3STUA

Crystal structure of tomato methylketone synthase i complexed with methyl-3-hydroxydodecanoate
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
258
structure length
258
Chain Sequence
FVKKHFVLVHTAFHGAWCWYKIVALMRSSGHNVTALDLGASGINPKQALQIPNFSDYLSPLMEFMASLPANEKIILVGHALGGLAISKAMETFPEKISVAVFLSGLMPGPNIDATTVCTKAGSAVLGQLDNCVTYENGPTNPPTTLIAGPKFLATNVYHLSPIEDLALATALVRPLYLYLAEDISKEVVLSSKRYGSVKRVFIVATENDALKKEFLKLMIEKNPPDEVKEIEGSDHVTMMSKPQQLFTTLLSIANKYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Emergent Decarboxylase Activity and Attenuation of alpha/beta-Hydrolase Activity during the Evolution of Methylketone Biosynthesis in Tomato.
pubmed doi rcsb
source organism Lycopersicon hirsutum f. glabratum
molecule tags Hydrolase
molecule keywords Methylketone synthase 1
total genus 88
structure length 258
sequence length 258
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3stuA00
1MN6A 1EDEA 4J0HA 2BKLA 5KREA 4G9GA 3WZLA 5DNWA 4OU5A 3L1IA 2PU5A 2OPHA 3G0GA 5AKJA 5SYMA 1XQXA 5AKHA 4DNOA 1ZD4A 5FP0A 4Y2UA 2XB6A 4OPMA 1I6WA 3WLAA 4IO0A 4AMYA 4WJLA 4J0CA 2WG1A 1VJ5A 1MPXA 2WIDA 1XZMA 1GKKA 4PNZA 1FJ2A 4XX1A 3BL8A 1H2YA 3AZPA 3H2HA 3AUKA 5CURA 3NOXA 3H0CA 2EDCA 2W22A 1TRHA 3HI4A 2WIJA 1T2NA 1O6FA 1GKLA 1N8SA 2XMGA 5EFZA 2HU5A 4PSUA 1R3DA 3SWWA 1ZI6A 4MEBA 3WK7A 2H7CA 1EVEA 3BJMA 3PI6A 5K3BA 5AM0A 4GEGA 1QE3A 4RPCA 5CT5A 4X71A 4UBMA 1EH5A 2JEZA 4UBOA 1RP1A 3ANSA 5I7UA 1YS1X 1Q0RA 3DLTA 4DMCA 2VAVA 1QIMA 1ZIXA 3HZOA 4H7JA 3E0XA 2I78A 1HBJA 3WKCA 3OPMA 3AFIA 4G8CA 4UHDA 4X97A 3GBSA 4X6XA 3FLAA 5ALIA 4BE4A 5AKLA 4PQEA 3C45A 3KD2A 1CUWA 2X76A 3H2IA 4BC1A 3WWCA 5AI8A 5K3DA 1R1DA 2CZQA 1Y7IA 5JIBA 1LZLA 5CT9A 4EHBA 3F8SA 4EBBA 4UBLA 2XDWA 3H1AA 3MGAA 4Y2RA 4BBZA 4NZZA 5KBYA 1N5MA 4IQ4A 4G8BA 1W4LA 2B9VA 4LIPD 5LZ2A 3HABA 1XZCA 3QPDA 1A8SA 2XMDA 5EIHA 2ONCA 1CUZA 4J0GA 1DQYA 2JGEA 4EA6A 2FUKA 4BTLA 2EEPA 3I6ZA 4Q3LA 1E5TA 2ORYA 4K6GA 4A16A 1ZOIA 3WZMA 3HSSA 2JBWA 1MNQA 5K3FB 3V1KA 1CUAA 5AHXA 2FJPA 5C8VA 2CKMA 2GBFA 1GPNA 3BDIA 2AJ8A 3BIXA 5AI0A 1THGA 4FLMA 4HVTA 1F0NA 3GROA 1CUUA 4WDQA 2ACEA 4H77A 1UZAA 2Q0XA 3PUIA 4IH4A 2CUTA 2HRQA 5ALEA 4DNFA 5JAHA 1TCBA 3GELA 3WKAA 4N8SA 4NMWA 2XQKA 5ALPA 4GECA 5ALVA 5LZ8A 4B81A 1XRMA 2LIPA 4QLAA 1XZKA 5T4EA 1ETHA 2C0PA 4X6UA 4MWTA 3DJYA 2XI4A 1XRNA 4FBLA 1GXSA 2K2QB 5AK6A 3PFCA 4BDTA 1SCIA 2C58A 4F21A 2B20A 1UOPA 5JANA 2OXEA 5JYCA 4TGLA 2WU4A 3ZLTA 5JAPA 4B84A 4J7AA 4EY5A 3O9VA 4X91A 5BWCA 4AX4A 2XLBA 2WU3A 4UUQA 1BE0A 2HA6A 4E11A 1CUIA 3D3NA 1E89A 2D5LA 5AKIA 1ZICA 4X94A 4U2CA 1UOOA 1G4HA 1ACLA 3E1GA 2HA2A 4PW0A 1UWCA 2HA7A 2PX6A 1SOMA 3DL4A 3ANTA 1XKTA 4OB7A 3FLEA 5BOVA 3DQZA 5HFNA 2WSLA 5JASA 3OOSA 2GBGA 3BJRA 1KEZA 5CTAA 1BCRA 4GLBA 2Y2UA 2HA5A 2VJCA 5I8PA 5JARA 3WJ2A 1MNAA 4HXGA 1TIBA 4Q3KA 1PJAA 2J3DA 4G4JA 4YK7A 5C8ZA 4FKBA 1XRQA 3A2MA 4GXNA 4QDOA 5LKRA 4Y2YA 3TEJA 4L72A 1YS2X 3A6ZA 4Q34A 3F96A 2QZPA 1LNSA 3PF9A 4UHEA 2XUGA 3UUFA 5AKKA 1CUBA 2HA0A 5DLPA 4Q05A 5AM4A 5JZBA 1CVLA 4N8EA 5E2IA 3KSRA 3I1IA 5IVIA 1MTZA 3ZLUA 1NU8A 3JWEA 3QPAA 3STTA 3LCRA 5AK5A 4K5QA 2WTNA 3OG9A 1MX5A 2PUHA 2PSDA 3WIBA 1F8UA 1QIHA 2PSFA 5F4ZA 1LPSA 2R8BA 1EDDA 1M33A 2XUJA 4QDZA 4X00A 4UFOA 1J2EA 4G1FA 2YASA 4OD0A 2WFZA 2XT0A 5DNVA 4Q3OA 3ESCA 3DYVA 3G7NA 2DSNA 3FVRA 3AZQA 5AOAA 6YASA 3HYSA 3D4LA 4H7HA 2XQJA 2OAEA 4Y2VA 3U0VA 3C6XA 3H1BA 5ALUA 4BCDA 4B0PA 1HLGA 1W1IA 1AMNA 3R0VA 3D2CA 3DKKA 3K9BA 2XMBA 2V98A 3FYUB 5A71A 1XLWA 2ZSIA 3WL6A 1EA5A 2QJWA 1XROA 3C5VA 4X85A 2QMQA 5EHZA 1LBSA 5JD6A 2OQIA 1EB9A 3PE6A 3G9XA 3WA6A 3H17A 1AGYA 5D6OA 5ALXA 4A5SA 2Y6UA 2GZSA 4Y2QA 1Z68A 1LPOA 1UOQA 1JMKC 5CT6A 4BZZA 4ITVA 4QDTA 4INZA 1RYYA 3OM8A 1U8EA 1VA5A 4C88A 4HTAA 1GPKA 3CXUA 3MUOA 4KE7A 3LIIA 1VA4A 4W1SA 1YAJA 4QEKA 5FDFA 4J0DA 4DGQA 4HS9A 2XE4A 1C7IA 3I6YA 2J3QA 1R9NA 5ALNA 1BRTA 1MX1A 4CG3A 4DSZA 3G0CA 2H7XA 4QE3A 2GZRA 3PFBA 1U2EA 2G63A 2XUOA 2RHWA 2XUKA 3BWXA 5JD4A 1J06A 2XQIA 3MVEA 4BYMA 2ZYRA 3SX4A 2ZJFA 2BCEA 5LZ9A 3F98A 3W06A 2AXEA 2QRUA 2WIGA 4GW3A 2BGNA 4PO3X 2XMSA 5EHQA 5ALJA 2DHEA 2JGFA 4KJXA 4AQDA 3EF3A 5AP9A 5HQ3B 1IUNA 5DYYA 2DCMA 3E3AA 5ESRA 1WB6A 2YXPX 1K5PA 1CUXA 1GGVA 4M0FA 2PUJA 1R4ZA 5CT8A 5YASA 1XZIA 4H35A 1XQWA 2QM0A 4X95A 1CUVA 4KE6A 1ZJ5A 2HDWA 2VATA 3WK9A 3W9BA 1SCKA 1WCYA 5A6VA 5ALQA 2ECFA 5JZSA 2I03A 4K2AA 4W9RA 3QITA 3NWOA 4LHEA 1DX6A 3D7RA 5HF8A 1USWA 2QR5A 5JZ9A 1LPNA 3N2ZB 2GBCA 3IUQA 2Z8XA 2CJPA 2VEOA 3IULA 1YB6A 2PPLA 5D3KA 4I19A 4IH1A 4U2GA 3E4DA 3WWEA 4U2DA 4CG2A 2H1IA 3V1LA 4ZXFA 1P0PA 2QT9A 4X93A 1K6EA 3C6BA 4NVRA 4E14A 4D9JA 3ZLVA 4X7BA 4FNGA 2WFLB 2AJDA 2RONA 3IBTA 3FOBA 1IZ7A 3O4JA 3D2BA 3R3XA 4GDMA 4JYPA 2WHRA 1VLQA 5KWJA 4KR0A 4U2FA 4UBNA 1WHTA 1CV2A 4LXGA 1OXMA 4ARBA 4FTWA 1JU3A 1E8MA 3D2AA 1AX9A 1XZLA 4BCBA 3FLBA 2WIFA 5ALTA 4CIAA 3DNMA 4L3WA 2WG2A 4KAFA 3A2NA 5FXMA 3PICA 3KDAA 4X6YA 3QBJA 2V97A 4FWBA 1DWQA 4K6KA 3F67A 2OCIA 1CLEA 3CCCA 2BAGA 1MJ5A 3VVLA 1G5FA 1ZD2P 3R40A 4AZ3A 2DQYA 3H04A 3LLCA 2XMZA 4EB0A 1TK3A 3AJAA 5ALOA 4GBGA 5LLSA 5JALA 2VJBA 1EB8A 1QFSA 2WIKA 3DCNA 3I28A 4BVKA 1H23A 1FFDA 2ZJ6A 1C7JA 4GWLA 2DFPA 2VJAA 3W04A 1QOZA 5EIAA 4QWWA 4PSCA 3IUMA 4CCYA 1IZ8A 4BP8A 5CMLA 3D0KA 4UBKA 2QXTA 1IUOA 5AIAA 1CUYA 2XLCA 5LZ4A 5C81A 2VQ6A 4BAUA 2XUQA 4B6GA 4C4ZA 4UHBA 4Y2XA 4XJVA 4S0XA 5AOCA 2BUBA 3I1YA 5CH5A 1CUGA 3A70A 5AK4A 3HEAA 1ISPA 1QFMA 4EZIA 3C8DA 4W1RA 3STYA 5LKAA 1U65A 4KEAA 4WCVA 4Y7DA 4BVJA 3QZUA 4C89A 5K3EA 3A2LA 1L7AA 5ALRA 4MXDA 1CUFA 1LPPA 1F0PA 3QH4A 1JMYA 3O95A 5ALSA 1VE7A 4ROTA 2O2HA 5AH0A 3KOOA 2JGIA 4AXBA 2J4FA 5HKAA 3O4IA 3PDCA 1QIIA 5CT4A 4EY4A 4UPDA 2ROQA 4PSDA 3RM3A 2D0DA 3AILA 3DEAA 3QPCA 1QLWA 1ZI9A 1UT6A 5JAOA 4UHHA 2OQVA 1N5RA 5KWIA 3JW8A 3DYIA 4KRXA 1MAHA 2HFKA 2VA9A 4FFWA 2DHCA 5HKBA 3S2ZA 4OYLA 2XMCA 3HJUA 4MWSA 1GQRA 3U1TA 2HL6A 3FYTA 1A8UA 3ZWQA 1XRLA 1ZD3A 5I9IA 4DIUA 5ALKA 4JUIA 5K3CA 2VT7A 4H7DA 1EK1A 5AIBA 4QDXA 2VTVA 5A7FA 4QLOA 3AINA 3DKRA 2BFNA 3LP5A 3C8HA 2DHDA 3I2HA 1G42A 1DQZA 2VF2A 1QIFA 4PV7A 1Q83A 4B0OA 4B83A 1SCQA 5IVHA 1XZAA 5JD5A 1ZGCA 3G8YA 4P93A 5A7HA 3O9MA 3SK0A 3I2KA 4UFNA 1HQDA 1ORWA 2OG1A 4G5XA 3W9UA 1QIKA 5EHNA 4EUSA 1CUCA 2OGZA 2HIHA 4B7ZA 3C6ZA 1QJ4A 1A7UA 4AO6A 1OILA 3WK6A 4HXEB 5JADA 3B12A 4WDRA 1CR6A 1TAHA 1TCCA 1BU8A 3G9UA 2H9YA 1YA4A 3ED1A 3WWDA 1LLFA 3AIMA 3W2TA 4DYHA 2HFJA 3R41A 3AIKA 4KYVA 1P0QA 1LZKA 4HZGA 4GI1A 1TKRA 3F97A 4CIBA 5AKEA 1THTA 3VISA 1JT2A 5T4HA 3N0TA 1R88A 3FYUA 5LP1A 4N8DA 1DWPA 5FRDA 3DD5A 5AICA 1H22A 1H2XA 2BUAA 5DTJA 1H2WA 1Y7HA 2W6CX 1WOMA 3IUJA 3RKSA 3TRDA 1JFRA 2CMFA 2GYUA 2PBLA 2XMQA 5HF6A 3M3DA 2JGJA 1JJBA 4UHCA 3WWOA 4P08A 3WIOA 2HRRA 1QGED 3P2MA 4AO8A 2B4KA 4FNMA 3STVA 4CI9A 3LS2A 2OLEA 5LZ5A 2QVBA 3RK4A 4C4XA 4OCZA 1BEZA 3HC7A 3I6MA 4BATA 4P9NA 1MAAA 1X70A 1DU4A 4LXIA 3STUA 5AI6A 1UFOA 1K4YA 3G02A 3GUUA 2RHTA 2WUDA 2E3JA 2GYWA 2G5PA 3C43A 5CW2A 5ALDA 2WTMA 5JAUA 5E4TA 4E15A 4DM7A 4UFPA 3WQHA 1NU6A 4ZRDA 1RWQA 4QZVA 4HAIA 1IVYA 1AC5A 3EIOA 1HKHA 3G0IA 1ODCA 3OC0A 4Y2TA 1DX4A 5E4YA 2WILA 4J0KA 1CEXA 3CN9A 4K6HA 3I2JA 2EDAA 2JEYA 4LYEA 3EBLA 4QWMA 4BC0A 5FOQA 2WHPB 4FBMA 2C0QA 4CCYB 1CQZA 1JI3A 2DQZA 4J3JA 3LIPA 3PF8A 3IIIA 4F60A 1UK7A 1EXWA 2GBIA 5AM5A 2O2GA 3IA2A 1DT3A 1YA8A 1UK8A 3OURA 3G9ZA 2X8BA 5ISMA 4H7FA 5AKXA 2JGKA 3FSGD 2HU7A 5FLKA 2WUEA 3IB3A 4G4GA 1BN6A 1UK9A 3TGLA 3ICVA 3NUZA 4Q82A 5DJ5A 1IUPA 3BXPA 4RE5A 3WA7A 2WUFA 2WJ6A 2GYVA 4OU4A 2QTBA 2AJCA 3V1MA 3CCBA 1FFEA 1Y37A 1YCDA 4BE9A 1MU0A 1OCEA 1YAHA 4DSAA 2RAUA 3QVMA 2XUAA 3WL8A 2RI6A 4BCCA 2WJ3A 2QJRA 4MYSA 1CQWA 3VKFA 3ESDA 2WKWA 3M83A 3O4GA 3OTQA 5CH3A 4ZGBA 4WFIA 3M82A 4ETWA 5DYWA 4G9EA 4ARAA 2PL5A 4KAAA 2CB9A 2Z3WA 4DNPA 1ODTC 4X92A 4Y2SA 3B5EA 4BVLA 4J0IA 1AKNA 2PKYX 2FX5A 4EY8A 1AURA 1XLVA 1FFCA 2BGRA 2WQZA 3L1JA 1QIDA 2PU7A 1DWOA 4HXFB 1F6WA 4BAGA 3S8YA 4Q1VA 3GFFA 5T4BA 1U4NA 1EVQA 1TQHA 4C01A 1S8OA 4H7KA 5AI4A 2G4LA 2XQFA 2Z3ZA 1XZBA 1J07A 3C6YA 1VOTA 4YASA 4CFSA 4UHFA 1ZD5A 5ALYA 5ALMA 5AOBA 3FCYA 4W1PA 5EIEA 4ZREA 3BIWA 1PV1A 3DOIA 4UBIA 3EQ7A 4F0JA 4FLFA 1MX9A 4NS4A 1VZ3A 1DINA 1E8NA 1E8DA 3FVTA 4KACA 3H19A 2ZVDA 5ALLA 2O7RA 3WK8A 3G0BA 2QUBA 5CXUA 3DOHA 5HFAA 2ZSHA 1ZIYA 3V9AA 1HPLA 3W05A 4Z49A 3DDUA 1LGYA 5A2GA 3B3QA 4FDMA 3VXKA 2ZJ7A 3YASA 1WM1A 2OGSA 4MJ3A 5SYNA 3KWJA 5HK8A 4F5ZA 5ALFA 1J1IA 1BCSA 1LBTA 2Y6VA 4XIIA 3VJKA 2G5TA 4FHZA 3Q8WA 3ESBA 2OCKA 4N5IX 1XQVA 4B80A 4OB8A 2BJHA 4EY6A 4GHWA 1EX9A 3DS8A 5IVKA 1LPBB 2QKYA 2WLSA 4WFKA 1WHSA 5BWBA 1GZ7A 4ZV9A 3C70A 2IX9A 4RGYA 4XVCA 5ALHA 5HZGA 1R50A 1SC9A 5DWDA 1B41A 2NW6A 2XMRA 1ZGBA 4BDSA 4YX9A 3QM1A 4WFJA 1SFRA 1K63A 2PSHA 2JF0A 1N1MA 4B9AA 1CUJA 1NX9A 3WK5A 2HHAA 1CFJA 5EI5A 2AJBA 1HL7A 4IHAA 4BZWA 2RGUA 2X5XA 1XQYA 3I2IA 5DNUA 3R3VA 4ZWNA 1QIJA 2VT6A 2ZYIA 3FAKA 1ZJ4A 5AI9A 3O4HA 4YPVA 5HQ3A 5AKZA 2WJ4A 3VDXA 4EY7A 1YR2A 2RIPA 4MYDA 2OCGA 4B82A 5CBKA 5T4FA 4JNCA 2XUDA 1QONA 4DMKA 1GQSA 3IUNA 1QZ3A 1EDBA 1VE6A 1AQLA 4KE8A 3VJMA 4H0CA 1MT3A 4LXHA 1QIGA 3C5WP 3G0DA 3BDVA 3H2GA 3WYNA 1LPMA 4OUKX 2C5FA 5H3HA 1VZ2A 3WKEA 3H2KA 5C8XA 3HLKA 1P0IA 2VSQA 4OB6A 4DTCA 2VJDA 1KU6A 1P0MA 2VAXA 5K3FA 4DMHA 2Y1KA 4J0JA 1A88A 1PFQA 2O2IA 4Y9SA 3WKBA 4L9AA 1BN7A 1AUOA 4M0MA 5A62A 1FSSA 2JGLA 1GT6A 1QIEA 4QDUA 2WG0A 1C4XA 2H7YA 3WWPA 3D5EA 3V48A 3NGMA 4QA9A 1CUDA 1UXOA 2PSEA 5AI5A 4C87A 5D3ZA 4WY8A 1YSCA 2JIDA 3CN7A 5HF9A 1Q0ZA 2ES4A 2IITA 2O7VA 3R3WA 4AZ0A 1E66A 4G8DA 3IDAA 2XUIA 4X3CA 1TCAA 3IVMA 4KRYA 1UKCA 2OGTA 3H2JA 1D07A 2ACKA 5IKXA 1MO2A 5IVDA 3ZI7A 1JJIA 4W63A 1XLUA 1WB4A 2XQGA 1O6GA 4HRYA 1QTRA 2QXUA 3R3ZA 1EI9A 3WMRA 1ODSA 4B9EA 4LYDA 4ZV7A 5AKYA 4AB1A 4AN0A 1CUSA 1T4MA 3WL7A 3ICWA 3FCXA 5AM1A 4AN1A 2J4CA 5K3AA 3GZJA 5HCUA 3T52A 4C6HA 2I3ZA 2C7BA 1G66A 4FMPA 5AJHA 4Y2PA 4UBJA 3BF7A 2HA3A 2WHQA 5LIPA 7YASA 5AM3A 5EGNA 5J3JA 3K2IA 4B85A 1BS9A 1XRPA 1ORVA 4BAZA 2IIVA 2P8SA 3I2FA 1VKHA 5AO9A 2WUGA 3D59A 1UK6A 4ZI5A 3I2GA 4FFVA 2C4HA 4WY5A 3BE8A 1FFBA 5CH8A 3RLIA 1BEEA 2R11A 2Y2VA 1JU4A 4E46A 3EQ9A 4N5HX 1W75A 3UMJA 5E4JA 2QOEA 4MEAA 1ZI8A 3EQ8A 1EHYA 1UKBA 5DTIA 3O0DA 1JKMA 3WI7A 2FJ0A 4PF1A 3WYDA 4BRSA 3WJ1A 4P92A 3HACA 2WHPA 2PM8A 3Q0TA 5AK3A 4JYMA 3PUHA 5AM2A 1K8QA 4TVKA 3V1NA 1WB5A 3F9CA 3AIOA 3R3YA 1XZDA 2WFLA 4FOLA 3K6KA 4RNCA 3ESAA 1HDEA 4DNQA 5ALZA 1H2ZA 3HRHA 4A23A 4XWGA 4U2EA 1XZFA 1BROA 2XUHA 3DL7A 3FWHA 5LYYA 4CCWA 3GA7A 1AZWA 2HU8A 1CRLA 5DYTA 1L7RA 1QTIA 1UKAA 4I4CA 3JYHA 3VJLA 4KE9A 3H18A 5FKJA 4QNNA 1R9MA 2CEKA 4BTVA 3G9TA 4IH9A 2ZYHA 5D7BA 3WK4A 1X2BA 4HRXA 4L0CA 1EK2A 4LKOA 4RE6A 1W76A 1X2EA 1VXOA 3QYJA 2CBGA 2V9ZA 4C4YA 1YB7A 5HF5A 5A7GA 2OCLA 1QO7A 4Y2JA 3X3HA 1W6RA 5BV7A 5ALGA 3QMVA 1B6GA 3MUNA 3HXKA 2WM2A 4AO7A 1XZJA 3FNBA 1XFDA 4JEIA 4J03A 1WPXA 2YYSA 1E3QA 1CPYA 3TJMA 3R3UA 1JJFA 3T4UA 1VXRA 5EHXA 4G4IA 4BP9A 4I3FA 4FLEA 4CG1A 1CUHA 4AMZA 1WPRA 5FPQA 5ALWA 1FFAA 2HA4A 4OYYA 5JATA 3RARA 5HK9A 2QS9A 4H7EA 2B61A 2BUCA 3FYUC 1IMJA 3FSGA 1XZGA 2ZYSA 2HM7A 1L7QA 3L1HA 3QMMA 4H18A 4JH0A 4H7IA 1CIJA 4KAJA 2AJLI 3STXA 4OSEA 2PVSA 4BRZA 2DR0A 4MQLA 2I3DA 1EINA 1DT5A 1ACJA 2QUAA 5IH7A 3AZOA 4X90A 2Z8ZA 3M81A 5CRIA 1DTEA 3ILSA 3WL5A 2YH2A 2JGMA 5FUMA 3QMWA 1QO9A 5C7YA 3KXPA 5FPPA 3FBWA 5K5EA 2PSJA 4DLNA 3VVMA 2Z5GA 3UUEA 2WFMA 4V2IA 3STWA 1KU0A 1YASA 4O08A 1A8QA 1XZHA 3C87A 3ZV7A 3WKDA 4W1QA 4TPKA 3BF8A 2HADA 3SC2A 2C5GA 1XRRA 5FV4A 2OAGA 1Q84A 1XKLA 1CUEA 3ZPXA 4DMFA 1GPLA 5LZ7A 1W52X 4BB0A 2XUFA 2XUPA 1XZEA 2V96A 2UZ0A 4M0EA 4U2BA 4MQMA 3IURA 5CXXA 1LPAB 3KWFA 5AKGA
chains in the Genus database with same CATH superfamily
1QMGA 5EXDA 5CHYA 4DCPA 3DMDA 4O4HB 4J0HA 2X9QA 2VHJA 3FWPA 1FFSA 4WA8A 4CMGA 5KREA 5JVDA 1TTHA 4EG3A 2EZ4A 4CHGA 1G21B 5J4LA 1DIBA 3TW6A 5DNWA 2GSDA 3PRYA 4OU5A 3OEED 3RTCA 1DUSA 3KJGA 3V1UA 1RZRD 2RHRA 1GDTA 2O1WA 2B0JA 1T8PA 4JLKA 2VVTA 4QTTB 5SYMA 2X0JA 3WLQA 1TT5B 2R3SA 1A69A 2H54A 2QLMA 4ZI7B 3DV9A 1GVHA 3PHJA 4F1WA 4KPGA 3CWZA 4MB6A 3RK0A 2QI9C 5E3HA 2XB6A 3ME5A 2WJVA 3QHPA 3O73A 3U61B 2WT9A 1Q1QA 5IC5A 1WW2A 3M4XA 4WJLA 5ELMA 5ARDA 3LCCA 2DT8A 3PXXA 4BN5A 1KI4A 5EYPA 1HT2E 4DC0A 4D0SA 5JJLA 2PMDA 1Z5OA 1MPXA 4RMHA 1NW3A 1JEEA 1RHQA 1XZMA 2DKOA 3I73A 1ZIOA 3IBYA 4JAVC 4QM7A 4E30A 2VCYA 3NIBA 1E9DA 2YIDA 4DQVA 1DC7A 3EDCA 5H5JA 3R6TA 2OAP1 1ES9A 4D8VA 1F9AA 2JAWA 4FD2A 1N6LA 1E2FA 3BOSA 1E3JA 3TTYA 3V7NA 1UC8A 1FP4B 5I7VA 1B0AA 3LLMA 3GRUA 5C4MA 4YAWA 3RKRA 3MINA 2EYQA 4KPUA 1EXDA 4C0XA 2QE7D 4H4EA 3LWDA 1AKMA 2QF7A 3M3HA 4YJ2A 3GAFA 3TLBA 1UDXA 4L15A 2BFDA 4OKNA 1BO6A 4AMGA 4UMEA 2EDCA 3I9FA 3KQLA 2VDQB 1N6PA 3ACCA 3OZ7A 3FVWA 1V8FA 3CKKA 4E4YA 2VSNA 2QAGB 3BXEA 3HI4A 3ZUGA 4C6TA 2V6GA 5C34B 3LFTA 3TCXB 4ZCLA 2IH5A 1JIXA 1RM5A 2RCNA 2H31A 3A28A 1KF0A 2XMGA 3G1TA 3QNUA 2UKDA 4J2OA 4EELA 3RS7A 5JLJA 2OILA 1BCRB 1R3DA 4PSUA 1GNLA 4V0MA 4WA7A 3VZCA 1CY2A 4MEBA 3RS0A 1BE6A 3L93A 1E1NA 1E1CA 3BJMA 3IDFA 3PI6A 5CNMA 1M1UA 1V7CA 3MWEA 2BFDB 2CLDX 4DIDA 3P2IA 1F5NA 2OHXA 5IUKC 4IG4A 2I67A 4J43A 4LYFA 1JDZA 3UV7A 5IKMA 1QE3A 4FW9A 4PLVA 4BFWA 3QWBA 5CT5A 4UULA 3RREA 1EH5A 4FFBB 3UT5A 3C2QA 3ANSA 4LSZA 2G36A 3UUWA 4DMCA 2N47A 3HDGA 3Q6MA 4HAWA 1VP9A 3JQEA 1ZIXA 5K09A 2ZBEA 4KI7A 4Z1OA 1LDGA 3NHYA 3OPMA 5AUOB 1ZMBA 5GAJA 4BWGA 2WAMA 3QK7A 1H85A 5I6DA 5E9AA 3UWMA 4EY3A 3PUVA 1C2TA 2PUBA 2VJKA 3T3HA 1GTRA 1W9HA 5CVEA 4LF8B 4DA6A 1SQ0A 2AFIE 4UHDA 3CPSA 3CXRA 3QBDA 4WKPA 1V37A 1Z2AA 2Z1DA 4N3NA 4X6XA 3U62A 4QBTA 3ZGZA 3IEIA 3GRRA 1RXCA 5AKLA 2CVQA 4D80A 4R7TA 3B2EA 4JJGA 3C45A 4DBZA 3E61A 3DQQA 4YV0A 5H83A 5GZ3A 5JBIA 5BR1A 2B34A 2X76A 4II3A 1Q3KA 4X20B 3WNZA 1K7EB 2R6JA 3LI2A 3T7JA 5GVSA 3P4XA 4O2AA 4D98A 2AI3A 5C1DA 2C2XA 5K3DA 3L5KA 1ZH6A 2Q1SA 4BBJA 3R6GA 3ER8A 4BPRA 4BMNA 4IDHA 5CA1B 1NAIA 2DHQA 2CVZA 4PRZA 3NEYA 1NBOA 4HYYA 1JSLA 4FZ5A 4UBLA 3W5UA 3H1AA 4BBZA 2X7JA 2H65A 3JQ7B 5HFJA 3NI2A 4DCGA 4B3TB 4PO9A 1GPMA 2W37A 4G8BA 4D46A 4D8UA 2VQFB 4HWPA 3FTCA 4O4LA 4RTSA 3CMMA 3C7DB 3HABA 5JAIA 4AN4A 4HEHA 1XZCA 5EOVA 3FIUA 4QGSA 5D00A 3KT6A 4GYKA 3RC3A 2JL1A 3PCTA 4AROA 5K05A 4ER0A 4LQ4A 5BVGB 3C98A 1H5NA 2I2XB 3QLTA 4FIDA 1RAAA 3U4DA 4C5CA 1CF4A 5EIHA 3S2UA 5HGJA 2IE0A 4L8VA 1NVMB 4K9SA 3TB6A 3HJRA 4QOHA 4X63A 5BSRA 5D3MA 4EA6A 1TAUA 4F3NA 1O5OA 1ZH8A 3P2KA 1EUCA 3QFHA 5FI0B 3TSCA 4IRUB 1K6MA 4KJZA 3DEYX 4ZQEA 4TYWA 4KN9S 3LMKA 4UM8B 1V0JA 3G5MA 5B2EA 1I2BA 1GNRA 1R8SA 4HEA6 3NKVA 1F2UA 3A11A 4OHZA 2Z56A 4NJMA 4D3YA 1AF4A 2XF2A 2D1SA 1WOYA 4Z54A 1ZOIA 4F2PA 3U4MA 2E89A 3EUEA 3HSSA 2O7NA 1G7RA 3EOBI 4J4TA 2E4ZA 4PIPA 5LMCA 2IWRA 3ADOA 3KTOA 4MITA 3V1KA 1OZ0A 2X1MA 3G2OA 2CKMA 4BEWA 2ZREA 4QYIB 1GKYA 3DFZA 4P7FA 2NUPA 5E7JA 5CITA 4YGYA 4BNFA 3A4VA 5AI0A 4PICA 3ZNNA 4YRMA 1Z12A 3BG5A 5MF6A 3S1LA 4HVTA 4FLMA 2HLDA 1ADYA 2J3LA 2I76A 4ZMSA 1D8TA 2ACEA 3G2PA 2GZAA 3Q3GE 4CR7A 4EW1A 2YQ4A 4QEZA 3SS7X 3E84A 1UZAA 3PUIA 1UMBB 1ZUD1 2IW3A 2REQA 1MIOB 2CVPA 5AVXA 4JOCA 1DAIA 4HEJA 1JHQA 2CGEA 1BDHA 3CUSA 4N8SA 4UNNA 3WKAA 1XV5A 3E8XA 2XQKA 2VJLA 3D3EA 5FUBA 5BNTA 3JARA 1X9GA 3JWHA 3UJ9A 1XRMA 1Q20A 2J4DA 1GTVA 1JEYB 5K0CA 3FFWA 4UREA 1MLDA 3WZ2A 1PBNA 2B3DA 4O4JB 5DX0A 4PLTA 6PFKA 4BNDB 3QLUC 3O8RA 5H82A 4KVZA 4OGKA 5AHKA 4MKFA 3ZJYA 5GZ6A 2C0PA 4X6UA 2C9ZA 2B9EA 1G2IA 5I5EA 1V95A 1Z3CA 2QRPA 1SXIA 2CD9A 3HPQA 4ND5A 4HJXA 3CEMA 4MWOA 1Y5NA 1PTJA 3KSZO 1FK8A 2Z9BA 3RYHA 4OQ4A 3F9RA 3F8WA 3GL9A 4XLZA 4WOBA 1Y63A 5A3JA 4AUNA 3I30X 1DAEA 2FMHA 1FQJA 3PFCA 3DWIA 4BDTA 5E1MA 2I6SA 1HM5A 2N42A 1SCIA 2D62A 2ZS7A 4JI1B 4F21A 4Z5XA 4GKKB 1CK4A 3R3JA 1Z9BA 3AHIA 3CY6A 1UOPA 2OFPA 2WSMA 3FZYA 3GCWA 3ECSA 4NULA 4QPPA 4XYBA 5JANA 4TGLA 5JYCA 2PUGA 1KSJA 2LCIA 4AY2A 3ZLTA 3ET5A 4CTMA 4J91A 2ZRJA 2Z09A 4NEQA 2WWRA 4ZOBA 1C30B 1RQXA 2EARA 5BWCA 2PXHA 2XLBA 2WU3A 3O2NA 3ZLBA 2BGJA 2HF7A 5DBGA 4XCXA 2ZAGA 3AVYA 2CL5A 4R9SA 2HQBA 4KQWA 4PR3A 2BGIA 1QKIA 1TQ4A 4GZ3A 1T5DX 3WV5A 1E89A 1OTHA 3GUHA 4N18A 4WESA 1T0PA 2IOFK 1HNNA 1ZICA 4H1UA 3VYTB 3F3SA 1PJZA 3KVRA 2IIQA 4H3SA 4OL9A 3LF2A 2C5BA 3B6ZA 3I3OA 1ZK3A 4IGKA 4DR2B 4TMVA 2X7XA 3MTGA 1ACLA 3E1GA 2Q5JA 2PQ2A 3T1QA 2CJXA 4OAOA 2HA7A 2VHTA 3MGGA 2PX6A 3RVLA 4L28A 3FLEA 1OW3B 4MUMA 1GR1A 1FRQA 1L5QA 1SXGA 3QOFA 3DQZA 4NH0A 1EVZA 2IT1A 2A84A 3AETA 3RE1A 2YVKA 1KRHA 2CNKA 1SOVA 2ZSBA 5DI3A 1MF7A 4L08A 4P3YA 4BMOB 5JASA 1QS0A 1QQAA 2ST1A 1CB7A 1KEZA 3CKMA 1BU5A 4I9GA 2VRBA 4CMCA 1UFQA 1I7SB 3R5FA 3A4IA 2AFHA 1KZ7B 4KQJA 1JQJC 5BN5A 3CLSC 1G5RA 1R6XA 2GT1A 3QXSA 3MJSA 4S1WA 4GOXA 1KDPA 4XWAA 2ZJ1A 1O0BA 2O57A 4IRMA 5I8PA 3A3KA 5EVCA 4J90A 1C7EA 4TRRA 1MAVA 3WJ2A 1IVSA 1H3EA 4FFMA 4JP2A 4QPZA 4AJ9A 3LZ6A 4MVJA 3RBAA 4RJ2A 3W4JA 3NQ41 1U5BB 2VNIA 4HDQB 3WQSB 3K30A 5C8ZA 4FKBA 4JKYA 4XGIA 1ETUA 4MWDA 4CM6A 4AYTA 4JK3A 4EJSC 1B6RA 4EQ6B 2FSFA 2A9QA 4M9SA 2ZBDA 5JJBA 1SIOA 2A33A 4EUKA 2WJYA 7GPBA 1M74A 2YN4A 1EK6A 4Q1CA 2W98A 3BSWA 4UVGA 3OBBA 4Q34A 5IAKA 1E6LA 1SUCA 2QZPA 3HUUA 1D7AA 1LNSA 2QQ5A 1F17A 2ZI7A 3INYA 1RWWA 1UWLA 3HFJA 4I8XA 4PZPA 3OQHA 2XDAA 3MWFA 5F1PA 3U7QA 4BWVA 4ZP1A 3ANMA 3ETNA 3UUFA 1I7PA 1LWNA 1B73A 1T13A 1IPEA 1V11B 1FTSA 4FDLA 4BJ5A 3ENZA 1SHKA 4LHXA 3I5AA 4GI3A 4TTJA 3ROQA 4Q05A 2A7QA 2KPOA 1KVRA 2ZJ5A 4PN7A 4L9WA 3CZMA 4UCQA 1ZC3A 5JZBA 1MW9X 5KTTA 1D09A 4MUIA 5L51A 3SVTA 3MSCA 5DLYA 3EX7C 1CVLA 1R27A 5E2IA 4DR3B 3KSRA 4OXQA 3CF0A 4I5IA 3DOEA 1UANA 1PDOA 3MWGA 2HSWA 1SU4A 2G5GX 2PLFA 3QE4A 4WX2B 3D8TA 5E95A 3UWOA 1G3IA 4EG6A 2DAPA 1ANKA 1YR8A 2JGRA 3SKVA 5GINE 1WCWA 1H9CA 5CVCA 3KOUA 1X7YA 1V8DA 4J3FA 1LBIA 3P2YA 1SUDA 4Y6QA 1C1DB 5CNKA 1UPTA 1PGNA 3IAXA 3OG9A 2J5BA 4LZAA 1PJ4A 2FWNA 5BOSB 5KQPA 1GTSA 4M6WB 2GESA 3NXKA 3WIBA 2I65A 2H51A 3HCFA 1J5XA 2X3YA 1T10A 2GK4A 3NASA 3SQDA 1RAHA 4WASA 3Q2OA 2VZ9A 5C7OO 3HKDA 4MZXA 2X40A 2CNBA 5B7QA 1BOFA 2C9OA 4AF6A 1TYZA 1QQ7A 7MHTA 3ETLA 4FD3A 1U8UA 4ALKA 1JBKA 2ZRDA 1PR2A 4MDEA 4G1FA 3LLUA 5EZYF 1M8GA 4NC9A 4Y1EA 1XXHE 3HHPA 4IFIA 3DAHA 2WFZA 2XT0A 1G55A 1APBA 5DNVA 1KWKA 3L7JA 3RVOA 5KAMA 3TK1A 4XM0A 4CQLA 3DYVA 2OM6A 3ZGYA 3OMXA 5WRFA 1NKVA 3I0NA 5AMXA 2CDBA 3CW8X 3Q98A 5TGDA 2QW0X 5DHSA 2C83A 4KKXB 1EDZA 3JQFC 1Z28A 2KW5A 3FVRA 4ZANA 5TGTA 1HLDA 6YASA 3KQNA 2R6GA 1Z15A 2UXBB 1Z2EA 1J22A 2HREA 3NAQA 4J7XA 3V4ZA 2HF8A 2GLTA 5KVQA 5ITSA 1QF6A 4NYMR 4EFNA 3JQAD 3FNHA 4GQAA 4F6CA 3HYSA 2J5QA 3ONNA 2PIAA 3B82A 3ZY2A 1PT5A 4ZO4A 2EVWX 3P9PA 1VLHA 3N87A 2F17A 1T1GA 3H5IA 4M1TA 4PX3A 5ALUA 3UAXA 4AMVA 4F9EA 1HLGA 3TRJA 2BBSA 2XTNA 3HXOA 1S3FA 3R0VA 3ZYCA 4LJKA 1QDLB 4B46A 4LRXA 1D4OA 3DKKA 5GONB 2O19A 1I94B 2VEDA 1XE3A 3WNVA 2CN1A 2HPAA 2JLBA 1U2ZA 1HE8B 1M2KA 3TEMA 4JJ8A 4JYAB 1B3RA 2UXDB 2XOKA 3WGYA 3LSTA 4C9BA 4B8YA 4FNAA 5KINB 2GB4A 5EFOA 3VM6A 1TD9A 1FW8A 2A0KA 3CX4A 3ILYA 4XUDA 4ER6A 1MUUA 4RZXA 2HQRA 3V2UA 2QMQA 1TF2A 4UNPA 1VHJA 3MIZA 6REQA 3AU9A 2X0KA 4B3BA 1BA2A 2JFOA 1I13A 1FS4A 4KQEA 3B7PA 5E8JA 4GT1A 1V8BA 2H2HA 3OD1A 4QO7A 4RKFA 3LP8A 4M7RA 3U7EB 5F9HA 3EPRA 5GTDA 4YP6A 1GGFA 1T43A 3WA6A 4ICIA 4W7IA 3A4NA 3E5MA 1UBTS 4N1AA 2XCTB 3QUTA 2FZVA 4EW6A 5DM70 3DB2A 3GNSA 4I1PA 1YCGA 1IM5A 3H17A 3LPCA 4DOMA 5LXTA 2QLLA 4W9NA 2Y6UA 4PLFA 2KBFA 3WBJA 5C32A 3A6KA 2GZSA 1W19A 4AM8A 3HADA 3EVZA 4LYAA 4UUAA 2VF5X 2PO5A 3VR5D 1JU9A 4EG5A 1USVA 3LDGA 3LUCA 4RPHA 2XVZA 4HWRA 2CYBA 1L8XA 2Q8QA 3V34A 4AD8A 2J0VA 3BK2A 1S7GA 1ISHA 3WMEA 2BCGY 3KEOA 5HG0A 3NC1C 4ISBA 1RTKA 1T25A 4Y3UA 4INZA 1I14A 1SU8A 5EY5B 3S55A 4L1KA 5J4VA 3GJTA 1JW9B 1WXDA 2RG1A 5DBOA 3TSWA 3IV6A 4C88A 1U2DA 3O83A 3MTIA 2DFNA 1ESZA 4DLTA 2V8BA 1SNYA 2Z2JA 1P9OA 1S9HA 2IPXA 1GQOA 2VKQA 4W9MC 3KYJB 4DXHA 1YAJA 4BVGA 1RTTA 3I72A 3LH5A 4R40A 2I4LA 4I1IA 3ZR4B 5BUSA 3ZHZA 1R6VA 4J0DA 4Q5IA 3L0SA 1NM5C 4DGQA 3AR3A 3WYAA 5DW3A 5AT1A 1NN1A 1JNYA 1YBVA 4U63A 2XE4A 2MINA 4YJGB 3F6CA 3MCZA 4I4TA 2VF7A 2JA1A 3MW8A 4JVSB 2IDKA 4XUCA 2N46A 3DQPA 3PITA 3LV8A 2QDXA 4HEA1 4U9HS 3U31A 3VX4A 4D0RA 1YI8A 2A78A 3KZCA 1SQFA 3NYWA 5AVOA 3EXG2 4GH5A 3PNKA 2WMDA 2H7XA 5EINA 2BZGA 5IT5A 3HDYA 3FCEA 4Y18A 2F2TA 3PC7A 2QZ9A 1YJ5A 2AEJA 5IANA 1H93A 5KOYA 1V3UA 1JBEA 1I2ZA 1A5ZA 1BHO1 1SQ6A 3AF1A 1A95A 2YFYA 5F5XA 4F3KA 5JR3A 1FOEB 5FULA 5KX5A 3VVCA 1RQRA 1SHUX 4XPIB 1T4BA 3DLCA 5IJ9B 4CQNA 5BR4A 3VZSA 1J06A 3NR2A 1TM3E 2A9RA 3MVEA 3C8ZA 4E7PA 3EFBA 1W88B 3LF1A 2HNKA 1ZU5A 3OI7A 1XA0A 4GPZA 4KTVE 3TAHA 2PL1A 1T2CA 3ZHCA 5LZ9A 4WOCA 5JBQA 5LYJB 1RJWA 3F98A 1SUIA 3EXIA 4KBYA 5HBRA 4RUKA 4L07A 1NG9A 2SICE 2VG8A 2X5OA 3PKIA 1YF3A 1M5TA 1U9ZA 4Y7CA 2YTZA 1QC5B 3ASVA 1L3BA 3JQ8A 4CMEC 3CLUC 2D1TA 4QPDA 1BH2A 4GW3A 4MKRA 2QRQA 1DGQA 3TTTA 1EQ2A 1EP9A 3HYLA 3LQ1A 4QBKA 2IU0A 2ZSDA 1O6ZA 5KC9A 3T5AA 3GLGA 4N5DA 4BV8A 5EHQA 2OFFA 3A7EA 1PJRA 1I7NA 4R3WA 4DKJA 2VCHA 1DBSA 4B2LA 2ZVJA 3I04A 4GU5A 5SY9A 3RASA 2JGFA 1U4OA 1SA0B 4WWHA 4PGMA 4XAQA 4OFWA 1G8FA 3AYZB 5IH3A 2QM3A 4D3SA 5CD1A 2QI9F 3C6QA 1N9GA 4LMBA 3F8TA 1SPBS 2OZLA 1TYDE 3PR1A 4PC3A 3UMVA 1IUNA 5DYYA 2DCMA 1A9SA 3N6RA 4HAVA 4B79A 3DR3A 2Q21A 1M1YA 3VU9A 4CDRA 4LYJA 2JI9A 2AEFA 2QGNA 2XCUA 2CWWA 1CUXA 3MEQA 4M0FA 2CWDA 3LBYA 4K9OA 1DLIA 5DHUA 3VNSA 3ZZMA 4B47A 2QRMA 1AO0A 2PUJA 4GOLD 1R4ZA 3FKSD 3R7WB 3OEWA 1VHQA 1KYTA 5YASA 5C7IO 5JNUA 3OSUA 3EZ2A 3WBFA 3SEAA 4MW1A 4AZSA 3VKWA 3ND5A 1JHRA 2EKPA 2MSLA 1F4VA 4MS3B 5EWLA 4R71A 4H35A 5IAAA 1YB2A 1SURA 3MJCA 5F3RA 3TPFA 3DMTA 2CL0X 5CDFA 1VJCA 1I3MA 3A26A 4QREA 1HC7A 2C2HA 4RQAA 3SZ3A 4RCZA 3DDSA 3BXFA 4Q0MA 5HJ5A 2HDWA 1RWVA 2QL6A 2VATA 4LECA 4EW2A 5LWQA 2BOVA 2WTUA 3A1NA 2NP6A 4CWAA 3W9BA 5JNWA 1RLTA 2VK8A 1SCKA 3OQVA 3ZX4A 4CKEB 2NQTA 4OF4A 3ZHBA 4D9MA 3D6AA 2ZUEA 3CR7A 1WCYA 2ECFA 3T35A 5JZSA 5IDVA 3TW4A 4BFUA 3HG7A 3C1TA 4OUDA 4WLFA 1K8YB 4AZTA 4RC9A 2O48X 4FX2A 3QITA 4RS4A 3S68A 2D13A 2E5LB 1GDDA 2BM8A 1TJNA 4GZ6A 2QVYX 1YHZA 3ESYA 4G07A 1DX6A 4L9SA 5D7NA 1S01A 3DKIA 7REQA 5JJCA 3C0KA 1USWA 1NBIA 2QR5A 4KPUB 4ZOAA 4RPLA 2GKSA 1N7GA 2ZJYA 1SKMA 4GI5A 3DEJA 4YAIA 4YBZA 1FVFA 3CWQA 1DP4A 1PZEA 3WTCA 1IMOA 1EFLA 2DBZA 1JHZA 1FX0B 2JNWA 4ZA2A 3FMFA 3IULA 1YB6A 5KX5B 2H2FA 1NT2A 4MYHA 5KYTA 5HIAA 3IHLA 4LRQA 1QRUA 4RVSA 4KIWA 3PIIA 3PFNA 4HDRA 4COOA 1YR3A 2Y27A 2ZUWA 4IH1A 2HJRA 5IEBA 5D1HA 4OXNA 2NO5A 4Y0NA 4EYGA 5JJKA 2ID9A 1DPGA 1U1DA 1K3FA 3E4DA 2FRDA 2NU6A 2GM4A 4EYKA 3NPMA 3HU5A 3DSRA 2WWXA 4JVNA 2YV1A 4ENSA 4X93A 2VZLA 3EG9B 2AMJA 2RJNA 1WQ4A 4RF3A 4X3PA 2ONZA 1GUZA 4NVRA 1DTWA 3DMTC 5H9VA 3AF2A 3VDRA 3VKGA 1YOBA 4CIWA 1R6TA 1CIPA 2NT4A 3K9CA 4LK2A 2QROA 4DARA 4J4HA 1W1WA 4P5DA 3K4HA 1R0ZA 2AW5A 4C43A 3HY6A 4IIDA 1DC4A 5AVZA 1WEKA 1L7VC 3WNBA 4KKVA 4R8MA 1PCXA 4P80A 3UA3A 3H9BA 1T8TA 1F8GA 4ND1A 1VQ1A 4WBSA 2WVJA 4BQEA 1QWOA 2GUWA 2IHJA 3IVXA 3JPYA 3PEVA 4FEYA 4GPEA 5F7ZA 2AQHA 3TLXA 4BFXA 1GNQA 4KN6A 4EPWA 1B8PA 4LXGA 3EBOA 2NNLD 1JR6A 4JQYA 1IIRA 4ZT4A 1I33A 4FQ7A 1IRIA 1CRWG 1S2DA 4RGBA 1V2GA 2PUVA 2ZIFA 3KKLA 1MOSA 4FCVA 4BN0A 4BQQA 5F64A 4HUJA 4BGVA 2XTAA 1JU3A 2V9CA 3UBTA 2IF0A 2AX3A 4PIVA 4EJSB 1E8MA 3RSGA 2V6JA 5IS2A 3K9LA 2OBFA 1E7YA 1GLGA 3TUZC 3VH3A 2JD2A 4OQFA 2C7OA 4HSEA 4B48A 2GN6A 1GG8A 2IWHA 1DRUA 3G79A 2OV1A 2I4MA 3EH1A 4RCVA 3C4VA 3K9NA 5ADWA 4GPIB 2VYVA 1J0EA 1JYEA 3D7LA 4W82A 3MOIA 2CLEB 3H5RA 3HYTA 4I81A 5TPWA 2WNIA 3W78A 5JXWA 5BQPA 1YU9A 1EXNA 4FYXA 3TXXA 1XD9A 4L22A 4YFYA 1QM5A 2H08A 3F67A 4O2BA 2BFFB 2OCIA 4OBXA 2V3CC 3PJFA 2IRWA 2BAGA 3CSUA 3I6IA 3VVLA 4TKVB 3A2KA 5DYTA 4OQNA 3RT1A 1PGOA 2FQYA 4LHVA 3ZNPA 4W8GA 5KTOA 2KS6A 3U9SA 5KWSA 1IN1A 1QQ6A 4Q1BA 5H4HA 2HUNA 3DXXA 3LLCA 1OJ7A 3A6JA 3OHPA 2H57A 4Q9AA 3OAAA 1JXOA 5LU8A 1C1XB 1TK3A 1ULSA 3AJAA 3QXCA 5LXTB 1H2EA 1H5QA 5LLSA 5LQJA 2FX3A 2OCXA 2VJQA 2ZDQA 5KQSA 1IBSA 3OLZA 1X42A 1YZVA 2C2KA 2FEOA 4AY3A 4IIFA 3ETGA 3D7MA 5JHGB 1U02A 1P2FA 1TNDA 2X77A 3SF0A 1DKMA 1Q7TA 1DAHA 3I28A 4P3OA 3RYCB 4BVKA 1GAQA 4DJFC 4CDMA 3A58B 2R84A 1VL8A 3TMYA 2QT1A 2RH4A 4PG4A 3UAOA 4V1CB 3NIFB 1QOZA 4LFCB 4CUJA 3BMCB 1Z6PA 1I2MA 2BHRA 4Q9DA 5LC1A 1J7KA 4MGYR 4PSCA 4DQUA 4M1EA 1XPJA 3BHMA 3CPHA 1LJ8A 4AJKA 3S99A 4BP8A 2VZ8A 1P6UA 1E3DA 1QQBA 4OQZA 1YDEA 1IUOA 1ECGA 2V6FA 2XV1A 3RC7A 4K7JA 3EHDA 2BHTA 1JKFA 3C7CB 3MCAA 3R5TA 1FP7A 2C1ZA 4GMXA 3P4UA 3IP8A 4NYIR 2X0FA 1QYDA 4CKCA 1MP0A 5LZ4A 2VQ6A 4JP5A 5HTKA 3SDSA 5CB4A 4XB1A 3UMMA 7AT1A 1FNNA 4C4ZA 1ABFA 1U7ZA 3RIXA 1XL0A 4V0QA 4XJVA 1BGWA 5FHQA 1OXXK 1QVWA 4NECA 3U44A 2BUBA 5E3JA 2QUIA 2QSYA 3H2SA 3KOMA 1ZXLA 3CVXA 3NDPA 5EKDA 4JD5A 3NLLA 1MIOA 2AF3C 2RARA 3DP9A 1ISPA 1DC6A 3HEAA 4YAEA 4GFDA 1L1FA 3EFOB 3H13A 5J58A 2ZR0A 2C84A 4LC1A 3TD2A 4Q4CA 1ZH4A 1WZIA 3FIJA 5K3EA 3ND7A 4CTNA 4N3GA 3A2LA 1L7AA 3N7UA 1DDIA 1TMYA 3KR2A 3MT7A 1F0PA 4L2IA 5THXA 5E1BA 4E5KA 1QO0D 5AJVB 1EFPB 1U5AA 2JPDA 5ALSA 4INPA 1ZVKA 1C3LA 3GF4A 1Z88A 1UKZA 3BWEA 4UHJA 1SAYA 4US1R 2B83A 1GD1O 3ABOB 4ZAZA 1KA9H 4AKIA 3E6AA 4TSRA 2LPMA 3K32A 5BN4A 5JYDA 5CLQA 2AOVA 4DAOA 3L7YA 2OC9A 4YCDA 1JZTA 4AXBA 4EFDA 3IV7A 1IEVA 1CERA 3AU8A 4YMWA 1P18A 5CXQA 1QRRA 2GI4A 2MSKA 2PMBA 2R6R1 4UE2A 1MV5A 1QIIA 2YWRA 5CT4A 3WLEA 1UADA 4Q9HA 4D5GA 3QVOA 2XA9A 4YRNA 2JAOA 2EBUA 2QX8A 1S6YA 1J0AA 4HH4A 4P35A 2OBXA 4TUYF 1C9JA 2A0YA 2OMKA 4MVJH 4NMMA 3VNVA 1QLWA 2AV6A 4I6JA 4RH0A 3H2BA 2BV3A 3L01A 5KVCA 1RD4A 2JBAA 4II2A 3KSAC 4OP3A 5KS2A 3GZTB 2BEVA 2NTVA 5GIOE 2GNAA 4GVLA 1KQGA 3W3AD 4E5NA 4HUQB 1G3UA 4P4LA 5AVVA 2OZLB 1A5TA 1MAHA 1DV2A 1VI5A 2JRCA 3OAAD 4FFWA 2AS0A 3GCGA 3S2ZA 2XMCA 4MWSA 3NBXX 5EE5B 2BCJQ 3SZGA 2I91A 1AN0A 1EXVA 2YHIA 3KQTA 3C3PA 3R9XB 4LXUA 3VX3A 3CHYA 3AR9A 3IP5A 3H1EA 3R77A 2NSDA 2VDLB 1UZUA 1YRBA 5I9IA 2VK4A 2Z5LA 4MZDA 3U7JA 1NUSA 2DYKA 3OP1A 1ZN7A 3BJZA 3AV0B 4JUIA 4BU1A 4CF5A 5JFGA 3M9WA 3N58A 3QKTA 4H7DA 3PT5A 1EK1A 5K6AC 4CM3A 3K70B 2W2PA 4FOSA 5AIBA 1N77A 2VTVA 3ICCA 4MCAA 4TMTA 4YMSA 3RAGA 3CZRA 3SZOA 3WWYA 4ECEA 3DXFA 4HNSA 4UAJA 4Z4QA 2BFNA 5IKOA 3U9TA 3OLXA 4NV1A 2WWFA 3O6VA 4MKGA 1ADBA 5K0LA 4XM1A 1L5HA 4D96A 2JA2A 1YI1A 4CMAA 1NJGA 4FDVA 4QL3A 1RXYA 3VPSA 1DQZA 2VSOA 2VF2A 4KSBA 1SIWA 1SCQA 2C20A 3FMGA 3HU2A 3ILXA 4QGBA 4QG3A 3VH4A 4QJIA 1Y1TA 3KUXA 1QLJA 4ALMA 4HDKA 2BP7B 2G08A 3EZYA 5A7HA 1H0KA 4KLNA 3U7IA 4Q7EA 1CR0A 1ZX1A 2IUTA 2C07A 2O4UX 1E96A 4MQEA 5KTPA 1W36D 1P8AA 4HPWA 2IFTA 3HCCA 4Q3CA 3ZXUB 1A8HA 4G85A 5EHNA 3FJ1A 2O8VA 3QFFA 4MYUA 1RM0A 1JPVA 2N1MA 3HLTA 3VC2A 3GMTA 3SM9A 2K6GA 2IX3A 2R48A 4R68A 4YWJA 1Z4JA 5B7PA 2GEVA 4O2RA 1CUCA 2Y1WA 3D0RA 2BEKA 4TXJA 3WSVA 5HWSA 4BNWA 3TH5A 1QJ4A 3PIRA 4NJEB 1MCZA 3QU5A 3ZHRA 5MN4A 1EVJA 4XIGS 3NBFA 2XHEA 3EARA 4XE5A 4I1VA 4L0MA 3DTTA 2B25A 3WK6A 1ZHHA 2C88A 1MVNA 5AXBA 2A35A 4MVJI 4IXTA 2V1UA 1PV2A 1P9LA 3W2GA 2EP7A 1PT6A 1UFRA 2JHPA 2ZQ5A 3G9UA 5H7XA 3PU6A 4CHTA 3KYDB 4QARA 1SKYB 5E6UA 3GRKA 3ZGVA 3BAFA 2F1RA 5IUNC 3THRA 3AIMA 2XBMA 1QG2A 5EQFA 3R41A 1T36A 2FK7A 1VYHA 3ORFA 2WJGA 1Y7LA 3VU0A 3RUHA 1P0QA 4Y0VA 4GI1A 1KS2A 5JSZB 2BLLA 2C61A 1C9KA 3PDIB 3SGLA 4CIBA 3GPIA 4XIJA 1HT3A 5LUBA 1S1CA 4OI4A 1RXVA 3FDZB 4OIFA 1R88A 3KEFA 3Q3IA 5E7MA 3CISA 4N8DA 1Y89A 3O8CA 2XA1A 4RFSA 5JSHA 4EAQA 3PQ8A 3ER6A 4PBTA 1KZ1A 2AW3A 4YBRA 3ZD7A 3AJRA 4LE2A 5HZMA 2PQ0A 1TUBB 3EE6A 3F2IA 4X0EA 3UYLA 4BVEA 3COSA 3KVVA 3KAQA 2J59A 1W6UA 1JHVA 4FYWA 4XI9A 1PJQA 5EKTA 4C0JA 3DDWA 1XTZA 1XJCA 3L18A 3LDAA 1JFRA 2G25A 3SXUA 4FI3F 2GYUA 2AD1A 3M3DA 4HVCA 3QWFA 2DWPA 3M6XA 4NU0A 5HF6A 4JVMA 5DLDA 3LY9A 4CIVA 5FX2A 1NJ2A 1KPIA 1JJBA 4NR0A 4OMCA 3RTBA 3Q8MA 1OI4A 4BIMA 1QHHB 2KE5A 2I2DA 4P08A 3BERA 3TG2A 1Z0JA 2R1UA 3E22A 4H1HA 2HRBA 2ZYGA 2AE1A 2I4RA 5ERXA 4RKQA 2Q9UA 4FNMA 5PNTA 3LS2A 1M1YB 4MPTA 3M5PA 2OLEA 4WCFC 4LOIA 3EGOA 4KYUA 3R75A 1L5WA 1KOJA 3VSAA 3QUSA 2QTFA 4JLBA 4C4XA 5IULC 1FQKA 1P6QA 3PCXA 3FD8A 2PUDA 3EZFA 3QKWA 4L4SA 1CEYA 4BEBA 3I39X 2ZG6A 1S7CA 5DYIA 1GZ6A 4A15A 1X70A 4PYKA 3STUA 1M2VB 4PTYA 2O8DB 4GX2A 4NKRA 1DAMA 5AI6A 5EJFA 2JS7A 2HF2A 1K4YA 3GUUA 3D6HA 4QYTA 5DHFA 3HCRA 3RJZA 5I7WA 1ZFNA 2FUG6 3LE8A 4NV0A 3Q7TA 4NMXB 2WUDA 4XSVA 3E1SA 1NQ5A 1VL6A 5BQFA 2BDUA 3UCEA 4B4WA 1JFTA 3KV3O 1C7ZA 2JFHA 3T8YA 1GRVA 4G5RA 3HRIA 3ZV4A 1UXKA 2R66A 3EIHA 2IKSA 2ZP1A 3EF1A 3X1ZA 2VTEA 2WTMA 4RADA 5BT8A 1BWSA 2QVLA 3BD9A 1JG6A 3K0FA 4HQKA 4YJ3F 1ABEA 3ZKWB 2QTZA 2EHDA 3LQKA 5E4TA 4D4GA 2RH8A 2VQ3A 2PX8A 1JVNA 4E15A 1OBFO 1P5ZB 4WNAB 1QPBA 2DPGA 5KHOC 1WSDA 3DPSA 3FNQA 1SBIA 4PVDA 5JPIA 3ULKA 4EM6A 3QW2A 1G5HA 2DMRA 5E6UB 4C0SA 3GLGE 5FNVA 1PTKA 2FHSA 2VT2A 3JATB 1YZQA 2WPDD 1HKHA 1OBOA 2A88A 1YNSA 1IB0A 1WPQA 2FAXA 3QUAA 4PXAA 5SZIA 3OC0A 1ODCA 3GH1A 4Y67A 2GTPA 5KSZA 1GUFA 4NXNB 4PRYA 4H6XA 3LA6A 3SZUA 5FTNA 1FSGA 3LKBA 3O3MB 5I9MA 3AY0A 2AL7A 1D2AA 4WADA 3H5VA 4CFYA 2O23A 4G0PA 2H63A 3ZXIA 4QWMA 1LY1A 3NWPA 5DMHA 3HU3A 3JVEA 3E7PA 1FXWF 2QAIA 2IZOA 4C03A 4UE3S 1NC1A 1WA5A 5HZKA 4CCYB 4KLCA 5B4TA 2IYAA 2AR0A 3LKDA 2RGRA 3VJRA 3HBAA 1JI3A 1P1BA 4TV9A 2F6RA 4IWYA 5C8DA 4BWFB 3HCNA 3E9CA 1SC1A 3B7GA 2RFLA 4GGMX 1X1EA 2J0EA 3MC1A 1IG0A 4PCVA 4Q9IA 2GBIA 3QKSB 5AM5A 3D6UA 3F49S 3HM9A 1DJNA 2XCSB 4M86A 4URUR 1YA8A 2P6MA 2TMKA 3SXUB 2CE2X 3P27A 3JVDA 1OI7A 3EA0A 4MRNA 3IERA 3OURA 2YQ5A 4YJ2B 3W6ZA 4L5JA 5CJ2A 1DUVG 4RDCA 1WL8A 2H2GA 1P9WA 1TCVA 3GLSA 4IDAA 4G0MA 4QM6A 2FW9A 3U4IA 4KDEA 1G6KA 2VWGA 3PQ4A 1L7EA 1J7JA 3FDJA 1WLYA 2MSCB 4GOMD 4LISA 3ISVA 2O59A 2I1VB 2IU6A 3BXPA 4RE5A 1N57A 2CF6A 2PWYA 2MIIA 2WUFA 1AZTA 3SBXA 1N2IA 4OHWA 5SV2A 2GYVA 2DPXA 1XTBA 3CE6A 3LTNC 4L75A 5D5HA 5A6SB 1I6MA 3VSDA 4OU4A 4YEDA 4D9NA 3PPIA 5C52B 2CLMB 2CDAA 4LW8A 1HLPA 4N0QA 5LLDA 1H6AA 1BDIA 4M1OA 3T94A 1J8YF 1FFEA 4GLFA 1HNXB 1SA0A 4PSKA 4GYYA 1Y37A 2ZCJA 3QFRA 2IYWA 4DIBA 2QN1A 4U6QA 2JLZA 5F51A 4BBAA 5I5GA 4PAGA 2QB5A 4L95C 2NZJA 5IKEA 2WU1A 1JDTA 4M9CA 2BL4A 1U6JA 3ZIAA 5AVWA 3P9CA 2P68A 2WJ3A 5IDWA 5L7TA 3N3AC 5G2OA 3CNBA 1VB5A 1ACMA 1CQWA 3H5TA 5G0UA 2FPIB 4ATNA 2CHFA 1VPLA 4L4RA 4I4NA 3FMVA 5KWEA 3M83A 3IPAA 3OCCA 1TEVA 3O4GA 3OTQA 1WETA 2O8BB 1PT7A 4EPYA 2YL2A 1WUJS 1JVBA 4LY6A 4ETWA 3G2HA 1OZHA 4G9EA 1YB4A 3PYXA 5ES3A 4B6OA 1TEHA 3DP7A 5B7GA 2D1RA 3COPA 1UAAA 1JMVA 1DCKA 4QO8A 3RBXA 2ODEA 5KVAA 5JU6A 1GIAA 2RKBA 3K1AA 3A14A 4DFDA 4PWYA 3OJCA 3DZGA 5BY2A 4ZAVA 3ZDBA 4BEJA 1KYXA 4G0VA 4A6PA 5EPEA 1J99A 2YXDA 3GMIA 4J3NA 3VVBA 2XNCA 3E3NA 4ZVSA 1AKNA 4HN9A 3I9NA 1VMEA 1TIPA 3RH0A 4NZPA 4EY8A 5HUQA 1AURA 1XLVA 2UU9B 5B64A 4LBWA 2NLOA 2A7XA 2WQZA 1VM6A 5IP5A 1LW7A 2NXEA 2G4VA 1DWOA 1TMGE 2R4QA 2ZRFA 4Q39A 4KO3S 2FW7A 1J09A 5UKDA 3S8YA 1KFCB 1QMPA 1IWOA 2C92A 4YQYA 3LO8A 4I5GA 3GFFA 2Y0BA 5C7LO 5KOHB 1XP5A 2GZHA 1B16A 4OHXA 1TQHA 4C01A 4EGQA 1QNFA 1IYZA 4OJMX 3CNHA 5LB2A 2FEKA 3U9LA 3VTZA 2BH2A 4H7KA 1U7WA 1FXSA 2PZEA 1U3FA 4O6VA 2GK6A 5AI4A 1PWXA 1YNOA 2F3QA 4DR6B 4MINA 1MJNA 1FVHA 2P69A 3I52A 2P40A 2H4XA 4YASA 3JQGB 3F6PA 5I4IA 3A27A 3ZV6A 4U6SA 3FRIA 4M2LA 2E1RA 3GLHE 5JFTA 1FIUA 4ZVVA 1A2KC 1THMA 4K9NA 4OSPA 2P9YA 3DE2X 1N2JA 1N4AA 5J43A 5BWLA 1FTQA 3QKUA 3KSBC 1ZD5A 5ALYA 1F6DA 5ALMA 3QHQA 2H92A 2OORC 4DMMA 4HV4A 1NFQA 2E18A 1U0TA 4RJIA 3JRWA 5HILA 1E2KA 1KJ8A 4TM8A 3FM9A 4G8JA 3IJEB 1GQFA 1YKFA 1Z0DA 3BA6A 4C76A 1T0HB 1MX9A 1FDIA 4CL2A 4Q1FA 5JQGF 1VZ3A 2CFRA 2OP1A 1Q5PA 3GOHA 1LBQA 5EA2A 2QL5A 1GG5A 2F8LA 2QSUA 1E8DA 1M2HA 2R8OA 1NQUA 1U0LA 4BJ6A 4HMPA 3EGWA 1PWHA 1ZSYA 3RFUA 2IA5A 5JUWA 5TPZA 3H19A 1CZLA 1XCGB 2D2XA 4INAA 1K1EA 4DIFA 3P1JA 4MQBA 3RLFA 1SOWA 2QUBA 1BH6A 4RKEA 2IGTA 4UM7A 4I9HA 1BQ4A 4M9RA 3T5DA 2HBRA 1U28C 3E9NA 1P8JA 3F5FA 3A6GA 5TGZA 3FYDA 2JD1A 3U5TA 1GO2A 2HCRA 1XYGA 2RKOA 1C9DB 5BNFA 2ZIGA 3V9AA 4F3CA 3D6FA 4L8WB 4KQ6A 4HGPA 4MGEA 3KKNA 5HCNA 4QRIA 1P7PA 5ICFA 3TQOA 3TQFA 3D4IA 5L3VA 3RIMA 4Z4IA 4F11A 2BBTA 5HQTA 4IY1A 2VHUA 1OLSA 4M0DA 2V7QA 5JWHA 1WM1A 3B8HA 3BUSA 2ADOA 3BS4A 1OWNA 4UEJA 3T3DA 5JNSA 3SP1A 4MYCA 5CDSA 4Q66C 2EFHB 2W6IA 2ZAMA 3DOJA 3JQ8B 3KWJA 5HK8A 4RHFA 3EJ6A 1E79A 1F0YA 1MJGA 4M0PA 2QQ0A 2JLQA 4RTKA 3BGWA 4G4SO 3AVQA 1QR2A 1N6OA 3EOZA 1V25A 4MPJA 5LA6F 3KLBA 2ZJBA 3MT9A 2H4FA 2GFIA 3VPCA 3VJKA 2G5TA 5T8KA 4XQ9A 3L6UA 4DJDC 1PR4A 2WOOA 2ZAYA 2FV8A 3CPJB 4P81A 4RTMA 5CIQA 3FCUB 4N5IX 2R8ZA 1JH8A 1XQVA 1WW3A 3IQFA 3IP1A 2WZBA 5DHAA 4DIOA 1S2OA 1DB3A 2QTAA 4OB8A 2BJHA 1Z8HA 5H0IA 4F04A 4ZHQA 4GX1A 1KY3A 2DFDA 4WPGA 5F4BA 1VI6A 3MBKA 3N5KA 4OXIA 3SVZA 2PT5A 4F9FA 2WWYA 4MUGA 1PV4A 1BKYA 4PYMA 3L43A 3A6DA 2P1DA 4OX9Y 1LPBB 4ZDWA 4UEOA 3UWDA 1UBSB 4MUKA 2BFMA 3GT3A 5L9AA 5BWBA 1GZ7A 2VDKB 1JFFA 3CKYA 2Q9BA 3IJ5A 1KMMA 1MRNA 2AN4A 4TWJA 4XVCA 2QJFA 3AW9A 4O2LA 2ZB7A 4K03A 3WQQA 1R50A 1SC9A 4RHUA 3BWYA 4IIGA 4C7BA 5CFZA 3I12A 3OIDA 1FSZA 1E5XA 5G0SA 3ZCRA 3TQRA 3BWCA 2P3QA 2XMRA 5KPDA 1Q91A 1ZGBA 2DFVA 4YX9A 5MGBA 1BXRB 3DMPA 3W3AA 4YUAA 3C15C 4ARCA 3F3KA 2QG4A 3ADBA 3AETB 4EI7A 1TJ5A 1M2FA 3CE9A 5CP8A 3OFJA 2AKAB 1GLNA 2F64A 5KDOA 4PNPA 1N1MA 3C74A 4HQNA 1SWVA 4TRMA 1CUJA 2ZI4A 1SVNA 4TWZA 4Z99A 5IT0A 3EPJA 3GJQA 3VZPA 1TFRA 4TL7A 3JD4A 3QEMA 3SFVA 2L17A 3CYFA 4RMGA 5JAQA 2AJBA 3LHDA 3IO5A 1ZBDA 2ZIAA 5SZJA 3DLAA 2HR1A 1D6JA 1FTGA 2O1EA 4GI2A 5GVRA 1G4UR 4IHKA 1HWYA 1PR3A 4JBNA 1ZUHA 4Q7LA 3TI7A 1E2IA 1J8VA 1RM4A 2QTVB 3SZLA 2X5XA 5KTMA 1XQYA 3D7SA 3N2YA 1KI3A 3TWOA 5LMZA 2BRUC 2EZUA 2REBA 4BX9A 3LFHA 4OX9B 4I5DA 3V1YA 2ERYA 3R3VA 5DLEA 5DNUA 4NZ9A 3DMRA 1YOVA 2MR5A 3UJAA 3GP3A 4GAEA 4KQXA 3SC2B 4OHPA 3W8EA 1VPVA 4GM0A 2X8LA 2ZIWB 2EQBA 3CM0A 3G2QA 3H6KA 4WZBA 3AM3A 2NXJA 1P2BA 3VDXA 2PGDA 1OLXB 1ZY2A 2JJ2A 5CEEA 1MB4A 2RJOA 4IQ8A 1MB9A 2VCEA 4EY7A 3UTCA 4Y1GA 5IMBA 2A67A 3EQ6A 3QYAA 2RIPA 4OATA 4NK5A 5LQDA 1AKVA 2E7ZA 4RJJA 3FTNA 3EMKA 2OESA 1VCNA 3HNRA 4FZ3A 4KUHA 4G1CA 4BFTA 4L74A 1JR3D 5CBKA 1KE1A 4NYJR 4ACAA 2Y66A 3B1KA 4UDNA 3I01A 1WU8A 3PHHA 5FOSA 3UOWA 4K9DA 1RLJA 1GQSA 3IUNA 1YC2A 2MU1A 3NIWA 1Q7GA 4D8TA 4D9FA 1A71A 1WVIA 1YTLA 2J09A 3FWZA 3ZZNA 3N8HA 4KE8A 3EASA 5E3IA 2C7VA 3UGQA 4HG2A 1ZN9A 3LGSA 2IEIA 3DE4X 1ZUWA 4UZSA 3RBZA 1YO6A 2ZXEA 1BDBA 1LQUA 1OPXA 1YVDA 2HIGA 2ZI5A 4H0CA 3UK1A 4Y98A 2A0WA 4B8ZA 4YUXA 4B17A 1QIGA 4Z4HA 2RK4A 4UMVA 4LWQA 2REQB 4HKTA 4WUVA 5JYBA 5LLTA 1D2MA 3DV2A 3WGTA 3ZDAA 4QQFA 4ARUA 4X1YA 2PJDA 2UV8A 3C5CA 4PSAA 1WXXA 4U9UA 2YY7A 3PGKA 2KHZA 4N0PA 2ILTA 5C8XA 4CMIB 2ZXFA 1XPOA 3DFUA 1LI7A 3CZ9A 3BSFA 4LBVA 1E99A 1E92A 1OX6A 1L8AA 1YDWA 1WULS 4WKGA 3Q88A 2ZSFA 3BILA 5K3FA 2EX1A 2Y1KA 4LTMA 5TEVA 4KWTA 4ND4A 4J0JA 1A88A 1DRKA 1W34A 1Y8RA 1VKZA 1PFQA 2O2IA 2QIOA 1IBKB 3PXAA 3AR2A 4PXYA 1BN7A 1TQDA 3C3YA 3SHTA 3PKZA 4WBXC 3OE7D 1A8PA 1FSSA 2V55B 3DA8A 3DAPA 2PZGA 4QDUA 2WG0A 2QMYA 3SOZA 4CEIA 2EKBA 3OCYA 2WYVA 1V3TA 2YMMA 3KZMA 3L41A 3W90A 3WV4A 3BIOA 5JHHB 4UEWA 3THYB 3EAFA 4KFUA 2JHCA 2VH5R 1RHUA 3OZFA 4ND8B 3NHPA 4LSGA 1KRXA 1GCIA 1L4YA 2PSEA 2AVNA 3QEMB 1H69A 2ID4A 1AQ6A 1Q57A 1KSFX 1P1HA 3AJEA 3N2EA 4PXSA 3SJAA 4KOEC 4WY8A 4FR5A 3UV3A 4E5MA 4ZN6A 4P3PA 2JIDA 4Z0HO 3KU4A 4BFLA 5HF9A 4UU8A 1TVMA 2HDOA 1Q0ZA 2ES4A 4MR7B 1XN4A 2GR9A 1T1IA 4C78A 4LJYA 5B12A 3T4PA 4JXZA 1SMKA 3R3WA 1MX3A 2A2ZA 3QKRA 3DAYA 2Y1GA 1VLMA 2RHDA 1XC7A 5KYUB 2BGWA 3VYVA 1RPJA 3DLIA 3JU3A 1XU7A 4CODB 1TCAA 3IVMA 3A05A 4US2R 5DM1A 3GLIB 4FOOA 2FTKE 2OGTA 1J8MF 3IPLA 1J8FA 5HS6A 2Q0QA 1Y6JA 1YD7A 3H2JA 1E0SA 4QHTA 4EHHA 2NT3A 3TO5A 3SJZA 2B7CA 3KPUA 3R76A 1MO2A 4MOWA 1C4OA 4MVXA 5IVDA 1B14A 1VMKA 3OC6A 1JJIA 3RJ9A 3Q12A 3T0GA 4XD7A 3GDGA 3QNMA 3DUFB 4QYMA 3RVSA 3B1XA 1BMFA 1RJGA 2IXDA 3B52X 3BSYA 3MLEA 2AUMA 1Z0KA 2BSXA 2HV8A 1L5ZA 2L69A 4O2AB 6GPBA 3LYLA 4Y6PA 4PS0A 1H1LB 2QXUA 4BKPA 1VPDA 1PU2A 3JQ9C 3LWBA 1TOAA 1FMCA 4UMDA 5SZKB 4C1NA 4U4AA 5LD2B 1UBKS 4KXWA 4LYDA 2VUIB 3GC6A 2P5YA 4F8YA 2RHOA 3OPVA 1Q1AA 2CD7A 4NJEA 4NYJQ 4AB1A 4AN0A 5LP6F 1W87A 1Y9JA 4LHYA 5KNBH 4ZAGA 4EMTA 1PEDA 1L1EA 4LXXA 2EIHA 3KVOA 1NZFA 1HYHA 4QSHA 5HM6A 4GPBA 4MUNA 2EGGA 3DEKA 2XJ4A 3CKLA 1XA4A 2ACVA 4RA6B 3VAZA 2BZ1A 1RCFA 1D4ZA 4HWOA 3KR0A 4AN1A 1NKSA 1BJRE 2J4CA 3DC7A 2ZUSA 5CLFA 1BD3A 3BWMA 3Q40A 2VJYA 3AJ8A 3GZJA 1USKA 3MGCA 3T52A 4FMPA 2FG6C 4UXJA 3O47A 4WXPA 1NF2A 1VSVA 1UWKA 4UTRA 2C2MA 2Q2VA 3BXHA 4IJUA 2XH8A 4Y2PA 3BF7A 4RMJA 3SQMA 1HZZC 3H11A 3OESA 3EXG1 3DWEX 3LM8A 1HDYA 5LIPA 1KAHA 4GEKA 1IULA 2R751 5FUVA 2J5RA 4ENUA 5AM3A 2QE7A 4LWOA 4CZ2A 1P5FA 4ESVA 1LF0A 1YXMA 1XG5A 3RANA 5B6IA 1WB9A 2QN8A 1KOLA 2QLFA 3I76A 3OD5A 4OJNA 5HBGA 3RHFA 5L7YA 2VYQA 3WLFA 2HV9A 1ZHFA 1JDBC 4G9BA 3SXJA 1RJDA 1ORRA 2NUTB 2XYVA 5DSTA 2V0NA 1VKHA 5JCJD 5AO9A 3IAFA 4EAAA 1GGHA 1N2XA 1E1KA 1L6IA 5K0ZA 3DOOA 3L4BC 1JG1A 4AS1A 1YZKA 3GJ3A 4R54A 4BO0A 4BX8A 4F5DA 2D8AA 2O7QA 1UK6A 2ZITA 4PYOA 1ZW6A 4JUFA 1J9ZA 4IIUA 4D44A 1GNTA 4WY5A 3U48A 2IVZA 3JSAA 4RTPA 1KO1A 5I7AA 2HK7A 1RAEA 3UJPA 5CH8A 5K0EA 3HO1A 1S2GA 1PJ8A 4M1YA 2B6NA 2Y93A 3KNZA 3O93A 2H18A 4AKSA 4BTEA 4F7WA 2X5JO 1NW9B 2ZKIA 5KCMA 3IUSA 2G1JA 1LTKA 4G1UC 1KZHA 3CA8A 1XDBA 3ZBQA 4PGAA 4Z2AA 4ZHSA 5JNTA 1HOTA 1PP4A 1VL1A 4MEAA 1RZRA 1UH5A 1ZI8A 2QX9A 2BFCB 3R6DA 2PNJA 5EIBC 1XELA 4X8MA 5DTIA 2ISSD 3PNPA 2EAUA 4MVCA 4OEHA 1GXSB 2FJ0A 3UOGA 4OYRA 1QC5A 3HMQA 1Z5ZA 4PF1A 1EBBA 3VMFA 2GEDA 4BRSA 4PG5A 3OFVA 3ZGNA 1Z4MA 1NUUA 3AL3A 3C6KA 3HACA 4WOJA 3PIDA 5AJZA 3AQIA 1M6EX 4FXOA 5AK3A 4JYMA 1J70A 1H3FA 5BQ3A 3EW9A 5DLQC 3T9EA 1AY0A 1L4BA 2VBIA 3LYHA 5DOZA 3AI3A 2FKAA 2FMIA 4M54A 5DWQA 4QLBA 5AM2A 1YQTA 4WECA 3TOCA 3F9CA 4QIHA 2AG5A 3KHSA 1XTIA 3H5AA 5I9LA 2FPLA 3UJNA 1X87A 5B37A 4F8EA 1KOFA 4Y6LA 2QTLA 2IYQA 3DAFA 3FB1A 4UUBA 1MVOA 1LWOA 4FOTA 3WFZA 4Y9DA 1F60A 4MP8A 3KELA 5LMUB 1COWD 3ESAA 3DHEA 4F85A 5K99A 1VHLA 1H2ZA 2C4TA 1EWVA 5TVGA 4PG8A 1JAYA 4A23A 4K46A 4EEKA 1XVUA 5I9NA 3ISTA 2V5VA 4U2EA 1Q3TA 3BHIA 3KKPA 2IHZA 1QTNA 1W5AA 2AUTA 3SX2A 2J6IA 3IQIX 1DO2A 4ZVQA 5CDGA 1K7SN 1G6OA 3I9V6 3JWGA 3QX7A 1YL6A 1KXJA 4CLXA 3AR7A 1VIAA 2RC6A 3OOJA 3RIHA 1TZCA 2O2JA 2QUZA 4CTJA 3EG5A 5KOJA 3QE9Y 1V47A 1VDZA 1R37A 2P3LA 3C3XA 4TRNA 1FQOA 2O52A 1CRQA 1CRLA 3HJHA 1WKBA 1PEYA 1ZM7A 4J16C 4K6FA 1RI2A 4NNPA 4S12A 3SYKA 1QTIA 1ZEJA 1FF9A 2HDNB 2I1LA 3OCVA 4I4CA 1DOAA 4DG8A 4GMGA 3C4QA 2EJBA 4X84A 4NICA 5ED4A 4K9QA 2ZWMA 4MQEB 2R5WA 5CFQA 421PA 4QNNA 2IZZA 4I1UA 5C3UA 5CIWA 1R9MA 3F6SA 2DR3A 3F6BX 3ITKA 3WISA 4KFCA 2BFWA 2YXNA 3GO4A 3F73A 1UMCB 2CEKA 1JAHA 3KCNA 1K8XB 1L5KA 4UJ3A 3G9TA 1F2TB 1EVYA 1KO4A 4RFLA 3SM3A 3WK4A 4HFJA 4ZPXA 5DN6D 2WPDA 4KXMA 4LZPA 5FWDA 3CRNA 3A1FA 1XU9A 4L0CA 1RKXA 1X19A 2V59A 4NU5A 3RQIA 1A50B 3GAMA 1SIBE 1TEXA 1INLA 1E77A 1Q0QA 1AA9A 2EW2A 1E4EA 2HU2A 2DECA 2VT3A 3NHZA 3O94A 4H1TA 1JQ3A 1X2EA 2BMDA 2XAAA 3EB9A 5FPTA 3TR5A 3UXMA 5JT1A 2QGFA 2CBGA 1CULC 2V9ZA 4JHXA 3VC7A 3BMOB 5COQA 5G40A 3EXEB 3QEOA 4HLQB 1ISMA 3CFYA 4H3HB 5KC8A 3SYRA 2FETA 1N9GB 3QU7A 2P2CA 1JI0A 1W96A 1CY7A 1NNSA 1NQTA 2YWCA 1W6RA 1X86B 1ZWLA 2GPAA 2BMFA 2XYRA 3LGAA 4JGGA 2JI8A 4LSWA 4M9UA 1E3EA 2AC2A 1T36B 2TMGA 3QMVA 4M22A 5C8YB 2MDTA 2V8OA 3PQ6A 1M73E 1IXZA 5HIMA 3AEKB 1XZ8A 2BM9A 5IAOA 1H66A 1B26A 2EGHA 3IBGA 5BRNA 4U7HA 1IM2A 3JRXA 4OQDA 2IIPA 3ZQ4A 1POWA 1QH0A 3CF4G 2NU8A 1G20B 1UBUS 1IOVA 3ORYA 1NMXA 1XFDA 4JJ7A 4ITRC 5FOTA 3O84A 4F6RA 2XT9A 5LR6A 1WPXA 4MVYA 4GO1A 3PXGA 4TLCA 2ZDHA 3RFTA 4M1QA 3TJMA 3UPTA 4GMKA 3IIJA 5T7BA 5FH9A 2JRLA 1QQ5A 4YJHB 5EHXA 1VXRA 4XQGA 5K0SA 5HEKA 1T35A 2AT1A 3KOZA 1QX3A 4IXMA 3AEUA 1R00A 7MDHA 2EHJA 2H4YA 3VR0A 1SBCA 4CG1A 1SXJA 2FY8A 4CL3A 4YMIA 4TROA 2B69A 1TXGA 1GUBA 4GS5A 5DTEA 3ZWPA 4KTTE 4AMZA 3R9KA 3OUZA 2PS1A 4ARVA 4HB4A 2Y92A 4YT8A 2ON6A 1RYFA 3S2FA 1FU8A 1GWNA 3ZIDA 1IUKA 1BXKA 1VJ1A 5DX1A 2J6HA 4QBGB 3MAJA 1UMBA 4GBMA 4DWJA 5JYEA 4RMNA 3EPHA 1NV9A 2IYUA 3MUEA 5SZHB 1O6CA 2QS9A 3NHBA 2YX1A 3OZSA 4C4RA 3H9UA 5A9RA 2BUCA 2QZ4A 2FEMA 4U7GA 4PE5B 3B6EA 1Y3FE 3K8YA 4RGVA 4JASB 4MV0A 3MTDA 5MDHA 1IC6A 1EJ6A 4O4JF 1UXGA 2XRMA 3CNLA 5IAGA 4EZBA 2C97A 3QG5A 4JBHA 1YCHA 3QVTA 4HQLA 3AJDA 1M7BA 2NIPA 1XFAA 3LK7A 2X1HA 1AN9A 4DT1A 3IEXA 1XOIA 3A3OA 1Z4LA 3L1HA 2EW1A 1M1NA 4ZOLF 2VJNA 2O3TA 3O1LA 2ZUCA 2MJLA 1E0KA 3JYLA 2NYRA 2PH7A 4M76B 2W2LA 2GN1A 4NBRA 1DRVA 5LMNB 1U7TA 4ID3A 4MWGA 3DDOA 3PKJA 2DR0A 5K6TA 3B1WA 5K03A 2I3DA 4PC1A 2W4MA 1RBQA 4DYVA 3FUVA 3FMIA 4JLAA 2GDJA 4FS8A 3WO1A 3JR3A 4PSDA 2GO1A 5IH7A 1RRFA 4YV2A 2A57A 2G7MC 1CR4A 3GZ4A 3CUWA 1CZOA 2VAWA 3SQLA 4AKGA 1OPRA 1S89A 1OYVA 3EG9A 2FQXA 4PHGA 4FN4A 3OM1A 4UXHA 2DJ5A 2PZMA 4QTXA 5EQJB 3L6EA 1DTEA 4ACBA 1J0XO 2YH2A 1H1DA 4MW7A 5B1IA 5FUMA 2WV9A 3WGUA 2HWYA 1QO9A 1OX4A 4LRUA 1ZUNA 3E9YA 4HLNA 4BU0A 2XKKA 2HXYA 2GO7A 3KFVA 4GXRA 3B3FA 1QOQB 4IIXA 3HJBA 1IY1A 2FZEA 5LYJA 1DBIA 1IWBB 1NN0A 2XVYA 1XL1A 4Q24A 3TI9A 3EPPA 3P0RA 3NH9A 4CR6A 3S5UA 5BMVB 1Q0HA 5JW6A 4A2WA 2ZIUB 3KZXA 1U28A 1FRVA 2TYSB 3UUEA 2WFMA 3H5WA 2OD7A 2PZ8A 2Z08A 3L8MA 2O8NA 3FOWA 4JR2A 5GP1A 3NNDA 2ACWA 4J2HA 2EF0A 4JL6A 5D51S 4DADA 3TBHA 3ZWOA 2P9HA 1TZ2A 1MFPA 1T0JB 4QD3A 3W7AA 4R16A 5C35A 3VGPA 2ZJAA 1LB1B 5C4GB 3G2IA 4G0WA 3IQWA 5ER9A 1HE4A 4PPGA 1MT0A 5DTRA 1ADFA 2P62A 3ZV7A 2ODQA 3I4CA 2EV9A 3HYRA 5JZMA 3QA9A 4YP0A 2HADA 3MTBA 1X8JA 3HA5A 3ZH9B 1Q3HA 2Q41A 4A4DA 3J80A 1E3IA 4E5SA 2YWFA 7ABPA 3U7HB 1O58A 2PXAA 5MGNA 2IDJA 1W88A 2WAOA 2Z5FA 2HQ1A 3HBNA 4KX5A 4A7PA 5IYZB 2HMUA 3ONFA 2W11A 4B5LA 1IY9A 1E59A 1ONSA 2JK1A 4OM8A 2DB3A 2QMOA 3F6EX 4RVNA 4BASA 1KP9A 5FAXA 3NHMA 4A91A 3H9QA 1H0SA 5DT2A 5AW0A 4EG0A 1JE1A 3HCPA 1G0OA 1HV8A 1O89A 1HK7A 1R3UA 1S3GA 2RI0A 2Y1CA 1ECPA 2FOIA 3BZWA 1PDVA 1GPLA 1WUYA 1W0CA 3ITDA 4J1SA 5IABA 2QP3A 5LNK6 1M1YE 2BELA 1NZDA 3BGSA 3F7MA 4K8RB 1JT9A 2Z9CA 1M1XB 4KDRA 1JWLA 2VFAA 3PVZA 1X7GA 1RMYA 3GB9A 4BB0A 2XUFA 4M38A 2XUPA 3ZS9A 3QLVC 4DDMA 4F9TA 1QZUA 5GONA 1F06A 3UGJA 2V96A 1HQYE 1NXSA 1FNBA 5L7WA 4M0EA 4DU