4QLAA

Crystal structure of juvenile hormone epoxide hydrolase from the silkworm bombyx mori
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
424
structure length
424
Chain Sequence
LDLEEWWGPPELKQKQDTSIKPFEITFSETMVKELKERIKKRRPFAPPLEGVGFKYGFNSKQLDSWLKYWAEEYPFAERQKFLNQYPHFKTNIQGLNIHFMRITPKVPKGVEIVPLLLLHGWPGSVREFYEAIPHLTAVSKDRNFALEIIAPSLPGYGFSDAAVRPGLAAAEVAVIFKNLMARLGYKQYYVQGGDWGALIGSAMATFFPKEIIGFHSNMALTLSPAATFLEFVGALFPSLIVEPELANRLYPLSEKYSTLLEELGYMHIQATKPDTVGIGLTDSPAGLLAYILEKFSTWTNPDLRSKEDGGLSYRWTKDQLIDNLMLYWSTKSIVTSMRLYAESFSSRHFDLKLDEIQVQVPTWVLQAKHELAYQPPCILKMKYPKLVNASVIEDGGHFLAFELPEIFAKDVLKAIGEFRKLKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Juvenile hormone epoxide hydrolase
publication title Crystal structure of juvenile hormone epoxide hydrolase from the silkworm Bombyx mori
pubmed doi rcsb
source organism Bombyx mori
total genus 142
structure length 424
sequence length 424
chains with identical sequence B
ec nomenclature ec 3.3.2.9: Microsomal epoxide hydrolase.
pdb deposition date 2014-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06441 EHN Epoxide hydrolase N terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4qlaA00
1XRPA 1XZJA 3IDAA 3RARA 4KRXA 3HRHA 2BGRA 3R3VA 3DCNA 1QIMA 3H1BA 2B61A 4O08A 1L7RA 4AZ3A 1NU6A 1YB7A 3H04A 4GI1A 5HF9A 5E4TA 1CEXA 3FNBA 3STUA 2OCLA 1CQZA 3WKAA 1JU4A 2IITA 2ONCA 2PSEA 2G4LA 4UHDA 4AQDA 1HLGA 1A7UA 5CTAA 5BWBA 3F8SA 3STXA 2OCGA 2BJHA 5ALNA 1XZAA 1EXWA 1UOOA 5C8XA 3RM3A 1FFEA 5D6OA 5T4EA 3WKDA 1ZD3A 1HQDA 5KREA 2WHPB 1E66A 4B7ZA 1JKMA 5AICA 2WILA 5HF8A 1WPRA 1ZGCA 3DEAA 3W9BA 2J4CA 4DSAA 4G8DA 1K6EA 4CG2A 5BV7A 4X93A 1IUOA 2GBCA 5AK5A 1MNAA 1YS1X 1GPKA 1DQZA 5AKJA 1UKBA 1GGVA 2WG0A 5HF5A 4B83A 1QIGA 5IVHA 1VE6A 1WHTA 4E46A 1CUGA 2O7VA 1YS2X 4BDSA 4CCYA 5AO9A 5AKYA 2FX5A 3QYJA 1OILA 1H22A 3L1HA 4UHCA 4P92A 4V2IA 4L9AA 3D4LA 3WK5A 3HJUA 3STYA 1R88A 4MWSA 7YASA 3CXUA 2CKMA 4FNMA 5EGNA 4ZXFA 3FYTA 4BP9A 4KACA 4K6KA 5ALSA 3W06A 5ALOA 2DSNA 2XQKA 4LYDA 3WI7A 1QFSA 1W6RA 1XFDA 4Y2YA 3C6YA 4S0XA 4PSUA 4J0DA 2PUJA 3WIOA 3IUNA 5CURA 2OCKA 1ZD2P 3H18A 4BE9A 4AMYA 1C7IA 3H1AA 4QDXA 5JANA 4LKOA 4OB7A 1MNQA 2Z8ZA 4B9AA 3L1IA 3B12A 3AZOA 5ALFA 4KE7A 2ZYHA 4DMKA 4U2EA 3H2JA 4FLFA 5DYWA 2Q0XA 1F0NA 3RLIA 3KDAA 5ALGA 1CUJA 2DFPA 3GROA 1K4YA 5AI0A 4EHBA 4MYDA 1HPLA 1GKKA 3VKFA 2HADA 2RGUA 2JF0A 2X8BA 1FFBA 4Y2XA 5AI6A 3FYUC 1N1MA 1MJ5A 1XQXA 2VQ6A 3A2NA 1CUUA 4HZGA 1EA5A 2JIDA 2W6CX 4XJVA 1IUNA 1EVEA 3D7RA 1JJFA 3GA7A 5FPQA 1WM1A 5AI9A 1MAHA 1YA4A 5LIPA 4X71A 4UUQA 3WLAA 4MJ3A 4P93A 3O4IA 1XRNA 3C5WP 5J3JA 1B6GA 1WB6A 5CT8A 4Z49A 4PO3X 3PUHA 5IVDA 2D0DA 1J07A 3UUEA 2QTBA 3WKEA 3I2HA 2OPHA 1ORWA 1N5RA 4PW0A 4X92A 1DX6A 4W1PA 4BDTA 3G0DA 3O4JA 3BIXA 5IH7A 3C87A 1N8SA 1R9MA 2XUKA 5HFNA 4QWMA 5EI5A 2QUAA 3BF7A 3OURA 2OGZA 4GHWA 5I7UA 1VXRA 5ALJA 3LIPA 4INZA 4WFJA 3OPMA 3RK4A 2HA2A 1Q0RA 4UFOA 5ALKA 4PV7A 1SCQA 4G4IA 3G9TA 1YR2A 3PF8A 2E3JA 3ZLUA 4WFIA 5JD5A 1XZDA 4RPCA 2BUAA 4X91A 5JYCA 2DCMA 3KWFA 1X2EA 3W9UA 1USWA 1UT6A 3JWEA 2OGSA 3EQ7A 3AZPA 1AC5A 3B3QA 2NW6A 2XMRA 3PICA 5AI4A 2VJAA 3DLTA 1XZCA 2P8SA 4GXNA 1CUYA 1EB9A 3EQ9A 3EF3A 1JT2A 2Z8XA 4GBGA 2H7YA 4KAJA 3ZV7A 2HFKA 4MXDA 2C5GA 5SYNA 4BZZA 1GQRA 2XUAA 1EDBA 3FSGA 4YX9A 1AQLA 2BFNA 2JGFA 2XQGA 1ETHA 3BL8A 1QONA 4OB8A 3AUKA 5AH0A 1BU8A 3DJYA 5ALLA 2XQIA 1O6GA 1XRQA 4Y2TA 1HL7A 4UHBA 3UUFA 2O2IA 2XB6A 1G5FA 2XUFA 4C87A 1UK8A 5AM5A 4MQMA 1RWQA 3TEJA 2XUPA 1MPXA 3VVMA 3O0DA 3WA7A 5FLKA 2ZJ7A 1CFJA 4J0KA 3F67A 3IA2A 4PF1A 1IVYA 3AFIA 1SFRA 3I2GA 1DT5A 1VZ3A 4H18A 2PM8A 1JMKC 3I6ZA 4LXGA 5EHZA 4Y2UA 4QZVA 2FUKA 1CUSA 4G9EA 3C70A 4P9NA 3QMVA 2XI4A 1LPNA 4G4JA 1QLWA 4I4CA 2JGLA 3LP5A 2QVBA 2GYWA 3C8HA 2HA4A 1TCAA 3QITA 4J7AA 1D07A 4D9JA 5KWIA 1G66A 1ZD4A 4X85A 2ACEA 2B4KA 5AHXA 1F8UA 1P0PA 1FFCA 4KE9A 4G4GA 5CT9A 3VISA 2HRRA 2XLBA 3MVEA 4B80A 1LZKA 2Y2VA 2ZSHA 3BDIA 3OC0A 4ROTA 3C6XA 1PV1A 3BJRA 3QM1A 3NWOA 2AJ8A 1KEZA 4NVRA 5HK8A 4ETWA 1EINA 1K5PA 4WDRA 1XROA 4CI9A 5JZ9A 4H7HA 5ALRA 2XDWA 4DNPA 1H2WA 2I3ZA 2GBFA 5JAOA 1F0PA 5CMLA 4PSCA 2GYUA 5ALVA 3Q0TA 3R3WA 1T2NA 1QGED 1E8MA 2VATA 3AILA 4N5IX 1U8EA 4FDMA 4HXEB 1XZKA 1X70A 1RYYA 3ZLVA 3ANSA 1KU6A 2QZPA 5HK9A 5JAHA 4YK7A 1BEEA 4W63A 5AIAA 3V48A 2WFMA 5JARA 1H2XA 4BC1A 1WB4A 2JGEA 2XUQA 2WSLA 2G5PA 3AZQA 1XZEA 3ED1A 3DNMA 5JALA 3QPDA 2XQFA 4A16A 2GZSA 2BUCA 1TQHA 2WHPA 5D7BA 3PI6A 2WKWA 1JJBA 3HYSA 5AM2A 1QFMA 4WCVA 4GEGA 1ZJ5A 2VSQA 4E11A 1XZLA 2XMSA 4Y2SA 5A71A 3VXKA 3S2ZA 1CUZA 2AJDA 1QOZA 4UBJA 3FOBA 5LKAA 4DMHA 4L72A 3AJAA 2WLSA 4AX4A 1AX9A 2X76A 3HI4A 2WIGA 4J3JA 1CQWA 1E5TA 4DLNA 2HA0A 1GQSA 4Y2JA 3PUIA 1EDDA 3M3DA 3BE8A 3SK0A 4U2DA 2C5FA 4BZWA 1QZ3A 1QIEA 4AB1A 2WHQA 1TK3A 1XZIA 1C7JA 4UFNA 1VKHA 3KSRA 4BYMA 4G1FA 2XUJA 3C45A 3O95A 1SC9A 5EIHA 4BVKA 4DTCA 3BWXA 2R8BA 1QO7A 4NZZA 4RGYA 1XLVA 3DOHA 4QLAA 4Q05A 5D3ZA 1XLUA 1QIFA 1K8QA 2XQJA 2VT7A 4BRSA 2Y2UA 1ZIXA 2CJPA 5ALDA 1TRHA 2ES4A 4BTLA 2JEYA 4FWBA 3A70A 2VAVA 2HA7A 4HTAA 1X2BA 3R41A 1BRTA 1HKHA 3U1TA 4UHFA 4IO0A 2WQZA 1CUHA 1WCYA 1Q84A 3SX4A 1JMYA 4WFKA 5AOBA 3IUQA 4QWWA 5FRDA 3VJKA 4W1SA 4QDTA 4U2GA 2DR0A 5LZ7A 1EB8A 4XIIA 5EIAA 1CUEA 4GECA 1GKLA 2GYVA 1WHSA 4XVCA 4QLOA 1Y7IA 1SCKA 4L0CA 2ZYRA 1YCDA 1DWQA 3T4UA 5CH3A 2IIVA 2JBWA 1AURA 2WIFA 4EBBA 4EUSA 5AM1A 1YA8A 3CN9A 3WWOA 3D59A 2VEOA 2GBIA 5EHXA 4ARBA 5CH5A 2UZ0A 1U65A 4CG1A 4X3CA 4GW3A 2PSFA 4FFWA 4OPMA 2OAEA 3V1KA 3I2KA 4ZI5A 4A5SA 4Y9SA 2PUHA 1ZICA 2OG1A 1Q0ZA 1ISPA 4MEAA 4J03A 2H1IA 5A6VA 3F96A 4KRYA 3R0VA 4B9EA 3I6YA 3WWCA 4MWTA 5CW2A 5AI8A 5AM4A 3HABA 3L1JA 4Q82A 4GDMA 4EY8A 3D3NA 4BTVA 2PSJA 4FNGA 5C7YA 1XZFA 1UXOA 3ZLTA 4BE4A 3FLEA 4HRXA 5ALEA 3WKCA 5AKKA 3QH4A 3WK6A 5AKEA 1AMNA 3NOXA 2QUBA 1Q83A 3O4GA 3BXPA 2QS9A 1EHYA 2VJCA 4UBIA 3ESBA 2QMQA 3DDUA 5K3AA 4M0EA 3W2TA 5C81A 1LBSA 3HC7A 3I28A 1ZJ4A 4N8EA 3HSSA 3IB3A 1R1DA 2O2HA 1LPSA 4J0JA 4UBKA 4QDZA 1FSSA 1GPNA 4DYHA 1XQWA 2XUOA 3STVA 4NS4A 5LZ9A 2VJDA 4BAZA 3OG9A 2V9ZA 4CIAA 2XMCA 1XQYA 3DOIA 5EHNA 1J2EA 2EEPA 1EK2A 3C6BA 4DM7A 2PPLA 4Y7DA 4EA6A 1EI9A 1XRMA 1ZOIA 4FFVA 1G42A 4ZV7A 3O9VA 3FBWA 4DGQA 1E8NA 1E89A 5CT4A 3UMJA 3WK9A 3ZPXA 3DYIA 2V97A 4H77A 2YASA 1IZ8A 4K2AA 2CBGA 2PSDA 2OQVA 1UK7A 1I6WA 3BDVA 3R40A 4CIBA 2QXUA 5C8VA 3SWWA 3AIKA 4X90A 3PE6A 2DQYA 1TAHA 5AKHA 1GT6A 2BUBA 5K3FB 2I3DA 3LIIA 1MO2A 3M82A 4A23A 2B9VA 4F60A 4DMCA 5AKZA 4AN0A 4YASA 3FWHA 3X3HA 3WK8A 3VVLA 4QDOA 5FV4A 4WDQA 2QOEA 4K5QA 1VOTA 1QTIA 2HDWA 3AIMA 4RE6A 1LGYA 3G9XA 2VF2A 4Q34A 5HF6A 1CV2A 1XZGA 2XUIA 2HA5A 2QRUA 4TPKA 1ORVA 4XX1A 5ALWA 5CXUA 5FPPA 1UZAA 4FOLA 3KD2A 5EFZA 4P08A 1QIHA 2JGKA 4X7BA 3STWA 3ESDA 4LIPD 1CRLA 1W1IA 3HXKA 1CUVA 2WFZA 3ANTA 1CUXA 1QIKA 2HHAA 5AM3A 3WZLA 2VA9A 4AN1A 1MX5A 2Z3WA 2RIPA 2K2QB 1QIIA 4QA9A 1EH5A 4AZ0A 4U2BA 5ALUA 2QXTA 3IIIA 4B81A 1BN7A 4IQ4A 4BB0A 2WM2A 2H9YA 3WL6A 3PDCA 3WWEA 3EQ8A 1MT3A 2WHRA 2DHCA 1DQYA 4JNCA 2WU4A 1QIJA 1EVQA 3G0BA 5AOCA 1BS9A 4AO7A 1WPXA 1DINA 3FYUA 4EB0A 2Y1KA 1XZHA 1LPMA 4JUIA 3WQHA 5F4ZA 3IVMA 5A62A 1XRLA 3R3XA 4Y2VA 4MEBA 1THTA 1P0MA 1C4XA 5K3EA 5E4JA 4JH0A 5DLPA 4J0GA 5HQ3B 4F21A 2O7RA 5H3HA 4X6YA 1O6FA 2Z5GA 2WJ6A 1Y37A 1LZLA 4DNQA 3FSGD 4UHHA 2ZSIA 3WKBA 2AJBA 3LLCA 3MGAA 3STTA 3JYHA 2I03A 4FHZA 4KE8A 5DTJA 4F0JA 5DNWA 5K3CA 3R3UA 2PKYX 1ODSA 3H2HA 3CCBA 4B6GA 3V1LA 2O2GA 1E8DA 3WYDA 2OLEA 3GZJA 3QZUA 2YYSA 4HAIA 5E2IA 1TCBA 2WIJA 2OXEA 4H7KA 2HA6A 4B84A 1A8UA 5K3DA 3TGLA 4F5ZA 5ALIA 4MYSA 2GZRA 4YPVA 5AK3A 4OU4A 5IKXA 2XMDA 3CCCA 3ZWQA 3PFBA 1VJ5A 5AKXA 4L3WA 4E14A 2CEKA 5ISMA 4RNCA 4UBMA 2XMBA 4I19A 2PBLA 1MU0A 4FKBA 3TJMA 5HZGA 4K6HA 1AKNA 2PSHA 4C6HA 4ZWNA 5LLSA 4HXFB 1CPYA 2QR5A 5E4YA 3V9AA 3FYUB 5ALZA 4AXBA 2WFLB 4HVTA 5IVKA 2RONA 5FP0A 3G7NA 1GZ7A 5JD4A 5AKLA 4Q3LA 3G0GA 3NGMA 2FJ0A 1ODTC 4ARAA 2PU5A 1ZIYA 3E1GA 2H7XA 2Y6VA 1LPBB 2C58A 4Y2PA 5KBYA 2RI6A 1DTEA 3N0TA 1CVLA 3QBJA 1J06A 3D0KA 1DWOA 2OCIA 4BRZA 1S8OA 4MQLA 3QPAA 4OU5A 2QJRA 5JAUA 5HCUA 1LPAB 4BCBA 1DX4A 4EY7A 2WTNA 2DHEA 5D3KA 3A2LA 5AI5A 3H17A 4HS9A 4U2FA 1U2EA 2XUGA 5K3BA 1PFQA 1THGA 1TCCA 3WIBA 1P0QA 2WJ3A 1QO9A 3C8DA 4JYPA 2C0QA 4W1QA 5FOQA 5BWCA 3ICVA 2J3QA 5CT6A 3M83A 3VJMA 1MTZA 1MN6A 3VJLA 3I1YA 2WTMA 4ZREA 3OM8A 2QKYA 4DSZA 2PU7A 3M81A 1HDEA 5T4HA 1XKLA 3HLKA 4X6XA 2V98A 3N2ZB 5EHQA 5BOVA 1A8SA 3IUJA 4TGLA 4IH1A 4DIUA 1T4MA 3ESCA 5JATA 1EDEA 3I2FA 3K6KA 1QE3A 4UBLA 4DNOA 1UOPA 1W76A 4H7JA 4OB6A 4N8SA 4W9RA 3K9BA 1QTRA 1W4LA 3WA6A 3DYVA 3MUNA 4C88A 4CFSA 1U4NA 1QJ4A 4ZGBA 2FJPA 3C5VA 3WL8A 1CIJA 3SC2A 3DQZA 2J3DA 2ECFA 1Y7HA 3V1NA 2XT0A 1G4HA 1ZD5A 4FMPA 5ALPA 2EDAA 3D2BA 1LBTA 3C43A 4QEKA 1AZWA 3I1IA 5ESRA 2ACKA 1YAJA 3U0VA 4BAGA 4BP8A 1EK1A 3KXPA 2BGNA 2HFJA 1MAAA 3A6ZA 2Y6UA 4CCWA 3F97A 3WZMA 4H7FA 5AK4A 2BCEA 2I78A 3H19A 1IMJA 1UOQA 4WY8A 3P2MA 2CZQA 5AM0A 1ZI8A 5HKAA 2HM7A 1CUWA 5A7FA 4C01A 4Q3OA 3O4HA 1CLEA 2C7BA 4GLBA 5KWJA 2YH2A 3LS2A 3A2MA 2G5TA 4Q3KA 5K3FA 5JAPA 2HU7A 4G8CA 3AINA 3HEAA 5DTIA 1OXMA 3R3ZA 3RKSA 1FFAA 1CUFA 5CH8A 3EBLA 1VZ2A 3G0CA 1M33A 1NU8A 3IULA 4KAAA 4XWGA 1H2ZA 2R11A 4QNNA 1AUOA 2W22A 2WU3A 4U2CA 3BF8A 5AP9A 2XLCA 2BAGA 5EIEA 4BBZA 5LZ4A 3WJ2A 3S8YA 1J1IA 3FCYA 3QPCA 4ZRDA 5FXMA 5ALQA 1B41A 5HFAA 3TRDA 4I3FA 4DMFA 4CG3A 1BEZA 2HRQA 1H23A 1MX1A 1VA4A 2ZVDA 3LCRA 2VAXA 1N5MA 5FDFA 3JW8A 1SOMA 3R3YA 1XRRA 4LYEA 3ESAA 1L7AA 3H2IA 1IZ7A 1UKAA 3HACA 2C0PA 1VA5A 5C8ZA 3PF9A 1TIBA 2V96A 2Z3ZA 2WUFA 4OD0A 3O9MA 1GPLA 2GBGA 4B0PA 3DKKA 3DS8A 3FLBA 1R9NA 3DL4A 2ROQA 3T52A 5HKBA 4IH4A 4H0CA 4ZV9A 4BVLA 5LZ2A 1BCSA 4H7DA 1CUIA 2LIPA 3W05A 1BCRA 3ILSA 4EY4A 4LXIA 3YASA 4J0IA 3H0CA 3KWJA 3E0XA 4FLEA 3HZOA 2PX6A 4FTWA 2HA3A 4BATA 1VLQA 4FLMA 3G02A 1VXOA 5AKIA 4BC0A 4UPDA 2HU5A 1CUBA 1K63A 3WK4A 1KU0A 5ALYA 4H7IA 4X94A 5DJ5A 4IHAA 2HL6A 2ZJ6A 1YASA 5JZSA 4CCYB 4PQEA 1PJAA 3FLAA 3ICWA 3GELA 3IUMA 2RAUA 2CUTA 4KJXA 5HQ3A 1FFDA 4BAUA 1EX9A 4J0CA 1UK9A 1JJIA 1YB6A 2XUDA 3F9CA 2B20A 5A2GA 1XZBA 4W1RA 3V1MA 3FVTA 5FKJA 4HXGA 3QVMA 1XLWA 2XUHA 3DL7A 4PSDA 1R3DA 4G9GA 2WIKA 1LPOA 2XMZA 1UWCA 2JGIA 1ODCA 1JFRA 3Q8WA 2G63A 4ITVA 3FAKA 3I2IA 3GBSA 3WMRA 3C6ZA 5JD6A 5YASA 2H7CA 4UHEA 2WUEA 4OYYA 3WWPA 3ZI7A 1ZI6A 2XE4A 1UKCA 2X5XA 5A7GA 1GXSA 2WUGA 3VDXA 3QMMA 5CBKA 4NMWA 1F6WA 4E15A 1BROA 4C4XA 5DYTA 4RE5A 4C4YA 1AGYA 1A8QA 1YSCA 3WJ1A 2HIHA 3IURA 4KEAA 4M0FA 2ORYA 4H7EA 3PFCA 2AXEA 4JEIA 2JGMA 3WL7A 2YXPX 2EDCA 4KE6A 5A7HA 4FBMA 4C89A 3H2GA 5T4BA 5K5EA 4X95A 1XQVA 3BIWA 2BKLA 2WFLA 4QE3A 3CN7A 1CUCA 3FCXA 4UBOA 1LNSA 2CB9A 2DQZA 3G9UA 1MX9A 5DNVA 5LP1A 1NX9A 2J4FA 5CXXA 3D2AA 4N5HX 1L7QA 3KOOA 5ALXA 4EY6A 2HU8A 1CUDA 3MUOA 1CR6A 2OGTA 2QM0A 1TKRA 4GWLA 5LYYA 1IUPA 2QT9A 3IBTA 6YASA 5LZ8A 4WY5A 5JZBA 2OAGA 3NUZA 4PNZA 1QIDA 5AIBA 2IX9A 5AJHA 1WB5A 5ALHA 4UFPA 2XMGA 3G9ZA 3GUUA 4OCZA 4BCCA 3DD5A 2RHTA 2WUDA 3B5EA 5SYMA 1CUAA 5FUMA 3DKRA 5AKGA 4EZIA 4KYVA 1ZGBA 3K2IA 5ALMA 4OSEA 5AOAA 4BVJA 1JI3A 2ZJFA 4UBNA 3H2KA 1LPPA 5I8PA 4H35A 4DNFA 1W75A 4AO6A 4K6GA 4AO8A 4OYLA 4X6UA 2ZYIA 2AJCA 4QDUA 1H2YA 2VTVA 1XKTA 2PL5A 3WK7A 4TVKA 1JU3A 1ACJA 4FBLA 2JEZA 5CRIA 2D5LA 4J0HA 4LXHA 1FJ2A 1R50A 5JIBA 2C4HA 4JYMA 2WJ4A 4KR0A 3WYNA 4IH9A 4OUKX 4Y2QA 1OCEA 4LHEA 5JADA 1WOMA 4EY5A 4Y2RA 3E3AA 2QJWA 5JASA 2VJBA 2RHWA 1W52X 4B82A 3F98A 3G8YA 1SCIA 3AIOA 4HRYA 1UFOA 2AJLI 4KAFA 4C4ZA 1UK6A 4Q1VA 5T4FA 4M0MA 5DNUA 5IVIA 1BE0A 3W04A 4G5XA 2JGJA 1DT3A 3OTQA 4AMZA 1DWPA 5LZ5A 3WL5A 2PVSA 1BN6A 2WG2A 1ACLA 4N8DA 3EIOA 1VE7A 3G0IA 2VT6A 4B85A 1YAHA 3QMWA 3WWDA 3E4DA 3I2JA 1P0IA 4WJLA 1XZMA 1LLFA 5DWDA 4BCDA 2WG1A 5LKRA 2XMQA 3FVRA 3D5EA 1Z68A 3I6MA 1R4ZA 2DHDA 4X97A 5DYYA 3BJMA 3D2CA 2CMFA 4G8BA 1HBJA 4B0OA 4X00A 1RP1A 2WIDA 1ZI9A 5I9IA 3GFFA 2OQIA 1A88A 1E3QA 5ALTA 2ZYSA 5AK6A 5CT5A 3OOSA 1DU4A
chains in the Genus database with same CATH superfamily
1YMVA 5JPIA 2Q2WA 1HDYA 1XZJA 3LP8A 3ABSB 2CDBA 2RHRA 3T1NA 2P27A 2ZIAA 4XIFA 2VXCA 1WZEA 1NDQA 4XUCA 1G6Q1 4RJLA 1G5TA 3DBRB 2R751 1GGNA 4YVFA 4EHIA 3GPDG 4DF3A 1FDSA 1CZRA 1K4KA 4CMGA 1SUSA 3R3VA 1J99A 5HILA 4PTZA 3GL9A 4PPQA 3K5PA 4OHRA 4X65B 1BRMA 3OCYA 1ZZGA 4NICA 1J8YF 3NEPX 3NNDA 4O08A 2F3UA 2WUVA 3PHBE 4AZ3A 1I2ZA 1AKRA 2X3YA 2P2CA 3FVQA 1UDCA 4TYYA 1QH1B 4YAWA 4DC0A 2AW3A 2JD1A 5CB0A 1KR5A 3H04A 1HQCA 4QJ4A 4E5NA 2GEJA 3AR9A 4R68A 4W5RA 3GU3A 1EFHA 2PWYA 3D4BA 5K8JB 1NNEA 5LQUA 5IFKA 5BWLA 3LZ6A 2D7DA 1WZNA 5HF9A 5E4TA 4YMUA 1KNQA 1CEXA 1L0BA 2CNBA 3FNBA 1T2AA 4HLCA 1D0IA 1CQZA 2QRQA 3EG5A 4WEOA 1K06A 2Z2YA 1ZH2A 1D6SA 2PS3A 1XVVA 2QF7A 5MGBA 4UHDA 4AQDA 4LE1A 1V1MA 1HLGA 4W6QA 2XA2A 4H1UA 4NG4A 5JCPA 1JJVA 3TQRA 2EW1A 3GK3A 1RXWA 3I5MA 1SC3A 4FEAA 3U3JA 1ML3A 2W5UA 4M1WA 1QHHB 4M6WB 4JL6A 1T6BY 1ECGA 2I1LA 3TMYA 1QORA 3BZBA 4ARZA 4BEBA 2IXGA 4QQFA 1VLLA 2F4NA 4FDTA 1R27A 3STXA 2HCFA 5I7HA 2JFWA 2NUTA 2DF8A 1OSNA 5ALNA 3NHUA 3WSWA 1F7UA 3BA1A 1EXWA 1S89A 2GLTA 1T3SA 3SLKA 3HDTA 1H5UA 2OFFA 4IS2A 4BFUA 5C8XA 3R7FA 2WSIA 4WNAA 4A6PA 1NVVQ 2ZOSA 2Z5LA 2CWDA 4HOYA 4L02A 4QU8A 5AW4A 1OB5A 4UM8B 3COVA 3NBUA 5JCOC 4TZ0A 4B7ZA 5GY7A 1JKMA 5KTMA 1JR6A 1U0NA 2O8DB 2NUBA 3GFVA 1J49A 3VX3A 5JEDA 2QORA 2UYQA 1WPRA 1Z0UA 3M6LA 3K0SA 1VQ1A 3S2YA 3FPAA 3MHTA 1W2WB 1ZGCA 3DEAA 3OICA 3T1QA 1MAWA 1WW8A 1Y4AE 1ZCAA 4DV1B 4B5KA 1ADJA 4DMRA 2J4CA 2V7TA 3QVKA 4DARA 3HVJA 1CR1A 1MQSA 4CG2A 4WLEA 3BT7A 1WP9A 2HK6A 1E9VA 2B25A 2WZQA 4YDQA 4RADA 2W58A 3UCEA 2IS4A 4M36A 1AGNA 1SHZA 2W8BB 2FPPB 4ND5A 5AK5A 1RZRA 3UW1A 1E7QA 2ZRQA 1UXJA 1YS1X 4P86A 2R6FA 1G7RA 3AF0A 1UKBA 2HMYB 3H9QA 4N5LA 4YJFA 1QG0A 1TVEA 2OBLA 3HXLA 3FKQA 1Z6YA 4FFNA 4JVSB 1XEXB 5HF5A 3UAOA 4ZKDA 1EVJA 3MHPA 1GYQA 1VE6A 3MJFA 4JQZA 1WV1A 3TSAA 4D82A 3SVTA 1P5HA 5ICSA 1RFGE 4RZ2A 1EGMB 1YS2X 3M6XA 4R5MA 1Z4IA 4NMHA 1DEXA 3U7RA 1JPUA 1XRSB 1O9BA 2WWGA 4IVQA 4CCYA 4EQ6B 3EOBI 1UEJA 3LQ1A 1EXMA 1PZHA 5AO9A 4RF3A 1UKVY 3JQEA 2HB6A 2FDRA 2H1LA 4J07A 2E87A 2J85A 4ONEA 2GESA 1GKIA 3QX8A 5GTDA 3GUVA 3RODA 5JRZA 3FHOA 5KSOA 1Z4QA 3R6LA 1YR6A 1YI0A 4LF5B 1YRHA 1R5NA 4JLVA 4X63A 3AEXA 3SHWA 1HYBA 3AR5A 2YZ7A 4ZC1A 3SJUA 3D4LA 3WMXA 2H2WA 1XXHB 3G3EA 3TVYA 4O25A 2IVZA 4F38A 1X38A 3CXUA 3KETA 1F2UA 1VPVA 1L7BA 2CZCA 2C3UA 2PUEA 4MWZA 4ZXFA 4MEJA 3FYTA 5BRNA 1ESCA 4RD3A 3RIMA 1XMOB 3S2UA 1E9EA 2BH9A 2K4MA 1QU2A 3SHQA 3W06A 1FDWA 5EE1A 1GVNB 4HYTA 3O8RA 3FOCA 5PNTA 1M6VB 2J9GA 1R0ZA 1NT4A 2DSNA 4OBEA 4LYDA 4AP5A 1NXSA 2I8CA 3L7AA 5IASA 2ZJ2A 3C6YA 9LDBA 2O48X 1X1SA 2PGNA 2VCYA 4UULA 3LQQA 1X7YA 1F8FA 4L22A 1NMYA 4MAFA 1FXUA 4MLCA 5EWMB 4BNHA 5DBOA 3PUWA 3PEEA 4DS3A 2XYQA 4Z99A 1FDIA 4JLBA 4EUHA 3IUNA 5CURA 3MOGA 4LYYA 3LMKA 2CXUA 3KTAB 2RAPA 3K30A 1JEYA 4WOPA 3M9XA 4PAGA 4P34A 3DWFA 4OB7A 2H8KA 1YCGA 3IEVA 4RENA 3N2GB 3C97A 3C4QA 3O8LA 5A3RA 5ALFA 1YZQA 2Z1NA 4KE7A 3JRNA 2QTFA 3L05A 4B4UA 4I9HA 1YE8A 1BJRE 2AX3A 1KYTA 4DMKA 1CRPA 4CMIB 3FGNA 4YT5A 3GD5A 1E6UA 1GZVA 2O50A 3ZG6A 3L82B 5ABPA 1RWKA 4CLHA 1HE4A 1FNSA 3LRPA 4L50A 3KDAA 4R4JA 3JZIA 5ALGA 1CUJA 3X2FA 5GADl 2XKKA 2C1EA 3G2IA 4NBRA 1KSHA 4WZ6A 4PO8A 4GX5A 5AI0A 1RVV1 3AKCA 3DD1A 4MR7A 5J2UB 2VBGA 4ZYZA 4MYDA 3WR5A 5AVRA 1XCGB 1PQYA 3B3JA 3OE1A 3OT1A 4XM0A 2HADA 1GADO 5EVCA 5FBVB 4HB4A 4G0MA 1PTKA 3MWKA 1T36B 1PWZA 1LVHA 2RC5A 4I5IA 4HNQA 4G1MB 2AE2A 1RPZA 1ZH4A 2ZQZA 4QJIA 3X1XA 4DUYB 1JUDA 4MDFA 1N1MA 3X43A 5I5GA 1JIJA 3RYTC 1T6ZA 1W4BA 1QZUA 1F48A 4MQ6A 4C7KA 1F4LA 4QGGA 2Y68A 4G97A 2E5LB 1JWAB 4XJVA 1BGXT 1XTTA 3LWZA 2Q6KA 1EQAA 5TQVA 1I3KA 4F2WA 2FWMX 3TR0A 1YOBA 1Z5NA 3ZTWA 2J4DA 4KDRA 4S1PA 2ZRKA 5FPQA 1HFKA 3HZRA 4QPJC 2R8ZA 3QX3A 3P0EA 2ZYWX 3TTWA 4CTKA 2CNOA 3DLCA 4QHSA 1G5HA 3BD6A 2PA3A 5F52A 3T8YA 4H27A 3WLAA 5K3SA 1K6MA 1GKYA 3DMGA 3RT9A 1SURA 1L1QA 2IHUA 3IPRA 3R9IA 5BR1A 5FI1B 6CHYA 1OXTA 4OOFA 1EE2A 1QR2A 1KY2A 2CLLB 4INPA 3N75A 5CT8A 3KT0A 3MF4A 1A7KA 3QKSA 1KYZA 3S55A 1JZQA 3MBOA 3TEFA 1YTUA 1NJ8A 1WHTB 2PMKA 2Q5EA 4I50F 3N6XA 3QLVC 4AJ1A 1GCOA 1OREA 1AF4A 3IQDB 4FFOA 4YP1A 1YWGO 3RR2A 4ER6A 1P4RA 3O8DA 4X62B 1EVIA 2D0DA 4IDAA 5E1DA 4YR9A 1YMUA 3BDAA 2BGJA 1T9DA 4E08A 3FOEC 4KWIA 5C1DA 2W70A 4JX9A 4PZ9A 2FSFA 3U7GA 2FPMA 2GHIA 3ZE9A 1RQGA 3ZHSA 3PTAA 3R7AA 3O8BA 3E27A 1AGRA 3CUKA 1X1TA 1JAHA 3LC1O 4YRLA 1NVAA 3PXGA 5D87A 2AV6A 1ZGAA 4MA4A 5DI9A 5C7IO 3U16A 1ZMRA 2OQRA 1DX6A 4TMXA 4W1PA 5G53C 5LDHA 2FRDC 2A5DA 3O4JA 1U3FA 4IKOA 5FUWA 3RSOA 3ZVRA 2JIZA 3C87A 1YRQA 3JYQA 2FMUA 4BKQA 1BMTA 3HKDB 1NXXA 3H5AA 3U4DA 1IQUA 4JI2B 3LWBA 3EQ6A 3Q11A 4AY2A 3C6MA 4RZSA 2BCJQ 5KWSA 4MIOA 4QWMA 1RFLA 2QUAA 3BYZA 3GRKA 4RIFA 2CVZA 1YFJA 3O8OA 3VO9A 3LIPA 1QGUB 4XDYA 3M4JA 1NF3A 4WFJA 4CM4B 3ZE8A 4B17A 4ACBA 2B82A 2BHRA 2L42A 1WCWA 2G1UA 3FLMA 3PWSA 2O8EB 1GYRA 1L5WA 4QUGA 3UF0A 1WQ4A 3OD5A 1X8LA 2IHVA 5TVKA 1NX6A 2DM6A 2L18A 1WMEA 4DLPA 1DAEA 3D5QA 3M6MD 3FZNA 4R41A 5CA1B 4I3HA 2H1CA 2Q5LA 1D5CA 3K53A 3OTWA 3G9TA 3HA3A 4KQEA 2ISQA 3HB5X 2E3JA 2ZI7A 3PF8A 3NWJA 2WFAA 4I7EA 1KOJA 2FN7A 2A5JA 1ZN9A 2GJ8A 3EZ2A 5A3JA 5EJAA 1TZ2A 4RPCA 4Q5IA 3ZHRA 3VOAA 1UJNA 1LW6E 4ZAWA 3ROZA 3KD3A 2DCMA 1F9EA 1VL1A 1P6XA 3L7LA 4L1KA 1E96A 5IYZB 3RV4A 2P6PA 4NHEA 2CFSA 3W9UA 2FZLA 4WIAA 3MIIA 1SC6A 4QG7A 3ZWOA 2E37A 2MHCA 2QDKA 4TM8A 2PGIA 3T9BA 2VTBA 3TIXB 1IPEA 1G0OA 3AZPA 4P84A 5BURA 2V5AA 2JS7A 3LNTA 3N2IA 4HG2A 3ROTA 3HEBA 8ATCA 5J47A 5LQCA 3SC6A 1M1XB 3OAAD 4L15A 1JAYA 2KLBA 4RA6B 1EYZA 3T3EA 1Q91A 2AUTA 2XMRA 1HDGO 4DY6A 3PICA 2FMIA 2Z1MA 1CS4C 5G0WA 5BQPA 4MDYA 3TH5A 2VJAA 3TUZC 4L8YA 5LNK1 2DFKB 3I5YA 3EUFA 1CUYA 1JLKA 1SCJA 1WS6A 2VDRB 5CLJA 5BR8B 3EF3A 2O5CA 3VH1A 3V8MA 4GRDA 1V16A 3BWCA 3OC6A 4QJ3A 4REMA 5C5EA 5SICE 4ZQGA 3SKVA 3K71B 1GLNA 2Q7XA 1Z25A 4KWEA 3RLFA 1KYQA 1ENOA 2MT9A 5LU9A 2NNLD 4JI5B 5IJ0B 2OP0A 1O6CA 1UDAA 1BX1A 1I10A 1W59A 2FLVA 1DZ3A 2YXDA 3LCCA 4LNUA 4WJKB 5FA5A 4YX9A 3EXG2 3J81A 4O4IB 1ONPA 4R6WA 3ND9A 3MJSA 3VSCA 2ODBA 3F6EX 3LUCA 1JSCA 1G60A 2JGFA 3NBKA 3VTKA 3DHNA 3O2JA 1N4AA 1TQDA 3LCMA 3H5WA 1RCUA 2AIRA 2JFXA 3AUKA 3D31A 4P3PA 4D3DA 5L3VA 4KXVA 3UMYA 1SUAA 3AVWA 3GFOA 4LHSA 3DJYA 3LDAA 4TWAA 5ALLA 5FUVA 5C8DA 5I7EA 1JH9A 2WF8A 1NJ5A 4MKGA 1AS0A 1AKEA 2OTCA 4DXAA 2HWYA 4OMUA 3RSZA 4ENVA 1PNRA 1XRQA 2EWMA 3BKWA 2IV3A 2AZ4A 2F1HA 4X8LA 1HF3A 3OPYB 1X14A 2DTEA 5AFSA 2O2IA 3AERB 3HB0A 2XUFA 1UK8A 1RWQA 4P4LA 1ZMXA 3KALA 3TEJA 3KR2A 3TM5A 4RTKA 2PE5A 1C3LA 2A9KA 2DC1A 3BRQA 4D8XA 3JYPA 2J07A 1Z75A 1Z0SA 3O0DA 4HQNA 4NFHA 5DCLA 2EYUA 4QYWA 3ZK7A 2ZBQA 1W19A 2ZUBA 3OM0A 2WF6A 1CFJA 3U4GA 4AP9A 1XV5A 2JRLA 3F67A 3GT0A 4J0KA 4PF1A 2IZZA 1ZG3A 1O9GA 5CG2A 2APJA 4Y98A 2D2VA 1AKVA 4MS1A 4UU8A 2IF2A 2RGGA 1JMKC 1FX1A 1PK9A 2BGWA 3RUAA 1AUVA 2FUKA 1EJ6A 1CUSA 1NW9B 1T2CA 3BRSA 4G9EA 1VMIA 3GV0A 5E7IA 3OCUA 5FTKA 3NCHA 3WL4A 4P9NA 2JLXA 1WOYA 4H3HB 3DVLA 2JAQA 3LPMA 3PJDA 4G4JA 2FF7A 4OGGA 2YJGA 1JEJA 1BFDA 1DKUA 3KB2A 1ELOA 3NTUA 4I4TB 3TI9A 3JVEA 2NQ2C 2VHEA 3HZHA 3P8ZA 4OH1A 4B1FA 3FUWA 4Q48A 2GK3A 1O97D 1BOFA 1H0RA 1SKQA 3WS7A 5CLHA 3RFVA 2QTTA 2JGLA 1M6HA 3LP5A 4ZZ3A 1VKRA 4L0QA 2GYWA 3IL2A 4YH1A 1C7FA 5LWHA 4GX1A 3QEAZ 1XB2A 3HWSA 3L0YA 3HDVA 3QF7A 1H2FA 5BWMA 4E13A 3C8HA 1JEQB 4S1WA 1U0EA 3QITA 5FNVA 4X66B 4J7AA 1FRNA 2V58A 4RLSA 7GPBA 4D9JA 3OEWA 4Q21A 3UCFA 2MMGA 5L4NA 4OQLA 2A5LA 1NE7A 2P2YA 4NV0A 3U09A 4E2YA 3IIEA 4S2EA 1I0ZA 4B6OA 3V7NA 1PLKA 1G3MA 2ATEA 2AG0A 5A4JA 2ZYDA 4TTPA 4LHYA 3HCEA 2QYHA 3K6RA 4B09A 2VFAA 2IBMA 3VISA 5CT9A 3GNQA 1N77A 3E3MA 5D8DA 3MTBA 4F3YA 5BVGA 3ZV3A 1XGKA 3HFGA 2FOXA 4Z7JA 4OQYA 1G59A 3QKTA 1RJ9A 3FPHA 4UHJA 1ZINA 2JFBA 2XX3A 1R7RA 3PNYA 2F67A 3KJHA 3MOSA 1XZPA 1AQUA 1XL0A 3H4IA 1JFTA 2X15A 2R5FA 3WRWA 4ESEA 4B73A 4AJOA 4E09A 2VJYA 2JAHA 3MAAC 4TUYB 2AD5A 4BV2A 4R71A 4JI6B 4KO3S 2WU1A 1E62A 2JAUA 3BE4A 1YS9A 2VP6A 3AEQA 3KHSA 2AJ8A 1NV9A 1VFNA 3BULA 3PEFA 2YV1A 1KEZA 1CJCA 4GR5A 4NVRA 4KREA 1NNSA 1BVUA 2P0EA 2Q27A 4ETWA 1EINA 3WXMA 3M6AA 4GE0A 4II7A 4MPRA 5IN5A 4WDRA 3OJLA 4CI9A 4F4IA 3I5XA 4Y9RA 4LDZA 3VNUA 3HG7A 4LJRA 5DI3A 3ANLA 2RHDA 3LP6A 4IUDS 2VRBA 1EFVB 4DNPA 1H2WA 5FO0A 2GBFA 4J43A 1JYFA 1ZIPA 1GRVA 2PG3A 4LY0A 4YUXA 1JSXA 1F0PA 5CMLA 3TZEA 4DY4A 1MEOA 5TNXA 1GSOA 2QLNA 2Q62A 2R8RA 2GYUA 2I8LA 4AUNA 2UVPA 3TQCA 3PRYA 5BN4B 1H69A 2OKGA 3ZIAD 5E3HA 3PFGA 1N9ZA 2CMDA 4HUQA 5DIFA 2ID8A 5AYVA 2QM3A 1E8MA 2VATA 2XA1A 3SY8A 1QB7A 2DWCA 1E4EA 4N5IX 4Z7QB 3FWYA 1T0BA 3B51X 3NAQA 4QVGA 2C00A 2JBAB 1ZVJA 3SR4A 1G41A 1YKFA 4HXEB 1XZKA 3TZ6A 3WNCA 3AVYA 4FZVA 3O93A 1KJNA 4QXAA 4XYMA 5H9VA 1LK5A 3PLAE 3ANSA 3C5HA 1ATZA 4B2LA 4NIMA 4BKUA 3LX5A 3DZIA 4K1XA 1PEAA 5JAHA 2BD0A 3B3FA 4Y30A 1BEEA 4M1ZA 4LY9A 1J25A 2XBUA 3I92A 1R9GA 1H94A 4BMNA 3WSVA 2P2GA 3NWBA 3GLHB 5BOSA 3P9QA 1DRJA 4LAFA 2IS6A 5EXXA 1NVWQ 5HDBB 3T9EA 2H2HA 4WKGA 2BFCA 3B52X 4MUEA 3U39A 1FX0B 4HK4A 3OU7A 2VLIA 2FQYA 4F3KA 2VDVE 4CL0A 2XQFA 4RTOA 3OKPA 3VYRB 4D0NA 1PHRA 5IAJA 4KO8A 4P4NA 2JLSA 5L6MB 2XZOA 1TQHA 3RT1A 1W94A 3GAZA 3OUTA 2PUCA 4HRVA 2B4AA 2WKWA 1JJBA 4JP3A 2X1LA 5F3RA 5AM2A 1UC5B 1XMQB 3K9WA 2IYEA 4HSEA 4CGZA 1CF4A 1KH2A 3L7BA 1QFZA 4GPIB 1JFVA 3D1VA 3LY8A 4UQPA 2VSQA 1E7WA 3NWPA 2OV8A 3A4NA 1KKUA 3QEKA 5EZ6B 4P4SB 3K5WA 2ZM6B 4KYUA 3E3LA 4Q4DA 4Y2SA 4WY2A 2O4UX 1P7WA 2FNAA 5JHHB 2HJRA 4R9RA 2WWYA 3VXKA 3TJZA 1DJLA 3WWZA 2ZSKA 1MF7A 1EXNA 1SXHA 3PC3A 1VE5A 4TRMA 1PG5A 4LGCA 1PL8A 4QC2A 3G2QA 4R2KA 4UD2A 1L5YA 4JZKA 3OLZA 3I6BA 2HUNA 2DETA 3L4BA 1KJ8A 2VYVA 5EPOA 2H9AA 2E4AA 1BHO1 5I8ZA 3EMVA 4CIYA 4HAVA 5KMGB 3HQ4O 1K7CA 1PDOA 5FJIA 4UZSA 1PJRA 1ZRMA 4L4YA 5KVSA 1YV9A 3R7LA 2BKEA 4GPTA 3MRSA 4NZOA 1KDYA 1N1DA 1R5OA 1H8EA 4DC9A 4CV0A 4UTXA 4ZQHA 4BNLA 3HI4A 4J3JA 3HADA 4Y6OA 3SBOA 5EJEA 1DQSA 4CM6A 2R8YA 3PC8A 3DE3X 5AD1A 1DRUA 1XP8A 2HA0A 4KBGA 1F60A 2PZGA 1KYXA 1E2IA 1IM8A 1AGXA 1C41A 5GONB 3OCXA 1QHSA 1JHAA 2YJZA 3BE8A 5GJCA 1R6TA 4EJSC 1V45E 1LK7A 3TDMA 1PJTA 1QIEA 1FXWA 1GHTA 4OHBA 4AB1A 2XWBF 2ZJ5A 4DQLA 5EWJA 4R0MA 4YUZA 5I6DA 4KB5A 3K6JA 1P45A 4IDOA 2YNMD 1FLNA 4O6VA 3KT8A 3LUGA 4LCEA 3UB2A 5JYDA 2CYBA 1D4FA 3BGVA 1FVOA 3AJ9A 3H9UA 1P8AA 3BRCA 1N9GA 4KGDA 4UUOA 4Z8XA 2IUEA 2P9JA 5SZIA 2OXRA 4DCPA 4PIVA 5JY6A 4MB6A 4A8HA 4EY3A 3IJEB 4JMLA 3BXXA 3URMA 3SVLA 2DUUA 4ZAFA 3AF5A 3C45A 2JEOA 4B7AA 2C5SA 1VJCA 2E4UA 4YN3A 2H11A 2GA9A 2HQRA 4DMLA 3IEMA 3KQOA 1IWOA 1QO7A 1OH6A 1A1SA 4RGYA 4RFSA 2AB0A 2OFWA 1JEAA 1XDDA 1PHPA 4QLAA 3PNSA 4Q05A 2AR7A 1XLUA 3QE4A 4C2AA 3W5CA 2BISA 5M04A 4EW2A 3GLSA 1X80A 3KAKA 2I7DA 2XQJA 2JGRA 2VT7A 3HYRA 5F78A 4BRSA 1RLMA 3UC9A 2NYVA 4G23A 2VQEB 5LD2B 4KKVA 4CL2A 2BHLA 3S6JA 1MHTA 4IJKA 3ZLBA 2G0TA 5ALDA 2ES4A 3RU7A 3SHOA 4BTLA 5B4VA 1E3MA 2ORIA 2O8VA 5P21A 2HA7A 5F3DA 4S3MA 1BRTA 4M89A 3T7DA 1JYEA 2LVBA 4Q7JB 1U3UA 3V8QA 3K05A 4I3GA 1LWNA 4IO0A 1KP2A 1CUHA 2XTAA 1Q84A 3OA2A 4HQLA 2H1RA 5EOVA 1GL9B 3SX4A 3P2OA 1ZOSA 4C0QC 1JMYA 1UAYA 4FGZA 1CEEA 2GN1A 2OC4A 1P1IA 2WPDA 4YRGA 2XSZA 3B6EA 2D3TA 2Q3MA 2DCUA 2QSUA 3O26A 3AF4A 3R09A 3KQMA 4K8RB 4R1LA 1AHNA 3OFNA 3QXXA 2V6JA 1DQNA 2F7SA 3WP0A 4QDTA 2RGNC 4U2GA 2DR0A 5JD3A 1W9HA 4R9VA 3G89A 4GECA 2GD2A 4YT4A 3TBHA 3ETCA 1V2HE 5KYNA 4L73A 1Z56C 3LGXA 2WW8A 3Q1LA 3ZU3A 3QYPA 4QLOA 3ZGYA 1P19A 4JODA 2QRKA 4L0CA 4U7PB 3TLGB 2HBYA 2ATVA 2D2FA 3NASA 2DBYA 1QYVA 3KFVA 3TW0A 1DWQA 1VG1A 3GJYA 2AVNA 2FMTA 5CVTA 4BS9A 3ZS8A 4NEQA 5CU7A 3DMFA 3TM4A 1PD1A 2FEKA 2ANBA 3LY5A 1V95A 2VNSA 3D6TB 5T8KC 4B4KA 5H3LA 3EGCA 3EEOA 1YA8A 1QHEA 3CN9A 3SEQA 3OU2A 1DBQA 4DLSA 3MJEA 5EMKA 3FMVA 2FJUA 3WLEA 2GBIA 4KLZA 4BZXA 5TF4A 4FYKA 1X42A 3OIYA 4K05A 5CH5A 1GARA 5HTOA 1CZUA 4PCAA 1IH8A 4LOHA 4UUAA 3SE7A 3ZD6A 4CG1A 3NAGA 5TMBA 5H4GA 3QUSA 4LRWA 1G7SA 1KPHA 3QFTA 3AFMA 4V0NA 2NTVA 4EG4A 4GW3A 2PSFA 4AYXA 1P1KA 3HPQA 1QH0A 3AF2A 4MKZA 5DT2A 4AUKA 4EUFA 1L4NA 3SIXA 3V1KA 1SBIA 1K3UB 1ZONA 3KB8A 2EEZA 3C48A 5AW6A 1FFYA 1ZICA 4NU6A 4KLRA 1ZK4A 4UM5A 1S2DA 3B2NA 1ISPA 2G4CA 2WDPA 5EEHA 3UJAA 3L7KA 2VUHB 4DUZB 4R81A 5I47A 3O38A 5EXEA 4IQ8A 2FEOA 4H6XA 1SQ6A 1EQ2A 2HSDA 3AFNA 3EXG1 2EGHA 1XTBA 3FXAA 2Z58A 1DDOA 4UNQA 1FZTA 4G5FA 3T1OA 5DXFA 1HETA 1YT5A 3R0VA 1Y8RB 1G8HA 1TYCA 2GZHA 2PTHA 2XE8A 3JYNA 4LBYA 4MRVA 5DEOA 4MWTA 4HDMB 5C46F 4HN9A 1JPJA 4DLKA 5JMOA 4ZVLA 2IZ0A 4JHXA 5FLXA 1FNCA 1R6DA 2Y99A 3AI1A 4O4JF 1ZH8A 3LBYA 1I0IA 1TMOA 1VL6A 4Q82A 3SR3A 3AKZA 5JJLA 1PT6A 2O57A 1Z8HA 3SYTA 4EY8A 4KO4S 1E61A 4M0LA 1AMUA 3KIPA 4TL9A 1J5EB 3W4KA 4FYIA 2PSJA 1XYYA 4UEQA 5I4BA 3FGZA 3S4YA 2ACVA 3PPXA 2BI8A 3VR5D 2AK2A 4HQRA 3ZGNA 4C1BA 1DC6A 2QN1A 2YFQA 1FMLA 1O5OA 4MH0R 4XPIA 5KNCH 5KYYA 5CD9A 3D9QX 3ZLTA 4C76A 3UMVA 2KJQA 3FLEA 4NCJA 4I9FA 3V9PA 3FRJA 2QMYA 4HRXA 4Y9TA 5DBFA 3WKCA 2UU9B 4V3CA 4AY4A 4B4WA 5HX7A 3DMTA 1JRLA 2MWMA 4AJLA 3WK6A 1KJZA 1DV2A 4GOND 1Z13A 4U02A 5AKEA 4EJFA 2QL5A 1YB5A 2D4HA 3QHAA 2W6OA 1MW8X 1OWNA 3K9HA 5A9SA 3EFHA 1O97C 4O4HB 2EVWX 4RFLA 2QS9A 3E1SA 1W8IA 2VK4A 3AQ4A 4GOKA 4JASB 4ZVQA 3SMVA 1W0JA 4A0QA 4A7PA 5HUJA 5ITSA 2OV6A 4UBIA 5EUQB 4NLLA 2DPLA 5F9HA 3G1WA 1IQPA 5AVZA 2ZDQA 4KQFA 3LRXA 5MN5A 4M0EA 2JZNA 3QU4A 4A2CA 3LCVB 4PZEA 4GOOD 3HC7A 4K3UA 4R2WA 3C3DA 1W36B 4XSHA 5DT9A 3T9CA 4OI0A 4QAJA 4RNDB 4IIXA 3WFZA 1FPQA 3HSSA 4RX1A 3BIOA 5FFNA 3IP6A 4AS3A 4ZYLA 2O3UA 1RM5A 2JFFA 2QE7D 2FP4B 1YZVA 2O6LA 4PLVA 4J0JA 4RH3A 3RSLA 1OFIA 3GZNB 3A1WA 1P1RA 5KX5B 1BW9B 3MINB 1Q95A 1FSSA 3PXEA 4L3VA 1IHOA 3EH1A 1VCNA 2IT1A 2PLFA 3B1FA 5LR6A 1EK6A 2OZVA 4V03A 4IHJF 2K7FA 3E9ZA 2ZREA 1ZXLA 3EPRA 4FK8A 1EFKA 5HDQA 1AOXA 2ET6A 3STVA 1UMKA 3O9ZA 4Y3UA 3KNZA 1RLIA 2HEIA 2BM9A 1W30A 3FWZA 3OG9A 2IYUA 4K7JA 4CIAA 1X1BA 1O54A 2CFCA 4RH0A 3D64A 4MCIA 5EZYB 2VOEA 5E1BA 3DOIA 6ABPA 2CSXA 4Z1MA 3ZHBA 1K89A 1BXGB 1NDUA 2F8MA 4RVUA 4WBNA 3M7IA 4RLFA 3BWVA 4DM7A 4ZMBA 3OPVA 1NVVR 5LQRA 4Q4HA 1XAGA 2NG1A 5F4BA 4MHSA 3PQEA 3IFSA 3ROFA 3AT1A 1K08A 2ZBRA 5JTTA 3WY9A 3B13B 2YHIA 1LV7A 3IUYA 3GGPA 3VAZA 2O3RA 4YECA 3UNXA 3ZD9A 4QPPA 1Z7WA 2ZB4A 3QOYA 1O7JA 2DPMA 4DGQA 4CKZA 2HMAA 3QU9A 1XDSA 2ZUFA 1E89A 2GAFA 1N0IA 2ORWA 2BR3A 1FRFS 1FS5A 4WL0A 2OGWA 1JQ5A 3ZPXA 5FUQA 1GG5A 3DYIA 2V97A 3KCQA 3N2KA 2FCAA 1TU0A 4PG7A 4ZANA 3V1UA 2Q3BA 1TM3E 4K2AA 1OXSC 3OPNA 2H52A 2Q0QA 4RA9B 5A04A 3PL1A 2PS0A 1T1GA 1N6PA 2N1BA 2PWBA 1U9ZA 2Z2XA 3AI3A 2FY8A 3FTPA 4R6XA 4KX5A 4ND8A 1QYWA 4UW9A 3MBIA 2J9RA 2PSSA 3CW2A 3BEOA 3HH8A 3R40A 2QXUA 4IO1A 1XPJA 4NONA 4WEQA 1ENYA 2NMVA 1YRYE 2VT3A 3TLYA 1K3FA 3MK31 3UJHA 2ADFA 4L8LA 4QXPA 5C8VA 1M2VA 4RHEA 5JSQA 3VTAA 3I05A 1VP9A 1R6VA 2R1TA 3IT0A 2IE0A 4V1CA 3VU8A 3QNUA 3AIKA 4P38A 4AUEA 4AJIA 1RU3A 2PRZA 4X90A 2MCFA 4BQOA 2HHLA 4ZEOA 1RLJA 2MYNA 2AOTA 2VYFA 1DELA 1TAHA 4WCFC 3MCUA 1CDZA 5FLYA 3LDHA 1GT6A 3RYIA 2RKWA 4FWTA 3SF0A 1PTJC 1SBCA 1TKCA 1G2QA 3EXIA 4PGHA 5HE9A 2HQ1A 3WV4A 4HYQA 4YYEA 1SUDA 1DFGA 2OCXA 4I81A 4F60A 4DMCA 4KQJA 4KGXA 2GPWA 3PXBA 2NZYA 2Q5FA 3EUWA 3RYFA 4QGHA 2WSBA 2ZJZA 1XAJA 2YBDA 3BXHA 3PBKA 3X3HA 5ICEA 3IT2A 3WK8A 3IBCA 5BN1A 4WLUA 5FV4A 2OHJA 2B4YA 5TPZA 3ZQJA 2ZUDA 4IMJB 4K5QA 5K99A 3DM5A 2I7CA 3T4PA 4X6LA 6NULA 2NSLA 3VNBA 1OLSA 2CLSA 2EGUA 2W6MA 2VDWB 4HPJB 3AIMA 3FB4A 2F64A 3L02A 3UFXA 4RE6A 4BQIA 2OQ2A 3G0OA 1LGYA 2B92A 5CDYA 1IPHA 3G9XA 3RAPR 4DV5B 3CF0A 4Q34A 1AHPA 1NTRA 3L5OA 1J70A 2EF0A 3GGDA 1XZGA 1SM4A 3AK4A 4RQUA 4XTCS 3FPSA 4KBYA 3UTCA 2H4WA 2P5YA 1CJSA 3IQWA 1SK9A 4TLEA 1KBQA 1MENA 3KL4A 1Z5UA 1ZK3A 4XX1A 3WNQA 4KK4A 4HDNB 5CEFA 3S1AB 3IMGA 3KSMA 4LSZA 3T3MB 1YJ8A 4RKFA 2NQ8A 4YIHA 3R0IA 5EFZA 4GE3A 1M2HA 1QIHA 4U0JA 4J0QA 5EGSA 3PK0A 3K1AB 3K0KA 4E5VA 4TZTA 4ZZIA 2PV0A 1DNPA 2NQTA 4YDHB 2JI4A 4MI1A 4F84A 1W49A 1JF8A 3L0CA 2I4OA 1T4CB 3ESDA 5IARA 4IY1A 4G41A 1CRLA 4RTNA 1W1IA 5DP1A 4PCLA 1VRVA 4EAAA 1NG1A 3GFQA 5B6IA 1K7YA 3AM1A 4UCXA 2ZUCA 1HEUA 3N3BC 1CUVA 3UW3A 2E6KA 3LFTA 3EZ6A 4BASA 5ADUS 1CUXA 1QIKA 2GCPA 3FFTA 3QELB 4OHOA 3UK0A 2FPIB 2R7NA 1YACA 2GAJA 4JD5A 2VDPB 3AVVA 3WZLA 4M0DA 1C9YA 2VSXA 1WY5A 2EKDA 3OFKA 4HVAA 4IDPA 1BA3A 3GRRA 3NM5A 3VZCA 4L3OA 3H5OA 2Z3WA 4O1HA 1NY5A 2LKCA 3GUHA 1AUXA 2QIOA 2FX2A 4RM2A 3NV9A 1AV6A 5L53A 1A9SA 2W90A 2FR8C 4PPNA 4WXYB 2PT5A 1Y5LA 1SO8A 5KOJB 1V5IA 1PL7A 4JUAA 1Q7CA 2OM6A 3K8OE 1E1KA 1A4RA 3CV3A 3NOVA 1SU7A 4HFMA 4PC2A 2CYCA 1CVIA 1Z2DA 4R1QA 1QHIA 1QH8A 3IAUA 4G1UC 4IQ4A 3DVRX 5ETJA 1IK6A 3DONA 2LGJA 3OCZA 1BMQA 4IMPA 4DIEA 1N6RA 3I42A 1ILWA 5JOQA 4N41A 1D2CA 1E9CA 2MR6A 4FEGA 4RL4A 2PEYA 4R3UC 3UKOA 4YMTA 1RIIA 5HZMA 5DU2A 5GZ3A 4JNCA 3RREA 5JEEA 3AJDA 3DLBA 2WSSA 2XWQA 3PXUA 4BFZA 4BX2A 1I7DA 2TS1A 2VWHA 2YJ3A 2EJWA 1OHHD 1BS9A 3PFWO 4IGEA 4NOLA 4OHFA 4Y8VA 1KI8A 5LP6B 2DWOA 3WYGA 1WPXA 2UVQA 3Q40A 5SY6A 3QE3A 5H68A 3FYUA 4YJ3A 3JQFC 3KZOA 5BMOA 1WLYA 2CNWD 3D4OA 4G07A 2GS9A 1XZHA 4FN5A 2AR0A 2A9RA 4R1OA 3OQ1A 3GEGA 3P9YA 3M0EA 1PUIA 4HB2A 5FR1A 1V3UA 4UEJA 2B7BA 1GAJA 1XRLA 2PMBA 2QN7A 5MN6A 1NF8A 1C3OA 4MEBA 5G1NA 4BBAA 1J2RA 2YV2A 4PX9A 3HBLA 5K3EA 5E4JA 4BNZA 2NXWA 2ODAA 3E23A 3O2SB 1AO3A 4G24A 1MIOB 1W6UA 4F21A 4MHOA 3PPIA 1GZ4A 1L8XA 2GEDA 3P9ZA 4OJNA 5FJJA 2ZG6A 1A5TA 3SQDA 3MMXA 2JFPA 2PKXA 4QQRA 4KIUA 4BHTA 2NZ8A 4PXAA 4EKYA 1FUUA 1KJ9A 5KDLA 1MRSA 3DPUA 1USGA 2QI9C 2ZSFA 3BMQB 2VP3A 4KPUB 2AJBA 1A2BA 2QVLA 3ZDDA 2PJRA 1XU9A 4F6RA 1MQAA 2DX7A 4ZO6A 4LZJA 4AL4A 1EP9A 2CXNA 3STTA 3EGXA 1TIPA 2X77A 4KQMA 1G55A 1WVMA 3KRTA 4NP6A 3P19A 2QGNA 1TYBE 4J16C 3CLRD 3MRXA 4FKMA 3VDNB 2IP4A 1ZLYA 2Q8NA 3B1JA 4V0KA 2CE2X 2HTFA 4AICA 5DNWA 1UBLS 1J09A 2CK3A 3C14C 3DBOB 3R3UA 4A27A 3SJ7A 3EVDA 1NMSA 3DFFA 2ZT5A 1J8FA 2POQX 4EB8A 3L6OO 4JKYA 1M5RA 1FYXA 5K05A 2NZ2A 5CA0A 2IA5A 2A3RA 1BMFA 3INNA 3Q5EA 1Y3AA 4JXJA 3IALA 2O2GA 3PRKE 5BUCA 2BGUA 2V55B 4MW2A 1XD2A 4HFJA 3LXMA 2O52A 1GA1A 3AVTA 2EFCB 3W6NA 4OXXA 3QA3E 1BWQA 2Y0BA 4JLNA 2HC9A 2IYTA 2YYSA 3CWZA 4LWQA 4OQFA 5FWYB 3TQOA 1RHRA 1R18A 2ERYA 1GL7A 4WKNA 4CLOB 2IZ6A 1YKGA 2WIJA 4I1OA 4ND3A 3ZZNA 3GXOA 1APBA 2FFQA 1U0OC 2P9BA 1NF9A 2W0MA 2X6QA 2XEDA 1HWYA 3TGLA 1KK1A 2A7XA 2O2YA 3A26A 2MDTA 3LBHA 5ALIA 1P74A 3W5HA 4CF5A 4NL4H 1FQKA 2GZRA 2IYQA 1JZSA 1HRDA 3D7SA 4YWHA 4O2BF 4M55A 4U4AA 1A2KC 5IKEA 4YPVA 3E35A 2ZWPA 3L8CA 3QY0A 1SPBS 5IKXA 2FWPA 3FROA 2F9MA 4K9MA 1QKKA 3MWDB 4U7HA 2C31A 3E7WA 3HI6A 5ELLA 1D7AA 2WQ7A 2AG8A 1R64A 3EVEA 4S2UA 3F90A 1VJ5A 2E4XA 4H59A 3V4OA 4NEHB 4CTMA 4I8IA 3J7TA 3DXZA 3C3WA 4E14A 3UYLA 3C3BA 1A04A 1UPTA 3M5DA 2OORA 1TUBB 1E2PA 3ABZA 4RNCA 4YRFA 4ZOLF 2NVUB 3VR6H 4CMJA 2GXAA 4MVJP 2FSHA 1PFUA 2QRHA 1ODIA 2GRAA 2P5UA 2PBLA 2XMBA 2XXBA 2OSBA 4G81A 4ZVKA 2CL6X 2ODWA 3K92A 4RABA 3ZYZA 1NI5A 2MSCB 1W25A 3SFZA 3ZUPA 1OMOA 4XGNA 3F7MA 3A6GA 1UZMA 3IQIX 4IM7A 2UUPA 5IJAA 4QOGA 2Q7DA 1NNLA 4GZ5A 1Y1SA 3FF4A 4MX8A 3OFVA 2WI8A 5FD8A 3RQIA 4QT4A 3U61B 1QP7A 3PGJA 2HJWA 4XWOA 4KN8A 2QR5A 5E0KB 3M1IA 1N4DA 1N0UA 2D1YA 4M9ZA 5E6RA 4KUGA 4TV8B 5E4YA 4J29A 5HGXA 1U98A 2SNIE 4JLPA 4MUNA 1FTGA 3NCTA 1D6NA 4D9BA 3W4JA 4XXHA 3IQFA 1DXYA 2A33A 2A9VA 4MPTA 4PTYA 3G7NA 3SD7A 1GZ7A 2HZBA 5BT9A 3RFUA 1C3EA 2JDID 5INTA 4P33A 1SQSA 2FJ0A 3B60A 4G4SP 1RD4A 3AHFA 1XMIA 1E2JA 5H02A 3S44A 1PJCA 3GLIE 1TTQB 2HPHA 3GJ6A 1OZ0A 2ZIFA 4ARAA 1P5JA 5AQEA 5KDDA 3NHLA 3R9XA 2RHCA 1HYEA 1OFUX 2H7XA 4HB3A 3D8TA 3PR2B 4GZLA 2Y6VA 1G3UA 1RCFA 2C58A 2YV5A 3REGA 3WLFA 2NTYC 1V7CA 4CN9A 1E3SA 2IPLA 5KJEA 2VPXA 4BJ6A 3CZRA 4IGFA 3DTNA 3MZ0A 3RJZA 4DNXA 4L95C 2RB5A 3LQ4A 4V24A 4DLBA 1QAQA 1K3TA 4I1UA 3D0KA 1DWOA 3V2UA 2I6QA 3QY9A 3D8RA 2OEPA 4FILA 4BRZA 1IBKB 1GWNA 1FE8A 1S8OA 2OZLB 3QPAA 4MQLA 1XCLA 4OFWA 3NVAA 3SP1A 2BEUA 4NK4A 3FGPA 1NMQA 2QJRA 3ZR4B 5AJUA 2OB1A 1N2IA 3EXHC 4MWGA 4BFXA 1PZEA 1IDOA 8AT1A 4XQGA 2BEVA 5AOVA 1PZFA 3RKUA 4PM4A 2SICE 3ULKA 1IBCA 3IIKA 1E9RA 2AFIE 2VZ8A 4GC5A 1WXXA 4CDMA 5KCMA 4EY7A 2HIMA 2UXCB 3L9XA 4MB0A 3RNOA 2DHEA 2CYAA 1HMPA 3HO8A 5IANA 1NDHA 3PD7A 4G2TA 1JKFA 1OI4A 1IJFA 1KI6A 2IXDA 4PVCA 3ZJ5A 1U2RA 2F1JA 4I1RA 5K3BA 4EELA 1XVLA 1EGAA 3A4LA 3O1IC 3TOZA 2J0UA 1CC1S 3UJBA 1TCCA 2VBFA 1GKUB 1GITA 2QQEA 1NYQA 4UUMA 5CK5A 2X40A 3CVXA 1N6KA 1D2MA 2VQSA 1LJUA 3Q2KA 1M34B 3OKFA 3IKVA 2WB2A 4H4DA 5BSMA 4DLZA 2YWGA 3F73A 1J39A 4CQJA 1OKKD 3F9IA 4AY5A 3LAWA 2PKCA 3WMGA 4INOA 5BWCA 3RAEC 2DWPA 2J3QA 2BRUA 4N82A 3VJMA 3RBZA 4XQEA 2CL0X 4FKZA 1NOJA 1SKYE 1Z47A 3TGWA 5H81A 3F2VA 1UM9B 3AUSA 1N7HA 3LWDA 2OMKA 4BV3A 4DRYA 3I1YA 4OK6A 4C03A 2PJUA 3ZTTA 3IE1A 6AT1A 1RR6A 4JVMA 5LBUA 1VKJA 9GPBA 2DJIA 4MQUA 3BTVA 3V4FA 2ZRAA 2WY2D 2Q4TA 3ROKA 3LLUA 1MG5A 4DWOA 4NYIR 5AUQA 4HLQB 4GO1A 4XJSA 5SZKB 4TMWA 2PU7A 3SEAA 5FBKA 3ZXUB 4JXXA 5BUSA 4YJHB 4L16A 1HDEA 2GR9A 5T4HA 1XKLA 1J22A 1W88A 4L6IA 2ZRJA 5KYWB 3KVOA 3U44B 1NRWA 1RE0A 3PGKA 4X6XA 1VM6A 5LXTB 1OGYA 4LVOA 1D9XA 5EHQA 4LF8B 1IY2A 4JDUA 1A8SA 5D01A 4QSHA 4DIUA 4FR0A 4QJBA 1E6MA 4RK0A 2ZRLA 3OQJA 3BA6A 4DLYA 2JKZA 4KXYA 2BTQB 2CLFB 1TA9A 2VF7A 1EUYA 2MINA 4X84A 5E9WA 4FGUA 4D3SA 3BB3A 2CDNA 1ZVMA 3H3XA 3T35A 4C6TA 3K6KA 1P1CA 4UBLA 4UMEA 5BRJA 2G6TA 4HGZA 5E8RA 1Q77A 3FWKA 2C92A 3H1PA 4C29A 3A9RA 3JD0A 3PT9A 1D4OA 1HORA 2J9FA 5CNJA 1HLPA 2VH2A 5DM60 4XGKA 3Q6NA 5B36A 2JJ1D 4FDVA 5IXYA 2DLNA 1RYMA 1Z3IX 1NQAO 1SGWA 3K9BA 5HM8A 4E7OA 1W4LA 2G9RA 4EF6A 3EPKA 3MUNA 4C88A 2FEMA 2O7SA 1TE2A 4UZEA 2VJKA 1PN3A 1YXMA 4OIFA 3OECA 1AY0A 1CF9A 5BYAA 4EZEA 4IIBA 4DDKA 4ZGBA 3KQYA 3BXGA 3D2LA 3UA4A 3C5VA 4M9CA 5IPFA 1NATA 1QK5A 4D9CA 3FPCA 3SC2A 1GNPA 1Y8AA 2WC1A 1RQPA 3CRW1 4BZPA 4E6EA 3U81A 3GP8A 1SN7A 2GSWA 4FC7A 3ZX4A 2BGTA 2YWDA 4AZVA 1GTMA 1ADFA 2H31A 3RTEA 9LDTA 1RXUA 4L4SA 2VLBA 4PS1A 3RAFC 3WFJA 5I7RA 1DUSA 2XNHA 3DAFA 2XXJA 1R4AA 3MPOA 4FMPA 2YFKA 4LZOA 3L7CA 4FGKA 2EDAA 2HNAA 3DVSX 5ALPA 2EW2A 4BQNA 4PC6A 4DHEA 3A6JA 1GGJA 4DT1B 3QW4B 1QYXA 3W6ZA 5D84A 4B6EA 1II8B 1IG0A 4BP1A 3RAJA 1XQ9A 2P78A 2RJNA 3IKMB 5EVJA 5ESRA 4G6ZA 3OHSX 1MCZA 2ACKA 3KXIA 3HUFA 1NL3A 2ADOA 2BI4A 3TBFA 3ZKAA 5ES4B 3KXPA 1XHLA 2F9LA 3W78A 1XDWA 5JNTA 2X41A 2Y1CA 3F3KA 4TV9F 4FFBB 5H0IA 4AG6A 1MAAA 4UHKA 2PO7A 1RT9A 3F97A 4R2IA 2HBRA 1Z0JA 3RABA 4YMGA 4I1SA 1EGVB 1AK2A 2X8JA 2XVXA 4H7FA 4N5NA 3ZXIA 1OLXB 2RCYA 5B1IA 1MD9A 3CCFA 3DP7A 1MRZA 1Y1RA 2NZXA 3EVBA 3RS9A 4GQBA 1SVUA 3KHUA 4RS3A 3I4CA 2PMDA 1YDWA 1T3HA 3A6PC 2X8AA 9MHTA 1O94D 3VPCA 1K68A 4XPZA 1UOQA 3FPKA 1JL3A 5FF9A 1J5PA 1PO7A 1R5BA 1DO8A 4LGVA 1GPBA 4C0SA 5BSWA 4PX3A 2JLVA 4GMHA 4NX2A 1ZI8A 3E18A 5AUOB 2FUG1 2DFTA 3OWXA 4PG6A 5A7FA 4ZV4A 1TTTA 4C01A 3ND8A 2QL7A 1HLDA 4Q66C 4CHGA 4ZRNA 4PGAA 3G13A 1G5PA 4KQCA 4Z5XA 3JAKB 2WJGA 2C7BA 1RQ2A 1UC4B 4GLBA 1CJVC 3NZEA 4RKQA 2PL9A 1FNDA 1JVSA 1PJZA 3A2MA 3LXXA 1E63A 4TTQA 3TTXA 3D6VA 4Q3KA 2B6NA 3PDIB 5K3FA 1ZITA 3ROEA 4RD0A 4XE5A 5EP1A 4ZYTA 4RCVA 5FV7A 4G8CA 1JR4A 3AINA 4W9MC 2GN6A 2FWNA 1D2NA 1SUPA 4FDUA 5DTIA 3PFIA 3W90A 1E1DA 2D74A 1UBUS 2XDAA 1TO1E 5DNEA 2AN4A 3CF6R 1GTJ1 3RFCA 3JAWB 3F5MA 3RKSA 4CBVA 1CUFA 1KZ4A 2RGRA 5JC8A 5I9BA 3K70C 1ADYA 2FWAA 2J31A 2A3NA 3CZ9A 2M6KA 1IM2A 5CFOA 4YCCA 1JEOA 3DP9A 4KAAA 4OHXA 1FFHA 1H2ZA 4ID3A 1B76A 3BXEA 1O6ZA 4NCAA 5GAJA 1PJSA 8LDHA 4PZDA 1OT5A 1UJ5A 4HTFA 5ULLA 1N9KA 1IZ9A 2P75A 2V0GA 3NHJA 4BBZA 4B3JA 3S8YA 1GAEO 2LR0A 3AV3A 2G1JA 2VYQA 5EYPA 4C6SA 2PGOA 3ZBQA 3WE7A 4IIYA 3JQAA 2GM4A 3QFSA 2OD7A 2C7OA 2C3YA 3FI9A 1M73E 5HFAA 3TRDA 4AZ3B 1J2YA 3F9RA 3A1DA 1P7VA 4TQAA 4L6AA 4OY3A 2EERA 2QAGC 3LVQE 2IP2A 1SXIA 3COYA 3W5SA 1U3CA 1P2FA 3LUKA 2HRQA 1H23A 3GQBA 1VA4A 2VHTA 3QPWA 3QTBA 3RHZA 2I80A 4EI8A 3V4RA 1P2VA 1SBQA 2BGKA 5THKA 1N5MA 4YBRA 4RPJA 5KOHA 5FDFA 1NVFA 5J40A 3CLRC 1SOMA 4AI6A 1OX4B 2WHXA 2I33A 2OR3A 4AXXA 3QSGA 3FWPA 3PNVA 4X8MA 3GJ5A 3H2IA 3RF6A 1IBSA 2A1UA 3GFRA 3HACA 3IP7A 1VA5A 1BWRA 5C8ZA 2PX4A 1TIBA 4ARZB 1B16A 2X5NA 4MRMA 2VZ0A 4DWJA 3DB1A 3VH4A 1P2DA 2JK0A 1G8MA 3ECCA 2CUZA 3CNLA 1XTJA 2AFIA 1F8XA 4U7GA 1SY7A 1CP2A 1PLLA 1JSRA 1P9NA 2AXNA 1GUDA 2GBGA 2NUTB 4NH0A 3BWDD 4P1ZA 2ZUTA 2C9CA 2L19A 3VR2A 4BP3A 5IN4A 2P62A 1V71A 1HTWA 1N2CA 1GFIA 1PZNA 2PZLA 3FLBA 4CF4A 4MKRA 3TZLA 3DL4A 2ZWOA 2O3SA 3BSFA 4W7IA 3U9TA 1N34B 2FF5A 4G3XA 4N3CA 2JIPA 2BE9A 3AEYA 3ZUGA 4QU5A 3ZWPA 4ECAA 4P0TA 2F1RA 4D4IA 1QQBA 2H85A 3QBVA 1SVKA 2J33A 3N58A 2A5FA 2R2AA 3ZQKA 2ASEA 4HH3C 4L5YA 3EG9A 5TQ0A 4AKSA 4B3GA 3RTDA 3O03A 1AQNA 2JH9A 5FCDA 3ILSA 1NIJA 3GVXA 2PNJA 4J0IA 2VHCA 4WFQA 4OFBA 3DEHA 4PFJA 3AHGA 2POCA 3H0CA 4QGAA 3JPYA 2HWKA 2PXXA 3MTAA 3LV8A 3HLTA 3HZOA 1YGPA 4GSYA 3HB9A 3ELDA 2HA3A 3V1TC 3MMSA 4QBTA 3JZDA 3GT4A 3G02A 1JDPA 4CR6A 4JLMA 1GZ6A 4FIDA 4XX0A 4JI7B 2WJZB 2CJWB 5AKIA 2CKDA 3L0ZA 4BC0A 4BNXA 3WMEA 4HH0A 1TVCA 1Z5PA 2Q45A 4W99A 1CUBA 2NO9A 1NSYA 4OFXA 1RXVA 2RGCA 1HFWA 3FN4A 4YJFB 1KU0A 1Z37A 2FETA 4H7IA 4RKRA 3HO1A 4R8RA 1DDIA 5JAUA 2GN0A 1KMHA 5K0GA 4IHAA 2ZJ6A 2BEWB 3FMIA 4R1NA 1FB5A 3VOTA 4DCSA 2R2GA 3WDSA 4CCYB 1L4FA 3OSZA 4FPXA 2ZTUA 3E9RA 2A1TS 1JDZA 3B6MA 5D1NA 2HHJA 5D3MA 3ICWA 5HOEA 3S81A 2ZT8A 4JB3A 2C2WA 2V7XA 3AEZA 3ISTA 4XZ3A 1MABA 5KNDH 2D5IA 1ECBA 3L07A 3ACCA 4IIJA 4K3VA 2AH5A 4KJXA 2Q3CA 3JVUA 3TIVA 3RU3A 3TDKA 5HQ3A 2VNAA 4GR9A 1XXLA 1ULSA 4TSFD 4BAUA 3EMBA 1XR3A 1E1RA 2EKPA 3BAFA 1UK9A 1PX2A 4J0CA 3VM6A 1C7RA 4TTTS 3EGDA 2RHMA 4RK6A 1O0BA 4HATA 1YDHA 3F9CA 3KXKA 4XD7A 1Q7EA 3T3DA 3ZVMA 4ZOAA 3CH4B 1G20E 5ER6A 3IRVA 3BMNA 1AKQA 4O0LA 3HJRA 3IJ5A 1CEQA 4QPNA 3WLKX 3JRXA 5DX0A 1GSIA 3QVMA 2XUZA 2V7BA 2QAJA 4GWKA 1TKAA 1QWOA 1E6WA 1XLWA 2GAOA 2Q8PA 2YC4C 4PCUA 3RSSA 3KYIB 3EZ9A 2BP7A 2XUHA 3GI1A 3DEIA 3V33A 4D9FA 1LS1A 1R3DA 1VKOA 3MIZA 5GJVC 1X7YB 3NAZA 4AJKA 1RBZA 2VP4A 5C4MA 3ANXA 4L2IA 3IDFA 3CU5A 4MR9A 4WERA 2NYRA 4YDRA 4BVGA 5FFFA 3FAZA 1QKIA 4MUMA 1LPOA 1LF5A 4KXFB 3RTCA 1UWCA 1IONA 1PFKA 1JEYB 1T6XA 5KNDA 1FC0A 1V47A 1I7PA 3CEHA 2C29D 1IE3A 2G63A 5B4UA 3E4CA 1PAUA 2R4QA 1TO2E 3PUYA 1YUMA 5JR3A 1XF1A 3G2HA 1Z07A 2GHQA 2WIAA 3WGZA 4DQUA 2O19A 5LU8A 1UOEA 1UMBA 1P3DA 3LC2O 4IKEA 1MB9A 3NVMB 4EG8A 3THWB 2UAGA 1TEZA 4P22A 2QSJA 4C0HA 3N8DA 5KDOA 1WULS 3C3JA 4DDVA 3EZLA 3EMKA 3TBKA 2VAMA 1G17A 4CKBB 2WUEA 4MR7B 2R00A 3O3CA 4EDHA 4RIHA 3TWOA 4F2PA 1Z0KA 3ZI7A 1ZI6A 2BMFA 2X5XA 2WUGA 2HCBA 3VZQA 3GLKA 1TDJA 1PSWA 1JAIA 1HZJA 3HGTA 4E15A 1F6WA 2EYQA 4XIGS 1ZOOA 4NS1A 4B4OA 3LW8A 2NO5A 3JQBA 3VHXA 2C8JA 2GNPA 2OVFA 3W2HA 2G28A 1FP6A 2MYUA 1KP3A 2FW1A 1K6XA 2ZB7A 4RE5A 5DYTA 3X1JA 4Q4JA 2W93A 4NOKA 5I4KA 5LMCA 2FZWA 3BHMA 2QLLA 2R7MA 3MSXA 3AY3A 3ZCSA 3EA5A 1ZK1A 5H70A 3FUVA 4B8YA 1ZH0A 3W4IA 4M0FA 1T8YA 2GEKA 3KEFA 1DIGA 4Y6GB 5KVVA 3TS1A 2NSYA 3EUAA 2QV7A 2GRJA 3KQHA 4RPGA 4J9VA 2AXEA 3UCXA 3CX6A 2JI8A 3QFHA 3WL7A 3T4XA 3L7NA 3QFCA 1I80A 4EW3A 3E7PA 2NYAA 4KE6A 3CRQA 5A3VA 4LZPA 3KB1A 3UQYS 4C89A 5LQNA 1IQRA 3Q87B 1EVKA 3DDSA 4N76A 4F4FA 1ZSVA 5AW3A 5KU7A 5HNKA 3GH3A 4OJTA 5JFTA 1Y3IA 3TQFA 1GU1A 3DE1X 3KOYA 1KEKA 1T1EA 1DBRA 3QKSB 4B3CA 3CN7A 5FQOA 1CUCA 2O7QA 4YRQA 1IXKA 3G5LA 4UBOA 4ZK6A 2J6HA 2GNAA 3IKTA 1LNSA 1S01A 2F8LA 3H8VA 2R25B 4HO1X 3BRWA 1C80A 2WR8A 3IQZA 4JITA 1MTOA 4JP5A 1IYZA 1ZO8A 2JHGA 3OOJA 4J49A 4KBFA 1GRCA 4D4KA 5CDFE 3VA7A 1PVOA 4R8KA 2IEBA 3PITA 1RHQA 5DNVA 2NXJA 5EUBA 3QMPA 5LP1A 3NTVA 1PBNA 1RZVA 2C2ZA 1TF7A 5KVQA 2YIDA 2V7GA 1E92A 1SCAA 2FZGA 2YN2A 4H16A 3UGTA 4RAOA 3D2AA 4NFYA 5DSTA 3B6KA 4ZCTA 2NTEA 2Y0PA 5ALXA 2X7XA 4UVHA 4WGFA 4XSGA 4C3ZA 1SVMA 2D1RA 3UMBA 4DCGA 4EG7A 2FZ5A 1D03A 1DJQA 1TKRA 4TSRA 4GICA 1EWTA 1WUHS 3GMTA 5LYYA 3RSFA 2B7CA 2GJ9A 3CT6A 4OUDA 3T94A 2RBGA 2XNJA 4J2OA 3QLVA 1DB3A 4ENRA 1HR0B 1J2TA 2YMQA 1QRSA 4BIMA 1DOZA 1WQ1R 2OAGA 2IU6A 2QLMA 4PN7A 2O23A 3O8OB 5CX1B 1ZGJA 3MQ4A 3NUZA 1OC4A 4JBHA 4R01A 5GGXA 3TLJA 3CYFA 1B8PA 1ZNQO 3WMWA 2X4IA 4K2HA 2QX4A 5AIBA 3A14A 2IX9A 5AJHA 1U2DC 5DHRA 4UFPA 2XMGA 3G9ZA 1OX5A 1AQYA 3HJCA 4OCZA 3KQQA 1P8JA 1FVXA 4MGKR 4AG5A 2PK3A 1LTQA 1ICIA 4HN2A 4BCCA 4CLXA 4YROA 3DLIA 4PLPA 4A0SA 4OL9A 1B93A 1EBBA 2X9QA 3EVTA 5A9TA 3H8WA 1PX0A 2IZ7A 2QX7A 4AKIA 3HUEA 1LC0A 2AF4C 1M7BA 2VWPA 3UAYA 5SY9A 5FUMA 5LOVA 4ERNA 5JTUA 1YF3A 4UPVA 3CG0A 4EZIA 4V3BA 4EAQA 1MHPA 1L7OA 3KJZA 4OSEA 1QR6A 3BFXA 5AOAA 5CAEA 1Z2NX 3FRHA 3LHSA 5BW4A 2DJ5A 2O2EA 3AEKA 4A36A 5IJWA 2RE8A 1E4OA 3HNOA 1O94C 1OPXA 1E2FA 3H4VA 4FD2A 2IOYA 4H35A 2YOFA 2YV3A 2WKSA 4AO6A 1ZUNA 4CN8A 1M2JA 1Z0FA 5CVCA 3PFNA 3MWEB 4K6GA 4LF7B 1GXSB 1S7GA 2H17A 4AO8A 1U80A 3MERA 2AJCA 1GN9A 1TJPB 4M3NA 5EKSA 3LQ2A 1UXGA 1KZ7B 4P58A 3SF8A 4RPHA 2PL5A 1JU3A 2ZEJA 2ZPUA 4QVIA 1JG1A 2FFHA 3THRA 4Y6PA 1Z6QA 5CFZA 3QKRA 2B78A 4IQFA 2I5PO 3TG8A 1WBDA 4MTLA 1R50A 4HNVA 4M9XA 4JJZA 3UJ9A 4DBLE 4Z7NB 4KRFA 1E20A 2IYNA 4E30A 2FB9A 3J7AC 4OOEA 3PVCA 3LX4A 3V8BA 1GAWA 4UM7A 4TS4A 1TPZA 5IUKC 1LV8A 1A69A 2DBQA 4Y2QA 2GTPA 2BFWA 2OHXA 4FR2A 1QH1A 4BLQA 4KQ1A 2OAP1 5JADA 1I7SB 4QM6A 1AA9A 2P3QA 4GBJA 1WOMA 4GMKA 5EE3A 4Y2RA 3KYJB 4LGMA 3P2IA 3V4PB 2RMKA 3BM5A 2XECA 4DA7A 4DJ5X 1KRXA 5JASA 4NYJQ 2RHWA 3CBGA 4LEIA 5I9NA 4B82A 1S5PA 1H8HD 2Q4OA 2PWZA 5B4TA 1S2IA 1E2UA 4O0MA 1R8QA 4HRYA 5JAIA 2QTAA 2VI5A 2NO0A 4FP9A 5FOSA 5HP4A 3TEMA 1WDWB 4HGPA 1KQOA 4TRRA 2XB4A 5CIWA 4NYMR 1GYPA 3K0CC 1CK4A 3LGAA 1G20A 2W2XA 4Q1VA 1E9AA 4M0MA 5T4FA 1ULHA 4PLTA 1NI4B 4MS1B 5CBPB 5JY1A 2X7JA 4N7MA 5FWDA 2CNKA 1ZJ6A 1E1MA 1RLOA 4KGVA 2AYXA 5IVIA 3SFTA 5JXJA 4HAUA 5F3WB 2FV8A 3V6LA 1DG9A 1X1CA 1PFGA 2VP2A 3CZMA 5JROA 2CMGA 2NT4A 2ZWIA 4JN6B 1SU4A 3C3CA 2X0DA 3WL5A 2PVSA 4IW3B 4MWDA 1W35A 3DBIA 4L5CA 1W4CA 1RZ3A 1VJGA 3LBAA 2QT1A 2NXEA 5DZSA 3AB8A 2HO5A 2O8DA 3G0IA 1RQ7A 4U9UA 3UY4A 4KC0A 4C7VA 4XA8A 4ZHQF 5IC4A 3BPSA 4KX3A 1KL7A 4D4GA 3SDSA 3FPGA 3WDKA 3P2YA 2BTEA 4HMOA 1YAHA 1SB9A 5FNVB 4GI3A 4MVXA 1Q15A 1RHUA 1QMPA 3EIXA 2ZIEA 4LBWA 3UAXA 4W4TA 1GDTA 5TARA 3FGOA 2W8BA 2WINI 1Y6RA 2CXHA 1LLFA 1TCVA 1JU9A 2OMEA 3UK1A 1H85A 1KEUA 2QW8A 3LVBA 1G6HA 1V7ZA 2ID7A 4BCDA 4PX2A 4J0EA 1UZUA 1VCMA 4MW9A 3GRYA 5DCYA 4R1SA 3TQQA 4HDRB 5TR9A 2YC2C 3W79A 4NECA 3THYB 3CJQA 4J1NA 3ZTYA 4GDFA