1V9SA

Crystal structure of tt0130 protein from thermus thermophilus hb8
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
208
structure length
199
Chain Sequence
MRITLVDHPLVQHKLAHLRDKRTGPKDFRELAEEVAMLMAYEAMRDLELEETTVETPIAPARVKVLSGKKLALVAILRAGLVMVEGILKLVPHARVGHIGLYQYYIKLPPDIAERRAFLLDPMLATGGSASLALSLLKERGATGVKLMAILAAPEGLERIAKDHPDTEVVVAAIDERLNDHGYIVPGLGDAGDRIYGTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of uracil phosphoribosyltransferase from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Transferase
molecule keywords uracil phosphoribosyltransferase
total genus 47
structure length 199
sequence length 208
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.9: Uracil phosphoribosyltransferase.
pdb deposition date 2004-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14681 UPRTase Uracil phosphoribosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1v9sA00
4OHCA 1O57A 3DAHA 1XTVA 4WN3A 4RABA 1DKUA 1LH0A 1BD3A 2GEBA 4RAOA 4JLSA 1YFZA 3KB8A 1STOA 1L1RA 3OZFA 1DKRA 1A4XA 1HGXA 1R3UA 1D6NA 2AEEA 2H06A 1ECFA 1P4AA 5EUCA 1G9SA 2JKZA 1IBSA 1QK5A 4F8EA 1UPFA 5JSQA 1XTTA 3N2LA 4P81A 4LZAA 1ZN7A 1DQPA 1FSGA 3MBIA 4RHYA 1V9SA 2HCRA 4X44A 1MZVA 1XZNA 4S2UA 1A95A 1DBRA 1G9TA 3OZGA 4RQAA 4Z1OA 1WD5A 1Z7GA 1W30A 2C4KA 4LZNA 2JBHA 1JLRA 4QRIA 5JV5A 1QK4A 1A3CA 1TC2A 2E55A 1P18A 1VSTA 4LYYA 4RAQA 1G2QA 1ECGA 2WNSA 1I13A 3S5JA 1TC1A 4RANA 1BZYA 1OREA 1I0IA 1VCHA 1HMPA 4P84A 2VFAA 4RACA 4M0KA 4RHUA 4RHTA 3GGCA 1DQNA 1NULA 3QW4B 3MJDA 5BSKA 4QYIA 5ESXA 1CJBA 1VDMA 4M0PA 1J7JA 5E38A 5KAPA 1ZN9A 1QK3A 4WMLA 1GPH1 3O7MA 2H07A 3ACDA 2P1ZA 3GGJA 4P80A 3OHPA 1ZN8A 1XTUA 3LRTA 1I0LA 1U9YA 2H08A 3HVUA 4PFQA 4QYIB 1Y0BA 5BQOA 4LYGA 1NONA 3ACCA 4M0UA 1QB7A 5HIAA 1ECJA 2EHJA 3G6WA 4ZFNA 1QCDA 2IGBA 4JITA 1A96A 1ECBA 3NAGA 3DEZA 5BRNA 1ECCA 2PS1A 1XZ8A 2FXVA 3H83A 1L1QA 4P82A 4KN6A 4X45A 1I5EA 4RQBA 1P17A 1P19A 5IAOA 1JLSA 2YZKA 2DY0A 1G2PA 4MB6A 1OPRA 1QCCA 2XBUA 2JKYA 3DMPA 2PRYA 4FYMA 4PAWA 5HKLA 1I14A 1A97A 1GRVA 1BD4A 2JI4A 3ACBA 4IJQA 1A98A 1U9ZA 4LZOA 3EFHA 4RADA 1O5OA 1PZMA 1QB8A 5ESWA 5K51A 4P3KA 4P86A 2PRZA 3LPNA 4P83A 5IPFA 4TWBA 1AO0A 3M3HA 4RHXA 5KAMA 1OROA 3GEPA 4RV4A 1UPUA 5BQPA 1UFRA
chains in the Genus database with same CATH superfamily
1U4OA 2PAFA 5JDIC 4KZPA 1CUSA 1JECA 4RUKA 2WMDA 2CVOA 1EIWA 4HZGA 4WFIA 2IODA 2GN6A 2Z5VA 4G0XA 4W9RA 2KSQA 1Q14A 1Y3AA 1A9QA 2HDWA 2X5XA 2X0KA 3DQPA 1SOWA 3JARB 4KACA 2JFBA 3CIOA 4XM0A 1Y3BE 1UF9A 2MSWA 3BOSA 2WAOA 1R0KA 3YASA 4RVFA 5IM4F 5L3QA 1EHIA 1Y5MA 3DBLA 1JHMA 4LV6A 3QV2A 2PZAA 4GQBA 1QRTA 3G0DA 3P2MA 1DJQA 4C0JA 2OCXA 5HM8A 2OORC 4O6VA 1RPAA 4XDGA 2VHWA 5TPZD 2GSWA 3Q8KA 3NRJA 4EPVA 2OXRA 2BL4A 3QGMA 1RWNA 2YS7A 1H6CA 3O8QB 1TEXA 2J9GA 4B5LA 1E2BA 2JBHA 2GD6A 4BASA 3FG9A 3HJTA 4MK4A 4OBXA 4TQAA 4DLLA 1SIOA 2HEGA 3OEHD 2QTVB 3C3CA 2XUFA 3TTSA 1AH2A 1NVKA 2F62A 4IEFB 4BNFA 3HJHA 1DNPA 2C2XA 2IL1A 3KPUA 1T3HA 2FFRA 2IZ6A 4UAVA 4PNZA 4C76A 2CNWD 2DYKA 2C7GA 5EVCA 1VA4A 2IKQA 3QHQA 2DOKA 3WSVA 4KSCA 2I80A 4PO3X 4HNGA 2CL0X 4D9KA 2ZDGA 1VP3A 2A9VA 3OU7A 2OR3A 1WTAA 4QYIA 1EX6A 1EP1B 4TMKA 2IS4A 1AMNA 2R8OA 5B3JA 2QV7A 1YB4A 2Q41A 3VHLB 4ZHSA 1L9XA 3Q3VA 3FWHA 2XYGA 2GESA 5CVJA 2BM1A 1ACMA 1N2BA 1NW7A 1W0KA 1NF2A 1X7XA 2PVCA 2VS1A 1HYQA 3IULA 3LU1A 1NKSA 2Y0DA 1HUQA 2FP4A 1YDWA 1IUOA 1NKVA 2I33A 5JXWA 3PDIB 3EUFA 3L7YA 3EXEA 3H8VA 4RE6A 1NI3A 1ECCA 1WOYA 2BCGY 4K2AA 2GNOA 3IB6A 1SU4A 4AVYA 3MMXA 2QPAA 3K6JA 4Z4FA 4LHWA 5EMLA 4LHVA 1SC1A 2QUBA 3HCEA 4HYTA 3OZDA 2IDJA 3HB9A 1DRWA 3P27A 1G0OA 1VI6A 4IXDA 4DIBA 2EDAA 1RM5A 3JATA 4MARA 4ZQBA 1LA2A 1O54A 2HLDD 5K9ZA 4Y1RA 1WHTB 5E7QA 4C0QC 5K3CA 1K8YB 5EE1A 2VG8A 3U13A 3V8NA 4EFNA 3NBFA 4KXNA 3UATA 1E3WB 3VV2A 3UPUA 3BFKA 1OFUX 2XOKD 3H5AA 2AZDA 5B3LA 1ORRA 4JR0A 5DT9A 4H27A 3L0PA 3A9RA 2ZBQA 2NZVG 2GBPA 3OBIA 3UF0A 2UZAA 1K6XA 2Q0XA 1ARZA 2WILA 1OAOA 3FD8A 2HSDA 2B3TA 1PHRA 4I4LA 4UNPA 4XOUA 5KNDD 1AMOA 3Q5DA 4U9IS 2CHEA 4WCDA 3S70A 1OW3B 3X1ZA 4BX8A 4DG9A 2C97A 4IWXA 5BYKA 2GAJA 4YJ2B 3CCBA 4BRZA 2WJHA 2C4VA 2PZJA 3AFGA 3D4PA 1WW3A 4YI3A 4W5TA 1V5EA 4XM1A 3OTOB 1TEVA 1THMA 1X7ZB 2VZ8A 2BLNA 2NTNA 4GRAA 1TTHA 3IT3A 4CT0A 1Z63A 3DBHA 1W76A 2ZRJA 4LZPA 5F21A 5JWOA 1BO6A 2YY7A 4OB7A 4DQKA 4D9CA 3Q3GE 4Q4HB 4PQGA 2XCSB 4BFXA 3AG6A 2GLUA 1NRJB 3QMVA 1BOFA 5CVEA 4MINA 2HA2A 3PFWO 2OHIA 4DJTA 4IY1A 3MBIA 3HADA 4HWGA 2AQKA 3AHCA 3Q3JB 1S1CA 1Z5WA 3PFGA 1JIUA 4WLNA 3OECA 1YMVA 4X65B 3A4LA 1JL3A 4GP7A 1FMJA 1Z35A 1SCIA 2HQOA 3EVTA 2DU8A 3UA3A 1EUDA 3CZMA 1ABFA 3ELDA 5M2QA 1QYVA 4URUR 3NAMA 3TL6A 1EGVB 1EWKA 2IDKA 5EJ9A 3M34A 2ZRGA 2RJOA 4YPFA 4EQ6A 1CLEA 1KSJA 3HFGA 1P31A 2OLEA 3F6BX 4P2BA 3SF8A 3G85A 4OUDB 4J29A 2W6JD 3WZ2A 3ZOZA 4N7BA 2AMYA 3L1UA 1PZGA 3BCUA 3UEOA 2V6FA 3LSTA 4D4MA 3ZK9A 2R7MA 4LV8B 5JBNA 1J8FA 2Z2IA 5TDHA 2J08A 1L7QA 4EJSC 5HZKA 1RYDA 1Z83A 2OA0A 4M8IA 1JDSA 2IKSA 2PX2A 2V59A 3AETA 5FTNA 3FZNA 4JHLA 1EGMB 1WPQA 3F7NA 2XF2A 4X85A 5B4TA 1YVUA 1F0PA 3KPYA 2XWQA 4R1TA 1J0XO 5HG0A 4QPJC 5A02A 1Y63A 3FX2A 3RSGA 1CRLA 2L69A 4JJ7A 2G7MC 4K9KA 4JI7B 1ZHFA 2L17A 3KEQA 3H8JA 4WESA 5HIAA 3VSEA 1Z2DA 3T5TA 4N5DA 2QX8A 3CWCA 4AUEA 3CE9A 1Y7HA 1VHTA 5EKXA 3SCZA 3F3MA 4C7KA 5AW4A 4XSGA 1BJTA 1KOFA 3PPIA 4EYEA 3W2HA 1NX6A 2Q49A 3H4MA 5SZJA 2O5RA 2FMUA 4RY9A 1VHDA 3K05A 4NBVA 2C31A 4UUPA 3X2EA 1BHJA 5CLLA 1LK0A 1JFLA 2Q9CA 1IULA 2O7VA 1QCCA 3FUWA 4YMWA 2XBLA 2LDBA 4HQRA 1L5KA 3HVJA 3J7TA 4G84A 5L3VA 4OMDA 4FHDA 4KDCA 3CWZA 2X3FA 1AG9A 3RSZA 5JD5A 1M8GA 3TB6A 3TW4A 3WWCA 1PG2A 1NAHA 4MICA 1N5DA 1VIVA 4P86A 1Z4QA 4NBTA 1WZUA 3KQPA 4ROTA 5PNTA 2VAMA 5DW0A 2QAGB 1M2GA 2C77A 3JQGA 6GPBA 1YQUA 1NDUA 3QVMA 5HFNA 4BX3A 4CHTA 2ZS8A 3H99A 1U1EA 2BC9A 2HRDA 3HGTA 3QVTA 3SYMA 3BD8A 5BWOA 2ZM5A 3FTFA 2GJ4A 3BE4A 4D9JA 3R3SA 5ARCA 4UEWA 5ADWA 2I03A 3QOWA 4K26A 1XJ5A 4NENA 2JGEA 5FBRB 5CFPA 5KSPA 1BDJA 2Z4RA 1NATA 2Y0EA 3PGA1 3Q7QA 1L4EA 1JFFA 4DJEC 4RJTA 7ABPA 3DL2A 2X5JO 4G4JA 2GZ3A 1W5EA 2BKEA 4XB1A 3WMGA 5ED0A 2GBCA 2RK6A 1DJPA 3SOPA 1NV9A 3K9BA 3IT2A 4QOJA 3DAGA 1XJCA 3PS9A 3RFUA 3ECCA 2YHIA 3FOEC 3AEYA 4DRXB 1SCNE 3AB8A 1QOPB 2YBEA 1VSQA 5ICCA 3RVSA 1RAAA 3I1IA 3EDRA 3GMIA 5COQA 1OXTA 4HV4A 1HF3A 3VUFA 5FV7A 1ZR4A 4JYAB 3G7SA 3ZKAA 2O8BB 2EOAA 2FRXA 2QLLA 4OHWA 3TQSA 2FZ5A 4DA8A 4E3WA 2PX8A 4EYGA 5J43A 3PLNA 1P2DA 3ECAA 1V1MA 2B3DA 3HR7A 4WA7A 1TFUA 4WI1A 1HTWA 1X1EA 4B81A 4CFZA 1G64A 3ZBTA 2X0NA 1ONNA 3QLVA 1RQ7A 5CU7A 3DL7A 1NVWQ 1W75A 2VYQA 3ZHTA 4KQKA 2BHNA 1JDBB 1PR1A 3RYCA 4GPZA 1G3QA 1OBHA 3IR7A 3IO3A 1R64A 3GEBA 3V2IA 2OGUA 3RADC 1UBUS 1GDHA 2PLAA 4ZXPA 2XBMA 3AB3A 2X2PA 3DM5A 2O7SA 1L8LA 1IY8A 1GTL1 1VRCA 5HM6A 4RK7A 3GZNA 3QFSA 4J16C 5CXUA 2IUEA 4MR7B 1H8EA 4MRRA 5M04A 1Z16A 3ESZA 5A3SA 4QDXA 2V58A 1A72A 4FB5A 1C3JA 4MGKR 4PYKA 5IC5A 5IW8A 5DGIA 3ESQA 2VYNA 4K0RA 1CLUA 4FX2A 3IIMA 4LSZA 3GEHA 1DT5A 3PFHA 3I58A 3PVSA 1ZONA 1YE3A 1XQ6A 3EXEB 2QXYA 1Q16A 1CY4A 1LW6E 3A10A 3EZFA 3RT1A 4OQDA 2QRMA 1F1BA 1GLVA 1KU6A 1DXYA 1UBCA 3M6FA 1S4MA 1Z29A 2CVQA 3O03A 2V7PA 3KLBA 1WNFA 3RUFA 4R2WA 5E9AA 3CZCA 2N1MA 4HDSB 4YX9A 1ZEMA 1PJLA 3DEHA 3UK7A 4C7OB 2IZ1A 4NNJA 2F67A 4I6GA 2PR7A 1NMYA 2H31A 3AUFA 5J5CA 1UBLS 2I4OA 4QKQA 5K0SA 3Q7EA 1CPYA 4CFSA 5HXAA 3HG7A 3KPJA 3CLKA 3L46A 5DNVA 5JDCC 3K31A 3OT5A 3OZTA 4ISCA 4OIFA 4IXTA 3IERA 1J2TA 4HYEA 2Y0PA 1EFKA 4TMZA 3L49A 3B1YA 1NTOA 1YQWA 3OKPA 4P83A 5DYWA 4BZQA 4D9FA 1YACA 4L0QA 1GM5A 1D2CA 1G4HA 3MPOA 1ML3A 5P8WA 4ZK6A 3I28A 1OZGA 4AZVA 5JLJA 4MYSA 1JWAB 2GVNA 4X7BA 1EXVA 3HKDA 3Q7PA 1EVEA 2IP2A 2XTNA 2V4MA 1IDOA 3HA3A 3IMGA 4P3NA 4DNQA 1T1IA 2I3AA 4EPTA 2HTFA 2Y27A 4I14A 1DO2A 1ZD9A 4HNHA 4TZTA 3THOA 3ZHBA 2VP3A 3IXMA 4EI2A 1M75A 2GYWA 1JXOA 4ALNA 2XXAB 3QFFA 5DBIA 2Y68A 2F4VB 4B44A 1X1RA 2YL2A 4HH0A 4CM9D 4AJ9A 1R18A 4Z1MA 1G20E 1ATIA 1WSDA 2R8XA 2H00A 2VJBA 2ZFUA 3CFYA 5I5EA 5FLYA 4ZYYA 1OILA 3I39X 2VA8A 2W37A 3CLRD 4OFBA 1QTNA 2HIAA 2WIJA 7AT1A 2FSVC 2XQVA 2SCUA 1ZHHA 5J1SB 3P52A 3T7TA 2I34A 2WE8A 4XIGS 2E5FA 3ORHA 4B4UA 1LQTA 3ETHA 2WP0A 4NAHA 3MCAA 4C01A 4EB6A 2RGNA 1CUVA 3RSHA 4R2LA 1FDTA 1LV8A 3A4YA 2HEIA 4YRQA 4KU4A 2OK8A 1FDOA 2FP4B 3OIWA 1PW5A 4G6ZA 2WJ6A 3IQWA 1HTBA 3EC7A 1J1UA 1BMQA 3UMVA 4DY6A 3B48A 1G8PA 5ADHA 2C5HA 1AQNA 3C6KA 1A9RA 2JFNA 3GAFA 3HPQA 3L01A 3WHLA 3N8NA 2OP0A 3I9MA 4U0KA 3A4IA 4OVKA 3IDZA 1B26A 3P2JA 1Z2CA 4OBEA 2OKCA 1W96A 3I92A 3NH6A 4O25A 4D9MA 1BZYA 1LC3A 2YR0A 4JIMA 3X2SA 1DG3A 1I51A 3EH2A 3LPCA 2OFFA 4QLAA 5EFOA 3O31A 4JQYA 5CLGA 1NR1A 2QSUA 3K9LA 4J3JA 4DSZA 1U2ZA 1PDOA 3GCDA 5DLYA 1U2SA 3NVDA 4J03A 5AVZA 2UYGA 4DIFA 1EUYA 4QWWA 4DR7B 4DLYA 3ZWPA 4L5AA 3VZQA 3EULA 1II9A 3RFXA 4A10A 5CJJA 1IXRC 3LA8A 4BAGA 1PWZA 1R3DA 1CRWG 4NFYA 3D7RA 2IW3A 5DNDA 4EG5A 1AQJA 1QAOA 1UP4A 2OY0A 2CV0A 1KR5A 5L4LA 1UAAA 2CL5A 3ACCA 3O8QA 4HPWA 2H1IA 1LPSA 4LFCB 4DR2B 4K81B 2P6MA 3LT4A 1BEZA 3PNKA 4CV3A 1FFGA 2Y1GA 1TTTA 1FP6A 1GL9B 3KR0A 2XTJA 4AURA 4PYRA 3NBMA 4WQMA 3WL7A 4M8LA 2IU0A 3WZMA 2ZYUX 3ZTYA 2R9VA 2M2IA 2WG2A 3I34X 3P4XA 4P36A 4QT0A 2EJUA 5LA6A 4BJ1A 5ANRB 2KM1A 4L4UA 1MAWA 2RGUA 1Y1SA 2XDQA 2A7XA 1P7ZA 1MEOA 2C5FA 5JYEA 1X6VA 3EC1A 3AKZA 4QJ5A 2YHSA 1A8UA 5JXGA 1HM5A 4WFKA 1SK9A 3ZXSA 4A6DA 2FW1A 3U09A 1A5ZA 1C7RA 3A0UA 5FJJA 4ZGGA 1U2DC 3CJQA 1L3IA 2A1TR 2B82A 4PICA 3K16A 1JLLB 3ETNA 4YP0A 1DPGA 3GCGA 1E4YA 4X63A 1RI5A 1WUIS 5KU7A 3OZEA 4FFWA 2VQDA 3A6GA 1IB6A 1U2EA 3JQAA 2ATXA 3VMFA 2B94A 2EJWA 3F8WA 4L27A 3FMFA 3RKRA 1P1HA 1CVRA 1BVUA 2X76A 3TMKA 1KRXA 3K1AA 2IIQA 5AM1A 3HKDB 4BFZA 5DT2A 3TSCA 3JQPA 1YJQA 3ZXYA 1FP4A 1DAHA 1NBWB 3R41A 4O33A 2XUZA 2C8LA 5L9AA 4B7AA 2X77A 4PWZA 3RWMB 1PS8A 2AZMA 1V7QA 4OQQA 1CS0B 3L5KA 4PGGA 3NBYC 5GGXA 4MQFB 4OAOA 5K45A 5LWQA 4FYHA 2QVZX 2W6MA 1AURA 1E3JA 1PQWA 1XEAA 2IDZA 3E2PA 3K0AA 1XC7A 3MF4A 4M38A 2GO7A 4GSYA 3WKAA 4CLRA 3NHMA 3RRMA 3BORA 1XD8A 1RWXA 3O2JA 1DUIA 1LX6A 5IDWA 5JRJA 3PQFA 2DXIA 1XZMA 3T7AA 1I8TA 4ZT4A 4CIAA 3JYPA 1XCLA 1FDRA 1BE1A 3PJEA 4Q4DA 2Q7DA 1JKXA 1GQ2A 1O1YA 3ICVA 5I8WA 4ZVRA 3CEPB 2ODBA 1ESMA 2BKVA 2O6LA 4HYQA 4MZXA 5BMOA 2J3QA 2FDRA 3TFWA 1AF7A 2IWRA 4PY2A 1QP0A 4KX5A 4ZOLF 3HNOA 2JGNA 1J42A 4LTNA 1FBNA 3FHTA 4PBTA 4KOEC 2P2ZA 1Y4SA 1ZLYA 2W2XA 4DCSA 3BMOA 3QYFA 3R3VA 3CH6A 5LQUA 1T5HX 1XRRA 2HD4A 1A76A 4OP1A 4Q3KA 5EHIA 1Z0JA 5F7XA 2I6TA 2JI6A 2BHLA 4GI1A 5CLHA 2MINA 3H5NA 1ZUIA 1FZTA 3OP1A 3QELA 1G55A 1WXIA 1XMIA 1NJGA 2B8WA 4LHEA 4RDIA 5TPWA 5KC8A 1IU9A 4RZHA 2WB2A 3WJ7A 2IUTA 3OE7D 4YH1A 1KVQA 2HIGA 1FMCA 3VR4D 3HV0A 2C5SA 3QLUC 2GK6A 2WZBA 5KYXA 1HR0B 4UJ5A 5A4KA 1CY8A 3H3XA 3HCCA 3RTEA 5DJ5A 4JI5B 1XZFA 5DM70 3P9PA 4P54A 1XTUA 5F2NA 4YK7A 3KVYA 3GROA 1LLFA 2ZBGA 2ZYHA 1NN1A 1V1RB 4JI6B 4D3FA 4E08A 1NBHA 2XGMA 4DLWA 2XE4A 4AMUA 4IM7A 1NC3A 1DTWA 1E62A 1O2DA 5IASA 1NLYA 4JJGA 4R8KA 3AUAA 5FWAA 2Y05A 3VTFA 3VRHA 1SUAA 2YXNA 3N6VA 4CRWB 4F3CA 5JBIA 1S7GA 4DZZA 1J06A 3NIGB 3ZS8A 2ORYA 3JQCA 1SKAA 3RHSA 1H8HD 2H3HA 2YOGA 1KR2A 2O6HA 1JLSA 3SX2A 3THSA 3W6ZA 5JD4A 4JENA 2A2ZA 4ND8A 1OWLA 1A2KC 2PU5A 3RU7A 1EK1A 1CUGA 3G2MA 2I54A 1II0A 2JCVA 3D8SA 4MWOA 4RZIA 4MMXB 1I14A 2GPYA 1A88A 5GV8A 4E1BA 2PJRA 3DWEX 1RRFA 3IALA 4EA9A 3ZWQA 1U0HC 5LM3A 1T9HA 1FFXB 1RWWA 4AQYB 4DARA 4LF5B 1WU7A 1VSBA 3O8OB 1KSGA 2GK7A 1EFUA 2B4RO 2ECQA 5E4YA 1L5SA 2EIHA 3N9IA 4L75A 2ES4A 5KNCH 1FK8A 5GM1A 4OHFA 5TX7A 4HADA 4MRSA 1EI9A 5KAMA 4BB9A 3IL2A 1M0SA 1C8LA 2EXXA 4LGYA 4YJHA 5KREA 4GE3A 4ZYVA 2BTOA 3AR5A 1W0JD 1Z2NX 4LWPA 4N8EA 5JCXA 5JJ5A 3LBYA 1B8NA 2GUGA 4UTPA 3NG1A 2OFXA 3F1LA 4JJKA 3I30X 5DHRA 4RAOA 4OQYA 1X8KA 2QL7A 3ER6A 3JVEA 5AKHA 2IUFA 4UUAA 4REQB 4EHKA 2O8CB 2V97A 3KTOA 2V74B 2YWXA 3U80A 1GAQA 4X24A 4CKCA 1KK3A 3HA2A 1INLA 2J0QA 5JFGA 5U4QA 1JWBB 5ER6A 1U3UA 5TVGA 3T1YB 1EB8A 1O5TA 2QP4A 3IAS1 3INNA 1KE2A 2UUBB 2X9GA 4TYNA 3LT1A 2WP8J 1KEEB 2OFWA 3IESA 3E58A 5B53A 1YA6A 1JWLA 4M1MA 1MLDA 1R6AA 1W36D 1EBUA 4DMLA 1ONPA 1ESNA 2MYPA 1F6DA 4R0NA 2ONKA 1D4AA 4Y2HA 3RWBA 1IEWA 3ASYA 2HJVA 4DMFA 2VC2B 3EZYA 1YRWA 4BNJA 4B09A 4KR0A 2AI2A 2HXYA 3B9QA 1T2EA 4UUQA 4GX5A 3VPDA 3ZDBA 3FOFC 2GCOA 3GRYA 3FNHA 2P6RA 5JISA 3GFTA 3BXHA 2FSVA 1RFGE 3R6DA 2NU7A 1M1YE 2I55A 2NU8B 4HGNA 5KX5F 4HQNA 1DINA 2FJPA 4U7FA 3OMLA 4AN0A 4ZZIA 1KO5A 2CSXA 1SXPA 1THTA 5F3DA 2A4KA 3ORYA 1U7UA 3TQRA 3V1MA 4CMIA 3RB8A 1X3LA 2VCYA 3C45A 4V39A 4I50A 3L8FA 4BMYA 4XWKA 1TYZA 3NEYA 5EP4A 1H4TA 1PR3A 1VKJA 1XVVA 2Q4BA 1H2WA 3GDWA 4YCJA 2ORVA 3M4JA 1BS1A 2DB3A 1IZ9A 3E35A 3JD3A 4MRPA 4RW0A 1RI2A 3UHFA 5L4SA 1J1IA 1VMDA 1U8XX 3D7NA 4AX4A 2FPPB 2IGTA 1FMFA 1I4EB 2PYIA 3E3AA 3LCCA 3I73A 1VI2A 4N6NA 1TAQA 3LYHA 4MR9A 3UAOA 1ZN8A 3MT0A 2JFOA 1ZOLA 2WTUA 4AG3A 4DLBA 3EDQA 121PA 2A0KA 4R84A 1KO1A 3C85A 5T57A 5E8JA 5EL0A 1JA9A 1TEZA 2IPAB 5J2UF 1EG2A 1KIMA 3HCWA 2I2DA 4Q02A 5IRCD 1ZAKA 3LK7A 2P2LA 2Z8XA 1GTJ1 2DLCX 1M8FA 3OCJA 3EFEA 2WM8A 1PD0A 1DZIA 1DT3A 3P0IA 3TW8A 5TQ2A 5JROA 1FMLA 4BN0A 4P3OA 1VG1A 5FBHA 4MVCA 1RU3A 3DE2X 2O8FA 1DO8A 2Q6KA 5D1HA 1Y5LA 1US8B 3I9FA 1DKMA 1YXMA 5BV0A 1U7XA 1XFDA 3KYIB 3GP8A 1LDNA 3FRJA 3TL3A 3B1KA 3K09C 2XGSA 4MHTA 4HK4A 3D0KA 1EVYA 1PU2A 1VPLA 2XDYA 3EODA 1MHPA 1F5SA 1QX4A 4GOOD 2HJWA 3M9WA 3PE4A 2ZR7A 2C0QA 4XE5A 4WLEA 5EJ2A 3VO8A 1NVVR 5AUNB 1IY0A 2CLFB 4XGQA 3DUFA 1XTIA 4ZVTA 4TTPA 1GGHA 1Q1AA 1XQ1A 5JAIA 3IPAA 1U6IA 2CKDA 2YRWA 4PSVA 5JEEA 2W22A 2A9KA 1CETA 3TJZA 4HWTA 1GAJA 3M1YA 1TCAA 2OD2A 3AFMA 4HAUA 4O5OA 3K53A 1IHUA 2H51A 3RK0A 2EF0A 2GTHA 3GZJA 2VCHA 4OKSA 2BPOA 2ZUFA 4HRVA 2OV6A 4J90A 1V43A 3KSZO 1Q50A 2QRZA 1I5OA 3KNZA 1K97A 5KJFA 4NJEA 2ZAMA 1TCCA 3IAS6 5BR7A 1TM5E 1W35A 4NONA 3K9GA 1VCNA 1ZL2A 2OQVA 4QARA 1XYYA 3PGMA 2Q3JA 4JBYA 4BVKA 1G5PA 1DBWA 3FPBA 5FBZA 2FH5B 4WV3A 2EKQA 4Q3AA 4JSYA 1MJNA 5DW3A 2QX6A 3V6MA 4EG7A 1RC8A 4MVJH 3LE8A 3N2GA 5HE8A 2F3UA 3FZYA 3QEKA 2DBQA 1NU6A 4YRRA 1VLHA 5C5IA 2H1SA 1DBRA 2P27A 4QVIA 2X1MA 2PLWA 4B3FX 5EKTA 2OAEA 3ELWA 5BNWA 4RFLA 1XMQB 5E1OA 4K03A 4U3JB 2CT8A 5FBLB 2OOKA 4YVFA 2JCSA 2P3QA 1D09A 1SMKA 3QFRA 1ZVKA 2QUIA 2V96A 1GKUB 2QZJA 3DBIA 3QVSA 3RRFA 1E9RA 4I55A 4GOND 3FCOA 3MINB 4COOA 3UJHA 1CJMA 2BFWA 3P5SA 1N36B 1N0IA 2PXHA 1QU3A 4HGOA 1P33A 2Q27A 1B0AA 4OLJA 2OESA 2C83A 4PV7A 1Y6GA 2IC5A 4TMYA 1U99A 3AXTA 2NVUB 1ODKA 3WK9A 4WOPA 4C2AA 5L51A 5L40A 2NZWA 3CNHA 5JMPA 2ZJAA 2QL5A 1KQPA 3MRVA 1S1MA 3IUEA 3NTOA 2APJA 4R9NA 2OBXA 2RGAA 5CM9C 3TOVA 4DPKA 4BQNA 1XN4A 2O2YA 1H2XA 1XMSA 2E85A 2GN4A 2AYZA 1RWMA 4LDRA 4E5VA 2AB0A 5BN3B 1VE6A 1BQEA 2E7ZA 4HHEA 4MX8A 5EHGA 3RS0A 2AOTB 5HJ7A 1E4OA 1KJYA 3DMGA 1PNTA 3U1TA 1BIFA 1IM2A 1C29B 4EUFA 1Z6PA 2PJZA 3WWZA 3ZI0A 1GD1O 1LSJA 2FMIA 4DMCA 4F5ZA 5ULLA 1W1IA 2UDPA 1Z5UA 2Q07A 1JKJA 2NADA 4DNOA 2X6TA 3Q3HA 6AT1A 1VB3A 1T8WA 5JPCA 5C35A 1SVOA 4IKOA 1Q2XA 1IPFA 1IZ8A 4D9GA 3D4LA 3L04A 1N7JA 3L7MA 5H5JA 9GPBA 2E49A 1QQ6A 2ATVA 1BA2A 1KRWA 1Y42X 2WTNA 1EJ0A 3PIDA 3AY0A 4YCDA 3RANA 2Y77A 1E2NA 1WZCA 3NNNA 1RPZA 3N8DA 2AFIE 3OFSA 3GMDA 2FQ1A 3OZWA 2IX3A 1H23A 5TVKA 4TXLA 1MRZA 1BWQA 1DX6A 1OT5A 2G28A 3Q9UA 5MGNA 5IS2A 1OA0A 2XHZA 1C4OA 2AJCA 3UWDA 1FW8A 2R6DA 1PDWA 1I2AA 2IEDA 3ETJA 2JI4A 1S2DA 4MA4A 3OAAA 5ICEA 1W5BA 1O5OA 3GLHE 4X1YB 5K51A 2IZ7A 2ZWAA 2IHNA 3LTNC 1Z3IX 3QPCA 3NYRA 3CSUA 1EUCB 4GECA 3FGZA 5E1MA 4Q6BA 2IYSA 4W8GA 5FYDA 1MORA 1FNDA 1FQWA 1Y5RA 2R8YA 4TMVA 1UPUA 1C81A 3CRVA 3O93A 4FE3A 4S1VA 1RXVA 4AY5A 3I76A 1W73A 5G0VA 4JQZA 2WRZA 1Y1RA 4DYDA 5E7IA 3ZGZA 2WLSA 4S0XA 2ZAGA 2WBLC 2RKOA 3DP9A 5K4AA 2HRRA 3JR7A 5BOSB 2PUWA 3KQKA 1R3UA 2R8BA 2Y1DA 3F5DA 3L07A 1GWNA 5IEBA 2GPSA 1ISIA 3K73O 1CVLA 1E61A 4XB2A 2PKXA 3K35A 3MUFA 3A05A 1OWPA 3GJ0A 3C8DA 4RHCA 2BT4A 1FSGA 1M54A 1T6NA 2JZNA 2W6CX 3D64A 3GG2A 3ZWXA 4BOYA 4O0LA 3DQZA 4HUJA 2PU7A 3H1TA 2B99A 2G72A 1C7IA 4G1VA 4KDFA 4CM5A 1FXUA 4YP1A 2NO6A 4BVJA 4P5EA 2AH5A 2CMGA 3H42B 1QC5B 3WGGA 4RHEA 2M1ZA 1PL6A 2DM6A 2KLHA 2Q3LA 3K1AB 4LOKA 5ALRA 2ZJ5A 4OLBA 2CNLA 3NRBA 4PCUA 4WPGA 5HCIA 4PC7A 3ZVRA 1QVAA 2HQBA 3HWSA 3T8YA 3N6XA 1IH8A 5ER9A 1B74A 3QE2A 1MGOA 5DGTA 3FCYA 2EG5A 2VPYA 2ID7A 2GDZA 4FXOA 5JC8A 3TG8A 1O9HA 2DJIA 5KOHB 4HCJA 2YMMA 1FOEB 4Z3DA 4DANA 4URVR 3KHUA 4LJRA 2J3KA 4XA8A 5C8YF 1MVOA 2ZPUA 4MB2A 3IBCA 5JVDF 3L06A 2NTYC 2BE9A 4XPZA 3LFHA 2C2BA 4CLOA 1B2LA 3FBWA 4Y0NA 3UY4A 1YR7A 1XZIA 2X1HA 2IY8A 1FLVA 1TU3A 3U44A 5EXSA 2O2JA 1FTGA 1QUFA 2RBEA 3I5MA 3NHSA 3QKIA 4IMIB 1JDZA 2SICE 1N9ZA 3R24A 1W2HA 3BK1A 2GB4A 3RFVA 5CAEA 4ZOQI 5K3EA 2VQFB 2V6JA 3VAZA 5C80A 1G2IA 4K28A 3OZCA 2K87A 3G9QA 1WIWA 3GLGB 4TV8B 3PDUA 1U9IC 1ZRSA 3EXFA 4UUOA 3EPHA 2HBRA 4RYDA 4I50B 1AIPA 5FTWA 4AS2A 4YWHA 4D02A 1GU0A 1P45A 2VYCA 4JBLA 3GEMA 1E1DA 1XP5A 1MJ5A 1Q12A 2ZYSA 3QVKA 3UT5A 5JNSA 1OXMA 2V5VA 4FCCA 4C1NA 4EGFA 1S3IA 1LNQA 3SEAA 4TTQA 4ZDJA 2FOIA 3TQQA 1DQYA 1EBBA 2CD9A 1OFIA 4RH0A 4U7JA 1OFVA 2QM7A 4QDZA 2W7TA 4IVQA 5HKOA 3ORQA 2B83A 2ID8A 5FPSA 3HI4A 4YAEA 3PITA 4XIFA 4DSAA 1NQAO 1IY2A 1DTWB 5I4IA 3U6BA 1A04A 1B6TA 4OQ4A 5FADA 1I3NA 2PZGA 4TV8A 2E1RA 1BU8A 1KZ4A 1UQRA 2RI1A 4HUQB 1E1MA 3WQBA 4O59O 1TM4E 2J87A 3AK4A 3QX9A 4LBWA 4QUGA 5I7FA 1Z4OA 4E6EA 1DXOA 2OYCA 3CUKA 2GDJA 1SKMA 1S89A 3D1VA 4RJJA 2C7VA 3WX0A 4QWMA 5K8JB 3PXCX 1VJGA 3TZKA 4YGYA 3LUPA 4OGKA 3NB0A 3B8EA 1YS6A 1IHXA 2ZIGA 4Y2XA 3IQEA 2VTEA 3BWYA 5F33A 5B58T 4EZBA 4ZHQA 5LDDC 1D1SA 2X3UA 3UAXA 3DJFA 4EOGA 1J00A 2B8NA 2W8BB 4ARAA 3ZWYA 3MJTA 1A4RA 5LC1A 3HYTA 3TOCA 1D6NA 2ZAIA 3C7DB 4B4OA 3UGKA 5KWSA 1V96A 4KI7A 5FPQA 5MGBA 5KKCA 3KPVA 4CKBA 5KBYA 2X3YA 2YJ5A 5A0TA 2XE6A 1O0CA 4NMWA 4BX2A 6CHYA 1WMFA 3U49A 2HWYA 4F45A 3KT3A 3WLJA 3RIXA 3EOAI 3CF6R 3WGTA 3GGOA 3WLPA 1KL7A 1Z6QA 4EO7A 4S35A 3NVKI 1JYFA 3TJRA 3KKOA 1QIDA 3DPUA 2ORED 3E7PA 3E9RA 4RQAA 1W88A 1MA3A 2EKZA 4RSGA 5EPUA 1UBMS 1P3DA 2Q5FA 4BKOA 1JH9A 1ZMXA 1NT4A 1WAMA 3FLMA 4BV8A 3G2JA 3T1QA 4CUKA 2H7YA 4PLWA 4O4HF 1Q20A 4CMEC 4OI4A 5IULC 4AIIA 3WHPA 2LRHA 3ESBA 3UXEA 1HT2E 1D4FA 3WYFA 4GFDA 2JD1A 4M7OA 3BB4A 5KSZA 4U7GA 3DHWC 4ZALA 4QU0A 3T6KA 4KRGA 1KDTA 5JI3E 1H0KA 3KTFA 4RL6A 4C2UA 1QCYA 4EDFA 4S1NA 1LX7A 5AVTA 1NHWA 4IDDA 4CDMA 3TB4A 5DEIA 4TYWA 1AKQA 1P6UA 3PCXA 3UN1A 2FZLA 3WYBA 1XCJA 4FR5A 5BVGA 4UU7A 2BR4A 4KI0A 1C1YA 1FQOA 4MUAA 3AVPA 1J7JA 4JC0A 4R2MA 2Z1MA 3S5UA 1SVUA 2WV7A 1FSFA 1ZGBA 1QLHA 3IEPA 3ITKA 4JEIA 1R12A 3LBNA 4L4YA 4QUJA 4KQ2A 1JKIA 1PKXA 2ZYGA 4OM7A 5A71A 3GLFA 1AK9A 4CTJA 4TVKA 4BNYA 1E2HA 1A7UA 1DQZA 2P4SA 3C97A 3GJXC 1CEEA 2DQSA 1QIIA 3PQ7A 2YIJA 5SICE 3HBAA 4REQA 3W1EA 3NTQA 4FSDA 4ER3A 4GOJA 2R5NA 1IFXA 3FPEA 1GPBA 1O6CA 3ENZA 3Q6MA 5E2BA 3FSGD 4IXMA 4J7AA 2FN7A 4H1HA 4LY0A 5G0TA 2MDTA 1YD7A 1L4YA 4OJNA 1SEVA 3EOZA 2H4HA 1P2SA 1PO7A 3OETA 1T9GR 2R11A 1MH9A 2HY7A 4FFDA 2ONZA 3EZLA 4IFIA 4IHJA 4GPTA 4XGIA 4L3VA 4EI8A 3OJEA 4IL5A 4EUHA 4F1JA 1B16A 4B84A 4PVDA 5KIAA 1BDMA 1Z07A 1E3TA 1T6BY 4RMJA 1IQRA 4OQMA 1P3Y1 2PYZA 2RGNC 2Z2JA 4MI9A 4XEHA 1P9WA 3V4PB 2H5IA 2C61A 3KXKA 4KIFA 3DHEA 4KWTA 3HXLA 5CW2A 1WG8A 3NHBA 5I6DA 3LUDA 4I4CA 1B8VA 3O2QB 4G65A 1BYUA 4YRIA 4LXGA 3NNSA 4MV7A 1K86A 1U7ZA 2Z4TA 3DF7A 4UTRA 4NEHB 3ZD8A 2VTBB 1O3YA 1QR2A 3KE8A 1TO2E 2EFDB 4U39A 1A5AB 2BEKA 4OM8A 3M1IA 3W1VA 1G5QA 1GFWA 3KTDA 4BWFB 3ROZA 1EFDN 3KELA 3QXXA 3HSSA 4FKMA 2W6ZA 1HURA 2JHPA 3FVVA 7GPBA 2FEAA 3IHLA 3VU3A 1WOMA 1UM9B 1A27A 3AY6A 4MSUA 1XTVA 2KE5A 3MT9A 1EFHA 2IEGA 3H2BA 2TRSB 1LDGA 2IU6A 3EGWA 4HLUA 4MTCA 3VHQA 4DRZA 1JIVA 1QH8A 2VDJA 4I19A 4DLRA 2NIPA 5A6SA 3BZWA 2X40A 4FYJA 1OBOA 1I3OA 4NV3A 4D3YA 1ZQ1A 2DCUA 4W9MC 1V16A 1H4QA 2IPLA 3DDWA 1RZRD 2JF0A 2ZUSA 2OPBA 3CGGA 4OJKA 5FTKA 5BW6B 3UO8B 1Z4JA 1IZ0A 1CB7A 1YQQA 2HBQA 4IRXA 3GFFA 2WSSA 5EZ6B 4C2TA 1EFTA 1BFUA 5DOZA 2NYVA 4YDQA 4Y2YA 4BVHA 4KPFC 3TGLA 5JNWA 4EBBA 3JQ7A 3KG2A 3O2SB 4BP8A 2JGAA 5ITZA 1KZYC 1P7VA 2R1ZA 1SCKA 4LZNA 2CD7A 2TS1A 5AUQA 2Y71A 5H59A 4QUEA 4LXHA 4TV9A 5BUCA 1AZWA 2WZCA 3R0JA 3I5AA 2IY9A 2YWGA 2ID4A 3BMNB 4JCOA 4R1UA 2MT9A 1RXWA 1T9ZA 2X1VA 4IXNA 1XT6A 4AN4A 2YV4A 4DEYA 1JQKA 4P92A 1CUEA 3QVUA 4Y2RA 2JDIA 2GFQA 4U2BA 3HUUA 2GWHA 2P5YA 3W7BA 2AQHA 2MYUA 4HFRA 4GOXA 4E2XA 3LLCA 2V03A 4TKLA 1Z33A 221PA 4B6GA 3UXMA 5AK5A 4G1UC 1R9NA 2QEQA 1T15A 1SO8A 1SXGA 4HS4A 2JB9A 5ALVA 4GGOA 3R9XA 2B20A 4DV3B 1DADA 1Z6YA 5E38A 1O4WA 3D7LA 2H7VA 2UXCB 2F55A 4R68A 4M3NA 2ZIWB 2BISA 3V9AA 3GLHA 5EPEA 3OUZA 3STXA 4FGUA 3KAPA 3RIMA 4B48A 4KXVA 4LY6A 2QZ9A 3SAJA 3Q11A 5L7WA 1VKRA 1MX9A 3ROEA 3A26A 2FW9A 1R5OA 2VZLA 4BPRA 4EB3A 4D81A 3BXFA 1ACLA 1GGJA 1CUDA 2LCQA 1CFJA 4KXFB 4D5EA 4K6MA 4HP8A 5K3BA 3THYB 1DFGA 2Q1UA 1IHYA 3WNQA 4UBLA 4YHBA 3HJRA 3I8SA 2IK8A 5GZ1A 3B3GA 1ODCA 1X9IA 1RJFA 4TTRA 2D5AA 3FKJA 4B0PA 2R68A 4HDMA 3G8CA 2FDXA 5SYAA 2CXQA 3S99A 1F2DA 3MT8A 1ODFA 3OEED 3PPVA 3QOYA 4LGVA 1UZAA 3S28A 2XRMA 1K6IA 4A6XA 3DAPA 1KARA 1TA9A 2RI0A 5JI2E 1E1RA 4I55B 5L3SA 1X1SA 2VF4X 5C81A 4GH5A 4MVJP 1T6YA 3L0ZA 3OM8A 1GL3A 4GKJB 4KE8A 3NAZA 3NBKA 5DCUA 3C39A 1NI4A 1A7JA 3QTLA 3QU4A 5K4HA 4F06A 1NUQA 3GWZA 5BWMA 1PR9A 5IAJA 3IIEA 3GHHA 3G9XA 3TTXA 5BQPA 1JEEA 3KM0A 4DWJA 1U2RA 4NR0A 4MS4B 5LN1A 1PKEA 2XMRA 1UQTA 3IRUA 4B2YA 3TBFA 4JVNA 1DWOA 4QYWA 2G04A 5IVPA 1KS2A 2KWIA 1JDNA 1N2GA 2C98A 4IVNA 2I2FA 3TTUA 1QIHA 4M76B 2PXXA 1QAQA 2ZUDA 2X8JA 1C0LA 3I3OA 3RQIA 4QGSA 1FX0B 2LDXA 2X6QA 4PYJA 1N92A 1YC5A 3CVWA 3SR0A 3GWGA 5I9SA 3VR4A 1LRJA 3GBPA 3H8SA 4CJXA 2P6NA 4RVNA 2V5AA 2BFDA 3SIWA 4BO2A 1IJKA 1TRKA 1LY1A 2F00A 4FIZA 4OSOA 5CDHA 2HOQA 2I4MA 2PKEA 2VT7A 4UEKA 2FR1A 3D4BA 4DV5B 3V55A 4FLFA 2IYQA 3FZQA 3I9KA 4ZI2A 1JNXX 3IIIA 3TS1A 3D6NB 2QR2A 4L0DA 3QFCA 4MLCA 3OQHA 3JX9A 4KFTA 3QX8A 3GFSA 4OREX 2W6PA 3F47A 3IOMA 3A9UA 1T0HB 4XWGA 1YIOA 1KIFA 2X23A 4B71A 1DE0A 1NW6A 4KNVA 4QOIA 1LS1A 4ZK2A 4XUCA 2GXSA 5TXGA 4H1VA 4DGQA 1IQPA 1MJGM 1Z5NA 4HFNA 3ODPA 4JJ6A 1E3IA 5GY7A 3V1UA 3C6YA 3CNBA 5K0JA 1SU6A 2C8KA 5ESRA 4BLUA 2B7CA 4RA9A 3QEJA 1T0BA 4O1IA 2WYOA 3AI3A 2XEXA 2YFQA 1CB0A 1MA0A 1VRVA 3DSRA 3QXCA 5JJKA 3H18A 4K40A 4AJPA 2BFCA 3RYIB 2NSYA 3HXPA 1M73E 3FNQA 4JT2A 4WD3A 3V33A 4BZZA 4NPAA 2WWYA 3GI1A 5SY9A 1KGSA 4L9WA 3BGSA 2PMFA 1CQJB 1JAHA 1I6MA 3PDIA 4L4ZA 4F93B 2BF7A 2ACEA 2VPIA 3FYUC 3G5LA 2QY6A 2NT3A 4G1FA 2PFKA 1WMSA 3TLJA 4JMLA 4RLFA 4HUTA 1JSXA 1TJ4A 2XOEA 3BHIA 3BKWA 4K8RB 2WU3A 3LKZA 4QXMA 1UXHA 4ZT7A 4LKRA 3RYTC 4CCWA 4CQMD 5FO0A 2FZ4A 5K8VA 5EWMB 1YU9A 5FF9A 2DLDA 2GHQA 4AICA 3OD1A 3R76A 1V6CA 2YJZA 4YC7A 4HNTA 1CUXA 1ZO8A 1UBKS 2D4HA 3F7TA 3FVTA 2JJ2D 2I7CA 3O74A 4GPIB 2W90A 1SVMA 4K6CA 1SZCA 4LDNA 1ZMBA 4TUYF 4Y30A 5DNEA 1WW8A 2DGDA 3A1FA 5FWYA 2OPHA 3MSCA 4M8KA 2I91A 2EW1A 1W93A 1WPRA 2C78A 2OFPA 3QLEA 3QU5A 4JU9A 5CVUA 3NJRA 1AZTA 1TT7A 2QN1A 1WF6A 2I6XA 2RDMA 2W6ID 4D96A 4R1LA 4A8HA 2AVDA 3RVDA 5DHAA 1UMDB 5FQOA 1KJNA 2XCIA 3BVPA 2Q0HA 3VYUB 2WDZA 3C3PA 2ZYWX 3ZKWA 4AS3A 4OX9B 2Z2XA 1W0KD 3IPLA 1SQFA 2Q3FA 3ACBA 3IBFA 1SVLA 3KVOA 2RCYA 3D1JA 4MP6A 1IBCA 5IU6A 2CYCA 1R0SA 1X8LA 3CT4A 3ZU5A 1F2UA 4D0SA 4RLQA 3JALA 4YMHA 2H63A 3R8FA 2EFHB 1IOLA 1L5FA 4ESOA 2R96A 1US8A 2F64A 2Q4DA 2QW8A 4HNAA 1JG7A 4J0DA 3ZGYA 4E21A 4RY8A 2CVZA 4TYMA 4DQXA 3L8MA 1OC2A 3DOJA 1E60A 1UFRA 5ADVA 4PLVA 2V3CC 1N3LA 2I1WA 1X38A 2WUFA 4IFBA 3ZBPA 3EJ6A 3RQSA 1HE4A 2ZDHA 3I0ZA 4RXMA 1E20A 1EVKA 3OAAD 2A92A 1OBFO 2ZW9A 2IJGX 3HBNA 4C0HA 3VR4H 5DNYB 4GBJA 1TIPA 1Z68A 3WICA 1Y9JA 3AV0B 3CLVA 5FWYB 3S2IA 2R6CA 2JLYA 5CT4A 3L0BA 5KZMB 4YO8A 1J8MF 2HMVA 1JG6A 5FA8A 3M89A 1R9JA 2WTAA 3VBCA 2O3TA 5LP6B 3ZZUA 5G1PA 2LD4A 4PTYA 2XRYA 3DCYA 1NR5A 2PX6A 1KYWA 2P9FA 3OY7A 3DLAA 1A8PA 3T3DA 4MR7A 2G6TA 4UDYX 1NZJA 3CLUC 1KPHA 3KEFA 4DS3A 1L3CA 4NCAA 2FPXA 1KVUA 2V1UA 3DPSA 4UDNA 4EJ6A 2F1KA 1K98A 4G8CA 3Q12A 2JIPA 2XI4A 1XEWX 3KFVA 3MLBA 1FW6A 1HT0A 2D5CA 1MV8A 1H93A 3CZ5A 3L4BA 3SS9X 3M83A 5C5EA 1D9ZA 3NUQA 1RRMA 4UBNA 3JD4A 4S12A 3R7AA 2PD4A 5FNZA 2H16A 4I9HA 2PZKA 2YC4C 2P5UA 1IRXA 5CUQA 4Z7JA 4YUAA 4JYCA 3NTUA 2HRZA 3ROPA 4NCXA 3Q72A 4KBYA 2YDXA 4N54A 4OUKX 3SZRA 2FPOA 3B1VA 1ZK2A 1RQXA 5K0LA 1Z5OA 3BJEA 3AV3A 1YQEA 1VJRA 1SHKA 5CFLA 2OSVA 4Y0AA 3UHJA 1TJ5A 4IKEA 1GNVA 1VYUA 4MJXA 1WKVA 5CVTA 3R5XA 1N2EA 2ZT5A 2XT0A 3FTPA 5C9ZA 3ND6A 5DYIA 2GPNA 4G24A 2D1RA 4B83A 1B3RA 1JJFA 3B3JA 4GKAA 1XJQA 3X2FA 4D0RA 4D26A 3JRXA 3MWKA 4CGZA 1QKKA 3C1UA 3AFNA 3TXYA 2PH1A 4HPXB 3MB8A 2HT1A 1AJEA 3ELBA 2ZJ1A 3GCZA 3QYAA 2QTWB 5DDIP 4Z99A 1E5LA 2EKPA 3IVXA 2G8LA 3O8LA 3VISA 2D7JA 1SC3A 2Z83A 3M6LA 5LD2B 2XUAA 3BRQA 1I7LA 2IFTA 2WNHA 3GRPA 2CZCA 5BV8A 2YFYA 4QU9A 4FK8A 4HB3A 3QKUA 3W9UA 3ZCTA 1WA5A 3PXDA 1QIJA 4LJ5A 1KI7A 2HFKA 1P2GA 2QXUA 4OXRA 5HP4A 2J1LA 2WTXA 4G8DA 2QRQA 4D42A 1SOUA 5KTSA 5ALPA 5TB5A 5K2OA 4O2LA 2OG2A 3TM4A 5T4FA 2C96A 2QMUA 3DBLB 2EZ9A 3FJ1A 4MRMA 2ERXA 1XKQA 4ZC1A 3ENNA 2KI5A 3H5LA 1GZ5A 4ZDIA 1FU7A 3KKPA 4R8MA 3JQGB 1TRHA 2NX2A 2IIPA 1XZQA 4W5RA 4D8YA 1LBEA 4UFOA 2XDAA 1CCWA 5JCJA 3TR5A 3VZBA 3OA2A 1G8FA 2I2CA 4EY5A 4O08A 1HSZA 1CVIA 1G7TA 1NM5A 1XNRB 1PJSA 4HR7A 5IARA 2R0QC 2BTEA 4G5SA 3M5CA 5A9RA 1NAIA 1GOTA 2VWHA 3ETGA 2QM0A 3LQ1A 4DILA 5LKAA 5G0WA 2GPAA 4HT3B 3OJ0A 1F0YA 1YK0A 3AKYA 3QNMA 2CUTA 1SCBA 3HUEA 3LQRA 5A6VA 4UNNA 2PSSA 3KFXA 2AWOA 3BXXA 3PB3A 4LF8B 2XVXA 4RVGA 4DBZA 2BUAA 3CGWA 3WYGA 4NEGA 3NR2A 4YMLA 3L7JA 1WXFA 1XHLA 3B2EA 3LYLA 4KE6A 1N1MA 2F1HA 3EXHC 3L92A 3MIZA 1KFJB 4PCLA 1TAGA 3GLGE 2WOOA 4TLBA 3JZFA 1P1IA 1TA0A 1Z5VA 2FZWA 3CG4A 3EW7A 4Q3EA 4X94A 5DF1A 2HGSA 4POAA 4ZP1A 3ZNOA 3CEAA 1ZUNB 2JVJA 5LIPA 5EHQA 2NSDA 1U0TA 2ZGVA 3I1JA 3F4BA 4DC0A 1EBFA 3FI9A 3ILXA 4Q24A 3SXUB 4UBMA 4EHFA 2P11A 3K2QA 4N47A 1M34B 2Z5FA 1AZLA 3C41J 1D0VA 4M4SA 1FX0A 1TM1E 2BFMA 3FCUB 1XL1A 2PL9A 4NZNA 5HJ5A 1L7OA 4UMFA 4MS1B 1W88B 4JJIA 3SZOA 1QP7A 4E13A 5T3YA 4GM0A 4TKMA 4HQOA 2QX7A 4F96A 3P0JA 2GVDC 3ONNA 1I6KA 2BMWA 1P4JA 4TVBA 1Y3FE 3RUDA 1MB2A 1TZMA 3A1TA 1G5IA 4OHKA 3SBOA 4RESA 4C9BA 2W71A 3KQHA 1FU4A 2FU5C 4F3TA 1T29A 2JAWA 3AY3A 1WB5A 5EJ4A 1P0QA 3UOAB 2XDQB 3SG0A 3NX4A 1WXGA 4IOJA 3DYVA 5TF0A 2YV1A 3ZV5A 2QP9X 3HR8A 4FZJA 1EFVB 4EATA 4HDQB 1EWRA 3AP2A 5EIFA 1I2MA 4L8YA 3G79A 3PE6A 3DTNA 3I61A 4JP3A 1U7PA 2IE0A 3MTJA 3PNMA 4GAEA 4ZQCB 1RYHA 2PGIA 5ITZB 2VLIA 4QD3A 2ZJYA 1BMTA 5A9SA 4RA9B 4ZAXA 3ED1A 1CP3A 2A14A 1E32A 3M6VA 2DPHA 4L4XA 2VN8A 2PS0A 1JB1A 4II7A 3UWSA 3W9BA 2ZUVA 3W6UA 4AWAA 1ISRA 4J0GA 1QFYA 5H3CA 4TKVA 2JD0A 3NFRA 1FP7A 5G2OA 3FUXA 3CPSA 3EAGA 1JQJC 1U5BB 1ZJZA 3ITEA 2UZ0A 4IGAA 4EARA 2D2VA 2ETXA 2PA0A 5HKAA 3ILVA 3T3NA 4UU1A 3GA0A 3FDFA 4FU0A 1A7KA 4DLUA 2SHKA 5EMNA 5ARDA 5DPMA 2PT7A 3H84A 1U2PA 1K4KA 2I78A 2OCLA 2VSYA 1ZMRA 3O2NA 1YF3A 3FWKA 4Q18A 3W78A 4ABYA 3PI6A 4XB6B 3IE0A 1HBJA 1TMKA 1UJMA 1JW9B 2EJBA 3ABRB 4MW0A 1U3VA 5LP1A 5ALDA 3A3NA 4DFDA 2JH9A 2ORIA 3ESYA 4UNIA 2Y66A 3QUQA 4R1SA 4YQFA 5AKEA 2QLNA 1L4MA 2PX0A 3EASA 1GCIA 1PW7A 5LQKA 4ZVMA 4BECA 1GV1A 1ZJJA 3ITNA 3R3WA 4YA6A 1OLSA 1NOJA 1VHLA 3BB3A 1O9GA 4US0R 3VJRA 4QBHA 3K0CA 4QOSA 4WXYB 4MLPA 5EJGA 3RR2A 2GF9A 2OHJA 2OORA 2WKWA 3NVMB 1E2QA 2FUG1 4HH3C 3FM9A 4PHCA 4Q9DA 4U9UA 3SMVA 2IHZA 3DBRB 2CMFA 2HJGA 3SHQA 3UVEA 3TUZC 3TD6A 4K7JA 4QDUA 1DC7A 3IV7A 4C89A 1XPOA 4LJ7A 3SIPA 1RWKA 1EP9A 1K06A 3L6OO 1K7XB 3L8EA 1H9BA 1E9EA 5EVJA 2PX5A 3ZJ5A 3OI7A 1R37A 1Z08A 1QP4A 1CUIA 1Z37A 4W1PA 1JA1A 3GPDG 1Z56C 2UUCB 1RLJA 3W2GA 4X61A 1PJZA 2EWVA 5LQSA 4HBZA 4X44A 1UZNA 4BC0A 3E5RA 3KAJA 3N2ZB 1IPEA 4GPBA 1X1CA 4MWSA 4N40A 3AR9A 4RIFA 4WT7A 2ZB3A 1JEYA 3GLQA 1ESZA 3P7MA 4UEQA 3WLQA 3U7GA 3N28A 5B1HA 3V4ZA 3VSCA 4I5EA 3R0QA 4QPZA 2WY2D 4B2IA 5KDDA 2N46A 3PDJA 4YXWD 3QF4B 4PINA 3WKCA 3ANTA 4JJEA 3VJLA 1DVRA 3FOWA 1RAIA 3AHDA 1U3CA 3HDYA 3W0LB 1JE0A 1Y5IA 3H5WA 3TWOA 1E1CB 1XP8A 5ESDA 3WRXA 2IBTA 1HV8A 4CMBA 3A7EA 1U9JA 5JJLA 3PX7A 3BDVA 2Z6QA 5ALZA 1H5QA 1NULA 4RVOA 2Q4EA 3E3LA 3OPQA 2CMHA 1KERA 2PS9A 1R16A 4PSKA 1JHPA 2CLEB 3LUAA 3Q40A 4PG7A 1MN6A 3DVRX 3K8OE 2ODQA 4GXRA 5C8VA 1EM6A 1MU0A 5KMGA 4FFRA 4X7PA 5FCDA 3GGDA 3GT0A 3DOCA 5DGCA 2ZBEA 2PFGA 2YZ2A 3WSWA 2ZVDA 2DLNA 3KWLA 4IIJB 4N7RA 4CEIA 2C2OA 1EK2A 10MHA 5HQ3A 1Z6TA 2O3RA 1JF8A 5CGQB 1AK2A 3LBAA 3ROTA 5CDTA 3GN1A 2C7QA 1KQOA 3MQ2A 4B7XA 1IN6A 4AC9A 3DHVA 1X7YA 4OMUA 4KN6A 4EYOA 1BXRB 2FUCA 5K0FA 1UOQA 3RG2A 4UHBA 3RC7A 4TV8F 4LFBB 4MYCA 1K6EA 3A1SA 4HDMB 4RORA 4TLAA 2H7CA 4JVSB 4BO0A 3MLAA 3A6LA 1V5GA 2VQSA 2ZKIA 3I6QA 1M5UA 5BO5A 3T41A 3W5SA 1PR2A 5KHLB 2AN1A 2YIDA 3EVDA 4RTPA 1MR3F 4Q7MB 1XLTC 2F1RA 1SOAA 1C5KA 2VHZA 4PNEA 4J1NA 2J6HA 3AGPA 1BS2A 4HB2A 2QN3A 1J90A 4ID3A 1BDHA 3WGOA 4UCXA 1Z45A 3OOHA 3HY3A 4Z2YA 1JAIA 1CDOA 2IXBA 3AF4A 3K9QO 1QPGA 3TUIC 2VZ9A 1RCFA 4J0KA 5IBRA 3KS9A 5TGZA 5GONB 3RODA 4B3BA 5IUNC 5JXIA 5HTOA 2Q2VA 4QGHA 2C4WA 5I51A 3QVJA 2OE2A 3FYSA 5EUQB 1DBSA 1PR4A 1SCAA 3ZIUA 5IK2D 1U9CA 4TS1A 1FA9A 4XD7D 4WNCA 1QO0A 5AHXA 5C7IO 5AM0A 4KVFA 2BH9A 4KLRA 1EPUA 1G8MA 3EPKA 2HJ9A 2F7SA 1JRLA 3CW9A 4KO2S 3U4HA 1LLDA 2XJ9A 5J4KA 4R7ZA 4HAOA 1EGAA 1T1SA 3GA5A 3OHSX 2IF2A 3A4TA 5LB2A 1HRKA 3Q3EA 3P26A 1UT5A 3ZE8A 1ZA2A 1SCQA 2H06A 2DC1A 4ZREA 1GPUA 5E8RA 3C70A 3TQTA 5ALUA 1K8XB 2HUPA 3EMDA 3UMCA 2JC3A 3M3DA 4INPA 3MWJA 4N5MA 4O4JF 1FSSA 3L43A 3FYHA 1ZVMA 2M6RA 4L8VA 3E3OA 4JSTA 3V4SA 2FPUA 3ZK7A 3HEBA 4H16A 5I7RA 5I7VA 1QAMA 3JD0A 2WAYA 1KGDA 3DO6A 4H6WA 4IIVA 2ZYAA 5EUMA 5KYTA 3GLIA 1HG1A 1DGQA 2QTZA 3GOQA 3LZCA 4IX9A 4CWAA 2B30A 4BNGA 4RJLA 4WSOA 4CQJA 3NPMA 2R1UA 5K3FA 3CU5A 3IS3A 2FWBA 3N2GB 1YASA 5JC1A 4KQIA 1IN1A 1PJBA 3TSWA 1CR0A 1FP1D 2DRIA 1TYCA 1KYIA 5H0IA 1UJ6A 3RSCA 3WV4A 3SZ3A 3BDAA 1XPRA 2F9MA 3P9CA 3VSBA 5L4NA 3H6KA 3KTAB 1H0SA 3ZHYA 3T7IA 3A1NA 5F1OA 4DCVA 2I1LA 3P9ZA 3GJSA 1XAHA 2XQGA 2WWWA 3SHFA 2PYDA 4JKIA 3PIRA 3BAZA 3IB3A 4ISBA 4DRYA 1UBRS 1L8XA 1G60A 4LK3A 3ZH2A 2A3RA 3LI2A 4R0VA 4JI0B 3G8YA 3U9SA 1RBZA 5ISMA 2FMFA 1YCFA 1AKTA 4NZYA 4X8OA 1AQUA 5HSGA 2ATCA 2E48A 1CYDA 1G8KA 1KDRA 2J9FA 3B82A 3N2KB 3OE1A 4BQFA 2OB2A 3X1MA 3V34A 2FJ0A 1TMGE 3LY9A 4PLTA 4BNLA 3GAAA 1NQOA 3TRFA 3M7IA 4HG2A 1WDMA 3RTCA 1LC0A 4AECA 1XXHA 5FO1A 4YO7A 2AOUA 3VR5D 1F0NA 1UCFA 1Z75A 2YBDA 1VHWA 1ZOSA 2ZT7A 4M1QA 1XE3A 1V3VA 5ALMA 2GEUA 5D3ZA 1QGDA 2LWIA 4B33A 1CEYA 3MAJA 2JFWA 3BHMA 1CF2O 3OFND 3JQ6A 4PIPA 4S24A 3RTDA 3WG9A 3MMZA 4HDKB 3EPJA 4URFA 2OK7A 4X6XA 1P17A 1P19A 1WMDA 3SS7X 4GYYA 1YBHA 1ZWLA 3KZMA 3EQ8A 1X2EA 4HX2A 1QONA 1REQB 3LGSA 2ANBA 3GG9A 1UKZA 2AUTA 1ZWKA 1TQDA 5HKLA 3HKCB 1DOHA 1M6VA 4B3DA 1ICIA 5LP6A 4HDNB 5AOCA 2I6FA 4L9SA 2P9TA 5A04A 1LSUA 2OV8A 4IHJF 4M87A 1M9NA 2C3MA 4LCEA 1S3FA 3CZAA 1MG5A 2WHEA 5CNJA 4JS0A 1BWSA 4MW5A 2MWMA 3X1KA 3QE9Y 1KMQA 2FUNB 4NYMQ 4O2AA 1K7FB 2B5WA 1O96A 1D1TA 3LZ6A 1H6AA 2VIIA 4LZLA 5J9FA 1HRDA 4DUYB 5AQ1A 4M9UA 3R5FA 1AO0A 2FNAA 2JLZA 3IHWA 4CT5A 5CT9A 5EP1A 2PKRA 1JJ7A 1U7TA 4MWEA 3SVZA 5EJ6A 1II8B 2F90A 3NHRA 5HW0A 3AI1A 1U7DA 4QLBA 2ISCA 2PKWA 2HK6A 3OIDA 4QQRA 3TPZA 2YHUA 1J99A 1XVIA 3EIQA 4X6YA 5JJIA 1RLTA 1RVDA 3T1OA 4COKA 2VL7A 1J6UA 3PHJA 2XMPA 1YB7A 2HI0A 2HPZA 2PA3A 3F5FA 3GJRA 1DKRA 2EX4A 2D74A 2NTEA 5FH9A 1VI5A 4OEHA 3RE1A 2DHCA 4WESB 2XAUA 4G26A 4M9CA 1JHXA 4K3UA 4Q1DA 5CT5A 3UJNA 3K30A 5ITWA 1S2MA 3JVVA 4QBFA 4U4AA 1V45E 2BGTA 5FDFA 1L4NA 2BHSA 3LQQA 5A0FA 3DP7A 1M3SA 1ZRHA 2L42A 4Q4AB 4Y6GB 3WWPA 3KKZA 4IBOA 2ISSD 4IIGA 3ZU3A 2J31A 1Y4AE 3N76A 4QG7A 1H1LA 2V7XA 3D3EA 4TSFA 3PD1A 1S2IA 2ZJFA 2HIMA 1X39A 1CEQA 3WJ2A 3OF2A 3NRCA 1BGXT 1NXXA 4LOAA 5JCOA 4ARCA 4OXIA 2JLAA 1JIQA 1N4DA 1V2HE 3FUUA 4B4VA 4NG5A 3U7FB 3I42A 4JI8B 1JQAA 1P9LA 2FEKA 4X20B 3WLEA 3PEYA 2H7XA 4NCHA 3KZNA 4F4IA 1UKVY 2ZB4A 1T0JB 3SIXA 1X0VA 3MXOA 5J2UB 2IH4A 3EC2A 1XD9A 1VJ1A 2NVOA 4IDAA 4C4OA 5ITVA 3FWZA 4J7CA 4IJUA 3BWVA 4JT4A 4LJKA 4OL0A 1NDQA 3UK0A 1JIJA 1QYXA 5JS8A 4ZANA 2X0IA 1JG3A 1DQNA 1VHQA 3GJ3A 2HUNA 1Y9ZA 1OWMA 1KMMA 1EJ2A 1N2JA 1O6ZA 1WUKS 2H11A 3A9CA 3BK2A 3GD5A 3KV1A 3PEEA 4BCBA 2CLIB 1CV2A 3FF4A 2POCA 5C1IA 2CMKA 5E7JA 1VPDA 4CR8A 3UJCA 2GX6A 4ZRMA 1MABA 1Y1KE 1T2AA 4NXNB 4X7RA 4IUDS 2PG3A 4U7DA 2WDPA 2FLWA 4CLRB 1CZKA 5IMSA 5LWHA 4EY7A 3TLBA 4BP9A 4O63O 1L5WA 1FFXA 3G2NA 4J1TC 1ULSA 4MS3B 4TQ9A 4AYWA 3SWWA 2XTZA 1XRMA 1ECBA 1W25A 2G77B 3OLWA 2WWVD 2RBGA 4AW9A 3H2HA 3HRIA 3NTXA 5CNMA 3ROGA 3NHPA 4K0KB 1PDVA 5DN9A 3K1TA 3DV0B 4DSUA 2AJBA 2PGDA 3GDOA 4EJMA 4ENSA 1EIZA 2P0AA 3C3MA 3PX2A 5KDLA 2YTZA 3LV8A 3DMNA 5PGMA 3DUFB 3JRWA 3DMPA 2XPCA 5FI1B 3SC6A 1FTYA 1KFBB 2YOFA 4Q21A 4X92A 4YDSA 1H6DA 3WBFA 3LYAA 3D9QX 2Q6IA 5H7XA 4Y9RA 2LTAA 3VXKA 4BNMA 1GGFA 4DWOA 2ZXUA 3RC2A 1JEJA 3D3KA 2GLXA 2Q7XA 3KRTA 3LH5A 1ODLA 4JYBA 1OH7A 1G6KA 3IBSA 2WM2A 4O29A 2L2QA 4NK4A 3FCAA 1TD9A 5BXQC 2IDMA 3B1WA 4ZDWA 5MFPA 5EIWA 1KU0A 2WYIA 4XYMA 5GADl 2UYHA 2XZDA 3TCKA 1G21A 3EQ2A 3DE1X 4KNYA 1Z26A 3TW0A 2UVPA 4UEJA 4BWYA 5HOQA 3HDVA 3PT9A 2JGDA 2XNHA 2WHQA 4MW6A 3CLUD 3L40A 2NU9B 3KWFA 1JHDA 5IHPA 4HQLA 3PSHA 2X42A 2RHRA 5CVCA 2E2WA 3K0FB 4KXUA 1OBCA 3LC2O 3P5BA 1EDEA 1UMCB 3EZ7A 2IV7A 5JU6A 4QM6A 5J2UA 3KKLA 3RU9A 5KTNA 1UBGA 3TO5A 3KYBA 1T5LA 4TS9A 3N75A 3SYRA 2ZVPX 1TIBA 2BGMA 3N74A 1X86B 5DM2A 2GARA 4JAVC 1ZD4A 3LCMA 2QAGA 5BUSA 1GQSA 3FF1A 1IHPA 4LV5B 3RF7A 3WBKA 4C08A 3T7DA 2HTEA 5CG2A 2PTGA 2EFCB 2JLCA 4Z53A 3OLYA 2I4TA 5AHOA 3HB5X 4S1OA 2CB9A 4PYMA 4IW3B 1JPUA 3D6JA 3V1YA 4AP9A 2E5LB 1FLAA 4FI3F 2X86A 2Z8YM 1NR7A 3UFXB 1CU1A 1GIAA 5CJ2A 3AFHA 3K0KA 4NFSA 4FNAA 3V2UA 3U1VA 5KTPA 2QYOA 3SEFA 3PU6A 2GBIA 4EGCB 3GNQA 3FNIA 1K75A 3HWX1 3R3ZA 3QKWA 3QVGB 1UAGA 1KK0A 1HWYA 1DAFA 1Z8HA 1NFFA 1O9BA 1X7HA 1ZH6A 2K2WA 3PHHA 4A15A 2BELA 3GLHB 5LZ7A 3WB1A 3AKCA 5IUKC 1SH7A 2GCOB 2NLOA 4ARBA 2QY9A 3E3NA 4FJ0A 4QJ4A 2EGGA 1ZXBA 4UHHA 4G25A 4PC3A 1VXRA 2G08A 5ESXA 3VNSA 2B8JA 3AKEA 3IJPA 5IBQA 4Z7OB 2IH5A 3E7DA 4FMDB 2ZUWA 3PYLA 2IOQA 4TUYA 2Y6UA 3WY9A 5AVUA 4F2WA 5KQPA 1I7PA 3CISA 2ONCA 3AIOA 2GT1A 5BSMA 4JNCA 5FBWB 4AXBA 5CLIA 3UKDA 4RCVA 4UW9A 1MW9X 1OSNA 4KQWA 5KPJA 1OFHA 3SHVA 3O8BA 1BYIA 4EG0A 3UWOA 5D7NA 2VZEA 1LDBA 5JZMA 2O8EB 3R3JA 4ESHA 2IGBA 1WETA 2WAMA 4JGGA 2G0NA 5HK9A 1SN7A 3D43A 3E8XA 3IMKA 3QEMB 2PGLA 1N8TA 1OIXA 3JARA 5D8DA 1QYDA 2VDRB 3GOHA 1X7WB 1YCDA 3NEAA 4K9DA 5T4HA 3K4PA 5JTTA 3HZHA 1WXXA 2AUNA 4EQ6B 4MUMA 5D1NA 3EAQA 4MW4A 1X1TA 2CV2A 2QTRA 3FWPA 4HVTA 4AG6A 2IXAA 3RH0A 4NI5A 4C22A 5B1YA 3D6MA 3F71A 4RQTA 1EUDB 1P8AA 2JFVA 3H86A 5CD9A 3M1AA 3D54D 2AFIB 5ECYA 3HPRA 3NOOA 1OX5A 2WNIA 3D2CA 4EUNA 1VGRA 3EFHA 4KIGA 2XY4A 4J0EA 1XELA 1MV5A 4XCQA 2B69A 4CF5A 2V0GA 2P30A 1Q0HA 1CRQA 2WF8A 2UYOA 1RJGA 2DFPA 2V7EA 5AW7A 1XXHB 2QN8A 1DDGA 1MOPA 2O48X 1RYEA 1KY4A 2V8BA 3FAKA 1IM8A 5CB4A 1NBAA 3PVCA 1N9GA 3DAOA 5T6BA 4EQZA 1WSBA 2Q62A 1T5DX 1ZUD1 3OQJA 4N0PA 4QHSA 4WXPA 3FFBA 4WHMA 4FUTA 1UDCA 3UJ9A 4AF8A 1USVA 1JV2B 2FZCA 2GZDA 4MV1A 4MYTA 4FYIA 1X9GA 5TQ0A 4YDRA 4DLVA 1E9CA 2W43A 2YYZA 5I8PA 3KSAC 1HEIA 2X19A 3D4OA 3KTAA 2A1UA 1UFKA 4JP1A 4B17A 2YHAA 3RFTA 5F9HA 4K5QA 4RDHA 4UXJA 1NN3A 2Y1XA 2O59A 5FR2A 3T5DA 1Q21A 5HJEA 1B41A 2PY6A 1B14A 1KPIA 3BD9A 4MO9A 5DI3A 1JFSA 1D1QA 4N8DA 3IRVA 1JPJA 1WZNA 1RLIA 4IHAA 5K0GA 1OTXA 3G2PA 2VTKA 3UAYA 4MUGA 4BQIA 2G4VA 5KNDH 5LSAA 1O95D 4XUGB 5FOUA 3TEJA 2PL3A 1C8BA 3TZBA 4U3JA 3VU9B 4BV9A 4CM8B 1Z7GA 4R3NA 1SU8A 4O4JA 2CDAA 1HDYA 4Q9HA 3WRYC 1I80A 1RI1A 4DADA 3EWSA 3S1AA 4B47A 2QUKA 3Q1LA 3OEEA 1RW4A 1SG6A 4BFSA 2CYAA 3ZC3A 4YAIA 3CN7A 4GGPA 1U1GA 1MC5A 3L84A 5EEHA 3BXPA 4B80A 3QQ5A 1JT9A 4J94A 5DISB 2G0TA 5FOSA 4DR3B 1YFKA 4M98A 2RHMA 2J9RA 3N8IA 2GJSA 1GITA 3HCAA 4B3SB 1C3OA 4XLTA 3S55A 1EHCA 3V1KA 5INTA 4ZVOA 4R54A 2Q1WA 3W9SA 5JNUA 2LV8A 3G0IA 3VPFA 1OY1A 1Z7WA 1RWOA 4YEDA 4I3HA 1ORVA 3QE3A 3EXHA 2CC2A 3CY6A 3D0OA 3QPDA 2ZI3A 4MGHA 4M9RA 4ZOCA 4Y1EA 1HLFA 2RAUA 5JVDB 2VWPA 4WDQA 4IDEA 3KZKA 3AG5A 2O3UA 1CNEA 4Q01A 3CX8A 4X41A 1DIRA 3AEUB 4D2IA 1SBZA 3BIWA 1EHYA 2R44A 1SURA 5AKYA 5CX1A 2BGGA 2FG5A 3ABSB 1MO6A 3LQKA 1YB6A 4IMJB 4QYIB 2IYTA 2H85A 3Q0EA 1XF9A 2GEDA 2ZRDA 5CH3A 3UUGA 2OZEA 4R2JA 4MVJG 1C0PA 1V4VA 2B4QA 4REMA 5KINB 4W5QA 3LL7A 3SK0A 1C30B 3R8XA 3E1GA 5DK6A 4WWHA 4E07A 1XTZA 3IV6A 3RC1A 1USWA 4CCAA 1YVDA 2H8KA 1M5RA 2HBYA 1HYEA 1V1RA 1RXEA 1QO9A 1PV1A 4I50F 5BN5A 5IAOA 4A23A 3T0FA 2VYND 2FR8A 3H5RA 4IEIA 1KAMA 2XVMA 2IIBA 1JN0A 5ILGA 1XDUA 3S44A 3VAAA 3WIOA 2VP0A 4EECA 4C6TB 1KJ8A 2AWNA 3MTAA 1LBTA 5K3FB 4X8MA 1EE9A 3CO5A 4XXHA 3NHWA 1CHDA 1NYRA 2V55B 4YAOA 4CM6A 3ZW9A 2BKUA 2ECKA 5HNKA 4JKOA 4OQLA 4PCAA 1BH6A 5FEUA 3ZZ0A 4Y2QA 4BHTA 1TI7A 3PR3A 4M1ZA 4QDTA 1PFWA 4CM7A 5LP6F 2EJCA 5LMZA 4QVGA 3F2VA 4FUQA 521PA 3E1KA 3RBZA 5J4HA 3T3HA 2CVPA 1C8VB 4OA5A 3OOEA 3VZPA 5JCPA 1B43A 3PJRA 3DLHA 3UAGA 2PSFA 2QUAA 4BJHB 1FUUA 5A3RA 1JP7A 2RIPA 5LQRA 2V6GA 3ZGOA 1Z7BA 1TZKA 1X80A 3GQBB 5JJBA 1OLUB 1MX1A 1HEUA 3UAZA 4NL4H 4FPXA 4HAIA 1XNJA 4YCBA 4I1SA 4TZKA 1ZSVA 2VHCA 1H2YA 2VDWA 2AK2A 4Q39A 2HMTA 2PIAA 5DYGA 3U3XA 2A1UB 4JLMA 2JKVA 2LP4Y 3DFIA 4DUGD 4JLAA 3TAHA 3BWEA 2HF8A 1XDGA 1QHNA 2BEWB 3LWZA 1P75A 4QATA 2BJWA 3FDIA 5KVCA 1CY6A 1ETHA 5LB4A 2XITA 1FUKA 1ZR2A 3O4IA 1E99A 3L5OA 4ZEOA 5IT0A 1VOTA 1N8SA 2WU0A 4DDTA 1IN8A 5TJ9A 3E7XA 1JPVA 2NV6A 2P3OA 1SCJA 2H1VA 1J5EB 1VSVA 3PGVA 5DRTA 4H4DA 5DXFA 1NOIA 3DHYA 2XIJA 2ZBDA 5IDVA 4PR3A 4AAYA 1IRIA 2ZRCA 1Z62A 3A27A 5EMKA 4EA7A 3MMPA 1YBFA 2I8LA 5LL6P 3T9BA 3M49A 1F0KA 4FFBB 1AXGA 4C4RA 1PJCA 1WB6A 3MERA 1U2DA 3HE3A 1Y7PA 2TMYA 3P2OA 4DXAA 1TADA 1M1YB 2DF8A 4JLJA 1I33A 1G5HA 1JTEA 1ZS9A 3Q0IA 3IBTA 2FKAA 2FPKA 2R00A 3R7LA 4WXEA 1JH8A 1N5KA 1XEXA 3G68A 4QU8A 4D4IA 4PG8A 1TVMA 5JZBA 1UMBA 3PUJA 1ZAYA 4CIVA 4HSEA 1QPBA 4DXHA 1EX7A 3O6VA 2DHRA 3BSWA 2G88A 5KWVA 2JGMA 4IJVA 1PT6A 2AX4A 1KAGA 1JEDA 3GRZA 1JTFA 1NNUA 4E5KA 2SCUB 4BL5A 4R1NA 2ZRBA 4X1OA 3WGQA 2GM9A 3A3YA 1N2OA 3BMNA 1U7OA 3OQBA 4IFTA 1C7EA 3OT4A 4MPDA 4UBOA 4GR5A 4RK6A 1K9SA 5IF9A 3WVNA 3HVHA 4LRXA 1U7WA 2BAGA 5JSUA 8LDHA 2HMWA 4OTZA 2IYUA 3MD0A 3VKWA 3C1AA 1ZK4A 2QTMA 4J4HA 4A8JC 4JITA 3KJXA 2R6HA 2WYWA 4LKOA 3OQNA 4ZOBA 1SA0A 1XZ8A 4ZKEA 1CQWA 4HNSA 2EQ5A 1DAGA 3BTVA 5FL3A 4EJ2A 2WM9B 1I4WA 3WGMA 4FFBA 4NEQA 1N7GA 1TZJA 1E3QA 1LXCA 4M8NE 3DZDA 3OPNA 4HLDA 1Z4PX 1ZH0A 3FPKA 1J7KA 1NYLA 3P19A 2FFJA 4K9QA 3GF4A 4INOA 3ZHOA 5AJYA 1G5RA 4BNUA 2OBYA 3BBLA 3E4DA 3LLSA 3ONDA 1NRIA 3PEUA 4H9GA 3C8ZA 1EP2B 2FY8A 2NU6A 2Z2ZA 4XH9B 4AZSA 5A5EA 1RHQA 1U02A 1G9XA 1HTTA 2NXJA 3CR8A 1D6MA 2AE1A 2FW8A 3HJCA 5ENDA 1R00A 1C9JA 3I9LA 4BV3A 4YV2A 1CUFA 5JRZA 4P9NA 2YYAA 3SR3A 4KYIB 1GGEA 4DIKA 2OGWA 5H70A 3NU1A 2FPLA 3UV3A 5C53B 5EE9A 1OB2A 5L53A 4DAEA 2C1ZA 3BFJA 2ESRA 2YASA 3HJUA 4BCDA 4RV4A 4YAWA 5FAKA 5KEIA 4BGVA 1QYRA 1T5TA 3B89A 2D3WA 1RQGA 5F2OA 2OQIA 5AVSA 3GZ4A 3HU3A 5AOVA 1NW5A 4F9FA 1AKUA 1G20B 2RKWA 4Z5XA 2IIVA 2JFQA 1K4MA 3M6XA 4BBPA 4EW3A 2F3SA 3BC1A 1YS4A 4ENPA 3LCRA 1BG6A 2VDOB 2XX3A 3DFFA 4GX2A 5ALJA 2E87A 2PNJA 2RAVA 3VH4A 5BR1A 5LNK6 3M70A 4AZ3B 1DOZA 3VKFA 4DQ0A 3TQHA 2CUKA 4REOA 1G4AE 4YN3A 4ZC8A 4QGGA 3B1JA 5F64A 1XTTA 4F4UA 1O5IA 4JB3A 1XTSA 2NQ8A 1FFDA 2Q46A 2QLFA 1HNZB 4HPJB 2QTAA 2FUEA 2XWPA 3BA6A 3CX7A 3OZ7A 2JGRA 2VQ6A 4NBUA 3S81A 1T2DA 1K6MA 3LFTA 5LKRA 2CFIA 1R7RA 2Q3EA 1X77A 2BMJA 3BJIC 1RZ3A 1AUXA 4JN6B 4R9SA 3FETA 4N03A 4RYLA 5D86A 1GTMA 1Z25A 2O7QA 3PNBA 1IATA 4P1ZA 5H16A 3LX6A 1YQTA 4MS1A 1BOOA 2R2AA 2NACA 3OKFA 4YRAA 3RSLA 4TZ6A 1KZ7B 1BGWA 1ZKDA 3MS4A 1I3KA 4YHHB 2ZBFA 2B4KA 4BPBA 2WNSA 1WBBA 2NM0A 1SRQA 3MJEA 4ZEVA 3EWNA 1YUNA 3LXRA 3UQYS 4M49A 4Y9UA 1JUDA 4L5CA 2YC2C 1HMPA 3WNVA 3NXSA 3QX3A 4FDLA 4KSYA 3ASZA 1Q7CA 1O94A 1QF9A 3IEKA 2V4ZA 3W5IA 3RS8A 1G5TA 2ZBUA 1SUIA 1MIHA 3LS2A 4E88A 3L8GA 4WMLA 1UKCA 4YGXB 1HL3A 2NVBA 3AEUA 2WTBA 1DIGA 3HB7A 3K2IA 2IYVA 3LM8A 4QX6A 2HSJA 4ETWA 5WRFA 3KYCA 1VL8A 1V7PC 2FN8A 4EAAA 1JZQA 3Q9LA 3CW8X 1C4KA 3D8UA 2B61A 4ZCQA 2O19A 5CITA 2OC4A 1NV8A 1TAHA 4ENVA 2JEYA 1QB7A 3L2OB 4HEA1 4PQRA 3T4UA 1Q15A 3O75A 3AR6A 2Y8EA 2XMDA 1RXUA 4LQDA 9ABPA 1E64A 1XVTA 4NZZA 3WWYA 3E2MA 4BEVA 2QMHA 2JASA 3IDQA 4PZUA 4IWNA 3EB9A 2XMQA 3E6AA 3TUJC 4ZKDA 5JSHA 3L93A 2PDAA 3J81k 4QYXA 3F2IA 4MOWA 4CKBB 2CLCX 5J1TB 1IUKA 1NXOA 4QFDA 1Y5NA 1YRHA 2VR1A 5AKIA 2PRYA 5IN5A 4QXQA 2DUNA 2R6R1 2GUWA 1ECLA 4WZAE 2KLBA 3ZJVA 5AP9A 1IWOA 2FWJA 3FKSA 2DT5A 4II3A 1G63A 3IP6A 1XDSA 1MOQA 3I04M 2R79A 3K8YA 2AOWA 4ZPJA 2Z5GA 4BUCA 1T5SA 3A1VA 1NJFA 4GYWA 2Y1OA 4XTCS 4Y6QA 5TQJA 5I3ZA 3AINA 4GLLA 4ND1A 4B6JA 2D00A 4JLBA 3SZGA 2BFOA 1Z7EA 2XT9A 1J2EA 1TM7E 1VRWA 2Z9CA 5CFRA 3CF4A 1ZIOA 4MVJI 4F60A 3P45A 1OXBB 3TTTA 1BGVA 2VP5A 4H3SA 1T8PA 4RHFA 1POXA 4UOQA 3VZCA 4RK4A 4LFAB 1UXGA 1GZSA 1IIRA 3Q6NA 1TTPB 3CBGA 4XGRA 5FX2A 1PT8A 1D7OA 1OU0A 3V8BA 1Z4IA 4K9NA 3RLIA 4B43A 4MPPA 5HHTA 3OX3A 1Y3IA 1R5JA 5ERGB 3V4FA 1QDUA 2IVZA 4Q6WA 5KX5B 2PKQO 1L4KA 2A8YA 3MFQA 1CQXA 1GUDA 1ORIA 5A4AA 3DT6A 2IUUA 2MIIA 3ZCQA 1ZA1A 2CUNA 2X58A 3O8RA 3B6IA 1PT7A 3O1IC 2WIKA 3OZAA 4OGFA 1XCPA 1PD1A 5I5GA 1MD9A 2AQIA 3KDPA 4JDPA 3IDAA 2OCKA 1PYGA 4HVLA 1IBKB 2YQ5A 2G1UA 4HX9A 2PGXA 4RHYA 5FTLA 2JGIA 2KBEA 4M0LA 4LVCA 4R7GA 3TLGB 5KTRA 2VRBA 1MIOB 3RF6A 3IHTA 4IV8A 4WOCA 4Q9JA 1IMOA 1M6YA 1R4ZA 3NM4A 2JCYA 3X1XA 3ZGLA 4NK5A 1LSOA 3OM9A 2R6GA 1EKXA 1JR3D 1L8QA 3AOGA 2E4XA 4P0TA 4MDYA 4N5IX 1P61B 3GUUA 3MTEA 3MTDA 3O8DA 3RV4A 3UWMA 4RMNA 3DBVO 5IKMA 1RM0A 3ZDCA 4GKKB 2HA6A 2SBTA 2YWCA 1TJPB 3DW3X 5C8DA 2I87A 4NYMR 4N82A 1N8KA 1TC1A 1TXGA 3HU5A 4H77A 2PKYX 5ALXA 1GJRA 2V3WA 2PMEA 3RSQA 1QYWA 4G0OA 2IYWA 2P5TB 4KLNA 2R2GA 4RA6A 4JUFA 1NI4B 4FZRA 1XI2A 4R31A 4ZGBA 4Z7QB 1VLLA 5TF4A 3GT3A 5H3LA 4Q1BA 5DK4A 3O8NA 4N49A 7REQA 4HWPA 5KSWB 4MUIA 4M0PA 5C31A 5EJFA 4HH4A 3H0EA 4QASA