1GZ3A

Molecular mechanism for the regulation of human mitochondrial nad(p)+-dependent malic enzyme by atp and fumarate
Total Genus 200
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
200
sequence length
554
structure length
554
Chain Sequence
HIKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMTSPLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVGLACSQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDQCLPVCIDVGTDNIALLKDPFYMGLYQKRDRTQQYDDLIDEFMKAITDRYGRNTLIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTAAVALAGLLAAQKVISKPISEHKILFLGAGEAALGIANLIVMSMVENGLSEQEAQKKIWMFDKYGLLVKGRKAKIDSYQEPFTHSAPESIPDTFEDAVNILKPSTIIGVAGAGRLFTPDVIRAMASINERPVIFALSNPTAQAECTAEEAYTLTEGRCLFASGSPFGPVKLTDGRVFTPGQGNNVYIFPGVALAVILCNTRHISDSVFLEAAKALTSQLTDEELAQGRLYPPLANIQEVSINIAIKVTEYLYANKMAFVYPEPEDKAKYVKEQTWRSEYDSLLPDVYEWP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular Mechanism for the Regulation of Human Mitochondrial Nad(P)+-Dependent Malic Enzyme by ATP and Fumarate
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords NAD-dependent malic enzyme, mitochondrial
total genus 200
structure length 554
sequence length 554
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.38: Malate dehydrogenase (oxaloacetate-decarboxylating).
pdb deposition date 2002-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00390 malic Malic enzyme, N-terminal domain
A PF03949 Malic_M Malic enzyme, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1gz3A02
3.40.50.10380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Malic enzyme, N-terminal domain 1gz3A01
2BELA 3MTGA 1YJ8A 2QYSA 3AK4A 3QW2A 4UVIA 1DHRA 1YQGA 3LT4A 1D1TA 1J49A 3Q9NA 4FD3A 3WIDA 3RSHA 4R9SA 4DQUA 4NR0A 4D7AA 1EZ4A 1M6HA 3OJFA 4WEOA 4BGUA 2FRDA 4FFRA 4Q39A 1DEHA 3OJ0A 3F47A 4BNWA 1ZSNA 1T24A 1VE9A 2D2IA 4J3FA 1U8FO 3VC7A 3NAQA 3ZZNA 2XXBA 4II3A 4YAEA 4NBWA 3ZU4A 4FPXA 4XD2A 1WDKA 1Z6ZA 2Q3EA 1HDZA 4JXKA 4MVJI 5ICSA 1U3UA 2IEDA 1HSZA 3WWZA 3QY9A 2HMWA 1ENZA 1F8GA 3OH8A 3HZZA 3K96A 1DDOA 4FOOA 4HFJA 1AGNA 3K8ZA 5AQ1A 2R2GA 4B7UA 3JYQA 4FC6A 2POQX 3NYWA 3GVIA 4L4XA 4XGIA 1ISJA 1G0NA 1HZZA 1BMDA 2VYVA 2DKNA 1VRWA 1SCUA 4J7UA 1LTHR 1L7DA 4WNIA 1LNQA 1R4NA 2D0IA 4M86A 3GNQA 4A7PA 4MVJE 2ZB3A 3ZWPA 1LC3A 4XB1A 4AJHA 2RCYA 4PRLA 2Q4BA 1D3AA 1M75A 2IXBA 2I9PA 4GSKA 4ALJA 2QRJA 1E3WA 4CR6A 5B1YA 2E82A 1JWAB 3IUPA 1F17A 3BMQB 1U28A 3F4LA 1ULUA 4DIBA 2HMUA 3G17A 4BNYA 2ILTA 4O6VA 2W4QA 2NV6A 3TJRA 2VZ8A 3PGXA 4CV1A 3R6DA 3LQFA 2FSVA 1I3NA 1K6XA 1N9GA 4TRMA 4ND1A 4OIMA 4QQRA 5F3RA 1JTVA 1I24A 5JO9A 3FCOA 2NU9A 1N7HA 4DBVO 4YJFB 1BG6A 1Y8QA 3GZNA 2YV1A 5C7OO 1XDWA 3U4DA 4N18A 4U0KA 5L53A 1JAYA 2VCYA 5A03A 5IN4A 2Q4EA 4UAGA 3DL2A 4B8WA 3Q0EA 1KS9A 3GK3A 4EUHA 3VH3A 1LRJA 2FR8A 4EITA 2OP1A 4CUJA 1VSUA 2C7GA 1MXHA 4X54A 3DR3A 2B5WA 2DC1A 2PZKA 2Y1FA 3PTZA 3KTDA 3WSVA 4WCFB 5IG2A 1QR6A 4BQPA 2O2YA 1PS9A 1Y8QB 3GZNB 1K0UA 4FGSA 3JYLA 3LF1A 2J3JA 3M2TA 3FR8A 3KLPX 4XRGA 4R3NA 5I7EA 4S1VA 3H3JA 4TKMA 4U6QA 3FRJA 5IXYA 1FXSA 2DTEA 1MC5A 3Q2IA 1BRMA 4TRJA 4BMVA 2I6TA 1O8CA 3GF4A 2Z1NA 5JDIA 2Y05A 2PK3A 2DU8A 1U5CA 3GLQA 1VPDA 4D79A 1J4AA 2EW2A 1PGOA 1Q0LA 2FPGA 1ENYA 4BKPA 3UGKA 5ER9A 2NVBA 5I8ZA 2NVUB 2BGMA 3PK0A 4RPGA 4CLRB 3H9QA 4DC1A 1VI2A 1J5PA 1GUZA 4XQCA 4XWYA 4CLEA 2C20A 3DTTA 5TS3A 4NBVA 1T2DA 1Q7GA 4JK3A 2W90A 4BV9A 1P1HA 2UAGA 3RROA 2C2XA 5L4NA 3I9JA 1V8BA 1QMGA 4MKZA 3UAGA 3BTVA 4ROSA 1NAHA 2NTJA 2YYYA 4ZU3A 4J16A 1GR0A 1IE3A 1MX3A 2H9IA 1XGKA 3GVXA 3LSYA 1IB6A 4PLZA 3MEQA 3UH1A 1YXMA 3H3FA 3W8FA 2W2KA 2O4CA 1D7OA 3F3SA 2GUGA 3DC2A 5TLSA 1OZAA 2W2LA 4CMEA 3CZRA 5GMOA 4WLFA 5MGBA 4BNJA 1F0YA 3ZNPA 1OC2A 2V7PA 3DAGA 4OJNA 4RJTA 2DAPA 3ZWYA 3OEYA 2CDCA 5KVSA 3MJCA 5A9SA 2OOSA 2EF1A 5T6BA 5BSEA 5AXCA 4W9NA 4L74A 1Y5RA 4MVJD 4RPKA 4BO4A 1WDMA 1E5LA 1H6AA 3H9JA 2FMUA 2R6JA 5G0UA 1WWKA 1DC3A 3QHAA 4D44A 1KERA 4UVEA 2HK7A 3UCFA 4DYVA 2Q1SA 1LEHA 5A3VA 1IHXA 3GN1A 1HE3A 4ZRNA 1QORA 1NXQA 3Q9UA 1LSUA 2X0NA 4OGWA 1LU9A 1C3VA 2OUIA 5B12A 1T2CA 1HKUA 5EQFA 4DUPA 1ZIDA 3OA0A 1U3TA 1GTMA 4XZ3A 5F21A 1HF3A 4OKIA 4B4OA 4BUCA 4E2WA 2HDHA 3M6IA 4BGIA 3AY3A 2W2KB 4C7KA 2C5EA 3AUAA 3KRTA 5F5LA 1NHWA 1R15A 2YUTA 3JQ9A 4YDRA 3QV1A 3KB6A 4IQ8A 3RJ5A 1OOEA 4YJGB 3MZ0A 1DC5A 3TRIA 4BGVA 2J5QA 5CDYA 1PWZA 3PZBA 1XG5A 4IGEA 4KTVE 3VH4A 3KHUA 5JSFA 2DBRA 1Q7BA 1GFSA 3SJUA 5JYEA 1EVZA 3KYDA 1LDNA 4MP8A 1IHYA 1XQ6A 3JQGB 2ET6A 2BFPA 4TRRA 3KV3O 4BKOA 5TNXA 2OBYA 3LLVA 2FPIA 3DBRB 3VPGA 1KC1A 1YONA 3ROMA 4F45A 2Q1UA 3ZHZA 3ZWWA 3BZUA 4A0SA 3L0DA 1GUYA 1DBVO 2VT3A 1SEPA 3W4KA 2P9EA 3GG9A 5J23A 4PVDA 4PN3A 4L9RA 1NFQA 4R16A 4DVJA 2Y66A 2EV9A 5A05A 3RUDA 3GGGA 3P19A 4B8ZA 4BNIA 4E5YA 5H82A 1R6DA 2TMDA 3K92A 3U4CA 4CM3A 2A92A 2HCTA 4YR9A 3PZRA 3RBXA 2VYNA 4PLGA 4NNJA 1LDMA 3W4IA 1CF2O 4J4TA 4Y67A 1ZXBA 4XYLA 2DPHA 3E9NA 3MOIA 2BFAA 3RASA 1RPNA 4CQMD 2EKLA 1C1XA 2CF6A 3F1KA 3W1VA 4E21A 3RKUA 3RKRA 2D59A 3QWBA 1EVIA 3I23A 5G0VA 4YWJA 5JPIA 5KTKA 4RLHA 1QYDA 2HK8A 1NHGA 1JKFA 3RUIA 4HFMA 4O63O 2GN4A 5JO0A 1MA0A 1EEHA 4PG5A 3RU7A 4K26A 4MVJF 4CJXA 4R5HA 1LJ8A 1YL7A 4UULA 3JQ8B 2Q2QA 3DOCA 3CSDA 3GHHA 2A35A 2VZ9A 3QLJA 3WJAA 2BHLA 3ZHYA 4XB2A 2FZWA 3OQ6A 3D1LA 3P2OA 2C07A 4CQLA 1TLTA 1O9BA 2WD8A 3UXYA 4HV4A 3AU8A 4RVSA 3OFSA 5TIIA 4LMPA 5CDUA 1IPFA 1DFHA 1PJSA 4FN4A 3EMKA 1X7GA 1LSOA 4CLOA 5I9LA 3JCZA 4DXHA 5KVCA 3RIHA 3WGHA 2O50A 3KZVA 4M8SA 3OIGA 2V6BA 4O5OA 5IDYA 3K73O 2Q2WA 3H5NA 3DAFA 3LU1A 3F5SA 2JCVA 4BNGA 1PJ3A 1UXIA 5L51A 2NM0A 3GUCA 3B70A 3HADA 4AVYA 3PHJA 4BNKA 3HSKA 2E4AA 5T8KA 2X0JA 3TQHA 1ZVMA 2WYWA 4R9RA 5JAZA 4TQGA 5A4DA 1W0CA 5KOIA 3W8EA 2UYYA 3IS3A 1YWGO 4NFHA 2RAFA 3ADOA 1NR7A 2EP7A 3DBLA 4KUEA 4RGBA 1B2LA 3GMSA 4NJMA 5FFFA 3NT4A 3VH2A 5AYVA 2AEJA 3E03A 3K30A 4DYDA 3WGYA 4ND2A 1KEUA 4BS9A 4Q3AA 1FJHA 4RPHA 2LDBA 3ZN2A 1B14A 3L4SO 4PLFA 1HZJA 2B4QA 3VPXA 4J1NA 5B4TA 2AEFA 1PL6A 1ZUD1 3I1JA 3U4IA 4Z0PA 4ALNA 5BNIA 5FF9A 1GAEO 3ANLA 1ZBQA 1OAAA 4FJ1A 3FWZA 5EPOA 3MJVA 3UW3A 3ICCA 3JQBA 3QWIA 1E7QA 1WZIA 4MDHA 1GYRA 2EHDA 1XIVA 1T2EA 4RL6A 1PIWA 3OQBA 1X7HA 5BSGA 4N7RA 1GADO 1O89A 2IZZA 1ENOA 5L7WA 3GGPA 4CM8B 1YVEI 2EKPA 4RF2A 1E6EA 5A3JA 5L4SA 2V6GA 3ASUA 1CQIA 1WW8A 2JFFA 1RM5A 3D64A 2IYPA 2X9VA 4RQTA 1R4MA 3HHPA 3PFWO 1Y1PA 2I3AA 2P91A 4IY1A 4JIGA 3KLMX 2D3TA 3PWZA 3CE6A 2DTDA 1MC4A 4MJLA 1XELA 4UUNA 1SEVA 2Y1GA 3DHNA 4KOAA 5KJEA 1PL7A 4JGBA 5JBIA 1UZNA 1Y9AA 3GNTA 3S8MA 4FOSA 5BNFA 1M66A 3HDYA 4OOEA 4U5QA 1PQWA 3MWDB 3NEPX 4A2CA 3GVCA 3H9UA 3L4BC 3LC2O 1P1FA 3PGJA 4OKNA 4YAIA 3D3EA 3IJRA 5KJ1A 3OJOA 4ZGWA 3RU9A 1LA2A 3V1YA 2WJPA 1C1DA 2QIOA 4RF4A 5L95A 2HO5A 1QSGA 1PX0A 4RZHA 3K5PA 4AJIA 4AJJA 2O23A 4D3SA 4FDAA 1KIFA 3EK2A 2VWQA 3G1UA 3I52A 5KKCA 4G5HA 3QRWA 4ZHSA 3P7MA 3ASVA 1MFPA 3ENNA 2VQ3A 1YBAA 4UREA 3R0IA 5T67A 5A5EA 1ADGA 3DBHB 4FCCA 3JQ8A 4E3ZA 5L4LA 3CXRA 5CDTA 4P8RA 1RYDA 4CM1A 4DIOA 1H6DA 1RM4A 4ZQBA 3NV9A 3BMNB 1YE3A 1JWBB 4NBRA 2G17A 1XU7A 4IDEA 4YBZA 1N92A 3PIIA 1LDGA 2J3IA 2PKQO 2Z95A 4LRTB 4AJOA 2QX7A 2EG9A 4ILKA 5CG2A 4J43A 5BT9A 2X5OA 3ZU3A 2BMAA 3I9MA 2RHCA 3GEDA 3PPIA 3QVOA 2GN8A 4NH4A 3C1AA 2G82A 1EMDA 3IUSA 2VTEA 1X14A 1V3TA 4HX5A 4Z9XA 5BSHA 2Y1CA 3B1JA 4CV0A 4CMKA 4N5MA 3V1TC 4QX6A 1HETA 3IKVA 2PR2A 1A4IA 3S55A 3RCBA 4DPKA 3GHYA 1AXEA 4E30A 4IMPA 1VJ1A 1NAIA 1PQPA 1H5QA 1O0SA 1T26A 1YDEA 4ID9A 1TI7A 1RM3A 2OFPA 1XR3A 5BR7A 1XU9A 3VOSA 3PLNA 2C59A 3U09A 3W6ZA 4J2HA 1ISMA 1C0IA 3S2IA 2YFQA 2YW9A 3FSRA 3GR6A 1ONPA 5COQA 3AOEC 4U6SA 4BNVA 4JN6B 1PGQA 5DF1A 4LCJA 1CJCA 4O0LA 4QSMA 4M55A 4GWGA 2Q45A 1GQ2A 2TMGA 1NQOA 5EJ2A 2EW8A 1ULSA 4IDCA 3QA9A 3T4EA 1TB4A 3OEWA 3RUAA 4DMMA 2X58A 4DREA 4KMSA 3OP4A 1A5ZA 3JQ6A 1OMOA 3AW9A 3GUYA 3MCVA 1FDWA 1KBZA 1F12A 3HB4X 1A27A 3ZV4A 3AFMA 5HBRA 3OECA 1Z45A 4UEJA 2RHRA 4BVAA 5JAMA 4WLEA 4W6ZA 4CM6A 5KJ6A 1OFGA 2VTDA 1KEWA 1HE5A 3TDKA 3VDQA 3OICA 1K89A 1E7RA 5DCYA 3KYBA 1FDTA 5CPBA 3PYMA 2FWMX 5DCUA 5KJCA 1ZK3A 2BKAA 3CIFA 2PV7A 3ZWXA 3DBLB 2P5UA 4RVGA 3VTZA 3VVCA 3FHLA 2D5CA 3LK7A 4IUYA 4IS3A 3GDOA 4E13A 2VNAA 1C0PA 1HLPA 4L75A 1E3IA 4BO9A 5I9NA 2HRBA 3TFOA 3UUWA 1UR5A 3INTA 1PL8A 4XIYA 1E3EA 3PQEA 1N1EA 1DAPA 4CMJA 4OXNA 2DUWA 4CPDA 2EXXA 4MO2A 1YL5A 3W6UA 2DUUA 2VRCA 4K6FA 4R1TA 4WKGA 2Y99A 1E1NA 3G1TA 4JBGA 2D4AA 3AY7A 3PDJA 4E33A 5JAQA 3ONEA 4EBFA 1EUDA 1PR9A 4BMSA 4PLPA 1C0LA 2NU8A 1IULA 1HDOA 5C37A 4CUKA 3SC4A 3Q11A 2OP0A 1V35A 2FY8A 3OETA 1SMKA 2E37A 2HKIA 5T5QA 3TZ6A 4A27A 2IODA 4YAJA 3CUKA 3DMTC 4GLLA 2X23A 4FFLA 4YJGA 2B5VA 2P4QA 2QHXA 1DIBA 1KVSA 1ZK2A 2X9GA 4PVCA 4W4TA 3EY4A 3BMOB 4YAGA 2HSDA 3F5QA 1XLTA 3FF4A 4OXKA 4E5PA 4CV3A 4AJKA 2Z1MA 4LN1A 1NFRA 2O3UA 2YZ7A 1ZXLA 1TT5B 1ADFA 2VRBA 4NIMA 4BKUA 4OQYA 1UUFA 3IC5A 2QZ9A 2CDAA 5COBA 3ROQA 5L40A 3PEFA 1I10A 5IXSA 2OZPA 4D0SA 1ZMOA 4XQ9A 5A5FA 5HTOA 3QP9A 3BIOA 2G5CA 4Y6PA 4P4GA 4NJMB 2O7QA 2ZCUA 4TROA 3O8QB 1Z7EA 3JQBC 5EL0A 4AJPA 3CPSA 1YQDA 3GA0A 2I65A 1DIRA 1S6YA 2GNAA 4CLRA 4IZHA 4PLCA 4B7XA 3ENKA 4HXYA 1NWCA 5DOVA 1H9AA 5KKAA 3ZWAA 3RI3A 1LC0A 1BTOA 4L4SA 4HP8A 4BIIA 3KYCA 9LDTA 3ZV5A 4XQGA 4WK6A 2O2SA 2I3GA 4OMUA 1UP7A 4R5MA 4XDYA 2EKQA 1B8VA 1NX6A 3B1KA 5JNLA 4PRKA 2JFGA 3TF5A 3SBOA 3K2BA 3KOUA 1X15A 5IF3A 4GVXA 3VPFA 4CM9D 1DJNA 1YB1A 2JD1A 3C3XA 3JQFA 1PJCA 3ITDA 1GDHA 1T4DA 2AXQA 4J0FA 3INRA 3KEOA 3N7UA 4MINA 4BHTA 3QWHA 2NLOA 3BMNA 1BW9B 1EVJA 4GMFA 4A73A 3UFXA 4XR9A 2BFMA 3PHIA 2XF8A 4OO3A 2RBEA 1NPTO 1HRDA 4MVJP 4RF5A 4MKXA 4YA6A 4J1QA 4YACA 3VKVA 3WFJA 5KNLA 4LSMA 4U7WA 2DM6A 3RQSA 2ZYAA 4BKRA 1NNUA 5AXAA 1NR1A 2GN6A 1YDWA 1G6KA 3U5TA 1HYEA 3GRPA 3BXXA 4EI2A 1DFIA 3I83A 5TRTA 4NPCA 1AHIA 2HAEA 1WLYA 1FK8A 4J1SA 1DHTA 3P5SA 3ROKA 1KOLA 4XYGA 4IDDA 1JVBA 2WDZA 1Q0QA 3UCEA 4J9VA 1ISGA 2PH3A 1R0KA 2GN9A 1H0KA 1GZ3A 5FI5A 1XHLA 1XYGA 1GZ4A 4NZ9A 4MOWA 1K6IA 4GPD1 1ADBA 1PGPA 5L45A 1JA9A 1NTOA 2YQ4A 2GLXA 1NBOA 4IDBA 3WICA 2Q99A 1ZJYA 3DAPA 3ZWOA 1PS0A 3PFFA 4JBIA 3AI3A 1DPGA 1HSOA 1EUCA 1GUFA 1A9ZA 4EW6A 3RAJA 1WXDA 3O4RA 4AICA 1AE1A 2JAPA 2X5KO 2AG8A 2AW5A 4CMEC 4D41A 1Y8RB 3ZU2A 3NDJA 5DT9A 3OJEA 5JS6A 4YT8A 3NX4A 3OSUA 1LDEA 2EP5A 2O3SA 4CQMA 4YJHA 2GD1O 1NM5A 1BXKA 1HYHA 4B7CA 1JKJA 3LDHA 2G76A 3UCXA 1EFKA 1UDBA 3VZQA 1PWXA 4ALIA 3TL2A 3GAZA 1CETA 4D42A 2I76A 4KP7A 3S2EA 1I30A 2D5AA 3EVNA 2V65A 3O38A 3G0OA 5AOVA 4E4YA 4WPGA 2P9GA 1HDXA 1UP6A 4RZIA 4YRBA 4WOJA 2PGLA 3ZV6A 3P2YA 2CVOA 3OIDA 5G4KA 3SLKA 4IIVA 3GG2A 1P74A 3WTCA 3WGOA 2BD0A 1P3DA 3PHLA 3COSA 3JD3A 4GWKA 2VT2A 4IXTA 2C0CA 1WPQA 2GRAA 4R1SA 4RQUA 1P1KA 1KVUA 3W4JA 1QLJA 2AQHA 4L76A 3ZW8A 4N54A 1ZO8A 2ZJ1A 3CZMA 4XYMA 2FOIA 3VKUA 3HFGA 1QYXA 2JKVA 5I9MA 3ITKA 2G1UA 1GPDG 2YY7A 3IIEA 4ZD6A 5FYDA 3NTOA 4GKBA 3IKTA 1XWFA 4YJHB 1LLUA 1LQUA 1WNTA 4J91A 2VHWA 2X1HA 3QWFA 4BO6A 1AUPA 2YHIB 1XKQA 1O6ZA 4IDGA 2O3RA 3RWBA 3SX2A 3WGZA 1DIGA 3FNEA 1UJMA 1C14A 2YDYA 4D3FA 1HTBA 4XYBA 3WGIA 4YT4A 8ADHA 3PYXA 5EIOA 1W73A 2B4RO 1DRVA 3A1NA 1P0CA 3D4OA 5JFOA 1HDGO 5LDHA 1R0LA 4OOFA 1V0JA 2J5RA 2NNLD 3D4PA 3IP3A 5CAEA 4K28A 2O3TA 1V6AA 4HNGA 3ANNA 3UVEA 1XCBA 2Y0DA 1MG5A 3FTPA 4KWIA 4JBHA 5A9RA 3ON5A 3JD4A 2NVWA 2V6MA 1N1GA 2IEBA 2NSDA 4AL4A 1NASA 1FMCA 1YB5A 3A4VA 3T4XA 4FB5A 2D8AA 4PLTA 1GY8A 2OORA 2C7VA 4IM7A 5C5IA 4NFSA 3L07A 1A7KA 4N5LA 2QZZA 3GT0A 4NJOA 1I2BA 3VPHA 3WLFA 3L77A 1E77A 3DB2A 1U3VA 1EBUA 2NQ8A 4XQEA 3EZYA 1SC6A 4NI5A 5U4QA 3KUXA 3ZWBA 4CM9A 1EQUA 1PTJA 4A03A 3GNSA 2XOXA 3GFGA 4RORA 3DZGA 4J7XA 5IFLA 4FR5A 1HL3A 3QVWA 4Z6KA 4YT2A 5ILOA 1DLJA 3LZ6A 1Y5MA 2NACA 2BI7A 2Q46A 1WP4A 1H2HA 5JDIC 3WGTA 1NYTA 4LCEA 1LSSA 3VZRA 4CUZA 4DA9A 1NQ5A 2EGGA 3PDUA 1I01A 3L9XA 1AXGA 1ZMTA 3D5QA 4CR8A 4B3HA 2PZMA 2BFOA 1DRWA 2VRCD 2ZTLA 1R4MB 3C7CB 3C7DB 1YB4A 2XPCA 3L6DA 4EJ6A 5JMPA 4WLVA 1NVMB 4WGGA 2PZJA 2QG4A 4WCFA 4AFNA 3HE3A 3GGOA 1MG0A 2WD7A 3PIDA 3ZWNA 1ZK0A 3O8QA 1K2WA 4L0QA 2CNBA 3AM5A 3V2HA 3KETA 3JQFC 5ES3A 4BO3A 1P33A 3ETDA 2DLDA 4C4OA 1BVRA 4LMRA 1Y9EA 3QVTA 4YB8A 3C24A 2P9CA 4CR7A 3OMLA 1XQ1A 3IJPA 3D5TA 5DZSA 1H94A 5LC1A 2OXIA 4J0EA 4ZQFA 3G79A 3GPDG 4IS2A 1SB9A 3WS7A 1R37A 2GSDA 7MDHA 5GZ1A 3DMYA 1SZJG 2ZYGA 3PQDA 5TJ9A 3TOZA 4JJIA 5U1PA 3TZKA 4R54A 4IGFA 5JDCC 1UXKA 3JD1A 1DC6A 5KCZA 5CEJA 1WMBA 3PWKA 3HN7A 4YRAA 4QUKA 3WSWA 3JQAB 5A9TA 3GAFA 4N5NA 3H9GA 1KEVA 3F46A 4RVDA 1ZKMA 5DNAA 3S2GA 3GMDA 5CEEA 3ROPA 1QRRA 3WBBA 4B79A 5HS4A 3RFVA 5JCJD 2ZTVA 3SXPA 3ZU5A 4FBGA 2YDXA 1PZHA 4HFNA 1QP8A 5GZ6A 3NT5A 2DBZA 2OHXA 3ADPA 1O94A 1DB3A 2DTXA 1JDJA 1LDBA 2OGUA 1YJQA 4F3YA 4Z0HO 1T2AA 3CMCO 3LLSA 4UUMA 1UAGA 1B0AA 2VUTA 1MB4A 3ETGA 2IE0A 3TZQA 5ENDA 4J1TA 2GCGA 1JW9B 3B1FA 2QW8A 1GV0A 3PI7A 3DZHA 5TF4A 4YQZA 2VOJA 1P1JA 4UUPA 3BTSA 4ZVVA 4DL9A 2CVZA 3RFXA 4JROA 2CD9A 2ZB8A 1Z75A 2PKQP 3VTFA 4J4BA 1NQTA 2BH9A 3INGA 2GYYA 5L9AA 4PLVA 1DLIA 3AUUA 4RVUA 3FNFA 2WE8A 3FNGA 1Z74A 1PZFA 3GFBA 4L8VA 4EDFA 1RJWA 2PLAA 4XIJA 3KSZO 3ZI0A 5ILGA 5CPFA 5CEFA 1TEHA 4IJWA 5I7VA 3RUFA 2W8ZA 3FNHA 2Q49A 4HFRA 1IOLA 4CLDA 4GGOA 3BTUA 1A72A 4JP3A 3VAZA 2YV2A 1H9BA 2DBQA 4WE3A 1UH5A 4AJ4A 4DPMA 4DPLA 4LVUA 1JU9A 3IOYA 4BB6A 3VZSA 5JE8A 2VNSA 1GU7A 2Y68A 3D4NA 2PNFA 3PJDA 3RUHA 3AWDA 4UUOA 2IZ1A 3Q2KA 5IZCC 2C29D 3EZLA 1LDYA 1M2WA 4IPTA 1CWUA 4H15A 3NGLA 4NU6A 2WSBA 5CG1A 3WGGA 3EUWA 4Q3CA 4UEKA 1P44A 3ZGYA 2EJWA 4DQXA 4BO7A 1ONOA 1Q0HA 4Q3EA 5JC8A 1YS4A 3FWNA 1UXGA 2P2SA 4NG5A 1PR3A 2Y0CA 3DZBA 5C7LO 1ENPA 3O26A 4XGNA 3E82A 4GGPA 4CV2A 3GH3A 4Q3DA 4QT0A 5G0TA 5KVVA 4MP6A 4URFA 4DMLA 1O95A 1D1SA 3L4BA 4YJDA 1PS8A 3V2GA 5JY6A 1YQXA 3JYOA 3ICPA 1EVYA 1P77A 2H63A 4PCVA 2AEMA 1QYVA 2AE1A 3KVOA 4AJNA 3HB5X 1HLDA 1YL6A 3NGXA 1BHSA 3LC7O 3UKOA 3FPCA 4TZTA 3QJ5A 3HUDA 2X5JO 3JQ7B 2J3KA 2VN8A 4LVCA 2A94A 3TNLA 2I67A 3ZHXA 1F14A 3NDIA 4MVJM 3ST7A 3WFIA 5JY1A 4R68A 5FWNA 3FTNA 3C8MA 1ID1A 2RH4A 2X22A 3C1OA 4Q3BA 2SCUA 4FFOA 1VKNA 5L7YA 3E6AA 5A1TA 3EAGA 1ZEMA 1N9GB 4CLHA 4OSOA 3HDHA 4ZQEA 4ITUA 4WOKA 1E3WB 1E7SA 2E6UX 1GCUA 2OBNA 3AM4A 3GOHA 2OL4A 2B83A 4MVJG 2ZKLA 4RO0A 4WASA 4Y6SA 4BNZA 4CMBA 5KJFA 1HEUA 3AUTA 1E0DA 4PLYA 3ZNNA 4K9DA 4ND4A 4RDHA 5H81A 4OAQA 1H6BA 2Y67A 3T7EA 3V5NA 2YHUA 4WLNA 3DMTA 1ZCJA 1U5AA 3WG9A 5BNTA 4D46A 4QFDA 2O48X 4A26A 2JD2A 6ADHA 1RWBA 5HS6A 1CRWG 1EUZA 1Y7TA 1U4OA 5A06A 1LSJA 1W4ZA 1EDZA 1LRLA 3Q6IA 1SNYA 4IDFA 1JQBA 3KYDB 1PJTA 3SLGA 4HY3A 2ZB7A 3I3OA 1TVEA 1OI7A 1TT5A 4FS3A 1GQYA 4LK3A 3VPSA 2NTNA 1FDUA 4G65A 3JV7A 3C85A 4RPJA 5JC1A 1HT0A 2GZ2A 3H4VA 3ZNOA 5L3ZA 4IXWA 1NPYA 2H1SA 3MWEB 5JW6A 4ND5A 1QKIA 5C7IO 1ZFNA 3RC1A 4EZBA 4HUJA 1GYQA 2VYND 4JP2A 4XA8A 2FR1A 1E1KA 4PZCA 1VKOA 2A4KA 3D0OA 3ORFA 4MIEA 4U0JA 3AOGA 4D3DA 4CLOB 4CMIA 4JLWA 2QYTA 3WJ7A 1IZ0A 3CMMA 3A06A 4D45A 1WZEA 2AQIA 3L9WA 2D1YA 3DQPA 3IP1A 1T4BA 3WMXA 2ZJ0A 4LISA 2BRUA 4R3WA 1NPDA 5CDGA 4GL4A 4FW8A 3L6OO 5F1KA 1G1AA 3H2ZA 4E2ZA 1LRKA 3RJ9A 1PEDA 4H3VA 4GX2A 3MJ4A 1GV1A 5TJHA 1SB8A 1ZEJA 4Z9FA 5A9SB 2R00A 1NFFA 1VM6A 4OXYA 5GY7A 3WNVA 2EGHA 2PGDA 5G0WA 2CZCA 1JVSA 4NMHA 4CM5A 4H16A 3M1AA 4FGWA 5EINA 3ZH2A 1KYQA 2HU2A 4BKQA 1O5IA 4XGKA 5CDSA 4CM8A 3QWAA 4OSPA 3WQSB 3PJFA 4J49A 1EDOA 1WAMA 3A28A 3FI9A 2ZIZA 3PHGA 4GKVA 3OM9A 4M49A 4XRRA 1QV7A 4E2YA 1KVTA 4IBOA 5AVOA 3MTJA 4OH1A 1HDYA 4YRDA 2FR0A 4FSHA 3ZV3A 4ND3A 1P9LA 4EEZA 3Q3CA 4QO7A 2VUSA 3I4FA 3IQDB 3I4CA 1VL0A 1X13A 1EFLA 2JHFA 1D4FA 2RH8A 2PKRA 5ITVA 2PGJA 3E8XA 2X0IA 1NQAO 3R3SA 2C5AA 4KUHA 4E0BA 2NQTA 3VH1A 1E7YA 4DTIA 5LCXA 3ZCXA 1F06A 4D0RA 4YAKA 1P31A 4BL5A 3AUSA 3I9LA 3PQFA 1U4SA 1HE2A 4D43A 4C7JA 2DT5A 1C1DB 3F9IA 1I2ZA 3HJAA 3LT2A 3OJLA 3TWOA 2P5YA 1DJQA 1K6JA 2UV8A 3FBTA 4Y9DA 3BA1A 4NK5A 3UICA 3WQQA 4BQRA 1PU2A 1KEPA 3EW7A 4M89A 4B4UA 1E6WA 3FN4A 1NVTA 2VZ0A 3WOHA 4WLOA 2GZ3A 1K3TA 3WYBA 5I7FA 2O7SA 4O1MA 3E48A 4QECA 4WUVA 4YTEA 4GX0A 3QVXA 4HADA 4RLSA 4J2OA 4ZQHA 3JQ9C 4J6FA 1W8DA 1B7GO 4XX0A 3W8DA 1MGOA 4IIUA 2VWHA 5C3MA 4ZN6A 1H93A 3MOGA 5I8WA 3VZPA 4ALMA 3JYPA 3KEQA 1UXHA 4B4WA 1U2GA 3D3WA 1VJ0A 3DO5A 3DWFA 3H9EO 1KVRA 4G2NA 1EBFA 4K6CA 4TSKA 4PG4A 2BF7A 5G4KB 1ZK1A 3PLRA 3GVHA 1I36A 1GPJA 1XEAA 1P1RA 4KDFA 1PJLA 5G0SA 3BMQA 5LDGA 2O4UX 5EESA 2DFVA 1YH3A 1I3MA 5A04A 1YOVB 5KIAA 4BMNA 4DLAA 1SBYA 1A71A 1QXSA 4XR4A 1L1FA 2CUKA 5ITWA 1S7CA 3GRKA 4NBTA 4UVGA 3ZHBA 2GPTA 1LUAA 3LC1O 4IQGA 3JQAA 2EJVA 4XCVA 4UVHA 2X86A 3JD0A 1UXJA 2PD6A 3GEGA 3A14A 1MUUA 1EE9A 3G3EA 4QO8A 3E9MA 4GX5A 4PG7A 4AJ1A 4MVJH 3JQGA 1HDRA 2P4HX 4E2XA 5EERA 4IJUA 2X9NA 3UOGA 1EK5A 2HMVA 3DFZA 1Z73A 3U49A 3PYLA 2Q50A 4YYZA 3NT2A 4F6LA 1SAYA 1UDAA 2YQ5A 1JLLA 2VHVA 4RCVA 3ZWCA 4BO8A 1PSDA 2PH5A 2ZTUA 2VUUA 2A9FA 1U7TA 4CMAA 2YJZA 5JDCA 2FZEA 3KO8A 3IAHA 1Y6JA 3K31A 1F8FA 3E5RA 3RC7A 4R51A 3DFUA 1UZMA 1M76A 2GO1A 1R66A 1B16A 1BXGA 4FFPA 1X0VA 4LGVA 4BB5A 4BNLA 1B8PA 1V9LA 3HQ4O 3D7LA 5KVQA 4Z3DA 1B8UA 2X6TA 3GPIA 3MJEA 1IZ9A 4IJKA 1B26A 1U1IA 2Y1DA 2NVUA 4Y6RA 3EGOA 2Y1EA 2WEKA 2AG5A 3DZKA 3DZJA 3ULKA 4BNMA 4Y98A 2IRWA 2XXJA 2NUAA 2VOEA 3TPCA 2PFGA 2QQ5A 2WTBA 1DO8A 1U3WA 1UZLA 4IJVA 4R1UA 3WXBA 3JQ7A 1ZH8A 3A9WA 1BVUA 1ZK4A 5B4UA 5TT0A 3TL3A 5DOZA 2NTVA 2LDXA 3E9QA 3Q1LA 3M1LA 4B3JA 4W7HA 1VSVA 2JCXA 2FPPA 3VDRA 5IZ4A 3KSDO 1PJ4A 4M54A 2JL1A 3JSAA 4EEXA 1ONNA 3CTMA 4I8XA 1GD1O 3JYNA 5EMHA 3WDSA 1PJ2A 3DBVO 2WD7B 1N5DA 2ZQYA 4I5GA 3RVDA 1ZW1A 3HFSA 3MJTA 2F00A 4BO0A 4XDZA 4UEOA 1C1XB 2PD4A 4CMHA 2H5LA 3GQVA 4NBUA 3WB9A 3M2PA 4FC7A 3NJ4A 4HWKA 4PG8A 5F5NA 2HUNA 4YVFA 4LRSB 1MXFA 3F1LA 4RVFA 4XEHA 4QXMA 3X2EA 1AN9A 4I08A 1CDOA 3DHEA 3LVFO 4FJ2A 4BNHA 1ISHA 3AY6A 3RUEA 2J5KA 2JHGA 3OBBA 3GC6A 2CDBA 1BW9A 4WEQA 2CMDA 4CL3A 3LF2A 1LXCA 1YGYA 2I99A 1C0KA 2JCYA 5B4VA 4I1IA 5EQDA 2X7HA 3DEYX 5DP1A 1CERA 2OO5A 5B37A 4GVLA 3SC6A 2CFCA 3DBHA 3NDRA 1ISFA 2HQ1A 2V6FA 4LSWA 2YFHA 4F46A 2PZLA 2HK9A 2IZ0A 4P4NA 1I0ZA 5AXDA 2Q1WA 1ISIA 3I6QA 3RC2A 3S2FA 4E5MA 2GASA 9LDBA 4KZPA 4BV8A 4U8GA 4M87A 3K9QO 4P22A 3H5RA 4O59O 4GAEA 1PZEA 1KETA 2FHSA 3EHEA 4E6PA 2Y1OA 3BMCB 2VHYA 3NRCA 1PGNA 4KQXA 3U62A 3UHAA 1P1IA 3PP8A 3TFQA 1HDCA 1IY8A 4TVBA 1DOHA 3F6YA 4KQWA 5DBFA 3DZIA 3H6KA 3AM3A 3G49A 4YPOA 1DRUA 1LLDA 1E6UA 2I66A 1WMAA 3WGQA 2O3QA 3UF0A 1TT7A 1N8KA 5TT1A 1ZJZA 4ALLA 4BO2A 4CL8A 4BNXA 1DXYA 4I5FA 4PG6A 1PJQA 3V8BA 5ICMA 1W6UA 2DVMA 3LT0A 2GZ1A 4I9HA 3IL2A 3LT1A 4JNKA 2GGSA 1FF9A 1SPXA 3ONDA 1IUKA 4HKTA 3ANMA 2CF5A 4TZKA 5JMWA 1I3KA 1ZSVA 3ZNQA 2EWMA 3BMOA 1E1LA 4PFJA 4PIVA 2PA3A 2WWRA 1J6UA 4OL9A 1R16A 5COAA 5K6AA 1X0XA 2C82A 4CM4A 4J90A 4JJGA 4UVDA 4BNNA 1RM0A 1N2SA 2FN7A 1ORRA 1YBMA 1SOVA 4W9NC 2PTGA 4NK4A 2BGLA 2VWGA 6LDHA 2O3JA 3KXDA 4MP3A 4AG3A 3WIEA 2JFHA 4TKLA 1B3BA 2IDZA 3DOOA 3E1KA 4EJ0A 3E18A 5TQVA 1TXGA 2AQ8A 4YEDA 1I8TA 1LLCA 3QVSA 4BNFA 3BHIA 3ONFA 1AHHA 1VL8A 1B3RA 4XJSA 3TZCA 1V3VA 5A02A 3HDQA 1Q7CA 5HWSA 4RF3A 2VHXA 3EYWA 2B4TO 2RIRA 3QSGA 1E3SA 4MIYA 1E5QA 2Y0EA 3H65A 4CM4B 4BO1A 4E5KA 3GVPA 3KSUA 4KTTE 5K0ZA 1E3JA 1UDCA 1A4UA 4AJEA 3U4HA 3GN2A 1U7HA 1YOVA 3DONA 3PWSA 4R01A 3JQEA 3F4BA 4I9UA 4IMRA 4NU5A 1N7GA 1BXZA 5HRUA 3T7CA 2F1KA 1ML3A 4DRYA 4ZRMA 1GYPA 3D3WB 2HRZA 4BGEA 1QG6A 1P0FA 1WVGA 3X2FA 1I32A 1BGVA 2NU6A 1PGJA 3I9NA 4Z0TA 3S1LA 4GQAA 2NWQA 1IPEA 5KWEA 1R12A 5JAIA 3V2UA 2AE2A 2DQ4A 4NFYA 1DIHA 3AOEA 4Z9YA 5DDIP 1LQTA 1EE2A 2WE7A 4BO5A 1GZ6A 4ESOA 3GEMA 1MLDA 3KM0A 1VLLA 3I9OA 2HMSA 2Q2VA 4P38A 5G4LA 5THKA 3NUGA 4CLXA 1EQ2A 4P4LA 3NTQA 1TA4A 1Z82A 3HNPA 3R1IA 4ONEA 3I9KA 4XJTA 4EYEA 4A5OA 3FBGA 4GBJA 2Y93A 1E1MA 1OC4A 3AU9A 1Q1NA 5TC4A 3AFNA 5JXWA 1E7WA 4AJLA 4L4RA 4DLLA 1L7EA 3NKLA 1H6CA 3GDFA 1BDBA 2GR9A 4FJ0A 4ZQGA 3WLEA 3ZWVA 3WQRA 7ADHA 4OYRA 3CINA 4CM7A 3QE3A 3RBVA 5IDQA 2YHIA 3RBZA 1MFZA 2HLPA 3CEAA 1RKXA 5AXBA 2B0JA 3RC9A 4R1NA 3B6ZA 3DXFA 4IQ0A 2IYOA 4GSLA 1JAXA 2E48A 3HG7A 4RVHA 1JKIA 4DLBA 3JQAD 1D8AA 5JCXA 5T57A 2J6IA 3H5AA 5HM8A 1X7DA 3C1TA 2PY6A 5DP2A 2B36A 2I5PO 5JYDA 3DBRA 4XKJA 1ADCA 1M67A 3O03A 4MPDA 4PLHA 3TOXA 4ZA2A 3ABIA 1YKFA 3WWYA 1G0OA 1ARZA 3ZDFA 3BAZA 1M6WA 1BWSA 1QYCA 4QTZA 1J0XO 5ENVA 5F1PA 4BNTA 1U2DA 4KDEA 4CODB 1U9JA 3U0BA 3AJRA 2J3HA 4OM8A 1LI4A 1BSVA 4CMCA 2JJYA 1WDLA 3N58A 2BLLA 1T1SA 3O9ZA 1BDMA 1P45A 3CH6A 2P68A 1I33A 1NVGA 2QRLA 4NHEA 3STHA 2PWZA 4TRNA 2HMTA 1T25A 3KYCB 3WNQA 4A10A 2GDZA 1CIVA 3BHMA 3WYEA 1LX6A 1MP0A 5DBGA 4DC0A 5DCWA 2E49A 4HBGA 1JN0A 1ZNQO 1PJBA 4DBZA 1QYWA 3KBOA 4XYEA 5IDXA 4W99A 2JD0A 3JQCA 4GI2A 5K9ZA 3BYZA 1Q2XA 3NTRA 4BOYA 4JX8A 5DBIA 1HXHA 2ZB4A 4J4HA 3FPLA 4DGSA 4ZICA 3I5MA 5BQFA 1V3UA 3BHJA 3JD2A 4B3IA 4WCDA 1VJTA 5THQA 2NADA 1E92A 1UP4A 3H7AA 2HJRA 1FDSA 3RFTA 1LBEA 2EEZA 4TMFA 2R00C 2X0RA 4WJZA 2B37A 3PRJA 1GEEA 4Q9NA 4IDAA 2H6EA 1CQJA 4ALKA 1KY4A 2VYVD 2Z5LA 3C7AA 1GQQA 4NDNE 1NP3A 2JAHA 3PXXA 4PLWA 2WYVA 2AQKA 5ADHA 2GERA 2VWPA 4TWRA 4DWVA 5I7SA 4FIZA 1DFGA 2ZATA 3DOJA 3DZFA 3WYCA 1EK6A 4PZEA 2IXAA 1DC4A 3OQ1A 3H8VA 2CSUA 5T64A 1PQUA 1R4NB 5IJZA 4HNHA 1DSSG 3MJSA 5FI3A 1Y81A 1XSEA 8LDHA 4MIOA 4RPLA 5IN5A 3OF2A 4WLUA 1GCOA 4J7CA 4CMIB 3DTYA 4S3MA 1Y8RA 3WBFA 2AA3A 4QEDA 3V1UA 2EIHA 2NU7A 5MDHA 1I2CA 3K2EA 3WX0A 4YQYA 4EUFA 3R3JA 3RUCA 4DQVA 2ZK7A 5T8KC 3AI2A 4GX1A 1KVQA 4EJMA 3EDMA 4YXFA 3PHHA 2CVQA 1VL6A 2VHZA 3I6IA 4YCAA 1YO6A 4WNCA 3LYLA 3OA2A 5BSFA 1QLHA 2WM3A 3BMCA 3E5MA 3WTBA 2G0TA 4K1LA 4WCFC 2OMEA 4CQLB 5IZCA 1RYEA 2FSSA 1SO8A 4L73A 5JLAA 1E7MA 1KC3A 4RDIA 3WR5A 3FR7A 4IZIA 1CEQA 2DFDA 4KWHA 2X8LA 1FDVA 1VC2A 3GDGA 2UVDA 3WMWA 3B20A 1I5RA 4J9UE 4M1QA 3GY0A 2CY0A 4W7IA 3TSCA 2HJSA 4JCOA 1OBFO 4F6CA 2WYUA 3ETEA 2C54A 3L6EA 3EVTA 3U3XA 3DDNA 4JQCA 4E12A 5EN4A 4PGFA 1YBVA 1R0SA 4QFCA 1A7AA 4CQMB 4TVOA 3ZWMA 1U8XX 3PVZA 5CHEA 1GL3A 4Z3KA 4EGFA 4ZJUA 1UAYA 3QIVA 4R4JA 4R69A 1YRLA 5F1OA 1SOWA 3QQPA 4NQZA 1ZZEA 2C2YA 2ZYDA 4YT5A 3OIFA 1X1EA 4E32A 2W98A 4II2A 2X4GA 2YV3A 3VVBA 1H2BA 3CKYA 3JTMA 3SVTA 3N74A 2AMFA 3SJ7A 1DAOA 5L7TA 2FP4A 4GMGA 1PZGA 2DPGA 4E5NA 3PJGA 1XA0A 4BNUA 2PD3A 4W82A 1CYDA 4G81A 1T1RA 2B35A 4I5EA 4I9NA 1B15A 1I3LA 1NWHA 4JJFA 4PZDA 5IDWA 1K5HA 2ZTMA 2UUPA 4YJFA 1E3LA 4IINA 5GZ3A 3EC7A 1LLQA 2BGKA 1HYGA 1A9YA 3SEFA 1MV8A 5DN9A 3DHYA 2BI8A 2J8ZA 3FD8A 5DULA 1GEGA 3AI1A 4MKRA 5CP8A 1T2FA 4E31A 4DIFA 3IMFA 5CFZA 4KUGA 2Q1TA 2ZQZA 3VHRA 3H2SA 2QRKA 3HWRA 5TX7A 2GF2A 1X1TA 4WECA 4OHUA 5JCJA 5H83A 5TSDA 3RD5A 3TZHA 3K6JA 4H7PA 4OQZA 5U9CA 2DBVO 1ZSYA 4LW8A 3BTOA 2W2LD 4INAA 1DIAA 3JQDA 3TN7A 3U9LA 2UUOA 5IAAA 4R41A 4EUEA 1IYZA 5TGDA 1IL0A 3NJ8A 4GLOA 4FQ8A 3GZ4A 2WMDA 5G2OA 2B69A 4AJ2A 5HA5A 4CMGA 1HE4A 3OHSX 2EERA 1QV6A 2UDPA 2ZCVA 4RV9A 4MVJA 5K6AC 4Y8VA 3HN2A 4I5DA 3HDJA 2AHRA 2XAAA 3ZW9A 4FFNA 4GH5A 5ER6A 1HWYA 4Q3NA 3UN1A 5FEUA 3IDSA 4B4VA 1BXGB 1Z7BA 3PJEA 1KY5A 4FFMA
chains in the Genus database with same CATH superfamily
2B3DA 2BELA 1JKJB 2R6ZA 2ZRNA 3MTGA 2LKCA 3PUVA 4JUBA 3RFFA 2C8KA 2YXPX 3UMMA 1DHRA 4JB2A 2WLSA 1JEQB 3Q9NA 1SXJC 2C4TA 3UWSA 5BR1A 5KOHB 3RSHA 3T5BA 3MMPA 4FNAA 4DQUA 3O8LA 3HABA 2VDJA 2FRDA 1Z12A 1G20E 1DEHA 1E1YA 1FQOA 2WWWA 3HLYA 3KLBA 4HR7A 3NAQA 2H1RA 2HU8A 2WHYA 1OLSB 2XXBA 4II3A 4L22A 5IULC 2OHOA 1WDKA 3DOHA 1FSGA 1U1FA 3CRVA 3Q88A 3LGAA 2PJDA 4CCSA 2UZAA 1ODLA 1GKKA 3ZE7A 4E7PA 2ZWIA 3NHWA 1DBQA 2DFKB 3DT6A 4Q4LA 3RHFA 2HMWA 3G6WA 1F8GA 2KYRA 1E4EA 4L0DA 2VJNA 2QNIA 1T8TA 3RWOA 3SVZA 4YP7A 1A97A 2R2GA 5KYUA 3JYQA 4OJYA 1Z2DA 1ETHA 1NM5C 4A0FA 4B73A 2C04A 4L4XA 3RJMA 1Y9JA 3TUZC 3EWAA 2JBAA 5BYBA 1JMKC 1A9OA 1Y3HA 2I71A 2JFUA 3EH2A 1ISJA 4O2BA 1ZU5A 1Z5WA 1BMDA 3GLGE 5H3LA 2O8EB 2FN4A 1QOQB 2DKNA 1YK0A 1SCUA 4F5ZA 1I7PA 1LTHR 2DULA 2BGUA 2D0IA 1N8NA 1TZ2A 3PT5A 4M86A 3ZG6A 2VJYA 4AN1A 2RK4A 2ZB3A 3JAWA 3LIPA 2RCYA 4YP0A 4G07A 4XGQA 4LJSA 4U00A 2PNJA 4NEHB 3SJBA 3LXUX 3N2KB 4P7BA 5BQ5A 3TLMA 3KKPA 3RYCB 4KR2A 5B3AA 2LUOA 3BM5A 2PUBA 2E82A 3G13A 3V7YA 4B4DA 1U0FA 5FAXA 1F17A 1GNTA 3DV2A 1I9GA 3F4LA 2HMUA 4D9CA 4BNYA 4NMWA 1AZSC 1O95D 3WIBA 3WKCA 4DCCA 4JYAB 3QF7A 4CV1A 3V97A 3ADKA 4Y2VA 1K6XA 1JBEA 1F0NA 4Q93A 3CTPA 4ZYTA 2KQUA 3GFSA 4PXSA 1BIFA 5F3RA 4HGRA 5HGXA 1ES9A 3A9CA 2I87A 1A5TA 2FQYA 2F1IA 1CJKC 1SUBA 1DEXA 1R9MA 2R6R1 2ST1A 3QKSA 4AUEA 3GZNA 3MQ4A 4KLAA 5C7OO 2XUGA 1XDWA 3S2YA 4U0KA 2OYSA 2CYCA 5L53A 1I2AA 5KREA 2GM4A 4UM8B 2C9MA 1T9DA 5EXPA 5DH9A 2YV5A 2CSXA 3O82A 4UAGA 3Q0EA 3VH3A 2FR8A 4IR7A 1W85B 4X8LA 1KZGB 1KI6A 1VSUA 1MXHA 3KAQA 2EJTA 3BFPA 3E0QA 5SV2A 3WSVA 4Z51A 3B6MA 4WCFB 4UU0A 1W36B 1QR6A 4I5IA 2O2YA 3GZNB 1K0UA 2EQBA 3COPA 4PCLA 1TQ2A 1W9HA 3GJXC 3KLPX 3BN3A 4GRDA 4J0QA 5I7EA 4U02A 2C8VA 3A6PC 5DEOA 3FCYA 5KNBD 5KTTA 2BKUA 3BRSA 1FMLA 1MJGA 3H3JA 4K0RA 5CT9A 3O5AA 4TKVB 1X7XA 1ZM4A 2NTYC 3MMNA 2M1ZA 5JQWA 3V1MA 1BRMA 4ARVA 3TLGB 2NZUG 1O8CA 3FDZB 5HTKA 1XCOA 2DHDA 5B53A 1U5CA 4M8NE 3GLQA 1C4XA 1WUHS 3H9BA 3NAMA 1ZL0A 1PGOA 1Q0LA 1PEYA 2FPGA 2F7SA 3EOAI 2EP8A 1BROA 2NVBA 1KA9H 2RGYA 5DM70 3MTAA 2VJOA 2YVQA 3HBAA 4BV3A 4XGRA 2VLBA 4EAQA 2ZJ5A 1YDMA 1KI2A 2ZT7A 2PO7A 3O0DA 1A5BB 4XQCA 4XWYA 1P9NA 2C20A 5IAKA 5BYJA 1QFSA 4NBVA 1T2DA 1XVAA 1NV8A 2ZVPX 4ZI5A 1GL6A 4JK3A 1QX4A 3S70A 1TO1E 4ZGGA 1H5UA 3O1JC 3X1DA 4Y7CA 3KPVA 3VC2A 3RROA 1ONSA 3NS7A 1MB9A 4YRKA 2WLTA 1QMGA 4C2TA 2IT1A 2W0SA 3GJSA 4WKNA 2WK1A 3GLHA 1ZVVA 1D5WA 2NTJA 1AO0A 4ZU3A 3KG2A 1VMKA 2QTWB 1IE3A 2H9IA 4L1KA 3T34A 5TPZD 2O2ZA 1XGKA 2HDOA 3LSYA 4IEIA 5KQSA 3CO5A 2P2DA 1IB6A 3OZIA 3DB1A 5FUYA 1Y4UA 5I01A 5GV7A 4TV9F 3U1TA 2WP0A 4LGYA 4KEAA 3G7SA 4Y2GA 4X95A 1FUYB 1CUGA 2DFTA 4L15A 2Y0BA 3EN0A 4XIFA 4B2LA 2WNHA 3F3SA 5EVCA 1CUAA 1GNLA 1NDUA 4FWTA 5HUHA 3W5AA 2W2LA 2X3UA 4FQ7A 2FUNB 1G6Q1 3CZRA 1Z28A 2AOVA 2ZS8A 5DNYB 1LPSA 4G4SP 4BNJA 4RM2A 3GCGA 4WK0B 5BRJA 4KBYA 3PCRB 3UB4A 2R65A 2CJPA 4KK3A 1S9HA 2GHRA 2CDCA 1P75A 3GDHA 1GG5A 1Z37A 2PT7A 3V8PA 3W5IA 2Z30A 5A9SA 4I1PA 5HR5A 5BN5B 4DLVA 3G2MA 3LGSA 3NVKI 5A5DA 4W5HA 5DLEA 4ZAWA 3GRAA 4MVJD 1XDUA 3EMDA 1WBDA 4GR9A 4BO4A 1JG7A 4XWKA 2ZYRA 3CJRA 1TF7A 3OEHA 3NALA 1TF5A 1FMFA 2FMUA 2R6JA 3HNOA 5G0UA 3QHAA 1DC3A 4OI4A 4HF7A 1IXSB 2AN3A 3AF1A 3OEED 3UAVA 4OQXA 3DEKA 1BQ3A 2D62A 1IN5A 1HOXA 3MQFA 3WADA 4DABA 5BRAA 3SK0A 4GXTA 1NIJA 2FI1A 1EAMA 1NXQA 1QORA 3Q9UA 3VR1A 1LSUA 1ODJA 1C3VA 5I7UA 5B12A 2PGAA 1HKUA 4H4EA 3ITEA 4CU2A 1DKOA 5C7YA 2HBYA 1SVMA 1WUIS 3ETNA 4YROA 3U13A 4B4OA 4E2WA 1S8OA 4FMDF 1OIXA 3M6IA 3HDTA 1XK7A 2PGXA 3VSDA 2V98A 2QXYA 1EVKA 3NEAA 1BN6A 3HVHA 4JIMA 3S4YA 1NHWA 4B6QA 4JBWA 4L57A 4DDTA 4L9AA 5JYBA 4F9FA 2A9OA 1XV5A 2J67A 3ZHVA 2ADMA 1DIOB 3RJ5A 3ROXA 4Z86A 3QKWA 4WOPA 4FNMA 4EX6A 4QTYA 1VA4A 2R96A 3L46A 3M1YA 4HZGA 4EY6A 5CDYA 2FOLA 2XCTB 1MT0A 4NLLA 4IGEA 1DP4A 1LJLA 3N8DA 3OZVA 3AT1A 5JSFA 1PK7A 1GFSA 3SJUA 1QP4A 3R23A 3WAGA 2HF2A 4OREX 1DEKA 1KXJA 3AF0A 3EIFA 1IHYA 1BX1A 2CFTA 4QJ3A 1V7PC 2BJHA 2OBXA 2PSHA 3F0TA 4FP9A 5CB4B 3KV3O 1Z35A 5D85A 2HWUA 3V4PB 2EBFX 1L7QA 3KKOA 4BKOA 1N32B 2FPIA 1M2HA 3ISJA 2Q0XA 1YONA 1M2OA 3KEMA 1GL9B 2FZLA 5GAJA 3T4UA 4MTLA 3D0KA 3ZHZA 1Z13A 4FILA 1RI1A 2CHQA 2NZ2A 3I5UA 1ILWA 4H1TA 3U3ZA 3WFZA 1FFYA 3GG9A 3DDHA 2RGNA 3HJFA 4PN3A 4ZCQA 1W59A 5CFQA 1ACMA 1Z0KA 1NI4A 4KXNA 4Q6WA 4D2IA 3GGGA 2VZEA 1NN0A 2PMWB 4E5YA 3BK7A 4L78A 3ANTA 2FG5A 4ZOBA 1B1CA 3ZK9A 3FBWA 2B6HA 4ZOLF 1FNNA 4YR9A 3PZRA 5FBZA 3RBXA 1L1EA 2VYNA 5B3JC 4KV9A 2F8LA 3KTAB 3VJRA 4UFPA 4Y67A 2ZUSA 1IOZA 3WMEA 1ZXBA 1E1QD 4LPSA 2VSXA 4QC2A 4A1OA 4G5GA 4XYLA 4PR3A 4KMOA 3P9ZA 1U7ZA 2I22A 4WFIA 4Y2TA 1RPNA 1KIAA 3GLVA 3QXGA 3TCKA 1TW3A 3W1VA 4CQMD 4DA8A 2GBGA 5MN5A 3RKUA 4MR9A 1BS2A 2X8JA 3RKRA 3WKDA 1GKIA 2WJWA 4XX0B 1JG3A 2OHJA 4LG1A 4AMYA 3O2SB 4Z9AA 2WVHA 3I42A 4FSXA 5KTKA 1QYDA 2EFJA 2HK8A 1EFTA 4C4XA 3PL5A 4CF3A 1ZC4A 2GN4A 2YL2A 3LAWA 4O63O 2XWPA 3WY9A 5JO0A 2ZUCA 1BQEA 5CB6A 1BKSB 2P3LA 2PZ8A 4BRSA 4K26A 1VPWA 1CU1A 3P32A 4CJXA 4KSBA 1SKAA 3JQ8B 3QFTA 4ETMA 1RS0A 5B64A 1WABA 5TMPA 1UKYA 3W1EA 1QF9A 4PGAA 4PU0A 1KI8A 4ID3A 1EH5A 3LP8A 4QJBA 4CQLA 2FZWA 1Y98A 2C07A 1DX6A 3DULA 3RS2A 2HI0A 4YQFA 2AGVA 3GCZA 1TLTA 1O9BA 2WD8A 3UXYA 4HV4A 4FE3A 3PTLA 2X9QA 3N7AA 2HWXA 2HJWA 1DFHA 1PJSA 2VP4A 2ZI7A 4FN4A 4H77A 5ESDA 3EMKA 4I50A 4U7TB 3IT0A 4DXHA 3I39X 4HO1X 4QUAA 3WGHA 2F43B 4G9EA 4M8SA 1LV7A 5ES4B 2V6BA 4BATA 3EGXA 1JJBA 1USKA 5THXA 2PQ0A 1F7VA 1FTSA 3EIOA 3K73O 5FTMA 4M7WA 4BWFB 2OR3A 2JCVA 4JU9A 4WY8A 2DF8A 1JQAA 4K9SA 4K1XA 2NN3C 3EIQA 2NM0A 1DV1A 1V6CA 1ZUWA 3HADA 4U2KA 3RK4A 2QQ0A 4AUKA 1E79A 3VVMA 2JI4A 2J07A 1YHYA 2GJAA 2R1TA 3H75A 3QMMA 1ZVMA 4C4SA 2F4VB 1EWVA 4MI1A 3TLYA 5KOIA 4OATA 1EJ2A 1WO8A 5EOVA 3SNHA 3DGFC 1YWGO 3LWNA 2RAFA 4K9NA 4NFHA 3WGMA 5FFFA 5FFNA 3B3FA 1AQIA 3D8NA 1EFVB 2VIIA 4S04A 2VXBA 4FDLA 3K0EA 5DBHX 6PFKA 3JU3A 2IYXA 3L8FA 3H5LA 2Q9UA 5LMUB 5ADVA 3DD1A 4UDXX 3KVRA 3RVQA 5JJ5A 1EUDB 1FJHA 4RY0A 2H3EA 3P4YA 4RPHA 5AKZA 5A4KA 3ZN2A 5F5XA 4FLMA 3TR0A 2OQRA 4Z4CA 4YRRA 1YF3A 3QG1A 3VPXA 1C81A 4I46A 5B4TA 2H1WA 4CN9A 3U4IA 4ALNA 3O8OB 2WQ6A 1TC1A 2BSAA 1RC0A 3U7EB 5FOUA 2PKYX 5DCLA 2VTBA 4DUZB 4OHXA 1V1RB 4BUJA 4Q4CA 2RAUA 4M9CA 3GQBB 3R24A 1ODIA 3R7BA 1OAAA 2Q3FA 3FWZA 1UCFA 5H8WA 3W5CA 2DXIA 3UW3A 3E70C 4D8XA 3QWIA 2XA1A 2XYRA 4RL6A 4NPHA 1GYRA 5DGTA 1LI5A 1KU0A 5G3ZA 5JARA 5CLFA 1F2TB 4M21A 4N7RA 4MYCA 3RSSA 2WG2A 1O89A 2B1JA 5IKXA 2YOGA 4CM8B 3TQRA 2EKPA 1E6EA 2W2OA 4JUCA 4RCYA 5A3JA 4YUZA 2X4DA 1EFRA 2F8MA 5FWYA 5EIXA 5AOAA 1KBOA 3LA6A 5J3JA 1WHTB 1RM5A 4WXRA 1QZXA 5HZMA 3EA4A 1RYYA 1XXHE 2X9VA 3BL8A 1R4MA 3PFWO 4Q0MA 5HZGA 3RSLA 2BUBA 3TB4A 3KLMX 3PXUA 2D3TA 5EKDA 3H05A 5BT8A 4PM4A 1YI8A 1B6TA 4RJJA 4I66A 2BFDA 2JGAA 1DAHA 2YZKA 2ZBEA 3C2QA 4ZK2A 4UUNA 4O4HF 4PHFA 1MVNA 3MHPA 1VCNA 1S4QA 1PL7A 4J0KA 1OFVA 4YLGA 1PL0A 2WIJA 3NI2A 1RI5A 2YOHA 1XDSA 3EYAA 3HDYA 5IT4A 4QAJA 4O2LA 2YFKA 2B4YA 1YRAA 1ULHA 4QDTA 5KJ1A 3D3EA 3IJRA 5C8YF 3OJOA 3B6IA 2VSNA 2WICA 1LW7A 5FTWA 1SCAA 3ZBQA 5TGTA 1RRFA 5AVRA 4D4HA 5T6MA 2WP8J 3HPRA 3Q0TA 2HO5A 4ZI7A 3RC3A 1Y42X 2FVYA 3WGKA 1GNQA 1N6KA 5EUQB 2O23A 2HWKA 5ARDA 1N6OA 3EK2A 4I4NA 4Q3OA 3PRKE 1DQNA 1E2FA 4J4BA 2VWQA 3BORA 1NKVA 1U2RA 2PL9A 4GZ3A 3CX8A 4EA9A 3P7MA 3VISA 1PYGA 3NW9A 1MFPA 1PR6A 3TLEA 5KCMA 4UREA 4HHEA 1UT6A 5A5EA 1ADGA 3DBHB 3F7OA 3OLQA 3PPXA 2XUZA 1FX0B 5L4LA 4NCAA 1PD0A 3CXRA 3N5KA 2P35A 2ZYWX 4ZI3A 1G7SA 3D0RA 1N2GA 1PNTA 3NNDA 4J0CA 4QHTA 1QG4A 4DG8A 3LUGA 3BMNB 1NXPA 4RDXA 3F97A 4K6OA 4EW1A 4QDOA 5E7JA 5HCIA 4IDEA 3G82C 4Q9DA 1N92A 4UMFA 4YBZA 2OG2A 2J7PD 4AJOA 2X14A 1A2OA 4W5QA 4JEUA 4ILKA 2ISSD 4V3CA 2A78A 1TPZA 5CG2A 5HKKA 3RTEA 4NBNA 2OCKA 1CNMA 1M1YB 2HLNA 4ZO8A 3QLEA 1ZHOA 3C1AA 1OCEA 4XFDA 1VBMA 2OYCA 1JEJA 1P72A 2YIVX 3HCAA 4JLVA 3TLGA 4Z9XA 2FEAA 3ILSA 3EZFA 3IVGA 5LBTA 2OCGA 3B1JA 5F2OA 1GLGA 4ZGBA 2PX5A 3EISA 2UZ3A 1TVKB 1HETA 4JBLA 3OQHA 4UUQA 4NV1A 1FTWA 3C3PA 4P84A 1A4IA 3N28A 4CKEB 3THWA 1AKWA 4DPKA 2QJRA 4FGKA 4B6EA 4EUNA 3HFRA 4RPIA 1SCQA 2ECOA 1QS0B 4LDNA 3VUFA 2MYNA 4ES6A 1XU9A 3N75A 1M1ZA 1YVRA 2FZCA 1YZ3A 3W6ZA 4K9PA 1GPAA 2QI9C 3E9DA 4BWVA 2R87A 3S2SA 3QJYA 2IOFA 2IWRA 2YW9A 5BN4A 1PV4A 1FX0A 1RD4A 1XMSA 1ONPA 4QU9A 4BNVA 5LR6A 3C8HA 4PC7A 4JXXA 2IY8A 1KOFA 2PBFA 1IOVA 3LY9A 2OFOA 3E7FA 3T41A 4GBED 4M55A 3O4IA 1E0KA 1M6EX 2Q45A 3ER6A 2VDKB 1DCTA 4IDCA 1TB4A 1TMGE 1C9MA 4EJ2A 3IILA 4ED9A 3IV6A 2X58A 4GXNA 1FFCA 2PXAA 4A2WA 3U56A 2JJQA 3N6RA 4URYR 4C0LA 3OP4A 1A5ZA 4EL5A 1IB0A 1JFLA 3KQHA 1LPNA 3AW9A 4A2QA 2GK3A 3PNQA 2C2GA 1FDWA 4KI7A 4YS6A 4UTOA 5EJ6A 5LA6A 3HB4X 3ZV4A 5HSGA 3NFRA 5HBRA 3H5OA 4IG9A 4JKYA 4RESA 1D0VA 2W6JD 1H23A 3OECA 2AZDA 2J46A 4L5YA 2RHRA 3HCBA 3KT6A 4WLEA 4W6ZA 4CM6A 2B20A 5KJ6A 4MW0A 2VTDA 3HGQA 2VK4A 4JWKA 4PTZA 4OP3A 2I4LA 5JJKA 4JB0A 1AQYA 4JT4A 2J0SA 4MPJA 1I5EA 4JBXA 4GI3A 1LJUA 1K89A 1E7RA 1TL7C 3OBIA 3PYMA 2IYQA 5ALPA 5IEBA 2HJ9A 3BXEA 5KJCA 3KQMA 1J9EA 4OTZA 2E4YA 3VTZA 3FHLA 2GB4A 3KJZA 4R8LA 5FI1B 3W1WA 2A1TS 5EXSA 1V5FA 4DQLA 2NP7A 1NDQA 4JYZA 4ZT2A 1AGXA 1Y82A 3OQIA 4B5LA 5I9NA 3UUWA 5EUCA 4PHCA 5FUWA 5K0SA 1MBZA 3EIWA 2ORED 3G7NA 4I4LA 2UZ1B 2EGUA 1D2MA 2PHZA 2QN3A 4HJRA 2WFLA 2ZIUB 1P7VA 1V8PA 3O3NB 4M88A 3DE5X 3DM9B 4OV6B 4OXNA 5ALYA 1KDZA 2DUUA 3FCSB 1I7LA 4K6FA 4WKGA 5EKUA 4CKWB 4EECA 1AKVA 2HB6A 5CVEA 4JVMA 2D4AA 3ED1A 5J1TB 3UQYS 4XWTA 4C7VA 4I1OA 3OE4A 3ONEA 2AG1A 2ACKA 3GJ5A 2FDXA 3NLLA 4RA9A 3L8EA 4QZVA 1Q95A 3CX3A 1AK9A 2WIGA 3HYLA 2QGNA 3RS8A 1FLDA 1HDOA 1FUKA 3K6SA 4G4JA 4F3TA 2PMKA 1TQ6A 2HRDA 1G60A 3RTDA 1L7RA 3DEFA 4I1UA 1V35A 3NHYA 2Q5OA 1BH2A 3SMVA 2F1RA 3G5LA 2EZTA 3QOYA 5EJEA 1A9PA 5LBUA 3TZ6A 3GQBA 4YRTA 3FFTA 4G41A 4YAJA 1F9EA 1T1JA 4LXTA 3CUKA 2LIPA 4DJAA 4R0MA 2BAGA 4FFLA 2ALJA 1RZRA 3KTFA 3QA3E 4N0EA 1DIBA 1KVSA 2X9GA 4L4ZA 2ZRAA 3M82A 3BMOB 3L6BA 4C0QC 3L1VA 1XLTA 3A6FA 2I80A 4E5PA 5CT5A 3FHTA 1VLJA 3BBPA 4DFDA 1JILA 4LN1A 5J4LA 1FQJA 2O3UA 1ZXLA 3Q72A 1ADFA 1JTEA 1Y3FE 1XX6A 2JF0A 1UUFA 4BN4A 1ESCA 3THYB 1ZG3A 2XE7A 3NPMA 1QWOA 1CUZA 1MN6A 1S3GA 1Q20A 1V11B 3IPYA 4KG7A 5EIBD 3ROQA 5L40A 3FFWA 5M29A 3GLFA 3TB6A 2VYFA 5IXSA 3F5MA 1WB5A 1ZMOA 1FDOA 1VB5A 4K2AA 2REBA 4RFVA 4A8HA 2H92A 4CKBB 3BIOA 3QOWA 3B85A 4ZHQB 3TG2A 1CKEA 4NJMB 1DTEA 2ZCUA 4OA8A 3O8QB 5AHXA 4EY5A 2ZCJA 5FBLB 3VU3A 3H1TA 3T7IA 3KJNA 1ZW6A 1M8PA 4DR5B 2I7TA 1TZBA 4WI1A 3E8MA 1BX0A 3ZX5A 2QSJA 1DIRA 2JVJA 1MHTA 2GNAA 1H8EA 1KHTA 2QT9A 1FPMA 4IZHA 2HA2A 1S2OA 4ZI2A 4DJTA 4BECA 1H9AA 4HAUA 1H8HA 2XQFA 3FCXA 4HP8A 4MPRA 2QZ4A 3KUCA 1O95C 1C1YA 3L7DA 4ME6A 4TWZA 4WFQA 3ZV5A 2J9YB 3R6TA 3F73A 3C7TA 4XQGA 3KVVA 5E7MA 2RHJA 1TOAA 4L3WA 4XDYA 4D9NA 1V2HE 2CZQA 4LQLA 7MHTA 3JPWA 3G2OA 3B1KA 2FSHA 3JY6A 3MB8A 4MW4A 4LNUB 1KQNA 3TF5A 5H1YA 1T36B 5AW8A 3KOUA 1G21B 4GDMA 3WRXA 5C51B 5BPFA 4D0GA 4QASA 1E3TA 1DJNA 1GNPA 3QI2A 5FPSA 1C2TA 3JQFA 5K20A 2JGKA 4AF8A 3ITDA 1JHXA 3PA6A 1NMZA 2JJ8A 3QLVC 1VSBA 2XMQA 5DBOA 3IE2A 3K4HA 1UKBA 1WX1A 4ARBA 4ERNA 1ULTA 2ZRFA 3UGJA 1D2CA 2XMZA 4MINA 4MQ6A 4OFXA 4BJ3A 3QWHA 2X41A 3EGXB 1BW9B 3E2MA 3QX7A 4JUAA 4YRIA 3PEWA 4J6EA 5A4IS 3AXSA 1KJIA 4NVRA 2CK3A 5CM9C 3AJEA 5JWRA 2XF8A 3HMQA 4MYRA 1RW4A 2YN4A 1OLUB 1KNQA 2GS9A 1FP1D 4GP7A 1HRDA 4BDTA 2IP1A 3AP1A 3KWFA 4MVJP 3TG8A 2Z2JA 2BDUA 3O4JA 4RHUA 3GPBA 1YCFA 4YACA 1GGMA 3VKVA 1X2BA 1MPTA 2O8EA 2IKSA 2JLSA 1KRHA 4HEHA 1JBQA 1H1DA 2QM0A 2ZYAA 3A1EA 3ZLUA 4PPYA 1NNUA 5AXAA 5IKOA 1QS0A 3RIMA 1C30B 2GN6A 4L0MA 3ZHQA 1KKMA 1ABFA 1X80A 1RAGA 1R5BA 1NMSA 5J2UB 1G6KA 2AL7A 4BZZA 4B3XA 1E62A 1XLWA 5FBWB 1NLMA 1DFIA 2N46A 3KQWA 3GJ3A 3VOBA 4JI4B 1DHTA 1SVOA 2BP7A 1KOLA 4XYGA 3H04A 1SBHA 4IDDA 5LP6F 3QV2A 2K5UA 2WDZA 1T4CA 4IIHA 2P2GA 3MTDA 4NHOA 3FOFC 1QE3A 1WQ1R 2RIPA 1ECFA 3OCYA 1A1VA 1GZ3A 4NYMQ 1XHLA 3PI6A 1GZ4A 1U1GA 1V39A 4LI3X 4K6KA 4FZ5A 1Q22A 2XDQA 4K6HA 3ZQKA 4B2IA 1ADBA 1PGPA 5FOTA 2QX9A 3I53A 3ZDBA 3OPXA 1JA9A 1NTOA 1P18A 3I92A 2H06A 4Z2AA 3K6KA 4TZ0A 3QVLA 5JRDS 1LBIA 2B8TA 3UUFA 4O4JB 3ZWOA 1PS0A 3NKVA 2CCJA 3EZNA 3PFFA 3SLRA 2XQGA 1SBCA 1DPGA 2BI4A 3NZEA 4RKYA 5LD2C 1YB6A 3KQLA 4F2DA 4QICA 1PD1A 3D3KA 3ZCSA 1A9ZA 3MWYW 1EZZA 2JCSA 2R7NA 4JC4A 1TO2E 2YJGA 4PCUA 4C7BA 5JI3E 3KQNA 2JAPA 2AKAB 3QBVA 2AW5A 3CLSC 5C35A 4K3VA 3RH0A 2QD1A 2FMIA 1M9NA 5SYMA 1A8HA 1Y8RB 4P4UA 3EXHC 1IJBA 2GF0A 3NDJA 3QIAA 3KR0A 2WU8A 4PE5B 4UATA 1NBME 5IJAA 4BX2A 5JS6A 2QTFA 4B3RB 1YJXA 3NX4A 3OSUA 2Z6QA 2EP5A 4DLYA 3ORHA 1XZIA 4CEJB 3RRFA 3TLKA 1ZD2P 5CCXA 3HP1A 1TEVA 4BWGA 4UNIA 1UDBA 2FZ5A 3VZQA 3USZA 4ZI7B 2WV7A 3F8SA 1Q6YA 3TL2A 5JNUA 4HI0E 3O73A 3AB3A 3T0GA 4D42A 2BFFA 5BRNA 3KE8A 1QB8A 4KP7A 5CB0A 1ONBA 1I30A 2D5AA 2PBRA 2W00A 1PBNA 4US0R 2ORIA 1U8AA 5AOVA 3ZJ4A 4WPGA 4E4YA 5DT2A 1M34B 1WW3A 4ZCTA 1UP6A 3K72B 4RZIA 3CNNA 5JJIA 4WOJA 3ZV6A 4IV8A 1JSCA 1K5GA 2YHBA 4FT4A 4LWZA 2B9VA 3W7VA 1P74A 1KK1A 4OMCA 2A0XA 1OZHA 1P3DA 1HTTA 1ST3A 2HU7A 2Z0MA 2WT9A 5DSTA 4DLTA 1VP3A 2WTXA 3VBEA 3ICOA 2QTTA 5K03A 3MUFA 4KFRA 2O8DB 1U0TA 1MGPA 3A04A 1ETUA 3L41A 3MBKA 4Q9AA 2ACVA 2WU0A 1EGVB 4UNPA 1CQZA 1P1KA 2R8RA 5LL6P 1MO5A 1Q14A 1VE7A 1R0ZA 1V9CA 3KUKA 4I36A 2ZJ1A 2AN1A 3GGCA 1FP4A 2FOIA 4GNRA 4W63A 2ZBFA 4XYMA 3VKUA 5HKKD 2CBGA 1KKLA 4PEVA 4XIGS 1X1RA 1OA0A 2SKEA 4UU8A 1KI7A 1PR5A 4V1CI 3M3DA 1GPDG 2DCUA 3HSSA 3IIEA 1B8NA 1GVNB 2H2HA 3NTOA 3OZDA 3PPYA 4GKBA 3IKTA 5CUQA 1WUJS 1AVTA 1SVNA 1LLUA 2G04A 1LQUA 1UOOA 3EXFA 1P6XA 2VHWA 1I7SB 2JLBA 2ZVJA 4X62B 4BO6A 4X0EA 3RE1A 1AUPA 1DX4A 2YHIB 2DKOA 1OUMA 1EK1A 5E0KB 3L1KA 3RWBA 1M0WA 3LIIA 5ECGC 5LKAA 4KQMA 4YP1A 1YZGA 2YDYA 4D3FA 1RYNA 2CB0A 4NBSA 5BURA 2ZZMA 1G2OA 5BUCA 5DGDA 4CXMA 4RABA 1NZDA 2EU8A 1AH2A 4DQDA 2A88A 2WU1A 3D2CA 4MDYA 5EIOA 2FLVA 2FQ1A 3T06B 3X1WA 1K97A 1R3DA 2XUOA 4IIYA 3QKRA 4OB7A 1H3EA 4B76A 2JI7A 1H5NA 1CUEA 5EHIA 1SY7A 3OTIA 4HWOA 4OOFA 1XXHB 5BN4B 2PMEA 4L72A 3LCCA 5HNKA 4B2PA 4KODA 2WM8A 3NBZC 1XJWA 3R09A 4K28A 5JVDF 3Q3HA 2RE8A 5LZ5A 1K7FB 1XCBA 2Y0DA 2O19A 2WMYA 5K6TA 1O8BA 1SVUA 1A69A 4BBAA 4RTJA 5KSYA 2CDRA 2V6MA 3PPVA 4AL4A 3E1GA 3QLUC 1P5FA 1G7RA 2CVPA 1TVKA 1FMCA 5LQUA 5AUPB 1ODCA 4QBFA 4UCWA 3R0ZA 4NG4A 1EWTA 5AI9A 4QU0A 4AW9A 2WOOA 4FB5A 1J99A 4PLTA 4Y9UA 4ZODA 2OORA 3VR0A 1M83A 1PR2A 1EKXA 1ZOIA 2D0OB 1M8GA 2HCJB 3IAFA 3ER8A 4INJA 1A7KA 3G2LA 4N5LA 1LPBB 4EELA 1SQSA 2ZKIA 3GT0A 1JG1A 3UTCA 5DTQA 2H1CA 3LFUA 3RODA 3WLHA 2BGNA 2Q0QA 2PT5A 1U3DA 2QVCA 4NV3A 4F4IA 3BWVA 4V24A 3NNSA 2W6JA 4R2KA 3TNFA 3KUXA 3ZWBA 4OAPA 4C4PA 5JH7F 3WK8A 5AMXA 1MKYA 3D6JA 3JVEA 1Y3BE 4B7ZA 1PTJA 4A03A 5AW6A 4K3UA 4IQ4A 3H11B 4V0OA 5CCBA 1W2GA 1FU4A 1AZTA 1YR6A 4FR5A 4JC5A 1HL3A 2FRVA 2PJZA 4WESA 1GQFA 3ZH9B 4DAEA 3OLCX 5DN6A 4I9GA 1SZPA 4W5WA 1ZUNB 2TMYA 5C1IA 2V5UA 1QX3A 2OPHA 3CVXA 2BI7A 2Q46A 3KS9A 4PZLA 1H2HA 5J2TF 4YP9A 3IVAA 3G8DA 1AKMA 4YMUA 3M6UA 1Z4MA 3A9VA 3B52X 4YMWA 5E6RA 1EWKA 2EGGA 4ZAVA 5KDLA 4BX9A 1OA1A 2JIDA 2PSJA 1I01A 1LVGA 2AMYA 2CXSA 2HUPA 3R0XA 5LMCA 3AVWA 2RGWA 3B6EA 1GTSA 4KQ9A 5ISMA 2BTQA 4C88A 4B3HA 4IVRA 4LDAA 3N2KA 2OHVA 2ZIEA 2MR5A 1TX4B 1H85A 3FIJA 4JA0A 4KGXA 4AULA 3KZOA 3TQSA 1O96A 2JDIA 2WWIA 1YB4A 2DX7A 3L6DA 2XMGA 4EJ6A 4XASA 4WCFA 1YFLA 2QRNA 3SEZA 3HE3A 3W04A 4AFNA 3E2IA 1AKYA 3S6JA 1U9ZA 3OJXA 3Q6MA 2DWCA 4MGKR 1MG0A 1QIHA 2H1HA 3ZWNA 5BORA 3V1LA 1LS1A 1SD5A 1X39A 2CNBA 3AB7A 3AM5A 3KPWA 4R83A 4EYOA 4BO3A 2NU6B 4LVNA 2QQEA 4V0QA 2DEUA 2CJFA 1PDOA 1YZQA 2GBCA 3L7AA 1T9HA 4KW7A 4PBRA 3U17A 4YB8A 4PIPA 1E5DA 1KYXA 3OMLA 2IDJA 2JFZA 3M6LA 5I6DA 3HKBA 2IBTA 1WW2A 1DJMA 3CGGA 1H94A 1RP1A 5LC1A 3BF7A 1QVVA 2OXIA 3T12A 5KYUB 5LMNB 1DO2A 5LUAA 3LBIA 1SB9A 3DDCA 2C2MA 1GRNA 1SZJG 2J7KA 3PEEA 2CXQA 4E51A 2E2WA 5AUQA 2HIAA 2HZ7A 1PEAA 4JOQA 4K05A 5U1PA 3TZKA 1KF0A 4Q7QA 2RHTA 4ZU6X 3IKLA 1XMQB 4NE7A 2PDAA 1EDDA 3V7FA 2CMGA 2VRNA 3BVPA 3JD1A 3PGKA 4GW3A 3W6OA 5HKBA 1WMBA 1QAMA 2XTJA 3KVNA 3DWIA 1VPVA 3JQAB 2X7XA 4N5NA 1ECCA 1KEVA 1X1SA 3GCXA 3F46A 4X7MA 1FW8A 1V8OA 4RVDA 5JT1A 4RZ3A 3ROPA 5HS4A 2G07A 4AY5A 2H8KA 5JCJD 2EOAA 2GNPA 6NULA 3EXHA 5G1OA 4KK4A 1OTHA 2YDXA 3IOCA 4FU0A 3NT5A 4MV9A 1IJFA 3JR7A 4Z1MA 1CSEE 1O94A 2IYTA 3QUCA 3RDPA 1LDBA 3GD7A 2ERCA 2FF7A 1AQLA 2OGUA 1YJQA 3HV2A 3QTLA 2H4HA 4ZMSA 1T2AA 2HBRA 4J3JA 5KDOA 2X19A 2XE4A 3N8NA 3S68A 3KSBC 2C7OA 2G1PA 2KHZA 1UAGA 2VUTA 3ETGA 1MB4A 3ZE8A 1ZH4A 2PH1A 3V00A 1KQGA 5GIOE 3DBOB 2GCGA 3W5SA 4A92A 4R2HA 1FX1A 3LBYA 2QW8A 2K4MA 1RPZA 4B3MB 1XZDA 1S2MA 1D1PA 2O0KA 1FXWA 2VOJA 4RD2A 4YQZA 4ZVVA 2FA9A 3RFXA 3TOCA 3X1XA 1BDHA 2CD9A 1IEXA 4RVOA 1E8NA 1KMQA 2DFNA 1Z75A 2RC5A 4MKFA 3SHQA 4OI0A 2PKQP 3VTFA 1Z0IA 1VXRA 3INGA 4GECA 2P8SA 4PLVA 3CLHA 3IXLA 5KOHA 2R84A 1J2YA 2GZRA 1SXJA 3ZE9A 2WE8A 1UJCA 1GFZA 2HC9A 1SULA 4WXEA 3LLUA 3JAKA 3CVOA 2WSSD 2CBZA 2OV2A 4EDFA 1RJWA 5BMOA 3ABZA 4U2CA 2RGRA 4L51A 1YU9A 2DSNA 4XIJA 5EEGA 4DCPA 3KSZO 5ILGA 5HMLA 5EZYB 1XVLA 1O57A 3RUFA 2W8ZA 3AF5A 3FNHA 3UFXB 4JC0A 3I72A 1XWWA 4TLBA 2WI8A 4CLDA 3AHCA 4NFLA 1JDBB 4HLDA 3BTUA 3VUEA 4QRIA 1V4BA 2P9ZA 1H9BA 2DBQA 3HFJA 4MGIR 3X1MA 1HE1C 1UH5A 3TTXA 2HPZA 1JU9A 1Z6GA 2IXGA 2VPZA 3HLKA 4BB6A 3GPLA 2FEOA 1GU7A 2FCRA 3RUHA 1E6KA 1JQDA 3VGPA 3FUCA 3AWDA 4IO0A 2BP7B 4ZCLA 1KMCA 3LHIA 4UUOA 2IZ1A 3MFYA 6ABPA 3KJQA 4C0BA 2Y27A 1CWUA 5JZSA 1SUSA 2BCGY 2WUVA 3TLCA 1WF6A 2LWIA 3R6GA 5FKJA 1BS9A 3ZXIA 2ATXA 5L3SB 3I5XA 2GARA 4NU6A 4CF5A 1G63A 2QTVB 3EUWA 4UHBA 1WXIA 4QTUB 2VDOB 4DLXA 2EJWA 3Q40A 4DQXA 4MLCA 1JA1A 2CHGA 2XECA 2NUTA 4DNQA 5B7NA 1Q0HA 3WRXC 3J80A 2XEXA 1RWKA 3FWNA 4U7DA 1UXGA 2C5BA 2X13A 3AP3A 5D5PA 2O8DA 3O4GA 4MS4A 1PR3A 2LRHA 3ENVA 3O26A 4XGNA 3PQ5A 4BE9A 2P0EA 3F7NA 4Q3DA 3CY6A 4WY2A 5G0TA 4CV2A 1KH1A 3P0RA 5GIPE 4BLRA 2VH1A 1XMVA 4MA0A 3NRJA 2H3HA 1JZSA 1EJBA 4EHBA 3SFVA 1B8OA 3QVKA 3ICPA 3MWDA 2ZRIA 1E89A 1ZD5A 3HDVA 3UMCA 3KVOA 4I4TF 1ZU4A 1C41A 4KXQA 4MMXB 3T3OA 3CRNA 1BD3A 4QJ5A 3H99A 3AHFA 2F6RA 3S8EA 2IHUA 4WT7A 2C2OA 2XDWA 3OZCA 3SY8A 2YOFA 2VN8A 4LVCA 2CBXA 4QPJC 5KWIA 2I67A 1WXQA 3T15A 4KE7A 3ST7A 2YBDA 1T36A 1UFOA 2NG1A 2WAYA 4B87A 5FWNA 2RH4A 1XOIA 3C1OA 3FTCA 2SCUA 4MO9A 1MB0A 1VKNA 3E6AA 3CLTC 2AJTA 4B6PA 5A1TA 3RF6A 1GZSA 4FFSA 3CUVA 1ZEMA 3AEUA 4QJ4A 1T9GS 1N9GB 4HYTA 4ITUA 1I7NA 2DY0A 2E3JA 1I4DD 3AM4A 2OBNA 3NASA 1P0IA 5AVUA 5FULA 4J1TC 1C7ZA 4HXFB 1XLTC 3UJCA 1JHVA 5D8DA 5KJFA 3AUTA 4RMJA 4QVIA 2AIRA 1NJ2A 3ZNNA 1XVVA 2G67A 3GGDA 3G2KA 1IWOA 4XXHA 3EFHA 4M7PA 5ALQA 4WINA 4QBIA 5EMLA 1U5AA 4BVKA 1CQWA 1MAAA 4Y2XA 4MB0A 3UB2A 3EEBA 3UMRA 6ADHA 1WVIA 1DDGA 2ZRDA 1LSJA 1XBTA 1RAIA 4Q4JB 1SN7A 3COVA 4LUCA 4R1QA 1KIMA 5J40A 1NUHA 2FPKA 4AKTA 4H1UA 5FR1A 3SLGA 4HY3A 4B6OA 4YCNA 4FT2A 1U7OA 3CIOA 3WLOA 2PKWA 3I3OA 1SCBA 3ZXUB 3SDSA 2B7LA 3KR2A 4WZAB 4DCOA 2ZJBA 5TF0A 2FK8A 1GQYA 1MU0A 1XDBA 3IXMA 4LK3A 4RMNA 2NTNA 3VAAA 1I6MA 1H3FA 4BVBA 3P9SA 2OEPA 4FUTA 4C0XA 5KTPA 1T0HB 2UUAB 2W93A 3FM9A 4IQFA 3KOWA 1JL3A 1KRXA 2O2JA 3KAJA 4AURA 1NPYA 1K06A 1RBMA 3AR8A 1NOJA 1OYOA 2W2QA 4ND5A 4F3CA 3A2MA 4F2PA 3HUEA 3RC1A 1R8QA 2VYND 1EX1A 1RQNA 2ODWA 4PZCA 1E1KA 2P2CA 4LXXA 3TW6A 1T8WA 3SYMA 1K86A 1PWYE 2VJQA 1YT5A 4GP6A 1D1QA 3C39A 3CX4A 4IVQA 4TLAA 6Q21A 3AHGA 5JZBA 2JBAB 4EHLA 4CLOB 5EZYF 4TUYA 2EFDB 4WKBA 5I45A 1NLZA 3OP1A 3A25A 1YIAA 3CMMA 3JARB 4GYWA 3L0SA 2W6OA 4D45A 1U7DA 4DCSA 4L5JA 4N8DA 5IAOA 4E22A 2XCLA 4MUKA 2BTQB 4I1RA 2UVPB 2BRUA 3SU8A 1QGED 1ST2A 1L4MA 5AI0A 3GGSA 3BKWA 3L6OO 3T9BA 4ESEA 3FRHA 1RT9A 4FOPA 3RJ9A 4C3OB 3F6BX 4PQEA 4C4AA 1H69A 3RV3A 1R50A 3KQOA 1H1LB 1T8RA