3NWEA

Rat comt in complex with a methylated desoxyribose bisubstrate-containing inhibitor avoids hydroxyl group
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
213
structure length
213
Chain Sequence
b'DTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEINPDCAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catechol O-methyltransferase
publication title Catechol-O-methyltransferase in complex with substituted 3'-deoxyribose bisubstrate inhibitors
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase/transferase inhibitor
total genus 76
structure length 213
sequence length 213
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2010-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3nweA00
5GP1A 1ORIA 1YB2A 3CJQA 4OBWA 4QDKA 4HTFA 2JHAA 3DOUA 1JTEA 3GRUA 2ZVJA 3LL7A 3LKZA 3HTXA 3AWIA 3DTNA 1VBFA 2CL5A 3JWHA 5GINE 5CVJA 4RTOA 5MHTA 3P9CA 4CTKA 1T43A 4GQBA 4HRAA 2WK1A 3DULA 2LD4A 3G2PA 2YTZA 4X1OA 2C7RA 4H0NA 1Y8CA 3HVJA 2ZBQA 1SG9A 3VC2A 1QAQA 3KQTA 2JJQA 3CKKA 5HIMA 2PV0A 2P40A 3TFWA 3KQMA 3AY0A 3FUTA 2I6GA 2WA1A 3PVCA 4FT2A 5EIWA 3HEMA 4RV9A 4EQZA 2GB4A 2QM3A 5K0JA 2IBTA 1ZGJA 3PFHA 4AZSA 2GLUA 3HA3A 3OZSA 3SSNA 4RTSA 3EVFA 4R6XA 1JQ3A 3GGDA 3CVOA 5G02A 3SX0A 1BOOA 3LBFA 4KDCA 1BC5A 3SXJA 2NXNA 2VDVE 1L9KA 3GO4A 5DX1A 5EIFA 3HP7A 3DXZA 2PX2A 4MTLA 3IEIA 4PYLA 3TM5A 3FRHA 2B2CA 2Q41A 2Y1WA 1R8XA 1WS6A 3HCDA 4OA5A 5CVDA 4HTFB 3UJ9A 5LQKA 2ZZKA 5KYGA 2Z6UA 5EOVA 3I53A 3UA4A 2QE6A 3LCUA 2GA9A 4MHTA 1WZNA 3GRRA 1VPTA 5DM0A 5HFJA 1EQAA 1ZHFA 5IKMA 1HMYA 3ELDA 3GJYA 5JR3A 3KPJA 2ERCA 1RJGA 4RTLA 1X1BA 2ZIEA 3SM3A 4GOND 5HZMA 5FADA 1DL5A 5FWDA 2PJDA 1D2HA 3IV6A 4V0RA 5F2KA 3UZUA 1NT2A 2FRXA 4EVIA 1SUIA 5DSXA 2C7QA 2CMGA 2ONZA 2VS1A 4RTPA 2ZTHA 2GAFA 2JG3A 2OKCA 2ZZNA 3GXOA 1O9HA 5K0FA 3JWGA 1FP2A 2FK7A 3HCAA 4M36A 5K03A 1JR4A 3R24A 4A6EA 5K0GA 2IBSA 4BLUA 4CTJA 5GIPE 5M5BA 2PX5A 2ESRA 3TPZA 2PLWA 3GRVA 3MQ2A 3ER9A 4YV0A 3NWBA 5F2OA 1M6EX 2AOVA 3EVGA 5BXYA 5LR6A 1UFKA 1OR8A 1XDSA 2PKWA 2PY6A 1Q0SA 4ER7A 3SGLA 3B7PA 3KQSA 3X0DA 4RWZA 4P7JA 2G72A 2BZGA 3M6VA 2Z6QA 2AOTB 3OFKA 4EK9A 3LCVB 2AOUA 3A25A 2K4MA 4HGZA 2B9EA 4PIPA 5EC8A 4YUYA 1WG8A 4R6WA 3P9KA 2QYOA 4E70A 5KQRA 3MERA 3FPEA 1N7IA 2AOXA 2A14A 1VQ1A 4E32A 3NTVA 5EMJA 5LQUA 4AZTA 3PB3A 3NVMB 3NWEA 1ZQ9A 4C03A 3TRKA 3KKZA 3PFGA 1KR5A 2HNKA 2FHPA 3PX2A 3LPMA 2CWWA 1FP1D 3A7DA 4KRGA 2GS9A 3ME5A 1G55A 3KQYA 1AQJA 2P3QA 4L7VA 1H1DA 5E2AA 4BLWA 2ZFUA 3DH0A 3BGDA 3G88A 3OFJA 5DPMA 5DWQA 5EMKA 1G8SA 4KVZA 5DRTA 3Q7EA 4QTTB 5K0CA 3HM2A 1UIRA 5CUQA 4NECA 3LECA 3AJDA 3P8ZA 5K0BA 1JSXA 3HCBA 1XTPA 3CC8A 3B3JA 2H00A 1BHJA 3FUWA 4PCLA 4PGGA 3MCTA 3TKAA 2XYQA 4RTRA 4KDRA 2OB2A 3BT7A 4OQEA 3TLJA 3FTEA 2R6ZA 2B78A 3NVKI 2YXLA 2P8JA 4X60A 5T64A 5K0EA 2PWYA 2NXJA 3BKXA 8MHTA 3JWJA 5EHIA 4K6MA 3LDGA 5FWAA 2ZZMA 1AF7A 3ANXA 2PT6A 3KQWA 3R6TA 1RJFA 2HWKA 2AR0A 1JQEA 3DXXA 4PGHA 4X61A 1R00A 3B89A 1M0EA 2ZIGA 1KYWA 2YUIA 3G5TA 3FUVA 4IWNA 5E1MA 1G38A 1TW2A 4M38A 4HG2A 5E1BA 1JTFA 1XVAA 3FPJA 4WXHA 1KIAA 4MWZA 4PNEA 1VP3A 5H02A 4RTJA 4XUCA 4Z2YA 3T7RA 4DCMA 5GOZA 1KPHA 5FQOA 3P71T 1QZZA 4HGYA 4ER5A 1XXLA 5E8RA 4CKBA 1G60A 1HNNA 2ADMA 10MHA 4RVFA 5DTRA 5GM1A 4G56A 5CCBA 5E9WA 4E2XA 2ZBPA 2PWPA 4X63A 3PT9A 2ORED 2O05A 4P7KA 4PINA 4POOA 5BP7A 3UBTA 2HMYB 4OA8A 3M70A 1ZG3A 5GWXA 3TMAA 1EJ0A 4KW7A 3R0QA 3EVZA 1PJZA 4DKJA 2H1RA 2NXEA 3OE4A 1Q0TA 1B42A 7MHTA 3KPVA 1IXKA 3HCCA 1SQFA 1V39A 3BUSA 3KR0A 3LHDA 2XBMA 4BP1A 3O7WA 3RW9A 3FPGA 4IV8A 2JH9A 3HA7A 3D2LA 2AOTA 2B25A 2JH8A 4HH4A 2ZBRA 4Y2HA 2AVDA 4QQKA 4IKPA 4PYKA 5D1NA 3CCFA 3UJBA 1JQDA 2YVLA 3FYDA 3FPHA 4LECA 2XVAA 2G70A 3K0BA 4XUDA 5K0LA 2PBFA 4E33A 1XDZA 1NW8A 2IFTA 3G8BA 5DM2A 3MCZA 5C9ZA 5C0OE 1WXXA 2IDKA 3RIEA 3DMHA 2F8LA 3P97A 3P9IA 3IYLW 1EJ6A 4RTMA 4FR0A 1BKYA 4DQ0A 4WVLA 5K05A 3FTCA 2OXTA 3BWYA 3QOWA 2YR0A 3AXSA 2BM8A 5T67A 2VZ9A 2P35A 3VC1A 1N7JA 2BR4A 2XYVA 4DM3A 2OYRA 3M33A 4PYQA 5EMLA 4UOEA 3GNLA 2IH2A 4GOLD 2YXDA 3OPNA 3GIWA 3BWBA 2E5WA 5EPEA 3HVIA 2AN5A 1I4WA 5FCDA 5E1DA 2B3TA 3ELWA 3BGIA 1L1EA 1SQGA 3A26A 4RTQA 5CVUA 2G8NA 2G71A 3M6UA 5FTWA 2P1DA 1INLA 1DCTA 3BGVA 3PX3A 3SMQA 4EMSA 1I9GA 2IP2A 1NBIA 1QYRA 2I7CA 5FQNA 2EFJA 2VDUE 2JHPA 3HNRA 3KU1A 4MIKA 2HR1A 4RVGA 3MB5A 2XYRA 3UA3A 3IHTA 4FSXA 4AZVA 1NV8A 2O57A 2KW5A 4ZTBA 5LSAA 2YXEA 1R74A 2UYOA 4GOMD 2YQZA 4YV1A 1X1CA 2OPBA 4LWOA 5DTMA 4ATNA 4M37A 1D2CA 1KP9A 3BWCA 5FA8A 3THSA 1DUSA 2AOWA 3KPUA 4GUAA 5EG5A 3V97A 3CBGA 4E31A 3UJ7A 1SVUA 2AN4A 2FK8A 3E8SA 3KR9A 5GIOE 4BY9E 3AXTA 4P7GA 3O4FA 4OQDA 5EKXA 1O9GA 3LDUA 3G89A 4MQ4A 5DXAA 5ICFA 1FPQA 1QAMA 1RI1A 3TOSA 1NW3A 5FA5A 3T0IA 4F85A 2UZ4A 2IH4A 4QTUB 2QRVB 3LGAA 2ONYA 3EGEA 3NDJA 4ER6A 4B17A 4KWCA 3DP7A 3NW9A 5KQSA 5CVEA 1L3IA 1XJ5A 2ZCJA 1D2GA 3F4KA 1R8YA 3FUUA 3GRZA 3ORHA 4KIGA 1P91A 4A6DA 4R8RA 4GOOD 1X19A 3UJ8A 4DZRA 3EVEA 4FGZA 4RSRA 2C7OA 2XVMA 2BR5A 1JG3A 4BP3A 5FHRA 5FULA 4QVGA 3H2BA 3FTFA 1JG1A 1KHHA 3SR4A 2ZSUA 4R05A 3EGVA 2AS0A 3BXOA 3M6XA 1YUBA 3DR5A 3EVAA 2O07A 3OU2A 1ORHA 5EZSA 4C08A 1PRYA 2CMHA 2G1PA 4AUKA 3KR2A 3HA5A 4C04A 4HSGA 1R6AA 3OU6A 5DTQA 1UWVA 4DCGA 4E2WA 1RJDA 4PIMA 3P2KA 4CWAA 1QANA 4QVKA 5HIIA 5P8WA 4CKEA 2UYCA 9MHTA 3UWPA 2OO3A 2R3SA 1R18A 1G6Q1 4PWYA 2HTEA 3EMDA 1FBNA 2JHCA 2PXXA 3HCFA 4PONA 5FUBA 1YFLA 4PCAA 4C07A 1XDUA 3I58A 1X1DA 4PYIA 2OB1A 1Z3CA 5HOQA 1QAOA 4FP9A 2PVCA 2ZULA 4YUWA 2BM9A 4CKCA 3EVBA 4DF3A 3FUXA 3MGGA 4YUVA 3T7SA 1WXWA 3FRIA 3REOA 2QY6A 2IPXA 4GF5A 3S68A 1SUSA 5BW4A 5LQNA 2YX1A 1SKMA 4YMGA 1M6YA 5DX8A 4GBED 2ZW9A 4E2YA 5E1OA 1VL5A 5GM2A 3CJTA 2H11A 4HC4A 3MTIA 5EMMA 1VIDA 1RI2A 3ELYA 4F86A 3NJRA 1TW3A 4P58A 5LQRA 3TM4A 3ER8A 5DSTA 3EEYA 3JWIA 4E30A 1O54A 1YZ3A 4RX1A 3RODA 4V0QA 3OE5A 5DXJA 3OZRA 3P9NA 3P2EA 4FS8A 2PSSA 3E05A 4OBXA 3KQOA 3MTEA 4FSDA 2IIPA 3R9XB 4C05A 2O06A 1KPIA 5ERGB 1NW6A 1MJFA 3TQSA 2ZIFA 2GPYA 2PX8A 5DM1A 3HVKA 4C4AA 3M6WA 3SSMA 1U2ZA 2ZWAA 2PGXA 1VLMA 3DUWA 3G2MA 3I64A 5EVJA 3WSTA 2C7PA 1RJEA 2I9KA 3C3YA 4YUXA 1NE2A 3TKYA 3CGGA 3MAGA 2P3LA 3OU7A 4QQNA 3QOXA 4FT4A 5FHQA 1P1CA 3TR6A 5ICGA 3FTDA 1ZGAA 2IGTA 2PT9A 5DX0A 4XCXA 5CIYA 3U81A 3PTAA 3KPWA 3KQVA 5E9JA 3E23A 3V8VA 2EJTA 2HV9A 4LG1A 4IV0A 2P7HA 5K09A 2V7EA 1AQIA 5E9QA 2FYTA 3BKWA 2P3OA 5ICCA 3Q87B 1NKVA 4M7RA 5K01A 4EKGA 3KR1A 2GH1A 1NW7A 3A7EA 3VYWA 5KS2A 2DULA 5CVVA 1F38A 3G2QA 5EEHA 4X41A 1KPGA 1JG2A 4GEKA 2NP6A 2QRVA 4AX8A 2PX4A 1YZHA 3KQPA 3LX6A 5HIJA 4YMHA 2NYUA 3A4TA 2OY0A 4U7PB 2ZWVA 3QV2A 5K8VA 5KVAA 5HIKA 3EGIA 1VP9A 4ISCA 5BW5A 4R8SA 1XCJA 1KYZA 2VDWA 1F3LA 1I1NA 3GDHA 3I9FA 1RI5A 3ID6C 3LSTA 5DM4A 5K0NA 3KPYA 4CXMA 4OX9Y 2FPOA 1P1BA 1L3BA 2CKDA 3UJ6A 1EG2A 3K6RA 5CD1A 3B3FA 5C1IA 2P7IA 2VP3A 4KIFA 2PXCA 3GU3A 3FPFA 3OCJA 3T7TA 2OBFA 3L8DA 3A27A 2OZVA 3CJRA 5T6BA 5F2NA 5CCXA 4GC5A 5U4XA 2O0LA 3G7UA 3DMFA 2EG5A 4PYNA 2NXCA 4GC9A 2EX4A 2FCAA 3I5UA 3OZTA 4RTKA 2V74B 4PYMA 1G8AA 5EKUA 3DMGA 3GRYA 5EGSA 3LKDA 5DRYA 5DT2A 3UJAA 3C6KA 4RTNA 5EQJB 1VE3A 4E2ZA 5EZQA 1ZKDA 2NNWB 5EHGA 3THRA 4YUZA 1NBHA 5JUWA 1YFJA 3ERCA 5D1HA 3P2IA 1N2XA 3FZGA 3EEOA 1MHTA 4FZVA 2AVNA 1L3CA 4AZWA 3UFBA 3LDFA 4PYOA 5LQJA 4RYLA 1AV6A 3NDIA 3B5IA 4JXJA 2IDJA 1RI3A 2PXAA 4U7TB 3VSEA 2IH5A 1NW5A 3C6MA 3B3GA 3EMBA 3PS9A 4Y30A 5HEKA 3EPPA 5B1SA 4PYJA 3DXYA 5LQCA 2UYHA 1EIZA 3FYCA 2NP7A 3ELUA 3C3PA 2BH2A 3M4XA 1TPYA 4XUEA 2DPMA 2EJUA 3BZBA 3GWZA 3EVCA 4O29A 4QPPA 1EAMA 4RVDA 5CM2Z 5HILA 2UYQA 3DLIA 3G8AA 3LCCA 5E8JA 4EKIA 3R3HA 2ZLBA 4F84A 3LBYA 2Y1XA 1WY7A 5ICEA 2Z6AA 4QPNA 5LQAA 3UJCA 3HCEA 2AN3A 3BWMA 1X1AA 2WA2A 1JSZA 3KHKA 4P7FA 1IY9A 4DA4A 1RI4A 2AOUB 3C0KA 3HVHA 2I62A 3NMUF 2P41A 3EVDA 3G2OA 4RVHA 4DMGA 4BLVA 4LWPA 2BR3A 1YF3A 1JG4A 3G5LA 5IH3A 3E7PA 5EEGA 4QDJA 1IM8A 3O31A 4ER3A 5DLYA 3PLAE 3UJDA 1P39A 4C06A 3MHTA 3DLCA 3SSOA 4YV2A 1FJXA 1KXZA 1XCLA 2AZTA 5E2BA 1NV9A 3KQQA 3SVZA 3GCZA 4ER0A 2N47A
chains in the Genus database with same CATH superfamily
2PMDA 4H7PA 2VPWA 1U2TA 4KGZA 1KE2A 3RNOA 3N70A 3CZPA 4S1OA 3C7AA 5ESDA 3EH2A 3LKZA 5TMEA 4Z49A 5B58C 4C6HA 2QUKA 1A3CA 3DTNA 3V7NA 4RM3A 4MIOA 3GT7A 4N7MA 1A69A 4ND7A 2Z8YM 1S8FA 4QVIA 3ESYA 3HB9A 4CTKA 2D1TA 2REXB 4ENWA 4DEYA 3S99A 4HLCA 2AFHB 3AEZA 4QZVA 1S1MA 2E1PA 4UUQA 5FOVA 3TB6A 2Q99A 2R8OA 3HVJA 3P0HA 4PZEA 1SG9A 4RIEA 1YC2A 2C7GA 1KDVA 4DIKA 3ZLVA 4DBZA 4DNXA 2OK8A 3EIFA 4F3RA 1DJMA 1M1YE 4O3MA 4UREA 4G86A 3CPJB 2J45A 3TFWA 3LUPA 2WA1A 1EVIA 4CRWB 2E87A 5DYIA 1OLSA 5D2CA 5KYWB 2Q2VA 3OZSA 4PFJA 4O5OA 4ZOLB 3LS2A 2VK1A 4X7MA 3FVTA 2OV1A 3JSXA 2BKLA 1VKRA 3F6BX 1YXMA 1IIRA 3L8HA 4TWBA 3WHKA 5LVAA 8ATCA 4X95A 2HTFA 3R0XA 5EWJB 4BGUA 1P19A 4E5VA 3KBBA 1QVVA 3BK7A 3TTWA 4YAGA 1E1QD 2NXNA 2QE7D 3U3MA 3COVA 4UHKA 1A5ZA 4RZIA 5EIFA 1FP7A 3AK4A 1OUMA 4GT1A 4QLBA 5HGJA 1TADA 1PNTA 1PR0A 2RIPA 3AW8A 1ZN8A 1XO1A 3R3WA 4FEAA 4I3GA 2H9YA 4MZXA 1JZTA 4R2HA 5FAKA 2A1TR 5KHLB 1N2HA 4L9WA 2A9RA 1WZNA 3EGOA 4WLEA 1VE1A 3L7BA 4OGFA 4RD1A 3RBXA 3VYRB 2B4YA 3REFA 4EG5A 3TXYA 2QU7A 3LLSA 5JR3A 3WL5A 2PE5A 2DFVA 2DTEA 3L18A 1BYUA 4NYMR 3PYMA 3THYA 4J76A 3C1OA 1YDMA 1WP4A 2PJDA 3VR4D 4B5KA 5AHWA 1MW8X 1UPCA 2QVYX 2G8LA 2YWDA 5DOZA 3CZQA 2YQ4A 4FBLA 4G0NA 3HCPA 2ZTHA 1NW4A 2Y1GA 1CUHA 3E9NA 3PU6A 5K0FA 1JZQA 1MEJA 5CDGA 3K0AB 4UTRA 2BH9A 1K6JA 1RQNA 4HSEA 5J9FA 4DC9A 1BKSB 5E3JA 2WWHA 5GZ6A 3L7MA 1UK7A 3F1KA 5FI5A 5JVDB 2HY7A 2AOVA 1W36D 4EHJA 1KTIA 3AFIA 4YRBA 3PXBA 5JWHA 4D79A 2W2NA 3SDZA 2BZGA 2QJRA 3VNVA 2DECA 3PRJA 4QKQA 3N2EA 3U56A 4YUYA 4OMFG 1FF9A 3CISA 2P9YA 2Q9BA 3CO5A 1K92A 4FYKA 1DKQA 2GETA 3ENQA 1KO8A 1VQ1A 1YQWA 4YS6A 2JIOA 4MXDA 5JAPA 2VG8A 3GCWA 1LV8A 4G8CA 4GHWA 1NTRA 2PG3A 3OTWA 2ZP1A 4TS4A 5AXBA 1L4MA 4P4NA 1QP4A 4PTLA 5BWLA 3IR5A 5EHQA 1Y8QA 4Z7NB 3OFND 1SA0A 2ZKLA 4B44A 4H3SA 4ASUA 3VYTB 1E1CA 2WUWE 3CE9A 2IZOA 1EFRD 4N54A 4UJ5A 4Q02A 2XE7A 4BX9A 3OWHA 2WWIA 1FFCA 2V59A 3F6RA 2BEVB 5B2EA 1KNXA 1SU6A 1HC7A 4H31A 4IZHA 4QFDA 1WBDA 3ZKWA 4YJHB 3S1LA 2OCAA 2OBBA 1ISMA 2HA5A 3GEBA 2CF5A 5DMHA 3ZCPA 3A3PA 1V3UA 4EWLA 3EZLA 3BEOA 3TLJA 3UK0A 2BGKA 3T1OA 4Y6SA 4MRPA 4DAOA 1T8SA 1EX6A 2X0FA 4N6NA 1U1GA 5EUBA 1YB5A 4UU0A 1DJLA 4X90A 1NVEA 1E62A 3ADBA 2V8BA 2IYOA 3JQ9C 1KZHA 3RUCA 3CZRA 4IS3A 3FETA 4KPUA 3AVOA 5ECWA 4TS9A 2GUWA 2IW1A 4DXAA 3D8SA 5ALKA 2BM0A 1E59A 4IGKA 1PWXA 5GJWC 3N39C 5DYTA 3W04A 4ENQA 4G0PA 5AHRA 3M34A 4M7PA 3PGKA 2JFYA 3B1JA 4KK4A 2C07A 3SHOA 3KKMA 2DBQA 1HLFA 1M72A 1IDN1 2RB5A 2ONKA 5TGZA 3GBSA 4KN9S 2ZGVA 3W9BA 2P6UA 3P71T 1OH6A 2AXNA 5DEIA 4CMBA 4BB6A 2JFPA 4D56A 1A9SA 4DA6A 3KSBC 4GWKA 3PFWO 1ANKA 2XGGA 4RMJA 4CI9A 1GP2A 2I1VB 4KNVA 2WWXA 3VH4A 5A4DA 3A4YA 3LZDA 4KVAA 1M0WA 2IKQA 2PKEA 1YRAA 1S8OA 5D6OA 2MCFA 3VTAA 3CNNA 4CT0A 3PNSA 1XK7A 3DWIA 3KKOA 4B2LA 3O9VA 1ZG3A 3G6WA 4R5MA 4H6PA 1TTTA 1JECA 1OZHA 3JAKB 3PGJA 1GILA 1NOKA 3FE2A 4JU8A 1HG1A 5H0IA 4EBFA 4JI0B 4XOIA 4M49A 4D9FA 3PXXA 2QD5A 3ABZA 3MLEA 3WGMA 1JIIA 3H8VA 1RRMA 3T4PA 1DOZA 3VR1A 2I3DA 3C85A 3W2HA 2HSGA 4I8DA 3SEZA 2X22A 3VPSA 3ZHOA 3NASA 1D5WA 4MMXB 3D2LA 4UKDA 1L6IA 2QVLA 3AT1A 1M0TA 1C2TA 2V1XA 5E7MA 1VTKA 4FI3C 2PKXA 1VJ5A 1O1YA 5DM2A 2J07A 5DASA 3DZKA 1XZEA 2QRLA 3CUTA 4O25A 3EARA 1OJLA 4W5QA 3W5BA 4KMSA 2EWWA 2J9FA 4DEVA 4RTMA 1A76A 3UB4A 4C0KA 4BVAA 1SUDA 1L5ZA 3BWYA 4ZRMA 5C80A 5IXYA 3DR3A 1DWPA 3D64A 4QA9A 3EDYA 1J4AA 3L1HA 2YIMA 1UXHA 1RXWA 4Q9KA 3U80A 2XQIA 4H0CA 4N5HX 4QOJA 1NURA 1JTVA 2Q3CA 3WLSA 3HWWA 5EYPA 3QEMB 4HJRA 4N9WA 1H4QA 2R48A 4EB0A 3UV6A 2YY6A 2H57A 4DQVA 1L1EA 2G17A 4F4UA 4A6PA 1MBZA 2YJ5A 2IVZA 3KB2A 4PLZA 1X7GA 5E3IA 5BMVA 1Z16A 4ZOLF 3GT3A 2OGWA 4OK3A 2Y68A 5ECDA 3AZQA 2I7CA 3K32A 4LXTA 5EINA 5LXTF 5I7WA 5LMZA 1CERA 2LWIA 4L8VA 4ZYVA 5I4KA 4IFTA 3C5VA 3GAMA 1TCBA 3JQDA 3UA3A 5JT1A 4A8HA 2CSUA 5IG2A 4AIIA 5CTAA 4YJFB 2AMJA 4YMWA 1A5BB 1R74A 1NONA 3OZFA 4G3XA 4ZTBA 3LTNC 1OXKB 1JLLA 3DVAA 1JDBB 3EJ6A 4GOMD 2BGJA 4XZ3A 3PC6A 4LRSB 4JI1B 2H5IA 5D5QA 1WDTA 1AN0A 4K6FA 1TZKA 1AKVA 5F51A 4XB6B 2VZ0A 3IR7A 1ST2A 2Y66A 3THSA 3TLEA 1CZRA 1FFDA 1FYWA 3C14C 4ZCPA 5LZ7A 2NQTA 1I32A 5GIOE 5DFAA 2KBFA 2NXWA 3VISA 2ZJYA 4J7AA 4OQDA 1P9WA 1KMCA 4GMDA 4NMWA 3E82A 4QBGB 2W6JD 3SBXA 2X23A 3HPQA 5KPJA 3NKVA 5FPQA 1A9YA 1T5OA 1KP2A 2QM7A 3IJEB 4BJ5A 3NB0A 4ZOQI 2VAWA 2MU1A 3MJEA 4G2TA 1PSWA 3BYZA 1P75A 2V8OA 5TIIA 3BDVA 2W2LA 1U0RA 1Z5OA 4ZEWA 3UJ8A 2HLDA 2J3DA 2PPLA 2XJ4A 3EVEA 4AKEA 4EHNA 2Z56A 2FFAA 4YN3A 5JVDF 3MS7A 4QYTA 2X0JA 3ND5A 3M5CA 4H7EA 4CLXA 1AUVA 2QPOA 5CEEA 3GWGA 2O0JA 2JGIA 1JKIA 4ZI7B 2RG1A 4GZMA 4JUFA 1QVZA 4BWFB 4IEEA 3UXHA 3USCS 4ZMSA 2AFRA 2QDXA 4XE5A 2HXSA 2OHXA 3O03A 4JXKA 1VBKA 3P9XA 1ZWKA 4TMZA 3H4TA 1EGVB 4CV1A 5F7XA 5EFZA 4N82A 5ALGA 2J32A 1AHHA 3ZGYA 4EKDA 1Z2CA 3JQRA 1W47A 3VR3A 2UYCA 9MHTA 1V45E 1HQYE 1ZK3A 2ZRPA 5AUQA 1M2WA 1PZGA 1YR9A 2OO3A 2XWBF 3IT2A 3P5SA 4ID9A 4TX1A 2VSNA 3IAM1 3QRWA 3LOQA 2O14A 4PGMA 3AERB 4WOKA 4B6JA 3DZBA 4EHAA 1IJKA 2ZAYA 1IY8A 1M1ZA 4ZQCB 4GOJA 5LYYA 2OZLA 5TT1A 3ABQB 1P5RA 3CW8X 3H2ZA 1ZMBA 4N40A 2X1VA 4D9CA 2AT1A 1Z2PX 1UBLS 1WXGA 3CY6A 3BL6A 2GK4A 3FY4A 4LYGA 1SUSA 4U2DA 3LLVA 4M4SA 3TSCA 1SKMA 1N0VC 2IVFA 4CIDA 3U1BA 5AXCA 2FFRA 1YO6A 4IFBA 2WJ3A 3K9NA 5JIBA 1KRHA 1T5SA 3WB1A 4BJ6A 5KSWB 2Y1FA 2ID9A 4B4KA 2QD4A 1U5BA 4E07A 3BQMB 1ZNQO 1SBZA 3D3KA 4E11A 1J7JA 3BORA 2JKVA 1YZ3A 3HYSA 1FA9A 1Y4DE 4L8GA 1E3IA 5AJHA 1DP4A 3LAWA 3E05A 4I9UA 3HFJA 2IYPA 1M3SA 3KQOA 2MOKA 1J2TA 2IIPA 2JFGA 2WKWA 3R75A 2WF9A 3T9FA 2O06A 4B7UA 4LX0A 2X0KA 4BLTA 2ZIFA 3UVEA 7YASA 3L4KA 4ZFNA 1CUVA 2ID8A 2ZWAA 3LBIA 5G4KB 4WKGA 1RJEA 2VPYA 4BRUA 4MKFA 1NY6A 4G4SO 4FT4A 3RJ5A 3NWJA 1E2LA 1M6NA 1RWQA 1E1QA 3KETA 2QE7A 1L7QA 1RJ9A 1Y1RA 4R1MA 5CXUA 4CT5A 2C8KA 1G8GA 3S1SA 3UMJA 2J3LA 4JEHA 4JU9A 5ICCA 3EGDB 3MJCA 5CA1A 4HDNB 2J7PD 3MLAA 3ZY2A 3TVTA 4D81A 4ARZA 2EU8A 5GJCA 3T3GA 2IUUA 4GP6A 3N0VA 4TN1A 4GMFA 1W59A 3G2QA 3N8DA 2CJPA 1NDUA 3RWMB 1DQPA 2KJQA 4YQZA 3HJTA 5K4HA 4KGVA 3EULA 3LX6A 3AW9A 3UUFA 1MENA 4OQNA 3MWDB 5FOTA 3QV2A 1G7CA 2HUNA 1SU7A 3VR4A 1UR5A 4MW2A 3U26A 4ZT7A 4PZAA 3PYXA 2BJVA 3BCUA 4YCAA 4IYRA 3AVYA 1ODIA 4MLZA 2MTBA 5IVPA 3NTLA 1RBZA 3F97A 3IX7A 4BFVA 3B1WA 3QX8A 3QHQA 5HG0A 5I9TA 1NR1A 5LP6A 4FX5A 4BVGA 4BAGA 3UMBA 4XWGA 4O1IA 1WU7A 1Z8NA 4DN6A 3K0SA 2R1UA 2X9NA 3UHOA 1K86A 2A6PA 3JASB 4XIGS 1E4EB 2ERYA 1WCXA 1SUCA 2BRUA 3DMFA 2NXCA 3G7UA 1JHXA 3WK4A 3RAFC 1IHDA 4IZ6A 3UJHA 3VPBA 1WB9A 3E2MA 4PYMA 1N9KA 4KKXB 1WD5A 5EKUA 4MCJA 1T0JB 3BWDD 5TMDA 3O8NA 4ETMA 3N2GA 4H6VA 2ORWA 5DT2A 4DNFA 2H1WA 4ZPXA 2IP1A 2A88A 5A7GA 3DPIA 1LPOA 3EBOA 3M5WA 4B3FX 1EXVA 2FPXA 4F3YA 4W9MC 1NXTA 2EAUA 6REQA 2VJCA 2O8BB 2IIBA 3OFNA 4BV9A 4ENVA 1LQ2A 4RJTA 5EIEA 4M1WA 1XDBA 2GEJA 3JXEA 4MS4B 3A6PC 3FFTA 3PQEA 5CTJA 1EFRA 1PZMA 3EMBA 4WNCA 1DKUA 1JT2A 4F56A 3IIMA 2EZ8A 3OE7A 1F5SA 3N74A 4HYQA 4RMIA 4JBYA 4AO6A 1ATIA 1KI6B 1Y1LA 2PCLA 1L7OA 3GZNB 1G0OA 4Y67A 4BNIA 2FH5B 2F55A 4D98A 4JBNA 3EVCA 3H0CA 1EAMA 4QU8A 5B1DA 1JXQA 2QD1A 4RADA 1U1CA 2AN9A 3TZKA 1WY7A 3SQNA 1ZOLA 2Q6TA 3RYCA 2XODA 1V7ZA 4ZRDA 1W34A 1U1EA 3LT2A 4JCOA 3OMXA 4YONB 1KQPA 1OLXA 3TTSA 2ZXUA 3WBFA 4MGEA 3LF2A 3QF7A 1HORA 1GZUA 1GXSB 1NQWA 5UKDA 3BICA 4DQLA 1M6HA 3D7MA 4AC9A 1I3OA 3RREA 2P2SA 1SOWA 1FY2A 3G5LA 2JGEA 4EPXA 1JU9A 4B84A 2A0UA 3T0FA 2A9OA 2CVHA 2B4QA 2I3ZA 4FCVA 1KXZA 1T0HB 2O2HA 4I5FA 2VCHA 3GFBA 3IIEA 4F72A 2EEZA 4PAOA 1WM1A 2GOYA 1WB6A 3OO0A 3Q9LA 2J08A 4R9NA 2OLJA 1OWNA 5HE8A 1P81A 2GWRA 1R4NA 1GR1A 5BN4B 5NULA 5H3HA 1Z4LA 5A03A 4J7XA 4PLVA 4WA7A 3C8UA 3PUJA 3JY6A 4MDYA 2OA0A 2ASEA 1DC3A 1Z6YA 4GQBA 4HRAA 2WK1A 1XZGA 1A82A 5C1PA 1EA5A 5ABPA 3I52A 1I01A 4ZT2A 1I1HA 1U7HA 1T9CA 3G8YA 3LCJA 5L51A 4LHVA 3LVRE 4KBFA 4S24A 2QKYA 1Y3BE 2QYHA 2X9LA 3CKKA 1FDIA 2GPTA 1XN4A 5JRDS 3UV3A 4IDAA 1O8CA 1A4IA 1WCYA 3TLXA 1DBIA 4EYEA 3RBAA 4ZCMA 2RHMA 5JS2A 1GSHA 1ND5A 1O57A 1LX7A 1QYDA 3OLWA 1JHDA 4BLPA 1SZCA 3D7KA 2H29A 3OE1A 4XPIB 2HMSA 1Z4KA 3TZLA 1S4MA 4ANFA 1JNXX 3Q7SA 4X3OA 2QZJA 3FX2A 4LEIA 1ESNA 5BYJA 4DIMA 4DSZA 2PGAA 3ZWBA 3G0GA 3TX6A 3TM5A 4BNHA 3M2TA 1MEEA 1QH8A 1PL6A 2CXTA 4Q4AA 3UJ9A 2Z6UA 3UF0A 3E9RA 4LNUA 3TH5A 3AI3A 2XT6A 4KMMA 1ZR2A 4CFYA 1F2UB 3IMEA 2QWXA 4BEBA 4Q4JB 2OR3A 2WD7A 3D0KA 1RJGA 4LVOA 1X1BA 1ZEMA 3UK7A 4MJ3A 3MWEB 4WESA 4QPJC 1JN0A 5HFAA 1AUQA 3ZLBA 4A0FA 1CRPA 5CFOA 4AZ0A 4EGJA 1D2HA 2WUGA 5ALMA 4PM4A 3TI9A 1LPAB 3ZY6A 1GQYA 4U7GA 3TCXB 2Y71A 4IJKA 1SHKA 1E6WA 3C87A 2FK7A 3EQ7A 1W9MA 2HFKA 2XUDA 3UGTA 2ETXA 2G5CA 4BTVA 1XA0A 4U00A 4GI3A 1SVWA 2CCKA 2PLWA 5GJVC 1WTCA 1H3EA 4BWGA 1QIIA 5KOJA 2BN4A 2VIIA 2PKWA 3OCYA 4D8WA 1PJ4A 2P9BA 2XCRB 2LV8A 1OB5A 4NFYA 3KQSA 3VNAA 3X0DA 5IUJC 1S96A 3IIKA 1Z39A 4YP1A 4FGJA 5J1TB 2YZ7A 3TG8A 3IQDB 3VJRA 3K09C 1TUBA 1FSGA 1WMAA 3P9KA 3O94A 4Y0AA 2HHHB 2O6HA 3DQZA 2OHFA 4CMCA 1FU4A 2WVJA 3PB3A 4AS1A 2Q28A 1AGPA 4QTYA 2GBIA 1EWYA 2HNKA 2BFAA 1CUZA 2I9PA 3LA6A 3O8RA 3GFVA 3AEKA 1FP1D 3ZZNA 2AE1A 4B09A 1QG6A 4KRGA 3RRZA 1VZ3A 4EG6A 1VHQA 5LIPA 3UICA 3RYIB 4YRAA 5KJEA 3I6QA 3WLIA 3KD2A 4R3NA 3VR6D 1H4TA 1LBHA 5IVHA 1I6LA 2W6JA 3PEWA 4G37A 3W6OA 4RKEA 3ACCA 3D4NA 4H77A 1PS9A 4PO9A 4ZVOA 2DFKB 3GRKA 5LLTA 2QRKA 4RDCA 2F1RA 3J81A 2H3EA 1KAMA 2J1LA 2ZT7A 1R0SA 2DQ4A 2WRZA 4J2OA 5CVCA 4DDVA 5JXWA 2VZEA 5HUJA 3DMYA 4DCTA 4PC2A 4BO3A 1NVUQ 1C0IA 2N9UA 5KC8A 3F71A 5E7IA 3GJ3A 4BE4A 4Q6BA 3A1DA 3WMRA 4MVJE 2YXLA 2P8JA 5KYWA 1TEXA 2WDPA 2FG5A 4C21A 1E3MA 1KC1A 2JCVA 3GMSA 3E18A 3KTAA 5EHIA 3L1VA 5SICE 2FWRA 2XWJI 4E1VA 2R4TA 3KYDB 4EUNA 4DE5A 2CN1A 3G0HA 2QTCA 3O93A 3DXXA 2HWKA 3TS1A 5LXTA 1B2RA 1XKQA 3LQFA 3Q2IA 3AUUA 3G5TA 5C52B 4O2RA 4NH0A 4M0KA 5G0UA 1C8KA 3U3XA 3FPJA 4YYEA 5FPSA 2RSLA 1EUQA 1UK6A 1YB4A 5I5EA 4XVHA 2EWVA 1ECFA 3A05A 2XZDA 1QZZA 1GDTA 3DKVA 2C59A 1SZDA 4LSZA 4K88A 3PFNA 1QCCA 4KYVA 2NTJA 1BDIA 4G56A 5JSKA 4HRXA 5A9SB 3OJ0A 1AGNA 4X63A 1NI4A 1UCFA 1GCIA 3AHHA 4X3PA 4PAGA 2C5SA 4Q1CA 3RAEC 3S4YA 3RWBA 1ZMRA 3BIFA 3DZCA 1XVLA 2H4HA 3K0AA 4XM0A 4Q9HA 4TUYB 3QLUC 2H1RA 3AFGA 3IP9A 5IEJA 3A1TA 4KP7A 3ZBTA 1B42A 3CKYA 3PZBA 1CJSA 1DIOB 1F3OA 2HBYA 5DNUA 4MR8B 3LHDA 4DR6B 7MHTA 4AI6A 1N78A 5BV0A 5JVDA 4R1SA 3N7UA 4OUKX 2GEBA 4BNYA 1VE5A 5C32A 4PNPA 3QWIA 2EIHA 4M8IA 3K8YA 1U80A 1OYYA 1KWKA 4CQLB 1LS6A 2IHNA 5J5AA 1TT7A 1GZ6A 3LPLA 1QF6A 2Y27A 3FYDA 4DT1B 2CXUA 3FOZA 3OETA 4LPSA 4MKXA 1MXHA 3RS3A 3S1AB 5JC1A 4IDNA 4LBVA 4P3OA 4E33A 1H85A 1OGJA 1XDZA 2W8ZA 5EJIA 4CI0B 5KZMB 3QE2A 5AICA 3EY9A 1WXXA 1VRWA 2IDKA 2PVSA 1A5TA 2ZQ5A 1OU0A 4QSMA 1NXWA 3A6HA 3LGSA 3NANA 2G9VA 3BJRA 4QEDA 5IABA 1UF9A 2EEPA 2ZT5A 5BRNA 5G41A 1KYYA 1SCJA 3VVMA 3WA6A 2P35A 1XEFA 3PK0A 2O8CB 4BMYA 1AHIA 4PPYA 3GDFA 4I4CA 5DE3A 3EC1A 1L5QA 3T3MB 4WHMA 3BA1A 1ETHA 3QWBA 4K9DA 4Q24A 3WYNA 1GKUB 4Y1RB 4CQMB 4ZYTA 1OX4B 3OY2A 3TW8A 5CYPA 3PC7A 2KSQA 1QGUA 1KVUA 1AUXA 1G7SA 2PSDA 4GI1A 4CE6A 4BBPA 1ML4A 1EWKA 2Z2JA 1O97D 2AQHA 1Y82A 3G0DA 2PMKA 2C83A 1I9GA 2HWYA 2BZ1A 3HSYA 2D7DA 3VYSB 4RTOA 1V8BA 1ZNZA 3JQPA 1E7WA 1M34E 3H5LA 1VMIA 1XXHB 4FSXA 4YRPA 1CR1A 2O3RA 3IRVA 3Q40A 1PO7A 3GQBA 2UYOA 3IBGA 3KWMA 2PZKA 1KZGB 3QVKA 1DQRA 4IICA 1C80A 3T5TA 4X1KA 1QVAA 1QMPA 5SYAA 3OZBA 2INGX 4U8GA 5HP4A 4RE6A 3VU0A 4XXHA 1U8YA 3MRVA 3OQIB 2O8EB 5AI4A 4V2IA 3OQPA 4WDRA 9ATCA 2JKYA 5LDDC 2IA5A 4LS3A 2F3TA 5LKAA 4WN9A 2W5UA 1OSNA 2Q6IA 3MCVA 5SY4A 3N2YA 3CNHA 5FOSA 3ZBUA 4DZTA 4XD2A 4DR2B 2XUFA 4UBOA 1P3JA 3IVCA 2BKXA 1DPGA 3GUHA 3Q98A 1NUPA 4ZXFA 1FFXA 2BFBA 3IMFA 4HLUA 2OD2A 1R8YA 2G4CA 1G8PA 3PJEA 2JS7A 1MN6A 4CIAA 4A6DA 3FWKA 1N2JA 1TLTA 1U2EA 2EFDB 3H2SA 3O4IA 6AT1A 3CVWA 1YSCA 2G1JA 5FNVF 3TQCA 3ZV3A 4Y6PA 3WQBA 3JAKA 3JQGA 3WKAA 1N2CA 4ZICA 5K9ZA 1WEKA 1FS6A 2V45A 4F04A 3FOAA 3HBAA 4BGEA 5JLJA 2O4CA 2YOGA 3H5IA 1YVUA 4BVJA 3ZBQA 3M8KA 3UQZA 4DMCA 5TS2A 5HTOA 2E9SA 3OEHD 1W1IA 3PQ7A 4KBYA 1P4HA 5JD6A 1I4TD 4BC0A 3HA5A 3ZU2A 1I7SB 3SQOA 2G88A 3GFFA 4HDRB 1V9LA 2HIHA 3IMGA 2P0AA 3OWXA 4G89A 2HCTA 4J49A 4MGKR 4N5NA 4P4GA 4TMTA 1PQYA 4J6FA 1CLEA 3N2KB 1D07A 1Y5NA 4GUDA 4P4SB 3EMDA 4PWYA 5J58A 3C48A 3AI7A 3KXDA 3MVEA 2X0RA 5FUBA 4B2PA 1AD2A 4BIIA 5IYZB 5IRCD 3WLHA 3A1WA 2ZUEA 1T5IA 4FP9A 3ZQUA 4RF4A 2ZULA 3WLRA 4RVSA 3CMMA 3LT4A 4KREA 3G0BA 5CMLA 1ZJ5A 4JOQA 4C0XA 1WXWA 4OJQA 1JLMA 2P4HX 2QLNA 2WQZA 3H17A 4FZ3A 5EQFA 5SYMA 1KEZA 4EO9A 2VHEA 1TTPB 3UHJA 4JJ7A 4A91A 3WKEA 4E2YA 1CSEE 3JZIA 4GVPA 5JHHB 4KEAA 2IF0A 3HJBA 2CVOA 2H11A 2OV4A 3HU5A 1J9EA 1GT6A 3ETLA 3JTMA 4FD2A 4FU0A 4R31A 4BBJA 3O8QB 2VJYA 1P5HA 1YULA 1TW3A 1JA0A 3CBQA 3J7TA 2GYWA 4P58A 2FPSA 3NHZA 5EHNA 3S44A 2NVBA 3UUWA 3OE5A 3TUJC 1YASA 3OZAA 1U28A 2KX7A 4AZ3A 2P2ZA 3WIEA 1UZNA 5KQPA 1PDOA 2G07A 3AIIA 4IOJA 4IQGA 1DFHA 2VDLB 2JHGA 4C05A 3AWDA 2XNKA 3IJ5A 3DC7A 3GLIB 1TYCA 1Q7TA 3AIKA 2CD7A 2CT8A 3G2MA 4YAJA 4S3MA 1HX7A 2IXEA 3OU7A 3QOXA 2WLTA 1BFUA 4YC7A 5KNDA 4D4HA 4CKCB 1L7AA 3L5OA 1UP6A 2EJTA 2FA9A 2JARA 4EFKA 1SUAA 3LT1A 3DEJA 2BONA 5K20A 1KMHB 5MFPA 1AQIA 2XSZD 1ZCBA 3OIGA 5TDHA 3ZGLA 2YS6A 5FH9A 4UVGA 4QLAA 2C8VA 2ICAA 3WFJA 2XNJA 4AG3A 1AIPA 1BHQ1 1PNRA 4EKEA 2J5BA 1OIWA 4X41A 3SZ3A 3W7AA 3EBLA 1UK9A 1YRQA 4FHZA 5DH9A 1YZHA 3B85A 3ESQA 2CGEA 4ZQHA 1QQ7A 5H3CA 1A7UA 1M2VB 1UT8A 4FFRA 4N0EA 4DLSA 4TUYF 1A4RA 2OOKA 3E9YA 1XYVA 1Q11A 5IDXA 1TJ3A 4JC4A 2SKCA 3I09A 3KT6A 5FUQA 2PUVA 3P9ZA 2CZCA 1CUAA 4BZZA 2QZ9A 2GJSA 3A27A 1Y6QA 3RVMA 4E1BA 4EARA 4JVOA 5U4XA 3EX7C 3LU1A 1HYQA 5LB2A 3A6EA 2PGDA 4D4MA 5JNRA 2O2GA 2JGKA 3QEJA 1NZFA 3N28A 1MJHA 1XN1A 3ZZUA 1JYFA 4KODA 2NQ8A 2HBZA 4OGWA 1EK6A 2II6A 2VDPB 4G4IA 1MH1A 4OQPA 2EP7A 2FUCA 5I9IA 5DRYA 3Q1KA 1HR0B 4WLUA 3IAHA 3JRXA 4MUEA 3ZEIA 1AGXA 3CF2A 3EGXA 3AERA 3LVBA 4W82A 2VF8A 3NVAA 2ACWA 3QY0A 2E37A 3L6RA 3SG0A 5LJIA 1EEHA 4LHSA 1H2ZA 3BAZA 3QLVA 2C9MA 4H1UA 4ZALA 4ZC1A 1EUCB 3SYRA 1GCOA 1KU6A 4REMA 4IXDA 2TMKA 1TCAA 1WUYA 2AWOA 3COWA 2AHOA 3MJVA 3QYJA 3OP4A 1VL0A 2IDJA 2NSHA 3CX7A 4KBGA 4Y9UA 5AVWA 3VR6A 5ELLA 4U39A 5AVRA 3LP6A 4OLFA 4OUDA 3E2PA 1STOA 3PWZA 5L3SB 3M7IA 5IBQA 1PS0A 3IURA 3N0XA 3QLJA 1TVCA 4PLPA 5L9AA 1KY2A 1XC7A 3C7DB 4N7BA 4C2TA 1J2UA 2IHUA 1H2HA 5DEOA 3NHAA 3CVYA 2A57A 2LUOA 2QT1A 3PRKE 3G2LA 1GAXA 1RP7A 2HK9A 3Q3CA 4RBNA 1BXRB 5BUSA 1RZRD 3T9DA 4GBGA 4P7FA 1VLHA 1Z56C 3P4YA 1GUBA 1QJCA 1P4SA 1QK5A 2CJYA 2DG2A 3BDIA 3C0KA 1PYOA 3U1VA 5DTEA 5BRJA 1E0KA 2WT9A 3DBLB 3G2OA 1XL1A 5EPUA 1J2RA 4P5EA 1G17A 5G4KA 4DMGA 1CVRA 5BSKA 4EFDA 4ILEA 4NL4H 3HU3A 1J2YA 1KMIY 1D2RA 4LCBA 4GXTA 2GPNA 1RAFA 3MW8A 1KK3A 4OFXA 5B12A 4EUSA 2YCBA 4MCIA 3E5RA 1JUDA 2VJPA 2YHIA 1ZN7A 3EGDA 1ORIA 1UDXA 4HDNA 1C4XA 4YRCA 2DH5A 2JASA 4DMKA 4RF3A 4M83A 1E7YA 3W5DA 2PO7A 5C8YB 4O0MA 2CL5A 2R7KA 4GBMA 4UDYX 4Y2YA 4R69A 3MWDA 4O3FA 4IZIA 5BYBA 1BE6A 4L73A 2FZVA 3DDUA 3JZMA 3I8OA 3SXPA 3TF5A 2F8TA 3GVIA 2IE0A 4BQIA 1MA0A 1RWBA 2PV0A 1XRLA 2HRRA 5DI3B 3ZDRA 1JG7A 1QRSA 1D8TA 3INRA 3L5KA 2H7YA 3CXUA 2CLDX 4C0LA 5GTDA 3RSFA 1OC2A 5I45A 1NBMD 3HA3A 2HJVA 3MD9A 1GNPA 1Y4AE 3CH5A 4ZK2A 5JYDA 4A36A 1E4EA 4JOBA 4XDHA 2P11A 4HWOA 1D6SA 2A0KA 2OT3B 2XWQA 1D4FA 4JP3A 4UEOA 3LY7A 3B7WA 3X3HA 2J4CA 3ZWDA 4DWVA 1Q3HA 1I5RA 3ESBA 1Q3KA 2QV7A 3FPLA 5DX1A 4CTNA 3WLKX 5IYZF 2BT4A 5J2UB 5KUTA 2Q41A 2ZRDA 3G2IA 5LQKA 1ELOA 2RGBA 1LNZA 3BCSA 4AICA 3KSAC 3CIOA 5K6AA 4EYGA 3HB7A 1Y9DA 1UEXC 4QYSA 4DCUA 4EQ6A 1TOAA 1DBQA 2O7SA 3C16C 3RVOA 3NBQA 2WMNB 4O4LF 3AKZA 3DCIA 3SEQA 1CFJA 2JGAA 1Q7CA 2D1FA 1EXNA 4MS4A 4ON9A 4NJMB 5FADA 5IAOA 4PC7A 5JXJA 2QL5A 4ABYA 4OFWA 4XWAA 1RZVA 3AG6A 2Q2WA 4NEGA 4PFQA 3L93A 1RD4A 2PNFA 4P8RA 3VNBA 1Z7WA 3AUFA 3CR3C 1FRZA 3EEIA 2ZZNA 1FYEA 1PNQA 3NXKA 1N32B 4PO1A 3HCAA 3FDXA 1SVNA 1JMYA 1T10A 2GCPA 2H48A 3G8DA 2I67A 3AB3A 3C6XA 5FJIA 4CTJA 2IBSA 2J3JA 5FI1B 3U7GA 3ZDBA 4DBLE 4CYMA 1M2EA 1UFVA 4UE3S 3RT7A 1YI8A 3G2KA 2PS3A 2QN9A 3C3XA 1UOQA 1ZI8A 4XX0B 1M6EX 3GROA 3ONWA 1ZD4A 5F2OA 2E0IA 3A6FA 1OR8A 3I4LA 1REQB 4JVNA 4E3ZA 5KCMA 3KM0A 1Y8ZA 1LRKA 4RSMA 2G0AA 5B6IA 4B73A 3A6DA 3PE6A 5CFZA 3RS0A 2GD6A 5IVDA 1YV9A 2WYHA 1JDNA 1XQVA 2XJ9A 1GXSA 4X8MA 2R4QA 4DBLC 1R0YA 4YA6A 4CQJA 1JS1X 3ZW7A 4BNGA 4E32A 1HQDA 5KYUA 3KP1A 4HWRA 2QIOA 3NNDA 1BE0A 5FBLB 4AQYB 2QTVA 1RLUA 2B1QA 4MUYA 1N0WA 2X2FA 3VHLB 1U9YA 2WUEA 3PX2A 1TVKB 3FMGA 3LPMA 3NOVA 1VB3A 1CXZA 1MJ5A 2PBRA 2BIFA 3CX3A 1YT5A 1L5KA 4BZPA 1UBOS 3BF7A 1SC9A 4J90A 3H9CA 2W4QA 2FSSA 2C4TA 1H94A 1N5OX 4HADA 3KJNA 5EA2A 5B7NA 5HK9A 1L4HA 2DLDA 4HQ0A 1IK4A 2CE2X 1X9IA 1XL0A 4LFBB 2IYAA 1P7ZA 1KZ1A 7AT1A 1JNYA 2IHBA 3LNTA 4WECA 3UEOA 4Z4FA 3TGWA 3QM1A 2ZB4A 1QHHB 1QFZA 1E3LA 4OSPA 5LP6C 1ZUNA 3M82A 2BFPA 1Y8AA 2YZKA 1G20B 1MPXA 5I8WA 1P0CA 3BFVA 3E2IA 2CDAA 1PGOA 4FILA 4LBYA 4KUHA 4OAQA 2JAWA 4D8UA 3JQ8B 4RY8A 2ZI5A 2I65A 3HHEA 3OLZA 4PHCA 1W36C 1ND6A 2N3ZA 2ZR8A 2BRUC 1PYGA 2FETA 2ECKA 4EJ6A 3OZ7A 3JVEA 3JD4A 3LG2A 1GGNA 1D9XA 1VLVA 1E18A 1VZ2A 3SQDA 1LEHA 2P2YA 4J91A 1K6XA 3F8TA 4I3HA 4Z3OA 4UPVA 2Z43A 4FYXA 4P7BA 4F3NA 5T4EA 1CE8B 1YCHA 3OEHA 4E03A 5JEEA 5H5JA 4FIDA 1UZAA 2WDZA 1SIWA 3RFTA 2R62A 2PYIA 3KB6A 2ATIA 2XMRA 4NC9A 3FUVA 1UJNA 1W25A 4JQZA 1C14A 1NQVA 3LIIA 4WD3A 1Z4PX 4C7MA 1D2MA 1DO0A 1RRKA 3IUBA 4IJMA 5BSVA 1ZAYA 2ZJBA 3BTUA 3I8SA 1YB1A 1KIAA 1ZIPA 2GHQA 3O8OB 3BIWA 5EXSA 1JALA 4ROSA 4RYDA 1U2GA 2CLLB 1C0PA 3BERA 4Z4QA 1PQPA 4BL5A 2J5XA 4CKBA 4ZVRA 3SP1A 4GOKA 4Q4JA 2RI6A 4D41A 1G8YA 3QPBA 4LKOA 3NIFB 1PEYA 1A88A 4JHXA 2WPDD 1QK3A 3GLTA 4A1OA 3F7OA 2ZBPA 1KXJA 2PWPA 1TZJA 3CH7A 2C5AA 3N6XA 4PNHA 1T15A 3WKBA 1YOVB 2ZUSA 4QYMA 1IK6A 4LI0A 1W9HA 1SVKA 2D2EA 1L5OA 2GF9A 2ZJ5A 3NHYA 3PQDA 4K9MA 4IO1A 2YXBA 3M1LA 4QT0A 3ZCXA 1F4VA 1PJRA 1RYFA 1U8XX 5B1EA 1EJ0A 1V8OA 3PRYA 2RHWA 1KKLA 5FNVA 4WZBA 1SQFA 3FAZA 121PA 2DUJA 1MP0A 2P9HA 2BEKA 2V6BA 3T99A 3UMFA 1QIEA 1VCIA 1U0TA 4KQEA 1IXSB 4JLUA 2H1LA 3RQIA 5G0WA 1XDDA 2B35A 5AOCA 3CKMA 1FCJA 1EZ4A 1CQZA 3ECSA 3STYA 1MQSA 2SKEA 3AF0A 2PTHA 2DJ5A 2QEQA 2ZBDA 4NICA 4RH1A 2L69A 3MTDA 2XVAA 4FN5A 3ANYB 3IT0A 4FHGA 4UULA 3QOYA 4RJJA 4HB3A 5CIQA 3DWGA 3O0TA 2O2EA 4PHHA 3MCZA 4PN3A 3VPFA 5ENZA 1SM4A 3QMMA 4KO3S 3NNSA 4L8WB 1EBUA 2FOXA 4UATA 2F8LA 1SBQA 5CXSA 3SBDA 1EJ6A 4URVR 3ASUA 3S2GA 5CJ2A 4RWEA 3F6SA 4C7BA 5C8YF 2XSZA 4ZVSA 2CYAA 4Q9JA 5JS7A 1SCAA 1V47A 5D7NA 1PW5A 3G68A 2EP5A 5CB4B 1G5IA 3CLSD 2EJCA 5K2MA 1OXBB 3A6KA 4FC7A 3EOBI 4C3ZA 1W2HA 5TQ2A 3W2GA 1I7QB 2OSBA 2PRYA 2W0MA 2BWJA 2LVBA 5EJFA 4LJ4A 4BP8A 1PLLA 5BSEA 1YZVA 1J07A 1D7OA 1T3ZA 3RSOA 5FPYA 1XLTA 1UPXA 5JSYA 3V5NA 2KHZA 5AVZA 3ELWA 3N3BC 5LOVB 3A32A 4UDXX 5EKDA 1OWOA 3PNYA 3IUEA 5FTWA 3BGVA 1T6ZA 1HXHA 5JISA 4GI7A 4CEHA 4MYSA 5LZ4A 4UEQA 1DQYA 3QBEA 3NYRA 4FDAA 3V4PB 4GXRA 3DOFA 4F4JA 4JI8B 1FDOA 2Z3ZA 4C4PA 3HYLA 1QE0A 1CJMA 3CRVA 2NVUB 3T7JA 1A27A 3DTTA 3O92A 1CDZA 2H1FA 3PPIA 4AXXA 3QEBZ 1BU5A 4AG5A 1W2GA 4I1YA 1PSZA 5J2UF 1X1CA 2VJMA 4ATNA 1V7QA 1ORWA 5L53A 1PWHA 2FAXA 5C1BA 1DX4A 1XSEA 2ZPUA 4ARCA 2Q21A 4RZUA 5B3JA 3CZ5A 3W9SA 4BNJA 2FK8A 4W6QA 1XKTA 4F1WA 5KX5B 4B3MB 5GVSA 2DY0A 3AR8A 4HVAA 4OKSA 5AXDA 1YRHA 4A0GA 2OEPA 2OAQ1 4J0GA 5EKXA 3TOCA 3RM3A 3SYKA 4Y8VA 3PD1A 3TBKA 4EZIA 2QUZA 1KNQA 4M7WA 3E5MA 1BXGB 4F85A 1AS2A 5DLDA 1ZNWA 4MWTA 3VGJA 5C53B 2O1XA 1LPBB 1DMRA 3TDKA 1EZ1A 1WF6A 4ALLA 1GPAA 3IKLA 1JB9A 5ERYA 3F4KA 3FUUA 1C7FA 3CB2A 4PTZA 3MOGA 1GKLA 3BN3A 2Q7XA 2RHTA 4FINA 3UK2A 3K3PA 1QFMA 5JYEA 4P0PB 2XMDA 4FGZA 3WYDA 4B2YA 4QUEA 4TUYA 2FMTA 2Z9BA 5CYOA 3Q1LA 2W2TA 1IN7A 4E12A 1QB8A 3I2KA 4RDIA 3WTBA 2A78A 2OCBA 2YV3A 3JARB 3TIFA 3U3DA 3W1EA 3O26A 4EF5A 5AW4A 4R05A 2J46A 5JDIC 4LCJA 5JAQA 4K87A 1A5AB 1E64A 3INGA 3HXOA 3A4LA 3NC0C 4NYIR 3SDBA 3ZWWA 1B93A 4CQLA 3IBSA 1T8UA 1WJGA 2NIPA 3QXSA 4DR5B 3DBOB 4RCVA 2LIPA 2Q9CA 3T7EA 1KZ7B 3BMQA 4DT1A 3B3QA 4TMVA 4PG5A 4TTPA 3S1AA 1LC3A 2JK0A 1C0LA 4HL6A 3V4OA 4PWZA 3UOAB 1DTEA 3CXRA 1HPLA 4G01B 4XB1A 5AW6A 1DADA 1N25A 1ZA1A 3TSAA 4G5FA 1Z3CA 4GLJA 1CF9A 1EDBA 2WTXA 4YUWA 3DWEX 2A3RA 2JJYA 3EVBA 5BOSA 3MPOA 4BKQA 1ZHOA 1I7NA 4MQFB 5EIAA 1C4KA 1C8BA 1GLGA 4MRRA 4IV5A 2BJHA 2IPXA 1IBCA 3L1JA 2BSAA 2YX1A 2EW8A 2IGBA 2ERXA 3P4XA 4ZO8A 4WK2B 2ZETA 4Y1RA 3NH9A 1U5AA 1X2BA 1OX4A 2ONCA 3WVNA 4D3FA 3COJA 2MINB 1OBFO 3NV7A 2WB2A 2GCNA 1KH1A 1PJ2A 1PEKE 4F86A 4UPDA 4WBXC 3ZD7A 1W4LA 4UCWA 5AJYA 5IFKA 1GPJA 1M54A 3EEYA 4WKNA 1J20A 4PHTA 5JS1A 2TMYA 4L4ZA 4V0QA 2R1TB 4R16A 521PA 4OM7A 4HGPA 1PZNA 1TD9A 1JR3A 5TEWA 3NI2A 4D4IA 2W6PA 3F2IA 1NVVQ 4TKUB 1KPIA 1Q6YA 5ALLA 1NVDA 2TSYB 1NBMA 1XLWA 1U3TA 3VZCA 3WBJA 4BFSA 4ZDJA 3LCRA 3C6QA 3A1UA 1KY3A 4XCQA 3SSMA 4IJ6A 2GN0A 5EXPA 5F3RA 1WHTB 2J9YB 5DX0A 4QOHA 3ZWYA 4TZKA 3IESA 3NPAA 1TO6A 1K98A 2F9FA 3KUCA 4QUGA 3OQIA 3RI3A 3U7EB 4XSVA 1IQRA 2AFIA 3E9MA 1OHHD 4GSLA 1CQIA 4KE7A 5K09A 3TSYA 1MU0A 4PXSA 2GZSA 5E9QA 1Z15A 1E20A 13PKA 1S5PA 4UMDA 3C39A 1GG2A 3RHTA 4EVQA 1E8MA 2FJ0A 1UEIA 1VKHA 5H80A 3K1TA 1G0NA 5ALXA 1JG2A 3VO8A 4OHXA 3CWCA 2JJ1D 4GW3A 1QHXA 1CY6A 3ZHVA 4H7HA 1U7TA 3FPAA 1YC5A 3EXHB 2G9ZA 3KRTA 3QFFA 4URWR 3VOSA 5H68A 1VP9A 2BMWA 2YJTD 4BEWA 1ENPA 2GJKA 3TOVA 3U13A 1JAXA 1KYZA 1MHPA 2ZTUA 5DBEX 1TZCA 5K45A 5E6UB 1XZDA 1KJQA 3HRIA 4R2XA 1GKKA 2IZ0A 2Q9UA 2GAJA 3DV0B 4PX5A 4KHPB 5EIBD 2VP3A 4BQPA 4QDXA 1E0SA 2X6TA 3IBYA 4J94A 5BN5B 1YE3A 4HB4A 4GR9A 1XRPA 4XIIA 2XKAA 4GKKB 1O3YA 4J0HA 5TLSA 3RFXA 4FXOA 2QZ4A 4D3YA 2CUKA 5DU2A 3HYTA 3KAJA 4LDPA 4A2WA 3V7WA 1YZQA 5GGXA 3CRNA 3ORFA 3DVLA 4UCQA 1KQNA 3KLBA 1XOIA 2NUAB 3PXAA 3DZDA 4HDRA 3R9XA 1N4AA 1PJAA 3FYHA 3D9QX 3DMGA 4QO7A 3U4DA 3N2KA 3AC0A 1XZFA 3QUCA 1AS3A 3AZOA 3I1FA 4Q21A 4TTRA 4P4SA 5JPIA 4DVJA 1FJHA 2JLSA 2I54A 3QVXA 4NBNA 4GLOA 4NV3A 4FDVA 1O0SA 3DYVA 1Z29A 2I4TA 1KSJA 1JQAA 1KJWA 5A4AA 3RIHA 3QHAA 2QJWA 1C8LA 5CB4F 1U3UA 1FTYA 1X74A 2I55A 3ILYA 3U9LA 3UFBA 2D4HA 3DL0A 1N57A 3QVWA 1VG8A 1Z2EA 2ZIXB 1PTJA 3K1AB 4N3NA 4O4LA 1S3IA 3WGUA 1PR6A 4MB0A 1FRFS 3NM4A 1VPLA 3U17A 3ZLUA 5C81A 5LOVF 2DGDA 4DRYA 2VF2A 3DUFB 4KR9A 3A6LA 3B48A 3O8QA 4I4LA 1OW3B 5CITA 2NP7A 2ZS9A 5DF1A 3BD6A 2J0EA 1OROA 4N41A 4RZSA 3T5CA 4QGHA 5AW1A 1HEIA 4RVUA 3V6MA 5BVHA 2RGYA 5F35A 1G3UA 1BROA 2WFMA 3WYCA 3JAMA 1JFRA 1YMQA 2JJ8A 3NORA 3UJCA 3ZI7A 3ENZA 3IAFA 1U4NA 3C1TA 4DA4A 3GLIA 2AOUB 2R65A 1DEKA 4Z5XA 4CDMA 4I14A 2P41A 2WM8A 2GK6A 2YJZA 3D3EA 3ROTA 4N3CA 1L7MA 3OFVA 4FLFA 5TARA 1XLUA 3PWSA 4YCDA 4LGMA 2GSDA 5AVSA 1IM8A 1I2MA 1N2CE 5KX5F 5SYNA 2PXHA 4RXUA 3ADCA 3BB4A 3LUHA 1JEJA 4NFLA 3EY4A 3ROKA 1G9XA 1B8NA 1ZWLA 4N12A 5DYWA 1O5OA 3CVOA 1TM2A 3FDZB 3RPEA 4HLUC 2ZBUA 4LTDA 4TMXA 1K7FB 3GFRA 4CN9A 2JZOA 4FYWA 1KFCB 4PAWA 3WNVA 4HWGA 4LJ7A 4F2GA 1RYNA 1FYFA 1XHEA 1Y63A 3UYLA 2MR6A 5JJKA 3EAGA 1ZJ6A 2B94A 4IVPA 2M6SA 4JGIA 3S29A 3K9CA 2WPDA 3I0ZA 2RMKA 1FNNA 1E66A 1PSDA 3L1UA 3LWBA 5C8DA 2QQ0A 2Z98A 1X13A 4TPKA 2XB9A 2XCTB 2XRZA 2Y2VA 1E3WA 2O2ZA 1JIQA 3BHJA 3C7KA 3WNDA 4KFUA 3S2FA 4EX7A 2H2WA 2GTIA 3JQCA 2V3CC 3GUUA 4EQZA 2BFEB 1MX3A 5HXAA 2X8BA 4LV6A 3ZQKA 5DVZA 3ETJA 3TJRA 2XQVA 5F5XA 3B2NA 3WO0A 3FJ1A 4TVBA 1HT3A 2E18A 3BD8A 4EHDA 3N75A 5AVTA 4JD5A 3RC1A 3V4RA 1U1FA 1J0XO 2B5OA 3JQAB 3LQ1A 4F91B 1JKJB 3AR3A 3CO0S 3EIHA 4KQWA 3FXAA 3AVTA 1WPXA 1NXSA 1DVRA 3NBUA 3DXZA 4OQMA 4RK5A 4B5LA 3IEIA 4POAA 3WGZA 3FRHA 4WCFB 4ESVA 1R8XA 5CVDA 1ZN2A 1ZH4A 1EK2A 2IPOA 3CNEA 1NXVA 3GGPA 3QFTA 3FJOA 1X42A 3U7QB 1U63A 3TD2A 4WK0B 2BTQA 1FQKA 3LPAA 1USIA 2O48X 2HA4A 2VWHA 2Z4TA 4G1MB 1U6IA 4M88A 1QLWA 1H4SA 1AK9A 5DTIA 4C2BA 1EUCA 4LHWA 4YJ3B 4C4RA 2F3RA 4C1NA 5K3OA 2IEDA 2ZIEA 1NN0A 2AC4A 1KEWA 4PZPA 1S1CA 5DGHA 2G1AA 1E5DA 1SWWA 4MS1B 4RJ2A 5DTJA 4NCKA 2FRXA 3B1KA 4HNHA 1I10A 3QJYA 5L3SA 1U28C 2XQKA 3SKXA 1TVMA 2O20A 2OKCA 1UXJA 4B3DA 2L18A 5C37A 3R24A 4MI6A 2O3JA 3KSZO 5A3RA 3C74A 3C8MA 3GZJA 3TW4A 3U9TA 1PT8A 1ONSA 3NAQA 4N1AA 4AVYA 2FDCA 1RDFA 1K3FA 3NHFA 4TTAA 2PH7A 2CB9A 5LR6A 4R8LA 4ACAA 2RHOA 4L27A 4NBUA 3B7PA 3OZXA 4H7DA 5K4GA 4QXOA 1UOEA 2POQX 5G3YA 1M76A 1QZXA 1U1DA 4NPCA 4WN3A 2K4MA 2BUBA 3T6KA 4HNSA 1GTRA 3IKJA 2V9PA 4F4HA 3AR5A 3VAYA 2W22A 1CS0B 5EMJA 4II7A 4M87A 4KLZA 4E2FA 2D59A 4CFZA 2BVNA 1X0XA 3D4LA 3P0EA 3QIAA 3X2EA 4BTLA 1IMJA 4TTJA 5A6SA 2QAJA 2ODAA 3SYTA 2J59A 2PRKA 2EW1A 3G85A 2YOHA 2IRWA 5IT0A 2BFDA 5ED4A 4HPJB 1MDFA 5E95A 3IDAA 2ZYUX 1J33A 5C8YA 4D9GA 3WWYA 3UK6A 2GR9A 3ZXXA 4F9FA 3LYAA 1FMFA 3AUYA 3UAVA 2B30A 4EG4A 4B1FA 1I5OA 2H4ZA 2JRCA 4INOA 4DIEA 1XQXA 3O82A 5A62A 3OQ6A 1B76A 2COEA 2IP4A 1SD1A 2XF2A 3GIDA 4XLLA 4CM9D 1WPRA 2W6CX 1YB7A 2EZ4A 1DLJA 1FX0B 1H9AA 2REBA 5DI3A 1Z34A 3ZHRA 4OXYA 3ADDA 1P7VA 4GPZA 1B0UA 2B8EA 3GVPA 3T1QA 3QFHA 3WOVA 3QYFA 2IYEA 4MUMA 4MMYB 4I5GA 4JAVC 4I5DA 5FWAA 3UATA 2GHIA 3HJFA 4QWWA 4HDKB 4FYYA 4A73A 5MGNA 3D3WB 3O4JA 2JCGA 3O4RA 4IWNA 2J9XB 3KVYA 3QLVC 3ZW9A 1VA4A 5I7AA 1KQFA 3ROMA 4IMPA 1HA3A 4HG2A 4AM8A 1ZD1A 5J2UA 4YPFA 5DIFA 4MYCA 3SMVA 3HN2A 3U31A 1QPBA 2GXSA 1UBHS 2DFNA 2ZREA 1R0BA 2H1IA 3I1JA 2YNMA 1KK0A 5GOZA 1OKKA 2O3UA 2WYUA 2HSWA 3WQRA 1XXLA 1J21A 221PA 1H3NA 1LLFA 2X1LA 2X5XA 3OF5A 5JAUA 1IN1A 2OHJA 2HGZA 2LIVA 4L7QA 3UAYA 5KMGA 2DR2A 2A5JA 2P27A 2B2XA 5E9WA 4E2XA 1NN5A 3ABIA 4Q1BA 3NHBA 4LRWA 4NJMA 5COAA 2WQ6A 5HWSA 1QJ4A 2F64A 3E9CA 1KFBB 4JI5B 5BP7A 5LC1A 1SG0A 3OKPA 3Q7TA 1XB2A 3G9TA 2SHKA 4JGGA 2D0DA 4YRDA 3CLRD 5A7HA 4Z8YA 2CMFA 1MB0A 4DLNA 5C5DA 5B53A 2VK8A 3LPCA 3FG9A 3RVBA 4B45A 1BYIA 1BNCA 3DEYX 4LGYA 3PRHA 4ZQIA 1WY5A 2JLXA 2Q4OA 1FTNA 2WAOA 5TS3A 3SJ7A 4RHCA 4DBVO 3VAZA 1V39A 2DSNA 1M75A 4XX0A 2O50A 1I0LA 3T4EA 2XBMA 2OAGA 3TZ6A 5CBPA 3QU4A 1YL6A 4I19A 2JH9A 1W46A 4OB7A 4U9IS 2CJXA 3MJDA 4P38A 2ZBRA 3U19A 3CT6A 4XJXA 2I78A 2AQKA 2H9AA 3I61A 1WB4A 2WF7A 2YVLA 4JR0A 4PZYA 3MFQA 4EB6B 2X8JB 4B7CA 4QM7A 3RV4A 2OLKA 2PBFA 1KYVA 5KYVA 1BE8A 1J2EA 4G25A 5E9AA 3ZU6A 1JU4A 4P80A 2Q3DA 1LDBA 3RWOA 1MG0A 1W2WB 2DUUA 3NIDB 4DSAA 1R8JA 1R8QA 1T9HA 2GF0A 3B51X 1M5TA 4YPVA 1OHHA 1QB7A 1E2PA 4R2JA 4WZAA 2RK3A 1E2JA 5CLLA 2G4VA 4C7OB 3AXSA 5CRIA 3QOFA 1LRLA 2IYSA 2VHWA 1NY5A 3M81A 3UAWA 2NW6A 1SCBA 4D9EA 1FFYA 5BT9A 2Q5OA 1DCMA 5LZ5A 1V16A 1ZMXA 2VHCA 3WG9A 2VHYA 2JJ1A 2OM2A 1E9VA 4KI7A 2Z0MA 1G20A 3JV7A 3R3VA 3NETA 2XXBA 1TQ6A 4MVWA 1G5HA 4FKZA 1B7GO 2ZDGA 3JQ8A 3H2YA 2NPIA 1L7EA 5EJ5A 2AG5A 3U09A 4LY0A 2G71A 2AG1A 1T8TA 2OC9A 1K08A 3H13A 1INLA 1OBCA 3EK2A 4FEYA 3IAEA 1Z75A 2WP8J 4KQCA 1H2YA 1UMCB 1CNFA 1CU1A 4LX8A 3KU1A 5DHRA 2ZSJA 4ARVA 4MIKA 2F17A 2BMVA 2ZRJA 3ESZA 1LPNA 4RVGA 2NZUG 5CXXA 2X4GA 4BO7A 3EPLA 3AX6A 1CE8A 4XRGA 1QU2A 3LTEA 2IUEA 2Q8QA 4L02A 5K6AC 2LE0A 2Q6LA 3BRSA 1NG1A 3PHBE 1GU0A 4G4JA 1O96B 1EYZA 2FWMX 1RTTA 4N39A 3FH0A 4BWVA 3BWCA 3R6LA 3BULA 4GUAA 4P54A 4OSEA 1F8GA 1TIPA 3O8OA 1SVUA 3E0XA 2NG1A 4HO1X 3ZE0B 3NTXA 4IIGA 3MK31 4YJ3F 3FTNA 5KSPA 4DA7A 2QNBA 4ZVVA 1AZWA 1RRFA 3I0NA 4JBWA 5ALHA 2QQFA 3AL2A 1L8OA 4BUCA 4U4AA 1I2CA 1FPQA 3A3NA 4EY8A 2AK2A 4WE3A 3S27A 4C5BA 4LA4A 4W5OA 3EGEA 3RSHA 5KQSA 3CHYA 4R0MA 2QRHA 3I76A 1O97C 1XTJA 5E4YA 5CT4A 1TUIA 1ODCA 1ZY2A 1WSBA 3PPYA 1FK8A 4IDPA 4BVBA 1ZEJA 3PEEA 5CNKA 4DJAA 1NHWA 3GLFA 2ZTMA 4TKVA 2ZWIA 1VA5A 4MQ6A 2PUDA 3AF6A 2BR5A 5HUHA 4QVGA 3H04A 1D1QA 1SXIA 2WTAA 2ZSUA 3GUZA 4DOMA 4U7HA 3IDFA 2PH3A 5J4HA 4Q18A 3B38A 3NOOA 3RRNA 4D74A 1Y9AA 1E32A 5I51A 3JQAD 4E31A 3LQKA 2BI8A 3ZK9A 3CX4A 2Z57A 3BWEA 1PP4A 2R1ZA 1NNEA 2RHBA 4UFNA 4IMIB 1ZZGA 5H16A 1CQPA 1VIAA 4P9NA 4DCGA 4E2WA 2CFRA 1Q1GA 2E21A 4ZK6A 4ZU6X 5GJBA 1W0KD 2G80A 3COPA 1YE5A 1RWNA 2DT8A 1HSZA 1Q2UA 2KMLA 4QDOA 4YLYA 4GRDA 2QXUA 2XMBA 4UXIA 1RWXA 1SCQA 4OREX 1P2SA 1HURA 2DBYA 1QAOA 4M53A 1SOUA 2C5LA 2RB4A 1EI9A 3TI7A 3LIPA 5HZGA 5LWQA 3JD3A 3FUXA 2VAPA 4MEAA 1FXWF 2VK2A 3HY6A 3KJFA 1JHAA 5BW4A 2D62A 3KSRA 3LL4A 4G5XA 3DHYA 1RHKA 3OHPA 4S2EA 3ONDA 4CM4B 4NBVA 1N75A 3IA2A 3CVUA 1HDZA 3LJKA 4XOUA 2PL9A 5EMMA 3LDAA 3R8XA 4FGKA 4LQDA 3PSHA 3ZV5A 3WMEA 5LQRA 4OGLA 5LOVA 2VPXA 3KVRA 4JR1A 3HB1A 4E30A 1AZSC 2DPHA 3BWXA 1DAFA 4O0LA 1JBKA 1SC4A 4M89A 3L0CA 4GO1A 4MA4A 1E2BA 1J56A 1FYXA 2N1MA 3V8RA 4DY4A 4PBTA 3WK5A 4YP6A 1MTOA 1LF5A 1U8AA 4H0FA 4PR3A 2H6EA 4EHHA 3IMKA 2NVUA 3PNBA 2RAVA 2NUPA 1W73A 2YMQA 5HR5A 1EESA 3MF4A 4I99A 5IWCA 4EECA 2Z08A 4AW9A 4EI2A 5B36A 2VDKB 5HX7A 5ICGA 5FHQA 1U2GC 1V0JA 2PYDA 3EZFA 3IBFA 2YV4A 4YCSA 4ZDIA 3H4IA 1QYWA 2W48A 3PKZA 1PUJA 1NM5A 1SUEA 5F12A 4AG6A 2ONJA 4WBSA 2WPNA 2YC2C 1VKZA 2DHRA 5A5EA 5IT9A 4OHUA 4WZBE 5HCNA 1GTJ1 1YJBA 3OO1A 2AC2A 4DCPA 3DV9A 1OTHA 2HNBA 3F47A 2GXQA 4WEQA 3U3RA 1TCUA 2X5NA 1HUQA 5EJ4A 4ZMBA 1QK4A 1M8JA 1HEYA 2JFXA 4HKTA 3EXG1 4QQRA 3WDKA 1BXGA 1CDDA 3E8MA 3A8TA 4GEKA 5JXGA 3KXIA 2PX4A 4G0QA 3CTMA 4QGBA 2HK8A 3I9JA 4F45A 4U2GA 1W8IA 5IW8A 1DO8A 5CH5A 2Q0XA 3I1IA 3EQ6A 1Z5NA 1T6NA 1PBTA 2ID7A 2LCQA 4AJ1A 2RBKA 4TL8A 1KOLA 4OX9Y 3ZI0A 4JOSA 2B1JA 2DUWA 2FPOA 5ESWA 5I7SA 2WILA 3MT9A 1DOHA 1W5EA 4R9SA 4W8OA 2P7IA 2I1WA 4HFMA 1NJ1A 1QE5A 4WX2B 4N6OA 5EP3A 1WVGA 3HABA 2DHCA 2JGDA 2CFCA 3O0DA 3GA7A 1A9XB 1VM6A 5FI0B 5JH7B 4NZPA 2FEWB 3ETDA 3WX0A 1SHUX 5SY6A 1HZZA 4DS3A 4YAUA 3F9IA 3R7BA 2HQRA 4M8NE 3OZTA 2VAVA 1K75A 4RCZA 2F8SA 2IIQA 1TEVA 3GBVA 2B1IA 2WIJA 5EWMB 5K4AA 4EX6A 4WOCA 5BR1A 2B69A 3KKNA 1SY7A 4WLNA 2FR0A 1FTWA 3GUCA 1FRVA 1MB4A 1I3MA 4WACA 2X41A 4NF2A 4URXR 2V58A 1OZ0A 1VE3A 4RETA 2NNWB 5AP9A 1IN4A 2AUMA 1E79A 2ZJ4A 5ITVA 4M9CA 5D1HA 1T6XA 1P29A 3FCEA 1HL7A 4JJ4A 3FZGA 1WSDA 4FZVA 3Q15C 1YS1X 1L3CA 2Y2UA 4MQFA 2J0VA 4PBRA 1PFWA 1YRWA 4TTQA 4D26A 3SOZA 1QLHA 4H7IA 3KB8A 2FPGA 4KJZA 4HX9A 4E5PA 1JQKA 2YVAA 1GEGA 3LX5A 3U62A 2XUZA 3IT3A 4EY7A 4BNTA 2PD3A 3WWDA 4DTCA 4D0NA 3DHVA 2GYUA 5T57A 1OCEA 4DDKA 4YIKA 4FFBA 2JLCA 4QYXA 5C7LO 4NMMA 4CNBA 1O6BA 4V02A 4E13A 4CM9A 5DBFA 2R1TA 5JNVA 4DA9A 3FGNA 4TXLA 1CF2O 4F7WA 3KUXA 2XUKA 4JYBA 3VYUB 1OYOA 1J8FA 1X1AA 3EFBA 1JSZA 1FLNA 3MWYW 4GQAA 2PZAA 4JJIA 4ZU1X 4R9VA 1DDOA 1J8DA 1JKMA 1VECA 4CGZA 4X84A 3KLOA 2VT2A 2D06A 4FMCB 4B0OA 5IUNC 2NV2B 5U9CA 4LWPA 4OLAA 1CHNA 4RGYA 1P77A 1E61A 1NKTA 1G66A 2D5LA 3MYYA 3O2NA 4PRLA 1XZ8A 5L3QA 1MIOB 4ZYYA 2Q7OE 4Z4EA 1LBTA 3UOGA 4DADA 2NU7A 3UAXA 3VJMA 3P2YA 4C4OA 1SZPA 1SWVA 2FXIA 1ZUWA 1B6SA 1G8HA 4W99A 1FP4B 2ORIA 3K15A 3ZDAA 3UB3A 4JR2A 4YDHB 1AMOA 3L0IB 2VTVA 4J16A 2W2MA 4TZTA 5AI0A 1J5PA 3JWHA 3K1ZA 4GR5A 1Z5PA 4Q3BA 3DW3X 4QIHA 1OA0A 4XIYA 2WY2D 4ENUA 3IFSA 1XTRA 3EZ9A 4FQ8A 3EASA 4ALJA 1YIAA 3GAZA 4YEDA 1NUHA 3EXHA 1XZBA 4ALKA 4X1OA 1PR5A 2RK4A 5HKKD 4H0NA 5KNLA 3A1CA 3N05A 4RKFA 2ZAOA 3EDQA 5HIMA 2RC6A 3F9CA 5TF4A 1QM5A 3PVCA 3LXMA 4UARA 5GMOA 1Q7EA 3IGFA 3ZXYA 4DLZA 2BGLA 3OURA 1P6QA 5BN5A 9ABPA 3HGTA 3RF6A 1NSTA 2O7RA 2Y99A 4L5AA 2Y0BA 1WSAA 2IODA 2IYRA 2FSHA 1QIGA 1RPZA 3FLEA 5YASA 4CV3A 3DO5A 4NU8X 2EL7A 3HDQA 2A30A 1TQ2A 5JNWA 4Q3OA 1NFRA 1EFKA 2PX2A 2QAIA 5JS8A 4MJ7A 2GDJA 3VGPA 2QW0X 2NYAA 3RC2A 4LV5B 3LLCA 1K1EA 3CVXA 3B36A 1DKPA 4QNRA 4KAAA 3TECE 2JFBA 5TQ2B 2IITA 4G2NA 4O5AA 4UTNA 5A5FA 3R7WA 1IG0A 3FW1A 1NBME 1T2AA 3OA2A 4MNTA 2HA7A 2W2PA 4P08A 3W34A 1QORA 1DL5A 3KHTA 1TFUA 1SC3A 1V3QE 5CX1A 3TJZA 5ER9A 3EDRA 5HJEA 1GEEA 4C9BA 1Q7RA 4TV9A 1D4ZA 1IH8A 1THGA 2CMGA 5DSXA 1LDMA 3IEXA 3H3FA 5JJCA 2QN3A 1IOLA 1Q92A 4LZNA 1SBNE 1B14A 2Y77A 4Q3DA 3VKWA 2AFIE 5LQMA 4GMHA 2HIAA 1Y80A 3LC0A 1HNZB 2IDMA 1S6YA 2WJIA 2GTPA 2VA8A 4OJYA 4PX2A 5HTKA 3RSLA 1JZSA 1P0QA 1U7XA 1TGVA 1JSRA 2GCGA 4R1TA 5CJPA 5KYKA 4S2UA 2PX3A 2AR9A 2FSVA 3NP9A 1OILA 1YA4A 2VXBA 2HB6A 4ND8B 1DINA 1L4YA 1P9NA 1RMQA 2A1UB 2AZ4A 4J0JA 4NIMA 1ZJYA 3AZPA 4UM9D 3LCVB 1MB9A 2AOUA 5AKJA 5EC8A 5DW0A 2UZ4A 1KJNA 1UC8A 2QT0A 4BXOB 2HDWA 1X7ZB 4Z4GA 1NR5A 4YRQA 1DRVA 2AOXA 3E22A 4FKBA 4G5RA 4N0DA 1LW6E 3DGEC 2Q5LA 3R0JA 4E4TA 3KKZA 4F2WA 1IAQA 5CB0A 1RLOA 3EG9B 3ZIAD 2NQ2C 1YE8A 3HB0A 2R2AA 1M2HA 3FDZA 3OCXA 3PC8A 3L8EA 4TL9A 4Q34A 3Q5DA 2V3VA 1DBRA 3LPNA 3F8SA 1KDZA 4RFSB 1N8NA 3NDRA 4BLWA 4KX3A 2I2CA 3A1VA 3SFZA 4TL7A 4EG0A 4FCWA 2NMVA 4O4IA 4N49A 3F7TA 4NZ9A 4KVZA 2W9XA 1TKCA 4XA8A 3RS7A 4CUZA 1DHRA 3WQHA 1Q2XA 3P5BA 5C3UA 1ULZA 2BFOA 4NONA 1HRKA 1G3RA 4FFNA 1KARA 4Q19A 5BSRA 3UJPA 1DIRA 4RCYA 2WU0A 3FYSA 2EFHB 3ER6A 3AHFA 1JSXA 3HN6A 3K1YA 4K9NA 2JIMA 3LNCA 2FSPA 4FFVA 2RI1A 4KQKA 3RG8A 4B6EA 1EBBA 3GPBA 1A1SA 1TYAE 1GCGA 4TYPA 5I7EA 4UNSA 3TJMA 4DG5A 2R6ZA 1ZUIA 2C57A 1Z22A 3M6AA 1MDBA 2XZOA 2ZDQA 1ZPDA 1XBTA 4WLVA 3DLAA 2BFEA 3OCWA 4X60A 3T9AA 5JH7F 5KHOC 4LF6B 3RYFB 2O5CA 2NXJA 4YT4A 4EZBA 3I2GA 3DDZX 1QHNA 4MLCA 1VI6A 5CPBA 4YMUA 2VR1A 1JI3A 4D43A 1JHQA 1YJXA 2AR0A 3M4JA 4QXAA 3G1WA 3JQAA 5FJJA 2QLFA 3UTCA 1U8FO 1IHYA 2HA6A 4R8KA 4D97A 1YJAA 2R00A 1J70A 4KAFA 4NZZA 5BNZA 4MX8A 2C2YA 1T0IA 4ECEA 3JR3A 1W0KA 2XUJA 3IULA 3M6MD 3OJFA 2FEOA 2LCFA 3QVUA 1DQSA 3U7QA 1AQJA 4BMXA 5D5HA 4CDRA 3TGLA 5FQOA 4BB0A 1KRXA 2JLYA 1Q7BA 1WP9A 1P17A 3QNMA 1G60A 2I4NA 3LP5A 5D51S 3AUXA 4GZ5A 1LS1A 4FGUA 5DTRA 3VR5A 5A1JA 3DL7A 4D5EA 1CP3A 4ONEA 3GA0A 4LF8B 5HNKA 3V8BA 3ZGZA 1IULA 5H8WA 4BV2A 4MS1A 1QU3A 1GAEO 1WRBA 2D0OB 4POOA 5B6JA 3UBTA 2PU5A 4BLRA 1MNQA 2YVKA 3FIUA 3SQMA 2HMYB 1N5MA 1TKBA 1AV7A 2QRUA 4M8KA 2CL7X 2GD2A 1VL2A 1W48A 2R7AA 2V98A 4XIJA 2ZI6A 4I7EA 3CMCO 4XQEA 4L07A 4EUKA 4YV7A 4ZYLA 5HJ7A 4OI0A 3E4CA 1KVRA 4MVJG 2F1JA 4RIHA 3DZFA 4WFQA 3IDZA 5ITSA 4DKJA 2PVPA 2R6AA 3EUWA 2F3QA 5FLKA 1Z13A 2YXNA 1Z8FA 4RU1A 2WJZB 1GARA 1XZCA 1SMKA 3B8HA 3G82C 3NBAA 4P34A 1TIKA 2OZEA 4LYEA 2ZRNA 2WWYA 3ZZMA 3KJQA 1J99A 1JYEA 1CHDA 4L8LA 7ADHA 3VOBA 2JCSA 4ENTA 2Q62A 4HCJA 1D6JA