3NWEA

Rat comt in complex with a methylated desoxyribose bisubstrate-containing inhibitor avoids hydroxyl group
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
213
structure length
213
Chain Sequence
DTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEINPDCAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catechol O-methyltransferase
publication title Catechol-O-methyltransferase in complex with substituted 3'-deoxyribose bisubstrate inhibitors
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase/transferase inhibitor
total genus 76
structure length 213
sequence length 213
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2010-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3nweA00
1X1BA 1JG3A 1NT2A 3T7TA 3B5IA 4QVKA 3UA4A 2ZW9A 1VE3A 2NP7A 4PINA 3DOUA 2PXCA 4PYNA 3TRKA 1JG2A 5K01A 5KQSA 2Q41A 1JTEA 4YV1A 2B3TA 3I5UA 4RTOA 5LQKA 5DSXA 10MHA 1RI3A 4PNEA 4CTJA 5LQRA 5LQJA 2JHPA 2UYOA 4R6WA 4DA4A 1R6AA 1RJFA 3LHDA 5DTQA 1SKMA 2AVDA 1NBHA 2BR5A 2ERCA 3HCEA 2PX5A 3Q87B 4X41A 1MHTA 1M6YA 1XJ5A 2NXNA 3LECA 2AN3A 5C1IA 3S68A 4POOA 5GOZA 5DLYA 4OBXA 3UJ6A 5H02A 2PBFA 1VL5A 1INLA 1YZ3A 3MAGA 4GF5A 5E9QA 2IDKA 4GC9A 5K0NA 2OYRA 5IH3A 3G2QA 4OQDA 4DM3A 1JTFA 5E1OA 2CKDA 1JR4A 1EG2A 4PYLA 2PWPA 1VP9A 2ZTHA 5EZQA 2FRXA 4IV8A 2G71A 4RVGA 5LQUA 3PS9A 5CVVA 5EIWA 1G8AA 4ER5A 3M6XA 4OA5A 1BC5A 1IXKA 1YB2A 1WXWA 2AOTB 2PXAA 3HNRA 5DSTA 5EIFA 3AWIA 4E2WA 4PYIA 4YUYA 1TW3A 2JG3A 3KQTA 3BGDA 5DM2A 5E1DA 3O7WA 1NBIA 2AOWA 1WY7A 2PVCA 2B9EA 3TOSA 3HVIA 4PWYA 3EPPA 2R3SA 4DCMA 3KQYA 3EVBA 1G8SA 1F38A 2AOTA 5C9ZA 4YUZA 2DPMA 3ER8A 5F2OA 3O4FA 4RTLA 3VC1A 5K0FA 3GRZA 3TLJA 3GWZA 1XVAA 2JH8A 3BKWA 5GP1A 3DMFA 1HMYA 1I1NA 4R8SA 4PYJA 2Y1WA 1NE2A 3A25A 4KIGA 2O05A 2AN4A 2V74B 3DTNA 1KPIA 1X1AA 2IGTA 2P35A 3CVOA 3NDIA 1FP2A 4KW7A 2HMYB 4AZWA 4M7RA 4FSDA 2PX2A 3HCBA 3LCCA 1YUBA 4LECA 4X60A 1WS6A 4E2YA 4ER7A 5KYGA 3HCAA 3HM2A 4Z2YA 4JXJA 1RI2A 3EVZA 4IKPA 2ZZKA 3I53A 2PLWA 4C08A 5GM2A 4PIPA 2I6GA 3BT7A 1SG9A 2PT9A 2G1PA 2OB1A 5FWAA 1UFKA 1IY9A 1AQIA 1TW2A 1XXLA 5HIKA 5GINE 2XYQA 3SSNA 2P7HA 3KR9A 2BZGA 3P2EA 3EGIA 5KVAA 2H1RA 3BUSA 3THSA 8MHTA 3GCZA 1QAQA 3LBFA 2B78A 2ZIFA 5EMMA 2EJTA 4KRGA 4BLWA 1X19A 4CTKA 3CBGA 2P1DA 3KPVA 2YUIA 4P7FA 5T67A 4UOEA 3OZRA 3LKDA 4PYKA 4RWZA 1KHHA 5DT2A 3RIEA 5U4XA 1L1EA 3MGGA 4FZVA 3SSMA 3EVEA 1DL5A 1ORHA 3LPMA 3I9FA 3PFGA 2GLUA 1XDZA 4FSXA 1G6Q1 4RVFA 1KXZA 5HILA 1YFLA 4KDCA 4XUDA 5E9WA 3EMDA 3UJBA 4XUCA 4M36A 2ZLBA 1R18A 1XDSA 5BW5A 3I64A 2G8NA 2IP2A 4C4AA 1QAOA 1NV8A 2E5WA 4FR0A 1WXXA 1XDUA 1X1DA 3DULA 3PX3A 4LG1A 4BLVA 5BP7A 3FRIA 2ZBRA 3DH0A 4GEKA 3NTVA 4GUAA 3PX2A 1O9GA 4MIKA 3UJDA 3G7UA 3NW9A 3EGEA 4DKJA 4KDRA 4BY9E 3FTEA 5HOQA 1MJFA 2ZIEA 2P3LA 3MTEA 5FHQA 5HFJA 1ZG3A 4PYQA 2PWYA 3FPJA 3CC8A 4DQ0A 1BOOA 2G72A 1QZZA 4HGYA 1L3CA 3G88A 3P9KA 5EZSA 3KR0A 3PTAA 1JSZA 4YUWA 4FP9A 5EMLA 2PT6A 3A26A 3GRRA 3UJ9A 5LQAA 3GIWA 2IBTA 3TKAA 4A6EA 2PSSA 2VDUE 3KQMA 1YF3A 1JG1A 4R8RA 1JSXA 2NXEA 2ZSUA 4L7VA 5FULA 4YV0A 3NVKI 4OQEA 3BZBA 1R8YA 3ELUA 4GOMD 3NJRA 5FQOA 4E30A 2HNKA 2JH9A 2V7EA 5E1MA 3T0IA 4B17A 2YXLA 4RTSA 1UIRA 5FA8A 5F2NA 2GPYA 3HVHA 1VLMA 5EMKA 2PX4A 4M38A 5FCDA 4MTLA 3HA7A 1VBFA 3CJQA 3L8DA 1WZNA 4WXHA 4AZVA 4EKGA 5LQCA 3BXOA 2HTEA 3DMGA 3G8BA 5GM1A 5KQRA 2C7RA 3X0DA 4HRAA 3JWHA 3P8ZA 4ATNA 2VZ9A 1NW5A 2OXTA 5LQNA 4RTKA 4X1OA 4RX1A 4CWAA 3R9XB 3HTXA 4XCXA 3SXJA 3B3JA 3ERCA 3OZTA 2FYTA 2P40A 3T7SA 3KPJA 1NV9A 5KS2A 2HWKA 4DF3A 1N7IA 2XYVA 4IV0A 5EQJB 5FWDA 2FHPA 5K03A 4V0RA 3LCVB 3G8AA 2PXXA 3NMUF 4DZRA 2GAFA 2F8LA 3WSTA 5CCXA 3KQOA 4ER3A 3IYLW 4FT4A 3V8VA 1R74A 4E2ZA 3Q7EA 3P9CA 2YVLA 3PB3A 3ELWA 4GQBA 4E32A 3ME5A 3ANXA 1EQAA 1JQEA 3HEMA 5E2AA 3O31A 2YXDA 3LGAA 1KP9A 2WA2A 3KQVA 4GOND 2P8JA 3BKXA 1L3BA 1L9KA 3EGVA 4NECA 3E8SA 5EPEA 2ZZNA 1BHJA 3R6TA 2QY6A 3FZGA 2IH2A 2UYQA 3EVAA 3QOWA 2ZCJA 4E31A 5HEKA 5K09A 3HCFA 4E70A 5FUBA 3TPZA 5IKMA 3UBTA 2C7QA 2AZTA 3HVJA 1QANA 3FTCA 3UWPA 2OO3A 2IIPA 2OY0A 3R24A 5CVEA 3KQQA 4CKCA 5FTWA 2CWWA 4M37A 4DCGA 1I9GA 1HNNA 4YMGA 4X63A 3QOXA 3TR6A 4YMHA 4QDKA 3CJRA 5G02A 5JUWA 2BR4A 2AS0A 3SMQA 3OU7A 3MHTA 1ZHFA 5DM4A 3LSTA 1NW3A 3UA3A 1SQFA 2O57A 2VP3A 3BWBA 3NDJA 5CVUA 3FUTA 4QQNA 3CKKA 1AV6A 5DPMA 3FPEA 3KQWA 4R6XA 3P71T 2C7PA 3GNLA 1KYZA 4HG2A 4IWNA 1YFJA 1UWVA 5HIMA 4E2XA 2AOVA 5HIJA 4ER6A 4FS8A 4QPNA 2A14A 3OFJA 3ELDA 4PIMA 1JQ3A 3M33A 1VPTA 5EVJA 5FA5A 3FUWA 5HZMA 1SVUA 3KPYA 4RTQA 5ICCA 3JWGA 4KVZA 4EQZA 4AUKA 5CD1A 1FBNA 2XVMA 4E33A 4EVIA 3PFHA 5JR3A 4GOLD 1G55A 4O29A 1VIDA 4ER0A 4YUXA 3HA5A 2PGXA 3VYWA 3DUWA 2NP6A 3UJ7A 4ZTBA 4F86A 2CL5A 4HH4A 2HV9A 3MCTA 3G5TA 4KIFA 3LX6A 1KYWA 3FPHA 3LCUA 3GDHA 4QPPA 5D1HA 4QTUB 4RVDA 5FQNA 1Q0TA 1SUIA 4LWPA 1RJDA 3OE4A 3P9NA 4XUEA 4EK9A 2UZ4A 4RVHA 2ORED 3ORHA 3UJCA 2XBMA 3FUXA 3AXSA 3C0KA 4K6MA 4LWOA 3QV2A 5K0BA 3FRHA 3U81A 1O54A 3OE5A 2AR0A 2ONZA 3B3GA 3DXXA 2WK1A 3KR1A 4MWZA 2VDWA 5EEGA 3SSOA 3UJ8A 2P3QA 3A7EA 4AZSA 3GRVA 3ID6C 3AJDA 5BXYA 4PCAA 3JWIA 3KPUA 1VQ1A 4QQKA 5BW4A 5GWXA 3DLIA 5E1BA 2YXEA 4C03A 5DRTA 2ESRA 3PVCA 2I62A 4HSGA 3HA3A 3EMBA 3LKZA 5K0LA 3HVKA 5GIPE 4H0NA 2XVAA 4R05A 1D2GA 2PKWA 5FADA 3PT9A 2EG5A 4AZTA 2QE6A 3E7PA 2GA9A 4X61A 1XCJA 3TQSA 3FYCA 3BWMA 4GC5A 3CCFA 3V97A 4QVGA 5P8WA 4OBWA 4RTPA 1M0EA 1KIAA 4F85A 2JHCA 3B7PA 3BWCA 3UZUA 1G38A 3MTIA 1SQGA 3BWYA 2ZBPA 4MHTA 3GRYA 3M6UA 1R00A 5K0EA 2BR3A 2I7CA 2KW5A 3JWJA 1NW7A 2PX8A 3DMHA 4P7JA 4PYOA 3DR5A 3C3PA 3IEIA 2VDVE 5MHTA 4Y30A 2H00A 1BKYA 3SVZA 5E9JA 3FUVA 4CXMA 3GJYA 2Z6AA 4PGGA 5K0GA 3GO4A 3EVFA 3I58A 5EHGA 2ZBQA 4RTNA 4RTRA 2IFTA 4A6DA 2UYCA 1ZKDA 2QYOA 3IV6A 3LDUA 3DXZA 2EJUA 3OU2A 3PLAE 1XTPA 2AVNA 1QAMA 4RSRA 1YZHA 2NNWB 4QTTB 1N2XA 4HGZA 3TMAA 1G60A 3GGDA 3FTDA 3MERA 1Z3CA 3THRA 3VC2A 5D1NA 4DMGA 4CKBA 2GH1A 2H11A 5HIIA 2IDJA 2P3OA 3M70A 5CVDA 1DUSA 3SM3A 3OFKA 3R0QA 4C04A 1P1CA 2R6ZA 2HR1A 2PJDA 3E05A 4RYLA 2BM9A 3SR4A 1O9HA 3BGVA 4RV9A 2QM3A 4P7GA 2FK7A 2O07A 5DXAA 4BLUA 2PV0A 1KR5A 2YQZA 4PYMA 4MQ4A 2ZWVA 2DULA 3DP7A 2IH4A 5EC8A 2AOUB 4FGZA 3DXYA 3NVMB 1L3IA 5T6BA 3FUUA 1P39A 5EGSA 5B1SA 1KPGA 3B3FA 2O0LA 5EHIA 1N7JA 3EEOA 3K6RA 2AOXA 3P2KA 3AY0A 3TFWA 3REOA 3UJAA 3GRUA 1X1CA 3KR2A 2B25A 3ELYA 3G2MA 3T7RA 3CGGA 7MHTA 1RJGA 2AOUA 2I9KA 1B42A 2JJQA 1V39A 1I4WA 1EIZA 2NYUA 2FK8A 3LDFA 4ISCA 2UYHA 2ZWAA 3KQPA 1Y8CA 2N47A 2IBSA 1SUSA 3UFBA 2YR0A 3KHKA 3NWEA 9MHTA 3HP7A 2ZZMA 5ICGA 1PRYA 1M6EX 3C6MA 3M6WA 4PCLA 4C05A 4F84A 4GBED 3SX0A 5EEHA 5GIOE 3P9IA 5CM2Z 5ICFA 3TM4A 3KU1A 2CMGA 5DTRA 3D2LA 3R3HA 3FTFA 4PGHA 2EX4A 5LSAA 2ZIGA 4OX9Y 1OR8A 2AN5A 3BGIA 4C07A 2GS9A 2ZULA 5FHRA 2ONYA 2YX1A 3FPFA 1QYRA 5DX0A 3LL7A 3RW9A 3KQSA 2K4MA 4QDJA 4Y2HA 3A7DA 5EMJA 3P2IA 3LDGA 3SGLA 4BP1A 2YTZA 1FJXA 3P97A 2B2CA 2ADMA 2ZFUA 5K0JA 1ORIA 4BP3A 1ZGAA 4WVLA 1ZQ9A 2BH2A 1KPHA 2P7IA 1NW6A 1XCLA 2QRVB 3NWBA 3EVGA 4KWCA 5DTMA 5E2BA 5T64A 1VP3A 3EVDA 2OPBA 3LBYA 2Y1XA 1F3LA 2JHAA 3OZSA 1P91A 4U7PB 3OPNA 4C06A 2XYRA 5CCBA 5DX8A 2OB2A 2ZVJA 3C6KA 5ERGB 3GU3A 4AX8A 2Z6UA 4EKIA 3A27A 3AXTA 2QRVA 3DLCA 4V0QA 5EKUA 5DM1A 5DX1A 4YV2A 4HC4A 4OA8A 3M6VA 5EKXA 3G2OA 2IH5A 3HCDA 1RI1A 3EEYA 3FYDA 3OU6A 5EG5A 5CUQA 2P41A 3HCCA 1P1BA 1Q0SA 2CMHA 2BM8A 2OKCA 3TM5A 3G5LA 4RTJA 3MCZA 1JQDA 2FPOA 3MQ2A 4YUVA 1D2HA 4U7TB 2Z6QA 3K0BA 1H1DA 3OCJA 1EAMA 2PY6A 4HTFB 5F2KA 1EJ6A 1NKVA 2NXJA 3F4KA 5DRYA 1JG4A 2FCAA 1TPYA 5EOVA 1IM8A 1T43A 3M4XA 5C0OE 3C3YA 2C7OA 2VS1A 3ER9A 5LR6A 1RI5A 2GB4A 3G89A 5DWQA 3CJTA 1FP1D 3EVCA 3E23A 2EFJA 1DCTA 4P7KA 3KPWA 3TKYA 3FPGA 4HTFA 4P58A 5M5BA 3GXOA 4FT2A 1PJZA 4RTMA 4GOOD 3KKZA 1EJ0A 5ICEA 5E8RA 1RJEA 1D2CA 3VSEA 3A4TA 1WG8A 2IPXA 2O06A 5DM0A 5CIYA 1NW8A 5DXJA 3MB5A 1AQJA 2LD4A 3B89A 5K05A 2NXCA 3H2BA 1U2ZA 4G56A 5CVJA 5E8JA 4PONA 3G2PA 1AF7A 4CKEA 3RODA 2WA1A 2OBFA 1ZGJA 5K0CA 3IHTA 2OZVA 1RI4A 4EMSA 1R8XA 1FPQA 2G70A 5K8VA
chains in the Genus database with same CATH superfamily
4CQLA 1YL5A 3T7TA 3RAEC 2CDCA 3ZNOA 1M2VA 3KEMA 4PICA 2CE7A 4Q9HA 5K01A 2NP7A 1KMQA 3DDUA 3KB2A 3A28A 5FWYB 5KTKA 4M8SA 2KYRA 1VKNA 6YASA 4PNHA 1PFVA 4HGOA 3K2IA 3COZA 2ZK7A 2WYHA 3CRVA 1FIUA 4L07A 3KKOA 1ZH0A 2UYOA 2R11A 1S5PA 3EVTA 1KJ9A 3II6X 4IVPA 3HKDB 1GNSA 2C07A 4LE0A 3NDBB 4QUHA 2NXWA 3HY6A 1FBTA 3E7WA 5EMHA 5H1YA 3R6GA 1LPPA 2J3HA 1EFVA 2WPDA 3PWTA 5BSWA 5JY6A 5E1OA 1Q6YA 3MRVA 2QPLA 3OTOB 3ZXXA 2YS6A 4AYXA 1UM9A 3C15C 2RB5A 2E3JA 3UPTA 5IM4F 3B2NA 1OJ7A 5MFPA 4EW3A 3PS9A 2HBRA 3D6VA 1GPBA 5EP3A 3CNHA 3HQ4O 1BC5A 2CJWA 2PRYA 2ZUDA 4OYRA 3SMVA 1VI6A 1L8AA 3VR0A 3VR4H 2WTUA 1YE3A 3GCWA 3SIWA 1W88B 4U9IS 1E5TA 1YA4A 3MN1A 4BO8A 3TCKA 3B38A 2H8GA 3W1VA 1R0YA 4J1QA 5JPIA 4HX5A 1T2NA 3KYDB 4QBIA 1H2HA 3D6JA 1TMOA 4Y98A 4A27A 3KQHA 1DGQA 5E2IA 5FTNA 4P4GA 1EGAA 4CT5A 2Z5FA 2R3SA 1BXGB 3DEFA 1Y1PA 3EPPA 3GR6A 3CNOA 4BLPA 1RXEA 1QSGA 2XCQA 4M7PA 2CL7X 3O21A 1E89A 4BLOA 3RYCA 2Q4RA 2E85A 1JU3A 3FG9A 3NOOA 3N58A 3SXPA 3IKTA 3GRZA 1A50B 4QVIA 4P93A 4R5MA 2Q3EA 2B4QA 2EDCA 3VI4B 2CJYA 4KIGA 4DFDA 3WDSA 2BEWB 2P11A 2Y1EA 3UICA 4GLBA 4OJTA 4GOXA 2OTCA 3FZYA 4ALJA 2IYYA 3PNLA 5DGIA 3ZVNA 4F9EA 2IJGX 3GYGA 3GGSA 3VU3A 3ZQJA 4DLVA 2JGIA 1E6KA 4IHQA 4W6ZA 4YT4A 3TS1A 3LOQA 3T9CA 2O2GA 4AJEA 3MSXA 4KXQA 5FWNA 3L7MA 1WWKA 4YS6A 4YAOA 2J5QA 3INNA 4GD3Q 2AE1A 4R5HA 5CNJA 2PLWA 1XXHE 5DGTA 3NRJA 1LSUA 3QEKA 5GV8A 3VBCA 2Q1WA 3VDXA 5KNDH 1LEHA 4ZVLA 1DXQA 1I5EA 2JIPA 4ITRC 1ISSA 5GONB 4NC9A 2G1PA 2HH9A 5HIKA 1LUAA 4R8LA 3IMGA 3LBHA 4KIJA 1J0XO 2P2LA 4M6WB 4ZO7A 4ZI7B 1T2DA 5ALYA 3I5AA 3SIPA 3KR9A 1V71A 4J6FA 1SIUA 2X6RA 1T36A 2AYYA 4L2IA 4TLAA 3K1AA 2IZ1A 3TMKA 3W9UA 1EGMB 4E7OA 3HY4A 3PHCA 5GGYA 2WU4A 3UB4A 4R9SA 1HQCA 4RJIA 1JA0A 2QSUA 3DE6X 2P1DA 421PA 4YAFA 3LKDA 4GOKA 4PYKA 1E2GA 3MGGA 4FZVA 4JROA 1PG2A 4OXKA 5IYZF 1FXWA 4XGKA 1L8OA 1O97D 2DBVO 2R62A 3PV0A 3TW6A 2HU7A 1IN8A 4FSXA 2GASA 4MVJP 5HE9A 3WYAA 1IATA 1EWQA 4MICA 5HMLA 1L4LA 3PKJA 4F4IA 3OKAA 3ENVA 3BGWA 1W0KD 4DC1A 2AMJA 2YDYA 3PPWA 1QVRA 4FEGA 3NXKA 1ADGA 1QG0A 1L4HA 3TTYA 4BBPA 3N0VA 4S12A 4BNNA 1ZNWA 2JLYA 1JQAA 1VMAA 4N5HX 1Q0PA 5L95A 1MC4A 3KWMA 1H6BA 2RGEA 1UMCA 3AEZA 4JP2A 4KGXA 4NBLA 2HZBA 5FWXA 1ZNQO 1W44A 1SG0A 4BQIA 4FP9A 2MYUA 1GP2A 2JF0A 1HSOA 1JDUA 3IBTA 2J6IA 2P91A 3WRYC 1YF3A 3TBFA 1O3YA 2UYGA 2C4WA 4MS4A 4ECAA 2YVUA 4QE3A 1GSIA 2QM7A 1UIRA 1Y8QB 5AW9A 5HF8A 3FOWA 3K0FA 4XM2A 4G5HA 4ZTUB 2P2CA 3AM4A 4GSYA 1RBQA 1UKCA 4AZVA 4HXYA 2V5UA 1JFLA 1WDTA 2Z8XA 2HNAA 4B44A 2AHRA 1VJCA 3OX3A 4RX1A 3ZV4A 3HPQA 3ZCUA 4J76A 4C7MA 3ERCA 4S24A 4JK3A 3TSYA 2P40A 3DMTC 3DMRA 1G17A 1RPTA 3FNBA 5I45A 1N32B 4IX1A 1UDXA 1PJQA 1OVMA 5AXDA 3PC8C 1EFTA 3X3HA 5LP6A 2ACEA 1W0KA 3LQ2A 4GXTA 5K03A 5JWHA 1KH3A 2C2ZA 3AHEA 4EARA 3VMMA 4KQMA 1QHSA 4DADA 1GZSA 2WTMA 2XUIA 3K9WA 3MCWA 3RLIA 3SQOA 1DAMA 3WB9A 4BQEA 2QL5A 4DA6A 2WJGA 3EXAA 3K0HA 3WGZA 2NU6A 2QLLA 5HK8A 4M76B 3N0XA 1JR6A 3KVOA 4F3NA 3QSGA 3TJMA 3TPCA 3FCSB 5JISA 1YONA 4KBGA 1PGPA 2YXDA 5DU2A 4DY4A 3SKYA 2HJSA 3LAWA 1BHJA 1M0WA 1NJ5A 5DGCA 5IDVA 2D13A 2NTYC 1CC1S 3FZGA 1R5OA 2QGNA 3TTUA 5EJ9A 3PDIB 1TK3A 2XIQA 2Q5HA 4A73A 4OLHA 3Q3JB 3VC7A 3T6KA 3MZ0A 3ZXSA 3B36A 4L16A 1ZI9A 4BO2A 3K05A 2VAWA 4O4LA 1Y4AE 3NAZA 5D3ZA 4E1AA 5A4KA 3NTOA 1ISRA 3DOOA 4FHDA 4NXMB 3T3EA 4GKVA 4CKCA 4KCGA 4PCVA 4IJKA 1L5OA 2NOAA 3ORYA 1QH8A 2FSPA 1RJWA 1T4CB 5L8VA 1NJ1A 1U7UA 1VA5A 1Y1TA 3EZ2A 1F14A 3GZNA 1I0IA 2ET6A 3QEMB 4H60A 4COKA 1WUIS 5JQGB 4PLYA 5LU9A 2AMLA 3DOHA 3VPCA 4GNKA 2XQFA 2R47A 4BMOB 4Z8YA 1JG6A 5DPMA 2H29A 4M1KA 3FVQA 4E08A 4GM1A 2ZCVA 4JJ7A 3L8MA 4FN4A 2JVJA 5BN5A 3I8XA 2DUUA 4A92A 2ZKIA 2FKAA 4ZICA 3GJZA 3ET4A 4DBLE 4H15A 1XZJA 2X23A 3WLTA 2AV6A 3V9PA 2A84A 3DFIA 4MIYA 5INTA 1OZHA 4DMLA 2TS1A 3EMVA 5CD1A 1H2FA 3U19A 1YVUA 4BCCA 1G55A 4UDNA 2A4MA 3BCUA 1ZSNA 4ER0A 3CB4A 3RI3A 3HA5A 2PGXA 3I01M 2HLDA 4O2BF 4YCJA 1TCVA 1VKZA 5DYNA 5JFOA 4ALNA 1MGOA 1RPNA 1SXJD 2XOKD 4KIFA 4BVLA 2PUWA 3F7TA 4IS3A 4QPPA 1ULHA 2FWBA 4JVSB 1E2UA 3HGTA 1W4AA 4DLRA 5BWMA 3RS8A 2JFQA 4H16A 3X1YA 5CBKA 2EJWA 1JT9A 1W35A 4JC0A 4PTYA 1NAIA 3EARA 3DTVB 4U3JB 5DN9A 4NHEA 3SHTA 3TW0A 3ENNA 2YWJA 1JLHA 2RFLA 1W75A 3EW7A 4WINA 4JL8A 1YQWA 1I7DA 1BN6A 1YK1A 4MR9B 5EP2A 5FR1A 4F4JA 2ZE5A 2YXBA 3X2EA 3MWFA 3PLRA 3WL6A 1E1YA 1OILA 4I4LA 4EJ0A 3DLIA 2OGWA 1G8MA 1NU6A 4A5OA 3ZWMA 2CDBA 4QKQA 4HSGA 1ESMA 2OGUA 1KYXA 1UKZA 2QJTA 2YVQA 4Q3OA 1IJKA 3PI6A 1JDBC 1HDIA 4KQ1A 4QX6A 5A3QA 3PUVA 4R3WA 2HSJA 2D5CA 5GONF 5IXSA 1Q0HA 3P2YA 4Y2SA 3WNCA 3ZX4A 1BHQ1 1EFRD 1VE1A 2WFLA 4J7CA 4AJPA 5B55A 5JATA 1SBCA 2HHHB 4A1FA 2IXFA 4KSCA 3UMVA 4CNBA 5EVCA 3TZQA 3V8EA 1L5WA 2JFVA 3NHFA 5JYBA 4BZWA 1W29A 4IDHA 1KYQA 3UZUA 3Q7PA 3BWYA 1QLWA 3CUVA 1JAHA 2YL2A 3IXMA 1WLSA 4M9ZA 4L5IA 4Q9AA 4NVRA 4O8ZA 1KEZA 5P21A 1DC8A 3RS9A 4CYMA 3AFNA 2XZOA 1V9SA 2ZJ6A 3OTGA 2DQKA 3JD4A 4ZK6A 4Z4HA 2A5DA 4C2TA 1V8BA 4EPVA 3M1AA 4TL7A 1FUEA 1R7RA 2TMGA 4BNKA 2NYAA 3L46A 3DNPA 3GJYA 2XOKA 4YP1A 4BVHA 1GZDA 1NSYA 1L7MA 3DEJA 5T7BA 5BNFA 3AWDA 1FFWA 1QE5A 4G4IA 1IY8A 4CMHA 5EIAA 3CFYA 3WK4A 3FVTA 1N9ZA 5DDIP 3U3DA 5LQUA 4H2DA 4BMVA 5KB3A 3DT9A 3PTLA 4CLOB 3IL2A 5CFMA 1KF0A 1GKLA 4XWTA 4B87A 4D97A 5CT8A 3WL4A 3RVLA 4DHEA 2VHYA 1U5CA 1B8NA 2NT3A 3FHLA 3ZHQA 1GUAA 1YZLA 2SCUB 1ZGHA 4MRPA 3IP8A 4J1SA 2QQEA 1ZOPA 4PVDA 4ZDIA 3S28A 1Y6FA 3VR5H 1QE3A 3DVRX 3HCWA 2WTNA 4PVCA 5BOVA 2WBLC 2F1HA 3AKDA 1PHPA 1U7DA 1SG6A 2BWJA 2IKSA 3OFKA 4QREA 3SM3A 3ZCPA 3QNUA 1XYYA 2NN3C 1WAMA 4XGNA 3JQAB 4RYLA 1C50A 4W8OA 3S2GA 4Q1VA 2D6FA 1XU7A 2YQZA 3JVVA 4FYVA 3M9XA 3M89A 4QU8A 4M49A 1JVNA 1OREA 3Q9UA 4LZLA 1Z6ZA 3D1JA 4DR1B 1CYDA 1H2YA 2MU1A 2IF0A 3I0NA 5ESXA 3ZVLA 3ZEIA 1Z3IX 1VMKA 2BRUA 3NANA 1U8UA 3LNTA 4P35A 4QAQA 3REOA 3WLNA 1W1UA 4EGCB 5LP6C 1G8KA 4B6FA 2H9IA 1EFLA 2RHGB 1DBQA 1ZAKA 2QP4A 3G2MA 3ILVA 4J43A 3CGGA 4OXXA 1X80B 5EIEA 2DAPA 2D1FA 5IAEA 5I7FA 1VL2A 3H3XA 5EIHA 1KK1A 3QXHA 3ZDFA 4RPCA 2GUGA 4RDIA 4OJYA 4E4RA 2IYTA 1GZ3A 1UQTA 3L06A 4QBGB 4Y2UA 3WWZA 5TQ0B 2ZWAA 4KIUA 4F5ZA 2F67A 3A1CA 1PK7A 2DC1A 4YQEA 4DSAA 3ZEAA 4D92A 3D7RA 2HO4A 3HUEA 2ODWA 2PBLA 5GOTA 3GZJA 3TM4A 4ABYA 5T41A 3QF4B 1W30A 2VXBA 1K4MA 2PRJA 5DLPA 5AW7A 2VPTA 4X54A 1SWWA 4Z8XA 5ECGC 3FM9A 4C07A 2XE6A 3A70A 4FIDA 4ZYTA 2ZULA 3KC2A 4TMZA 2OORC 4R2JA 1B2LA 2QVLA 2HBYA 2EBHX 3PCTA 5ITZA 3W2IA 2F1KA 2PLAA 1OH8A 1KS9A 4CIAA 1DG9A 1JMVA 3HP1A 1RHUA 2B21A 3B6ZA 4PYRA 1FJXA 4NKRA 4AC9A 4ENVA 3N6VA 1D4ZA 4UNQA 1T0PA 2ZYUX 3QIVA 3EVGA 5DTMA 5JIBA 3ESXA 1ZICA 3DHNA 3EVDA 2H9AA 1EQUA 4FDUA 1Q7BA 2J0UA 1MB9A 2IUFA 2G76A 3A4LA 1MOZA 1TT7A 3IKLA 5EY5B 5ADHA 2MCFA 2EZUA 4CPDA 4FHEA 1UK6A 1LF5A 1W5BA 3PL1A 4TM8A 2E1PA 1FLVA 1WQ4A 2G7ZA 2MSKA 2P4UA 3CNBA 1JDPA 3LPAA 3OLXA 4LTDA 4Y3UA 4G63A 3A1VA 1C3VA 2WABA 1NY6A 3KV3O 2ZJ7A 1FLNA 1Q14A 2J5XA 2WJVA 3BK2A 3BREA 4TYYA 3RROA 2D7JA 5IU6A 5AD1A 2BM8A 4N7RA 4FHGA 4DCPA 4DUYB 4J1NA 1SB8A 3HWX1 4I0WB 1C9DB 4TS9A 4KYVA 1P4RA 4MW0A 5KSPA 2Z56A 3VM6A 1P18A 1CF9A 2PY6A 1PK9A 2QTMA 3KYCA 5DNWA 5T6MA 3UKDA 3UK7A 1AKWA 2VT2A 5ANRB 2XMBA 1RACA 2WJPA 2RBKA 3G23A 4XQ0A 1KDRA 4Y1GA 1FSZA 1T2EA 5FBWB 1A5BB 1DIGA 4IRXA 3TBHA 2PV7A 4OYYA 2WUVA 3PR2B 4MI9A 4Q3KA 4FYMA 1NX6A 1QK5A 4TV9B 3IHLA 4H6PA 1CZKA 2HDWA 2O5RA 4P58A 1XN1A 2H4ZA 4MA5A 4CKEB 1P1FA 4LRSB 4CF4A 3MWGA 4MWOA 2FGKA 1NNEA 1XMXA 4X45A 3ECSA 1D2CA 1U90A 1ULAA 2PKCA 3W8RA 1WG8A 3IDFA 1Y7LA 3PUHA 4HLUA 4ZYUA 1RAAA 4OK5A 1RM0A 3V42A 4BWGA 4EJSB 1CJKC 4K0RA 2IHNA 2PT5A 4FJ0A 3CW8X 4TTRA 3L1KA 4MKZA 1CE8B 1R8XA 3CZ5A 1E6WA 4OUDA 2OZKA 1OZAA 1S2MA 1U7PA 2Q3MA 2VHUA 3DAGA 4INZA 2XKKA 4I9FA 3DHWC 1VJRA 3I2HA 1XTRA 1FFBA 1ULUA 1YTLA 5HVNA 5JJ5A 1OXBB 1W0CA 3G2IA 1Z4JA 3T94A 2J6BA 2W70A 3D59A 2XD9A 5D5QA 5U9CA 5LQJA 2I2FA 5KYKA 2W2NA 4ETNA 4WKGA 4M86A 1G7CA 1R16A 4KLRA 4NAHA 2HA5A 1GAQA 1WUHS 221PA 1YRYE 3H3FA 3TQQA 3ETGA 2VI5A 1QYWA 3GVIA 1KJ8A 4MS1A 2ZSJA 2WD9A 5AJUA 3LY5A 4HAWA 1MAVA 1EIWA 4LV6A 4LY9A 2AG1A 4W9NA 5AW4A 3LC7O 2EBUA 1DOZA 4S35A 4I36A 5HX7A 2FEKA 4KJZA 4WH0A 4FD3A 2GDJA 5EZQA 2C5SA 2FRXA 1JN0A 2OXRA 2VEDA 3R41A 4BKQA 1N5MA 2CZGA 1G42A 4RVGA 1LTKA 4WRRA 4XDYA 4EUKA 2WDZA 1I13A 3O8QA 3GFQA 3TAUA 1P3JA 5BYKA 2NPIA 4GYYA 2J45A 3HNRA 2YFYA 1U9IA 3B13B 4LC1A 4IXMA 3HN6A 5EIFA 4IXTA 4GI5A 1WKBA 1Q1EA 3U60B 2OILA 3LNCA 4FFOA 1TVEA 3BL6A 4MMXB 4WK4B 2YY7A 3CO0S 1R64A 4AWBA 5EINA 1GZ4A 1DO2A 3DCYA 5U1PA 3ACDA 3H2GA 3A9UA 4BWYA 4YMLA 3KV1A 3U6KA 4JP1A 2V4UA 1EKXA 2GAIA 4F3TA 5SZHB 3C6XA 2F64A 5TEWA 2FPIB 1FFXA 3R0IA 3HYLA 4K05A 4B46A 1U9CA 5B4VA 1EFDN 1QQ5A 2CUNA 1ZHHA 2OFXA 1TQ6A 4B40A 5CFRA 2OBLA 3L4SO 4BO0A 1DTWB 3H13A 2ODBA 3PEUA 1VE7A 1TE2A 3C6YA 2XB8A 4WQMA 4XOUA 4MCIA 2IYZA 3M0EA 4WASA 1PNOA 2HFJA 1FF9A 2W2TA 4AD8A 3DNMA 1ESZA 3VPBA 4BFSA 2WIFA 3PEVA 5IJ0B 4BO6A 1V41E 1WCIB 2WI8A 5K5EA 3HBLA 3LJKA 1PTJA 2WJYA 4IUCS 4V1CB 1BVRA 1QB7A 2BRUC 1Q3KA 5G1PA 1BE0A 1YB1A 2ZKLA 3ADKA 1DXYA 3EK2A 4LECA 3GI1A 4ER7A 5DOZA 3V7YA 2ZYWX 3TUZC 4YCNA 3L8ZA 4YRPA 2O0JA 1T3SA 3QJGA 4W1RA 4ENSA 2C20A 2FFJA 1LK7A 3NTUA 3RTDA 4EDFA 5LZ9A 2EF1A 4L28A 2DF8A 2HWXA 1R6VA 4Q3NA 4U8HA 5CJPA 4OI1A 3ER6A 5E7MA 4J2TA 4QYIA 3VR6H 4L4SA 4GS5A 3TRIA 3TL6A 3K71B 4UPDA 5CW2A 5BSRA 2XMDA 2VH2A 2IY7A 3SSNA 3GLRA 2B94A 3I76A 4I5DA 1BROA 3OFND 1OFUA 1MOSA 4UU1A 5BWLA 1E9SA 4XLTA 1QU2A 1IQPA 1QAQA 5IVHA 4QT4A 3LSYA 3E9QA 1EK6A 3TTWA 2W6ZA 4OAOA 1ZR4A 2R65A 1JIXA 4RWZA 2GJ9A 4MP6A 1B8OA 5DT2A 4ZD6A 3ZWXA 3V8BA 4O2RA 1MRZA 1FZTA 2E7ZA 5E3JA 1W34A 3ZQ6A 3QBEA 3LXXA 3I9FA 1YK0A 4CFSA 1QO9A 3PFGA 2GLUA 2WT9A 3DZKA 5E38A 4X20B 3U1VA 2MSEB 3H5IA 1P1IA 1R9JA 2QNBA 5A4DA 1WY5A 2JK1A 5E9WA 1Z15A 4OHKA 3CLVA 3BTOA 4OL9A 3BVPA 3VFDA 3TOVA 1W9MA 3A6LA 3PX3A 4FR0A 4YRLA 4BMNA 4K0KB 9ATCA 1L5NA 1LA2A 1V1RB 3IKMB 4R2WA 4IJWA 5TQ2A 2HPHA 4D5EA 3NTVA 1BKDR 2NQTA 1V8PA 5JEEA 1K68A 1T1RA 1VPVA 3EGEA 3S1LA 3U7QB 1FX0B 3MTGA 5DHSA 1TF2A 2PH3A 4ND1A 2B4AA 1HKUA 1UF9A 1BOOA 5LB2A 3WAGA 1P3Y1 2HPZA 4UE6A 3PTAA 5CFNA 4OHXA 1VYTA 1WJGA 3L04A 4N8EA 4Q24A 4KPFC 3SY8A 3SFZA 2PRZA 1JWAB 2JD0A 2QNIA 1RFGE 3FLMA 5G0VA 3GJQA 4MO9A 2Q46A 1HYBA 4KI0A 5THQA 4IRUB 3K9CA 3MLBA 5M04A 1E3LA 3GAMA 2O4CA 3L79A 1XC7A 1G64A 2I3BA 3KAQA 4E30A 1UANA 2PZJA 2GA8A 1WU8A 4HAYA 1QIGA 4Z4GA 3HVHA 1BKSB 3ICQB 3WAKA 3L8DA 1X7DA 1WZNA 4PG8A 3K0SA 1CJMA 1QHFA 4AY3A 4WESB 3X0DA 3N2IA 2EOAA 3DKVA 4C78A 2ZUTA 4IHJA 5DBHX 2OESA 4FMBB 2QRMA 3ZGLA 7MDHA 3T35A 4JWTA 2OP0A 2QTFA 2UAGA 1GGVA 1N4AA 3EFOB 2YXPX 3S3TA 3ND9A 4HWOA 4P34A 1UMKA 3UWKA 3WG9A 4C03A 3EW9A 2DLDA 2J0QA 4MVJH 4NDNE 2JIBA 4C1BA 5M34A 4MW1A 2PQ2A 3WJ7A 3OX4A 3ED5A 3AYZB 5D3MA 2M6KA 3UMGA 1FP7A 9ABPA 2EW8A 4TV9F 5BURA 3IE2A 4Y9TA 3MAJA 4UXJA 2BKUA 4DIKA 3V4LA 2ADOA 4QELA 4J0CA 5FOXA 3UWSA 4DLNA 3U5ZB 4DA9A 4G5GA 2HNBA 3EA5A 1JQEA 4Y6QA 3HEMA 2D5LA 2O8EA 1AHHA 1U28A 3G82C 5TXGA 2J9ZB 3ZU6A 1K6MA 3GOHA 4II2A 1K66A 3U4HA 1G4UR 2WHRA 2ZWMA 2OCBA 4EHLA 2C00A 2NTJA 4EQ6B 6NULA 1NUPA 2Q1UA 4WXYB 1OWLA 3IP3A 2FMTA 2ZCJA 2ORIA 5LCXA 4E70A 5A4IS 2ZU6A 3G2HA 1P2SA 1PKXA 2WUEA 1EB8A 4JYCA 4REQB 1QANA 1GCOA 4W9NC 2XEXA 1AA9A 2IIPA 3AL3A 1QYCA 4RMHA 4RPKA 3T9BA 2ZBGA 3DFMA 3BSYA 1XP8A 5C5EA 2N1MA 1QIFA 1KZHA 3LE8A 1UMBA 2XHEA 3I9LA 2YY6A 3CJRA 4EMBA 1T35A 1U9IC 2H0QA 3IA2A 3O8DA 4D4HA 1ACJA 1TB4A 4PC3A 9GPBA 4KNVA 1SUPA 1G41A 4D6PA 4RQAA 4RHTA 3QGMA 5CVUA 1LRJA 3WKEA 5C3MA 1XLTA 1XXHA 3UTCA 1SO8A 2QZZA 2UZAA 4D8XA 1IHDA 1NN3A 3RVJA 1EWKA 1VGVA 3K1ZA 1F5SA 3R3VA 1BE6A 3LUGA 3P2JA 4G1UC 2G0TA 3N70A 4JLMA 4LCEA 5FEMA 4QPNA 4ZQFA 3R7WB 2BEJA 1E59A 1NOIA 3KOXA 1QG2A 3NPAA 1E98A 1JV2B 1R9NA 3S27A 1JQ3A 5AJXA 3D2BA 1UEIA 1VDMA 3AF1A 4NFYA 4MPTA 4FZ5A 3TKLA 1PWYE 3CLSC 3CTMA 5KTOA 3WGYA 3QBVA 1FBNA 3WK7A 1T3ZA 4Q4HB 9LDTA 3MINB 1S8AA 4LBVA 3ZNNA 4PQEA 2C2OA 3ZU5A 1A77A 2NPOA 1R0WA 1UQRA 1HI9A 1PTJC 3FSGD 5K3AA 3T5DA 1ZI8A 4G8CA 1DC7A 3PPYA 2CYAA 2ZUBA 3L84A 1Q0ZA 3K8QA 3X1KA 3HLKA 3LBAA 4CEJB 4ZRDA 4A0HA 4RVHA 2JJ1A 2HGZA 2HN9A 1ZUD1 4KLNA 2ODAA 4K1XA 3WP1B 4DCSA 3CNNA 4IHAA 1L0BA 1YCDA 2XE4A 4UUPA 2PUHA 4EPWA 2A5YB 4F71A 1QYVA 3DO8A 3GLHB 2Q6LA 1LNZA 1SC3A 1Y0BA 2CVPA 2O23A 4P5EA 4PC1A 3VKVA 3K6SA 2RC6A 4FWBA 3IQFA 4PCAA 5REQA 3SOZA 4F4UA 5BXYA 3SG0A 2AG8A 3WIDA 1U2QA 1FDRA 2JFNA 3LA6A 1JQJC 4MARA 3P96A 4UATA 5E1BA 3OBBA 4HB2A 4F5YA 3AVYA 1MABA 2GBLA 5MGNA 1PF7E 2UVQA 4P08A 4AIIA 2CDAA 3HRKA 5KU7A 5L4NA 2CXOA 5J2TB 3N5KA 1M1ZA 3AR3A 4IGKA 5HIAA 4BQSA 5KSYA 1VCOA 2GA9A 1C0LA 5A04A 3R9WA 4L4ZA 4QVGA 2FZ5A 3OTHA 3OAAA 3IUBA 1FXSA 1P2TA 3NM6B 2R8RA 4P84A 4YV7A 5MFZA 1NJGA 3B9PA 1PR3A 3EN0A 4LTMA 4G86A 3EBOA 4D9JA 3N7UA 3E6AA 3IT1A 3DMHA 1K8ZB 2I9PA 1U4SA 2W0MA 5G41A 4BX9A 5JWOA 5AVZA 3DWFA 1PFGA 2OCAA 3F0TA 1O6FA 3K3PA 3QPVA 1UPCA 3LPCA 4Y30A 4E15A 3KQKA 2E6KA 1BDHA 4RZQA 1P74A 2HQBA 1VRWA 3D4BA 3QF7A 3QVGA 1ZW1A 4B81A 4GW3A 3M81A 2NUPA 5B3AA 4EG7A 2DM6A 4URZR 4YMIA 1OXSC 2WAYA 5DLDA 5T3YA 4XVUA 2NAPA 3UGKA 2O20A 4I4IA 5CA1A 4Z4QA 4JEMA 5BSEA 4J75A 2ZAIA 3Q3EA 4NE9A 1C9EA 3UK6A 5K9ZA 1WHSA 2AVNA 3EPKA 4X93A 1E2DA 3R6WA 5AP9A 4MPRA 4BRZA 3NBYC 4G85A 2RI1A 2C2HA 3C6QA 3QVLA 2H52A 3W5SA 1G8HA 2QVBA 3HDHA 3M70A 4H59A 2X0EA 3NM4A 1S1CA 5F9FA 1XZPA 3CWCA 1CUSA 1M2HA 4MV9A 2OZEA 7REQB 2HR1A 3N8GA 8ABPA 5CCDA 3PU6A 4INPA 4RHEA 4AN1A 4Y6LA 3A04A 2R6DA 3JYOA 3G9ZA 3ANTA 4M7OA 3RAFC 1E9RA 1UFRA 1N6KA 2EG9A 4MDEA 2JFZA 2EBWA 3AG5A 3TIGA 4BEVA 2EKDA 4IFBA 4UNIA 1VECA 4MQLA 2QEQA 3B53X 4D45A 1D7AA 4OLAA 2HIGA 1QJCA 1NQAO 2KJQA 4JKOA 5EJ5A 2PXHA 5EZYA 1B42A 4KAXA 3TXAA 4RH3A 1O03A 2VJDA 2WSBA 2Q27A 3BXHA 1NMEA 3EG9A 2FG6C 3RADC 3WWOA 3CUSA 4AY2A 1MIOA 3I1FA 3DEAA 1IZYA 5B1HA 2I4LA 3RLFA 1ODSA 3R40A 1U28C 1EWYA 1B0UA 4IQ4A 3V3KA 1KQ3A 4PLFA 3O8OA 2PA0A 1EFPA 2CF5A 5CM2Z 2XSZD 5EKDA 2M6RA 4ADSG 1MXFA 4QGSA 3HUFA 1KETA 1GEGA 1PCXA 2X6QA 4Q1FA 2WKSA 3U0BA 3C1TA 3PYLA 1IN5A 5LD2B 3VI3B 3DMNA 3EWIA 4DABA 2XT9A 3LVRE 4GG1A 1L4KA 2FDCA 4PFSA 4M98A 4PQFA 2XOEA 3JQEA 1A8SA 2GTHA 4Q7KA 2XGMA 4OK3A 5I6DA 4BWVA 5AI4A 1U2GC 3TNJA 3OQNA 3IOMA 1O4VA 1RCTE 1WD7A 3NMUF 1JFRA 2J3EA 3ON5A 3RSGA 1FDSA 1IZ0A 2EQ5A 1M83A 5EXDA 2BI4A 1DJNA 1JQBA 2R8ZA 3FBGA 3E9RA 4ZYYA 1QGED 3I5YA 5AJHA 2BCEA 2DGDA 3G49A 3GH1A 4IMIB 4K9QA 4O4IA 1V5WA 1NJ2A 2WRZA 3L6RA 2IZ5A 4UZEA 3NH6A 1W73A 1Z6YA 2PD6A 4BAUA 3HDTA 1KOGA 2XVZA 3QH4A 4HC4A 3WGHA 4LPSA 3AIKA 1M73E 4C3VA 3HCDA 1RI1A 3RYFB 2Q9UA 1NXVA 2Y9PB 4E22A 1X7GA 4TXLA 1T3TA 2GMWA 5BQOA 1QFZA 4GLOA 1HE2A 1NRXA 2PVSA 3G5LA 1IQ0A 3BIJA 4MROA 3PR1A 1HT3A 4TLEA 1Z6TA 5CJJA 1P0QA 1NIJA 2Z4TA 3UMFA 4EG1A 2NXJA 1BH2A 4TTVA 2DPLA 2H4FA 3IP1A 3I04M 5DMHA 5HJ2A 1CSEE 4ZT6A 2ID8A 1R0XA 1N8TA 1VTKA 1ZOLA 2GB4A 2XSZA 4BBAA 1GT91 5JS6A 3GFRA 1QCYA 3LUKA 3E23A 3DVAA 1W85A 3Q85A 3OUZA 3D6TB 3AIMA 2AXQA 4PSDA 1Z45A 4YYZA 1CR2A 4RCVA 1E79D 3K70D 1NMYA 3RU3A 1AQJA 4WXEA 3BH7A 2ATEA 2PZFA 1C1XA 1Y37A 4LVOA 1VJ1A 2JLRA 3KKMA 4LIPD 1PQUA 3M6FA 2B99A 3GAAA 1OV6A 3OM0A 2WJZB 1X2EA 3PP8A 3FSEA 2X4GA 3QUTA 4J0QA 1JHQA 3SXUB 1KU6A 2A58A 1RW4A 3B5IA 2FUCA 4HFNA 4QVKA 3WOVA 3G3EA 3JQGA 4GR4A 4PYNA 1SKYB 1A72A 1JIIA 1RPAA 4UNNA 2GBLC 2AB0A 2I54A 2ERYA 2PHZA 3GWGA 4FZRA 4J2OA 5LQKA 1HOXA 1LI5A 4JLUA 5CM9C 3UG6A 4E0BA 5LP1A 3RS2A 4CETA 3L7CA 2OG1A 5AXBA 3WFZA 4DNOA 3U61B 2QZSA 4KKXB 1D2EA 1DAPA 3HXKA 2GEFA 4WK2B 1XVLA 4HFMA 1LQUA 4OQYA 4FFRA 4IGAA 4MAFA 3CR3C 1M6YA 3EFHA 5EWJA 4Z0NA 5JD3A 3LLSA 4BV8A 3GJ8A 3IODA 2GERA 4DLPA 1QRTA 2NSYA 1INLA 3JWEA 5DNUA 2VUTA 2IDKA 2DQZA 3IGFA 2SNIE 3Q7RA 4QJ5A 4DIMA 3ZV7A 4MCHA 2P9CA 2WUFA 3TZEA 2E4AA 1K8RA 5J2TF 4EY5A 3IALA 1EE1A 1EG2A 4JGBA 4JP3A 3LCJA 4C4PA 5BRJA 2H1LA 1WW8A 3I8SA 1YTUA 4J94A 1EDOA 4AQ7A 1S9HA 2G9VA 3IXLA 3KNZA 4CLHA 2NUTA 1RIIA 4XFDA 5DNDA 2P8SA 5C32A 2HSWA 2VNJA 4ER5A 2F55A 1WVGA 2PXAA 5JSHA 4E2WA 4H7IA 1Y6QA 3RM3A 3C8UA 1X7YB 1E79A 1JLSA 2H4XA 4GVXA 4WAUA 4WNAA 4RPIA 5DHAA 1PR5A 1Q0QA 3L9WA 3O7WA 5ED0A 1CFZA 2JGDB 1JJVA 1PR0A 1PX0A 2AG6A 4QNNA 3BIFA 4OFBA 3SZLA 5BMVF 4XWKA 1DVRA 5L40A 4BKRA 4NULA 1CERA 4P82A 3AYXB 4NZZA 4TSKA 5E4TA 2APJA 1QF7A 3QLUA 4CTMA 1H2XA 3T3PB 3WJAA 2F6RA 1MRSA 2HC9A 3K5WA 1DNPA 4MS3B 2GCOA 2WIDA 3H11A 2Q0XA 1X2BA 4MRVA 1KE1A 3A25A 2X86A 2VPWA 2Z5GA 3JAWB 2C2KA 2FPPA 5BQPA 4TLBA 1A1VA 4WY8A 1L7AA 3G2LA 3OJCA 1XYVA 4PRYA 3AL0C 3OJLA 1T6ZA 2ATVA 1JAYA 3FHJA 4JH0A 3NM5A 4L6AA 1DOHA 1E18A 3E7XA 4G5OA 3VSCA 3B2EA 3O4IA 1YUBA 2C3MA 1H9AA 1WS6A 3IIJA 4GPTA 3OPVA 3JPWA 3HM2A 4ZQIA 3ZY3A 2NAFA 4JXJA 4DNPA 4ARAA 1H5QA 2X9LA 3E18A 2IDMA 4JCOA 5CU7A 3ZY4A 4KAAA 4F8YA 3L6OO 1K75A 2P62A 1VGQA 1XKXA 4UBKA 4WBNB 1R15A 4FNGA 2Z4SA 1JHDA 3L7DA 4L15A 1W2HA 3TLKA 1JAZA 1RQ7A 2WHPA 3K32A 5GINE 2CNLA 2QGZA 3ND8A 2CF6A 3NHPA 3PC4A 4WOBA 1M0EA 2E9SA 3RSOA 2ZREA 1PJRA 3JQQA 4IXWA 2GBGA 4CG3A 2WY2D 1CF2O 4Q15A 1F3OA 3BHIA 5BSMA 5CXQA 1EINA 1VBMA 3IIMA 4X8MA 2Y1KA 3ZHZA 4O1IA 3ZD8A 4BKMA 1OLUB 4CCYA 5CA0A 4JCCA 4P7FA 3PJFA 1FL9A 1AKTA 1SIOA 1VZ2A 1GNPA 2CWDA 2F2TA 3DQQA 3KSMA 4HAXA 4DBLC 4K6CA 4DSTA 1DL5A 1VCNA 4NHOA 1BDIA 4TQUS 2EW2A 4NNJA 3IQDB 1Z6GA 4F96A 3PPXA 5F9MA 1PGNA 2F1RA 3AF4A 5BQFA 2XMZA 3L0SA 3E35A 2OK8A 3H1TA 1JALA 1P4GA 1YJQA 3N8HA 4AAYA 1QAOA 3L5KA 4R1QA 3CG4A 5CXXA 4MCAA 1G6HA 1X1DA 4ZQCB 4UEQA 5AIBA 4BXOA 1PSZA 1S9DA 3IAEA 2R87A 3DH0A 2Q8PA 1ETHA 4GWGA 1WDKA 3W90A 5EESA 3WE7A 5HOQA 5IT9A 1TTTA 5F1OA 4J03A 1R8QA 2WICA 5SZKB 4HT3B 1XCMA 4YALA 2H54A 1CY0A 2M9MA 4FCCA 3KKKA 4HK4A 3D9QX 5K3OA 3T5CA 1JSZA 2IEZA 2JB9A 1YE8A 3EF3A 3OJFA 3QENA 3FH0A 2PS1A 4KYTA 2G9NA 2FEOA 2LIPA 2A5LA 2I80A 4MMZB 2QDXA 3VU9B 4RJJA 5DVZA 3ILYA 3WK6A 2XTMA 3FWYA 1VPLA 1U5BB 1RZUA 4F5DA 5DYYA 3T4EA 4EHDA 4YV0A 1CRPA 4EMTA 4U7DA 3NVKI 3LUAA 1FX1A 1SBZA 2QQFA 1STOA 3DD5A 4PX2A 4RKYA 4UTOA 3W7BA 4J6EA 1R8JA 1KY3A 5FA8A 2WHXA 3MWYW 3E7DA 2P9QA 1HZJA 1ZP6A 1Q77A 3G0OA 3IQGX 4WN9A 5C8YA 4ZV4A 3LO5A 2GHTA 3IVGA 3QVOA 2O7RA 5BSHA 5LQCA 3AILA 2IZOA 1HE1C 1MG0A 1HO3A 2JFGA 3I28A 4B3XA 2C7RA 1Z8FA 5JJCA 3JWHA 3AEQA 4L5JA 3P8ZA 1EM8B 4ZCLA 4B4UA 3NV7A 1GL7A 3CZCA 4Y6OA 1ZJ4A 3A0UA 3NHWA 4IG9A 2RHJA 4QXMA 1KC1A 4D0RA 5JSKA 2XLCA 1CRZA 2EWMA 2NU7A 2DJ5A 5BR1A 1VLQA 3KPJA 4R0VA 1MJ5A 2FUG1 3OZXA 3FPCA 3DAYA 5JAHA 2BMVA 4F06A 2ZB4A 3O4GA 5FXMA 2XYVA 4IV0A 4WIAA 3SS8A 3VNRA 3LVFO 4J4HA 4OEHA 1R66A 1JFVA 1J1IA 3ZGYA 3PDWA 2RCYA 1XTUA 3GEMA 3DTTA 4FFBA 5LA6B 4ZT7A 1POWA 2ZPUA 1R74A 5PGMA 3EZGA 4RE5A 3RTEA 2YVLA 1UBGA 2QMOA 1J21A 1NM5A 2V6FA 3QPBA 3GUVA 3LK6A 4GAEA 2VLBA 5E2AA 4ONEA 4X1YA 3RKSA 4UTRA 2IXEA 4JP8A 5A1JA 1KP9A 2WA2A 3HM9A 2W2OA 3AFOA 2QN1A 3PGLA 3T3HA 4KK4A 3T5PA 2QTGA 1RAIA 4U9UA 2Q6TA 5J58A 1QKJA 4R2KA 1FYVA 2H57A 3DYIA 1N3IA 4EYKA 3GNQA 3IOEA 3RRNA 1LK5A 1FUKA 3DZFA 4FFNA 5CR9A 3KXKA 2PJUA 5I9LA 3UBTA 3Q7QA 5DN6A 1R9GA 1AHPA 2A0FA 3TYXA 1OKKA 3CSSA 4TMTA 3HSYA 4LRWA 4JNKA 3H0EA 3RRJA 4C9BA 2GEBA 3DV0A 2N1BA 3KWJA 2CSXA 1I9GA 3COJA 4Y6RA 1SOAA 4QDKA 3CW9A 1BNCA 5G02A 1CP3A 4WD3A 1PU2A 3WV5A 3IDOA 1NDQA 2AS0A 2PKQO 2WINI 4QIHA 2V7WA 3UAZA 2G6BA 3NC0C 5A02A 4RAQA 3TMYA 1NW3A 5JMPA 1Z17A 3C3JA 1AK1A 1GUZA 2NVOA 1DKMA 3DR3A 3KT6A 1XD8A 3DHVA 4KR0A 1TQDA 4P3XA 1L5LA 1YOBA 4HG2A 5AOCA 2HQ1A 3NHJA 4JBNA 4YYEA 1RHRA 2Z98A 2LV8A 4RY9A 2O3QA 3H05A 5EXSA 1WDMA 3U3XA 4KFCA 1GT6A 3GF4A 2RIRA 4XH9B 3UYLA 1BN7A 3QLUC 1RRMA 3PC2A 2ZIXB 5KCZA 4XWOA 1JL3A 2GF9A 1N0IA 4TSRA 4EQZA 2Y3IA 2R97A 4MKXA 1HDCA 1VBKA 4JBYA 3V2HA 4GVPA 4KFUA 1IEVA 1E4YA 2XXJA 5IF3A 1YZNA 2OCPA 4MUNA 1XMVA 5FLXA 2WV9A 2R8BA 4OVKA 3R76A 4IINA 4PHTA 3TCXB 3LYHA 3TCNA 3BEOA 3EB9A 1DT3A 1KZ4A 1WSWA 2JRLA 3GDHA 4MRMA 2ZDHA 3WNVA 4B35A 2YWCA 4CIXA 1T6YA 3PDJA 3U4DA 4CKXA 3TO5A 3W6PA 1YSCA 4HDKB 3IXQA 3JQ8A 4OXIA 4XUEA 2Q21A 2X7XA 1C9MA 2GPAA 4DG8A 4E3WA 5JNLA 3RC8A 2QTAA 3CH7A 1AK9A 4GPIB 1JIUA 2IDZA 1JFFA 1Y5NA 4XIGS 4ZOEA 3WLFA 2YYAA 3DXXA 4MYUA 3ZQ4A 1AVTA 3OIWA 4DNXA 4E5NA 4A8HA 5BQXA 2ZXEA 3SWWA 1AQUA 2G63A 5BVGA 1W48A 1H1LA 1E2MA 4TX1A 2OV4A 1RYZA 2Y4OA 2FZEA 3KM0A 3NCTA 5IASA 5JAUA 2II6A 3LBIA 1E7YA 1JMKC 5PNTA 1I6KA 4MR8A 4LJ6A 2I55A 4CMBA 1Q44A 1V25A 2YXEA 1W9HA 3JY6A 1WEHA 3KZCA 4XVHA 5F7OA 5CJ2A 5KDLA 3KT8A 4WBNF 1EX7A 1P2DA 1QCZA 2GHRA 3O84A 3KD2A 5K4AA 2IEIA 5IJ9B 4RABA 1L7PA 4GZ6A 3RFVA 4DRYA 1TU3A 2C29D 2UZ0A 3ZXYA 1TL7C 2M6SA 4GX1A 2WKPA 1B0ZA 1J0EA 1IUOA 2DBQA 4JIMA 1KDZA 3GZTB 4CM7A 1QX4A 1KIAA 3N2KA 5IJWA 3B7PA 1ZCBA 5DP1A 5L4SA 1H4VB 3K0CA 3I2KA 4NOMA 2O3UA 4U2DA 4CQMB 5B3LA 4I4TB 4PPQA 3FCUB 1GSOA 3Q88A 5IM4A 2C04A 4Q7QA 3ORSA 3EUEA 3L7YA 3G7SA 5CAEA 4ARCA 1WP4A 1H42A 3KVVA 3ETHA 2OSVA 2W71A 2WJ3A 3EMKA 2BSQA 2IFTA 1YRHA 2FZWA 2WTEA 4DIFA 3GT0A 2HWUA 4ACAA 1VJGA 3VVCA 4GSKA 4RK0A 4DZTA 1XTTA 3X1DA 2QYOA 1CETA 5BPFA 3HL0A 1T4DA 2O1EA 3DLHA 1YACA 4I8DA 4RDCA 1NVVQ 3OX1A 1PQPA 2Z1NA 2R1TA 2XA2A 1I7NA 1D09A 3BG5A 3SICE 3LF2A 5TIIA 3FPBA 3O3MB 4I2VA 4BKUA 3N05A 4C6SA 4GICA 3ROMA 1R0SA 1AMNA 4H27A 4B3CA 2I87A 4OI4A 3HYSA 4HDQB 4NAVA 3COSA 5H82A 1Z5WA 2Q0SA 4RA9B 4BLUA 4RV9A 1M76A 3AI2A 3TECE 2IW1A 2XUOA 2DULA 5B64A 2CL0X 3C39A 4HAZA 3SEZA 2F43B 1AZSC 4RSMA 1US8A 4GXNA 1D4FA 3QVWA 2AI3A 5EE5B 3E81A 4YIKA 1OIWA 1QO0D 1ADFA 1FA9A 2G4VA 3KJGA 2AZMA 3AF6A 4H0CA 1C4OA 4O4HF 2WU3A 3TOZA 2HK6A 3IMEA 1FW6A 4JODA 3KLNA 2HU2A 1CNEA 1BCSA 3F6BX 1GRNA 4RPGA 4OP1A 2VXYA 2ZB8A 2D5AA 4YRFA 4B3MB 2Q6KA 3KJXA 4ISCA 2BKXA 3D5EA 3KEQA 4JJ8A 4KFRA 1GCGA 2Q4DA 1RM4A 4HRVA 2A88A 2J6HA 3QU2A 5B58C 3LCRA 1NM5C 3KVYA 3LIIA 3NWEA 9MHTA 4MWDA 5FPKA 3LUCA 4XGRA 2G3YA 2Y76A 1A04A 3FMIA 4M0DA 5EEHA 1XBTA 3P9IA 3QKUA 3AUXA 3LDHA 1Z6AA 2CMGA 4FINA 5DTRA 4AN0A 1WXGA 4R7GA 2EX4A 3GYBA 2ZIGA 5KVQA 2WP8J 5LA6F 3FTNA 3T4UA 1G7SA 5IYZA 5BT8A 5HRAA 3W79A 4R0MA 3KXDA 3OZ7A 4OGWA 5KYUB 5IT4A 1PFKA 2I65A 4QPJC 4F6RA 3F5MA 2BUAA 2VDMB 1F0KA 1HM5A 2HJGA 4I5IA 4ZAVA 4CLRB 3OWHA 2FAXA 2OHFA 2E18A 1GG8A 3PIRA 2RHRA 1KJQA 4EHNA 4FE4A 1ZFNA 5AVVA 3D8BA 4WXRA 2IYNA 4ZOBA 5BY2A 4DPLA 1GADO 3EXHA 4L85A 3UGJA 1Z4QA 2C3YA 1CZUA 1MAUA 2JGKA 2QTVA 1TAHA 2RAVA 3IAS6 3JW8A 4MR7A 5JAPA 4AKIA 1GGMA 4G1BA 1Z07A 3TIFA 3OZBA 1YUMA 3MTAA 3VPHA 2O2ZA 1LFDB 1LQTA 3DLCA 3T34A 3WNBA 3N59A 4PZPA 1CLEA 5EKXA 3G2OA 1KI9A 2IKQA 1G2IA 3WGMA 2AFVA 3H1EA 2XRZA 1OU0A 2DUNA 3R3ZA 2EV9A 4U7JA 2DWOA 1NVXQ 3LY8A 4P86A 4BBJA 1N5RA 1XVUA 3V7UA 3NYIA 4B31A 3TM5A 4MI3A 1JR3D 3ZHUA 3ACBA 1EVKA 4P3PA 2A9QA 3E4DA 3A3YA 3KOMA 4Q4AA 1EESA 2LCFA 4DIOA 2IS1A 4B7XA 1NKVA 4H3SA 2JAPA 4MV3A 3L43A 2FUKA 3CRQA 4Q0MA 2C7OA 2LE0A 3ZD6A 1DCFA 1G8GA 2VJLA 4BMZA 5YASA 1ND5A 3QMVA 3ETEA 5EHNA 3WJ2A 3HI6A 1CDOA 5AT1A 2ADFA 3V1NA 1RRCA 1PJCA 5IT5A 1ZQ1A 1DLIA 2P6NA 1CDZA 2B8NA 1NASA 5CX1A 2C9DA 2ZJ0A 3GEEA 4K1LA 1E61A 4OIFA 1B41A 5F21A 1W6RA 2BUBA 3BBLA 2A1IA 2QVCA 4Q4JA 5AVUA 3LQ1A 1TGVA 4LW8A 4MP8A 2O2IA 2ZBUA 3RODA 3AQIA 4FDTA 1U0FA 3KLBA 1W1IA 4L02A 3G79A 4BFWA 1AUOA 2ZUCA 3OIGA 3TDKA 1ML4A 2JFOA 1N2ZA 5H4HA 4MLPA 1TYBE 1JPJA 3UCXA 1GUFA 1I4DD 1ZM7A 3SZMA 2F8SA 3U49A 2N42A 1EFAA 2F8MA 4RADA 2QW0X 1CS0B 1CV2A 1F48A 1M3SA 4QXPA 3ZDXB 4ARZB 1P2GA 4LXUA 2CLEB 3OMXA 3IEPA 5C35A 5K8LA 1FDTA 1M7BA 4R6WA 3WOHA 4DV5B 3OCXA 1R6AA 5DTQA 5JNRA 2ZQYA 3KHUA 3P26A 2PX5A 3AL2A 4IXDA 1LPMA 1AGPA 1XJ5A 2HWWA 3LECA 3GFPA 4FW8A 4MSUA 1K7XB 4L3VA 4JYPA 3K0CC 4WNCA 5A06A 5IULC 2HW8A 1Q0LA 2OYRA 1WSAA 2YWBA 3QU9A 3VNUA 4EG4A 3D7LA 2LGJA 4RD2A 3SVLA 4HPWA 3ED1A 1IPHA 4IDBA 4GMGA 4PYLA 4YMVA 3VUEA 3QKRB 4QICA 2BTOA 3HKDA 1M6NA 1J2TA 3INTA 4IJ5A 1CUGA 1FRNA 2VA8A 3WYEA 5AH0A 3RVRA 4E2FA 5EIXA 4CV1A 2VRWA 2H1FA 1KSHA 1W47A 1MD9A 1EXNA 1TEXA 1YFKA 2ZRKA 2ZSAA 3B60A 3K73O 3NO4A 3NBQA 3V5NA 3OLYA 2WVHA 5JZBA 5DSTA 5LNK6 2Q6OA 3OSUA 4E11A 3WGIA 3HU1A 1GQFA 5EQFA 4JQOA 2G06A 1J8DA 4YUYA 3GIDA 4FB5A 4RFLA 3CMMA 3CF6R 5JROA 1CUXA 4E13A 1W87A 3H2JA 1A4UA 3KJEA 4W82A 3KJHA 4DCMA 1S8FA 3KQYA 4QUKA 5F2EA 4KQ2A 5BSVA 5C1DA 2VQDA 4CL8A 1HK7A 4NXNB 4YCLA 1O0CA 1W88A 3OQMA 1MZVA 3HG7A 4OGGA 1KFEB 3EOBI 1C3LA 4X7RA 3OZDA 4A0SA 4EO7A 2BMJA 1C8VB 2XB2A 1PKEA 1XVAA 3KYDA 3KZXA 4MWEA 1T0HB 4KMOA 3OZVA 3OZUA 4O2BA 3Q2KA 5GQSA 5K8CA 4KUEA 1CUZA 5JCOA 1BXGA 1BYIA 4EKDA 2O05A 5JXGA 2BFFB 2O48X 3C43A 4J0IA 1HNXB 1PZGA 1OBCA 3ADOA 1LFAA 1PUXA 1UBOS 3K31A 3UTDA 3WWDA 3HE3A 3BMOA 5MDHA 4TQGA 1T5HX 1Z25A 2W6MA 2OV2A 4D5GA 1P1JA 1C8LA 1I6WA 2J0EA 3HCBA 4LOHA 4O0MA 2BEWA 3LU1A 4M87A 1LBHA 3P9XA 1Z18A 1VHLA 2CNKA 2HJ9A 3IDZA 4K9DA 3EUFA 4UUBA 1DP4A 2UU9B 1B00A 3WP0A 2IPAB 4DV1B 4GPZA 2OAGA 4JT8A 1IMOA 4EO9A 2IWHA 1SRRA 4M0PA 2GVDC 4TMVA 5CD9A 2JLBA 1O0SA 2PZAA 4QPCA 4NZYA 2JEZA 2YJ5A 2P68A 1MB0A 1BEEA 2XYQA 5IWCA 4FBMA 1AU9A 2AFHE 3X1XA 4BBZA 1YB7A 3F9IA 3BUSA 2QN2A 3OQ6A 3GEBA 3THSA 1NF9A 3IULA 4O3FA 3LBFA 2PL9A 1V8DA 3LBNA 4G9GA 3H3JA 5AW5A 5KX5B 3J81k 3D8SA 1NVWQ 5GONA 3ESZA 4RZ2A 5AVQA 2JDIA 1YKSA 3HC7A 4I46A 3AIOA 4L1KA 1DZ3A 4KIWA 1TJYA 5DCLA 3IJRA 2WYVA 3QV1A 5C4MA 2PUCA 1HDXA 4HQOA 2R4UA 3WIEA 1BX3A 3ABZA 1P0FA 3GEHA 4LGCA 5AK6A 3RFTA 3UG7A 4BPRA 2WB2A 1F06A 1IHOA 3DE4X 2I4MA 4GO1A 4KR2A 2ZITA 1KJNA 1SEVA 2HUPA 4QG7A 2I7XA 2JHGA 3UJBA 1EAYA 1XDSA 3NATA 2V9PA 1NURA 1FMLA 4BVKA 3R8CA 1QOPB 1MUUA 1S3GA 4A8JB 4DLXA 3EXHC 1NSFA 3TIVA 1R6DA 1PP4A 2SKDA 1KSGA 3VXKA 4U4AA 2XRMA 3UJDA 4H7KA 4EJ6A 1T5DX 4UU0A 3S2IA 5C4IA 2FZLA 3TZKA 4EENA 4ID3A 3QE0A 1Z6XA 5JZMA 1VKHA 3MVEA 4URVR 3K09A 4Z51A 2ZJ8A 3B5JA 3H87A 5IAAA 4PHHA 1JHXA 2LWIA 3EDOA 2JA2A 3M6MD 2YMPA 2R7NA 3QW2A 4AYTA 2GCEA 2Q9BA 1CS4C 1SC4A 1P1KA 2HSZA 3QI2A 1UP4A 3L4EA 5THKA 3CKLA 3SBDA 4KO4S 2L2QA 4DMRA 3P4YA 4N1AA 1B16A 4B4WA 4RTSA 2JLZA 1NT4A 1P19A 2W5UA 2D06A 3QFSA 1P33A 1RHQA 3FDZB 4KHZA 5EJAA 1LLUA 2FHSA 5EUCA 2AJCA 3DJYA 3V1UA 1K7EB 2LKCA 1UPBA 1KKUA 2P0YA 5IBRA 2WZQA 3L05A 1G5QA 3VU8A 3O8BA 1EVIA 1T1EA 4HRAA 4GXQA 1H85A 4RTKA 3I2IA 4NYMQ 1BMTA 1UXHA 1DJMA 1RT9A 4IDFA 3U48A 1GUYA 4FDVA 3TGPA 1T1SA 2FN3A 1TI7A 1QYDA 4GX5A 3KE9A 1F4PA 3PXUA 5B58T 1Z35A 3PQ2A 2IU6A 2H5LA 1CIPA 3RFCA 3Q8LA 4I5FA 2HIMA 4HQLA 3B1ZA 2O2YA 3DV9A 4MH0R 4B4VA 5JHHB 4U6QA 4GQAA 1JBEA 1XCPA 3HPRA 2QN3A 3IURA 1M2OB 4RDHA 3OTQA 1IOVA 3SC4A 3GAFA 2G5CA 2V59A 1ZMXA 1XZHA 1H6DA 4IVQA 1I4LD 1NBWB 3LGAA 5LL6P 3U3JA 1EHCA 4YRBA 2WFZA 2O3JA 4BB9A 2ZZNA 3NFYA 3SQDA 3C8MA 2E87A 1PJ4A 1JH9A 3DPUA 1A4IA 3A3NA 4A16A 4B32A 2Z9BA 4EEKA 1YFZA 2RKOA 4NMMA 1OFTA 3I1IA 4XJSA 3L02A 1UJ4A 4YCAA 3MYRA 4ARUA 1BXRB 1RTKA 1J0CA 1A9XB 3RPEA 1KTIA 1Q11A 2B8TA 2QUIA 1DQSA 2WP0A 1YRWA 3LUJA 1II9A 3SQNA 1N6RA 2FPSA 5EFOA 4I3GA 4AG5A 1EMDA 1FVXA 4KHPB 3GFSA 2X40A 3JQ7B 3KQQA 2FF5A 3UGQA 3DLAA 1TOAA 4FQ5A 4RS4A 4YJHB 2CWWA 3PDIA 4AJ1A 5L3QA 4NTZA 3WI7A 4BVAA 4YMHA 4G4SO 4RM3A 4PX9A 1I4EB 4FCVA 2BR4A 4CNQA 3BK7A 2G9QA 5IDWA 1AXRA 5DM4A 1YQ9A 2RGDA 2EF0A 1J0DA 4RH1A 2HUNA 4HH3C 2WMDA 4KMMA 2IF2A 2PSJA 4KQCA 1YDWA 2DPXA 3I6YA 1SKQA 1T4CA 1KYZA 2G1AA 1GSHA 3RU7A 1YFJA 1NYTA 1ZIXA 2PR7A 1NATA 1I10A 3QEMA 2XXBA 3CUUA 3TAHA 4DR4B 4G81A 1ABFA 2GRJA 4H9GA 3TTVA 1X86B 2ZIUB 2VAVA 5EVJA 1RZRD 3L0BA 1QVZA 1NPTO 4DLZA 1REQB 4WK6A 4BRSA 5CG2A 5A6VA 2ZM5A 3RUIA 4EVIA 1IHXA 2R6GA 5JCOC 3O9ZA 4C5BA 4JT2A 1F8XA 1E2KA 3DONA 2PN1A 4TWRA 5AHOA 1C3OB 4MV5A 1VHQA 2G04A 2JI6A 5IVPA 2ODNA 2PRKA 1GARA 4ZVSA 5T8KC 1W94A 3CVJA 4H7PA 3LX6A 4D42A 3FPHA 4G2NA 4DLUA 3R9KA 3U3ZA 4ZAYA 1EFUA 4EAQA 4FYHA 1I2ZA 1MTZA 2QN6A 5CHEA 3U9LA 1X9IA 5CEFA 2GETA 3CEAA 4AS2A 5IVIA 1I94B 2Q5QA 2EFGA 3BSFA 3GGCA 4MVYA 4Y2YA 2XBMA 2JJYA 3D6MA 4YRGA 1SZPA 3COYA 1X3LA 3TR0A 2J46A 3OE5A 1R37A 1U3UA 3B3GA 3S40A 1ZJWA 2WF8A 1GFWA 3UNXA 3OOEA 1FNMA 4IUDS 2IODA 2R2AA 2WF6A 4QNRA 2J9XB 4UD6A 2PMEA 4RHCA 4DN6A 2HB6A 4WMLA 3F9CA 2XW6A 4QLAA 4R83A 2WU8A 2B6HA 3DTVA 1LPSA 3CLRD 1G2PA 3L49A 4G41A 1K2VN 1OOEA 3CM0A 1ONNA 4U3JA 5ENVA 3VNAA 4E5SA 2O5VA 2WSIA 4W7SA 4UXIA 3SYLA 3PVCA 3UWOA 1Z22A 1TZJA 3NNSA 4E6EA 3UJPA 3WDMA 2P90A 2VKTA 4H0NA 3FZNA 1WRBA 4MR9A 4R05A 3E2PA 4MPPA 4ZI5A 1J1UA 1WM1A 3L1IA 1KEEB 1WE2A 1NWHA 5AI6A 4JLDA 2BGRA 1K6IA 1M1YE 3GGGA 4MDFA 4ZVNA 3KBBA 1XAIA 3JQAD 4K9OA 5BUSA 1Y5MA 1MFPA 1A9YA 1CNFA 1WQ3A 3B3AA 4L4RA 5ENZA 3WQSB 4BRWA 2C95A 2VA9A 2BDTA 1OLOA 2V7QA 3LQKA 4NARA 3WYBA 1QF9A 4MUHA 3TZ6A 2XVYA 1EEHA 5GVSA 2X15A 3I09A 1GAXA 5AI9A 1VBNA 3A2NA 3MUNA 2BZ0A 4KWTA 5FOVA 4YONB 1Y1QA 3ZE7A 2H1HA 4G0UA 3LX8A 4OQFA 3V4SA 3VR2D 3OECA 2FP3A 2PO5A 4A3SA 4B2LA 4PO1A 1DTEA 3E9YA 3VJRA 2AZDA 3K09C 1M67A 1FE8A 1RLTA 1V7CA 2FWRA 1DEHA 4L72A 4ALMA 4HH1A 1USVA 3FW1A 3T9EA 1Y3FE 2HRQA 5IT0A 3DYVA 2A9JA 4RSRA 3ASYA 5UKDA 1FMFA 4JJAA 2VBFA 4IYRA 4OGFA 4BRUA 3FBTA 2QLTA 3I2JA 3Q7SA 4FC7A 3ABIA 1QK4A 1G66A 4CLOA 2QHXA 4IIJB 3H5NA 4MVJF 1OLSA 1DX6A 1X8XA 1ZAYA 1TCAA 2VLIA 4OKSA 3IBCA 2J3JA 3QA9A 4ZQEA 3IT3A 5HQTA 1RE0A 1SCIA 1THZA 2BM9A 3FOFC 2SCUA 1FTQA 5DXAA 2RI6A 1LSOA 4Z53A 2G82A 3FWKA 3LZ6A 4Q47A 1GNVA 2AMVA 2HTFA 4D8UA 4ZZ0A 2ZAGA 3CVVA 5TX7A 2IX3A 3BJMA 3HJAA 3K6RA 3T7EA 4F5WA 2V9ZA 4GZ3A 1JLRA 2TRSB 4KR6A 4URYR 4ZDKA 4U5QA 2GXQA 1QCCA 1F4VA 2FLVA 2LP4Y 5LXTB 4TTAA 5L3VA 2V7XA 4YRZA 2Q3CA 2AI2A 3R3XA 4OP3A 3RARA 1QRRA 3BILA 5AKIA 2JIOA 3SDSA 3UN1A 5BOSA 1HDOA 4JBHA 3LDFA 5FO1A 5ICMA 1GU1A 4XCVA 1PS0A 3WA7A 4AO7A 1SFRA 3EZLA 4LHWA 1BYUA 4R3UC 2Q3BA 3VU1A 1SUSA 4K8RB 4RLFA 2A0KA 5KTNA 3ICCA 1FDIA 1NZFA 2Y68A 4ZO6A 4HVLA 1X80A 5I7RA 1W5EA 1YQUA 1QFXA 4JLOA 5ALOA 1UQUA 3SX0A 2BFMA 4RM2A 4EGAA 2Z3ZA 4MPDA 2INGX 4F2PA 1Y48E 4UCQA 3DQPA 5JVDB 4XW2A 5TQ0A 1ENYA 2O7VA 1SKAA 1BE1A 1EXMA 3QFCA 1ODTC 1Z7GA 4AJIA 4BEWA 5AIAA 4QARA 1V7ZA 3FPFA 2WQ6A 3UEOA 4MEJA 4XX0B 2BJVA 1SCBA 5I8PA 4M9UA 1I14A 2K4MA 1T29A 3SLGA 2GD0A 1K4KA 2WMOB 3B12A 3QF4A 4LXQA 4EFDA 3GDOA 2AW5A 1DUIA 2P9YA 1ORIA 5K0JA 3QUQA 2GZHA 4M7WA 2UUPA 3DWIA 4RGYA 3KD3A 4ZT4A 2DQSA 4NBNA 1NF2A 1T2AA 2GN8A 3UM9A 4G5SA 4HWSA 3ITKA 521PA 2Q2NA 1Y3CE 3QITA 1F0PA 3DAFA 1E2BA 2NO6A 5L3ZA 4EKIA 3A27A 5C7LO 1E3WB 1G6OA 2KWIA 2VTDA 3LQQA 3OSZA 1I3KA 1MB3A 1PD0A 1SBYA 1XQXA 3COVA 4IQ0A 2IYPA 2QY9A 3IJPA 3JSXA 3UPUA 1GYPA 4EYEA 3DZ8A 4MA4A 4GKAA 2ZWPA 4S1TA 2PUGA 2Y0PA 3E5NA 4MDHA 4G6ZA 2HLNA 2ZIWB 4NRDA 5K0ZA 3TE7A 4FYJA 4KC0A 1R88A 4IKOA 1N2IA 2A57A 1T43A 1EWVA 1Z4PX 1N2BA 4LSGA 4QGFA 3ER9A 1W36B 2W4IA 4BNUA 5BNTA 3JRXA 5E95A 4JR2A 1QWSA 1EYZA 1U80A 2ECQA 2FGJA 2IUSA 1BXZA 5KPJA 1EB9A 1N6HA 4WBSA 4YJGA 3MMSA 2P4QA 3TKYA 2J7KA 3FPGA 3O94A 4KN6A 2XDYA 4DNFA 2HRZA 4TKVA 2GF0A 1V8FA 2VBIA 3DOIA 1NZDA 3GGPA 4CBVA 2EJCA 1RJEA 1D2RA 3DA8A 4NR0A 4WUVA 4G0VA 1S4MA 3DW1X 4N0EA 4OREX 3DFZA 4XQGA 4MQEA 2JS7A 4XB6B 4TV9A 4TT3D 2YQ5A 4D25A 2OGSA 5B6JA 3T9FA 3G2PA 4NICA 1MG5A 2WAXA 4CKEA 4MHSA 2OBXA 1UBHS 1W5SA 5J5AA 3TW8B 1PR2A 3RRBA 2PUFA 2GXSA 3QLTA 4WY2A 1X1BA 3T1HB 1IN1A 4B3GA 2P2DA 3UAWA 1ZW6A 3H9BA 2J9FB 3IVRA 1Z75A 2P1ZA 3P0RA 3PGKA 3RUPA 1E5LA 2IC5A 2VT7A 2OOKA 1M10A 2WZCA 2OFPA 2AQHA 2QTTA 1K8QA 2BMAA 3M1YA 3EIFA 3O1IC 2PMBA 1CE8A 1WBJB 3GPDG 7ABPA 3GLVA 2WWIA 1VHDA 1G4AE 1V43A 3SR0A 4XD7D 1SKMA 4X41A 4BX3A 3C5HA 5T4HA 4UHCA 1KDTA 5F64A 5KYYB 5GOZA 4C06A 2OENG 5JD5A 2FPKA 1FOEB 4B3BA 2C0QA 3OTWA 3MXTA 1MC1A 4X5OA 3VU0A 2C4TA 5IF9A 2C5FA 4R2MA 2ISSD 4KREA 4GNRA 5MF6A 1FRQA 3FNHA 5JDCA 5EIWA 5BO5A 2HQRA 5CXSA 4UVEA 1C81A 4QJ4A 5LLSA 1PT9A 1W4ZA 2H07A 4HFRA 1QR6A 1MVNA 1GG2A 1JR2A 3H9JA 4UOQA 1NVDA 2W6JD 4KXUA 3L18A 1R6TA 2ACWA 1X7ZB 4D0GA 1ZIDA 3D1VA 4F7WA 5A5EA 5BUQA 1C30B 4TT3A 3H9EO 4KZPA 2HJRA 2WZBA 1IC6A 3TOSA 1V11B 4IZHA 2X9VA 4WY5A 5B2FA 2OCIA 2O5EA 1GA6A 1ODLA 2QIOA 2R79A 3RK4A 4J2HA 4M4SA 4UUMA 3WWEA 1YT5A 5THXA 2IVZA 1QTRA 3U7EB 3TXYA 1H23A 4EI9A 4N7BA 1Y9ZA 5JMTA 1KOJA 4MUGA 2AWOA 2WSLA 4PLPA 4WECA 5K3BA 3A4VA 5AK5A 3HXMA 5HR5A 3P5SA 2BELA 2FPIA 1U8XX 5FBQB 1KMCA 2ZRNA 3OM9A 4TKMA 4QZVA 5KWJA 1QR2A 3JALB 3AU9A 4IIJF 1J56A 1CUBA 1A95A 4QQRA 2Z43A 4M7RA 1MC5A 3ONDA 2HCJB 2J5RA 4WFQA 1IU9A 3C7DB 1ZK2A 2PUTA 1MDBA 3PC6A 1GV0A 1RI2A 2YYSA 3D6AA 3IFSA 4QJIA 4TLDA 5AKLA 5IJ0A 4NH0A 1WCIA 4BVGA 3O4RA 2QSZA 2W2LD 4V1CA 2VQFB 4KFTA 4E1VA 5BOSB 4XXHA 2OB1A 1Z56C 2CNNA 8ATCA 4PE5B 4LCBA 1CEQA 1ZRMA 5IC4A 3BWVA 2E49A 3L01A 4MIEA 1IG0A 1KJJA 3WAJA 1RQXA 5LXTF 4NU0A 4BTLA 2BHRA 3KJFA 1E1RD 2B78A 1CY2A 2Q4TA 2ZR8A 4R9UC 1ZGZA 1JEAA 4Q7MB 5A0VA 3O74A 1XNGA 2PYIA 1LH0A 5F52A 4X8HA 1VKOA 3ODPA 3CE9A 3GBVA 5BPHA 2JGLA 2REQB 4PX5A 4YMSA 1KVRA 2WHQA 3FXAA 2VZLA 2YIJA 4MW2A 2PK3A 5KOIA 3E1KA 5BR7A 4I1IA 3L8HA 1TTHA 4FFLA 1VGRA 3ELBA 1YFLA 1L5KA 4FGLA 1RLIA 4KDCA 3NVAA 3AW8A 3E70C 3KB6A 5IMSA 2HYIC 4MYSA 2CLDX 4MW6A 1R18A 1Z74A 4KPEC 1Z62A 5IKMA 1HGXA 2O7SA 3FB4A 1RD4A 5A7HA 1UDBA 5JVDF 4MO2A 2FMHA 3WIOA 4U2BA 5KOYA 1QU3A 5AKGA 1OA1A 3RSLA 2WV7A 4AQDA 4MMYB 2YV4A 1KK0A 2Y0EA 1I1QB 4X20A 5D6OA 4HCJA 3U7RA 4ZVOA 1BFDA 4Z99A 2JAOA 4PZYA 3S5JA 3THWA 4RJLA 1E9DA 4PYQA 2MSLA 4J1TA 2ZYRA 3VPAA 3UJHA 1ST3A 3HSKA 4RY0A 1WDLA 1ZCJA 4MAAA 5A4FS 1ZD5A 1MJNA 1V1RA 2ZUVA 3NHYA 1HX7A 3GIWA 1I2AA 2BFAA 3GFTA 4A26A 1T5LA 1NJSA 2VDUE 3U7QA 5ISMA 1FX0A 3N75A 3OO0A 4DDVA 2W2LA 1N34B 4OJKA 2I91A 1XEAA 2ZSUA 2ZI6A 3BMNA 4H4DA 5HTKA 4CM8B 3O8RA 3GLFB 3VPXA 4C7OB 1QFYA 3D3QA 4MB2A 1QC5B 1M34E 4L3OA 3ZWOA 4FKBA 4BDTA 2ZR0A 4R68A 4FYPA 4RULA 2CVFA 4M38A 1RWQA 3NRBA 4DWWA 1E1RA 4ZXFA 2JCSA 1C7IA 1A1SA 1PZMA 2OV6A 2YMMA 3T3NA 1D8AA 5T4FA 4EUSA 1TEVA 3RWBA 3R4VA 3DD1A 3SQLA 3DCJA 1V8OA 2YC4C 3IO3A 3VU9A 2GQ0A 1SULA 4N6GA 1H3NA 1Q92A 5TLSA 1E7MA 1V7PC 5E6SB 1L4MA 2QRLA 3LHIA 3STTA 3NP9A 1CFJA 1I36A 3E8MA 4G07A 2PYZA 4BS9A 1Z63A 4WESA 4DF3A 4NPCA 1IN4A 3HKBB 5KWVA 2Q0QA 3RNOA 3W7V