1GZ3A

Molecular mechanism for the regulation of human mitochondrial nad(p)+-dependent malic enzyme by atp and fumarate
Total Genus 200
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
200
sequence length
554
structure length
554
Chain Sequence
b'HIKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMTSPLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVGLACSQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDQCLPVCIDVGTDNIALLKDPFYMGLYQKRDRTQQYDDLIDEFMKAITDRYGRNTLIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTAAVALAGLLAAQKVISKPISEHKILFLGAGEAALGIANLIVMSMVENGLSEQEAQKKIWMFDKYGLLVKGRKAKIDSYQEPFTHSAPESIPDTFEDAVNILKPSTIIGVAGAGRLFTPDVIRAMASINERPVIFALSNPTAQAECTAEEAYTLTEGRCLFASGSPFGPVKLTDGRVFTPGQGNNVYIFPGVALAVILCNTRHISDSVFLEAAKALTSQLTDEELAQGRLYPPLANIQEVSINIAIKVTEYLYANKMAFVYPEPEDKAKYVKEQTWRSEYDSLLPDVYEWP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NAD-dependent malic enzyme, mitochondrial
publication title Molecular Mechanism for the Regulation of Human Mitochondrial Nad(P)+-Dependent Malic Enzyme by ATP and Fumarate
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 200
structure length 554
sequence length 554
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.38: Malate dehydrogenase (oxaloacetate-decarboxylating).
pdb deposition date 2002-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00390 malic Malic enzyme, N-terminal domain
A PF03949 Malic_M Malic enzyme, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1gz3A02
3.40.50.10380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Malic enzyme, N-terminal domain 1gz3A01
3HB4X 2YUTA 3DBRB 3RASA 2HCTA 3DB2A 4BO6A 4RF2A 3JQCA 3ABIA 1GQQA 3K9QO 4II2A 4CMIB 1RPNA 1G1AA 4W7HA 4JGBA 4XRRA 4NU6A 3C1TA 1EVZA 5KKAA 1IL0A 4Y6PA 2BFPA 2XOXA 3FPLA 3WTBA 2PLAA 1YONA 4FJ1A 3ZV4A 4B3HA 5L4NA 5GY7A 3TZ6A 1W6UA 2RHRA 3I1JA 3R3JA 2PNFA 3HG7A 4IS3A 4WASA 4JROA 3ITKA 4D79A 1MFPA 1YL7A 1HL3A 3JQ6A 2Y1CA 2ZB7A 3OJOA 2AXQA 2EP7A 1ISFA 4J9VA 1ZSVA 1E6EA 5IZCC 3WOHA 4XQ9A 2HRZA 2Y1OA 1GCOA 1UAGA 4PZDA 4B7CA 1ENZA 1U28A 4CMKA 3PWZA 3PHJA 4XEHA 3KO8A 1JA9A 1VL0A 5B4VA 2ZTLA 3WTCA 4XJTA 3VPFA 4A0SA 3X2FA 2G76A 4LRTB 5C7IO 1GQYA 2EXXA 4CL8A 2GRAA 1B2LA 1Z6ZA 3I9LA 4IY1A 5DN9A 1KY5A 4FFLA 1PJCA 5L7TA 5DBIA 3DZHA 2O3SA 4XGNA 3PGJA 4RJTA 3DAGA 2Y67A 5AXDA 3ZWPA 3EMKA 3S2EA 3JQGB 3S8MA 3ZW8A 3R6DA 5IDXA 3I6IA 4WGGA 5H82A 1RYEA 3DOOA 1B26A 1DC3A 1VL6A 1UJMA 3EVTA 1ZXBA 2PH5A 3I9JA 2OORA 3AM4A 2JD1A 1GFSA 4BNZA 1GYQA 2X58A 4XQGA 3AFNA 2O3TA 5KJ6A 1PZEA 1NQOA 1UP4A 4D42A 1KERA 3ZHZA 5DOVA 2YV3A 3GUYA 2P68A 2VYND 2B36A 1RM4A 3H2ZA 2WYWA 3QLJA 1OC2A 2C5EA 4MP6A 4Z6KA 1K6XA 1N1GA 1K6IA 1D7OA 1SB9A 3I23A 3D5QA 4MVJH 4U6QA 1IE3A 2J5QA 5I9MA 5EPOA 3DZIA 4E2YA 1UDAA 1Z7BA 5KVCA 4PLVA 4HWKA 4MKRA 4TMFA 1WVGA 4IDEA 4FBGA 3IUPA 4NFYA 3V2HA 1HDZA 3JQAA 4W7IA 4NDNE 2C54A 3GHHA 5IDQA 1D3AA 1SEVA 3UICA 1DIHA 4DLAA 1MFZA 1DPGA 3DO5A 2GN4A 2FY8A 3H9UA 3PJEA 4YRDA 1DOHA 1NQ5A 4Q39A 3E6AA 2PV7A 4CMCA 1I5RA 1ZJYA 4J9UE 1UP6A 2IODA 1LSOA 1NM5A 3PPIA 1C1DB 4CPDA 3U09A 4XYEA 1QYDA 3EHEA 5KVSA 1P0CA 1E0DA 3JD0A 3RBVA 4MVJA 4LVUA 3WGZA 1BSVA 3JSAA 2P9GA 4Q3BA 5DCWA 1XU7A 2J3KA 1A9ZA 4C4OA 3WMXA 5K9ZA 3DC2A 2W8ZA 1T2EA 1KETA 2QRKA 3R3SA 1EQ2A 1ADCA 1E77A 3DHNA 1ONOA 2DT5A 2LDBA 2JJYA 1I0ZA 1L7EA 1WW8A 4ALKA 1HWYA 2YYYA 2O4CA 2GD1O 1PGPA 3DAFA 1E3IA 3FWZA 3VKVA 3GNTA 2PK3A 1P74A 5T67A 5ICMA 1PJ4A 2UDPA 2GASA 1P1IA 4FS3A 4U8GA 4N5NA 4QEDA 3HZZA 5ICSA 4BGIA 1PJ2A 9LDBA 4ALNA 4ZICA 4I9UA 1F0YA 1P1RA 2X4GA 4RPHA 2IXBA 1PZFA 3AUUA 4UVDA 4NHEA 1DC5A 3PYXA 4CM1A 5B12A 1PZGA 4KTVE 2OP0A 2NVWA 1O8CA 2JCYA 2BGLA 3R1IA 1HYEA 4LRSB 1C3VA 1NAIA 4JJGA 5KJ1A 4JX8A 5FI3A 3QVOA 4P22A 1F14A 5IFLA 4QXMA 4CLXA 1AHIA 3DONA 3NT5A 4UEKA 3LK7A 1PJSA 4YTEA 4E30A 1DSSG 3E5MA 5BSFA 4JLWA 1QLJA 2X9VA 3TF5A 1UR5A 2OL4A 4WLOA 3FF4A 3NJ4A 2I5PO 1LC0A 2YFHA 3H2SA 2AMFA 5BR7A 1XKQA 4WJZA 1RM3A 1HE4A 5TX7A 4RVUA 4DPMA 3C85A 3P19A 4WKGA 3GEGA 1O5IA 3BMCA 1U2GA 2V6FA 1FDTA 1WMAA 4KZPA 4YAJA 1DRUA 3CSDA 2EKLA 4OSOA 4I08A 1J49A 2Q50A 4Z0PA 5TT1A 3JQFA 5EMHA 3UVEA 2QRJA 4E5NA 3L6OO 1MX3A 1P1KA 3I5MA 3CE6A 1PL8A 4GL4A 5HS4A 1U1IA 2Y99A 4J2OA 3VOSA 3WMWA 4A7PA 1E92A 1BTOA 3I83A 4FFPA 3RVDA 1ID1A 4GSKA 1G6KA 3QJ5A 3S2IA 3ZH2A 5CG2A 3VC7A 1NAHA 3GH3A 2JD0A 2DTEA 2B5VA 1ENYA 3U4IA 4KUEA 5JC8A 1UZNA 3SC4A 4HBGA 3KTDA 1U2DA 2Y1GA 4RV9A 2RAFA 2V7PA 4YYZA 2PA3A 2C20A 4CM9D 3G49A 4WCFC 3JQAB 5FYDA 4ZRNA 1B3RA 2C5AA 4R3NA 5KJEA 1N1EA 3G0OA 3OJEA 5TNXA 4EI2A 3K92A 4BMVA 2F1KA 2Z95A 1E7SA 5B4UA 5F1KA 3JQ8B 4IQ8A 5JW6A 1Y9AA 3CZMA 4GLLA 2EF1A 4GX0A 1ZVMA 3E9MA 1Q7GA 3ONDA 3U5TA 5G2OA 4XWYA 2HJSA 3OETA 1T1RA 1JTVA 3TJRA 3M2TA 3V1UA 3MOGA 5DNAA 4CL3A 4AJHA 2I66A 3AY7A 3Q9NA 1S6YA 1YB1A 3NJ8A 3PHHA 1LDGA 3ZHXA 4DPLA 4Q9NA 5ER9A 4EZBA 3DFZA 1SO8A 5G4KA 1A72A 3U49A 3FNGA 2BF7A 4H7PA 1H9BA 1XYGA 1DBVO 4BV8A 3MJTA 3GG2A 5FFFA 5C3MA 1PS8A 5JCJA 3E82A 4J0EA 1IZ9A 2E49A 1F17A 1RM5A 2D5AA 1LLQA 2W98A 2VTEA 5AOVA 2VZ8A 3ZHBA 4E5PA 3BTOA 3G1UA 3UF0A 1I3KA 2AA3A 4BO4A 3NEPX 2DBQA 3P2OA 1ORRA 1KVQA 3H7AA 1N9GA 4L74A 4UUPA 3TDKA 3EK2A 4IMPA 2B83A 4O1MA 4BL5A 1U8FO 1NFFA 1BW9A 3PJDA 2XPCA 1GZ3A 4BKPA 2JAPA 1OZAA 1Z73A 3MJCA 1ADFA 1QYWA 4UUMA 5KVQA 4BO0A 4DTIA 1K6JA 1KBZA 5I9NA 2VOEA 1HXHA 1AE1A 4OOFA 3I9NA 4XQCA 4J91A 1V6AA 2PGDA 4P4LA 4YRAA 1O94A 2GPTA 3CMMA 3I9OA 5L53A 6LDHA 1YXMA 4IINA 2QRLA 1ISHA 1QYXA 5JLAA 5JO0A 3FD8A 4CMEC 1JAYA 2Q45A 3TPCA 2NSDA 3FTNA 1SC6A 1U3TA 3G79A 3ZU3A 3SVTA 3I52A 1WDLA 4AG3A 3QSGA 1HE2A 3QVWA 3L4BC 8LDHA 3V2UA 4AJNA 1K0UA 2Y1FA 3TN7A 4ZJUA 5CPFA 4F3YA 4J0FA 5CDSA 1VI2A 3T7EA 3BMCB 5AYVA 4AJEA 3EW7A 3PK0A 4L8VA 3CH6A 4MVJF 5JSFA 4WECA 5JAMA 5JYDA 3JQ9C 4HKTA 1FJHA 2X0IA 1K3TA 2C59A 1OC4A 2IYOA 5L40A 3RSHA 1LSJA 1WXDA 5JE8A 4RLHA 4E33A 2GYYA 1LDMA 3HB5X 3OQ6A 1XG5A 2O50A 3ST7A 1J4AA 1DRWA 1JKFA 1WP4A 3D64A 3TOXA 3NGLA 2YDYA 1Q7BA 3BA1A 4KMSA 3F46A 3TZCA 4Z3KA 2YY7A 4P4GA 3WGYA 3PJGA 1NVMB 1ZO8A 3L9WA 3JD2A 1H94A 4TRRA 1WZIA 1D4FA 5HRUA 1HKUA 3H65A 1ZFNA 4GMGA 3GN1A 3JV7A 2I3AA 1IHYA 2OMEA 4XIYA 3GVIA 5COQA 3TSCA 1E3JA 3V5NA 3PTZA 1C0LA 1HE3A 2D5CA 4R1UA 4XR9A 1R4NA 5GZ1A 4WLFA 2DLDA 4IZIA 3WXBA 2O48X 1BXGA 2PZMA 2B4QA 3AOEC 4RQTA 1J6UA 2I99A 2HMSA 1I10A 1NQAO 4RVHA 4BNHA 4OJNA 3ZWMA 1J5PA 3WGQA 4XZ3A 5G4KB 4BV9A 5ENVA 5BQFA 4DMMA 1R0KA 2EW2A 1NFRA 2HDHA 3OIDA 3OQ1A 1GUYA 3ZWYA 1T4DA 1PIWA 3BMOA 1NP3A 4CMBA 1LJ8A 1U4OA 3WLFA 4Y98A 4OKIA 4BGVA 2GZ1A 2IYPA 4HFMA 2BLLA 3QRWA 1N9GB 1GDHA 1ISIA 1E1LA 3DBHA 4JP3A 1CYDA 4YJHA 4J90A 4O6VA 1BW9B 4UULA 1TA4A 4NJMA 1I2CA 5C7LO 1GL3A 3OIGA 4IJWA 1V9LA 5L4SA 5L4LA 3K6JA 5F1PA 1DHTA 2DQ4A 1Z75A 1KVSA 1LDNA 4GSLA 4CMJA 5THKA 1T26A 1ZKMA 3H8VA 5A3JA 2VUSA 3IJRA 4OSPA 4OXNA 3A4VA 4FB5A 4AJPA 5G0WA 4E2ZA 2GN8A 3RQSA 4HFNA 3ZZNA 4BO7A 5A5FA 1M75A 2WEKA 2ZTUA 3DQPA 4CQMD 3QIVA 3DAPA 3QW2A 4LMPA 2O23A 1CEQA 1QYCA 3BIOA 4EUFA 1RJWA 2NQTA 3GPDG 4ZGWA 4B4OA 3X2EA 3WWZA 4XX0A 1PJQA 1MP0A 3R0IA 5THQA 2Y0EA 4PRLA 1XSEA 4GWGA 1LLDA 5DT9A 1XA0A 3PGXA 1YKFA 4GKVA 1MB4A 3V1TC 3AUAA 4J1TA 1YDWA 2J8ZA 3RI3A 1I01A 1MGOA 2ZYDA 5KVVA 1BDMA 4P8RA 4RDHA 1O9BA 1XGKA 4DL9A 1AUPA 2IZ1A 4KWIA 5DDIP 3ZWBA 1P1HA 5MDHA 2AEMA 4MOWA 3WJAA 2NU6A 1QG6A 3RUHA 1DC6A 4EUEA 3C7CB 2DM6A 3EC7A 5FI5A 2HMUA 1U7TA 3AI3A 4R51A 2AQIA 1ZK4A 4E32A 3LU1A 1B3BA 4PLFA 1NQTA 3ANNA 4J4BA 2AQKA 5T8KA 4D46A 1B7GO 4BKQA 2DPGA 4D45A 1R6DA 3MWDB 3WWYA 2WE7A 1F8FA 4GQAA 3LLSA 2R00A 3EZYA 3I4FA 3GVXA 4IPTA 2AQ8A 4BHTA 4EITA 3LC7O 4GPD1 2DBVO 4EW6A 3OFSA 1NPYA 2RH4A 2ZKLA 2HK7A 1CERA 4P4NA 3W6UA 3ZU5A 5CFZA 1DIAA 3BXXA 3U62A 4D43A 3UHAA 3GA0A 4HNGA 1EBFA 2A92A 3U4DA 3WYBA 1A71A 1R4NB 1H6BA 1JWBB 3KRTA 2NWQA 2QZZA 4WK6A 5EN4A 1KOLA 1EFLA 4KUHA 1BXGB 4G5HA 4M8SA 3LQFA 4GGPA 3RJ9A 1X14A 2B4RO 3BHJA 3DBVO 2UAGA 3D7LA 5AXCA 4J4TA 4BO2A 4NH4A 2B0JA 2DFDA 3D3WA 3HN7A 4U0KA 4EJMA 5BSEA 3JQGA 5C37A 4B7UA 2X1HA 2O3JA 4IM7A 4CM3A 9LDTA 4PZCA 1XR3A 5A3VA 4IQGA 4ND1A 1NASA 2O3UA 5I7FA 4LGVA 1T1SA 2FHSA 4R5HA 3BMQB 1DXYA 2FSSA 3U9LA 1E1MA 5DP1A 3BMOB 4BO5A 4GX2A 3VPHA 4G65A 1H2HA 3JQBC 3KBOA 2FPIA 4OKNA 2AEJA 3SXPA 3A28A 3DBHB 3UUWA 4YJHB 4ILKA 4RQUA 4NJMB 1R16A 1AN9A 4DIFA 3BZUA 4CUKA 1P31A 4ALJA 4Y67A 4CV1A 3ADPA 3K8ZA 1M76A 1PGQA 1V8BA 2WD8A 5AXBA 4CMGA 5FWNA 5JCXA 2ZATA 3H9QA 4L4SA 5CDYA 2PZLA 5JO9A 4UAGA 5IZ4A 4C7JA 1FK8A 3LC1O 4CLRA 3QHAA 2HMTA 4GX1A 3GZNA 4RF4A 1KYQA 1UXIA 1G0NA 1PL7A 4YACA 1R37A 2VHYA 5HWSA 4J7XA 4IGFA 4EEXA 5KKCA 3VVCA 3F4LA 3GVHA 3GEDA 4IDGA 1I33A 4NU5A 1ADBA 3RC7A 4CV2A 4YVFA 1YQDA 1UAYA 4BB6A 3VPGA 4DUPA 1ENPA 4IDCA 5JBIA 4JJFA 3RBXA 2EW8A 4ONEA 1O6ZA 2YQ4A 2FR8A 3DZGA 4O59O 1BWSA 4UUOA 4BO1A 3AY3A 1I2BA 3DZKA 4B4VA 2EWMA 3ETGA 3PYMA 1H6DA 5MGBA 1ZMTA 1DIGA 1A4IA 5B37A 2YW9A 4TVBA 1ZW1A 1VKNA 4QQRA 1NHGA 2BRUA 1C14A 3VPSA 3RC1A 4CM9A 1BRMA 5ITVA 1PS0A 4PLTA 3ZWXA 2P4QA 4ZQFA 3PIDA 3L77A 3S2FA 2QZ9A 1NR1A 1B15A 2CNBA 3FCOA 4B79A 4YAKA 4QFCA 3QE3A 3WNQA 4NBRA 4PLYA 1ZSNA 4J1NA 3U0BA 4QFDA 2FMUA 1M6HA 4ALMA 4CQLA 1GUFA 4MINA 3UW3A 3HUDA 1QP8A 3RD5A 1CQIA 2G0TA 1P1JA 3DL2A 3EDMA 1EUCA 3N74A 3UCEA 1D1SA 3ZWWA 4BUCA 2JHGA 4KQWA 4K1LA 2POQX 4R5MA 5F21A 5IN5A 1ZMOA 2YV1A 2NTJA 3QWBA 3RUCA 3PWKA 4IZHA 2ZB4A 2VHVA 2GZ2A 1YQXA 1N7GA 3FHLA 4MVJM 3GGOA 3E9NA 4M1QA 5A03A 4MVJE 2HMWA 4I5FA 3KEQA 1V3TA 3D3WB 1P44A 1I24A 4GX5A 4CR6A 3UFXA 5TGDA 1ZK3A 4XDYA 3C3XA 3M6IA 1TI7A 4BNJA 4N7RA 2W2LD 2ZCVA 4RORA 2YZ7A 1VL8A 3WFJA 3INGA 4DBZA 1HYGA 2JCVA 1D8AA 1MC5A 1LTHR 3ON5A 1EK6A 2QIOA 4G81A 5DULA 2X22A 1Y5MA 1BXKA 1LSSA 3OEWA 2OZPA 2YFQA 4W9NC 3OJFA 3QV1A 5TIIA 4P38A 1JLLA 4D3DA 2OBNA 4OOEA 1PU2A 3KYCA 4GLOA 1WWKA 4BNGA 3N7UA 4NBVA 4RF5A 3DZJA 3MJ4A 2P5UA 3INRA 3VH1A 1KC3A 4CM7A 2HKIA 4OQZA 4GKBA 4PIVA 5GZ3A 5FEUA 4E0BA 3EY4A 4AL4A 1T2AA 3RU9A 1KVUA 1ISGA 2D59A 4CLRB 2ET6A 1B8PA 1VKOA 3GZNB 3TL2A 4F6LA 1HT0A 4M49A 1VPDA 3BHMA 2FWMX 1Y6JA 3IP3A 4YR9A 3S55A 3AWDA 3GN2A 4HP8A 3WS7A 1OFGA 1O89A 1QLHA 3JQ8A 3Q6IA 4PLHA 3NGXA 1EFKA 3UCFA 3L6DA 4HY3A 3WQQA 2V6BA 4D44A 2IE0A 5K0ZA 3ROPA 3PZBA 4D3FA 3FBTA 4CV3A 1J0XO 2X0RA 4AJ2A 4BO3A 4OXYA 1T2FA 4L4XA 3O8QA 4AJOA 4YEDA 3SJ7A 5JC1A 1PWXA 3CTMA 1V3UA 3SX2A 3IKTA 2Q99A 3I6QA 1Q1NA 1YS4A 4K26A 3KXDA 1DC4A 4OQYA 3G17A 1N5DA 4DQVA 1YL6A 4WLVA 3ZWVA 4UVHA 1CJCA 2E4AA 2DAPA 3LC2O 3OMLA 4WOJA 4BNIA 3WIDA 1K89A 2JFGA 3G3EA 4D41A 3LF1A 1LEHA 3AUSA 4FFOA 4B8ZA 3PZRA 3VZSA 4BKUA 2ZB3A 3TZKA 1EEHA 4PG4A 5F5LA 1HDCA 1JVSA 2X5JO 4WE3A 2VQ3A 2Q2QA 3BTVA 3QA9A 5CG1A 2EV9A 1T4BA 1XQ1A 4B3JA 3QQPA 4ZQBA 2NU9A 2DVMA 2WM3A 4CR8A 3V2GA 1EK5A 1PL6A 1ZIDA 2Q2VA 3QY9A 4NZ9A 2FPPA 3COSA 4HNHA 3JYNA 3UKOA 2W90A 4CQLB 1OOEA 1XU9A 4LSMA 4R16A 1WAMA 1GZ6A 4UEJA 1FDSA 2CVQA 1YJ8A 8ADHA 1JAXA 3KLMX 5ES3A 5ITWA 5HBRA 2PD3A 2EGGA 1C0KA 3STHA 2DUUA 3E1KA 1MG5A 3JQEA 3RFTA 3ZWOA 2GF2A 4WEQA 2ZJ1A 3WJ7A 4IJUA 1DJQA 3WQRA 4D0RA 1PGNA 4IDAA 2JCXA 5AVOA 3DOJA 2D4AA 1HDOA 1LDYA 2GUGA 2EHDA 2E6UX 3V8BA 3WLEA 2HQ1A 3F47A 4PLZA 3PI7A 3FNFA 3RFXA 1I36A 5IG2A 2GERA 3HNPA 4W99A 4D7AA 3EVNA 5I8WA 3MJEA 5IXYA 3Q2IA 3GQVA 5JDCC 1D1TA 3IOYA 3M1AA 4XYGA 3ZNPA 4JN6B 2B37A 4BMSA 1DAPA 3VPXA 3W4IA 2GCGA 3AI1A 4FPXA 1B8VA 1WZEA 3MTGA 1T24A 2WD7A 1YE3A 2Q4EA 3DWFA 4MVJG 1HZZA 3KYBA 2HAEA 2DBRA 3NUGA 2GO1A 2RCYA 4YCAA 4XIJA 5TS3A 1I2ZA 2X9NA 1DDOA 3GDOA 3OJ0A 4FGSA 4IUYA 4O0LA 4AJ1A 3JD1A 3PFWO 4DLBA 1V35A 3PJFA 1Z74A 3PXXA 2P9CA 2YHUA 4CQMA 1IY8A 4JBIA 3U4HA 3FR7A 1SEPA 3OF2A 5K6AC 1LU9A 1WLYA 3KYCB 3PQDA 1A4UA 1CDOA 4IIUA 4NIMA 5ADHA 1W73A 1X13A 2VYVA 4J7UA 4KQXA 4XB1A 1QKIA 3F3SA 3GEMA 2PY6A 1E6UA 4KTTE 2E37A 1N2SA 2UYYA 5CDUA 3WQSB 1X0VA 3AY6A 5EIOA 5G0TA 2R6JA 3MWEB 2NLOA 4CLOB 4Z0TA 1UXGA 1PZHA 2Y0CA 1GPDG 2WYVA 1P0FA 4Q3NA 1PJLA 4FJ0A 1KEVA 1IHXA 2GDZA 1GY8A 5U1PA 3L0DA 3ZV6A 4PGFA 4IIVA 4GVLA 1H6CA 4XKJA 5BNTA 3L6EA 5T57A 3KYDA 5CP8A 3O8QB 4KOAA 4N18A 1HSZA 1U7HA 1EUZA 1IULA 3RKUA 3ZV5A 5A02A 3W8EA 2IDZA 2NACA 3SLGA 3LYLA 1DB3A 4XA8A 2EIHA 3GRKA 1Q2XA 1ARZA 1YH3A 3FWNA 3A06A 1HDRA 1PSDA 3ULKA 1YVEI 3OBBA 1EMDA 4IBOA 1E3LA 4CLHA 1NR7A 3KZVA 3WGHA 4BVAA 2H5LA 2JD2A 4E2WA 2OBYA 1QXSA 2X23A 3VDRA 1LSUA 2IZ0A 2EP5A 3C1AA 1ULUA 3E9QA 4URFA 1H6AA 3KSDO 1QORA 1AXEA 3PP8A 4I8XA 5ILGA 2P4HX 3WICA 3K73O 4CUZA 3O4RA 2PD6A 3BHIA 3K2EA 4MDHA 3AM5A 1DFGA 2PGJA 3GDGA 3ZWAA 4IDFA 4QT0A 4FOSA 2FN7A 3ZWCA 1V3VA 1CETA 2BH9A 3CIFA 3NTOA 2NQ8A 4PRKA 4R1SA 3F1KA 3GGPA 2I76A 3VDQA 3VVBA 1T2CA 4S1VA 3GR6A 2CF5A 4Q3AA 1NVTA 5EL0A 1K2WA 2TMGA 5IZCA 4A27A 2OUIA 1XLTA 3KVOA 5JNLA 1NTOA 2X7HA 1DLIA 3GHYA 3KETA 3S1LA 1F12A 1Y9EA 1AXGA 1GD1O 1LRLA 2ILTA 4QX6A 2P2SA 2GZ3A 4R68A 5JYEA 2CDBA 1M6WA 1PWZA 2WD7B 3CEAA 4YJFB 4PFJA 4ZVVA 1UUFA 4XYMA 1XQ6A 2HSDA 4I5EA 1X1TA 4QTZA 5T5QA 4NQZA 4I1IA 2QYSA 1Q0HA 1VSUA 1VM6A 4TQGA 5A4DA 3QWHA 1EVYA 4JK3A 2WSBA 2WMDA 4CQMB 3IDSA 1I3LA 5A05A 3AI2A 2Y93A 4CM8A 1N8KA 2EERA 3GUCA 3RJ5A 2FRDA 3A14A 4GAEA 2Z1NA 4WLEA 2FZEA 5BNIA 3GPIA 6ADHA 5L7YA 2O2YA 2Q1WA 3B1KA 4DWVA 1IPEA 4MO2A 2H63A 4NK4A 5F5NA 5U9CA 1ZK1A 3CXRA 2HK8A 1P3DA 3K5PA 4RVFA 5JFOA 1A7AA 4PZEA 1E7WA 2RIRA 1ADGA 1PJBA 1ZBQA 2J5RA 4K28A 5DBFA 3B1JA 1N7HA 4RLSA 1M67A 4U0JA 1QR6A 3FSRA 4OHUA 1KIFA 4RPKA 3C7AA 4XDZA 5G0UA 4RZHA 5CDGA 3ZI0A 4BNNA 3EZLA 3B1FA 3TZHA 2VWGA 2GGSA 4MPDA 5TC4A 2Y05A 3FTPA 4O63O 2PKRA 1NYTA 4NBTA 3KYDB 4K6CA 2EG9A 4R9RA 1BG6A 3Q11A 4Q3EA 4J43A 3VZPA 2ZJ0A 3WYCA 1ML3A 1HE5A 2PKQP 5KNLA 3AK4A 3CPSA 3GAZA 2HJRA 3WG9A 1X7DA 3KOUA 4YPOA 4LK3A 3OA2A 1GADO 2GN6A 4CR7A 3GAFA 4HUJA 4XD2A 3WX0A 2AHRA 1W4ZA 1YDEA 3BMQA 3E8XA 1VJTA 2NU7A 2VHWA 2E82A 1LUAA 2BMAA 2JL1A 3MOIA 3JYOA 2C7GA 2AW5A 4JXKA 3F6YA 2CFCA 1EBUA 2C2XA 2P9EA 5EESA 4QSMA 2CVOA 2YJZA 4DPKA 1LA2A 3GF4A 4PLGA 4E12A 3ASVA 1GUZA 4MKXA 3GLQA 1Z45A 1VE9A 3CINA 1KS9A 4IMRA 2H6EA 3JYLA 1H93A 3B6ZA 5B4TA 4S3MA 1P33A 1GR0A 3F5QA 4RZIA 3PHLA 3BTUA 4U7WA 5A9TA 3IUSA 3ANLA 4YJGA 1R0SA 2OGUA 2W2LA 3L07A 3A1NA 4Z9YA 3QP9A 1WPQA 3AM3A 4IGEA 3N58A 2CDCA 4ND2A 2VZ9A 3PQEA 5CHEA 1RWBA 1W0CA 4KUGA 2I65A 3IJPA 1Y8RA 2VYNA 2FPGA 4TWRA 1R15A 1XWFA 5AXAA 4YJDA 1DO8A 1LQTA 2EEZA 2JAHA 2Q1UA 1P45A 4FIZA 3K31A 3HFGA 3WSWA 4YT4A 1BVRA 3WFIA 1ZJZA 1JN0A 1Q0LA 2A94A 2ZTMA 2C82A 5G0SA 3I3OA 1B16A 4WNCA 1X7HA 1EUDA 3GMDA 4TVOA 2VZ0A 5JS6A 1TLTA 4Q3CA 2V6MA 1XCBA 4TKMA 3WB9A 3NTRA 4HFRA 3DDNA 3AJRA 4W6ZA 4CM8B 1NPTO 2NADA 3V1YA 4DVJA 1S7CA 1FDWA 4KP7A 1B8UA 3MEQA 3W4JA 3ZNQA 2VRCD 4EJ6A 3NDJA 5IXSA 5KJFA 1GV1A 4W82A 3ZN2A 1P1FA 2GLXA 5L9AA 1C0PA 4A03A 1SBYA 3JQ7A 2BFAA 4OM8A 4WPGA 1Y8QA 3PHGA 2YHIB 4INAA 4TZKA 1HF3A 1UDCA 1UXJA 3NT2A 1X1EA 3LVFO 4OMUA 1ZSYA 3HWRA 2VHXA 1LDBA 3JD4A 5HS6A 2ZYGA 2O2SA 4TSKA 1RKXA 3NDIA 1Y1PA 2OXIA 5IF3A 1VRWA 4N54A 4NBUA 4H3VA 4WCFA 5BNFA 4ZN6A 5KJCA 3HADA 4L0QA 3TRIA 4NJOA 2DBZA 1WDMA 2CF6A 3T4EA 3WSVA 1V0JA 5JAQA 2G1UA 4DLLA 1E1KA 1XEAA 4PVDA 4ND5A 1E7QA 3MTJA 1GV0A 2UUPA 3KV3O 1BDBA 3P7MA 2I3GA 1PEDA 3W1VA 1Q7CA 1OMOA 5JDIC 3RWBA 1X15A 4ZU3A 4A10A 1EVIA 2DKNA 1ONPA 4MIOA 3LLVA 3OECA 1HRDA 2NNLD 3D4OA 4IJVA 4E3ZA 4XGIA 1H9AA 2YDXA 2VN8A 3JQFC 2OFPA 2BGKA 3DTYA 4FFNA 2NTNA 4L75A 1TT7A 3RUIA 2UV8A 2VOJA 4YB8A 3VTFA 1VC2A 1GYRA 1B14A 2WDZA 3IS3A 4DYVA 3Q0EA 2J3JA 4E2XA 2CVZA 2AQHA 3LT4A 3H3JA 4W4TA 4K6FA 3CMCO 2Y68A 4UREA 5BSGA 5BT9A 1MA0A 2A35A 3VAZA 4YJGB 4RCVA 2XXJA 4TRNA 4Z3DA 3NDRA 2VWQA 1X7GA 3DHYA 2VNSA 2OHXA 4R54A 1IUKA 4UVEA 2WE8A 4PN3A 1Y8RB 3LF2A 5IDYA 3DMTC 4FSHA 2TMDA 4M89A 2WTBA 1OAAA 4ALLA 1NWCA 2YV2A 4CMEA 4GBJA 4ID9A 3BTSA 1AHHA 3FI9A 2HO5A 4BMNA 2PR2A 5ILOA 4L9RA 2D3TA 3H9EO 4IJKA 4E6PA 4NMHA 2Q1SA 3MJVA 3L4BA 4FDAA 3GMSA 4R69A 1FF9A 4HXYA 1LLCA 3CZRA 1QV6A 3E18A 1GTMA 4I5GA 1NVGA 1YOVA 1ZNQO 2VHZA 4QO8A 5COAA 2EJWA 3JD3A 3DTTA 4F46A 5JMWA 1PR3A 3JQ9A 4ZD6A 5JXWA 2NVUA 4DA9A 1I32A 4PCVA 2CMDA 2ZQZA 3RAJA 4TKLA 5EJ2A 2H9IA 2X9GA 4MVJP 3JQ7B 1YO6A 1E6WA 3IC5A 1HEUA 4YAGA 1TT5A 3A9WA 3WNVA 1Y8QB 4G2NA 4MP8A 3KEOA 3RFVA 3T7CA 3H5RA 3UGKA 5HM8A 3SBOA 4NI5A 5F1OA 4YAEA 4RVDA 3WBBA 3VHRA 4ZQHA 3T4XA 4WCFB 4ROSA 3FN4A 1SAYA 3DXFA 2DUWA 3OM9A 4TZTA 4L4RA 2JHFA 3NTQA 1U3WA 5CEFA 1XIVA 4N5MA 3KSUA 4DIOA 3TOZA 3FPCA 3HE3A 3ZGYA 3NYWA 3AUTA 4FCCA 4L76A 3HDQA 3K2BA 4Y8VA 2PTGA 3AOEA 3PDUA 4RVSA 3WGOA 4JIGA 3OICA 4E4YA 3E48A 4CODB 4DQUA 1BVUA 4OAQA 4CM5A 4IXWA 2Q46A 2C0CA 2D0IA 4XGKA 5U4QA 1SOWA 1R0LA 2VRBA 5COBA 4PG6A 2NU8A 4AJJA 2DPHA 4WUVA 4HFJA 2A4KA 2O7SA 4BO8A 7MDHA 3G1TA 1OBFO 4J6FA 3IIEA 2ZQYA 4BNXA 2B5WA 2B69A 3GY0A 4FJ2A 1RM0A 2FZWA 1E7YA 4FD3A 1U3UA 4R1TA 5CDTA 3K30A 5L7WA 2QW8A 3KUXA 4JP2A 5GMOA 4CLOA 1DJNA 1ZEJA 4JBGA 2NVBA 1QSGA 2VUUA 2EKPA 2PZJA 2EKQA 1JDJA 3IQDB 3I9MA 4ZQGA 3W8DA 3PWSA 4R41A 1GZ4A 1LRJA 3CKYA 4LCJA 1WMBA 5DBGA 3L4SO 4AJLA 1GPJA 1Q0QA 5H81A 2D2IA 5TSDA 5I9LA 2PZKA 3GNSA 3WIEA 3Q3CA 4BNVA 2CSUA 4HADA 4OIMA 4OO3A 2C29D 2PKQO 4NBWA 5I7EA 1WNTA 2Q4BA 4B4WA 1T25A 2Q3EA 2ZIZA 3KHUA 1R4MA 3WGIA 3MZ0A 2VWHA 3ETEA 3ZV3A 4YDRA 3ZNOA 1M66A 2HMVA 4FW8A 2FSVA 3GVPA 2O3RA 1GYPA 3CUKA 2ZTVA 1DHRA 2P91A 1HDYA 1Y81A 1FMCA 2X0JA 1EE9A 4J2HA 4RL6A 1HLDA 4E5KA 4GVXA 4UVGA 4YBZA 2V65A 1YOVB 2HK9A 3PLRA 4NNJA 1SCUA 3LT0A 2Y1DA 1GEEA 1I30A 3QVTA 3BYZA 3KB6A 1H2BA 2VWPA 2NVUB 4WLNA 1R66A 2Q2WA 4M54A 2X8LA 2HUNA 1F06A 4OYRA 1E3WA 1YJQA 4YAIA 2NTVA 1YBAA 4R1NA 7ADHA 2BFMA 1JKJA 4A2CA 3PDJA 1TEHA 3GDFA 1TT5B 1ZK0A 2HU2A 3JQDA 3PLNA 4YT8A 1MXFA 3QVXA 5DCYA 4YQZA 4M55A 4EUHA 1U8XX 5A9SA 5HA5A 4BGUA 2JFFA 4A26A 4ZHSA 1GAEO 4DBVO 1AGNA 1A9YA 2X5OA 4LISA 3AW9A 5I8ZA 1ENOA 3E5RA 3LDHA 2CDAA 1U5AA 1TB4A 3IKVA 1P9LA 1MC4A 1YBMA 2BI8A 1CWUA 2OP1A 3KSZO 4M87A 4BQPA 1IZ0A 2O4UX 1L1FA 3L9XA 4WOKA 4BS9A 4Y6SA 3PVZA 1LX6A 2B35A 3PEFA 4FC7A 4YJFA 1T2DA 4DGSA 3ONEA 3F9IA 5A06A 3IP1A 3ROQA 1BGVA 4KDEA 5JAIA 2D8AA 4J49A 2OO5A 4EGFA 3NX4A 3U3XA 4CUJA 5KWEA 1JKIA 4JNKA 2G82A 1EDOA 3AU9A 1XHLA 3Q9UA 1FDVA 3SC6A 3HQ4O 5JDIA 2Y1EA 1QRRA 3DBLA 4J1QA 1E1NA 3ZU4A 5KCZA 4PLPA 3DR3A 5IAAA 3E03A 1NHWA 4BNWA 3B70A 4Z9FA 1XDWA 4RDIA 3JQBA 3F1LA 3H9JA 2HLPA 5T8KC 2Y0DA 3ROKA 3FBGA 3ONFA 1W8DA 2VNAA 2IZZA 1YGYA 3OP4A 4I9NA 1EZ4A 4XYLA 3P5SA 2R00C 1JQBA 3RROA 1GU7A 4Z0HO 2VUTA 1ISMA 3ZCXA 5DZSA 1PQPA 3KLPX 4DRYA 2JKVA 3AU8A 2PD4A 1MG0A 2Q49A 1DAOA 2AE1A 3WGTA 4MP3A 1XELA 2I6TA 3D0OA 3OH8A 3LT1A 4TROA 4K9DA 2C07A 4F45A 4RO0A 3I9KA 3H9GA 2DTDA 2BFOA 3PYLA 2FP4A 1QYVA 4R9SA 1G0OA 1MLDA 3P2YA 2VRCA 3FRJA 3QVSA 3O38A 5GZ6A 3RUDA 1R4MB 3U4CA 4CM4A 1RYDA 2CUKA 4EBFA 3DMTA 1PJ3A 3TFOA 1M2WA 2Z5LA 3H5AA 3K96A 4MKZA 2CZCA 2SCUA 2GSDA 1KEUA 2I67A 4JJIA 2JFHA 3Q1LA 2ZCUA 4NFSA 5TJ9A 1UH5A 1CRWG 1YQGA 4EYEA 1TVEA 4EEZA 2PWZA 4NPCA 4DC0A 4IS2A 3DOCA 5LC1A 4OGWA 2V6GA 2D1YA 4IXTA 3DHEA 1HYHA 3JTMA 4E13A 4WCDA 4BNLA 5CPBA 1YB5A 4WNIA 3W6ZA 1E3WB 2O3QA 4CMHA 4CLEA 3VKUA 1PQWA 5AQ1A 3W8FA 3OEYA 5G0VA 1JW9B 1LC3A 4NG5A 5L45A 3ICCA 1E5QA 1KY4A 4E31A 3LSYA 3HFSA 3GFGA 1SOVA 4FR5A 4YA6A 4NR0A 3HDJA 5A9SB 4H16A 1ZUD1 3QWAA 3WBFA 3MJSA 3TWOA 3ZDFA 4RVGA 3O03A 4J7CA 3H6KA 4BNUA 5C5IA 3D3EA 1U5CA 3DZFA 3ITDA 4UUNA 1GCUA 3GZ4A 3RIHA 5LDHA 1LRKA 3NKLA 2DTXA 3D1LA 1ZEMA 3HHPA 5EQDA 3TQHA 4R4JA 1H5QA 3OSUA 2QG4A 1HETA 1U4SA 4AICA 3F5SA 1YB4A 4PG5A 4ZA2A 4II3A 4BKRA 4MJLA 1A7KA 4TRMA 5A9RA 3C24A 1U3VA 2FOIA 3FR8A 4O5OA 3M1LA 1E3SA 3ZNNA 2VTDA 4QUKA 3TL3A 3M2PA 1NWHA 3GVCA 2WJPA 4EDFA 4ESOA 4DC1A 3UOGA 3ZW9A 4X54A 3DBLB 4R3WA 3AOGA 1UZMA 4GMFA 3FNEA 1MV8A 1ZK2A 3VH3A 3OA0A 3INTA 3RKRA 1TXGA 2IRWA 3JYPA 4NFHA 4BQRA 4YQYA 3JQAD 1SPXA 5I7SA 4W9NA 3RUFA 4AVYA 3ICPA 4D0SA 2BD0A 5LCXA 1DFIA 3UAGA 5DOZA 1NPDA 2AEFA 3VH4A 1VLLA 4CV0A 1EE2A 5A1TA 5CEEA 4A5OA 1IPFA 2QYTA 3RC2A 3RU7A 1O0SA 2Y66A 4FC6A 5KTKA 4MIEA 4Z9XA 4XRGA 2H1SA 2PFGA 2QQ5A 3JCZA 1ZCJA 2CY0A 2NM0A 4IDBA 2DFVA 2YHIA 3C8MA 1PJTA 1IOLA 1HLPA 1LXCA 5B1YA 3VTZA 3VZRA 4KDFA 2X6TA 3LT2A 4MVJD 2FR0A 2J6IA 3ROMA 4CMAA 2PH3A 4YT2A 4AJKA 2IEDA 1KEWA 3D4NA 1HZJA 3GFBA 3H4VA 5TF4A 3GK3A 5T6BA 1OI7A 2QX7A 3WYEA 4WLUA 4RF3A 1GEGA 4BKOA 1EVJA 3GOHA 3B20A 3NAQA 1UZLA 1C1XA 4CM4B 2AE2A 4I5DA 4ALIA 4GGOA 4RPLA 5DP2A 2Z1MA 4AFNA 4KWHA 4ITUA 4BIIA 4DYDA 1F8GA 5A5EA 3C1OA 3IAHA 1ZZEA 1ONNA 1CIVA 1HTBA 5L3ZA 2O7QA 2OOSA 1ZXLA 3HDHA 2W4QA 3ENKA 2AG5A 1NXQA 3ETDA 1PGOA 2RHCA 1BXZA 1L7DA 3PIIA 4FQ8A 1K5HA 3F4BA 3IMFA 4DMLA 2EJVA 2RH8A 4XR4A 2X5KO 1A27A 1MXHA 1LI4A 5IJZA 4J16A 1VJ0A 4J1SA 4DQXA 3ZHYA 5JY1A 2A9FA 2DU8A 3JYQA 1HDGO 2BI7A 4U6SA 2J3IA 4PVCA 4UVIA 5TRTA 3H3FA 5F3RA 1E5LA 4BNKA 5L51A 3UN1A 4PLWA 3UCXA 1YRLA 2CD9A 4C7KA 3BAZA 1ISJA 1N92A 2QHXA 4HV4A 2YQ5A 1EDZA 1SB8A 3EAGA 1HDXA 4Q3DA 3SLKA 4BNMA 4XCVA 4CM6A 3I4CA 1LQUA 5JMPA 2Q1TA 4B8WA 3AFMA 5A04A 4AJ4A 4B4UA 2B4TO 2WWRA 4ND3A 4LCEA 4D3SA 3EUWA 2R2GA 5TT0A 2AG8A 1SMKA 2C2YA 2NV6A 5DCUA 3GT0A 4CLDA 5TJHA 4FN4A 2HRBA 4FFRA 4FGWA 3OHSX 3ADOA 2X0NA 2C7VA 2X86A 1JWAB 2VT3A 1FDUA 1P77A 4DREA 1I8TA 5CEJA 3ZWNA 3DFUA 4LW8A 3GNQA 3D4PA 1KEPA 3TZQA 1I3NA 1PTJA 3MCVA 4GH5A 3LZ6A 5I7VA 4LMRA 5FF9A 3QWIA 2P5YA 4OH1A 2W2KA 5H83A 5JDCA 4JQCA 5EINA 4Y9DA 5KIAA 1VSVA 2VYVD 3GC6A 4BNYA 4E5YA 2GN9A 4J3FA 3O9ZA 2BKAA 3O26A 3TNLA 5EERA 4BO9A 1C0IA 1LLUA 3BMNA 4GI2A 2VCYA 2E48A 2BHLA 2BGMA 3PRJA 4J4HA 4CJXA 1KVTA 1E7RA 1YBVA 3IL2A 1U9JA 1WDKA 1DIBA 4YT5A 2XAAA 3DBRA 1DLJA 2G5CA 3DEYX 5K6AA 4A73A 5KOIA 4CMIA 4TRJA 1GQ2A 4QO7A 5LDGA 5IDWA 1EQUA 1HSOA 1VJ1A 1BMDA 5CAEA 1E7MA 5TQVA 5J23A 4R01A 3ZU2A 4YWJA 5C7OO 3GG9A 1A5ZA 2RBEA 4JBHA 1DFHA 5IN4A 1MUUA 5ER6A 1PGJA 1NX6A 5TLSA 4ZRMA 4XJSA 4E5MA 4YRBA 1NNUA 2G17A 4FOOA 1E3EA 1PS9A 1C1XB 1KVRA 1SZJG 3RBZA 4FFMA 5JCJD 3FNHA 1Y5RA 4HX5A 1B0AA 4E21A 4LVCA 2UUOA 4M86A 2WYUA 1QMGA 4PLCA 3W4KA 3DZBA 1UXHA 1Z7EA 4QECA 4YXFA 4H15A 4OL9A 4EJ0A 3ORFA 2XF8A 4BNFA 1PQUA 2J5KA 3C7DB 1ULSA 2LDXA 1NBOA 4XB2A 1DEHA 3ENNA 2IXAA 4Y6RA 2GNAA 5JY6A 3HSKA 3NRCA 4XQEA 5DF1A 3RCBA 3RC9A 3ANMA 2J3HA 1KC1A 3UH1A 4PG7A 3ASUA 2VT2A 4PG8A 3QWFA 3WGGA 2BELA 4I9HA 1LNQA 2PGLA 3DMYA 1YL5A 3HDYA 3GRPA 2GR9A 2F00A 3GGGA 4OXKA 3KM0A 2NUAA 3WR5A 2ZB8A 5EQFA 4WEOA 1PR9A 1CQJA 4RGBA 4RPJA 1LBEA 1X0XA 3OJLA 1IB6A 4BNTA 4RPGA 5T64A 4DIBA 5ENDA 4F6CA 3PHIA 4MVJI 1Z82A 1FXSA 1YWGO 4B3IA 3PQFA 1ZH8A 3WDSA 4ZQEA 1JU9A 5JAZA 3EYWA 3OIFA 4BOYA 1IYZA 2XXBA 3RUAA 5JPIA 4BB5A 1H0KA 1JVBA 4ND4A 1DRVA 1I3MA 1SNYA 1BHSA 1UXKA 4XYBA 5G4LA 1R12A 3UXYA 1UP7A 3H5NA 3EGOA 1DIRA 4N5LA 4NK5A 3SJUA 4MIYA 1CF2O 3PFFA 2UVDA 3NV9A 4GWKA 2IEBA 2ZYAA 5L95A 2W2KB 4LSWA 3RUEA 1PX0A 2I9PA 3OQBA 4B7XA 4U5QA 1LDEA 3NT4A 2EGHA 4JCOA 4LN1A 1UDBA 4UEOA 3S2GA 4BGEA 3VH2A 1QV7A 3BMNB 3D5TA 1C1DA 5HTOA 4L73A 3VZQA 4IQ0A 3Q2KA 3HJAA 5BSHA 4IDDA 2ZK7A 1NFQA 3TFQA 1O95A 2DC1A 3HN2A 2FR1A 4AJIA 1Y7TA 3SEFA 4DXHA
chains in the Genus database with same CATH superfamily
1DEOA 2OHOA 1WXWA 1CY0A 2YUTA 5EWLB 5T3YA 3GGSA 4RF2A 1E0AA 3K9QO 4II2A 4CMIB 4BX3A 1P0MA 4NNOA 1JJ7A 2FFQA 2H11A 4JGBA 4W7HA 1LGYA 3W04A 5J2UF 1T8UA 1UJ6A 3SNKA 3U81A 4AD8A 5FOQA 1MEEA 1USUA 5EKDA 1IL0A 4Y6PA 4NDAA 3IAUA 4U2FA 3USCS 4AN4A 3GLFB 1FYWA 2VDQB 1RACA 3PR2B 3IOMA 1Y6RA 4QLOA 4FX2A 4JLKA 5GQSA 2XAUA 2QTAA 4BLTA 4DA7A 5LP6A 1E5DA 4NPHA 3Q4GA 1ZI9A 3VU8A 3R3JA 3HM9A 3L5KA 3ZCQA 4IS3A 1A9TA 4MHSA 2BKEA 4IHJF 3EWSA 3GJ7A 3V8RA 1MFPA 3UAYA 3HP4A 3VNSA 2OFOA 2ZB7A 3OUTA 1YVRA 1QRSA 2JFOA 3A6HA 1NXOA 3DUFA 1PBNA 4B6RA 1ISFA 1ZSVA 1ZVJA 3O4JA 4CTOA 2FTKE 3WOHA 2B30A 3K53A 4XQ9A 4BNDA 1V16B 2WOOA 4X3PA 4DARA 2Q5JA 1FLVA 5B7QA 1KORA 1X7XA 2DHQA 2JBHA 4M6WA 5E3JA 5MFPA 1QZTA 3AGQA 2FQQA 1MH9A 1G20A 4C0JA 4J0JA 2XWQA 2CV1A 5JZSA 4FNAA 1M8FA 4IKPA 4P2BA 4LRTB 1K7YA 3D1JA 3I2YX 5FPYA 4CL8A 2GA9A 1I94B 4Y7CA 1EFCA 4OMCA 1L5RA 4IY1A 2G72A 1GNSA 4MMYB 1NMQA 2HO4A 2XVMA 2W0SA 4XDHA 3HKCB 3FNRA 4U63A 2VS1A 2XSZA 3DZHA 1YS6A 3FGPA 2AUNA 3D8RA 3OZVA 2YVKA 3QU4A 3DAGA 2Y67A 3T3GA 3UMJA 3LQYA 4NYMR 3ZE2B 3ZWPA 4BFUA 4HVCA 4AY2A 1NN0A 1KMIY 1I5EA 1QHYA 3FF1A 3JQRA 3MJFA 4LHYA 4KPFC 3SD7A 3ZIUA 5IDXA 4TMXA 3AHEA 3I6IA 3R40A 4KH0A 1J07A 4WGGA 3EASA 1M2HA 3LX6A 1B26A 4Y9TA 1GG9A 4W63A 2J48A 3I2FA 3ZVNA 2NUAB 2DFNA 3UJ7A 1EFAA 4LZLA 4ZOLB 3HA3A 1H85A 1S8FA 1EHCA 1GFSA 1N25A 2JD1A 3A8TA 1GYQA 1FC0A 1HBJA 4RMNA 5FRDA 3OZGA 4S1PA 1SBNE 1CUYA 1KERA 3R5HA 3U40A 1FX0B 1TJNA 3N8KA 2FCRA 2YV3A 5DTRA 1K5GA 3GEBA 4YR7A 5JNVA 2C5FA 4AX8A 4K6OA 4B3DA 3S2YA 4MVJG 1OC2A 4KW7A 1WCIA 3N0WA 1XZNA 2GVDC 4IFEA 1IQRA 4JUAA 4Z6KA 2Q3MA 3FJYA 1K6IA 1D7OA 1HE1C 3K8OE 1G5QA 3RVPA 1XPJA 2Z4SA 4MRVA 4YAWA 1DWOA 3PFNA 4PS1A 4Q24A 4QUGA 4TQ9A 3ABOB 4QRDA 4UHKA 4QKQA 5JQGB 4MRPA 4ZVLA 1QAQA 3NPAA 2A86A 4NEGA 5EPOA 2WICA 2ZSDA 3CRNA 3GJZA 4IX1A 5F23A 1WU7A 1AJEA 4HWKA 1Z0FA 5ALTA 1X2BA 2OK8A 4U7GA 1U0JA 2IK8A 3ZUGA 1FFCA 4X45A 2V74B 4KDCA 3V2HA 1MRNA 2HWWA 3JQAA 1XTKA 1LPBB 2IKSA 2O1WA 3P94A 4CFSA 3CW9A 4UDYX 5BV8A 3H11B 5IDQA 1XK7A 1SEVA 4OB8A 2I1WA 2FU5C 2PKWA 3UICA 1DPGA 1TNDA 3DO5A 3VR5H 1D6JA 3H9UA 4NOJA 2QRNA 2FSUA 3QI7A 3FETA 1D2RA 3GU3A 1G5PA 4TYYA 3IPRA 1LF5A 4F12A 2WAOA 3FSGA 2Q5HA 4J9UE 2JFPA 1UP6A 2IODA 1G8JA 2D4HA 1R8YA 3CZAA 1YUNA 1I0LA 3U09A 1QYDA 2ANCA 3EHEA 4MJ7A 3ZGZA 2PZGA 4N0QA 3RBVA 2GX6A 4MVJA 3IKLA 1E2NA 4X20A 1W36D 2P9GA 4XQ0A 2PMEA 5JHHB 1C8BA 4YI3A 3VV3A 1A9ZA 1CLEA 2JW5A 3QLUA 4F4DA 4AUEA 1T2NA 1E2FA 1KETA 2HPZA 2QRKA 4YHBA 1WY5A 1B2RA 1Z4LA 1RAGA 4HDKA 3DE1X 3SR0A 2BW0A 4ZYYA 5EFZA 5KTTA 1WW8A 2OXRA 2P6MA 3IDAA 3P9IA 4M99A 3FWZA 4YRQA 3W34A 4PANA 1OXSC 4BASA 3EOBI 1P74A 3ZJ5A 4C0LA 5ICMA 5TIIA 2AMLA 2GASA 1P1IA 4A15A 1QZZA 4U8GA 4ZCSA 3UK6A 6YASA 3PFGA 5DBOA 3W5CA 4RSHA 2JAXA 2QYHA 3HJNA 1R6TA 1HOXA 1LPNA 2AFHA 1ISSA 9LDBA 3U1VA 5J5VA 3UJCA 2FPUA 1HLGA 4ALNA 4QJBA 1M0TA 1OX4A 3GYBA 2C4NA 5C81A 3AUUA 5K3AA 2HV9A 4RY2A 1DC5A 2Z4TA 4P4SA 4CM1A 4PNHA 4XUGB 3ERCA 2ETVA 2AX4A 4NPAA 3T1HB 2HRCA 3VR4D 2NVWA 1I2AA 1FSSA 3WMRA 1O03A 1O8CA 3O1JC 2AN1A 2JCYA 3BXOA 1JEJA 4JWKA 1UBKS 2FWRA 2XB8A 3HZRA 5CLIA 4HGQA 4LRSB 5HKLA 1NY5A 4QGFA 4HWPA 5LN1A 3D9QX 5EXEA 1F14A 5IFLA 1XPRA 2G36A 1WUJS 3ROPA 3LK7A 1PJSA 2EFDB 2CD7A 1DSSG 3EODA 2R97A 3LHIA 4YTEA 1OJ7A 4MULA 2X9VA 3TF5A 1C7IA 1R6XA 1YQQA 1J1IA 1GLGA 4TTQA 4RULA 2OL4A 1TCBA 3FF4A 1UJ5A 2OV1A 1EJBA 1HLFA 3H2SA 1EFVB 2WHRA 5BR7A 1HE4A 2WIBA 4DPMA 1EP3B 3GEGA 1BGXT 2I22A 1O5IA 2ZU0C 3Q5EA 2WV9A 1VMDA 1WMAA 2PGIA 4YAJA 1DRUA 3CSDA 1U1DA 4EWLA 1ZHOA 2ZPUA 4I08A 2A30A 3UXMA 3TSOA 2WVHA 4WXPA 5H4GA 2UYQA 3L6OO 3EWIA 3TYXA 2FUNB 3N0TA 5K03A 3KWLA 4LKRA 2YWHA 4LX0A 2RGWA 5DU2A 2HSWA 4FZ3A 4J2OA 4A7PA 4EFKA 1G9TA 1X1AA 1CEEA 1AU9A 4QPZA 1K6MA 1W48A 4KKVA 4X64B 1CRZA 3DLPX 4K87A 4B84A 5CG2A 2RG7A 2IDMA 3BOSA 1NAHA 3A1CA 2NO9A 3NHWA 4PPYA 1PNOA 2X7JA 1XQWA 3A9TA 1Y6QA 1XZGA 3E7XA 4KUEA 4RJKA 3QLVA 1CYEA 2BL4A 3SC4A 3E1SA 1O87A 3KTDA 5E95A 1H8EA 2V7PA 2W2NA 3HR4A 2HJHA 2WINI 2O9JA 5AKYA 3LUAA 3G49A 4NZMA 5FYDA 4ZRNA 5AVVA 2EF0A 1R0WA 5JQWA 1QVAA 3WLHA 4HBZA 4OSEA 4BMVA 2PVSA 2VUIB 3KQHA 2XIQA 2Z95A 4G4SO 1C4WA 5B4UA 3VNBA 2YIMA 5F1KA 2WW8A 3JQ8B 3VMMA 1Y9AA 4ARZB 2EF1A 4H3HB 1XN1A 4GX0A 1DUIA 2HZ7A 1ZVMA 1L4HA 3IEIA 1JHAA 1Q7GA 1PX2A 1R6BX 2BMWA 4X92A 3W5AA 1BROA 1E1DA 1ZOSA 4EHJA 1X19A 4O25A 3M2TA 1U02A 4MUYA 4CL3A 1T3GA 2C98A 3OEHD 4LSZA 3AY7A 2V7QD 3K4PA 1XI2A 1DXHA 1ESDA 3PNSA 3Q9NA 4JFRA 2GAIA 3COZA 4CFZA 3HTXA 2ZULA 2FEXA 3CZPA 3NKVA 1A82A 3DFZA 5K3CA 3OFVA 4DN6A 3U49A 3N07A 1J5XA 1OFUA 2HJGA 1H9BA 1XOIA 4CKWA 1G16A 4BV8A 4OVKA 2FEKA 1IZ9A 4LFCB 4QIHA 2AJLI 4K0RA 3TGLA 2D5AA 2NO7A 2NMVA 5LYYA 3OD5A 4OY3A 1P7CA 2OGZA 4YJ3A 2VTVA 4PQEA 3WHLA 1RHQA 2H06A 4IMPA 1OFTA 3LP8A 1M6YA 3KQVA 1P4SA 3NHSA 5TPWB 2P67A 4US0R 1F2TA 5BR4A 4HGRA 3RS5A 2ZWMA 1NYLA 3P0RA 1ADFA 3OQMA 5J9FA 1XVLA 5I9NA 1KBZA 3B89A 2VOEA 1HXHA 4YRRA 1ZOLA 3RS7A 1WMSA 1TJYA 4Z2AA 3L7CA 1OAKA 5A71A 4BX8A 3KLNA 5BWMA 2IOFA 5JCZA 4CI9A 1ZH2A 1V6AA 2QN1A 5GM2A 1II8A 1L5VA 5D3ZA 2GPTA 3CMMA 5HW0A 3I9OA 1P7ZA 2FW7A 6LDHA 3FKSD 1ISHA 4C7OB 2V54A 1V5FA 4G01B 3DFKA 2C3OA 1E1RA 1XDUA 1QDUA 1D0VA 2ECKA 5G1NA 1U3TA 3ZU3A 2W8BB 3EEIA 3UENA 4GR4A 3NALA 3SVTA 4GU5A 2FPWA 2Z2YA 2BM8A 1WDLA 2BFFB 2HMYB 1XZMA 4AG3A 2ODNA 4AZ3A 4EY4A 5BR1A 4TLAA 3L4BC 1HE8B 4F11A 3V2UA 1FTWA 1YR8A 1K0UA 2CXQA 3MFQA 4IUBS 4DY4A 3FDJA 3SLRA 2A9QA 3UAZA 4ZC8A 2QTMA 3I2IA 3BMCB 2V8OA 1T36B 4OV6B 1R4ZA 1ZGZA 4P2GA 4DM3A 5KQLA 2Q7OE 5AJUA 1AQ6A 1VHWA 2HA6A 3GRFA 5D7NA 4OGLA 4OGFA 2GRUA 3OURA 2NGRA 3DOHA 3JQ9C 2XBUA 1AKYA 2DP4E 4HKTA 4Y2UA 1K3TA 1G5TA 5DXFA 2O5CA 1YU9A 1OV4A 1OC4A 5LOVB 1RKVA 2QT1A 4LK2A 4P84A 3RSHA 2WU1A 4N76A 2XNDA 4ZZ2A 1VHTA 1TK3A 5HGXA 5LKAA 5FHQA 2XVAA 3PX2A 3ST7A 4Q4HB 3UB2A 2X6RA 3EFOB 1DRWA 4QDOA 1JHPA 2QD4A 4QJIA 2P8JA 2YOHA 3HXTA 3MHPA 1Y34E 3NGLA 4CIBA 3D6AA 4KMSA 3MWDA 3EMVA 1OIVA 1DIOB 4GUAA 3I8SA 1TMOA 1EXDA 3MG9A 3A7DA 5JUWA 1SXPA 3WGYA 2B8EA 4H6VA 2Z8ZA 1KQOA 3DVLA 2QBYB 1NNI1 4I1UA 1TUIA 1ZMXA 2AOXA 4RVCA 4TRRA 5ECYA 5BRJA 5TPZD 3KQNA 1I2MA 4NV0A 3AZQA 4U2KA 2QMUA 4F56A 3BWBA 1JIKA 1JQAA 1P2DA 1ST3A 5KU1A 4Z5XA 2VH1A 2I3AA 4XIYA 3D5EA 5BT8A 1N0HA 1QOQB 1W87A 4OFBA 4BE7B 3DMRA 5JYBA 4IGAA 4IMIB 4FOTA 1RKUA 4R1UA 1U0OC 1JG1A 4QRIA 421PA 4QTUB 4HWGA 4WLFA 2IWRA 4OM7A 2DLDA 4IZIA 1UOQA 1CUBA 1U1CA 1QYIA 1BXGA 2R7KA 2B4QA 4YCDA 4B6SA 2VNHA 5T4BA 1LZKA 2PO7A 1RXSA 2MCFA 2HU5A 2AG0A 2HMSA 2VSQA 5FOUA 4B32A 4E09A 4BP1A 4OJNA 1OROA 3RSFA 1QANA 3UV3A 4EYGA 1E1QA 1A98A 4DCVA 9ATCA 5HKBA 5JROA 1YDHA 2CYAA 2W42A 2XXAA 3PTLA 3AF1A 4QBIA 3EPHA 2OESA 5C18A 4V0ME 3FPBA 2XEXA 2IX3A 5J2UA 5TV2A 4TL8A 3ORYA 5E1BA 4OQDA 4DQKA 1QP0A 1GUYA 4WZAA 4Y2HA 4ASUA 1Y3HA 4EA6A 2GMWA 4C06A 1BRTA 2ON6A 4TYPA 2RGBA 1L7BA 1PIWA 5F4ZA 1QPBA 4W1PA 5J3JA 2QX9A 5A4FS 3B9BA 3GLFE 1U4OA 1U3DA 3T3EA 2PVPA 1GPLA 2R8OA 2XYGA 2XUPA 3AR4A 3MXOA 2IYPA 5HRAA 1GDHA 4BN5A 1VJ5A 1UZUA 2O7NA 2ADFA 4YJHA 3THWA 2GAAA 5DLPA 4CKBA 1TA4A 4RTNA 3QKRA 4CM8A 1JDBC 1I2CA 1KO8A 1SCQA 3DAOA 3AUKA 3BSSA 4QGSA 5L4LA 1OFVA 2EZUA 1T4GA 3I1IA 1P7WA 3ELWA 1YR1A 5F3WB 3IAAA 3HZOA 4JHXA 1RBMA 1LDNA 3ZOZA 2WIGA 121PA 3H8VA 3OOEA 2XY4A 5KTOA 5GV7A 4Q3LA 3TJMA 4AJPA 3LW7A 2ACKA 3I92A 4QICA 1D0SA 1Z2DA 4TUYF 3MNFA 4XE5A 1L5OA 3RQSA 4BDSA 1M75A 2WEKA 2ZTUA 4F5ZA 1X8KA 5A5FA 2IYNA 5G02A 1J1UA 1G4AE 3WGKA 1JAZA 1N9KA 1YS9A 1NW8A 3LO5A 3KKMA 1PLKA 3C3AA 3IA7A 1QYCA 2FPSA 1K5PA 3A31A 1XTTA 4DV7B 3T1QA 4C01A 4X6UA 5TNXA 3I5YA 4ARCA 1K7SN 3CA8A 4TN1A 3WWZA 2A33A 1W5AA 4DZRA 1UBJS 2BMEA 4P5EA 4PSCA 1E2IA 4HWSA 1MP0A 1HDEA 1W88B 2P4SA 4HH4A 4JI3B 1UEIA 3BKWA 1XSEA 1B41A 3L1KA 4GWGA 1IUNA 1XA0A 4BFVA 1C9EA 2TMKA 1O57A 2NXEA 3O2QB 4J1TA 3RI3A 4ACBA 1SKBA 2BJVA 1HKHA 2J8ZA 1I01A 1I51A 2FGJA 2PFKA 3CEPB 3G2OA 3G2NA 3I30X 4P8RA 4P53A 2DWCA 1XGKA 1I13A 1ONBA 2LWIA 4KWIA 3P9RA 4F3CA 2RI0A 1JR4A 2WB4A 4URUR 3UWMA 3GJ8A 5MDHA 1F6BA 2GPBA 3R7SA 4GMKA 3UHPA 1Z0KA 4BY9E 1TEXA 1UWCA 2H52A 4R8KA 4R7GA 2MYUA 2HMUA 3JZAA 1J0CA 3OBIA 4E32A 3DTVD 2A9OA 3ANNA 5T8KA 1B7GO 3OQOA 4OJTA 5LQMA 4GQIA 3NOQA 1TVKB 3WY9A 3ANTA 3RU3A 1R6DA 4RKYA 2WE7A 4DNXA 1F8FA 2YC2C 3LLSA 3OZ7A 2UYHA 2OCPA 3BT7A 3DT9A 4RJIA 1OXMA 2A5FA 2ZBDA 3HCWA 1PWHA 1KBOA 3QXSA 5AM1A 4EITA 2FX5A 5E0KB 1LBHA 3IAM6 4QULA 1IHOA 1JDPA 4ZALA 5FBQB 3RRZA 1G5HA 2PRKA 1QB7A 2E5FA 3G85A 4N40A 4DT1B 2V97A 1RQLA 3D3JA 3IBGA 2YR0A 3SQLA 1QH8B 2GFQA 1D7AA 4P4NA 1QIHA 1ZIXA 2VFAA 1D4AA 2F3QA 2H1VA 3F2VA 1P4RA 3H2JA 4E03A 5JAIA 3FXAA 3UHAA 3AXSA 4DHWA 4HNGA 4FDUA 1EBFA 1YV9A 3RG8A 1R4NB 3DCYA 1YR7A 3VYUB 2RAVA 2QZZA 4XASA 2CGEA 3E9ZA 1GZHB 3F6SA 1KOLA 5FUYA 3S29A 2ZT7A 5JIBA 1KFJB 4M8SA 4R1PA 4G9EA 5ADUS 5F2KA 4GGPA 2VQ6A 1X14A 3REQA 3NHMA 3A1UA 4QGGA 1Z62A 4WI1A 4YBRA 2BFCA 5AXCA 4NH4A 3I8XA 2QAJA 2D2XA 4CQJA 2Y4OA 5EUMA 1UCFA 2O3JA 2HWXA 3GARA 1EX9A 3L02A 3OLWA 4PZCA 1ZNYA 4NX2A 4IQGA 1UL1X 4LOJA 1M1YB 1H1LB 1VB3A 3PRKE 4N5IX 2YZNA 4ND1A 5EIHA 2FHSA 3WDKA 3PR3A 3DL7A 4F3KA 3L8CA 3U6BA 1O8BA 2FSSA 1Y33E 1JPJA 2AT1A 3C6QA 3I0MA 4WN9B 4B7AA 5IYZA 1YC2A 3WRVA 2F9FA 5KX5F 3KBOA 1XZEA 4LY3A 3Q2OA 2D1TA 4URHA 4V0NA 1R18A 1NVFA 1WXHA 2I9KA 5ALDA 1ODSA 2C9OA 3B8EA 2DF8A 2QS9A 4H7JA 3A28A 4JQZA 5EP2A 3WMGA 4IIFA 3ZCSA 4UHHA 3ZY5A 4X1OA 2WT4A 4NYJQ 1BQ3A 4MUBA 3LDAA 4NJMB 1AN9A 2FZ4A 2XTNA 3RJMA 4AW9A 4L0MA 4CUKA 3UMYA 1ZVQA 1VE6A 4ZCPA 1KDYA 1P31A 1QIDA 2PT5A 5AM5A 1U0LA 4Y67A 3OLQA 2ZI4A 4JBWA 1CEYA 2D5BA 3GLVA 4Q4CA 3HUTA 5JCXA 4L4SA 1GCIA 5CDYA 1MZVA 2ZXEA 3GFRA 4ZEOA 1NNEA 4GE0A 4CLRA 3VYVA 4YRIA 3GZNA 1PQYA 4K6MA 1WHTA 1UXIA 2OLJA 4LZAA 4YACA 2C88A 2GBFA 4DWWA 4ENQA 4PTZA 4I4TF 5JD6A 2ROQA 3UMVA 3B78A 4IGFA 4EEXA 1MVNA 1I9GA 4OXIA 1DAKA 1YFJA 3IOBA 4IDGA 4M37A 2C2KA 3EQ7A 3HA5A 4HR7A 4YP5A 4DLKA 2WI8A 4CV2A 3D4IA 4S1WA 4ZCLA 5P8WA 4FR2A 4DMRA 4BB6A 3PDCA 3ETLA 3ABQB 1CK4A 1MBZA 4IDCA 4V3BA 4XX0B 2ATEA 3QEOA 1Q15A 4IXNA 3IAS6 3R3ZA 2VNIA 4OB7A 3RBXA 2ZE7A 1OR8A 5A0FA 3H17A 3PV0A 3ZIDA 1O6ZA 4YDSA 3DZGA 2CLIB 4UUOA 5KNDA 4BLUA 3AY3A 4QYIA 3DZKA 3JWIA 2MMCA 3FROA 1KI1A 3ETGA 4MW5A 3EXIA 1YJ5A 3H42B 3STTA 1E2LA 3NOXA 1ZMTA 1VGQA 5CDFE 1JR6A 3VSEA 4EF4A 3P71T 1M0SA 1VKNA 2C9BA 5LA6B 3BXEA 4JY7A 5JZVA 2IHKA 5E7JA 1C14A 2F1RA 4CM9A 3O31A 2XB2A 3J7AC 1LFAA 5ITVA 1S2OA 3OT1B 4LC1A 4IHAA 3FY4A 3GFTA 4U9IS 1PSWA 3S2FA 1B15A 4IIEA 2CNBA 2IUYA 3QOWA 4FYWA 4KVZA 2KBFA 4OBXA 3QE3A 4QFCA 4UASA 1EWKA 3UPDA 1VJGA 2VRWA 3EC2A 3LY5A 4PLYA 5DM4A 3TLGA 3U0BA 1H23A 4EUNA 8ABPA 1RZVA 3VGJA 3KFXA 2W2VA 1ESEA 2BGWA 3ZDYB 3R7AA 1KTIA 1MX5A 2AWOA 2G0TA 1W85A 4NU8X 3ROXA 1SQ0A 1P60A 5I51A 4Q34A 1P1JA 2X2PA 4KR7A 4TTSA 1ZNWA 1T3ZA 4P08A 2PN1A 1W36B 3N74A 2XODA 4FEEA 1CX9B 4HNSA 3UCEA 3ZWWA 1KI4A 2UKDA 4G1BA 3EXG1 4PRZA 5BW4A 2QM7A 5G53C 3QFRA 5E9JA 3CLVA 4LZJA 5F21A 3KE8A 4H18A 3W5HA 3GRZA 1OTXA 2IHYA 2XA1A 2ZSEA 3G9TA 4IZHA 5ALGA 1QRUA 3Q3HA 1MX1A 1J99A 1NVVR 5EEGA 4D6PA 1N2JA 8GPBA 5A03A 2H2DA 2HMWA 4YAFA 3VHXB 1S2IA 2HHLA 1BN6A 1RPZA 1X92A 3G8YA 1P17A 1MR3F 4I5FA 1TECE 2IE8A 2XD9A 1EXVA 3GGDA 4CR6A 4I2NA 2ZWIA 1X74A 1XMJA 1MH1A 3M6IA 4OKSA 2MSNA 1R00A 2FMFA 1PR6A 1VL8A 1KK0A 3KAJA 3SOZA 3WFJA 4HNVA 1GSAA 1C1YA 3C4JA 3QITA 2QG9A 2XGSA 3C87A 3G0HA 1LTHR 3IESA 1EK6A 4A6XA 3CNNA 4G81A 3T7JA 3F6PA 3AI7A 3L49A 4GRIA 2PBFA 2FPIB 2I7XA 3ITEA 3QV1A 3G59A 2WZQA 3MBIA 3NFRA 3SF0A 3SE0A 1EK0A 3WLSA 4K6GA 3TE7A 1JLLA 4D3DA 2HXGA 2VYCA 3P4YA 4HH1A 3EGWA 4KE7A 4J2TA 1ZN8A 2OBNA 4H60A 2VRNA 1PG0A 4ZMSA 4GLOA 4MTCA 3W5IA 4BMCA 3EGEA 4GECA 3HPQA 4UXIA 3DZJA 3HUFA 3VR6H 3INRA 4XAQA 1Y9JA 2HKIA 2AW3A 3WQBA 4GKBA 4KIGA 4PIVA 5GZ3A 2R751 1CY2A 3DCIA 4M3NA 4BQSA 1T2AA 4LF5B 1HO3A 1KVUA 2D59A 2DPYA 2D5LA 2ET6A 1ZCFA 2AJ8A 3L7DA 3MERA 3TL2A 1N6HA 1TAHA 3EG5A 3KZXA 3MWEA 2FDXA 4F6LA 3K6SB 2DHRA 3DL0A 1VPVA 4GMDA 1XTVA 4ZT7A 4JI6B 2OCGA 1RXCA 2O7VA 3DMPA 1DWUA 3KKLA 3PQ3A 3GRCA 5BV2P 1DT5A 1P0IA 2AZTA 1TMKA 2PUJA 2ZITA 1FNSA 3GJ4A 2RHMA 3L93A 3PD7A 4HP8A 1O89A 4OMDA 5GOTA 1BMQA 1OT3A 3NGXA 1USKA 2COKA 4DUGD 5LYJB 4D44A 2REBA 1RQRA 1BCSA 2IE0A 2WDPA 1PT5A 2HI0A 3D4BA 3FBTA 2PSJA 4P7BA 1XZBA 2B0CA 4ZP1A 4CV3A 1J0XO 4UZSA 3CE9A 3AR3A 1T2FA 3L0YA 4L4XA 4YDHB 4FP9A 1FMLA 1A9OA 1NQUA 1PWXA 1W5BA 3NHAA 2B82A 1E64A 4AF7A 2OEPA 4ZTBA 3OE7A 1Q1NA 3A04A 1YBHA 3B13B 1DC4A 3LLUA 2WIAA 1N5DA 3G17A 4RHXA 2J0EA 4IHQA 3WLMA 2QD2A 2XH8A 3K35A 1CJCA 1TK2A 2EFEB 2Q8NA 3C6XA 4L5IA 4WOJA 1IBCA 4BNIA 1EGAA 4FDVA 2JFGA 5EIXA 1W4AA 1YRHA 2V7EA 2CHUA 3FPSA 3HCAA 3OE4A 2I6UA 3DDUA 4FFOA 4KO2S 5ECDA 3T3MB 4KR6A 3BIFA 4BKUA 2ZB3A 3K2IA 3TZKA 4E1BA 1JHQA 2RKBA 3NI2A 4EGAA 2QRPA 3MSXA 3I6YA 1JVSA 2X5JO 5IKXA 1LK0A 2BHRA 2VQ3A 3KAPA 1W0JA 3BTVA 4NU0A 1OHHA 4ZQBA 2NU9A 3E70C 1NBMD 2YNMD 1KPGA 3DE4X 1TKBA 2O05A 4YGXB 2VSFA 3F4KA 3JYNA 1IPHA 4ZO9A 3TI9A 3ZKWB 3UK2A 2HQBA 4EW1A 3LNTA 4LSMA 1J0EA 4GPIB 4R16A 1U9ZA 1FDSA 1XV5A 4PYIA 2CVQA 1YJ8A 2Y71A 4IEEA 1RRGA 3RJZA 3WRYC 4X00A 3RRNA 5CFMA 4PZ9A 1IJEA 1C0KA 3STHA 3HKDB 3VKFA 3E1KA 3JQEA 5JSUA 5K0SA 2GF2A 4ZHQF 3C8ZA 4ZU1X 1KY3A 4ZKDA 5C53B 1PGNA 2P69A 4IDAA 3K3PA 4X24A 4B6PA 2X5NA 3TO5A 5J58A 5D86A 1BHO1 2EHDA 2ZRLA 2HQ1A 1VL5A 3U26A 4LW8A 3U7EB 1OGJA 4NCBA 3FNFA 2TRSB 4B47A 2GERA 2FPOA 1LJUA 3DPIA 2F9MA 3GAMA 2YOGA 1EGMB 3F71A 2F8MA 2WJ3A 5I8WA 4BP3A 5IXYA 4QARA 2VKQA 2YHBA 3ELDA 5CBKA 4QGAA 2HWYA 1JLRA 1L4GA 2GETA 3GQVA 4GI5A 1A4RA 3IOYA 3LOPA 5I4CA 3TZBA 4NG4A 1DBPA 2YL2A 3GLHA 2WHPB 3TIXB 3AI1A 4K2HA 1VMIA 2ZRFA 1T24A 2WD7A 2Z2JA 3KCNA 5CURA 1N6PA 3R9XB 1ST2A 1L7VC 1YVPA 2Q4EA 2NZXA 1HZZA 3H86A 4Q9LA 5T4HA 3QPCA 2GO1A 4MIKA 1R9NA 5TS3A 3UC5A 2AWNA 3KJEA 4GQBA 5L3RA 1SXJD 1UK9A 3GH1A 2C3PA 3DDZX 1YZKA 2LPMA 4AJ1A 5ALQA 2BGGA 4INZA 5D85A 5JASA 1V35A 1R27A 3PJFA 5IXJA 5JI3E 3ZCPA 3QJGA 4O2AF 2WSYB 5D7BA 1Z38A 4ZAZA 4G37A 4CQMA 4G1MB 4YLGA 1RU3A 2FMTA 3V2IA 1WLYA 2JI8A 2MSLA 3IUYA 3KYCB 4RM2A 1ZRHA 2O14A 1CDOA 3N76A 4JQSA 3VO2A 4NIMA 4CG0A 1W73A 4EHAA 1UIMA 1DAIA 5DNWA 1K6EA 2QUJA 4RTKA 4WY2A 1Z29A 4FFBB 2D54A 4TSRA 1I7QB 5DYNA 3BQMB 5LB4A 1YFZA 4IIYA 1N2SA 3MCWA 4GICA 1UFRA 1NRJB 2FE4A 5ELXA 5CH3A 5ARCA 4EKDA 1CUJA 2AXEA 2Y0CA 1JDBB 2GARA 4PBTA 5ALFA 5KINB 5CT9A 4JT9A 2YXBA 2DB3A 2I34A 3IILA 1QG4A 1IHXA 1GY8A 1QH1A 3P0JA 2YNMC 4HPJB 1J5EB 2ZJ6A 1G3IA 1P39A 3QX7A 3ZV6A 1T15A 2D62A 3O5AA 4IIVA 3MC1A 4LHVA 3DXXA 4A8PA 2O8CA 4XKJA 5EG5A 5BNTA 4P3OA 3M5CA 3BDAA 4CWAA 3RKUA 4KOAA 3C45A 1HSZA 5A02A 1L7RA 3W8EA 1BKYA 1UBUS 2NACA 1AUOA 3LYLA 4KB5A 3HNOA 2GJSA 4IHKA 3IBSA 3WLRA 1GTSA 4DCMA 4MA0A 4NABA 2UZ0A 1Y4SA 2WMNB 3V46A 1BDHA 4OJMX 3SHWA 2ZAOA 1G21A 3ZE7A 1Q2XA 3E8MA 4MPTA 1YJAA 3S4YA 2CLHB 3KOZA 4LJ9A 3QK7A 1VYHA 3ULKA 4IBOA 1NR7A 3AHDA 4ZV4A 5EMJA 4Y0AA 1ZNXA 3V6LA 3FWKA 3VFDA 1PBTA 4QLBA 5DVZA 1G8FA 2QJOA 4TTJA 3PB3A 2F3PA 1OI2A 1XTSA 1PFKA 2I29A 2QD1A 2QIPA 4JEMA 1JZTA 1GTG1 1Z4MA 1SJ9A 2A0XA 3JPWA 2H1HA 1XK6A 3LDUA 1ACLA 3KSDO 2X3UA 2OSBA 5ALWA 2R7AA 1NG1A 4LQLA 2W6MA 3MGBA 2P4HX 2W83A 4B44A 3MYRA 4QDTA 2C4HA 4CUZA 3O21A 4NCXA 5LR6A 4OREX 3K9WA 3C5VA 2VF2A 1W44A 3AM5A 3JQPA 1OLOA 2FE1A 4RD6A 3X0DA 1U0FA 3OZWA 2CMFA 1MDFA 2J33A 3F5FA 3AEQA 2DWQA 1OBCA 4P4UA 1QPGA 4X6XA 1PFQA 5LIPA 3LXRA 3T5PA 2QGNA 1V3VA 4PO8A 1CETA 4JBNA 2BH9A 5HIIA 5IASA 1SQ6A 1G7SA 2NQ8A 3BIJA 4R1SA 1I0IA 4R2HA 3GGPA 2NT3A 4GXRA 3GR6A 2AG6A 2FB9A 4O2LA 5E8RA 1NVTA 1YR9A 2RGNC 1IQPA 2JVIA 1E4YA 1YFLA 1IATA 2FWIA 4X62B 2IYYA 2C78A 4TTPA 4DCUA 5HOQA 1XLTA 3LKZA 2ZRKA 2XI4A 2O19A 2DE0X 2NAPA 3BK1A 3GHYA 3ABZA 4FSDA 5K4AA 3S1LA 1F12A 2CXPA 5DGDA 1AXGA 4M38A 4D3ZA 1GD1O 1NJ1A 3IQHX 4HYYA 4HNQA 4R68A 1P5FA 1EX7A 5LL6P 4C6SA 4L2IA 1WTAA 1KYTA 2WJIA 4HWOA 4YJFB 3ENQA 1M1YE 4Z86A 4ZVVA 3N2KB 1G8AA 1Y3IA 1QDLB 1XQ6A 3CNOA 1X1TA 2YRFA 4EH1A 3F97A 1Y0BA 2GKSA 2YZMA 4NQZA 1RXVA 5GPBA 3AG6A 4O1HA 5F2OA 4ECAA 2CXXA 4HDSB 1C30A 2NP6A 1RI3A 2ZJ3A 3RAFC 2VPYA 2QAIA 1XVTA 3C5EA 3IDSA 1JEDA 1I3LA 1QF7A 1QM5A 2Y93A 3AG5A 3GD5A 4HAVA 4O4HB 4M60A 3W0LB 2I2XB 3RJ5A 1UC4B 3LCVB 1G2IA 3OJCA 3WK9A 2Z1NA 5F76A 4CN9A 1ZLYA 5A5GA 2FZEA 3M0EA 1V39A 1LTQA 4X1YA 2EL7A 2Q1WA 3ZJ4A 2YHAA 4LX8A 1XEWY 2HK8A 1P3DA 2NVOA 3K5PA 4H4DA 5AHWA 1JAHA 4EO7A 1VHDA 4K28A 1ADGA 1PJBA 2JA2A 3HRKA 4LG1A 3FHJA 5FPSA 4DABA 2ENWA 5LP6C 5DH9A 4XWWA 4M0LA 1M67A 1O5TA 4X8LA 4NCKA 4RH0A 3FSRA 3QHQA 4ZYTA 4IJMA 4ZAYA 4DV1B 5M29A 4RPKA 2PJUA 3UGJA 3FHOA 5G0UA 5E3IA 4H1HA 1U3GA 4RZHA 4Z1MA 4A36A 2C2BA 3EZLA 2HT1A 2VWGA 4BIMA 4PONA 1IXSB 5J63A 3FJ1A 2X1MA 4XCQA 4ZT6A 4LS3A 1OJLA 1G9SA 2PKRA 2H1WA 1JDVA 1NYTA 5BYKA 4S35A 4QDUA 4DCTA 3DTVB 1ORIA 1MJGM 2G8NA 1ZESA 3H97A 4K6CA 3AKCA 4EPWA 4E5VA 3F8SA 4JB2A 4J43A 3AP1A 1L5HB 1EX1A 4HYQA 4EB0A 3SR4A 4MDFA 4MPRA 1D8TA 5IBQA 1P62B 2QAGC 3GAZA 1W75A 2HJRA 1KSFX 1XAJA 3WG9A 1X7DA 4LHEA 4ZWNA 4LK3A 4YPOA 5CNMA 1NQXA 1D6NA 4JD5A 3AEZA 3M3PA 2GN6A 5AVQA 4BBPA 1A8IA 3ZIAD 2QMEA 4B3HA 2TS1A 3HBNA 4JBYA 4QTXA 1E96A 4U7PB 1YGPA 4XD2A 3COPA 3K9GA 4CR7A 2EZTA 5HKKA 1TVCA 4BXOB 2P2CA 4QUEA 1E2EA 3OWXA 5GJWC 4FHCA 2R85A 1VJTA 4NY1A 3T0GA 2OZEA 2VJMB 4DANA 4PYJA 2Y1WA 1A8PA 1LUAA 3L7IA 3SYRA 3ZE1B 3HDVA 3N8HA 3AM1A 1BGWA 4HTAA 2XQGA 4GOOD 4I55B 5EP4A 4Q93A 3K1JA 3TNFA 1Z39A 2C2XA 3JRNA 4HAXA 3IA2A 3R7NA 1GUBA 1GZDA 2A3NA 3ZOKA 4ZO4A 1LA2A 1QP4A 3P52A 4HAZA 1RRPA 3GOQA 4DQLA 3CH5A 2RC6A 1NE2A 4WW0A 3DLAA 4Q37A 1KS9A 4HAOA 4TLDA 4X1IB 3JYLA 4UBOA 1P9OA 1TM3E 2GYWA 3A2NA 3IQEA 4PY2A 3C8HA 1GR0A 4QXPA 3DVRX 2QN8A 1LS1A 1PJAA 3RR2A 1VG9B 4YJGA 1NRWA 3DOUA 3L07A 2GK3A 3UYKA 3A1NA 1F20A 4G63A 4ZAWA 1UKBA 3CUYA 3QP9A 2CBXA 2DQSA 1RBZA 3SYNA 4IGEA 1SUIA 3N58A 2PZ8A 3SQWA 3KQQA 4GNKA 3A4IA 5FULA 5J2TF 1FNCA 1TO6A 1EWTA 2BMJA 1M2FA 1IHPA 1SKUA 2BGNA 2HA2A 2P9QA 3T41A 2EJBA 4Y6GB 2C94A 1TUEA 1W0CA 2ESRA 3R75A 3N0VA 4C89A 3O1IC 3S1AA 4LAFA 4ITVA 1QQ6A 1AS0A 2GHTA 3AFGA 3TBKA 1DMRA 1RLOA 1A8HA 1UBMS 3QU9A 2EEZA 2YXDA 4RCZA 4ZIRB 3AXTA 3WO1A 1VPWA 2B78A 3Q7PA 3AP3A 3YASA 3HFGA 4NENA 3F96A 2IUUA 4EB8A 2XNHA 1ZJZA 2LCIA 2X15A 1LF0A 1UDRA 3W5UA 3L4EA 1Y8AA 1BE1A 1B16A 2F6RA 3EVZA 3I3OA 4WNCA 1X7HA 3O47A 2IHJA 5IKMA 3GMDA 1Z37A 1VLZA 4AROA 2VZ0A 1FRQA 4OI0A 1TLTA 4R1QA 3N2LA 1BS9A 1MIHA 4B48A 4OL0A 2V6MA 4R71A 3EA0A 1E62A 2MINB 1J8FA 3NTRA 4HFRA 3DDNA 4TS4A 2FK7A 3QLUC 4RIIA 2Y92A 4AULA 4RCYA 1G8GA 4MWZA 4BPRA 1D2GA 2WWGA 3MMPA 1AV7A 3MEQA 2BM0A 4FVTA 1BH6A 1TCUA 5EZ5A 2X41A 3W4JA 3ZNQA 4QOGA 3EH1A 1XJQA 3N7AA 1INLA 2JLUA 5JSQA 3ABSB 4HS9A 1TZBA 2WILA 3BERA 4W82A 3CM0A 3ZN2A 5KJFA 2DY1A 1QHHA 3ESBA 5DGXA 1RI2A 1HFKA 2D1SA 4O4IA 2VTBB 2PX0A 3KB1A 5NULA 3TD2A 1XF9A 1K63A 3GJ5A 2WJYA 3U9TA 3V1LA 4JLPA 4QWWA 4DSZA 5DM2A 4NBSA 1Y8QA 2ZRGA 3IT1A 4QQ8A 1N33B 2R6HA 4PGMA 3KYIB 1NBHA 3EQ6A 4M1MA 1UXJA 1M9NA 3NT2A 4Q4AB 3K71B 3V48A 1TJ5A 1X1EA 4OMUA 3U44A 4KNYA 3HWRA 3TOCA 4B6QA 2V4UA 2AKAB 1YBFA 2R8EA 5FO0A 1NMSA 4IUCS 4HUQA 4GW3A 5BSUA 1SIBE 1M54A 4N54A 4NBUA 1NUTA 3SVZA 4DRZA 1SOUA 5TQ0A 5PNTA 2Q1YA 2D6FA 2C8JA 1UM8A 2Q5QA 3CKLA 2DBZA 2EG5A 2NX2A 4TTRA 1E5VA 1DL5A 3P27A 2E4ZA 4XWOA 3S8EA 2CF6A 4TSFA 4DIKA 1V0JA 1XNRB 2G1UA 4QFMA 2N75A 2ZYWX 4PVDA 1U6IA 3LDGA 3MTJA 1GV0A 3EBOA 1XZFA 1WDTA 2QTHA 3R6GA 1F48A 2M9MA 4FFVA 1PEDA 4L8FA 1Q7CA 2E9SA 4OHBA 3ISVA 5AHOA 1QYRA 2CXRA 4HDMB 4O8ZA 1TGVA 5F3DA 2PQ6A 2WM9B 4WZBB 5IVPA 1EK2A 1V4NA 2NU7B 4BB0A 3TTXA 1OPRA 3OECA 3PFIA 2NNLD 3E22A 3KAQA 5BSTA 2K7ZA 3DXZA 2PIAA 3UG6A 4KHPB 4XGIA 5BURA 4F92B 3UYLA 4F7WA 3G9ZA 4P0PB 3DNFA 4MV9A 1OX5A 1TT7A 2R6DA 4H0NA 2VOJA 3NHLA 4FZJA 3CVOA 4YB8A 4YP6A