3NWEA

Rat comt in complex with a methylated desoxyribose bisubstrate-containing inhibitor avoids hydroxyl group
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
213
structure length
213
Chain Sequence
DTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEINPDCAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Catechol O-methyltransferase
publication title Catechol-O-methyltransferase in complex with substituted 3'-deoxyribose bisubstrate inhibitors
pubmed doi rcsb
source organism Rattus norvegicus
total genus 76
structure length 213
sequence length 213
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2010-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3nweA00
3KR0A 4RSRA 3BKWA 2NYUA 2Q41A 1G8AA 4AZVA 2ZWVA 3FUVA 4P7FA 2OB2A 3MTIA 4MTLA 5DLYA 2NXCA 4XUDA 3NVKI 2NXJA 2UZ4A 4DMGA 4R6XA 3G5LA 3UJCA 2ORED 4IV0A 4BLWA 4M36A 3BWMA 1YUBA 5BXYA 2B3TA 2PX8A 3C3PA 1QAOA 3LKDA 1X1BA 3DXYA 4M37A 4AZWA 1XDZA 2IDJA 3FPGA 5ICFA 3VYWA 1BC5A 3GJYA 4FSDA 4QVGA 3SSMA 1KP9A 3T7TA 3HCBA 5KYGA 2IGTA 2NP6A 1RI4A 3E05A 3AWIA 3KQVA 4PYMA 3HM2A 3R0QA 4YUWA 5K0JA 2GB4A 2HTEA 3FYDA 4Y30A 5HIJA 2P3OA 3GRUA 2NXNA 3KQYA 5CD1A 1FJXA 3FPFA 5T64A 2XYRA 3PT9A 5EZQA 2E5WA 4HH4A 5E1BA 1NKVA 2H1RA 3REOA 2I62A 2ONYA 3G8AA 5KVAA 2O57A 4GF5A 5K0CA 3T0IA 1PJZA 3M6XA 3C6MA 3M6UA 5E9WA 3IEIA 2ZVJA 3P71T 5K09A 1N7JA 2BZGA 3A4TA 5FHQA 4FSXA 5E8RA 1AQJA 5CVJA 3EVEA 3CC8A 2PBFA 5CVEA 5CVVA 1R18A 2Z6AA 3BT7A 3P2IA 4LWPA 3GWZA 2AR0A 5KS2A 3GU3A 2Z6QA 2ZIGA 2ZZKA 3UJAA 4RVHA 2AVNA 3P9NA 4BLUA 4HGZA 3I58A 3HNRA 4FGZA 2WA1A 5ICGA 1UWVA 3B3JA 4DQ0A 3HEMA 1OR8A 3R3HA 5DTRA 2ZFUA 3NVMB 3SVZA 3GXOA 2ZIEA 4EKIA 5EHIA 4AZSA 5IKMA 2IBSA 4BY9E 2GLUA 2JHCA 2XBMA 1AF7A 3HCAA 4OA5A 2FYTA 2GPYA 2Y1WA 3DP7A 2O07A 3FTDA 5D1HA 2B9EA 1VE3A 2YXDA 2PT9A 1EG2A 4C03A 5LQJA 4GEKA 2IH2A 4CKBA 5BW5A 4QPPA 1FPQA 4RTNA 5FADA 2Z6UA 2ONZA 4ER7A 3UA4A 4HGYA 3LBYA 4PYJA 3ELWA 4DA4A 4DCGA 2PXCA 3JWIA 3PS9A 1P1BA 1M6EX 1H1DA 5P8WA 2XYQA 5G02A 3QV2A 3K6RA 5DRTA 2PGXA 4HSGA 2YVLA 3G2QA 4Y2HA 5DSTA 4PYNA 5EMLA 3F4KA 2PKWA 3BKXA 2R3SA 5EQJB 1XCJA 1NW8A 4PYIA 2CL5A 4QDJA 5EIFA 5EOVA 1SKMA 2QY6A 4U7PB 4BP1A 3LDGA 3HCEA 3FYCA 5IH3A 5H02A 1L3BA 3FRHA 1FBNA 2H11A 4IKPA 4HTFA 2OXTA 1VL5A 4OX9Y 5DRYA 5EKXA 4CKEA 1NV8A 5CIYA 1V39A 1X1DA 3UJ7A 1KPIA 2B2CA 3HCCA 3M33A 4OBXA 3KKZA 1VLMA 2K4MA 1SQGA 3E7PA 4O29A 3TLJA 1G6Q1 2YUIA 3TR6A 4KDCA 2EG5A 2O0LA 3O4FA 5B1SA 1KXZA 2PXAA 3I5UA 3LX6A 3FUUA 2GA9A 3PFHA 4QTTB 4EVIA 3VC1A 1SUIA 3ELYA 3BGIA 4RVFA 3TKAA 4C04A 5HIKA 5LQCA 3KPVA 5EMMA 2QRVA 5F2KA 4WVLA 1VP9A 2WA2A 2YTZA 3PTAA 3HA7A 4JXJA 3OZSA 4M38A 4U7TB 5FWDA 4KDRA 2FPOA 3EEOA 3V97A 2ZULA 5EVJA 2P35A 3DULA 2IH5A 1WG8A 3DOUA 3MQ2A 4RWZA 2AOUB 5E9JA 5LQUA 1KHHA 3A7EA 2YXLA 3HCFA 4HRAA 1MHTA 1P39A 3A26A 4YUYA 1D2GA 3PX3A 5CVUA 4AUKA 1FP2A 4UOEA 2UYHA 2P3QA 2UYOA 3B89A 3C0KA 3TMAA 3U81A 4AZTA 4X60A 3FPHA 3AXSA 4GOMD 3DLIA 3H2BA 1WXXA 3NJRA 3AY0A 4GC5A 1N7IA 3VC2A 5BW4A 5K03A 3P2KA 3FUWA 3OU7A 3FPEA 5EEGA 4E2WA 2P7HA 3DUWA 4E2YA 2QM3A 1XVAA 3PVCA 5DXJA 5K01A 3CBGA 3GRVA 3LL7A 4YUVA 4P7JA 2AS0A 3WSTA 3EGIA 2VP3A 3GRRA 5E1DA 1WY7A 1L9KA 3BZBA 3GRZA 3EVFA 1VIDA 5EPEA 3MGGA 2CMGA 3I53A 4HTFB 4MWZA 5E9QA 2C7RA 4DF3A 3HVJA 3CJQA 4E2ZA 1ZKDA 2LD4A 5CCBA 3SMQA 4XUCA 2IPXA 3C6KA 4MQ4A 4QVKA 4RTMA 4GC9A 4R6WA 4RTJA 1O54A 3EVDA 4RTQA 4KRGA 2G8NA 2ZTHA 5HEKA 4R05A 4PCLA 2ADMA 1QAQA 2N47A 1JTEA 5DM4A 4PWYA 3KHKA 2ZZNA 1DUSA 1JQ3A 2QRVB 1EIZA 3K0BA 4C05A 1MJFA 1QZZA 2AOTA 3IYLW 4KW7A 2YQZA 4XCXA 2P3LA 1R6AA 3FTFA 1VP3A 1ORHA 2Y1XA 4DM3A 2OO3A 1EQAA 4PCAA 5ERGB 1RI2A 2PX2A 3MCTA 2B25A 1RJFA 3KPYA 3LKZA 2XVAA 4ATNA 5LQKA 3EGVA 1I4WA 2PWYA 2ZW9A 3D2LA 1YFJA 2I6GA 3EVGA 5T67A 3B3FA 3X0DA 4PYQA 5HILA 1L3CA 4GOOD 5DT2A 1D2CA 2EJUA 5C9ZA 3UBTA 1G55A 3DMGA 3UJ6A 3S68A 1YZHA 2KW5A 1YFLA 2UYCA 5DX0A 3CVOA 1BKYA 3LCUA 3TOSA 2BR3A 1JG1A 1KR5A 2AOVA 2NNWB 4P7GA 4ER5A 4CWAA 1YB2A 4FZVA 4X1OA 4ER3A 4RV9A 4POOA 1Y8CA 5DX1A 2PLWA 5FULA 4X41A 1JG3A 5LQAA 2PXXA 3ER9A 2IP2A 3NTVA 3BWCA 4RVDA 1RJEA 1B42A 1SG9A 2G71A 3SR4A 3ER8A 3KPUA 1JQEA 4FT2A 3EEYA 4FS8A 4GUAA 7MHTA 3EGEA 2C7PA 2IBTA 1NE2A 3FUTA 3HCDA 3JWGA 3CGGA 3P8ZA 5HFJA 2ZIFA 5HIIA 3UA3A 5LSAA 2HMYB 1WXWA 2ZWAA 5DTQA 3L8DA 2P40A 4E33A 4GOND 2NP7A 4FT4A 2AN3A 1R00A 3DLCA 1X1AA 3I64A 1XDUA 3O31A 1BOOA 3LGAA 2PJDA 2ZZMA 3LBFA 4A6DA 2C7OA 1R8XA 2P8JA 3FZGA 8MHTA 2VDWA 1BHJA 1YZ3A 2JH8A 1P1CA 2ZBPA 3TPZA 2C7QA 4FR0A 2G1PA 2EFJA 5EZSA 3NW9A 1AV6A 1Q0SA 4KWCA 4RVGA 3RIEA 3KQMA 5EGSA 2G72A 1FP1D 4OBWA 4E32A 4RTOA 5E2BA 1RI3A 1TW2A 1WZNA 2HR1A 1NW5A 1WS6A 4HG2A 5JUWA 5EIWA 3MERA 2ERCA 3O7WA 3P2EA 4ER6A 3HVIA 3LSTA 4ER0A 1UIRA 2FK8A 2OBFA 3G89A 3B3GA 3GGDA 4IV8A 3M4XA 2AN5A 2IDKA 3CJRA 4C06A 3EMDA 5K05A 3KR9A 2ESRA 5EHGA 5EC8A 3FTCA 1XTPA 3HVHA 2JJQA 3SSNA 4DCMA 1KYWA 5DX8A 2P1DA 3M6VA 4E70A 3G2MA 4R8SA 3I9FA 2VDUE 3PX2A 3MTEA 5E8JA 3UJ9A 3TM4A 3BUSA 1O9GA 2O05A 3Q87B 3GRYA 4ISCA 10MHA 4KIGA 4K6MA 4PINA 3KPJA 2ZSUA 4MIKA 2UYQA 4Z2YA 5GINE 3LDFA 4RYLA 1G38A 4KIFA 5C0OE 1JTFA 3UJDA 2HV9A 1ZQ9A 3P9IA 3NWBA 3FPJA 4X63A 5GM2A 4PYKA 1INLA 4PYOA 1KIAA 3VSEA 5E2AA 3R9XB 5LR6A 2HNKA 1IY9A 2PY6A 5EG5A 2R6ZA 3BGVA 3EVZA 1NV9A 3OE5A 4V0QA 5K0GA 2OYRA 3GO4A 3G5TA 4PGHA 1RJGA 2FK7A 1NW3A 2OY0A 4QQNA 4B17A 5HZMA 5FQOA 2AOWA 4E31A 5FQNA 5EMKA 1G8SA 3FUXA 3DMHA 5F2OA 1JG4A 3JWJA 3TRKA 3MB5A 4QDKA 3DMFA 2QE6A 4M7RA 5CUQA 1ZG3A 1VQ1A 4C4AA 5FWAA 5GIPE 2GH1A 4L7VA 4RX1A 1DCTA 1NW7A 1DL5A 4YV2A 3OPNA 3UZUA 3KQQA 1F3LA 1TPYA 3KQWA 2I9KA 3BXOA 4QPNA 5K0FA 5E1MA 4KVZA 3CCFA 3UJ8A 3LECA 3LDUA 4PIMA 2BR5A 2OPBA 3AJDA 2FRXA 3OFKA 1L3IA 5CM2Z 2JHAA 1NT2A 1R74A 4F85A 3PB3A 2VDVE 4G56A 4DZRA 4OQDA 1UFKA 2YXEA 5LQRA 3DTNA 5T6BA 2GAFA 5CVDA 2V74B 4HC4A 1XDSA 2I7CA 4GOLD 4R8RA 4C07A 5LQNA 1Z3CA 3NMUF 5C1IA 3TFWA 4PNEA 4F86A 3DXXA 1RJDA 1ZGAA 3IHTA 3KQTA 5FCDA 3RW9A 5HOQA 1M0EA 3UWPA 3T7RA 1IXKA 3B7PA 1JR4A 2CWWA 2OB1A 2ZBQA 3NDIA 2CMHA 3SM3A 4P7KA 5EEHA 2BM9A 2BR4A 3G2OA 3V8VA 2ZCJA 4NECA 2NXEA 1P91A 2IIPA 2JG3A 5FA5A 3CKKA 3EVCA 3ANXA 5DSXA 5DWQA 9MHTA 3C3YA 3M6WA 3ELUA 4EQZA 1RI5A 5GWXA 2JHPA 3E8SA 2PX4A 3LPMA 1KPGA 3HA5A 4X61A 3B5IA 4GBED 2CKDA 5GIOE 3E23A 4YMHA 1U2ZA 3LHDA 4E2XA 3MHTA 3KR2A 3KR1A 3MAGA 4A6EA 2O06A 3ID6C 5CCXA 5ICCA 4QQKA 1L1EA 5BP7A 1R8YA 1RI1A 2V7EA 3LCCA 4WXHA 5DM2A 3ELDA 1ORIA 3P97A 5ICEA 2AOXA 3HA3A 3JWHA 5FA8A 4YMGA 1N2XA 3A7DA 5GM1A 4CXMA 3KPWA 5EMJA 1D2HA 3G7UA 4YV1A 2H00A 3BWYA 5KQSA 3A27A 1X19A 2A14A 1VPTA 4CTKA 3PFGA 2P41A 2EX4A 4RTSA 2P7IA 3OZRA 4EKGA 5HIMA 2OZVA 4GQBA 4RTRA 1IM8A 5GP1A 4CTJA 3GNLA 4LECA 1ZGJA 3DH0A 4XUEA 3T7SA 1SVUA 5M5BA 2AOTB 4H0NA 1PRYA 1ZHFA 3SXJA 5DM1A 3QOWA 1EJ6A 2AOUA 5K0EA 5JR3A 1Q0TA 3NDJA 1NBIA 2FCAA 1EAMA 3LCVB 5KQRA 3FTEA 4C08A 5K0BA 3EVBA 1T43A 3DXZA 2OKCA 1KYZA 3OU2A 3KQSA 3HP7A 3OFJA 2ZLBA 4EK9A 1SQFA 4F84A 4CKCA 5FHRA 3IV6A 3R6TA 1NW6A 3QOXA 5K0NA 3BWBA 3EVAA 3NWEA 1I1NA 3Q7EA 4QTUB 3TQSA 5E1OA 4EMSA 1G60A 2PWPA 2XYVA 2F8LA 3KQOA 5D1NA 1I9GA 5FTWA 4IWNA 4LG1A 4LWOA 5MHTA 3GIWA 5FUBA 2VZ9A 1JQDA 2HWKA 1F38A 2EJTA 1XXLA 3UFBA 5DPMA 4BLVA 4FP9A 5F2NA 3ERCA 3EPPA 2AVDA 2AN4A 3M70A 2ZBRA 5EKUA 2QYOA 2G70A 4YV0A 3ORHA 3G8BA 2PSSA 3KU1A 1QANA 3PLAE 3EMBA 1QYRA 4V0RA 2DPMA 3OU6A 2PVCA 4ZTBA 4BP3A 4RTLA 2JH9A 2VS1A 3P9KA 1KPHA 3BGDA 1HMYA 4P58A 2IFTA 2YX1A 3A25A 4PYLA 2BM8A 4DKJA 2B78A 1M6YA 3SX0A 3GCZA 2GS9A 3TM5A 4OQEA 3DR5A 4RTPA 3THSA 4YUXA 2XVMA 2YR0A 1NBHA 1JSZA 1SUSA 3MCZA 3OCJA 4PGGA 1JSXA 1VBFA 4E30A 4YUZA 3UJBA 2WK1A 3TKYA 3HVKA 3R24A 2AZTA 3CJTA 3OE4A 4MHTA 5K8VA 3AXTA 1O9HA 5DM0A 3RODA 3P9CA 3KQPA 3HTXA 1TW3A 1XCLA 3THRA 1EJ0A 3OZTA 5DTMA 2PV0A 1YF3A 4PIPA 1X1CA 2FHPA 4PONA 2IH4A 5U4XA 1AQIA 4RTKA 5DXAA 3GDHA 4OA8A 3SGLA 2BH2A 3ME5A 5K0LA 1QAMA 2PT6A 1XJ5A 4AX8A 1HNNA 3SSOA 3FRIA 2DULA 3G2PA 1JG2A 5GOZA 2PX5A 3G88A
chains in the Genus database with same CATH superfamily
4RSRA 4HWKA 4ZGGA 2QYHA 4UAUA 3ZTTA 4O4IA 2WSBA 4ND2A 3ZWXA 3AVVA 3EFHA 3WLFA 2Y0DA 2VOEA 1Q3KA 2M1ZA 1W29A 1O4VA 2Q62A 2WP8J 2I5PO 1C2YA 2FP4B 2ZWIA 3W9YA 1EVYA 1OWOA 1X1BA 3IPAA 5TPWA 1EE9A 1PVOA 3OPXA 4GPAA 1PR1A 4QQFA 2FDRA 5CB8A 3GJYA 5KYGA 2QLLA 2P0YA 4KYVA 3AKDA 3KQVA 3LW7A 4PYMA 2BGRA 4FCTA 4ZOEA 4AULA 3NT4A 3TR5A 1B8VA 3UWSA 3AG5A 1XWFA 4NBVA 3UMMA 4LISA 1P19A 3KXLA 2O14A 3ZBTA 1QSGA 2FXVA 4S3MA 3FOEC 4LJ7A 4FKZA 4IDHA 1E9EA 1BD4A 1CR6A 1Z29A 2IVFA 3DCNA 1KTIA 1W44A 5E1BA 4CTNA 4P08A 3SJZA 1VB5A 2ZVQX 1ZCFA 2BLLA 3EF1A 1U9IC 4JR1A 5JXIA 3M6UA 4MI3A 3I62A 4HWRA 1J56A 2X0KA 3AB8A 621PA 1XB2A 4FSXA 3GUHA 4PZYA 4FMBB 4YP7A 3B36A 3QE2A 1LNZA 1NATA 3HDJA 3MC1A 4JU9A 2G9ZA 2BGUA 1QHGA 2HF9A 3ETEA 4ZQGA 1VJDA 2BIFA 2WHPB 3GRKA 4LWPA 4Q7MB 2XRZA 2Z6AA 5AMXA 1HOXA 1E0AA 4G81A 5FWXB 3GZTB 3GGPA 1FDVA 3RIYA 1XQ1A 1J42A 2D54A 4OATA 1KBZA 2VRWA 3C3MA 4O25A 2Q8NA 3DVLA 1VLZA 1IJBA 3NKFA 2XIJA 3T1QA 4HDKB 2IV7A 2FZEA 3RUHA 1KI6B 2I6TA 4EJFA 1RJWA 2X8JA 2ISCA 2Q21A 2EW2A 1X42A 4J9VA 2IBSA 3GXOA 1PTJC 5H83A 4BKUA 4HDNA 4BWGA 4Z3OA 1TVMA 1PR4A 2BI4A 1ADFA 2FUNB 1DQSA 1BU8A 2GLUA 4KIUA 4FD3A 3HCAA 3ECSA 5J2TB 1DO2A 1WUJS 2HO5A 2FYTA 3DP7A 3FTDA 1ZOPA 2PRJA 4C03A 1NHGA 1PUIA 3VUEA 4H4DA 2DY0A 4QPPA 5FADA 4IIJB 2NW6A 1XMSA 2O7VA 2AG6A 4GMFA 2WIGA 2B4AA 1ZCJA 4KBGA 2G5PA 4E5YA 1JFFA 4LNAA 4CQMB 1YGYA 5TS3A 5JVDF 4XPZA 2Z2ZA 3SLRA 3OMWA 2Z3VA 4GSKA 5D2CA 2B5OA 3WADA 4A6PA 1E1CB 4ZT5A 4D4JA 1A8UA 3HUDA 2PZGA 4UBMA 4GVXA 3BIFA 4D5GA 3JQBA 3JVUA 4DANA 4C2UA 3RUFA 2NV0A 5D86A 3W6PA 4IXDA 5EP1A 2FWNA 3FYCA 6ADHA 1ZLYA 1HOTA 3ETGA 4AMYA 1L3BA 2BHTA 4KQ2A 4TTJA 1WTAA 2HA3A 4G65A 5CPFA 2ILVA 1Z0JA 4LV8B 4NCAA 4TTAA 1VI6A 1RQ2A 1GFWA 4WXPA 2VSQA 3L40A 5TJHA 4PO8A 1F06A 2QS9A 2AXPA 4GBJA 4DHWA 1XVUA 4I5DA 4M1QA 1RRKA 2N46A 4JDPA 1KFBB 2ZI9A 3TR6A 3QU2A 1BEZA 1PEYA 2AFIA 5AHXA 4EY5A 3B9PA 3AF4A 4IOKA 1SUIA 2R00A 1PQUA 1QBGA 4RZXA 5HIKA 1UJCA 4Z7NB 1DAFA 2QAIA 5BWOA 2CHGA 3LQRA 3B9RA 1AXEA 3GYBA 3EOAI 4R1UA 4RJJA 5A7GA 1QP0A 1PGOA 1NF3A 1MB3A 1U5BA 3GLVA 3KJXA 4FZ3A 4UE2A 1GA6A 4WLEA 1FTNA 5INTA 5KX5B 1PP4A 1NMSA 5EVJA 4F5ZA 1W5SA 1GGKA 4GPTA 3GEPA 2O0KA 1KI2A 2IH5A 2YXLA 3ICCA 2WVAA 1SOVA 2OXRA 2Y1KA 4BV8A 3IDQA 5AM1A 2JGKA 4G5OA 4L15A 4ARZB 5KDOA 1H6CA 3G6WA 2W2OA 2QB5A 2DFPA 1HE2A 4RL4A 3FTNA 2IYXA 2J9XB 2FQYA 5KYUB 1SUEA 4P54A 5K03A 1P1RA 1AD2A 4YCNA 2HPZA 1UZMA 3FPEA 1A72A 3RRNA 1BX0A 2O3UA 4I1VA 4BVAA 2PYDA 2GYVA 4TYPA 5JLAA 4P0QB 2AS0A 3GB9A 1WXEA 2J0VA 3CCCA 3GRRA 2D2VA 2JD1A 3PEVA 1G8PA 2A33A 2XECA 3E7WA 5EPEA 5BR7A 5HCIA 1ECBA 4AS2A 2MU1A 1A7KA 2W2XA 4K9LA 3JASA 1ZXLA 1ZKDA 2V7VA 1V71A 2VA9A 1IBCA 3EAQA 3TZ6A 1R9NA 2HIMA 2IX3A 2GAIA 4RTJA 1VZ2A 1ZIDA 2C2ZA 4K05A 4LS3A 2QQ5A 3ICQB 3UYLA 2AXEA 1Z7YA 2GNAA 3LF1A 3OPMA 2R1VA 1M8JA 4I4TB 1YC2A 2ENWA 2P2SA 3H87A 1WX1A 1KI4A 2RGEA 4LGCA 3DTYA 2Q7OE 4XWOA 4HUQA 5JYDA 1ZGGA 4QUEA 3PDIB 2FEXA 4D9GA 1AJEA 1NFQA 2I2BA 2Y8EA 1COWD 3H6KA 3FDZA 2HDOA 4FQ5A 4YASA 1N7HA 4MV9A 5H4HA 2AOTA 4UCXA 2ZUSA 3SDSA 4JENA 3F5FA 4YRRA 1ORHA 1QVAA 4BJ6A 3ZS8A 4BDSA 1YI1A 2JJ2D 3MWJA 1H65A 3GBPA 2PUBA 4FXOA 1T0IA 5ELXA 1TF2A 2GPNA 4C3ZA 3EQ9A 2WVGA 4BZXA 3BXXA 4U0KA 4TUYA 5EESA 2R9VA 2YN4A 2OORA 4ZMBA 2I4RA 1C1HA 5BV1A 5C8YB 2UZIR 4WN3A 1H85A 1H2HA 1J5PA 1RAGA 1GRQA 2BFWA 6PFKA 3IBSA 3IUPA 5LBTA 3NB0A 3SQNA 2I55A 3H2YA 4JVNA 3CS3A 3FOBA 5G1PA 3IVGA 1TADA 2D7JA 1QK5A 2E4AA 2JI8A 3ABZA 2OBBA 2NYAA 2WYVA 3CT6A 4AX4A 3BWCA 1Q3HA 2XTZA 4MRMB 1J8FA 2JC3A 2QMYA 1ZA1A 1B8OA 1BEUB 3L7DA 1J22A 1M5UA 3LCJA 3MRVA 4RKQA 5J5VA 1PD1A 1QF7A 1JMKC 2HUNA 3EGEA 3IXLA 4ZVQA 4Q3LA 5DMXA 2CW5A 1TVKB 3ADBA 1W46A 5LSAA 1D2EA 2YXPX 3A14A 1QYIA 1CY4A 2QTWB 4Z3DA 3MRXA 4GOND 4ZT2A 3ZIAA 1Y4UA 2A1TR 3CH4B 3G82C 4AAYA 1Y81A 3U9SA 1IH8A 4M1TA 1L9XA 4IVPA 1EM6A 4DWWA 2X2OA 1UKBA 1WM1A 2P2YA 3CRVA 3DBHB 3K6JA 4CMEA 4NY1A 2WR8A 3JQBC 4RH0A 2Z2YA 1GT91 1RM4A 3EISA 5DCYA 1B2LA 3WWDA 2JRCA 1AS3A 1ZCAA 4GP9A 1Z9BA 2YJ4A 1G7CA 3FAKA 4G8JA 4LOLA 3RIEA 1MO5A 2AJLI 1H5UA 3BDIA 4BQIA 1MENA 3AETA 1WZNA 4IIYA 3STHA 3R3VA 1NW5A 1IN4A 4BLRA 4Z5XA 4G4SP 1ENOA 1NQWA 3AERA 4KO3S 4LA4A 2FSVA 2V7TA 4BLSA 4L5BA 3ZUPA 4R1OA 2WG1A 1YZGA 4PCUA 4C0SA 2YIMA 1FL9A 1NVMB 3Q5EA 4H7DA 3JARB 1U8TA 2WDZA 1IUPA 4MEAA 2A88A 1O1YA 2JGRA 3Q3HA 4I14A 4X7RA 4URVR 3ZY6A 5LKRA 3SSNA 4NHOA 3IVCA 4FIZA 3QFCA 4G5QA 1MR3F 3BD8A 1F9AA 4YONB 1OU4A 4HD8A 1Y3FE 3G2MA 2DB3A 1ZBDA 4CL2A 1Z5VA 5ELMA 5IVIA 5FIUA 5KHAA 4KFSA 3OQMA 1KJZA 4QEKA 4MLCA 2QUKA 4PINA 1TO6A 1UJ4A 3DL4A 1CBUA 2H1OA 2XQFA 1A9OA 3HO1A 2LWIA 4RFLA 1WPXA 1WQ1R 1UMDB 2QRNA 2XLBA 4WOJA 2F43A 5F21A 1KYYA 1QOPB 3Q3CA 1B26A 5GM2A 3RYTC 3X2EA 2OV2A 2JDID 1VE9A 3R6DA 4TZTA 1KIAA 1J20A 2RGNA 4Y6PA 5EZYF 5HJ2A 5M29A 1G5TA 3ZZTA 2Z3WA 2P30A 3NAMA 4MR7B 4RADA 1OZGA 4TZ6A 1LFAA 1HT0A 1GFSA 3OPVA 4QWWA 1DIBA 1XNGA 3H83A 3G5TA 3HI4A 2QEQA 3OFNA 4PPNA 4RZSA 1UWLA 2YKGA 1CYEA 2V9ZA 1OILA 2VNSA 2OV4A 4R9UC 2GUWA 4WWHA 1SHTX 3TRKA 5AOAA 4CRWB 2I9PA 1SU7A 3N74A 3HSKA 2FF5A 1G66A 1X7XB 2ZS8A 3IO5A 5KTSA 2VPYA 2G0TA 1B15A 2GZ3A 1NWCA 4PFSA 1ULBA 1ZVMA 2Z9BA 2H0AA 5JLJA 4IFTA 1WQ3A 1P0PA 1ENYA 1ZZEA 3ADKA 3BXOA 5MF6A 2DR3A 4V0SA 4DDUA 1RRMA 4BGIA 2WIBA 1R7RA 4W7IA 4PIMA 2E4YA 1FTQA 3FSGD 2R1TB 4WY5A 2JI4A 3AW9A 4RQUA 4WZZA 1RQ7A 4RA6B 5AKIA 3PKZA 5L3SA 1BO6A 2VATA 4HRVA 1E2KA 2FA9A 2RJOA 2W6QA 5DHRA 2PSJA 5ITWA 5T6BA 3F4BA 1USKA 2O3TA 3EC7A 3I6MA 5KWVA 3SBEA 2QJRA 3MPUA 1WZUA 3IQDB 3BWEA 3HCRA 3SNKA 1I6MA 4CIAA 4OXKA 2PZEA 5JNUA 4GE3A 3LZCA 4IMRA 1W88B 3CLUC 3L7BA 1LK5A 1GUZA 1QM5A 3NDBB 5L40A 1QTNA 4RMHA 1IEWA 4YNBA 4BFLA 3L82B 3C24A 4QL3A 2OQIA 1MB0A 2R8OA 2NXEA 1KORA 2H4YA 1ISFA 2HJGA 2R6HA 3CVJA 3X1WA 1KH2A 2OORC 1U3WA 5E4TA 3WY9A 3W1VA 5KEIA 4RSGA 4OMFG 4LRXA 4OQMA 1HI9A 2C7GA 3E23A 1HG1A 3ONFA 1K86A 4R69A 3K9GA 2EBFX 2ZYVX 16PKA 3PUZA 3KR2A 3UYKA 2Z43A 3KJNA 1Y8RB 1WCWA 4IGKA 4NNOA 2XVZA 4KAJA 2N3ZA 3DVRX 3MGBA 5JDIA 1A7AA 1FU4A 1WU7A 1UMKA 1QFMA 4KAAA 1T9BA 3AFNA 4C4RA 3TCNA 3INRA 3LXMA 4LKRA 1F12A 4WBSA 3NANA 4RVOA 3IOMA 4KWTA 4GUDA 4PG5A 4XI9A 4CNQA 1P2TA 1CWUA 1SBIA 4QFCA 1R5BA 3I5MA 4WT7A 3WLHA 3Q6IA 1TK9A 2AMYA 1U04A 2GTPA 1M5TA 3H8SA 4PLWA 4UNSA 2F8SA 1K6MA 4IDPA 3RPEA 1O6GA 4PPYA 1N6NA 4MQBA 4ALIA 4BKPA 3U44A 1M33A 2E89A 1CF4A 3ACBA 1T9CA 1Y1SA 2QTTA 3FJ1A 4NP6A 2YWHA 2ODTX 3O9VA 4KV7A 3P4XA 4QPCA 3UK6A 4CMEC 4AKGA 3RIXA 3G2NA 5KNDA 1N2EA 5J4YA 3WK5A 1OIWA 1GTJ1 4RF2A 5LYJB 1QP4A 4XH9B 3Q9LA 1KP2A 1B3BA 4HPJB 5JZBA 1NL3A 2FOXA 2KBFA 2RARA 4DAOA 1ZQ1A 3HP7A 1GQSA 3KDSE 3AFOA 1SQFA 1E8NA 3I52A 3N0RA 2I2XB 3QKRA 4Y2TA 3K0AA 3HJGA 3DXFA 2FSVC 2NV6A 4B45A 4XQ9A 1DCKA 4DREA 4Q00A 1XRRA 4D4MA 4ARSA 4Z54A 1QGUA 1HE8B 2PTGA 3BGSA 5D1NA 3PCXA 1HZJA 4Q12A 4HDRB 1Y1QA 3BHJA 4KMMA 4CUKA 1FXSA 3QX8A 5C3UA 2PFKA 3MQFA 4MK4A 4YRTA 3HNPA 2ZBUA 1QIFA 2BI7A 2Y0BA 2LR0A 2ZI5A 2NQTA 2PO7A 4FLEA 3AIOA 4GYJA 3NEAA 4ICIA 1PJ8A 3OF2A 4K28A 4HHEA 4KEAA 3H9BA 1MEOA 3RSHA 3W8FA 3LLCA 4D8XA 1PV1A 3UN1A 1BCSB 1DXHA 5LLTA 4PYLA 5G3YA 4B3FX 4J8PA 4EX7A 3DMPA 1Z2OX 2MSKA 5ILOA 1FFWA 5DGCA 3A6LA 1NPTO 1V96A 2QW1A 2RI6A 1QS0B 3PNMA 4C21A 2VP4A 3W2GA 2JFUA 2SKDA 4M9UA 1E1YA 3MS2A 2RGNC 2XAAA 1Y3CE 3DYIA 4PGGA 1M72A 3T3EA 3BXGA 3R24A 3OE4A 1JIJA 4I4NA 3AXTA 1U1GA 2WAYA 1BHO1 3MD0A 2R84A 5A03A 5E7JA 3UT0A 4BV3A 1EJ0A 2XCSB 3X1JA 2XWPA 4MWCA 5CP8A 5K8TA 3P2MA 4G8DA 2GD2A 4G4SO 4GMKA 2YIDA 4BKMA 3SGLA 1DJPA 3H7AA 4F2HA 2PHZA 2IRWA 4MULA 1LQ2A 1Q2UA 5G4KA 5CA1B 2HZBA 1RTKA 4QYIB 2MJLA 4C29A 5I9SA 3DBRB 3UV6A 3H86A 5FOSA 1P7WA 1PIWA 5CK5A 4E6EA 2EP7A 4R68A 3W3AA 2RD2A 2RHCA 5TDHA 1G7RA 2CVQA 4DV3B 4GLBA 2QLNA 2XZTA 2OWEA 4FU0A 3NVKI 1K97A 5DTIA 4MUFA 4Z1MD 1MQSA 3G5LA 4M7OA 3FFBA 4DT1B 2C0QA 2FEOA 3MTGA 3WWZA 2UXBB 3LKDA 4Z86A 2K87A 2JGJA 3C3XA 1VJRA 1FMCA 1XFAA 2EFCB 2L2QA 2C3PA 2FTKE 2NUTB 3DXYA 2W2LD 2QG6A 3D6NB 4JLPA 4LDJA 2EP5A 4MWOA 4WN9B 4YRSA 1VE5A 3TD9A 1RI4A 2J5BA 4TM8A 3TECE 1UWKA 1H23A 3KOMA 1TB4A 2AX3A 2GB4A 2RAPA 4I99A 2JAWA 2VUIB 2VTDA 3DD1A 4GT1A 3SHTA 4ND1A 4LFBB 1MQ9A 2EYUA 2YZ2A 1CFZA 2HF2A 5AKJA 3UOWA 1U0EA 2FPGA 2OFPA 4GF5A 1CLUA 5DYTA 2GN8A 1CUBA 4B7CA 1WCV1 1ZD3A 4M8NE 4RMNA 5K09A 5KAMA 3CLHA 3LTNC 2GK6A 3R9IA 5E8RA 4O1MA 1DT5A 3TQOA 4OQNA 4S1NA 4YGXB 1R18A 2JLQA 3OFVA 2BFOA 5JOQA 3PHLA 5HJEA 4W99A 5F5NA 5AKYA 2IYPA 4U9UA 4CEJB 3D0RA 1J99A 3L3BA 4DC9A 2C5SA 3TRIA 3O8CA 1PFVA 3K0CA 3T4PA 1XD8A 2RI0A 5DISB 1IOVA 2XMPA 1VLLA 1XD2B 4M55A 3HKBA 3JD2A 2FQWA 1XKLA 1ZDMA 2WA1A 3V33A 3VZDA 3MGKA 1O5IA 2ZIEA 4EKIA 1FUYB 3JAKB 2PEYA 4IJ6A 4BNTA 4J6FA 5J4KA 2JJ1A 2XBMA 1P31A 4TXHA 4LRQA 3T4EA 3EC2A 4L8WB 1VYHA 4AX8A 2IX9A 2W48A 2VRCD 4CKBA 3JYNA 5FOXA 4WZBE 4EA7A 3PRHA 4XRRA 1NIPA 4PYJA 1I7SB 3HFGA 4AI6A 4W9NA 1I36A 2R66A 3IQXA 1W0JD 3H2HA 1AE1A 4HFJA 4H7FA 4AJPA 3R0XA 1P2FA 1U1EA 2Y05A 3AONB 1XA0A 3MUOA 3U6BA 5DO9A 2FQ1A 5JO0A 4JP1A 4A8JB 2OZEA 2PZKA 2VOJA 3ESBA 4NVRA 4EARA 721PA 4ND8B 5KC8A 3E9CA 1E7QA 2DHCA 2QHXA 4KR6A 2HK8A 1CUIA 2C7BA 2RJNA 4GZLA 5FX2A 4P6VF 2CYBA 4NE2A 2JFVA 4PY2A 3VR4H 4HVAA 4R1PA 5JAZA 4LJ8A 1GD1O 4AJIA 5B7NA 1LPSA 3IUJA 4HTFA 2FDXA 2ZE5A 2OXTA 5BW8A 3ZWCA 4AJ1A 2DUJA 3STXA 4CG2A 2WTEA 1J6UA 5JPDA 1XVLA 4BMCA 1OIVA 3MBIA 3M33A 4LVUA 2KLBA 1EZZA 3DOFA 2RHDA 4F4DA 4R8MA 2CUKA 2E85A 3R7FA 3T6KA 3SKXA 3BMQB 4HH0A 1FP6A 1L8AA 4HAYA 1G5RA 3IE1A 4RIIA 4MX8A 1V11B 2CL6X 4ECAA 1QVVA 2X6QA 3L7AA 4IM7A 4QSHA 1U3TA 4RY8A 2NVOA 5SZJA 3WLEA 4IQ0A 5DTEA 4EVIA 1JLLB 1OXSC 1YUMA 3BGIA 3ELYA 3TIVA 3TZKA 4ZHQB 2H2WA 4MGZR 3CEHA 2OHVA 3FF1A 4REQA 1QHHB 2OK8A 2VH2A 2ZWMA 5DHPA 2G1UA 1OAAA 1GZ5A 5E6SA 3EXEA 3OZSA 2A58A 3CNEA 4BC1A 3H13A 3W1EA 5JCOA 5AICA 3T38A 3LUAA 4H7KA 1Q7RA 3OETA 3L7NA 3NRBA 2AOUB 2VDOB 3IPLA 3OUTA 4RWZA 4CLRA 5AM4A 1DARA 1IN1A 1VG0B 2X9NA 4INOA 3MD9A 221PA 3LWNA 3TLCA 4GQAA 2CVOA 3DW3X 4CM9A 2UYOA 4HMOA 2JIOA 1YZKA 3I6YA 4EF6A 4V2UA 2QP3A 4F4JA 5BNZA 5KNBD 3W77A 3BSFA 5FR2A 4E51A 3JYHA 1DU4A 5GGXA 4IDFA 2ZI7A 3TN7A 4XYMA 2F90A 4Q4LA 3WMXA 4ZTUB 3CUKA 3GRVA 5EE3A 3BERA 7YASA 2GETA 4OMUA 3FSRA 5HQJA 3G1TA 4LBVA 1A9TA 4WESA 3DDWA 3DUFA 3KKPA 3AHFA 1L5SA 3O93A 5KJ1A 4Z4GA 2IPXA 5FBVB 2OCKA 4JT2A 4R6WA 3RQIA 1QYXA 5IMBA 1HA3A 2WF6A 2DFNA 3EG5A 1J97A 2G8NA 2X5OA 1UADA 2XZPA 2ZTHA 3CISA 1RBQA 3VZSA 1X9IA 3O0DA 1XR3A 2EX0A 5F78A 4HDQB 4DXAA 1FMJA 2ADMA 1N33B 1UOEA 1QAQA 4BPRA 1W2GA 2QUJA 2Q7DA 3GT0A 3PXGA 1W49A 4YAUA 4UNNA 2W6JA 1NY6A 1T4DA 1ZVKA 2X2PA 5LIRA 4M3NA 4OH1A 2R65A 1XK6A 4Q01A 2XCTB 3AI2A 3FIJA 1P4HA 4RU1A 5HR5A 1SPXA 2EW1A 3WGIA 3OM8A 5CHEA 4M89A 3N8NA 1CJSA 3HJRA 4WKNA 4JDUA 2PX2A 1C0EA 1EIWA 4DBLC 3QNMA 4D81A 1J2UA 5KMGB 4B73A 1UBUS 2ZW9A 4IH4A 3EVGA 3ADCA 4XEHA 1MJ5A 3B3FA 3BFXA 3OLZA 2RI1A 1OGYA 1ZZGA 3O3OB 1BWPA 1QH1A 1GTL1 4H59A 4K6KA 4L08A 1GZ3A 4HFMA 4M7WA 1ZOSA 3D64A 2UZ3A 5FPSA 3FFAA 2Q3LA 4J6EA 1Q50A 3SP1A 4C7BA 3OE1A 1NNUA 4IHAA 1BS1A 1YJBA 1FX0A 5DNAA 4O4HB 1IY2A 3D8HA 3LLUA 4LHZA 1XVIA 3SYLA 1ODSA 2PMKA 1UAAA 4I8IA 1YJXA 3BWDD 3EWAA 1FQOA 4RV9A 4BZZA 1QX3A 1JIIA 2XNHA 1PQPA 1JG3A 3BD6A 2IP2A 5LP1A 5G4LA 1B42A 1JPNA 2TMKA 1X94A 2CBGA 4QBGB 4RLSA 2JPDA 4ZVOA 2PMEA 1M6VA 1BMFD 1I3MA 1DWOA 2Z8ZA 3BH0A 3UO8B 4MUBA 4EYOA 5B3LA 4I08A 4RIFA 2C78A 5TB5A 5B4VA 2IS2A 3PQEA 3SVLA 2ZTUA 4MAMA 5GONA 3KQUA 3R9WA 1KXJA 4E33A 1B73A 4ZQCB 4UMDA 1VE7A 2VPPA 3EWSA 1YI0A 2F59A 4W9NC 1PWYE 1VSQA 3M6FA 4DSNA 1M2GA 4NR0A 2XCRB 2EFHB 1MVNA 2JIQA 3L79A 4H7IA 4RDIA 1XZMA 4UHFA 2HA5A 3VBCA 4IJKA 2C7OA 4FHCA 2OV8A 4GOJA 1BHJA 3GQVA 2JH8A 1RPAA 4O0LA 2ZRIA 1GZ7A 1GGNA 4QA9A 1QE5A 5EZSA 5H9VA 4DPMA 1KEVA 2COEA 1AKUA 1VSTA 2OZPA 4KXUA 3GQBA 3ORFA 3V4RA 1N77A 2QLMA 1E5VA 1E98A 2RGDA 2X6TA 3JS5A 3LZ6A 5EQDA 2EIHA 3FBTA 3FCEA 3V5NA 4E32A 4V0OA 1PGPA 3NR2A 1Z6YA 3GVHA 5AK4A 3WK9A 4BNWA 2YHIA 1EUZA 5A4MS 2WQ6A 3ED5A 3HWWA 3ZV5A 4HYYA 4CYMA 4X64B 5THQA 5A4IS 2BYTA 4DJJA 1C0IA 5AVTA 3W6OA 2Q9BA 3HXLA 3CH7A 2X1VA 2DH6A 3B3GA 4TLMB 3V1YA 2VT6A 2IDKA 2HBZA 3AQIA 4Q19A 2F8MA 4TWJA 4QTXA 1M6WA 2D8AA 3WJ7A 2HSEA 3OZFA 3QFFA 5FEUA 1E4VA 2JJQA 1E3DA 3U3XA 1HL7A 2D3WA 4F3TA 3TMKA 4B6FA 3HVRA 4UE3S 1ZAYA 2EWWA 1O9GA 2G4CA 3WYEA 1DJLA 3MQ4A 4ED9A 3P5BA 4LQ4A 4WAUA 1NOJA 1PKXA 5JCOC 4CGZA 4UVIA 1JU3A 3ISTA 4WZ6A 2IXAA 5JRZA 3MT9A 2AC7A 4YRFA 3DWIA 3I9LA 4JIGA 2YBEA 3NWBA 2C2OA 3WTBA 1L5FA 3F97A 1JHMA 2IEGA 5E2AA 3HEBA 1V3TA 3RYHB 1KI1A 1ZGHA 4GO1A 2PUEA 1NV9A 5I9MA 1HFEL 4G1FA 4LTMA 4QYMA 5ETJA 3FGOA 3RVNA 1R0KA 5TPZD 4MVJD 5DK6A 3DVAB 4L22A 4EJ6A 1K06A 5EMKA 2AQIA 1U2PA 3ZZMA 4L4XA 4X3OA 3GAFA 2Q0XA 4EFNA 4F45A 5IC5A 5FFMA 2IY8A 4YP5A 4PSVA 3D2AA 1BJKA 4F6CA 3D6HA 2H8GA 5FWAA 5JZVA 5GIPE 1NBMD 1CTQA 4L7VA 2DPYA 1RTTA 3FZEA 2AFHB 3HWX1 3T41A 3WX0A 4MGIR 1XVVA 3UZUA 2IZZA 1RZUA 4P2BA 3H2SA 1Y80A 4ZOLB 5AJWA 2ADOA 3K30A 2V45A 1LUAA 3GMSA 3AJDA 3D4PA 3LDUA 3MT0A 4KE9A 4KVAA 4P5DA 1KP3A 3CLTD 2E3JA 3MWFA 5G1OA 4BQRA 3TLAA 3BJZA 4C22A 1M54A 4DQKA 1N8KA 3H1EA 2AK3A 1CY0A 1GPYA 1QJCA 4J3FA 1F3OA 4B4OA 2HYDA 2QT1A 3OTIA 4OU4A 1R6BX 2I7CA 2I8LA 4R8RA 1KI8A 4RK6A 5A1TA 3FBGA 5DSZA 3GLGE 4U00A 1EZ1A 2GHRA 5AW7A 3DXXA 5KYXA 1UEIA 2GM5A 4YC7A 4WXEA 3K9HA 3QQ5A 4PZDA 1H0HA 1O95D 3T9AA 4YMVA 1EFUA 2P4UA 3R0JA 5AXBA 2QGNA 1NVKA 4L2IB 4A8HA 4JSTA 2YFQA 1U94A 1IN5A 2QN2A 4WNAA 3AP1A 4G97A 4PS1A 1A95A 2WM3A 1CY8A 1KU6A 4PG6A 1N0WA 1QUFA 3VR6D 4OXXA 2CVZA 4EUHA 1E9BA 4IJ5A 4P92A 4YAFA 2NUPB 1Y1KE 3WWYA 3ZXYA 4MVJG 4AZ0B 3NOXA 4G23A 2J3JA 4EEZA 1V1RA 3NBYC 1N2JA 3IKJA 4YMHA 3QKTA 1JPVA 5T3YA 1CUAA 3MAGA 3AEUA 2O48X 2X40A 3MLEA 1TU3A 2POQX 1X7WB 3KZCA 3S7TA 3PSHA 1JAIA 2OZLB 5AJTA 3Q8XB 2NX2A 3L02A 1Z0ZA 2DOKA 4TKUA 4C6TA 3G5MA 2GRAA 4UREA 3OAAA 3HRHA 5I7VA 1JNXX 2EBHX 2CV1A 2BFDA 3MG9A 5C31A 2W6ZA 2ZR0A 2H00A 3QPCA 3MXTA 2J9GA 4ITVA 2X41A 4CJXA 1I1HA 2RH9B 5DYYA 5DV9A 1BYIA 2VYQA 4Q4HB 4AKEA 2FETA 4RTSA 2WMDA 5DNWA 3UAZA 4KX5A 2KX7A 1CQJA 3EDOA 1YQ9A 1H8HD 2P91A 3QPDA 1OCEA 1KYXA 5TRTA 2ST1A 4KOAA 4X8LA 4OJKA 1MC1A 4NOJA 4C43A 4RTRA 1IM8A 1ZM4A 1IMJA 2X0RA 2R86A 5E95A 4UCQA 4YCBA 4A2WA 3BZUA 3DH0A 4J2OA 5D6OA 1P74A 4X85A 2OCDA 3L0ZA 3LS2A 1T0UA 4YAOA 3WGNA 2VSFA 4YP6A 5BR4A 2BRUA 5AHKA 2X14A 4PNHA 1OKKD 5FWYB 2WWFA 4BN5A 2CMFA 3SZUA 3ZHYA 2PT7A 4F1WA 1KYZA 4AIRA 3O4GA 2I4TA 1NG1A 5A7FA 5BWLA 4ARCA 3R6TA 1Z4OA 1CETA 3C5HA 3IUQA 3LC2O 3EVAA 5FPTA 1D4ZA 5D3KA 1OXMA 2XYVA 5JASA 4I1UA 3FVRA 4B82A 4DWVA 1AGRA 3KBBA 2QMQA 3BXEA 5FTWA 3GIWA 3RS8A 4BVKA 4FB5A 1V1MB 1VECA 2XB4A 3FFXA 1BFDA 5AD1A 2QN3A 5T41A 3O4HA 1FLNA 1DKOA 4AW9A 4B75A 2K2WA 1GR0A 5HTKA 2O20A 2FV8A 3DDNA 3G3EA 1CRQA 4TTPA 4NV0A 2GM4A 2QL9A 3OX4A 2B8EA 4JP3A 2FXIA 3V4PB 4B40A 4DIEA 4I6GA 3DE4X 3A25A 5EJ6A 2W2QA 2Y9PB 4D98A 3SX0A 1TKBA 1G1MA 2PVSA 4Q9KA 4YI5A 2Z5GA 4ENRA 1NAHA 2FWIA 1R4NB 4ME6A 4HDMB 2ZDGA 2BV3A 2LKCA 3LHKA 3P19A 4UHCA 3QEMB 4IG4A 5SY4A 1FYEA 5CM9C 1O9HA 5ALOA 3SEQA 3QXCA 3ZU4A 3DOHA 1X7YA 3H04A 1FJHA 5DNEA 5BOVA 3ZU3A 2F55A 5AKHA 1KY5A 1UQUA 1RIFA 3THRA 1JAZA 3VJRA 1YB7A 2P3SA 3LX5A 1P9RA 2PMDA 4BAGA 3LOPA 2PO5A 1IHDA 1LPBB 4EA9A 4YALA 1A5ZA 2WWVD 2C88A 4UTPA 1TRKA 421PA 4EHKA 5AXAA 5DXAA 4MPDA 3DBLB 3WZ2A 2V9PA 5AW0A 2Z95A 1W75A 1HNNA 3W7AA 4LF6B 2HQBA 3SSOA 2DULA 3ODGA 3R6GA 1XA3A 4X94A 4QECA 4QX6A 4MUIA 4N39A 2CE7A 3BB1A 1N78A 1VPVA 2DWUA 1W1WA 2XA1A 1UOPA 2Y93A 4RD4A 1QNLA 2GERA 2UZ4A 2GAJA 1SXGA 1JDSA 2V7PA 1G19A 1XQVA 2B83A 1AS0A 1FYDA 3DZKA 5CURA 2IWRA 4CV2A 3R7BA 2PX8A 5JSKA 4PFJA 1KSGA 3D8NA 2EW8A 4WEOA 3NTUA 1YL7A 3T3MB 2WD9A 4LHVA 2IGTA 1EQ2A 3TEMA 1BMQA 2P68A 1N2BA 1DOZA 3M6AA 3WB9A 5C5CA 1ZONA 5CFPA 2BFMA 4LY9A 2QI9F 1T2CA 2W6MA 2HTEA 1Y7HA 3AX6A 1DT3A 3GGGA 3I23A 3NVDA 4F3KA 5IDWA 1P1FA 3P2OA 3K0SA 4E12A 4MITA 4K7JA 3C3AA 4H17A 2FW7A 3SBOA 2C5AA 4ES6A 1DPFA 1T1EA 4B8WA 1SVMA 2NZYA 4LI0A 1ADGA 2O3RA 2E5WA 3CWQA 5AOBA 1A82A 4DGQA 5KTTA 1XMOB 1SVKA 1IWBB 1JA1A 2H1RA 2CXXA 1XTUA 3D6FA 4L0DA 4TV9B 3T5BA 3BM5A 4OM8A 3T7CA 4JKIA 2OESA 4LXYA 5GMOA 1RFGE 3A8TA 1KBOA 3A3KA 2P65A 4OUDA 4UMEA 1X7HA 3JQ8B 4MA4A 3KB6A 1M2KA 1P9LA 1S89A 2C4MA 3MWDB 4MCJA 1IQ0A 1T4CA 4DNPA 3V55A 2B99A 2BGLA 4NDNE 3TVDA 2FWPA 5AUOB 1XZGA 4H1VA 4LHWA 1WOMA 4D96A 3OZIA 5IDXA 2XJ9A 2IEZA 1NASA 4Y6LA 3RSLA 4KNVA 3G9QA 2LCQA 2PUFA 1P9WA 1EA7A 2C4KA 2VPXA 3V8EA 4MUXA 5A9RA 3BK2A 5IH7A 4C4YA 1RR6A 4IEEA 4GOXA 3CT4A 5COQA 4MVJF 4L5AA 4JL5A 1R0BA 5EHIA 4AZSA 3ZQUA 3IUYA 4WADA 4MQFA 4PZZA 3T8YA 1SC9A 1P7PA 1XZPA 3NTOA 5FD8A 3RJMA 5DHFA 5C3MA 4OYHA 5C46F 2OC4A 2YXDA 4GP7A 4QATA 2W70A 1XF1A 2ROQA 2XUOA 2CBZA 3SXPA 4Y2VA 1K6EA 2NU7A 4TV8A 4U9IS 1TKAA 2BRUC 3A28A 2A9JA 4ZP1A 4XX0B 1DFIA 4PX9A 3EOBI 3GLFA 1E3WA 5FPPA 3WLLA 3GD5A 4FQ7A 2H07A 4ZO6A 4Y2HA 4D0LB 3WGKA 1E2DA 3IERA 2DKOA 4UMVA 2IEDA 4ZMRA 1BDIA 1II9A 3L1KA 1Z2CA 1ATIA 1NF8A 2FPIB 3TQCA 4LWZA 1SOMA 4NS4A 4U7PB 2GVDC 2OGSA 3IP9A 2XNDD 2I76A 5ITSA 4WOCA 1V8DA 4ZYLA 2F3PA 1OC4A 1NVDA 3NHWA 2NZJA 2O52A 5H02A 3SQLA 3VYTB 4TMYA 5JS8A 5DCWA 3H5AA 4IHJF 5BR8B 4MVYA 4FYPA 1D0IA 3CLSD 3Q12A 3RHTA 3HRIA 2Q2VA 1LDNA 3S3TA 5B3KA 2B2CA 4LC0A 4MUNA 4NZ9A 1QZTA 3L8YA 2ZANA 3E82A 4CIWA 2APJA 1N5RA 1DKPA 1X1QA 3GOHA 1VLMA 4Q39A 4YB8A 4OMDA 1UDCA 2XCLA 4NYJR 1C1XA 1NBWB 3AUYA 3TNYA 4B3JA 4DLLA 5EUBA 1A2QA 2VUUA 2MYNA 5IYZF 3ZU6A 1DAMA 3RI3A 5B6JA 2ZYTX 5ICMA 1JLSA 1LNSA 4NBTA 3VA7A 2ZYGA 3DE5X 1M5RA 4INAA 3RHZA 4LJ4A 1FDRA 1Z2AA 2VJQA 4M8SA 4OL0A 3TJRA 3NFYA 1QFJA 4DRZA 5THXA 2ODBA 2X3UA 1HURA 5IN5A 1OJLA 3GELA 1N6LA 3HYSA 4TVOA 2J5XA 2D0DA 5LQUA 1JHZA 3A7EA 3VO8A 1H9BA 2NO4A 2O5VA 1HPLA 3VH4A 3ONNA 4E15A 3G0HA 3AI1A 1AK2A 1T0HB 1TTHA 4CPDA 5CCEA 3I2GA 3THYB 2C5HA 3RAPR 2ZUTA 3O82A 3T1OA 4X62B 2UYHA 4NJMB 1DWPA 3NXSA 4TZ0A 1LRJA 3AJ8A 4QLBA 3BZWA 4P3PA 4F4CA 4GC5A 1I3KA 1PJ4A 3HDYA 2FKNA 1KDYA 1TM2A 4F04A 3AR9A 4W5TA 2X4LA 3OU7A 3ZVNA 1E2PA 3HR7A 3L8HA 2WJGA 1TD1A 3LL7A 4UM8B 4OJMX 5F33A 1AHHA 3FMPB 1N0HA 3W5VA 4TYWA 1L9KA 5HGJA 3BD9A 3GGJA 1VIDA 1WVGA 1JWAB 4D99A 3I53A 4ZVKA 2GEJA 2FFBA 4V1CB 1CB0A 1GOTA 2VJMB 3GFTA 4XLZA 4DDTA 5JARA 2NSHA 5K99A 4XUCA 1TJ5A 2MYUA 3MPOA 3COSA 1AGNA 1N5KA 4IX1A 5FNVB 4B2IA 2AJDA 4BECA 4ZEVA 1YHYA 2Z04A 3NEPX 3EA5A 1L4YA 3KEOA 5HEKA 4YWJA 1LZKA 4C89A 4E5VA 5JSYA 1U02A 4IDCA 5BN5B 1Y5RA 2ZAIA 5KYVA 3KB1A 1KVSA 2XUFA 1HKUA 2HMWA 2XT9A 4W7SA 1PJ2A 2JAOA 3TCKA 2SCUB 1JQ3A 1GGHA 3AZQA 4QGHA 3JQ9A 4NI5A 1OYVA 2DWOA 4D97A 5I7SA 2HPHA 4AKIA 5EHQA 2BKXA 3BWXA 1Y4DE 2GOYA 1SD1A 4Y1FA 2R8EA 3AF0A 5AK3A 1JXAA 3SSAA 1KNXA 2X9QA 1TYBE 4LF8B 1JEYB 1RCTE 4YYEA 2NZ2A 3HCWA 3KEGA 2PD3A 1H2RS 1QFSA 1GILA 4PYQA 3RF6A 5TQ2B 3EGWA 2HW8A 3HCPA 1U6KA 5EJMA 1MX5A 3QA3E 3S5UA 1Q7TA 1UDWA 1DIGA 1JJBA 3ZNNA 4EB6B 1NJ2A 3PF9A 2CNKA 4C7VA 1QF6A 1C7QA 1JBQA 4BBJA 1GXSA 1TM3E 1OH6A 1F20A 3EC1A 3PQ8A 4B6GA 4ER5A 3OKCA 5K6TA 4WEQA 4RENA 4FZVA 4M9SA 3KBOA 3DA8A 1Z13A 2WKSA 3H9UA 1U8XX 3GAMA 4FYJA 3QFTA 4C78A 3NTVA 3RIGA 1FSZA 1ZITA 4EJ2A 5FOQA 2PSFA 4PAMA 1MU0A 4DLYA 4D9EA 2WWIA 4JYAB 2C3YA 2XB6A 2O2YA 3WLOA 1T5HX 1Z5PA 2HEGA 4RFSB 2AKEA 3KUCA 4LJ6A 4TLBA 3LOQA 3DFKA 4JJGA 1MQAA 3KSMA 3ILXA 4S0XA 5ULLA 3ZY5A 3L8DA 1VTKA 2EL7A 3TI7A 2O1EA 2O2IA 3PD0A 3RVOA 4CFYA 1GYQA 3BG5A 2XNSA 4M83A 1BGVA 2HWYA 2VJOA 5IXJA 1J4AA 1R0RE 2LUOA 1WDMA 2MSDB 4AURA 1TU0A 4OQFA 4NG4A 3IL2A 2IUEA 3DTVD 1OYWA 1QKIA 2ZDQA 1FVXA 4FR0A 4KV9A 4AMBA 4E1VA 2CF5A 3FNEA 3HGTA 4U1RA 3O47A 2X76A 1UIMA 1MB2A 2WFLB 4KWCA 2ZOSA 4MR8A 8AT1A 2V7XA 4L0CA 4BO3A 5EGSA 3E84A 1SVIA 2Q46A 3UWOA 1AMUA 1TW2A 3EXIA 3SZMA 3BH7A 4M8KA 2XB2A 2GD0A 1OBVA 1QFZA 3OMLA 4MYTA 3VKVA 4RMJA 1IXYA 3VR0A 5LP6F 3VU8A 3ZXIA 2XT0A 4MUGA 1R6UA 4DWJA 2NG1A 3PGA1 4JI2B 5REQB 3DT9A 2D1RA 2XD9A 3ASVA 4OHRA 5CT8A 4D80A 3FMVA 5I7HA 1BDHA 5KNCA 2O8EB 1MB4A 4PO3X 1RXWA 3O94A 4E22A 5J40A 4DAEA 1QIGA 3AOGA 1CFJA 2WYOA 2Y9MB 1HGXA 1CUDA 3F6YA 1HDIA 2O0HA 3FWZA 5DX8A 4BB5A 5B1YA 4E70A 4NBWA 3K1JA 1XJQA 3DMYA 3V2HA 3ENQA 3GRYA 2ZAMA 4HXGA 2P5YA 4OXNA 4UQOA 1U90A 1XD9A 3EDRA 1B16A 1K75A 2CXTA 3WNDA 4AF8A 2F7SA 2G80A 1A4RA 3DVQX 1N5MA 2KHZA 2C7VA 3LNCA 3ZVMA 2FW8A 3O38A 2QMZA 5J63A 1BDJA 1N6RA 2V9CA 5GVRA 4ZZIA 1BE0A 1HETA 5TXGA 3R9XB 4B3GA 3BGVA 4DMFA 4H6PA 3A9CA 4LJSA 4EKDA 3NP9A 1XTZA 2HU2A 3JYLA 3L8ZA 1P4GA 1WSWA 3FCCA 4YDRA 4I1RA 4JB2A 2IPMA 4HY3A 4NU8X 4Z0NA 4HB2A 3VTAA 3BIJA 4GM1A 1VQ1A 2I1VB 4DADA 4IFEA 3GP8A 2GH1A 1AGYA 4KXVA 3S2SA 1IK4A 5CX1A 1VCMA 1Y3HA 4NABA 3U60B 3ZX5A 2JNWA 3GLKA 3RU7A 2QZPA 5CDFE 2GJKA 2VNJA 1G2IA 1U8EA 1V6AA 2ZRLA 3PRYA 3FJYA 1D9ZA 1ZRMA 2ZETA 5EXSA 3SQMA 4H6WA 1JQLB 4CU2A 3CURA 3DTNA 4NPAA 2CNWD 2A9VA 2PYIA 1WXQA 2JFQA 3VHXB 3NMUF 3QWAA 4FGSA 3SS7X 4BO9A 2D2FA 1Z56C 2JIPA 5DN6D 3KQTA 4E5KA 5JJBA 2C04A 2ZRCA 1DQRA 3EEBA 3AMVA 4KAFA 1HFJA 3Q3IA 4MXDA 3R20A 1T8WA 3PUKA 1XI2A 3NM6B 4DQLA 2Y3IA 3KEFA 1WNTA 2JBWA 2ZYRA 4ZC8A 5TMDA 3GEGA 1PW5A 3VH3A 9LDTA 4HRXA 1RKUA 3L46A 4GZMA 4JJIA 3ROEA 3WE7A 3S8YA 3ANXA 2VXYA 5EE1A 4BMOB 4E1BA 4KHPB 3CMCO 4INZA 1VBKA 3FWYA 3MTAA 3BEOA 4MGKR 4QDZA 1JEQB 4EPYA 3OCWA 3OEEA 3WAKA 4OFBA 5FI3A 1YONA 1ZH0A 1BIFA 4HNHA 5K7SA 2CNBA 3LHDA 1IFXA 4BYMA 3F78A 3K9QO 4GG1A 4MMXB 1PN3A 4N18A 5CAEA 4OLHA 1E9FA 2PX3A 2VPWA 1TX4B 2ECKA 2X0IA 3PE6A 4MCIA 4IINA 3V4VB 3T0GA 4PZAA 3RVSA 4UDYX 3I39X 3MF4A 2PJRA 1RMQA 2IY7A 4MW0A 5J1SB 5EJ5A 4A2QA 2O4UX 2WNIA 5L4NA 5IARA 1TQ6A 3ETCA 4BCCA 5EXEA 2A14A 1G42A 1J8YF 3LM8A 3IPXA 4KE6A 5HIAA 4KQFA 3FNFA 4L6AA 4MAAA 4V1CI 1R27A 3L0DA 3PQ2A 3ZDDA 5HIMA 1O8CA 1PNOA 1QK3A 2OO7A 4L9SA 4ASUD 1EK5A 1Q19A 3BMOA 3TAXA 5LDHA 2EFEB 2RGGA 2W5UA 2IITA 4IQ8A 4IZOA 3U7QA 3T7SA 1SVUA 3CNOA 3RWBA 1CUGA 4F2DA 3P4UA 3Q0IA 5B58C 5IULC 2Q4EA 2FEMA 4RIEA 1O9BA 4ZCQA 5M34A 2W93A 1U6JA 5JR3A 2J6IA 2V58A 3BK1A 1Y7TA 2FWRA 5EJ2A 5K0ZA 2C83A 3ILVA 2OWDA 3L05A 2ZPTX 5IG2A 1PR9A 5L7TA 3KRTA 5DBGA 1MB9A 3CZQA 3ESZA 2XR1A 4B2PA 3L7JA 4QTUB 1NSYA 2XMBA 2PU7A 3TQSA 1ID1A 1SA0B 3B6KA 3P9QA 3V00A 3PC2A 2PFGA 1R88A 4LYAA 1I9GA 3BGWA 3H99A 4Y0NA 2BGTA 1WDLA 4H9GA 3ASYA 4RY2A 4P9NA 1OY1A 4BHTA 2X1LA 1Y6FA 1XXLA 4GXRA 4LZWA 4B7AA 2N0SA 2CUNA 3BTSA 1NW9B 3OOHA 1ISSA 3QM1A 2QYOA 3TTWA 1K7YA 1N7GA 121PA 1U9JA 1MV8A 2DJ5A 2XOEA 3EMBA 1QYRA 3B9QA 3DB2A 3FG9A 4KYIB 4TT8A 4QG7A 4DJEC 5KHLB 5LWHA 5FNZA 4L50A 4NICA 3ZEIA 4NBSA 4YCCA 2YX1A 4LSZA 4OHOA 4URHA 4YCDA 3W90A 2AE1A 4C4SA 2ZYDA 4PN3A 5EHZA 1KMMA 3LP6A 3NOVA 3OLVA 2WT4A 3CEMA 4OQEA 2X22A 4O63O 5L95A 4TSFD 3FOFC 1VKZA 1UPBA 3KK0A 4ZMSA 1XXHE 2GF0A 2VSXA 2ZVPX 3RK4A 4YUZA 1W52X 5JWRA 1DTEA 4O4LB 3TQIA 5JJKA 3R76A 5JROA 3NJ4A 2B35A 1P9NA 1X14A 3KWFA 4Q3BA 2NTVA 4MIEA 5IM5A 4PXYA 1W581 3U40A 3WNCA 5IKEA 4YBZA 2X23A 4WBNF 2EKQA 1R5NA 2E1RA 5D3QA 4PLPA 4CQJA 4EDFA 5JBNA 1ZR4A 3EHDA 3KAKA 1UBTS 1B3RA 5U4XA 4AMUA 2GX6A 2WHPA 1S8AA 2AJTA 5F3WB 3WAJA 1NN0A 1KK3A 2I6UA 2W6IA 4NCIA 5FWXA 5IAAA 1GLNA 3E48A 4O4JA 4MQ5A 3KR0A 4DRXA 1QP8A 1B6SA 1J39A 2CUTA 4R0NA 1XCMA 1PWZA 1Y0BA 2ZSAA 2DCUA 4HDKA 4KKVA 5IPFA 1XZKA 3KYDB 1C7FA 1U1CA 5ALRA 3K9FC 5TVGA 4U02A 2ET6A 5I4IA 2N9UA 1K1EA 1XELA 1Z0SA 1IJKA 3HHPA 3KT8A 3SFTA 5KJCA 2QSZA 1GYRA 3LK6A 5JAMA 2JGMA 5JQGA 2A57A 1Z25A 1U9YA 4R40A 3QXHA 4JHLA 1UT5A 3G2IA 2DYKA 2I3ZA 3QBTA 3E3NA 4M37A 1ML3A 1EP3B 3I9JA 2O8FB 1A88A 2AKYA 2I65A 2G9QA 3OWXA 4AY4A 3T7TA 2PV7A 2EJBA 2NP6A 1IMOA 5BNFA 3CNNA 3AHCA 2UV8A 1DC7A 1KDPA 3OTGA 4EG1A 2F62A 4HZGA 5T5QA 1BHSA 2C07A 3K4PA 1CUXA 1ISJA 3L6EA 4YJ3F 4E2FA 2V0GA 2XCUA 3HL4A 3HABA 3PG5A 4UEOA 4FNGA 3IULA 1E6UA 3RVDA 5CD1A 2QD4A 3FFTA 5C1BA 1ZH8A 2HJSA 3K6SA 3G0IA 3JW8A 1PSDA 1GUAA 1O5TA 3OLCX 1QH8B 2ZUBA 4NESA 4ECEA 3EEIA 5JCPA 1KEUA 4BU0A 2XZDA 2Q8QA 4BPBA 4FLFA 3AVTA 2O57A 5LMNB 1MBZA 3V6LA 4ACAA 4AMZA 5FL3A 1TMKA 4UAGA 2VK4A 5CR9A 3TB4A 3LFUA 2FEKA 1JG6A 2A78A 5ED4A 1Y9ZA 4GLOA 4Q82A 2DTEA 1WLYA 3WHLA 3UKJA 4DYHA 4OSPA 5IXSA 1GNTA 5IK2D 1X0XA 3KKOA 5LYJF 2J9ZB 2WRZA 3ZV6A 5LDDC 1E7WA 3OTQA 3GJ0A 2NZXA 1XZDA 3RHFA 4B3HA 5AVZA 5JH7F 2FI1A 3U4AA 3C4JA 3WMWA 1L1RA 5E3JA 1Q0UA 1KSHA 4FGZA 1G2QA 2X5NA 4ERXA 4MKHA 2ZFUA 1IBLB 3GUZA 4BUCA 2RGXA 1EK6A 4WUTA 2EGGA 1DKQA 1NU6A 2JHCA 4GH5A 4U8HA 3UOGA 1E1NA 1N4DA 2GPYA 4Q9IA 4GHWA 1S2GA 2PT9A 2SBTA 1RYEA 2F64A 1N34B 2VZEA 1FFEA 4BQPA 5TEWA 1OLXA 1LDGA 2Q5QA 4MS4A 1HE4A 1MNQA 1SCNE 2OOSA 1LTQA 1KEEA 2B8NA 3KTDA 2IQIA 3PFKA 1HQKA 3ZE0B 1K4MA 3ASZA 2O54A 1HQYE 2QTBA 1CD5A 3DL0A 1P5HA 1PGQA 1EVKA 3K6RA 1NR5A 1ZN7A 4UTZA 2PANA 3W2HA 2ZRBA 3I3SR 4N41A 2AD5A 3ILSA 5EQJB 3WA6A 1FFCA 4F2PA 5JAHA 3PJDA 1FUIA 2C29D 2QY6A 4GYKA 4E09A 1NR7A 5B7PA 2J5KA 1GYPA 2DKFA 4CETA 2WLSA 3CXUA 1MOPA 3L9XA 3VTKA 1Z5OA 1HDOA 1F0YA 3H0CA 1KK2A 5AW4A 3KQHA 1W4LA 1LFDB 3SOZA 1V35A 1SPBS 3IRVA 3NAGA 3P5SA 3PZBA 4AY2A 1RM5A 4N9WA 3X2SA 1L6RA 4XCQA 1WNFA 2OV6A 4KACA 3GRAA 3V3KA 3A6HA 4Z4EA 1B93A 1MOZA 3CLUD 3KOOA 4IIVA 3U4IA 4KDCA 4FFLA 2NGRA 3FXAA 4YJKA 3I2HA 3WIBA 4BFXA 3FY4A 4EB8A 3FUUA 4BLQA 1UZAA 2IHZA 5HE8A 3PDIA 4YACA 5A5EA 3RROA 1UUFA 2FPUA 4B80A 4WL0A 4JNCA 3NHMA 5FTNA 5JDCA 3UMFA 2ZP1A 3AVWA 2HH9A 2YTZA 3R5JA 5IVHA 3NPMA 4Q66C 2Q5HA 2R6GA 1PW7A 3EZFA 3ZGZA 4OQLA 5BNIA 3V97A 4NV3A 5P21A 3D7LA 3FCAA 3K4HA 3L8EA 4X1YB 3DOUA 4JC5A 3LZDA 1E3IA 1XTJA 1U0LA 1GAWA 1L4MA 1X80B 2PZAA 2RK6A 1CW2B 4KNWA 1GAEO 3F3YA 5KYWA 2R0QC 2Q5CA 5CLGA 3U31A 4AY5A 4NWIA 1FP2A 2WTAA 4UOEA 2BUAA 4YJ2B 5B4TA 3QE4A 3NP7A 4QPZA 1UMBA 2B34A 2M6LA 4BV9A 2IYZA 3DT8A 3FUWA 3VTFA 1USGA 4QKQA 2QM3A 3SQDA 3T94A 1FNCA 2HUPA 3L04A 4FDVA 3WSTA 3N7AA 3FYUA 3NBAA 2IOFK 4IYRA 3TINA 3GRZA 2CCKA 2EAUA 3EVFA 4OSEA 1DXYA 5AK0A 3RS0A 2I6XA 5EWJA 3UFXB 4LNUA 3GA5A 4JGGA 3ZIAD 1GAXA 2CLDX 4WPGA 5A6SB 3EZ7A 3PWZA 5ALVA 4X97A 3HU2A 1M8KA 4MQ4A 4OHCA 1ISHA 3S6JA 4HN2A 4IWYA 1W85A 1EA5A 4WLOA 1TVKA 3ISJA 4YPVA 521PA 1T0JB 4F6RB 1BX3A 3ZJVA 1G16A 3GIDA 3R0ZA 2PL5A 3CUEF 4ZT4A 4C4XA 1HDEA 5DKFA 2KPOA 3AINA 1H4VB 2O0JA 1H2FA 1LLUA 4PRLA 3QJGA 3B85A 4YO7A 1MRSA 3FM9A 3ABQB 4DR4B 2C77A 1ADYA 1EIZA 2C82A 3NU1A 5JFGA 3WRYC 2OHXA 5EA2A 2P9EA 4HCJA 1GSOA 3PI6A 5CFNA 2B4QA 4BNUA 3U56A 4XUGB 3AR7A 3QU7A 3HZZA 1ULTA 4DUZB 3HJTA 2JVJA 4OHYA 3UANA 5I9TA 2V98A 4WA7A 4EGCB 3AUSA 4GKKB 2QNIA 4DLSA 4FFSA 4KCGA 4ZRMA 1H1LB 3JAWB 1UXHA 5KPJA 2W4IA 3K2IA 3CINA 4ZAYA 1USWA 1HT1E 3OM9A 2PUVA 2QVXX 1DOHA 1E0KA 4N5LA 1IXZA 1AGPA 2ZB8A 2CXQA 1KERA 2GVNA 1D2CA 1N5OX 3VNRA 2EKLA 5CBKA 1A9XB 3OT5A 3FNQA 3ROPA 1IM5A 3S68A 1EVEA 2EJVA 4OYLA 4C2BA 2Q8PA 2C1EA 3N7TA 1C3OA 1K0UA 3DOJA 4FBGA 1FVHA 4KBYA 3KT0A 2O7QA 4G5XA 4POOA 3CRQA 1Y8CA 1X92A 1GQ2A 3NLLA 3D81A 3KZVA 2IF0A 1K7FB 1FYVA 5LQAA 1ZUHA 2CMDA 2Q1XA 2Y71A 3PJFA 4YCSA 2G71A 3VR5A 1WBBA 4CQLB 1UMCB 1QGYA 2WINI 4FMDB 4TL9A 2IOYA 2BBOA 3OFND 4AC9A 1ZD5A 4D1YA 821PA 1UMDA 3V8NA 1SKQA 5THKA 3UA3A 1D4OA 2VNKA 3ZLVA 2V6MA 1R6XA 2OCGA 4YWHA 3L6OO 5DWDA 2B36A 4KR7A 4FT4A 3G49A 3L6RA 2AF4C 4W5WA 3L06A 1RU3A 3K1AB 3W06A 3WIUA 4DLVA 2FSHA 2YMPA 1G3QA 1T8PA 1MJNA 4PV7A 2B4RO 2W2KB 4X91A 3LBFA 2ZI4A 4X00A 3D43A 3RTCA 1UXKA 4REOA 2Z3ZA 4I55F 3ZR4B 1G6HA 5JVDA 3RB8A 1X7ZA 2EFJA 4M6WB 1DC4A 3W3ZB 2VF5X 1FTSA 1OAOC 3PNLA 2YVUA 4GLFA 4RVGA 5BWCA 5AHWA 4RTOA 1C30A 2CJYA 3FDIA 4MI9A 3LXUX 4OKSA 5I9IA 3PRKE 2C98A 4BJ3A 4Q4AA 1H6DA 3LQFA 3ITNA 3O7WA 2OBLA 2IP4A 2K7ZA 3LSTA 3N6RA 1QYVA 4GXQA 4P31A 2KYRA 1ZJYA 4QBKA 3K09C 3WI7A 1QIMA 1LDYA 3M4XA 3NTLA 4V0LA 2GZSA 4JP5A 4YAIA 1RWOA 4ND4A 3TRDA 3IAAA 1L4EA 3IVMA 4D9KA 2AYZA 4RFVA 1G8FA 3O21A 1YKGA 1AKTA 1TTTA 1EB9A 3ZWAA 1MABB 2PPLA 3FPLA 1K68A 1E79A 3BSSA 2C94A 2NU8B 3UJ9A 3CU5A 2JI9A 3I4LA 1SR8A 4MPRA 1W88A 3LIIA 3QSGA 4B71A 5DE3A 1IM2A 1C0PA 1MJGM 2JKZA 1IYZA 4YJHB 4LZOA 1EFLA 1ES9A 1JTVA 5LBUA 1RRCA 1ND5A 3FPJA 2DG2A 5DTJA 1VBNA 1EDEA 5J2UF 1IY9A 1PAUA 1OAKA 2B5VA 3R77A 3C6XA 1JAYA 2H2FA 3EVZA 3NAZA 4P38A 4AMVA 1XKXA 2PBLA 4BQNA 4IJUA 4J0KA 2X0FA 1JFRA 3RTGA 3S2UA 4MWTA 1QV7A 2ZSJA 4OGLA 4QQNA 4MDFA 4R2LA 4BTVA 5KB3A 3GJTA 2BHRA 3F0TA 3WGYA 3MB5A 3TXYA 3ITKA 3TDKA 1YQEA 1M75A 4JVLA 4NJEA 3FYUC 3OEYA 4BRWA 4JZYA 1XNHA 1Y6RA 3O4RA 4JC0A 5CXXA 4AYTA 4FFBA 4TQ9A 1E1QA 1L7RA 1JKJA 1ZI8A 3ASUA 2PN1A 3PICA 4HZUB 5FEMA 1F5NA 1L4LA 2W37A 3HC7A 2REQB 4QPNA 1A1SA 2IUSA 3T99A 3FAZA 3BQNB 1W5BA 1XVTA 1GKIA 3HXKA 2G5GX 4CF6A 2CLHB 2EV9A 1O6BA 4I1PA 3U19A 1U0NA 3KOYA 2BONA 4WRRA 3LQ2A 1RAIA 2REOA 3GP5A 5KNDD 1NYQA 2IU3A 3HGMA 3OLQA 2GAFA 3RSGA 1XQWA 3W1WA 2TECE 4GOLD 5K2MA 4JUFA 2DQSA 1G0NA 1NTOA 1OA0A 2AB0A 2PZLA 3DWEX 4TKVA 3PNKA 4N5DA 2P9QA 2ENUA 3A1CA 3T7RA 2YINC 3WRXA 5A4JA 4KBFA 2ZIZA 1L7AA 2FGKA 2A35A 4QUIA 3VU0A 1GFZA 1M1ZA 4KXFB 3IXQA 4FFNA 1KMCA 1A8HA 1U7XA 1AQYA 2PAFA 3AR3A 2JLBA 2QRHA 4ZZ0A 3L0SA 2CFIA 2DT8A 3X1XA 3EW9A 1CZNA 3FLBA 3HYRA 5E6RA 1W34A 4BYGA 1HSOA 2GN4A 1E5TA 5L3RA 2C61A 2RHLA 4HDRA 1OZ0A 2CVHA 4TUYF 2C9MA 3VPSA 1WUHS 2DX7A 1G8YA 2FSPA 2FX2A 2HBYA 2ZR7A 2VP9A 4WZBB 2IY9A 3BSWA 3E2IA 3S2EA 1SH7A 3T5TA 4XB6B 2CHUA 4XLTA 4HNAB 4NZNA 3K8ZA 1NN5A 2POCA 3KYCB 4BTLA 3DKKA 4NAVA 1AT1A 3S1LA 3KJFA 4M8LA 4H16A 1BCSA 2BEWA 4YDQA 3MINA 3GJ8A 3OHSX 1E6CA 1GQFA 2CLMB 3JZIA 3L0PA 2YMMA 4P98A 3BDAA 4URXR 4ARUA 2ZXFA 4DTCA 4GD3Q 4N3NA 3RLFA 1QS0A 4HEHA 1X8XA 2P9ZA 5FTKA 2VYFA 3RJTA 4MRRA 3G17A 1NR1A 2QVYX 4TRNA 4GQBA 2JD0A 3UK0A 1GN9A 5E6UA 3IT3A 3GFSA 3QU9A 3GMDA 1Z7EA 3OECA 1WZCA 3ILHA 4ZU6X 1M2WA 3O26A 3EPLA 5M5BA 4KIWA 2ECOA 2AC4A 2H3HA 1ZSNA 2ZI3A 2WUGA 3FR7A 4LC9A 4RF4A 3ZCPA 4ZVTA 3FFWA 1T13A 2AZDA 3W3AD 1Z47A 2NV2B 5K0EA 3A2MA 5KOHA 2XZLA 2YZKA 4QLOA 4WACA 4WVFA 2EKPA 4C08A 2VQ3A 1DAIA 4I4CA 1T43A 3HGQA 1E1DA 4LZZA 1K92A 2ILTA 3MTBA 3HQ4O 5TF0A 2WKQA 4RCVA 1QU3A 2YV1A 3QFRA 3H1AA 2XXJA 3CLKA 4S2UA 3C45A 4ZV9A 3M3DA 5BSFA 5CLIA 5C32A 2D13A 3U7JA 1RYDA 1IPHA 1Z2EA 1P7ZA 2YRWA 3L1IA 1WZEA 4UD2A 3LT0A 1HYHA 3KOWA 4LCJA 4YIKA 3L92A 3L07A 1JDBC 1Z0FA 3AHHA 4GNKA 1F38A 2ZI6A 3ZHVA 4DT1A 3LUGA 3KQNA 1UOOA 2N1MA 5LNK6 4LXUA 4HB0A 4MIYA 2NUTA 1ZNXA 1EX1A 1U3FA 2Y67A 3B52X 3A1UA 3FMOB 4U63A 2FZGA 4BQEA 4ZN6A 2IDZA 4MVXA 4Y2PA 5M04A 1ABBA 2UUBB 1Z0KA 4P58A 1QX4A 1EM8B 1L2TA 2AV6A 2HU8A 5JCZA 1CS0B 4B6EA 5KO2A 2DHRA 3LPDA 1T9GS 5MN6A 3UUGA 2ZSDA 3KQLA 5DK4A 4L3WA 4BX0A 1XEWY 3L0OA 2J3EA 5LPNA 2ATEA 4RS3A 3QXXA 3BS4A 2G9NA 2CXNA 3UJBA 4B79A 1NYTA 3Q7SA 1XEWX 1BQ3A 5HA5A 1HYBA 3NORA 1JYSA 1E66A 4FFWA 2FUG1 3ZCVA 5C2JB 4E5DA 1TAUA 1E63A 1D0SA 3CIFA 3KQPA 3HTXA 3PVSA 3ZTWA 2Z1NA 4FKMA 5EZYA 2L19A 2ZJBA 3KKKA 3TBHA 1XRMA 2XKJE 2WC1A 3STTA 5D8DA 1U3GA 1TMGE 2C3UA 2OOKA 4OSOA 5T8KA 1PDWA 2DPLA 1Y8AA 1D4FA 2G17A 2K2QB 1R0XA 2FWMX 3GDHA 3PD7A 4XOIA 5EXPA 3TGWA 1JLMA 5K3EA 5KYNA 3HY6A 4ILKA 4MW4A 2JJ1D 2EZUA 4LW8A 2JGAA 4P80A 5F5XA 5KVQA 1A2OA 1XAJA 1HE1C 2QTNA 1XD2A 4JI3B 4MV5A 3F49S 1YK1A 3SJBA 2R97A 3LYUA 5EJIA 2QY9A 3SJCA 3RRYA 4EKYA 5C51B 3UJCA 2ORED 4HLQB 4IV0A 4OJNA 3LA8A 4C30A 1K3UB 1DX9A 2B3TA 3L0BA 1F8YA 4P36A 5BMVF 1OXBB 5H1YA 4XWTA 1MJGA 2OSBA 3AEQB 3JQ7A 3LUFA 3LWZA 4QD3A 1NMQA 1XZNA 3GL9A 1P2DA 2G0NA 2EGUA 3HM2A 4H60A 1KY3A 1SG6A 1ZU4A 1A76A 2C1XA 2Z8YA 3IAFA 5DYIA 2HJVA 4J7CA 2F4VB 1Z18A 3OQVA 5K9ZA 4B85A 4RMGA 4YDHB 1HM5A 3F3SA 3C6ZA 3ND7A 1XV5A 3P96A 4US1R 4XFDA 4Z7JA 2CJWA 4ESEA 3RNLA 3GEDA 3Q8WA 2FY8A 4A8JA 1I8TA 1JN0A 2F1JA 1EJBA 3D3KA 3NBFA 4BZWA 1OD6A 5HS6A 1S7CA 2ZRNA 2IODA 3E2MA 2P0AA 3SC4A 4I50B 1L6IA 1RC1A 2ZWOA 4U7WA 1V9SA 1Y37A 3K53A 3ON5A 3ZKAA 2RC5A 4NATA 3K73O 1TM7E 4RKFA 4JY7A 3ND6A 2ZSBA 1R10A 3F2IA 3MWEB 3QPAA 3V8MA 1P0CA 1JBEA 1E1RA 2XEDA 5WRFA 3UJAA 3BMNB 5HF8A 4DKXA 4KKXB 1V11A 3FHTA 3GZNB 3ZKWB 3SI7A 5JC8A 3WO0A 4YJGB 3RRJA 4JGIA 3GJXC 1DDIA 3R3HA 5HF9A 4ZHQA 3GG2A 1OFGA 3IH5A 3NVMB 4X24A 5CH3A 4YMIA 4GI1A 1QHHA 2VJPA 1O08A 4EFDA 5AUNB 1RPNA 3N86A 4CIDA 4CM9D 1Z6XA 1LK7A 1D1SA 4JX8A 3U3OA 1YI8A 3UM9A 3UV3A 1V2HE 2G82A 1YDWA 2EWVA 2O07A 2IH2A 4AJ4A 4F91B 4R5HA 1H4SA 3EA4A 3IEPA 1QPBA 4AJNA 2DM6A 4IOLA 4LRWA 1E2MA 2VYNA 1FC0A 2PH3A 3C5EA 2FX3A 1MC5A 2X8WA 5P8WA 3S1SA 3AVXA 4V2IA 3T12A 1NJ6A 5CNIA 4DYDA 4HK4A 2R3SA 3CLVA 1W1UA 3GLHA 4QUDA 4P83A 4UHBA 4X54A 1L7VC 2AYYA 1M2VB 1VIAA 2II6A 1CYDA 4UULA 5TGDA 4F7DA 1KTVA 4KQEA 2GEDA 1NT4A 1US8B 3AC0A 3KB8A 5ALIA 5BRAA 1DC8A 3ZHQA 3KAPA 1LEHA 4F5WA 3GPCA 1M1XB 1LX7A 3SJ7A 1HE5A 4B74A 3T3OA 3EX7C 1Z0IA 3GEIA 3PC6A 2HB6A 2I2DA 5ARDA 3FHLA 1ZH4A 1EPUA 1UPCA 3UTDA 2XMSA 1A5SB 1HEYA 2W6JD 1DCFA 4J29A 3I5YA 1J33A 1DKRA 4ZQEA 1SBYA 4BJHB 1RE1A 1DUIA 2GXAA 3OJLA 4M0LA 1QG2A 2VRBA 3O9MA 2IYTA 1FFGA 3O4FA 3GLIB 1PJRA 1CUJA 2PXAA 3MFQA 3DEHA 1AXRA 5CCDA 3OJ0A 4RAQA 2GEBA 1QH0A 5LQCA 4W5RA 3OCXA 4L9RA 4PRYA 4LX8A 2JFZA 2XPCA 3PTAA 4AFNA 2NYVA 3CY6A 2C4TA 3MMPA 1YS7A 2A9KA 2RK4A 5NULA 3UPDA 2ZULA 4MIOA 4CFZA 1OFHA 4EX6A 2J31A 3DULA 1DEOA 1NBEA 1ZM7A 2A9FA 4XB2A 1N1MA 3MELA 3EQ6A 5KMGA 1A71A 1JHAA 3RBZA 3TUJC 1UK9A 4GE0A 2VF8A 1JSCA 4CL3A 4KZPA 5SZIA 3O3CA 3T0FA 4YRNA 5LJLA 3GLGB 1W4CA 1O0BA 2ECQA 3ZDQA 4HEJA 1OF1A 4BB0A 3NJRA 1T34A 4WK2B 5BW4A 1UJNA 1Y8QA 1OI4A 3URMA 2OILA 4FX5A 5JI3E 5HUJA 2O19A 3KKMA 2CDBA 3EEFA 3ZH2A 4DY4A 1BS9A 3HLTA 4JJ8A 1CUHA 2H1WA 3L41A 4JJFA 1HTBA 1OX5A 4LJYA 3T5PA 2PUHA 2FN7A 4QOEA 1NUQA 1YNSA 3E9DA 4K81B 4OTZA 3BFPA 1JT2A 4TS3A 4BNFA 3GPLA 3A04A 3NETA 2VBCA 2C2GA 2WMYA 4IF4A 1IWOA 4I8DA 5JAIA 2YFYA 1QVWA 3O91A 3OIYA 2GZAA 1MLDA 1A9ZA 4Z9YA 1DAPA 1GU7A 3OM0A 3WR5A 2Z58A 1JFVA 5L45A 4JI8B 3GHHA 5KJEA 4YS6A 4EABA 4XIJA 4DJAA 1WABA 2I6SA 4J1NA 1EFVA 4TRJA 5LJIA 2HJWA 1NNLA 2QL6A 1FX1A 1TGYA 3PJEA 2P11A 3QTTA 3PFCA 3KWMA 1RWPA 1Q6YA 1Y48E 2ORVA