1GZ3A

Molecular mechanism for the regulation of human mitochondrial nad(p)+-dependent malic enzyme by atp and fumarate
Total Genus 200
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
200
sequence length
554
structure length
554
Chain Sequence
HIKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMTSPLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVGLACSQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDQCLPVCIDVGTDNIALLKDPFYMGLYQKRDRTQQYDDLIDEFMKAITDRYGRNTLIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTAAVALAGLLAAQKVISKPISEHKILFLGAGEAALGIANLIVMSMVENGLSEQEAQKKIWMFDKYGLLVKGRKAKIDSYQEPFTHSAPESIPDTFEDAVNILKPSTIIGVAGAGRLFTPDVIRAMASINERPVIFALSNPTAQAECTAEEAYTLTEGRCLFASGSPFGPVKLTDGRVFTPGQGNNVYIFPGVALAVILCNTRHISDSVFLEAAKALTSQLTDEELAQGRLYPPLANIQEVSINIAIKVTEYLYANKMAFVYPEPEDKAKYVKEQTWRSEYDSLLPDVYEWP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords NAD-dependent malic enzyme, mitochondrial
publication title Molecular Mechanism for the Regulation of Human Mitochondrial Nad(P)+-Dependent Malic Enzyme by ATP and Fumarate
pubmed doi rcsb
source organism Homo sapiens
total genus 200
structure length 554
sequence length 554
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.38: Malate dehydrogenase (oxaloacetate-decarboxylating).
pdb deposition date 2002-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00390 malic Malic enzyme, N-terminal domain
A PF03949 Malic_M Malic enzyme, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1gz3A02
3.40.50.10380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Malic enzyme, N-terminal domain 1gz3A01
3H9QA 1I3KA 4XB1A 1GUYA 3WYBA 3ZV5A 4U6QA 2EKPA 1DEHA 3RUCA 5JDIA 4CV1A 2PZJA 1ZK0A 1ZCJA 2B36A 4OHUA 1HYEA 3O03A 5JNLA 1GDHA 4TKMA 5A5FA 3JD4A 1M66A 2X5OA 4BUCA 2NTVA 2OBYA 2UYYA 3GH3A 3FBGA 4BKOA 5KIAA 1C0LA 2JCVA 4NU6A 3E18A 5EN4A 3PTZA 2H1SA 2PA3A 2WYWA 3KM0A 3L9WA 5KKCA 5MDHA 4MVJG 1EMDA 1XU9A 1EE9A 3V1YA 5KKAA 3GQVA 4GWGA 5HS4A 4B3HA 4NNJA 1ARZA 1ZMOA 1ZK2A 2RCYA 4Y8VA 4TKLA 3ADPA 3JQ6A 2HK8A 2H6EA 1EZ4A 3VVBA 4E5YA 1O89A 4YJFB 3N74A 1P0CA 3GGGA 4EEZA 5L40A 5T67A 4IDAA 5AXAA 5IN4A 2D59A 3AM5A 5JLAA 1DLIA 1U7HA 3OQ6A 4XRRA 4J16A 4J9UE 3GVIA 1DFGA 1B26A 1QV6A 1H2HA 3F5QA 4XYBA 2PK3A 3W4KA 1PZHA 2BF7A 3F4BA 3WSVA 5I7EA 4IS3A 4C4OA 4KZPA 4ALNA 4B8WA 4II2A 2PLAA 2D1YA 1R0LA 3BIOA 2RBEA 4JP3A 4A27A 3ZNOA 3ZWCA 4CM1A 3QVTA 4UAGA 3KHUA 4GLOA 4OQZA 2G17A 3RI3A 4YAKA 3FTPA 2FR8A 2ZYAA 2IYPA 1TVEA 2PGJA 3WXBA 5EIOA 5I7VA 4OYRA 3ETGA 1H6CA 2PH3A 4R41A 2A92A 5MGBA 3I1JA 3LU1A 2VOEA 4BO8A 3ROMA 1UXGA 4E5KA 3GG9A 3V8BA 2VTDA 3C85A 4DQUA 4E5NA 3SBOA 5I9LA 2CFCA 2E4AA 4IXWA 5I8WA 3DZKA 5IZCC 3JD3A 1YB1A 3M2PA 2RH8A 4YAJA 1SCUA 2XOXA 3MWEB 5DBGA 2QX7A 1F17A 3ZWAA 4WECA 1U2DA 3ZV3A 1YQDA 1NFRA 4KWIA 1A4IA 1LTHR 3Q0EA 2ZK7A 3H2SA 3LF1A 3QWFA 1HDYA 3UN1A 1QRRA 3I4FA 3JQBC 4MINA 3WYCA 4DL9A 4WOJA 1NQAO 2PH5A 1MLDA 4ZQEA 2VOJA 4Y6RA 3TL3A 1NQ5A 3LC2O 4FFPA 5CPBA 3RCBA 4CMKA 4I5EA 2DU8A 3TPCA 3FNFA 1H0KA 4Z9FA 5JBIA 2A35A 4ZN6A 2D5AA 2EJVA 5TQVA 4PLYA 3OJ0A 4YAEA 2ET6A 3W4JA 2NNLD 1U3WA 3BAZA 4HUJA 1OMOA 4F46A 2Y99A 3LT1A 4I9UA 1ZK4A 5JAMA 3JV7A 4YJDA 4WUVA 5F1PA 1PJ4A 5T8KC 4RQUA 4WOKA 2DT5A 1DC3A 1HZJA 3JQGB 4J2OA 5TNXA 4TQGA 4CLHA 2X9NA 1KS9A 2OHXA 3K2EA 4M86A 2Z5LA 3WTBA 4JK3A 5F1OA 3KYDB 1EK5A 3FR8A 3VPHA 2DTXA 1E3SA 1X0VA 3TOXA 5G4KA 2HUNA 3LVFO 2HCTA 4ZICA 1GV0A 4UEOA 3VPXA 2BFOA 1OBFO 2H9IA 4Z0HO 4CLDA 2YJZA 2AG5A 4JBGA 3NT2A 4R4JA 3CINA 3PWKA 1MFPA 2X22A 4WCFC 4LW8A 1T2FA 2FN7A 4W7IA 4KTTE 2DBZA 5U1PA 3AW9A 3WLFA 4MKZA 5KNLA 4G65A 1PZFA 3P2YA 5GZ3A 2IXAA 1DO8A 1LRJA 1GYPA 4O63O 3PWSA 1ZEJA 4IJKA 2Y05A 5FEUA 1UXHA 1H6DA 1P1HA 3FPLA 1L7EA 4R1TA 3BYZA 3JYPA 4D46A 4L73A 2QQ5A 6LDHA 3U4DA 4DLBA 3GEMA 3BMNA 4DLAA 3DMTC 3WNQA 1TB4A 4YXFA 2DM6A 2O7SA 3WG9A 2O3QA 3RVDA 4Z9XA 4OKIA 4B3IA 2G76A 5IFLA 1HDXA 4XDYA 2Y66A 2XAAA 1R0KA 3BHMA 4JN6B 1E3LA 1L7DA 3U5TA 1HYHA 1MXHA 1PGPA 4FN4A 1I33A 2R6JA 9LDBA 1VLLA 1QXSA 4DRYA 1ZO8A 4EYEA 4QECA 1ISGA 1J6UA 1UXIA 1E6UA 3TNLA 5JAQA 3VZQA 2ZIZA 5KWEA 2IXBA 5AXCA 4CR6A 2ZYDA 1WZEA 5DNAA 4KMSA 1E3IA 1XQ6A 1YJ8A 3RJ9A 3RUEA 4IQ0A 3WMWA 5IDQA 4J9VA 1R12A 1IHXA 1HL3A 3ZWVA 4EEXA 4YAIA 3CXRA 2VYND 1KC1A 1GZ4A 2GN6A 3VPGA 2HAEA 3ZNPA 3OA0A 2BKAA 2P4HX 1CF2O 2NTJA 3GRKA 4MVJD 1HDCA 3GFGA 1C1DB 2VUUA 4PIVA 4C7JA 2Y68A 5CG2A 2VHWA 3CMCO 3VH4A 1NHWA 3CH6A 4RV9A 1T1SA 4L76A 1TXGA 2ZB4A 4BMVA 5TF4A 4BO5A 4JCOA 4CQLB 3GVHA 3A4VA 4DXHA 2JCYA 1A4UA 3OETA 5GMOA 1QR6A 3I52A 3WNVA 4CMIA 1GCUA 4P4LA 3OJFA 4FIZA 3ETEA 5FI3A 2BGMA 2OO5A 4BKPA 1ISHA 3QJ5A 3GDOA 4YA6A 4A0SA 2DUUA 4NJMB 2BFAA 1H9BA 1KVUA 4TVOA 5F21A 1K6XA 1UJMA 2AA3A 3C7DB 2CD9A 1LU9A 3NT5A 1AN9A 4MKXA 4Q3BA 4RJTA 1J4AA 2ZCVA 2W90A 3WGTA 1M67A 4FOOA 1IULA 5BSFA 3E03A 3ENKA 1DIAA 3COSA 5CAEA 2HK9A 3K9QO 2LDXA 4B4VA 4J4HA 4NQZA 3RD5A 4BO7A 3FF4A 3QY9A 4RPKA 4D44A 2FHSA 3BMCB 2GUGA 1UXKA 5ES3A 3DZHA 2NU8A 1YWGO 4FCCA 3ANNA 3DDNA 3NDJA 4B4UA 5BSHA 1FDTA 4Z6KA 1DOHA 3PVZA 4BNWA 4JJFA 2VYNA 4DBVO 1ML3A 1PQWA 2PD6A 2NADA 2UUPA 1ONPA 3L6EA 4RL6A 3MTJA 3NGLA 1U7TA 4MVJA 1A7AA 3U4HA 4A2CA 3GR6A 2CNBA 3W1VA 3QE3A 1KVRA 5EL0A 3MWDB 1ZMTA 5U9CA 1R15A 4J7CA 3ZI0A 1PJLA 1VSVA 4XIJA 1KOLA 3PIIA 4F3YA 1KVQA 3HB5X 4MOWA 1YS4A 1I0ZA 1JWBB 3I9NA 4J7XA 1WPQA 2PFGA 4BO4A 7MDHA 4ROSA 3C24A 4R5MA 4NDNE 1ZVMA 5JDIC 1NVMB 1R66A 3OIGA 2JD2A 1YRLA 4FJ0A 1IY8A 1Q2XA 2Q2VA 2D0IA 2WE8A 4HWKA 1KVSA 4Y9DA 4IMRA 4N18A 1GD1O 3KYCB 3Q9NA 4FFOA 1PL6A 4PLZA 3D1LA 1R4MA 4B79A 3BMOA 3GT0A 1BW9B 3MJSA 5U4QA 2AQ8A 2C2YA 3AY3A 3U3XA 3UFXA 3IOYA 4FW8A 4NMHA 4ZQGA 3ABIA 3MCVA 3C7AA 4I9NA 1TT7A 2CVZA 4E3ZA 4BKUA 5IG2A 1HETA 1HDZA 5A9RA 2VHZA 3KSUA 2GZ3A 2W2KA 4BQRA 1E1MA 3H4VA 5T64A 3UOGA 1MB4A 5I9MA 4PLTA 2VHYA 3GMSA 2J3KA 1D8AA 1Y81A 2WEKA 1K3TA 2NTNA 2WYVA 4AJKA 4CV2A 4EDFA 3B70A 3FWZA 4BNKA 3E5RA 3H2ZA 3VZSA 4XQEA 2Y1FA 1A5ZA 1A9YA 2O4CA 2PZMA 1WMBA 2Y1DA 4GPD1 1UR5A 3RC1A 4J7UA 5BQFA 2FWMX 3MJVA 4FPXA 3ZN2A 2B69A 3ONDA 3ZWNA 5G2OA 1PJ3A 3V1UA 5FWNA 2DVMA 2CDBA 3K6JA 3S55A 3L4BA 4IY1A 4WLOA 3PJDA 1C0IA 4EI2A 4UVDA 2VWQA 1V3TA 4JQCA 4ZU3A 4S3MA 3ZHYA 4DUPA 2OORA 4BKRA 5L95A 4P4NA 2BFPA 3F4LA 3TZCA 3WB9A 5EPOA 3S8MA 4XQ9A 2B0JA 2B4TO 1YBMA 4U7WA 4IJVA 4IZIA 4BO9A 2DBVO 1EBUA 1VL6A 3UH1A 2AE1A 4JX8A 1PGJA 3NJ4A 4GAEA 3OMLA 3SLGA 3AM4A 4MIYA 4HV4A 1I2BA 1Q0QA 1YJQA 3D4NA 4XB2A 1T4DA 3GDGA 1IPFA 4AJ4A 3VC7A 4MVJI 3GPDG 1H94A 4CM6A 4RVHA 2ZB8A 1EVJA 2R2GA 3NGXA 1QLJA 2I3GA 3HZZA 4J2HA 4WPGA 4YCAA 5DF1A 3FN4A 4R9RA 2O3TA 1LLCA 4IS2A 4LMPA 3C1OA 4AL4A 3D7LA 3IL2A 4E2YA 2Q2QA 1BG6A 1Z6ZA 2EKQA 3IAHA 4WLUA 4BNZA 4K6FA 2FP4A 5AXDA 2R00A 5KVCA 3QQPA 3ITKA 5F5NA 1W73A 2YV2A 3H5RA 3CIFA 1X7GA 4DC0A 1DC6A 3ANLA 3GG2A 1B8UA 1F12A 2ZTLA 3JYLA 3IP1A 1TT5A 5EERA 1EQ2A 1NWCA 1D1TA 3RC2A 3TOZA 2NVUB 3D0OA 2DBRA 4CLRA 2X9VA 4J43A 3F3SA 4Q3EA 1CQIA 3F1LA 4RVSA 2Q1UA 4EITA 4QTZA 1U3UA 3VZPA 2X6TA 2EW2A 3PK0A 4J0EA 3UGKA 4CR7A 4KOAA 3VPSA 5BNFA 2JAHA 3OJLA 3AFNA 3EVTA 4J1TA 4RO0A 4JP2A 1UH5A 5ER9A 5KJFA 1ZJZA 3PHHA 3HNPA 3OH8A 2V6BA 1AXEA 4BNLA 3H5NA 3B1KA 3HB4X 1QKIA 4LK3A 2QW8A 4J90A 2J6IA 5JSFA 1MA0A 2Z95A 1Z82A 1DRVA 4UVGA 5DCWA 5JDCA 3T7CA 4D79A 1P1FA 4M55A 3F47A 1GUFA 3TSCA 1E1NA 3KB6A 4WEOA 1Q0HA 4YR9A 2HO5A 3LT0A 2JHGA 3L4SO 3WR5A 2CVOA 1DC4A 3P5SA 3Q6IA 3NAQA 1C0KA 4YT2A 4FFMA 5IN5A 1NR7A 3UF0A 4R51A 1U2GA 4ZRMA 2EIHA 4G81A 1P77A 1NPDA 2XF8A 4HADA 1Y8RB 2A9FA 1IUKA 3PGXA 4OXYA 1R4NA 1SAYA 4PFJA 1E3EA 1C1XB 4MP8A 1DIBA 1FJHA 1E5QA 1PU2A 2NQ8A 1QV7A 3WGOA 1Z73A 5JMWA 3MZ0A 1H9AA 3TFQA 2E48A 1KYQA 4CL3A 1MC4A 1NXQA 1GU7A 3PHGA 3QW2A 1HDGO 3STHA 1BXGB 1FDSA 1CDOA 4CR8A 1K2WA 2X0JA 3HWRA 1MG0A 4CM8B 4NZ9A 3BMNB 4H15A 4PG4A 2D4AA 2IE0A 1NAIA 3ZU5A 4BO3A 2HLPA 4NI5A 1ZK3A 1IPEA 1YE3A 3CKYA 3O8QA 1IHYA 3NEPX 3GVPA 3GNQA 2P91A 4CMAA 1X14A 2P9GA 3FRJA 4XR4A 3P7MA 4IJUA 4QQRA 4AFNA 1HLPA 5DBFA 3Q1LA 1FF9A 1QSGA 2EXXA 1CIVA 1NPTO 4QX6A 5H81A 3S2FA 5BT9A 1K89A 1ZJYA 2H5LA 2DKNA 2P2SA 3GA0A 1VSUA 1KY5A 4IZHA 5A9TA 1YGYA 3GHYA 4LRTB 5G0UA 4GGOA 4EUHA 4CODB 4XYEA 3JQAD 1DBVO 1I32A 4BO1A 1PX0A 2GASA 4P4GA 3CZMA 2D3TA 3HADA 3PJFA 4J1NA 4W7HA 3F5SA 4RVDA 3UVEA 1T25A 1XG5A 1J49A 4JBHA 3DXFA 1XEAA 2JFHA 5CDSA 2HMWA 2ZTVA 2Y1GA 1P0FA 2HMTA 4E0BA 4AG3A 1W8DA 2EWMA 2AEJA 2PD4A 4NK5A 2OXIA 3PEFA 3OFSA 3PIDA 4J91A 4DGSA 3EY4A 5ITVA 7ADHA 3P2OA 3GN1A 4XEHA 4CMJA 4GX5A 5BNTA 2NSDA 1YB5A 4FS3A 4U6SA 1X0XA 4D43A 3HQ4O 1OC4A 1YO6A 4NK4A 1E3WB 4OOFA 3BMQA 3DQPA 1UAGA 4TWRA 4FD3A 4D7AA 4I08A 3SC6A 3Q2IA 5A02A 3GUYA 4I1IA 1N92A 2IEDA 3EC7A 1NBOA 1EDZA 4EJ0A 1GR0A 2FZWA 3GN2A 4LCEA 4CMEA 4AJOA 4GKBA 1A72A 4NBVA 2B83A 4RLHA 3TJRA 2AEMA 2ZYGA 2JHFA 3DHEA 3AWDA 3QIVA 4QXMA 2YHIA 1HEUA 3PZRA 3Q2KA 4UUNA 5ENVA 1Y8QB 1F8GA 3F1KA 5DOZA 4QEDA 4IPTA 4OOEA 1D1SA 1TI7A 4DTIA 1R16A 1B15A 2VCYA 1B8VA 3I9KA 1JWAB 4YJHA 3GC6A 1HSZA 4OIMA 3I4CA 2B5WA 5BSGA 4BNVA 3JQAA 4CV0A 5CEFA 2UDPA 4E33A 4BNHA 1P1KA 2Y1CA 1N9GB 1LDYA 1B14A 4UVIA 5TX7A 1EVIA 2D5CA 4YB8A 2VHXA 4RF3A 1JW9B 1XELA 1ENZA 5BR7A 3RBVA 2VRBA 2POQX 2GCGA 3CEAA 3NKLA 4PVDA 5JCXA 2VWGA 4BHTA 1V3VA 2NWQA 2V7PA 3GEDA 2P9CA 4FGSA 3V2GA 4IJWA 2DPHA 1HE3A 4KP7A 4NG5A 4AJ2A 4A7PA 3ZWXA 1LSSA 3RFTA 2HRZA 3GEGA 4DPKA 4FJ1A 2ZTUA 2BRUA 3ETDA 3IMFA 2XXJA 3PFFA 4RLSA 2GNAA 1I3LA 4ZA2A 3VH1A 1PJBA 2XXBA 3S2GA 2YFHA 5HM8A 3JQ9A 2RAFA 4IGFA 1XSEA 3FI9A 4XA8A 1HWYA 1VI2A 2V6MA 2X5KO 3Q9UA 4Z3DA 3WDSA 4IUYA 4DA9A 5KVQA 3FSRA 1DHTA 2E6UX 4RDHA 5JY1A 1ZSVA 1B0AA 5HTOA 3DEYX 3PJEA 4RVFA 3BTVA 1AE1A 2O7QA 1VL0A 3DBHA 3EZLA 2FMUA 4R16A 3WSWA 2W98A 1HE2A 5CDYA 1RM3A 3GZ4A 4HKTA 3KETA 5TGDA 3KLPX 3WBFA 5GZ1A 1R4MB 1VKNA 3BMOB 5JY6A 4KWHA 5TT1A 5I7FA 1HE4A 3LSYA 2E49A 2FSSA 2UUOA 1LJ8A 3OM9A 1PGQA 2AQHA 5CFZA 4OSOA 4YBZA 4A10A 1PL8A 3D3WA 5EJ2A 3O4RA 1YL6A 2WTBA 2D8AA 4CLOB 1RPNA 2HSDA 4BGUA 4IXTA 1GTMA 2X5JO 3K92A 3RWBA 4E5MA 3D5QA 2DBQA 3QVSA 1JAYA 4K26A 1B3BA 2VWHA 2Q1TA 4PG5A 4UUMA 3L4BC 2OP1A 4MP6A 3EAGA 5DZSA 5FI5A 4ALMA 4DMLA 3KV3O 2IRWA 2EGGA 3QV1A 3AI2A 4LN1A 5IXSA 2PTGA 2HKIA 4HBGA 2JAPA 4PLVA 1IL0A 5G0TA 3VVCA 4AVYA 1GZ6A 4J49A 2GGSA 2WYUA 2HRBA 1IOLA 3G79A 3GDFA 3U0BA 5AXBA 1E5LA 2BFMA 1LNQA 3OBBA 1U8XX 3GGPA 3VOSA 3WGIA 1C0PA 4OAQA 1Q0LA 4NBTA 4BB5A 2HDHA 3BTUA 4PLGA 4Q3CA 1JN0A 4LRSB 2ILTA 1VPDA 3DAPA 4KTVE 1KEPA 1JDJA 3WJ7A 4EBFA 1UUFA 4E2WA 3OQBA 4IIUA 2GLXA 1GEGA 4WGGA 4E2ZA 5BNIA 3D5TA 1K5HA 2O3RA 5ICMA 3EYWA 3KBOA 3JTMA 2GO1A 2VQ3A 3H5AA 5EQDA 3KRTA 5L9AA 4IINA 4MIEA 3C1TA 3I9MA 5AQ1A 4KUGA 4XQGA 1X7HA 4QT0A 4WCFB 2R00C 1O94A 1FDVA 3LLVA 3B1JA 1BTOA 3AI1A 1CRWG 3L6OO 3SLKA 5JCJD 1C14A 2FOIA 2X9GA 4AJNA 4YJGA 2DTDA 1G1AA 2PZLA 1P1IA 3RU9A 3LYLA 4K9DA 1GAEO 1MV8A 1ULSA 3W8FA 3VDQA 3RC7A 4RGBA 3JCZA 1HSOA 4E32A 5FF9A 2CMDA 1LDMA 2GN4A 4QO8A 1QLHA 4RZHA 3DBLA 2GPTA 3MOGA 4OJNA 2BD0A 3QWAA 4IMPA 4XYMA 5DBIA 3GUCA 3KUXA 1TT5B 4BGEA 3K8ZA 1SC6A 4RORA 2GR9A 3IJPA 3QP9A 3BZUA 4HY3A 2EEZA 4FJ2A 1WW8A 3RSHA 2A4KA 1IYZA 1EUDA 1QP8A 4G2NA 1P74A 3DR3A 1DB3A 4HNHA 4I5GA 2WD7A 4KQXA 3S2EA 1QMGA 5C7LO 3R3SA 3OIFA 3O38A 5A05A 1U3VA 5JDCC 4Y6PA 5AVOA 1Y5MA 3H9GA 5HA5A 5JO9A 3WGHA 4EJMA 3PYXA 4N54A 2ZJ0A 4OMUA 1U4OA 3OICA 4BNGA 2X0NA 3DTYA 2Q4EA 4ZRNA 1NYTA 1I30A 5IDYA 1K6IA 1UP4A 5BSEA 4M87A 4EUFA 4XQCA 3DZIA 1SOVA 1T4BA 3E9QA 4CUZA 3RFXA 1XA0A 4TVBA 3DTTA 1SPXA 2Y1EA 1S7CA 1NASA 3EK2A 1KBZA 1I01A 3AOEA 4ITUA 4JBIA 4KDFA 1LBEA 1O5IA 3VTFA 3PGJA 1ID1A 4OKNA 4CM4A 2QHXA 4CMHA 3H3FA 2X4GA 3PXXA 5JCJA 3K30A 4J0FA 1PJCA 1WXDA 1ZUD1 3BHIA 4IDDA 4EJ6A 4ALJA 3FWNA 3IP3A 5L7TA 2BHLA 2V6FA 1R37A 1R4NB 1DHRA 1UDAA 3HSKA 2B4QA 1Y6JA 5L53A 4DYDA 3NDRA 2VZ8A 4CQMB 4NFYA 4XZ3A 5B1YA 3Q11A 2BI8A 2Q50A 5JW6A 5COQA 1S6YA 4J6FA 1MFZA 3ZU2A 2AXQA 4AJEA 4CV3A 3AM3A 1YVEI 5L4NA 1CQJA 2O23A 4YPOA 2BGKA 2PKQP 1O9BA 4U8GA 3DHYA 4AJIA 5LC1A 1JKIA 4FFLA 3NTQA 1FDWA 3SJ7A 3INTA 5IAAA 4ND1A 4CLXA 1E0DA 1K6JA 4MVJH 2NU6A 2O4UX 1DC5A 3R6DA 4BNMA 5L4SA 1HF3A 4D45A 2TMDA 3HDJA 2Q45A 4L8VA 4CM5A 2PNFA 5TJHA 1DLJA 1HE5A 1G0NA 1LLDA 1SOWA 3C3XA 1LSUA 4J1SA 4ZGWA 1DJNA 1VKOA 4HFJA 4W9NA 4J4TA 2FPPA 3WIEA 2Q4BA 4GQAA 3NYWA 4W99A 5COBA 2BMAA 3BHJA 2O48X 1RKXA 5CDTA 4JNKA 2GZ1A 1PS9A 3QLJA 1N1GA 3W6UA 3L07A 3AUSA 1HTBA 3GLQA 4H16A 4PVCA 1BXZA 2VT3A 1B2LA 2VUSA 4PZCA 5KJ1A 4RQTA 5HRUA 3UCXA 4HXYA 3Q3CA 4XGKA 4RPHA 5LCXA 3G1UA 5A9SA 2C0CA 3E9MA 1I36A 4MP3A 3HN2A 4IDFA 4CMEC 4YRBA 4GVXA 3DMYA 2QYSA 1N2SA 2DAPA 2NVWA 2BI7A 2AW5A 3BMQB 2GERA 1NVTA 2I6TA 4M54A 2WM3A 3QVXA 3H9UA 3LLSA 3I9OA 1RJWA 1YQXA 2P5UA 2QRKA 1PWZA 2C5AA 3ZHXA 1NTOA 1F8FA 3WQRA 2FY8A 2VYVD 4BO2A 3ULKA 1GL3A 4MVJM 5JXWA 1Z74A 4B7CA 4UULA 5JMPA 3GAFA 2G5CA 2GYYA 3MOIA 4CM3A 4PGFA 1NQOA 4R3NA 3ROQA 2VT2A 1LSJA 1GQQA 2D2IA 2GZ2A 4YACA 4D0RA 3DB2A 4S1VA 1O0SA 4MKRA 1PR3A 2C20A 2YUTA 3GPIA 2X86A 5DCYA 1E1LA 2UV8A 3KTDA 3M2TA 2OZPA 3I83A 3QHAA 4NU5A 5TIIA 4YJHB 4XYGA 1U5CA 5B37A 2X58A 1JVSA 1SB8A 4WLVA 1LUAA 1YQGA 2PKQO 1LI4A 3UCFA 5EESA 2JCXA 2PZKA 3VZRA 2QZZA 2X1HA 5A4DA 1OOEA 2O2SA 1LDEA 1XGKA 4ND3A 4Z9YA 1M6HA 1DDOA 2EG9A 1KEVA 1BXKA 3K31A 4ZD6A 3LZ6A 3AU8A 2HU2A 3EZYA 5LDHA 2DFVA 3GFBA 4PLHA 4DC1A 2IEBA 4HX5A 4BO6A 3NRCA 1V8BA 3PQEA 3ZNQA 3WGZA 3JQ9C 1GYRA 3ON5A 4YT5A 2FZEA 1I5RA 5H83A 4E4YA 3WX0A 4E21A 3MTGA 1ZKMA 3G0OA 1CEQA 3OIDA 3KEQA 5KOIA 4LISA 1X1EA 4QO7A 1HT0A 1LDGA 1Z7EA 4RF2A 1FK8A 2X0IA 2X8LA 4XWYA 2YQ5A 3VKVA 1PWXA 2VYVA 1NR1A 1WDLA 5JFOA 1RYEA 1DRUA 2DTEA 1PL7A 4FC7A 4GVLA 4AICA 4ZHSA 5JYDA 1QYWA 1NFQA 2GD1O 2I9PA 1XHLA 2IZ0A 1Q7BA 4ND4A 1UZNA 3ASUA 4FR5A 5CDUA 1RM4A 3BA1A 3D4PA 3ZW9A 2YV1A 1M6WA 2BH9A 3DBHB 1SBYA 2UAGA 1YXMA 3HG7A 2LDBA 2QRLA 4L0QA 1E1KA 4DIFA 1LRLA 2OMEA 2C54A 2RHCA 4L4XA 3U4IA 3E6AA 1OAAA 4I9HA 1R6DA 1KEWA 4JGBA 1N7HA 3DO5A 4R54A 4WNIA 3GZNA 3D3WB 4MO2A 1YB4A 5KJ6A 4R3WA 1LDNA 2Q99A 1Y1PA 1RM5A 1I2ZA 4IM7A 4NH4A 4OXNA 1HDRA 1PQPA 3QVWA 4HNGA 4PLPA 1KETA 4R01A 2V6GA 4BL5A 2NUAA 4U5QA 3AK4A 2VN8A 2G0TA 3AUTA 1DXYA 4IIVA 4R5HA 3KOUA 1PZEA 3NV9A 3EW7A 3H8VA 4KUEA 4II3A 4BGIA 2C5EA 1YH3A 4RVGA 3AY7A 4JXKA 5CG1A 1QYDA 2EERA 1HDOA 3PI7A 4RZIA 5JS6A 3GF4A 1UP7A 1EFKA 2P4QA 3PYMA 1PEDA 4W82A 1GZ3A 2Y67A 4R68A 3DAGA 5L7YA 4DBZA 1LA2A 3QRWA 3WYEA 3JQCA 1LC3A 4TZTA 1I2CA 1HZZA 4OH1A 3DOOA 3I3OA 1P44A 5G4KB 4XYLA 2JKVA 2YDXA 1YOVA 3FNGA 3RU7A 3W6ZA 1LX6A 3WBBA 2EKLA 4XCVA 4CMCA 2VWPA 4WK6A 4UEJA 1JAXA 1N1EA 2FRDA 4LVUA 3QWHA 3RBZA 3HJAA 2CDAA 3I9JA 2NQTA 3H9EO 4AJPA 2PWZA 3KXDA 3TL2A 1HXHA 3PLRA 2J5RA 1E77A 3GNSA 3M1LA 4O59O 5DDIP 2BGLA 1HRDA 3VPFA 1ISIA 3DWFA 1LLUA 3INRA 3UHAA 3G49A 1ZSNA 2Y0EA 4IQGA 2EF1A 1DSSG 4UUPA 1PJTA 5A3JA 5L45A 1C1DA 1Z75A 3EHEA 2DQ4A 1EVZA 2VZ9A 1NNUA 3UKOA 4LGVA 4YVFA 3WFIA 4XJTA 4Q9NA 4HP8A 4BS9A 1XDWA 4CMGA 5JC8A 2YV3A 4BVAA 4K1LA 3E48A 2WDZA 2FSVA 1GPJA 1CERA 2FPIA 1GY8A 1DAPA 1V3UA 1T26A 3KVOA 4JLWA 3DBLB 4PLCA 4Z0TA 5TJ9A 2EGHA 3OQ1A 5CPFA 3RC9A 2V65A 1I10A 1P31A 3KEOA 4DMMA 3H65A 2JD0A 2HQ1A 5G0SA 2GDZA 5DULA 2F1KA 3MJCA 2VRCD 3ZV6A 2QG4A 4OM8A 2X0RA 1TLTA 3DZFA 1M76A 4NJMA 1A7KA 4PRKA 2B37A 2HJSA 4ZVVA 4GX0A 2WD7B 4R9SA 5EINA 1KERA 1QORA 5F3RA 1B16A 1LQUA 2HJRA 2X23A 3ZNNA 4BV8A 1R0SA 4G5HA 5ER6A 1DIHA 4F6CA 4O6VA 3A9WA 1ZXBA 2Z1MA 2AQIA 1I8TA 1JQBA 2Y1OA 1PR9A 1RM0A 1X15A 3V2HA 3AOEC 4Y98A 2O3SA 3UXYA 4BNYA 2JJYA 3JYNA 4B7XA 1BDMA 1D3AA 3JYOA 1ISJA 2C2XA 3H7AA 3QSGA 4RF4A 1F14A 3PQFA 4I5DA 1GEEA 4UEKA 2WSBA 2Y0DA 1U8FO 1E7RA 4BQPA 1A9ZA 3O9ZA 4CM4B 2P68A 3KYBA 5CHEA 2Y93A 1V9LA 1LXCA 1OC2A 3EDMA 5AOVA 3IDSA 5K0ZA 4XGNA 3LF2A 3V1TC 1NHGA 2QIOA 2Y0CA 3JQ7A 1GYQA 1G0OA 3DZBA 3WLEA 1JTVA 2CDCA 4B4WA 4L4RA 1EQUA 2PKRA 1CETA 2WE7A 4NBUA 3ZH2A 1WZIA 4ALIA 2RIRA 4BB6A 3FNEA 3MJEA 3R3JA 3D3EA 5KVSA 5C3MA 2HMSA 4CMIB 2YZ7A 3AFMA 3WQSB 4D41A 1Z7BA 5KTKA 2NLOA 1ZW1A 1ZXLA 1SO8A 2E37A 2ZQZA 3KYCA 4Q3DA 4WLEA 2VRCA 4EZBA 3QVOA 1ADCA 2C7GA 3ZWWA 3ZV4A 2YYYA 1BW9A 4DQVA 3CUKA 4FC6A 3G3EA 3HHPA 4R1SA 4JIGA 1M2WA 1PIWA 1ENOA 2JL1A 1XKQA 1F06A 2OL4A 4W9NC 4WEQA 3CSDA 5KJCA 1X13A 3AU9A 3DZGA 3LT4A 1U1IA 1ZZEA 1NQTA 3ZDFA 4RPLA 4ZQBA 2C59A 1GADO 2CF6A 3CMMA 1N8KA 4DPMA 4MIOA 2PGLA 1E6EA 5DT9A 4GKVA 2CUKA 1NP3A 1NWHA 3CZRA 3SXPA 3ST7A 4RPJA 2OUIA 4D3SA 1BGVA 1UDCA 2J8ZA 4PG7A 5GZ6A 3TZ6A 1DJQA 1DAOA 3LDHA 4GX2A 5ITWA 5DOVA 1UDBA 2W2LD 2J3HA 1CJCA 3I5MA 1VC2A 4ND2A 4NFHA 4YEDA 3SJUA 5F1KA 4GSKA 4OL9A 4LSWA 4PN3A 2JFGA 4L74A 1ENPA 1ONNA 1WP4A 5TSDA 2ZQYA 5CDGA 5A3VA 1ZFNA 1K0UA 3AUUA 4DWVA 1PS8A 1KVTA 1N7GA 3TF5A 1SNYA 1ZBQA 4BNXA 2Q46A 2DC1A 5A9SB 2IYOA 3DFUA 3ONEA 5ADHA 4RCVA 4N5LA 3H6KA 2DLDA 2A94A 3ZU4A 3JQ8A 9LDTA 3W8EA 4GGPA 3K73O 4MDHA 1C3VA 3FPCA 1O8CA 3TWOA 4AJHA 3WIDA 5L51A 2I3AA 1OZAA 3JD0A 3OP4A 1QYCA 1EFLA 4GI2A 3OJOA 1E7MA 2EW8A 3UUWA 1TEHA 2H63A 1ZIDA 3PPIA 4XX0A 3UCEA 1P9LA 2NVBA 5IZ4A 1PSDA 4XR9A 2P9EA 1B3RA 3ZHBA 4FDAA 3HDQA 4B4OA 1UXJA 1SEPA 4WCDA 1YL5A 1E7WA 1PQUA 4O5OA 1ADBA 4IQ8A 4J3FA 5T5QA 3IC5A 4WASA 5ICSA 3IJRA 2ZJ1A 3ZHZA 1IB6A 4E2XA 1PGOA 5AYVA 2W2KB 3VDRA 1ULUA 1ORRA 3RUFA 4TMFA 3QWBA 2J5KA 3DONA 1P1RA 1VE9A 2WD8A 4JROA 5G4LA 3G17A 3ZZNA 4Z3KA 4TRRA 3AOGA 3JQEA 3AY6A 3IQDB 3ZWMA 2W2LA 1BMDA 4YYZA 4X54A 3PQDA 1U3TA 1ONOA 3D64A 2J3JA 4QUKA 2NVUA 4ALKA 2HMVA 5IDWA 3V2UA 4YTEA 1Q1NA 5G0VA 3DOCA 4FGWA 4CUJA 1E7SA 1IZ0A 2IZZA 1QYVA 2RH4A 5B4UA 5CEEA 3DC2A 1E92A 3WGYA 4GH5A 1ZSYA 5TRTA 2IODA 1PTJA 1WWKA 2B35A 3HFSA 3L77A 1GQYA 2OGUA 4CLEA 2YDYA 3FHLA 3AUAA 1V6AA 4MVJP 4LSMA 1U28A 3A28A 2XPCA 3GRPA 4WLFA 1BHSA 4K6CA 3NTOA 4A73A 4BNUA 4ALLA 3NUGA 3RKUA 1NFFA 1AHHA 4Q3AA 3JYQA 1XU7A 1A27A 4YQYA 3PZBA 3C1AA 5IXYA 1GV1A 3WGQA 2CY0A 4WE3A 3N7UA 4M8SA 3RQSA 1V0JA 4JJIA 2EV9A 4ZQFA 2HMUA 2O3JA 4WLNA 1Y8RA 2ZKLA 1KY4A 2DUWA 3GMDA 3A1NA 1H6AA 5DP1A 3I9LA 5KVVA 5K9ZA 2I5PO 1C1XA 3R1IA 1LEHA 4Y67A 4GBJA 5A5EA 5K6AA 4F6LA 3H9JA 3KO8A 4XRGA 4HFNA 4OO3A 3GZNB 1ADFA 4NFSA 3R0IA 4F45A 2WMDA 4BNTA 4EGFA 1CWUA 1WNTA 3HN7A 1ISFA 1JU9A 1BXGA 3GK3A 1LDBA 3JD1A 4CLRB 4E6PA 3QA9A 4CM8A 3FBTA 2VNSA 3K5PA 3S1LA 1T1RA 4NBWA 3S2IA 4TSKA 4LCJA 3IUPA 5EMHA 1XIVA 1XCBA 3A06A 3L0DA 4YRDA 3ZW8A 4Q39A 3C7CB 4XGIA 2Z1NA 2CSUA 2JD1A 4BNIA 2CF5A 4A26A 1EDOA 1XYGA 1O6ZA 2QYTA 3SEFA 4YAGA 4DIBA 1U5AA 4U0JA 4DLLA 1LC0A 1SZJG 1WDMA 4AJ1A 1MX3A 2I76A 2C82A 3PDJA 5KJEA 4ONEA 3GAZA 4CMBA 4M1QA 1X7DA 2W4QA 3NT4A 3TZQA 5ILOA 1E3JA 3F6YA 3KZVA 1YOVB 3N58A 3W4IA 1YDWA 3WWYA 2Q1WA 4BO0A 1UP6A 5EQFA 3PYLA 1YONA 5H82A 3QWIA 3ASVA 4UREA 2WJPA 3GVCA 3PHJA 3WWZA 4ZJUA 6ADHA 3E1KA 4NBRA 4BMNA 4IBOA 3U49A 4XKJA 3HDHA 4GMFA 3RIHA 1WMAA 4R1NA 1RWBA 2J5QA 3IS3A 4GLLA 3ANMA 5T57A 3L9XA 5TC4A 4U0KA 4P8RA 4E12A 1BRMA 4FQ8A 1DIRA 4BNFA 4J4BA 1E3WA 3DBRA 1PJQA 3GVXA 3PHLA 3PJGA 1RYDA 3FNHA 3OJEA 1OI7A 3JQFA 2JFFA 4AJJA 1EBFA 4H7PA 3U62A 2IDZA 2O50A 2VHVA 4PG6A 3JSAA 5CEJA 4PG8A 1AUPA 2ZATA 3O8QB 3ORFA 3ZWBA 1UZLA 3ZWPA 3FD8A 2NU7A 1AGNA 2EP7A 2QZ9A 4N7RA 4BMSA 5JAIA 4J1QA 1Y8QA 1T2DA 2VNAA 4BNJA 2EJWA 3TRIA 4LVCA 5A1TA 2YHUA 3SX2A 1B8PA 3UICA 4TROA 3MEQA 3INGA 2C29D 2I65A 1MGOA 3DZJA 4FBGA 4DYVA 5HS6A 4JJGA 2AQKA 1N9GA 1Y9EA 2EP5A 4HFRA 3WQQA 4MPDA 4GL4A 4CM7A 3RKRA 1YBAA 1DIGA 1XQ1A 4YJFA 3G1TA 5DCUA 3TFOA 3FTNA 4XDZA 3IUSA 3ADOA 4ESOA 5I8ZA 5DN9A 1ZH8A 4BNNA 1P45A 1NVGA 3I6QA 1LLQA 2IZ1A 3PP8A 3MJTA 1MUUA 2GF2A 3AJRA 3W8DA 3TN7A 1GQ2A 3F46A 1GUZA 5HBRA 3VH2A 4L4SA 2NM0A 4TZKA 4BKQA 3U4CA 2G1UA 4R69A 5J23A 4DREA 1NAHA 1YL7A 5JYEA 5THKA 4MVJF 4P22A 1EUCA 1VL8A 2I67A 2AG8A 1W6UA 2B5VA 2PR2A 4Z0PA 3WTCA 3AI3A 3KLMX 4K28A 5TT0A 3E82A 1W4ZA 3JQ7B 1GCOA 3PDUA 4IDCA 2HK7A 3I23A 2CVQA 4KQWA 3B1FA 5F5LA 2YHIB 4MVJE 3LT2A 1V35A 3BTOA 3SC4A 2FPGA 4UVEA 1VJ0A 3CTMA 3KSDO 3CPSA 3DHNA 5A03A 1DPGA 2Q1SA 3GGOA 2I66A 4QFCA 3B20A 5HWSA 1BVUA 4RPGA 2YY7A 3F9IA 4I8XA 1EEHA 3JQAB 2WWRA 4CM9D 3PRJA 4FFRA 1T24A 3LQFA 2VZ0A 3BTSA 1JVBA 4AJLA 3E8XA 3ROPA 4OQYA 1U9JA 5IZCA 1JKFA 3EUWA 2AEFA 2EHDA 1JLLA 1CYDA 2ZCUA 3DBVO 4O0LA 3OEYA 5GY7A 4A5OA 4E5PA 4CLOA 1ZNQO 3NDIA 4ID9A 4B8ZA 3ITDA 8ADHA 1KIFA 3VAZA 3FCOA 3V5NA 4UUOA 4GX1A 2VUTA 2PY6A 4B3JA 4CUKA 1P1JA 4R1UA 3NX4A 3FR7A 5COAA 1Q7CA 1J0XO 3GY0A 3GNTA 3JQBA 3RUIA 1XR3A 3VHRA 3GOHA 4GMGA 4Y6SA 3PLNA 4CPDA 2OOSA 3TZHA 2O3UA 1PZGA 2DFDA 1AXGA 1H6BA 4INAA 4NHEA 1NM5A 4HFMA 5CP8A 3JQDA 1Y9AA 1B7GO 1E6WA 1I24A 4PRLA 1E7QA 3DOJA 3JQGA 1W0CA 1D7OA 1YDEA 2I99A 5G0WA 3ONFA 1VJTA 1P33A 3KSZO 1GPDG 1GFSA 2ZB7A 3KYDA 3RASA 4TRNA 1H2BA 5JO0A 3OECA 1Y5RA 4XIYA 4CJXA 5I9NA 1T2EA 1EE2A 3DL2A 5T8KA 1ZK1A 4NJOA 2W8ZA 4WKGA 3JQ8B 2NU9A 5LDGA 1P3DA 2RHRA 1MXFA 4DQXA 4IDGA 4DPLA 1BWSA 4C7KA 3EGOA 4MJLA 1IE3A 5ILGA 1KC3A 4RVUA 3RUAA 3UW3A 3MJ4A 8LDHA 3ZCXA 1FDUA 4P38A 1PJ2A 2OFPA 3IKVA 3T7EA 2O2YA 5KCZA 4KDEA 2YQ4A 4CM9A 4WJZA 3NJ8A 4YT4A 4IGEA 2YFQA 3X2EA 5B4VA 1ENYA 1JA9A 4WCFA 3TQHA 2ZB3A 3PHIA 3ZGYA 1XWFA 3OA2A 1VM6A 2OP0A 4Q3NA 2FR1A 3DAFA 1UZMA 1WLYA 3LC1O 3PWZA 1VRWA 4OXKA 3WJAA 1KEUA 4BIIA 4E30A 4YQZA 2BLLA 3M1AA 2PGDA 3DFZA 5T6BA 2AHRA 4FSHA 4PLFA 4CQMD 2ZTMA 1L1FA 4WNCA 4YT8A 3WS7A 3IIEA 4EW6A 1ZEMA 4PLWA 3E9NA 3K96A 3GHHA 3JD2A 4EUEA 4URFA 3DMTA 5I7SA 3NTRA 3RFVA 1M75A 4NR0A 1I3NA 2AE2A 4H3VA 4FB5A 1JKJA 4M89A 1ADGA 1HLDA 1NPYA 4D3DA 3WICA 2Q49A 2PD3A 4ILKA 4DIOA 4FFNA 3T4XA 2GSDA 1O95A 5JPIA 3B6ZA 3L6DA 4KUHA 2B4RO 3ROKA 3EMKA 4L75A 1OFGA 4OSPA 3TZKA 1FMCA 4ND5A 3P19A 1T2CA 3ICCA 1LSOA 3OF2A 4D42A 3LC7O 2NACA 4YRAA 1SMKA 3UAGA 2UVDA 1LRKA 4D0SA 1T2AA 2OBNA 3ICPA 5DP2A 5L4LA 1HKUA 4PZDA 5A06A 1QYXA 3TDKA 3IKTA 1EUZA 3E5MA 4E13A 2X7HA 3ZWOA 1PGNA 5ENDA 4N5MA 4W4TA 1EVYA 2TMGA 1YBVA 2PV7A 5A04A 4LMRA 1WAMA 3D4OA 5K6AC 2CZCA 3SVTA 1NX6A 2G82A 4BGVA 1DRWA 4YJGB 3HDYA 3PFWO 2C07A 4PZEA 4XJSA 5C37A 4I5FA 1EK6A 5FYDA 3U9LA 4BV9A 4TRMA 2E82A 1E7YA 2BELA 4QSMA 5FFFA 4ZQHA 3EVNA 1UAYA 4CQLA 1G6KA 4CQMA 1H5QA 1X1TA 3BXXA 4YWJA 1WVGA 1Q7GA 3VTZA 3X2FA 1PJSA 5JAZA 3O26A 1HYGA 3OSUA 1PS0A 4DVJA 5B4TA 3C8MA 5JC1A 4N5NA 4BOYA 1TA4A 4FOSA 3ZU3A 2C7VA 5IDXA 2FR0A 3M6IA 1BSVA 4NIMA 2P5YA 1FXSA 2VTEA 4E31A 2GRAA 3RBXA 1YKFA 4NPCA 3CE6A 1VJ1A 2YW9A 3H3JA 3RUHA 3RUDA 1AHIA 4UVHA 2GN8A 4RF5A 5B12A 1A71A 4L9RA 5C5IA 4PCVA 3ZWYA 3A14A 4XD2A 2SCUA 3T4EA 4O1MA 4M49A 1I3MA 3BMCA 5C7IO 5L7WA 1BDBA 1H93A 4W6ZA 3OHSX 4RDIA 4A03A 3RAJA 4B7UA 1Y7TA 1MG5A 4IDBA 3RJ5A 3RROA 4D3FA 1BVRA 5L3ZA 1WDKA 3VKUA 4IDEA 5TS3A 3WFJA 1MP0A 2GN9A 1U4SA 1IZ9A 3WOHA 5IJZA 4GWKA 4QFDA 3OEWA 1MC5A 1N5DA 5TLSA 1SB9A 3U09A 1Z45A 3JQFC 3ENNA 3VH3A 4OGWA 2F00A 3HUDA 3LK7A 3WMXA 1DFIA 3WGGA 1D4FA 4TRJA 5IF3A 3HFGA 2NV6A 2J3IA 4CL8A 3K2BA 5THQA 3DBRB 4YDRA 1DFHA 1XLTA 3HE3A 2DPGA 4GSLA 5JE8A 2AMFA 2Q2WA 1QG6A 2Q3EA 1J5PA 1SEVA 1F0YA 1ISMA 5C7OO 2QRJA 1LQTA 3I6IA
chains in the Genus database with same CATH superfamily
3PC3A 4UCXA 4F3RA 3QY0A 3V8RA 2Q5JA 1Z8NA 3RUCA 2A0YA 4CV1A 2PZJA 4MS1A 2NSLA 1HYEA 3I64A 4JB2A 3GRRA 3I58A 4B6JA 5LQJA 1T5OA 4Y0VA 1W30A 3JD4A 4LDQA 4BUCA 4P54A 2O0LA 1FRZA 3FBGA 5KIAA 4CQJA 1P6QA 1C0LA 2JCVA 4L0MA 3E18A 1KE1A 3VO2A 2PA0A 5M2QA 3KM0A 2QVYX 4PY2A 4MW1A 1OB5A 3TS1A 4JKOA 4YJ3B 4HRAA 2ASEA 3C4QA 3DKRA 1N7JA 3ZYZA 3GQVA 5DN6A 5HS4A 4LY3A 4A9AA 1ARZA 1CP3A 4G07A 4BV3A 1SA0A 1ZU4A 4DR1B 1KXZA 4PC1A 3H99A 1XF9A 1ZK2A 5FB3A 3OM1A 4GKAA 4G0ZA 4OQLA 5EKDA 4ND6A 3NU1A 2ZAGA 1WVIA 2FSHA 2XCUA 3BXFA 2R6FA 1Z4QA 1EZ4A 5BWNA 3OP1A 2FXVA 1P0CA 5BQXA 3MHTA 4KE9A 1I7NA 3HKCB 3KVVA 1Z5WA 5AXAA 1VDMA 1W2GA 4FLFA 4B9EA 1GTRA 1DAGA 1PP4A 2D59A 4DLSA 1ZNXA 2YNMC 2QJTA 2HSEA 3IA7A 1D2AA 2W2MA 3OQ6A 4N9QA 3V1NA 2ZUEA 3GVIA 4TZ6A 3PJRA 1DFGA 1B26A 1QV6A 1H2HA 2FKAA 2OMKA 3W4KA 4EECA 1BRTA 3EUAA 16PKA 5FWXA 3CZQA 2O8VA 5I7EA 4IS3A 3C3KA 4K9NA 2CD7A 1VHWA 4L9WA 4GEGA 4KZPA 4ALNA 4EPRA 3JAKB 1KP9A 4PC6A 1S8AA 3OU6A 1CR2A 4EHLA 3MWJA 2RBEA 3AM1A 1U02A 3EIQA 3J7TA 3ZW9A 4UAGA 4R8VA 3JPWA 5DCLA 4OQZA 2BFDB 4GLOA 1Q1EA 1TF5A 1G5HA 4EKGA 1N2ZA 1TZBA 1W5AA 3HSSA 4GYJA 2FR8A 4P3KA 3LTNC 4MO9A 4HQRA 3WXBA 3O2SB 3LPLA 4NS4A 4UQLA 5I7VA 5CLGA 3NVAA 2CW5A 1CZRA 1J06A 2Q5OA 3IESA 1XEWX 2PH3A 1WZ2A 2A92A 1ZRHA 3I1JA 2IU3A 4ZCLA 2AZXA 5LYYA 4XWKA 4BFUA 1XQXA 5HMLA 1DDGA 4A6EA 1CNEA 4L4ZA 4YUXA 1FJ2A 2Z6VA 4MS3A 5J9FA 4E5NA 1G4AE 4L28A 2OM2A 2PT6A 5EKUA 2RGNA 3M2PA 1YB1A 3DE4X 2RH8A 3FDZB 3KOWA 4I7EA 5BWLA 1FQWA 3RVNA 2CXRA 1MJ5A 2HN9A 3MWEB 3DLAA 5DBGA 1F17A 4Q19A 4ZAXA 1TJ4A 3ZWAA 4JT2A 2CBGA 5DI3A 4EARA 4BY9E 1EDDA 2IYLD 1U2DA 4BQQA 3MCUA 4X65B 3ZV3A 4TS1A 3ROGA 1FNBA 1FEZA 2WVHA 4ER5A 1SD5A 3GT4A 3Q0EA 3BIWA 1JMYA 3BICA 2HHCA 3JQBC 3WYCA 4RA6A 4I36A 5IKOA 1NQAO 2AFIB 1B6SA 1MLDA 1CE8B 1KO4A 4AZ3A 3GAAA 4DLNA 3EFBA 1QH1A 5CPBA 4CMKA 1WKVA 4JBYA 4PAGA 1NM5C 2QXUA 1C8VB 4G97A 4Z4IA 1HQYE 3U4MA 2D5AA 1M6VA 4M83A 1Z16A 2DSTA 3CF4A 5TQVA 4TQUS 4HDRA 4YAEA 3K9NA 2H54A 2NNLD 3MWKA 4Q4LA 3WZ2A 1WU8A 3N9IA 4HUJA 1OMOA 2W4IA 3N75A 1V5WA 5TDHA 5I7RA 3LT1A 4EUSA 4I9UA 4IHJB 5JAMA 1VSBA 2HIGA 4DDUA 1PJ4A 3F96A 3KQWA 4X7RA 4MI9A 5AW3A 2OVFA 1DC3A 4CLHA 1O0CA 3L5OA 3ZIDA 1KS9A 4UHKA 3CUSA 1DBWA 4M86A 1N6LA 1YJXA 2Z5LA 2ZJ7A 3P45A 3WTBA 1M73E 3RVPA 5LD2B 2Z09A 3LUGA 3QLEA 2RGGA 1N2HA 1VHDA 1E3SA 1EJ0A 5DRTA 3PEWA 1BO6A 2GM5A 2HUNA 3L7JA 5G4KA 4RM2A 1GV0A 2VAVA 2WP8J 4RTSA 1J8QA 2BFOA 3OBIA 1IONA 4KXYA 1ZC3A 4EY3A 1R00A 4MRPA 1NVWQ 1SIUA 3PDIB 1U0LA 1XVVA 2I7TA 4P86A 3K6KA 2WAXA 3T7TA 1NUUA 4C3UA 2NT4A 1PR6A 3CCCA 2ZUWA 4KTTE 4S0ZA 1NKTA 4Z5XA 1MORA 2EQBA 4MKZA 1PZFA 1RAGA 3AHFA 4RLQA 2IXAA 4RUKA 5GZ3A 2X9QA 2QN7A 2ZVPX 4O63O 3VR1A 1ZEJA 1QIDA 1N5MA 2H2GA 4D4MA 2A9RA 1DIOB 1TQ8A 2PXHA 5KSYA 3JQQA 1BJKA 3Q40A 4Y1RA 1EFTA 2RK4A 1UFKA 2WINI 3LX6A 3VR5H 4DCTA 4YC7A 2H4FA 3KTOA 1V5FA 3ZVNA 5HIIA 3FUUA 5BW8A 2PNJA 4KQMA 1Z2NX 4OP2A 3U4DA 1H0SA 1XZCA 4KI7A 1Z68A 3BMNA 2FP3A 3FYUC 1GGKA 1GXSA 4DLAA 2PLNA 3ZHOA 4DA8A 1ESDA 1INLA 1A9XA 1TB4A 5AVTA 1G8KA 5K0NA 3LQ2A 1BC5A 2AX3A 4MAFA 1L4HA 2O3QA 3FVWA 2JHCA 4NYMR 3FSGA 3U7QB 4MX8A 1MC1A 3RBAA 2BAGA 4BMOB 1E2JA 4KSCA 4JLKA 1JZSA 2XAAA 1R0KA 3T06B 1Y4UA 4UZFA 2HSGA 3OUTA 3UK2A 1D5CA 3V4SA 1E3LA 1L7DA 4B4KA 4C2AA 5LIPA 4DDMA 1PGPA 3KLBA 4PS1A 3E22A 4EFDA 2J9RA 1RLUA 1W4CA 1YI1A 2IY7A 4DRYA 4FSDA 2REQA 1ZQ1A 3Q9SA 2P2CA 1PZNA 4GMHA 2ID4A 2LKCA 3VXKA 2DBYA 4IMJB 1UXIA 1E6UA 3F6RA 5KOJA 2WWGA 3GCZA 3NAMA 1FTNA 2JGIA 2RGRA 5AXCA 3BRCA 3DKVA 3FKQA 4ZCPA 5A4IS 3BJRA 1WZEA 3C3YA 2Z2ZA 2ZWAA 2O8CA 3JR3A 4V0SA 3LP5A 4FMCF 4KPFC 1UEIA 4QG7A 5JNUA 4ZZ3A 1NZFA 1ZN8A 3AWIA 3WMWA 4LYGA 5JJLA 1L4YA 5FA6A 4EMUA 3QNUA 1DO2A 2ZYSA 4J9VA 4YRIA 1P2GA 1IHXA 1Y4SA 1YJBA 2XMGA 3O4IA 2VJDA 4JUFA 4OMDA 2BCEA 2CLFB 1TCAA 2AN3A 2JAQA 5CTJA 2VYND 2CGEA 4ZARA 3VPGA 5CA0F 5JRDS 4II7A 3PUJA 1XPRA 4PYOA 3E9DA 5CA0A 1RFLA 1R64A 3GGJA 1GTG1 3H84A 2IZ6A 4JQYA 4AB1A 2ZRKA 1CF2O 4F9TA 3GRKA 4ZO4A 1HDCA 1EM6A 1XXHB 3AKDA 2VH2A 2G5GX 5BRAA 2FGJA 2GD6A 1U7XA 2PBRA 2QM0A 3CX3A 3UAYA 5CB0A 3E7PA 1GWNA 5CG2A 1M5TA 3M4XA 3IVAA 3CHYA 1TUBB 4GZ5A 4JFAA 2Z2YA 2ZB4A 1L6IA 2XB8A 3P27A 3ZJYA 2GD2A 4H0FA 1SUBA 1N36B 2JCYA 2OSBA 4O2AB 5DXAA 3GH1A 4KN8A 5HGJA 3LHDA 5C31A 2VPIA 3OETA 1QR6A 3I52A 3CW2A 5HE9A 1GCUA 3WNVA 3ZGLA 4BLUA 3HKDB 5AUPB 2Q6TA 4FIZA 3ETEA 3WZMA 5F76A 2XY4A 2JFNA 3KXIA 4QXRA 3PDWA 4MUMA 4XB6B 1A2KC 1E2DA 3A6DA 4A0SA 2DUUA 4NJMB 2IYXA 3URKA 2QDXA 2VA9A 4EB0A 5JS7A 1J23A 3EXG1 2B30A 1LBSA 2AA3A 4TOIA 1V1JA 2CD9A 4MKXA 3S70A 4RJTA 2XB9A 2H7XA 2HJHA 1QQ6A 3NTUA 4GP9A 4UKDA 1M67A 4CFZA 4BEVA 2O5RA 3ISTA 1H2EA 4TYNA 1EK1A 3P9PA 3KJQA 5CUQA 1X1BA 4CGZA 1NLYA 5CAEA 1UJ2A 2LDXA 1HO3A 4CKBB 2H4JA 2G9UA 1BCSB 2I6FA 3VKFA 2CLKB 3LL7A 4QDTA 2SCUB 1OYVA 2W6JD 4GP6A 1RC1A 3FF4A 2IPXA 1GCGA 2NUPB 3DCIA 3DOUA 1UXKA 3BFXA 2YJTD 4HJRA 4BZQA 1BFDA 4OQMA 5D3MA 1CY1A 5BSHA 2XB6A 1FDTA 3PVZA 4BNWA 5IC4A 5JANA 1WF6A 2R4QA 4DBVO 5AM4A 4YV7A 1H3EA 3DVRX 2JFPA 3L6EA 3MTJA 3HABA 3I04M 4RL6A 2H00A 3HXOA 3JX9A 1U7TA 4MUNA 1X94A 3CS3A 4UD2A 4A2CA 4OREX 3EXEB 1RJEA 3GR6A 4IOJA 5ALNA 2CNBA 4NBNA 4DUGA 1T5HX 4OYYA 3FUTA 5FTNA 1KVRA 1Y5NA 2BKLA 3MWDB 4GPBA 1JJIA 3LCVB 2DPXA 4OK5A 1PJLA 3SQMA 2JI8A 3L2OB 1O2DA 2WT4A 5AR1A 3OQPA 3W6OA 3SZLA 2PKEA 1C8KA 1KJ9A 1YS4A 3IILA 4DEYA 4FYMA 3M3PA 4J7XA 2NNWB 3IJEB 5AOAA 2RJNA 3MLAA 3RU3A 4AQDA 1M0EA 3C24A 2E55A 4H7IA 5DBHX 3TLCA 2HQBA 2PJDA 3OIGA 1YRLA 3HCNA 1Q2XA 4BX3A 5EJ5A 4HWKA 3GXBA 1KVSA 4H4EA 4GT1A 1NRWA 4IMRA 1GD1O 4LWQA 1RP7A 1P75A 4WXMA 4C87A 3AEKA 4DMGA 3K0CC 1OX6A 3KT6A 5KX5B 3EIUA 3G9ZA 1R4MA 1TADA 3BMOA 3CF6R 2VZLA 5U4QA 4IXMA 2AQ8A 4IO1A 3RYIB 2CMFA 3VBCA 4UZSA 4IRUB 1E9DA 2C94A 2XUGA 4ZQGA 2N3ZA 3ABIA 4BZWA 3IP8A 3C7AA 3MCVA 1TT7A 3QEJA 2D00A 3LY8A 4UD6A 2I2XB 4TV9B 5M7EA 4MW2A 2FPWA 4GOND 4IOMA 4QUHA 1JJ7A 5HSGA 3TO5A 5J5AA 1OLXB 3BD9A 2VYCA 5CBPA 1NG9A 1I2MA 1E79D 2CB0A 2R25B 3R7WA 4BQRA 2IYVA 1NW4A 1XMPA 1Z0UA 3EFEA 5ETJA 5T64A 3DM5A 1H3FA 2H4WA 3DWIA 3DXXA 4Y9UA 1MB4A 2A0XA 5EEGA 4BX8A 3W7BA 1D8AA 2R6ZA 5JH7F 1QK5A 3QYPA 5FQOA 4J0JA 3W05A 2FQWA 2NTNA 4KFSA 2HZ7A 2WYVA 4XAQA 4ZV7A 3UKJA 3WYDA 4AJKA 5JH7A 1UKYA 5EXXA 5JECA 1U0BB 4OH7A 1K2VN 2WHRA 3LX8A 4EDFA 2IYQA 1NI4A 3AO0B 1IZ7A 3DOHA 3E5RA 4PFSA 4IYJA 1USKA 5LZ8A 5A0VA 4MS4A 1A5ZA 4IIDA 2PZMA 3I8OA 2RB5A 2Y1DA 2G8LA 3QVMA 5BQFA 5HKAA 1V11B 3VV3A 3ZN2A 2DWOA 1K7YA 2WTAA 3BKXA 3LDGA 3NTXA 4AMUA 3C14C 4CZ2A 4JWTA 3V1UA 3I39X 1QGUA 1QB7A 2DVMA 5FWNA 1OXKB 3NBQA 2GEBA 3L4BA 5CT5A 2FFBA 4WLOA 3TUIC 3V1MA 3GEHA 4QWWA 1JDZA 3HEAA 3PJDA 2XGSA 3R3YA 4FNAA 1C0IA 1RLIA 1C29B 4UVDA 3WMRA 1U98A 4YI3A 1FFXA 4LV5B 5BSRA 4BKRA 1SC4A 2BFPA 1ZXXA 1G8PA 4HN2A 1TAUA 1FNCA 4R2KA 3S8MA 1W76A 1NVFA 3BK1A 5DGCA 1QCZA 3TCKA 2QMEA 2WIGA 1RTKA 1CD5A 3SOZA 4ETMA 4MWZA 2GNPA 3A05A 3ZCTA 4GC9A 3PV0A 4GAEA 1YVUA 4M4SA 4GOOD 3G0IA 5KVAA 4HV4A 1YR2A 3GFSA 4L22A 4WHMA 1K6MA 3GIDA 4XB2A 4WKBA 1A4RA 2EWVA 1H3NA 3JVVA 4L95C 2LTAA 2Y8EA 2OXCA 4MVJI 3BQ9A 2WK1A 2D13A 5ALXA 5GJWC 4IJMA 3QYFA 4PQEA 2CL6X 2PT9A 2R2GA 2ZB8A 1OWPA 4HZUB 5DF1A 3ESZA 2NV2B 1B6TA 4R9RA 1T9GS 1EDBA 1PUIA 1Z4MA 4LMPA 4EQ6A 3EDRA 5LQAA 1BG6A 1Z6ZA 1RVDA 3HUEA 4OU5A 3H13A 3Q7QA 4BNZA 4C20A 2J31A 5CMLA 3GQBB 1X80B 3FDJA 3MWGA 5AXDA 4R1PA 2Q5IA 1JALA 1W5BA 4KGXA 3ITKA 1QIHA 4K9SA 1DKOA 3WSTA 3H5RA 2X76A 3CIFA 4RTMA 4ZZ1A 3GG2A 4NCHA 1F12A 2YHSA 3QHQA 3A9CA 5LA6F 3T9BA 3AGPA 4RABA 1EIWA 5LA6A 4NXMB 5HOEA 3H1PA 3LWDA 3TR6A 2XQVA 2XW6A 1D1TA 4R2LA 3RC2A 5H02A 3OQJA 3SSAA 2ZI7A 1XQWA 2C3MA 4R1QA 1ILEA 1R5NA 1NC3A 1NJ2A 2DFTA 5AJXA 5JZVA 3I1YA 4R1OA 4I55B 2D1SA 4PQYA 5EWJA 3VZPA 2DHDA 1VIYA 3HACA 2EW2A 3PK0A 4HB3A 4WY2A 1Q16A 5DHQA 5K3EA 3ANSA 3PBKA 4GSYA 4R7ZA 5BNFA 3UZUA 1SHUX 5BMVA 5ITZB 5T4BA 1QO0A 3IQWA 3SZOA 4ZIRA 4RO0A 1RHMA 1U2SA 1M34A 4BMDA 4EABA 1TCUA 2V6BA 3OZCA 3GJYA 1W4RA 1X8KA 3L8MA 3N2KB 4MULA 2PSFA 5LL6P 4QDUA 3SBXA 4C78A 4PICA 4J90A 4WZAA 2OAEA 2PPVA 5EIAA 3UWKA 2B1RA 5DCWA 5JXJA 3HLKA 1UWKA 4FUQA 3R0VA 1N8TA 4D79A 1STOA 4PV7A 1LWNA 3D3QA 4M55A 1CCWA 5EHQA 3HJTA 3TSCA 1E1NA 2ZJ5A 2RI1A 3E2MA 4FLMA 1UJ4A 1TO1E 2SHKA 1XN1A 3WR5A 3W5AA 1M7BA 4W6QA 3P5SA 4PAWA 1C5KA 1L4LA 3WNDA 1ECGA 5B57C 5EJ6A 1D4ZA 1NR7A 3UF0A 3CU5A 3UMRA 3CKKA 4N65A 4F2DA 1TRHA 2EIHA 2IXFA 1GAWA 5KAMA 3EF0A 1NPDA 1D9XA 4Z86A 1T8YA 4C4XA 1I7QB 1WA5A 2GRUA 1LVGA 1UMCA 3UA4A 2K5UA 4P3YA 4F4UA 4ER6A 4UTNA 3HYSA 5C8DA 1UL1X 3OFVA 2I2AA 4N12A 1ZWLA 4BCBA 1T2NA 3WGOA 4DV6B 1WQ1R 2QUHA 5JMWA 3TFQA 3VPAA 2I80A 2V3CC 1XVUA 5AVSA 3NALA 1Y3HA 5EMMA 4CL3A 1MC4A 3JY6A 4X90A 3A1EA 4EF6A 1E64A 1N2EA 1YBHA 3KDPA 1EX9A 3STHA 1TJ3A 2XGJA 1RRCA 1T4GA 2CFTA 3OTQA 4K81B 1NBAA 3I4LA 2GFIA 5I7UA 1YR3A 1MG0A 4NZ9A 3UUFA 2M1ZA 1Q6ZA 3ITNA 3L6BA 3QM1A 1S5PA 2PMFA 4FYHA 3A6LA 4BN0A 3MA0A 3W6NA 5FBWB 4J76A 4KG7A 1YE3A 5FR1A 1XMJA 2F3PA 3NEPX 3DXZA 2VG8A 3DLHA 4GRDA 2GHRA 1P17A 2JHPA 3GNQA 3FSJX 2IYFA 2P9GA 3FRJA 1IXZA 4QQRA 4IJUA 2B8WA 4XR4A 4PSDA 4KAFA 1YUNA 2VAMA 3BH7A 1QSGA 4QBFA 5DBFA 2R5WA 4X20A 2HF8A 3EEIA 1CZHA 1QF9A 2HYIC 3FFAA 1RWWA 1TTPB 5CK4A 1JQ5A 3ZKWA 4A91A 4PAMA 3SE0A 3ILHA 2P2SA 1CG6A 4IWYA 4HWRA 2KE5A 2ZJ6A 3LCUA 2GK6A 3ZDQA 1MW9X 4Z4HA 2O14A 1N2OA 1TC1A 3PNVA 3HU2A 1ZN9A 1TYEB 4NS1A 2KMLA 3PGLA 1NVBA 1W2WB 4YN3A 2HQOA 2ZI5A 1CIPA 4PO9A 3TD6A 4EUHA 2GAAA 3VHXB 1DBVO 3II6X 3U19A 2ZPUA 1WY7A 2GASA 2VBIA 2OXTA 3NOXA 2D3TA 3MC1A 4I14A 4I9FA 2LUOA 4W7HA 4DWWA 5BWMA 3O74A 4KFUA 2NMVA 3KB1A 5HIMA 1SCKA 1L4FA 1RABA 2OECA 3PDCA 5H80A 1JDBB 3OT4A 1PFYA 1F8YA 1KMCA 2A9JA 2E18A 3SVZA 2AYZA 2P65A 4FEYA 1E3TA 4QLBA 5CDSA 1VJDA 1QH8B 2Y1GA 1P0FA 1XMQB 3L40A 1Z13A 4NK5A 1C1YA 1N6NA 3DEFA 5I7OA 4J91A 4HEJA 4ZOEA 3MINB 2QTGA 4JR0A 4XEHA 4CMJA 4B4DA 4YP7A 1XTKA 3RVLA 1YB5A 1FY2A 2JATA 4FS3A 2EWWA 3FY4A 1X0XA 3HP4A 4NK4A 2REOA 2XNSA 4TWRA 1UAGA 3EGIA 3BA6A 4Y2PA 4D7AA 4ER0A 4F4CA 2QVCA 1WX1A 3IO5A 4OPMA 3SC6A 3M3HA 2GEDA 3ACBA 2CFOA 3M6WA 1TLLA 1KSHA 2Z8YA 1Y6ZA 3GUYA 5EJFA 4YRNA 3QJYA 4HUTA 2HLDA 4K6HA 2R5NA 2NXNA 2W9XA 3LK6A 3B6IA 5DGTA 4AJOA 3LBFA 3CPHA 5DK6A 2XB2A 3KJFA 3PLAE 4ISCA 4NBVA 2B83A 3OPYI 3MB5A 4AMVA 5KB3A 1TO6A 4O2BB 4PGHA 2VF5X 2XMQA 4MEJA 2NU7B 2VJMA 3QTLA 5K3FA 3Q2KA 5ENVA 4WKOA 3UJPA 5LOVF 2ZZNA 2UXCB 5E4TA 4ZOQI 5LOVA 4MQEB 1BYIA 1MAVA 3JATA 2VDWA 1MBZA 2UZ3A 3EJWA 3OPQA 4MQ4A 4Q9AA 3T1NA 1D1SA 5CFNA 4IHAA 1J9ZA 1A88A 1R16A 2ANBA 4ZALA 4G5RA 3SHTA 5DVZA 1JYEA 2VCYA 5IMSA 2YVKA 3LZCA 1YV9A 2PX3A 1GOTA 3NAZA 5EMKA 5JPDA 1Y3DE 4BIMA 3GC6A 2WPDD 2XGMA 3I4CA 4ENPA 4LTMA 2P6PA 4BNVA 4GG1A 4QT4A 2E1RA 1B0ZA 3EG9A 4CU5A 2A5JA 3RRBA 2X6QA 4UVIA 4W5NA 1YZGA 2Q7DA 2QN2A 2VHXA 4B8YA 2KLBA 1R5OA 4W8HA 1J33A 4YMWA 2BL4A 4PC7A 1T9AA 2VRBA 2FX2A 1LTKA 2GCGA 2FMXA 1FS5A 2HEGA 1VLJA 2GYVA 2IP4A 2HCJB 1C7JA 1ZOPA 1KFCB 2MSLA 2QLFA 1VOTA 2V9PA 2VWGA 1V3VA 2ZS7A 2YICA 3MM4A 3GEDA 3ZHCA 4BHTA 2AF4C 4NZOA 1W96A 5FPHA 3EWIA 4NICA 1HE3A 4PINA 1XTQA 4UE2A 1HNNA 3GRVA 4AJ2A 4FGJA 3AH8A 2BHNA 3VMMA 1TEZA 1AKQA 1LSSA 1SC1A 1VLMA 2ATCA 2F3RA 4RNDB 3RFTA 4BQNA 4RGQA 4FZ3A 1U7ZA 4FJ1A 4OQEA 2YWFA 5C52B 3PVSA 4JXJA 1S9DA 2BRUA 2IYNA 3ETDA 4MA0A 1GAXA 3O84A 2QN1A 3OX3A 4DR6B 4EVRA 2GNAA 1I3LA 2ZBRA 3MQ4A 1CUFA 4ZA2A 3RJTA 3EIFA 2XXBA 1ND6A 1ZH2A 4OP1A 3S2GA 3VAYA 2CCGA 2YFHA 5ALGA 1KDOA 3JQ9A 3KQLA 3G0GA 3V7YA 1NF9A 2LKDA 1DJMA 4MA4A 4YH1A 2VDLB 4N3CA 4QOIA 3WDSA 5AKXA 3C6XA 1VE6A 1OTXA 3I3SR 3PUZA 2E6UX 3OC6A 3WA7A 5JY1A 1ZSVA 1QCDA 1B0AA 1YJCA 4QTXA 4EB6B 4XIGS 3OT1B 3DEYX 3PJEA 4BGDA 1AE1A 2O7QA 2FEWB 2FPGB 3M70A 2ZIUB 3O8OA 1JPNA 1OILA 1U2RA 1XDBA 3P52A 4B3DA 4C89A 1HE2A 4W1SA 3O4JA 4B31A 5LXTB 1RM3A 3ZE2B 2XI4A 4HKTA 4LOLA 3QFSA 5TGDA 1OZ0A 1BGWA 3WK8A 4LYEA 1UIMA 3CPEA 4OHOA 4JVSB 1HE4A 2YJ6A 1LFDB 3NV7A 3PU6A 4QUDA 5TV2A 3M5PA 5CFZA 1O94D 2JDIA 3KT0A 1CUEA 2GAFA 4A10A 2A3NA 2EG5A 2IYSA 4G25A 1PL8A 3O4RA 1HE8B 1WUYA 2WTBA 3F7TA 4IGAA 5HGXA 3VYUB 4I81A 4GWLA 3SS9X 2FA9A 3UK1A 1XQVA 2HSDA 3GA7A 3JVUA 4UTXA 1RC8A 3VDNB 4BC1A 3K92A 4E5MA 2BTQB 4XSVA 4OJYA 4W5OA 1F60A 2NO9A 4P82A 4EG4A 3OQMA 4S04A 1UDWA 4K26A 4H1UA 5FI5A 3EAGA 2QRVB 4EHIA 4EH1A 2P0YA 2BBTA 1LB1B 1P4GA 4F5EA 2C77A 2IRWA 2VPQA 3MT9A 4M1TA 4ZVKA 1Y80A 1Z5VA 1ZNZA 3DD1A 4TXNA 5FNVF 1JQLB 2JAUA 5DSXA 3VVCA 3NH9A 5FNVA 4AVYA 2I55A 2VNHA 1GZ6A 4J49A 5AFSA 1WNFA 1I5OA 2OYSA 1SR8A 1YRBA 1IOLA 3B51X 3IBCA 2AF3C 1E5LA 1KYVA 3OBBA 1U8XX 3H5TA 1V48A 3R40A 4ARVA 1XZHA 4RENA 4JELA 1C0PA 2NYVA 4JJ8A 4NBTA 5K8LA 4WW0A 4EAQA 4IXNA 2EDAA 4ITRC 3X1XA 1RYYA 3TSZA 1LI5A 1Z36A 2C4TA 4LRSB 2ILTA 4Q3CA 1RAAA 2ZETA 4JLPA 1R6AA 1G6Q1 3ZG6A 4EBFA 4ZEVA 2VTKA 1XWIA 1GEGA 3N5KA 4IIUA 5EY5B 2OZKA 1PFVA 3D5TA 2OFXA 1K5HA 3FNQA 3QE2A 8ABPA 2O3RA 4GPIB 4JEIA 4C4TA 1JKMA 3RSCA 4C4AA 1FS6A 3I2HA 3PPXA 3L41A 4GR9A 4HHEA 4M7PA 2Z08A 4LDRA 1I6MA 1DQYA 1UEXC 1IHPA 2G1KA 2VFAA 4DIEA 3C1TA 4JASB 3BBPA 3RIEA 1KWKA 1T8PA 3I9MA 2G67A 4IIEA 2G25A 4DLTA 3LQYA 1SK8A 4V3CA 2R00C 2CWDA 4M6WA 1SHTX 2JIZA 3B1JA 3CONA 3GFPA 1U3FA 4FDVA 4HGRA 4L72A 4NOMA 4RJIA 3SLKA 3X43A 1MAUA 2V4UA 5BP7A 4M7OA 4YJGA 1RBQA 3P71T 3P2IA 1OD6A 1AG9A 1JPVA 3TB6A 2R1VA 2C5HA 3VISA 3A6EA 3AY0A 3VDQA 5CLIA 1WO8A 3MRVA 1EJ6A 1HSOA 4ON9A 3O9VA 2VJBA 3CWCA 3I6BA 2GN4A 1BVHA 1YIOA 2B78A 1RHRA 2GPTA 5JADA 5FPYA 1Y9ZA 3KR9A 5DBIA 4MI6A 5L3QA 1KYTA 1P73A 1TT5B 4RZSA 2I29A 2O0KA 4RA9B 2GCIA 1ZUIA 3K9CA 3UEOA 3G7UA 4LRQA 2VA8A 3HA7A 4F7WA 2IUSA 3IBSA 2XCTB 3AVUA 3CGWA 1EFVA 1CUWA 5BVHB 4G2NA 3DR3A 4HNHA 2WD7A 5HX7A 4Y6LA 1QMGA 1ACMA 1S8OA 2ATVA 2QKYA 4ERNA 3EWAA 2AOUB 3R3UA 1QP7A 5E9QA 3VNVA 4DR7B 2XDQA 1T9KA 1XZJA 1QGZA 3O7WA 4Y6PA 3OMXA 5AVOA 4BUZA 5JO9A 4EHFA 1YR7A 3TI9A 4U5XA 2VDNB 1JLKA 3ZOZA 2PU7A 2ZYVX 4KVZA 4EIWA 4RULA 2C7OA 4ZRNA 3VHQA 5LKRA 3UTDA 3VR5A 4DSAA 3K0SA 5D84A 2Y6UA 2N1MA 4BEBA 5INTA 1C7IA 5E6RA 1U2GC 4RSRA 3W5JA 4E03A 4ARIA 2FRDC 3CZAA 3THOA 4AWXA 4B7ZA 4BLWA 1L9KA 2Y1EA 1K0FA 4WNYA 3WKEA 4Y2QA 5FULA 3F2VA 1SCAA 3L7NA 4Q0MA 4UPEA 2H59A 4YK7A 1YZKA 1QB8A 1I01A 2GBLC 2X0DA 1EUYA 3I0MA 4JBIA 4I3HA 3BSYA 4GZ3A 1UMKA 4IICA 5FXMA 1ID1A 4DG5A 4UDXX 1T8TA 2CNWA 3H3FA 4BFXA 2J09A 3P2KA 1XVTA 2CCKA 3KZCA 3VI3B 3K30A 2WJIA 4J0FA 5EMJA 1PJCA 3I72A 2ZQ5A 2F8MA 3AF1A 3NTLA 4GI7A 1WPRA 2WV9A 4DKJA 4E15A 5L7TA 1Y8CA 1HA3A 4ICIA 2V6FA 1JZTA 3MAAC 1XDDA 2C3OA 3HSKA 5EE0A 4ACBA 4XSGA 1OV6A 3EARA 5K3SA 2IYZA 4HQ0A 2PWAA 2VP4A 4DYDA 5L53A 5HVNA 1SFRA 3NDRA 3QI2A 2W2PA 3IAXA 2PUTA 3TM4A 3PNMA 3Q11A 2P2YA 4JH0A 2OM6A 2Q50A 3HO6A 5FLYA 4IHQA 3IT3A 5JW6A 1MFZA 3U3JA 1VP9A 1ZRMA 3ZU2A 4Q1EA 3AM3A 5FA5A 1T5TA 3RV3A 4DLUA 2W0SA 3HRKA 4EUEA 2FZCA 4ZOCA 1RQ2A 1UC4B 2EP8A 2P1DA 4EGAA 3X1JA 5LU8A 2GJAA 1YE5A 4K0KB 2QG9A 4FFLA 2JAOA 3KXLA 2VDQB 5JTUA 3INTA 6CHYA 1ABFA 5DBEX 3OJXA 5LP6C 3OTIA 5EAIA 1NBMA 3R6DA 4F4HA 2WSIA 2X8BA 1VYVA 1B74A 5H59A 2I91A 5AJWA 3HDJA 2FVYA 5C1DA 3DEIA 1L7VC 2YY5A 1UMBA 1NF3A 2OHIA 1JTEA 4PGGA 4PSAA 4CM5A 3HL4A 4F3KA 4H7KA 3RAFC 4D9CA 1LLDA 3HK2A 1VLHA 3C3XA 3IEPA 3JW8A 1LSUA 2Q28A 3MRXA 4YJ3F 5AHXA 3LQ1A 4QGGA 4ZGWA 4YJ3A 2GTPA 1VKOA 4PZPA 4JQOA 3WIEA 4EUKA 3TG8A 4DMUB 2FKNA 2IIVA 1XTIA 3U1VA 3JWGA 3H19A 2LPMA 3S1AA 3SQLA 3V3TA 3VHLB 2PVCA 2C4HA 4MYSA 1CQZA 2O48X 1RKXA 5GJCA 1DC8A 2QTHA 5B53A 1IBCA 3AB7A 3B8HA 2HK6A 5JQGB 5C8YB 2WMOB 3R9XA 4RESA 2ONJA 3S2SA 2REBA 1JR4A 3RTCA 1RPZA 1UJ5A 1L6RA 5AIBA 1JR3A 3GLQA 1Z06A 4H16A 3M4NA 2ZUUA 1B2LA 5D6OA 4S2EA 1I9GA 2PUCA 1U6JA 1B0UA 1E2NA 2WSLA 3OCCA 3UCXA 4EK9A 3EGVA 3IQEA 3PFHA 3QOYA 4XGKA 1AUOA 3N8HA 3G1UA 4BFLA 3U3MA 5IDVA 1GZVA 2G40A 1L5KA 1URPA 5CVCA 4MP3A 1AQIA 2BISA 3HN2A 3TIIA 4YRBA 4X7PA 2VH1A 4RAOA 4BQEA 5K03A 5DW0A 3V4RA 1YZUA 2QYSA 1JR3E 3RS9A 1LQ2A 5EI5A 3JAKA 4OGGA 4QJ4A 5J59A 3TCNA 5KMGB 3HCOA 3DHVA 3H9UA 4DA0A 1IAVA 2ZIGA 1J42A 3EDCA 5TF0A 2QZ4A 4Z4EA 3ESRA 2G7ZA 1CJVC 2YOHA 3H16A 5GIOE 2B92A 4UBMA 2BFDA 1SXQA 3I6MA 1J8YF 2VYVD 3IJ5A 5KDOA 1L1QA 2H5JA 3RRMA 2ACVA 1T8WA 2IV7A 1YFLA 3ZPXA 3IMGA 5ALOA 3B48A 4MVJM 1SOAA 2PLWA 1XZAA 1Z74A 1I6KA 3NRJA 1OYOA 2G5CA 4DJJA 1CHNA 1ZJ6A 3G9UA 4YP6A 1XKTA 2GYYA 2YMLA 3B3JA 4CM3A 5B7QA 5AM3A 1XYYA 2XRMA 2B8JA 2FZKA 3BUSA 3H1GA 1VJ5A 4UMFA 5MHTA 1L1EA 2D2IA 2OGSA 3D6TB 1AKVA 4RDCA 3DB2A 4YACA 1M6NA 4MKRA 4FN5A 4IIJB 4D0RA 5A5DA 1U81A 3NHBA 5F7OA 3ABSB 5BSUA 3QOXA 2X86A 5DCYA 5TIIA 3MGCA 1V2HE 4NU5A 1XPOA 3ORHA 4JJZA 2JLWA 1U5CA 2OENG 3I0NA 1Z28A 2X58A 3UK0A 1JVSA 1SB8A 5CBKA 4RKRA 4MUXA 2O8NA 4WLVA 5TQ0A 2PKQO 5D00A 1G7SA 1WB6A 3AL2A 1IQUA 1W87A 1BNCA 1UKBA 2QZZA 3WK9A 2O2SA 3GW8A 1J7KA 3D1VA 1CEXA 2AFIA 2IEIA 3QMVA 4JL8A 2YWHA 3N39C 4MV7A 1YZNA 1CE8A 4X62B 4G6ZA 2N47A 2HL6A 2ZTHA 3LVRE 1BXKA 1UKVY 3OO0A 3OTGA 4ZD6A 3V4LA 1OGYA 3WK4A 1HX7A 3HDVA 1KH2A 1FQKA 2YR0A 1K3UB 4NAHA 4TLDA 4UNRA 1XKXA 2VP0A 2IEBA 4MUGA 4DC1A 3PE6A 5IAOA 4MB6A 3NRCA 3WC4A 2RH5A 3HP7A 3CB4A 4JC5A 4FR0A 3EVAA 4K2AA 3WL4A 4EG0A 2VZEA 3QOWA 4YT5A 5AK6A 3GJ0A 3HWX1 5I5GA 1N6HA 2ES4A 3TXYA 3DTNA 4YMUA 1BE6A 4E21A 5A7FA 1ZKMA 2WU4A 1CEQA 2KM1A 2IDJA 5F4BA 4YUYA 5CFOA 1X1EA 2C9ZA 2O8BB 4E14A 5DTQA 5DEIA 2GM9A 3BGVA 2GAIA 4XWYA 2PGIA 1J8FA 3AF3A 1NR1A 3UT0A 1RYEA 2IHYA 4AMZA 2DTEA 1PL7A 2XIQA 1I0IA 3SIRA 4ZHSA 2IOFK 4FDUA 1QYWA 5C80A 1NYRA 2X77A 1J70A 1XHLA 1YRHA 3HBMA 5LVAA 2G71A 2AR0A 2ZDHA 1OU4A 2OK7A 1VCNA 2A1TS 2QORA 3BA1A 3D4PA 1NJ5A 1M6WA 4QHSA 2FN4A 1Z6GA 2YN4A 5FP0A 5IM4F 1JHUA 4HDSA 1T91A 1C3OB 3KKKA 2D1QA 4CHTA 3DNFA 3K1ZA 5J47A 2G5TA 3QX8A 2V59A 3KEFA 4W5JA 4G1FA 3UMYA 1QHHB 1SUEA 1TAQA 1LPBB 2OMEA 1HFWA 2Q6LA 2WQZA 2RHCA 4ZT5A 2QV7A 3U4IA 1OAAA 2GHIA 4UQOA 4DSUA 2NAFA 1KEWA 4K3UA 2ODAA 2ERCA 4R54A 5TGZA 5FYQA 5HK9A 2ECFA 3LBAA 3HUUA 4MLCA 3TBHA 5I4CA 4R3WA 1LDNA 1RRVA 1PYDA 1V6SA 2FSIA 2Q99A 4WK4B 3EPJA 1CVRA 1VE1A 1V1RA 4KVAA 4HYQA 2UZIR 4HNGA 4KPYA 3T99A 1SQ6A 4R2MA 3D7MA 3F9RA 2V5AA 4R01A 2AL7A 3AK4A 2VN8A 4GYWA 2ZULA 3T12A 3USZA 3NIGB 3WMGA 1DP4A 1FIUA 3TSOA 4R5HA 3KOUA 3DLIA 1DT5A 1A8QA 2YXLA 3OPVA 4TKVB 2ZCJA 3H8VA 3JARB 1QFYA 3UMGA 2X0KA 4OBBA 1M2VA 3U7QA 3LPMA 2JIDA 2OXFA 1Y63A 2QTMA 3A6HA 3BD7A 4LZZA 4NPAA 4KJXA 1UBFA 1QYDA 3PI7A 1HDOA 5CG1A 2DF8A 1M1XB 1DOZA 3GF4A 3N8KA 1JI3A 2XZPA 2J87A 1FTGA 3PG5A 4MWEA 4U3JB 4W82A 4WACA 2Y67A 1QQ7A 3DAGA 2ZDGA 5E38A 1LA2A 5HK8A 4DBZA 1BKYA 4UM8B 3JQCA 4UPVA 4IW3B 2GCOA 5ARCA 1F8UA 1QFSA 4RKQA 2EC5A 5DNWA 5EQTA 3DVSX 1P44A 1EXVA 4YV2A 5BQPA 3FWYA 1KI4A 1MKYA 4AUEA 5EP4A 1Q0UA 5CDHA 3C6ZA 1QAOA 5FAKA 2PS3A 1QOZA 1FLVA 4OUDA 4GLFA 1VGVA 1XRNA 2CL7X 4WK6A 3WY9A 1M33A 2HHHB 3FRIA 3F8SA 1C3EA 5DIFA 3RKSA 3V4OA 5C4IA 3GFQA 4K6GA 3UAVA 1N1EA 2FRDA 4LVUA 3QWHA 3T7JA 3GB9A 4D81A 4EW2A 1E5TA 3KUKA 1Q21A 3RIGA 3UHFA 3ND5A 2Z6AA 2FW0A 3CNBA 1H1LA 2NQTA 2BONA 1UPTA 2QTZA 3I9JA 4P4UA 2M6KA 2ZANA 4ZODA 3TL2A 2BMWA 3L0ZA 3LOQA 5BR4A 5LQNA 1O97C 2YQZA 1W2HA 3B82A 3VPFA 1ZM7A 1P2UA 2ZSJA 5I5EA 2WJ6A 4KN9S 3JASB 2GN0A 3M9WA 1NT4A 4IWXA 3DWFA 1UBSB 2PL5A 3FI0A 5AHOA 5C3UA 3EGXB 3PHBE 5A3JA 1XXHA 1UCFA 2DQ4A 3UJ8A 2OZLB 1F20A 3A0RB 1L7NA 2ADFA 4URWR 1IWPB 4FR2A 5K0TA 2P35A 4X44A 4DILA 2O57A 2W71A 2O5CA 3ESCA 1FTYA 3MLEA 4Q9NA 1TUBA 4HP8A 1PLKA 5F77A 4KYIB 3R7FA 4LF6B 1FDRA 5GJVC 2P30A 2BGRA 4GPAA 2E9SA 3E48A 1GPJA 1QPBA 2RAUA 1GY8A 3R4VA 4O2AF 5TJ9A 3X3HA 4U00A 5KNCD 2EGHA 2W2QA 3CRZA 4O2AA 1XXHE 1Z25A 2V65A 5BW4A 4KCGA 1T4CB 1Y6RA 4ER3A 5JWRA 3O0TA 2XDAA 1RZVA 2VSQA 2IWRA 3HKDA 3OOWA 4IG9A 3SEZA 1XD9A 3MS4A 4M53A 1G2PA 1S01A 1WBJB 3ZV6A 2JARA 2QG4A 2QP4A 4GP7A 5A3QA 3SHWA 3LDFA 4RZQA 3VX4A 2DWUA 1EUDB 4NJMA