7IA 1P17A 1GITA 1GPMA 1RNLA 2IFTA 1ULHA 1RR6A 2W9XA 2HEGA 2H1SA 3U7QB 1GL7A 5ALTA 4UOEA 3FOEC 5DTEA 4QDUA 3L7KA 1FRFS 1XNRB 3WGKA 1DAIA 5IXSA 2KPOA 3TVDA 1R0LA 3PJGA 1PTJA 4IQFA 4DTCA 3RIMA 1KAMA 4R2IA 1VQ1A 3H9CA 4RKEA 3QE9Y 4JI8B 4G8JA 3ZWOA 1WHTA 2HCBA 2WVAA 1N7HA 1NKSA 1JKMA 3A9TA 1TC1A 4KYTA 4HNUA 4KBGA 1JKIA 1Q1EA 1ZISA 4FKBA 3MHPA 5FBKA 1T0BA 1W34A 2OYSA 2QTVB 4B31A 4E5SA 5JECA 3Q3EA 2V6IA 5AKYA 2RHOA 1B74A 1YRWA 2HO4A 1XA4A 2IYYA 3GT3A 3I53A 1KU0A 3IERA 1ZK3A 3B1FA 3TGWA 5A0VA 1YDGA 3RHZA 1CY7A 4G81A 2HXSA 2HMWA 3QI2A 3QJGA 4IIJA 4MS3B 5AI4A 1KETA 4D6PA 1N75A 3ANLA 3NBQA 3TJMA 2XADA 1N2CB 1VYUA 3F6BX 5PGMA 3PWKA 1R0YA 4WCFA 1XIVA 1MENA 1NT4A 5IG2A 4F3NA 1IM2A 1VFPA 4BNDA 2H1HA 2SBTA 4BE9A 4O4JF 5HIKA 2XCRB 2FMFA 4JLKA 4HEJA 4RCYA 5F33A 3FBWA 3EUWA 4HMOA 3W5HA 3DFZA 3RVRA 6ADHA 3IEUA 3UMRA 1VLJA 1KHTA 3S2YA 3EIUA 3ACDA 1YOVB 4M99A 4A0SA 2REQB 3O8LA 1Q3TA 1JFTA 2O07A 1FYDA 2GF2A 3PUZA 5F1PA 4NFYA 5ITSA 1HQCA 2OXFA 3BWXA 2JIRA 3G8YA 2DQKA 1RM0A 5B12A 2KX7A 1Z5NA 1U0NA 4B46A 2WOJA 5AQ1A 1VP9A 3BXGA 2HZBA 2Q21A 2ORIA 4RVNA 2ZPAA 3JQGA 2QLNA 4KQJA 1SUWA 5EP3A 2EGUA 3CRW1 2WAOA 5ITZA