3STUA

Crystal structure of tomato methylketone synthase i complexed with methyl-3-hydroxydodecanoate
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
258
structure length
258
Chain Sequence
b'FVKKHFVLVHTAFHGAWCWYKIVALMRSSGHNVTALDLGASGINPKQALQIPNFSDYLSPLMEFMASLPANEKIILVGHALGGLAISKAMETFPEKISVAVFLSGLMPGPNIDATTVCTKAGSAVLGQLDNCVTYENGPTNPPTTLIAGPKFLATNVYHLSPIEDLALATALVRPLYLYLAEDISKEVVLSSKRYGSVKRVFIVATENDALKKEFLKLMIEKNPPDEVKEIEGSDHVTMMSKPQQLFTTLLSIANKYK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylketone synthase 1
publication title Emergent Decarboxylase Activity and Attenuation of alpha/beta-Hydrolase Activity during the Evolution of Methylketone Biosynthesis in Tomato.
pubmed doi rcsb
source organism Lycopersicon hirsutum f. glabratum
molecule tags Hydrolase
total genus 88
structure length 258
sequence length 258
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3stuA00
1CUJA 4BCDA 1EDBA 1WPXA 3W04A 1SOMA 3R40A 5DYYA 2E3JA 5KWJA 4HXEB 1CUVA 1N5RA 2Y2UA 3DQZA 1ZGBA 5CT9A 5LLSA 1VOTA 3V9AA 1DQYA 2DR0A 3WA6A 2UZ0A 2WHRA 1USWA 1UZAA 4GEGA 4Y2JA 4FNMA 4F60A 4Y7DA 4CCWA 1MO2A 5LZ7A 3FLEA 4C89A 5FDFA 3WI7A 1Z68A 4H18A 1BCRA 5AK5A 3E3AA 4H7HA 4BE9A 4X6YA 4N8DA 3ESAA 4MXDA 2VEOA 5FKJA 1W1IA 3T52A 1E66A 3NGMA 4B83A 1ZI8A 4BDTA 2XB6A 5AOAA 1H2ZA 2XUAA 3PUIA 2PSFA 5AM1A 1WPRA 5AKEA 2RAUA 1QIDA 1B41A 1E3QA 1XQVA 5IVKA 1QE3A 4BBZA 5LZ8A 3MUOA 1BN7A 3BJMA 4X6XA 4G9GA 3VJLA 1EDDA 3D2AA 3QZUA 1BRTA 3C8DA 3HJUA 5DWDA 4IHAA 2XLCA 1H2YA 2VJBA 1UT6A 3JWEA 3DS8A 5T4HA 1A8UA 5AHXA 4P92A 4NZZA 1Y37A 1XZCA 2IX9A 4M0EA 1ZIXA 3GELA 3EQ8A 3I2JA 1DWOA 2J3DA 2OCKA 1QONA 1Q83A 3IA2A 4N5IX 2HFKA 3W9BA 3HC7A 1QFMA 1N8SA 5ALKA 4CG1A 3OM8A 1VXOA 4FDMA 5AKGA 3H18A 2WQZA 5A2GA 4Y2VA 5AIBA 3WL5A 4X95A 4QDOA 4J0CA 1XZIA 3WA7A 1UK9A 3BF8A 2BJHA 2JEZA 3AINA 3VDXA 5LZ9A 3T4UA 3I2GA 3DEAA 4KEAA 1QO7A 2YXPX 1LBSA 5JAUA 4CIAA 4LYDA 2XE4A 2JF0A 1IUNA 4LYEA 2WUFA 2YASA 3EF3A 2PPLA 1BS9A 4HAIA 3V1KA 5AP9A 2OQVA 4KE8A 4HVTA 1XZFA 4DYHA 2XLBA 5LIPA 5K3FB 1EH5A 2WU3A 3UUEA 3E0XA 4KRYA 1WB5A 4KAJA 4JYPA 3M82A 4BRZA 1GXSA 4RGYA 5DNUA 1A8SA 3AIMA 3IULA 1DWPA 1CUEA 1N5MA 5ESRA 2WKWA 3U1TA 4BVLA 5HCUA 1FFCA 1K8QA 1UK8A 2ZYHA 2G4LA 2LIPA 4W9RA 2H7XA 1IUOA 1XZBA 2WUDA 3A70A 4AN1A 2OLEA 3GUUA 3HABA 3H0CA 1ZD4A 3OPMA 1MNQA 1TAHA 2XUOA 2WHPA 4ZXFA 5AICA 3CN9A 2Z3ZA 4A23A 2VSQA 3D4LA 1CUHA 2RI6A 4JEIA 3E1GA 2HM7A 1MAAA 3BE8A 3STUA 2OGTA 1QTRA 4G9EA 3PUHA 4UHHA 2Z8XA 2XUHA 5AM3A 3WK5A 2HA4A 3KSRA 1Q0RA 4X91A 2JGFA 5DTIA 5AOBA 4BVKA 4DTCA 5ALMA 1XRMA 3OTQA 3N0TA 5JARA 3G0CA 1R50A 4J0HA 1XQYA 2XMCA 4L3WA 4UHEA 5IH7A 5JALA 2DHDA 4QLOA 2XQJA 4PQEA 5CXUA 4JH0A 1XLVA 2DQYA 4H77A 3UMJA 1HDEA 3O9MA 2GZSA 2WLSA 4XX1A 2AJLI 3SX4A 3OURA 4DLNA 3G02A 1XQWA 4X3CA 2VJAA 3WK7A 3H1AA 5AKHA 2RIPA 3KOOA 1SC9A 3B3QA 2WSLA 3WQHA 1C7IA 1P0PA 4AQDA 2H9YA 5CT5A 1XZGA 3R3YA 4GDMA 1VXRA 1EK1A 2RONA 3AIOA 4TVKA 3QH4A 3DDUA 1CFJA 3VJKA 2FX5A 3ANTA 4M0FA 1JU4A 2Z8ZA 4FNGA 4Q1VA 4W63A 1LPPA 4UBJA 2ZJ6A 5BOVA 1ODSA 4GLBA 1EX9A 2WIJA 2XMRA 3BDVA 2AXEA 2Q0XA 1XLWA 2WG2A 3LP5A 1R3DA 4BAGA 3SWWA 3DLTA 1A7UA 3G0GA 5ALXA 2VAVA 3KWFA 4UBOA 4Y2XA 4U2DA 2C7BA 3NUZA 3BF7A 1QIIA 4G8DA 1EDEA 2RHTA 1MX9A 2XUGA 3G7NA 4FWBA 4B6GA 4CIBA 3Q0TA 3HLKA 5K3AA 2NW6A 1GT6A 3E4DA 4WFIA 1FFDA 4ITVA 5HZGA 3U0VA 1TRHA 1U4NA 3K9BA 3H2HA 3F96A 2WU4A 1MAHA 1VKHA 1JI3A 4JYMA 1OXMA 5JANA 5AKKA 4J0JA 5AI8A 5DNWA 3KD2A 2BUCA 4N5HX 3DD5A 3KWJA 5AKJA 3AZPA 2WTMA 3C6XA 1EA5A 5K3EA 4I19A 2JIDA 5HF9A 2X8BA 3V1NA 1LNSA 1WB4A 4WJLA 2QM0A 3C45A 1ORVA 2VATA 4OSEA 5IKXA 4LIPD 4TGLA 5A7GA 1H23A 2DHEA 2O2GA 4AB1A 3DL7A 5LKRA 1AC5A 1JKMA 3CCBA 3P2MA 5FPQA 3QMWA 5JADA 4BVJA 3AIKA 2QZPA 3O4GA 5E4TA 1MPXA 5C8ZA 1WHSA 2CBGA 1HKHA 5HFNA 3MUNA 1CR6A 2PUJA 2QR5A 4CG3A 1GQRA 5A7FA 1CUDA 3C6YA 2Y2VA 2V98A 4PNZA 5C8VA 1L7QA 1Q84A 3HACA 4RE6A 1G5FA 4B0PA 2ACEA 3BWXA 4QDUA 3WZMA 2B9VA 1YSCA 5DNVA 1JJIA 5CH5A 2XUJA 1P0IA 1UOOA 2GBCA 1DINA 3R3XA 1THGA 2I3ZA 3ZLVA 3FOBA 4N8EA 5ALFA 4K2AA 3YASA 1E8DA 5EIAA 4INZA 3FCYA 2PL5A 2PU7A 2ZYRA 2WM2A 1OILA 1E89A 3HI4A 3ICVA 4C88A 2WHPB 1X2BA 2XT0A 4AMYA 3KDAA 4K6GA 3ZPXA 2XQIA 1XZJA 4OU4A 1EVQA 1ODCA 2HA0A 3C6BA 1ZJ5A 1XRNA 4W1QA 1MNAA 3DYVA 4X90A 3BIWA 3TEJA 1UOQA 4B7ZA 1CUCA 4OB6A 1ZI6A 3H17A 2Z3WA 1LPAB 4Y2SA 3STXA 4J03A 2WIDA 4C4YA 3F8SA 3OOSA 4Q3KA 2Y1KA 1GKKA 1VZ3A 2HDWA 3IB3A 4HS9A 1KU0A 5AKXA 3R3VA 5CBKA 5DLPA 3BDIA 1XZKA 3STWA 1ORWA 5AK6A 4EY4A 2GYWA 2BFNA 6YASA 4Q3OA 5E4JA 4OCZA 4BE4A 3UUFA 2PVSA 3FSGD 2YH2A 4U2FA 2C5GA 4L0CA 1QIHA 4IO0A 1QIEA 5F4ZA 1WHTA 4HTAA 5ALDA 3VVLA 3GROA 2OXEA 3AUKA 4GECA 3PF9A 3WK6A 3FLAA 1Y7HA 2H7CA 5BWCA 3ESDA 2FUKA 4YK7A 3I2IA 4GXNA 1MU0A 1CUSA 4KE6A 5ALQA 2D5LA 2XUFA 1LPOA 1S8OA 4HRXA 4FBLA 2VJCA 4LXIA 4J0DA 1EXWA 4EB0A 1ZOIA 5EFZA 4DMFA 2QUAA 1C4XA 4IH9A 2PKYX 3IIIA 3O4HA 3F9CA 4MEAA 5AK3A 4MWTA 1NU8A 2AJ8A 2ZYSA 3SK0A 4WCVA 3CXUA 1CUAA 5JAPA 3RM3A 4FFWA 1PV1A 1VLQA 1FJ2A 3OC0A 2GYUA 3AJAA 2DCMA 4DNOA 1LZLA 4X92A 5AJHA 3W9UA 1GPLA 3HSSA 3TGLA 3HEAA 1XKLA 5JD6A 3ED1A 2PBLA 1AX9A 4H7FA 1TKRA 2C58A 2EDCA 4UHBA 5LYYA 5JASA 1XRRA 3GZJA 3G9UA 1YB7A 3QPDA 3W05A 1DT3A 2J3QA 2QVBA 2EEPA 5HQ3B 2VQ6A 4B84A 3EIOA 2IIVA 3DNMA 1ACLA 3C70A 3CN7A 3D2CA 5FXMA 1G4HA 4U2EA 5AM2A 3HRHA 5EGNA 5D6OA 4ARBA 1CEXA 4LHEA 2H1IA 4WDQA 4GWLA 1W6RA 1LPBB 2WFLA 3WKEA 1XZEA 1DWQA 3M83A 1HPLA 1C7JA 3FYTA 1LBTA 1CPYA 1ZICA 3EBLA 5EI5A 1YCDA 1CUZA 2GYVA 1YR2A 2J4FA 3IUQA 1BROA 2WUGA 4LXHA 4CI9A 3I2KA 1IZ7A 1R88A 2GZRA 5ALEA 2XMZA 3BXPA 1VA5A 5IVIA 3C5WP 4QNNA 3H19A 2HL6A 5FV4A 1HL7A 1GQSA 1EB8A 2CUTA 2OCIA 1O6GA 3EQ9A 1SCQA 3M81A 2AJDA 3ZV7A 1Q0ZA 1LGYA 3STYA 1H2WA 4IH4A 5E2IA 3C5VA 1H22A 4A5SA 3A2MA 4AZ0A 4FMPA 1B6GA 2BCEA 1VZ2A 3K6KA 1QOZA 1DT5A 4J0IA 1RP1A 5AH0A 5JIBA 1T2NA 5ALIA 1K4YA 2DHCA 4BC1A 2O2HA 4PO3X 5JYCA 5ALUA 4QDZA 1EINA 1VE7A 3GA7A 4BAZA 3RKSA 4CG2A 5J3JA 4Q34A 1ZI9A 2H7YA 1T4MA 3AZOA 5EIEA 3WYNA 1DX4A 3G0BA 2XQKA 4BB0A 3B12A 5AI5A 1U2EA 2BKLA 4UBIA 3GBSA 4KJXA 1G42A 1XRPA 3G9TA 5CXXA 3ESCA 5T4EA 1XZHA 3LS2A 4AO6A 2W6CX 5AKYA 2JGEA 3PFCA 3ZLTA 1PFQA 2CEKA 5AKLA 2GBFA 5JZ9A 1WB6A 4KACA 5HF5A 3DKKA 1E5TA 2BGRA 4CFSA 4X94A 4BCBA 4Y2RA 5I7UA 2VT6A 3O9VA 4K6HA 2G5PA 2C0PA 3WK9A 4W1SA 1ISPA 4UBNA 4N8SA 5I8PA 3B5EA 3H04A 3O0DA 2ACKA 2W22A 2HU5A 5ALTA 4UFPA 1JJBA 1RWQA 1F6WA 3A2LA 5EIHA 4B82A 3PE6A 2QMQA 5CURA 5DYWA 4FLMA 3QM1A 2DSNA 4F5ZA 3GFFA 2BUBA 5FRDA 1TIBA 4CCYA 1A88A 5EHZA 2P8SA 5ISMA 1VA4A 2JGLA 5HK8A 3WIBA 4H7EA 5HF6A 1WOMA 3ILSA 3L1IA 4QWWA 1RYYA 5YASA 2WIKA 4BCCA 1YASA 4JNCA 5T4BA 3DKRA 4BRSA 3WJ1A 2XMSA 3WL6A 5I9IA 3FSGA 5LZ4A 4B80A 1R1DA 3WKCA 1ETHA 3I6ZA 1VE6A 2X76A 4DSAA 2WJ3A 3IURA 3L1HA 5BV7A 1ZD5A 4X6UA 4ROTA 2PX6A 4QDTA 4H0CA 2QTBA 4E11A 3VVMA 1ZD3A 3PDCA 5AKZA 2WFMA 4KE7A 1LLFA 2WILA 1CQWA 2XMQA 2QKYA 3NOXA 1Y7IA 3H2JA 4ARAA 4BAUA 3G9XA 1FSSA 2ZYIA 1LZKA 4YPVA 1U8EA 4V2IA 1R9NA 5ALLA 1AGYA 3FVTA 1JU3A 4OUKX 5K3BA 3DYIA 1UKCA 1BEEA 5ALOA 1PJAA 5HFAA 1H2XA 3DOHA 3LLCA 1P0MA 1JMYA 3STTA 4B9AA 1QIMA 5JAOA 1EB9A 4PV7A 2OAEA 4UHDA 5AIAA 4Q82A 4G8BA 2HA3A 4G1FA 1AQLA 4G8CA 3QITA 1UWCA 3FWHA 1K5PA 4Y2QA 3PICA 1BCSA 3WLAA 3WIOA 2XMDA 1CUWA 3G0IA 4DIUA 1XZMA 1J1IA 1R9MA 4F21A 4UHFA 4UBKA 4G5XA 1QIFA 5AI4A 2WFLB 1TCBA 3LIPA 4BYMA 4BZZA 1XRQA 3H2GA 3C8HA 5ALRA 3FNBA 1BE0A 3BJRA 2DFPA 3VXKA 5ALSA 1CLEA 1CUXA 4UPDA 1X70A 5ALYA 4I3FA 1X2EA 5D3KA 2VJDA 2OG1A 3QMMA 1CUGA 4FTWA 3R41A 4GBGA 1ZD2P 4J7AA 3G8YA 4DGQA 2OPHA 2XMBA 3D0KA 4XIIA 5C7YA 5LZ2A 3V1LA 5AK4A 1MX1A 5SYNA 1BN6A 4ZV9A 1QFSA 1QIKA 1EVEA 3FVRA 4G4GA 5AI9A 4L72A 1AMNA 4EY7A 3G0DA 3K2IA 1GPNA 3R3UA 4AZ3A 2XUQA 4TPKA 4X00A 2K2QB 4J0KA 1HBJA 1UXOA 4ZREA 1I6WA 1XROA 3I28A 3WJ2A 2XUPA 3PI6A 4EY6A 2YYSA 1SFRA 1UK7A 2WIFA 2GBGA 5K3CA 3F97A 3D2BA 5KWIA 4H35A 4Y2TA 4MJ3A 5JATA 1LPMA 3Q8WA 5AI0A 1VJ5A 3MGAA 2R11A 4D9JA 4JUIA 5H3HA 3W2TA 3I6MA 5IVDA 4NMWA 1GKLA 1TCCA 5EHXA 2O7VA 1CUYA 3JYHA 3NWOA 4MYDA 1XKTA 3AFIA 4BTVA 2BGNA 4FFVA 2QRUA 2D0DA 3FAKA 3H1BA 3HYSA 5KREA 1E8MA 2G5TA 3S2ZA 4BTLA 1GPKA 2V9ZA 2Y6VA 2B61A 1BEZA 2FJPA 4K5QA 3D3NA 5CW2A 2WUEA 4B81A 2ZSIA 1DQZA 2QJWA 1IUPA 3G9ZA 1GZ7A 4DNQA 5CH3A 3WWEA 4EUSA 4PF1A 4HZGA 4H7KA 1EI9A 3DL4A 4KE9A 4X85A 3WMRA 1CIJA 2PSEA 4ZWNA 4GI1A 4KRXA 4DMKA 2IITA 3LIIA 4C87A 4CCYB 5JD5A 5DYTA 2HA6A 4B85A 2JEYA 1XZLA 4X71A 2EDAA 2ONCA 3BL8A 3L1JA 2JBWA 1HLGA 2I78A 4OB7A 3CCCA 4ZI5A 4HXGA 3WWPA 4RPCA 4AXBA 1XRLA 3HZOA 2CJPA 2BAGA 3WWDA 4PSCA 3ESBA 4DM7A 3WYDA 4ZRDA 3IDAA 4B9EA 1IVYA 2J4CA 1CQZA 4MYSA 4RNCA 1DU4A 3WKDA 1FFBA 3IUMA 3DJYA 4M0MA 3I2FA 4W1PA 2OQIA 3C6ZA 1L7RA 4KAAA 4UUQA 2WFZA 4WDRA 1BU8A 1M33A 2Z5GA 3WKBA 1XQXA 2ES4A 1ZIYA 2V97A 1TQHA 2JGJA 4FHZA 4QEKA 4QZVA 5DJ5A 4G4JA 1KEZA 2WG1A 5LP1A 2XUIA 1YA8A 4AMZA 3ZWQA 3S8YA 3JW8A 4QDXA 2OCGA 4XJVA 5KBYA 4HRYA 4E14A 2HA7A 4BC0A 2JGIA 4OYYA 1LPSA 3WWCA 3M3DA 4IH1A 5AM0A 4EHBA 4PSUA 2HU8A 5K3DA 2ROQA 1AZWA 1CUUA 3TRDA 2WG0A 4UFNA 3N2ZB 4C01A 1KU6A 4P08A 1UOPA 4OYLA 1R4ZA 2VAXA 3H2IA 1THTA 5JAHA 4QA9A 5BWBA 4GHWA 4H7JA 1CUIA 1F8UA 2VA9A 1TK3A 1TCAA 4RE5A 2PU5A 4MQLA 2HIHA 4O08A 1D07A 4OU5A 2VF2A 3R3WA 1ODTC 3AILA 4FOLA 4YASA 3RK4A 4EA6A 4XWGA 3WL7A 5JD4A 2PSJA 4NS4A 4IQ4A 5HK9A 3RARA 3FYUA 4Y9SA 1UFOA 2ZJFA 2O2IA 2WJ6A 3SC2A 2Y6UA 2XQFA 4ZV7A 4QE3A 1EK2A 2PUHA 1CVLA 2FJ0A 2G63A 4EBBA 4Z49A 1AKNA 2CB9A 1ZJ4A 5FUMA 4FLEA 4UBMA 3ANSA 3D59A 3H2KA 5EHNA 4X97A 3WL8A 4UHCA 5E4YA 1J2EA 5EHQA 4AO7A 3EQ7A 1OCEA 4DNPA 1A8QA 1IZ8A 2VT7A 3V48A 3F67A 4Y2UA 4QWMA 4A16A 4WFKA 3DCNA 1J07A 5LKAA 1XFDA 4PSDA 1YS1X 2QUBA 3WZLA 3AZQA 4F0JA 5ALZA 3D7RA 1AUOA 3R0VA 3QBJA 2JGKA 5AKIA 2CKMA 1ACJA 4BZWA 1W4LA 2HHAA 5ALGA 4P93A 5CT4A 1L7AA 3D5EA 1DTEA 1MT3A 2HA2A 2AJBA 3FBWA 4LKOA 2C4HA 4H7DA 5ALPA 3KXPA 5C81A 4GW3A 4NVRA 3QPCA 2DQZA 2I3DA 1P0QA 2XUDA 1JT2A 5ALWA 2QS9A 2O7RA 2OGSA 3IBTA 3ZLUA 4J0GA 2B20A 1YAHA 2XDWA 3IVMA 1NX9A 5IVHA 3PFBA 1F0NA 2WHQA 2QJRA 3RLIA 2OAGA 3WK8A 2VTVA 4BDSA 1N1MA 3WWOA 4AO8A 1MX5A 4Q05A 2AJCA 5CMLA 4L9AA 3TJMA 5D3ZA 4BP9A 5A7HA 3O95A 4BATA 4WFJA 5CT8A 1QIJA 4E46A 3V1MA 7YASA 2OGZA 4UBLA 4FKBA 5A6VA 1CUBA 2QT9A 1K63A 3F98A 4KR0A 3C87A 3A2NA 5FPPA 3ZI7A 3IUNA 2HRQA 1QGED 1YS2X 2QXUA 1FFAA 1UKBA 4WY5A 5FLKA 2CMFA 4K6KA 1W52X 2V96A 2C0QA 3WKAA 5HKAA 2HU7A 4C4XA 1IMJA 3O4JA 4S0XA 1SCKA 2XUKA 4Q3LA 1SCIA 4EY5A 4H7IA 4AX4A 3FLBA 5CRIA 4C4ZA 4QLAA 3I2HA 1E8NA 1QIGA 3STVA 2RGUA 5ALNA 2JGMA 5DTJA 5A71A 1K6EA 4HXFB 1O6FA 3I1YA 3HXKA 3FCXA 2HRRA 3VKFA 3MVEA 4PW0A 4U2BA 1QTIA 4AN0A 5K5EA 1UKAA 4J3JA 3BIXA 5HQ3A 4KYVA 1MJ5A 1MTZA 4KAFA 5LZ5A 1F0PA 4X7BA 4MQMA 5SYMA 3QMVA 3VISA 5JZBA 4OB8A 4EY8A 4W1RA 3X3HA 1QJ4A 2WIGA 2HFJA 1CV2A 4YX9A 5D7BA 5FP0A 5FOQA 1WM1A 5CT6A 4UFOA 2XMGA 1ZGCA 4E15A 1QLWA 5A62A 4OD0A 2X5XA 5AI6A 1JJFA 2WJ4A 4ZGBA 5K3FA 3ICWA 3IUJA 3I6YA 2XI4A 1EHYA 1NU6A 1DX6A 1UK6A 3W06A 5ALVA 2CZQA 5CTAA 1J06A 5AOCA 2PM8A 4DMHA 1AURA 3FYUC 4DNFA 4U2GA 2HA5A 2QXTA 3FYUB 1XZAA 2QOEA 1XLUA 5AM4A 4BP8A 4WY8A 5HKBA 2R8BA 4MEBA 4B0OA 1GGVA 2ZJ7A 4Y2PA 2RHWA 4LXGA 2ORYA 1MN6A 1XZDA 4MWSA 1JFRA 3I1IA 4OPMA 2ZSHA 1U65A 5T4FA 3QVMA 2HADA 5C8XA 4Y2YA 2WTNA 3A6ZA 1G66A 2BUAA 4U2CA 2C5FA 2PSHA 4DMCA 3DOIA 3R3ZA 1LPNA 2B4KA 3QPAA 5AO9A 4FBMA 3O4IA 4ETWA 1JMKC 1HQDA 3PF8A 4EZIA 3QYJA 1CUFA 3LCRA 4I4CA 2ECFA 5CH8A 1W75A 2ZVDA 1YA4A 2I03A 1W76A 2PSDA 1WCYA 4DSZA 1FFEA 2GBIA 2XQGA 4C6HA 5HF8A 3WK4A 4X93A 1CRLA 5AM5A 1YB6A 3VJMA 5JZSA 4P9NA 4XVCA 4FLFA 5ALJA 2OCLA 5ALHA 1YAJA 3C43A 3OG9A 4G4IA 1QO9A 1QZ3A
chains in the Genus database with same CATH superfamily
3OJCA 3OPXA 4BCDA 4V38A 1JAZA 3IBYA 3V4RA 3Q8KA 3F71A 4KO3S 1WPXA 1YVRA 3TE7A 3FWZA 2QUJA 5DYYA 1JX6A 1N75A 1XK6A 1AZSC 2E3JA 3KBBA 1BDMA 4QVKA 1N5RA 5K4GA 1GQOA 5H3CA 1WBBA 5L6MB 2AT1A 4XD7D 5TLSA 4WXEA 4P1ZA 2PTHA 4PR0A 3LX6A 1JHPA 1X1QA 3LAWA 2X9VA 3QV1A 4ZAYA 1DQYA 4EI2A 2IOFK 3GRZA 1OYVA 4AXXA 2HCBA 2F1OA 2UZ0A 2WHRA 2YYAA 1HE3A 1USWA 1NC3A 4G25A 4QG7A 1M2OB 3D6NB 3NT5A 1PGNA 5H3LA 4LXXA 5IZCA 3EQZA 4I55F 3OZWA 3QLVA 3DZHA 4GYWA 3CU5A 4A1FA 5CBPA 1I9CA 4OQDA 4TKLA 4FYWA 1IK4A 1M1YE 1WEKA 3QVVA 3OZRA 1LK0A 4WKCA 3R74A 4YUAA 2JLYA 5FDFA 1NW3A 4XA8A 3DLHA 4G41A 5JSYA 4KCGA 3HEBA 4JSTA 1PZMA 1CY0A 4MYRA 4XYGA 3U48A 4HWRA 4AMUA 1CS0B 5K8CA 3N2NA 2W6ZA 1KEEB 2C4NA 1WIWA 2DQ4A 4Q66C 1ZITA 2QE7D 2Q8NA 3GWZA 5EVCA 1YZHA 1C7EA 1V9CA 5EWMA 3PR2B 2RK6A 4P4GA 3W8DA 1S6YA 4RVDA 3PNPA 4BE9A 1HLFA 2OV1A 2X1VA 3BSFA 2KJQA 3NBKA 3OIFA 4MXDA 3VR2D 1W1IA 1BQ4A 3QEJA 3KR0A 2XF2A 3ZD9A 1BD3A 4FIDA 3C3CA 1R6UA 3VZBA 3K35A 4U7DA 4LUCA 5AOAA 1YL6A 1OLXA 5HBRA 4DMUB 2CLKB 3PUIA 3S70A 3P5SA 3X1WA 5LQNA 1JBEA 1U9JA 2N3ZA 4F84A 5M5BA 3GJ7A 1E1RD 4Y1RA 1PNQA 3JQFA 2XCSB 2B37A 4LF5B 2LPMA 5TQJA 3W5BA 1L4KA 2J08A 1OV4A 4QNRA 4LC9A 4YV0A 3KVNA 1B41A 3LP8A 3ABIA 4WK0B 3RT7A 4WXMA 4NYIR 2UZ3A 4HWSA 1TUBB 4YUVA 4FFBB 5AJVB 1ZN2A 4ZP1A 4BBZA 4BO6A 3AFOA 1D03A 1NC1A 2C3OA 2C4UA 3FPGA 1M8JA 5BNTA 2FU5C 1ZVQA 3N9IA 1HKUA 1ULBA 3EN0A 1P1IA 1NIPA 4FEEA 3PKJA 4N7BA 4OSPA 4P8RA 1AY0A 1V6SA 4PZ9A 4G9GA 1EDDA 2JHPA 9MHTA 3NWEA 5CG2A 1UPBA 3GEBA 5TDHA 4MRMB 4EI9A 1BDHA 3QJ5A 2FV8A 2QP9X 2XRYA 4QFCA 5AVKA 3FPBA 4OBBA 2X3FA 2WZQA 4DW8A 4PTZA 5D51S 4V0OA 4QJ5A 4B3CA 4V0MA 3TECE 2HHLA 1HNNA 3LDGA 2JCXA 1OLUB 1GZSA 4AQ7A 5EIXA 2VJBA 4PLVA 1XZ8A 4X1YA 1CZRA 1ZOLA 4FYXA 4XYBA 4ZTBA 3TZEA 2BISA 4QKQA 3ROMA 4LZWA 1XO1A 4KREA 3EVAA 1H2EA 3JVEA 1Y37A 1KPGA 4IQ0A 5EKTA 2V59A 4FT4A 4CQMD 2FZKA 4ND7A 4YQEA 5JXHA 3K0AA 5A3SA 3LVFO 1R15A 2ZCUA 5WRFA 2R8PA 2J3JA 1PF7E 1OZAA 2PA0A 4WK2B 1QONA 1WZCA 3I64A 3KR2A 2CHGA 3AX6A 6AT1A 1Q83A 2WU1A 3Q3CA 4LJ8A 2F90A 1XV5A 5CNMA 4AUNA 1UM9A 2G04A 3O7MA 3VYSB 5I7VA 4LDQA 4HZIA 2F2TA 5DBIA 4E3WA 3GFRA 1M6NA 3WRXA 3A6FA 5F12A 3R8XA 4R16A 4E03A 4MQFA 1GCUA 1Z0UA 2YCBA 1Z6PA 2PVPA 1NDUA 1ZRMA 1CR0A 1O97C 2YZGA 4TTPA 2EFJA 3IJRA 2O0JA 4L6CA 4UEOA 5JXGA 1QHGA 1KYYA 2FRVA 2J1LA 2NQTA 2NWQA 3PLRA 4NYMR 4JJGA 5EJ5A 4WLVA 4WK4B 2KS6A 4Q4AB 3OM8A 5E4FA 2FOLA 3T5CA 4QOFA 1X80A 1B16A 1DDIA 2X1HA 3K8OE 3KZCA 3BGOS 1ZOPA 3QNMA 1LFDB 4M36A 5AKGA 5TIIA 1OROA 3OWHA 2IHKA 4ZQEA 1OMOA 3CE9A 3WL5A 1TEVA 3ER9A 3C3BA 4QDOA 3UN1A 5DISB 2JL1A 2J0UA 1KSHA 2C88A 4D96A 2FFAA 2IDJA 2ZI7A 1WXHA 2WE7A 2JEZA 4PRKA 3KPVA 1Q1QA 3BTUA 1NI4A 4NU5A 4M9RA 4TLAA 3OT4A 3FMOB 4GMDA 3VZDA 4EVSA 2CUNA 2WAYA 3U7IA 3GARA 1P80A 1R74A 4EM6A 5JNVA 5K20A 1SRRA 5L95A 4Z4FA 5BR8B 1QX4A 4I4IA 4KEAA 4GMHA 1UP6A 4Z0PA 1QO7A 4BV3A 2ZWVA 1TQDA 2ZM5A 4RLQA 2VZEA 4WE3A 5CK4A 3EFOB 3RW9A 1ZUHA 1JIQA 3GBPA 4XLLA 4LYDA 4WASA 3CW9A 3H7AA 1JDJA 3I9JA 3UZUA 1RLIA 3TLBA 4RAQA 2GTHA 1TMGE 3BAZA 3IKLA 2NV0A 3DBOB 3EF3A 4U1RA 4F92B 3PDJA 3DKIA 3AHHA 3NP7A 4HVTA 5AVZA 1GHTA 3JALB 1GGJA 3IV9A 1YZGA 3P0EA 4JJ7A 4F3YA 1M2VA 2JVJA 1BZYA 2CDAA 4ZMSA 2HBYA 4OXNA 3UUEA 3GI1A 3LHDA 4JQZA 1O9GA 2XDAA 4LOIA 1VSQA 1WB5A 2PT6A 3ACDA 3CWCA 3HBNA 1CWUA 1W5SA 1MC4A 1WZUA 3LKBA 1NFQA 1ZBDA 3Q7SA 5IZ4A 2I4LA 3PE4A 4JLAA 4WKOA 2DMRA 4ALLA 1KWKA 4AKIA 1DWPA 4JP1A 5TV2A 4YAKA 1XZNA 4NG4A 5KTSA 4J9VA 4MJ7A 2DSTA 5BSWA 5JFTA 5GINE 4RTRA 4OHYA 5D2CA 1UT5A 2WKWA 3L7JA 4TMKA 3U1TA 4BVLA 5HCUA 4AJ1A 2OK7A 4RMGA 1IIBA 1Z82A 1GNTA 4HG2A 2FLWA 3PGXA 4MK4A 1HT3A 4Y67A 1A98A 3LBYA 4RX1A 3N70A 2LIPA 4ZRNA 3UAVA 3DFKA 4BMPB 4BNJA 1M5UA 1IUOA 2H7XA 2WUDA 3DZGA 3ETHA 3MTIA 3ADPA 3A70A 2PA3A 3DF9A 3B1FA 3QKRB 4QYSA 3HABA 2N47A 1WXXA 1XG5A 1EDOA 2VHUA 3D4IA 2AA3A 5DTRA 4EZBA 1QPZA 1MHPA 1TM2A 1MV8A 4FQ5A 4OM7A 4IDEA 4ZXFA 3WMGA 1EHCA 2XKKA 2BKVA 1KSFX 5I9BA 3JD3A 3LA6A 1O58A 5L3SB 2RI6A 4RFLA 1MW8X 1AXRA 1QH8A 2FKAA 5GVSA 3F6YA 5TQVA 2CD7A 3B13B 4L9RA 1VI5A 1Y34E 2LIVA 3STUA 3RQIA 2ZRBA 2CMHA 4RHCA 3BXFA 4NK5A 4TKVB 2ASEA 3CR7A 1YVUA 4YB8A 1GRRA 2OGWA 3WGTA 1BXRB 1C4OA 1I4LD 4HDRB 4KPUB 3R2JA 3NIFB 4R71A 1HDIA 1A04A 4X63A 5AVTA 1X0XA 3QY9A 1EGVB 2XV1A 3NM5A 1B8UA 5JFOA 5FOSA 2PD4A 2JIPA 4YI5A 3OQIB 1RQ2A 1RKVA 2ZRPA 2OVBA 1X1TA 4KP7A 1F4LA 3BILA 3WK5A 4JBNA 4LWOA 3KSRA 2FSSA 4IGKA 4QIHA 1BKYA 2H5JA 2DU8A 2JGFA 2V4UA 2W90A 3C1TA 4FFSA 1XVUA 2OC9A 2YZMA 4NMXB 1N2OA 4DTCA 3EISA 1D9XA 1V3VA 3UKOA 3F8WA 5DDIP 4O63O 1TJ5A 2JDIA 3RJTA 3KKKA 1YXMA 3I5UA 5JARA 2AD5A 3KZOA 1AQYA 5E7MA 1MB9A 1E7QA 5C53B 2YJ6A 2PR7A 5ARBA 2H1RA 4NFYA 2QL9A 2D1TA 2RCYA 3WMWA 4WH0A 1IY0A 1NQOA 1ESEA 1P5FA 2F3PA 3R0JA 4G85A 2FSGA 5IH7A 1EYZA 1MW9X 5JALA 2BZ0A 4QLOA 4PSKA 1G64A 5KB3A 3L6DA 4L5AA 2F9FA 5GQSA 1SVIA 2GH1A 3JU3A 5TS2A 1DO8A 1PGOA 2AXPA 4JI3B 2P2ZA 2R5FA 4K46A 2QRVA 1KH3A 3JQ8A 3KR1A 5DPMA 1KHHA 1YRAA 2NACA 2AVNA 1GAEO 3EPPA 3ZEIA 2QL6A 2QLNA 4BNGA 5JR3A 3AOEA 4XX1A 2VAPA 1I4EB 1II8A 1SEVA 2V5UA 3HB0A 1JHDA 4LJ4A 2CFIA 3JQ9C 3BHMA 4RH0A 5EZ5A 2XRMA 2OHIA 4ML3A 3N8KA 2BGMA 1D7AA 2XVYA 4X3CA 2BRUA 2I76A 4KXFB 3UV7A 4RKFA 4OA8A 3M8KA 4I55A 2RHOA 1U8AA 1KKMA 1XEAA 3B3QA 4HZUB 4N03A 1TW3A 4WA8A 3W1EA 2WSLA 5A9SB 1N3BA 3WYEA 2OCPA 4AQDA 4MDYA 1EGAA 1II0A 4IJ6A 1MP0A 1QCZA 4KR9A 1DRUA 1C29B 1KZ1A 3QUTA 3W5UA 3SJZA 3K0CA 2IY7A 2QZZA 1DQSA 1FPMA 3CKMA 4ZDWA 4GDMA 3QH4A 3NJRA 4JJ8A 1YJCA 1FUUA 1AQUA 2DQKA 3MFYA 2W98A 2FX5A 3IUSA 5TMEA 1JU4A 4A91A 2P2LA 4EB3A 5T64A 5CVCA 1GADO 1M6EX 1V96A 3VAAA 3H6HA 3FH0A 2UZ1B 4EFLA 4FNGA 2XB2A 1P0FA 5DCYA 5M34A 4W7SA 5JU6A 1LVUA 4FYHA 5IPFA 1Z2PX 1TQ2A 3U7GA 3SQMA 4GLBA 2B5OA 3KB8A 3PNLA 1EUQA 4R9RA 3K32A 5EIBD 2O7NA 3KT0A 5EUBA 3FYCA 4EABA 1JQEA 2BF7A 3BDVA 3NBAA 5IJWA 4HLNA 4M55A 1EVIA 3LCMA 2Q0XA 3K5IA 3B1KA 3UENA 1UBOS 2GX6A 3BRCA 4EKYA 5BOSA 2ZRNA 1PNTA 3DB1A 3E22B 4N41A 3KFLA 1YFLA 4OX9Y 1XD8A 5EIWA 3PHCA 4C4RA 3LP5A 1R3DA 4HQ0A 3JQFC 4D4LA 5A03A 1E1LA 1DAPA 4MV5A 1H3FA 3DP7A 3HB7A 3HJRA 1SKAA 3KHSA 4TX1A 3G0GA 5ALXA 2VAVA 2HRCA 3WFIA 1PQPA 3IELA 3KWFA 1T8YA 4HMPA 4IRUB 1Y5IA 4UBOA 1GY8A 4XGQA 5FQNA 1UP7A 1OTXA 1Y4SA 2VDMB 2VYQA 3PEUA 2FWMX 3LSTA 4X54A 4TSRA 5JMOA 4OLJA 1QIIA 4XD7A 5HJEA 3GZNA 2ZP1A 3P4YA 3ZZNA 5JG7A 3PHIA 4D6YA 3AFMA 5A4DA 1EDEA 3UGTA 2GPWA 2VQDA 4TZTA 3UK6A 1SBNE 3D81A 4TTJA 1R4MB 1J5XA 2RHDA 1SO8A 4QPZA 4PQGA 2JGDB 4NCJA 1JPUA 2A78A 3HADA 3HLKA 4XRRA 4BQQA 2QTAA 3R77A 1M8FA 2MSNA 2EBUA 2FXIA 5AXCA 5K3AA 5JEDA 4I66A 5E0KB 1VL5A 1IBKB 1GT6A 5ARCA 1C2TA 5GY7A 2OYCA 2QD5A 1SUEA 1VMEA 2HTEA 1X1EA 2VEDA 4FNAA 4NJOA 5A0FA 1XR3A 1UAYA 4R9NA 5AJUA 3NW9A 2JARA 3U0VA 3GLHA 1U4NA 2CN1A 1WLYA 2VDUE 3K9BA 2COEA 3ILVA 4XXHA 2PMEA 1JIVA 3R7SA 3GLGB 3NUQA 4PG6A 2IF2A 1NDHA 4ZOBA 2EKLA 1UJ2A 1JR4A 1XD2B 2QE7A 2AXNA 5ENVA 4F7WA 2QRPA 5EQDA 4US0R 4G5YA 3HS3A 3VR2A 1X7HA 3QUSA 4LSWA 2RKOA 4AJ4A 1ISFA 3K6JA 1RXUA 2Q49A 4I5IA 1N7JA 4QGAA 2XVXA 1NUHA 3K9CA 4H1UA 2QUZA 4OLFA 4RANA 1B8OA 5AKKA 3ZV4A 4AKSA 4BFSA 3PUWA 4Q9NA 2HHHB 5AI8A 2ZSBA 3G2MA 3T38A 2B1RA 2PZFA 4CIDA 1MKYA 3EA5A 1E1RA 4N5HX 4PS0A 2LE0A 3HZRA 2HI0A 2BD0A 2CL7X 3FOWA 2IPMA 3D9QX 5K3EA 1RQRA 1V45E 2QLMA 1VCNA 5EHGA 1OGYA 2HZ7A 5FTWA 3HCEA 1BE1A 4HDCA 1XD9A 3BHJA 2FPIA 1Z5ZA 1QGAA 1A8HA 1U3VA 1WB4A 1BDIA 4MIKA 2Z56A 2QM0A 9LDTA 3C45A 5LD2B 4OSEA 4LI3X 5TXGA 1GGEA 5IANA 4I36A 4KO2S 5IVPA 5TB5A 2J0SA 5J5CA 5LU9A 1ATIA 4COOA 3KQPA 1FFGA 2GPNA 2WJAA 3GRKA 3HCPA 4LIPD 5IKXA 2XIQA 4TLBA 4KQ9A 2DTDA 4JZKA 2O19A 3H05A 4YRGA 1Z35A 3TW0A 4PPFA 3H6KA 1G3MA 5FO0A 5JW6A 2DHEA 4C0XA 3G9QA 3T5PA 4KV9A 4KIGA 4KUGA 5AJWA 4MUGA 4NZMA 3RUFA 3TW6A 4AB1A 1EFPA 2NZJA 4JB3A 1RPZA 4R7TA 1P7VA 1TZBA 1O6ZA 4GZ3A 4IIYA 1JW9B 4YMIA 5JSFA 1XJ0A 2WU8A 2ORIA 4KN6A 2C7OA 4YRNA 1EVKA 1S3IA 1Y0BA 1NSYA 1ODJA 2GZHA 3T95A 4CQMA 1TO2E 5I01A 1N9KA 3ND8A 4Q7MB 1CT9A 1N57A 1IN8A 1T2DA 3AIKA 4RKRA 2X0EA 4B46A 2O8VA 3LTNC 3O4GA 3QU4A 1P3Y1 2OCBA 3A1SA 3KKMA 1K2VN 3ZQUA 1JLLA 4BP1A 3DR5A 4N01A 3R9KA 1CR6A 5AHOA 2QR5A 4E1VA 3LCUA 4FE4A 1R8YA 4X65B 1Z6QA 1CUDA 3GJ3A 3N59A 2BTOA 2HZBA 4EKDA 1NMQA 2V98A 1VFPA 2Y2VA 3LUPA 3RTAA 3UKJA 1EPUA 2FSFA 3C8UA 1Q84A 2FW7A 4HPJB 4RE6A 4JX8A 3TRKA 3WOVA 3ZV5A 4QJ4A 4FINA 1G5FA 4URZR 2JBHA 4B0PA 3M6IA 1I4DD 4EKGA 3LUHA 3R1IA 4B1FA 4A03A 4DJDC 1BWQA 1GXSB 2NPOA 4IWXA 4L0MA 3GDWA 4UCWA 1ZJZA 5KTPA 1FDTA 3EMKA 4M9XA 2FK7A 3UHFA 1FTWA 5L4LA 3CW2A 1EDZA 4GNRA 1X7YB 5E95A 5I5EA 1DKUA 5CH5A 2GJKA 2VF4X 4GOJA 3TLMA 5AXBA 4B8WA 1ID8A 4N0MA 4QICA 1M5RA 4LPKA 4XCXA 3PITA 1QP7A 2LZ0A 1XI2A 4NJEA 3R7WA 1Y82A 3A3PA 3WLPA 2FCAA 4EARA 4XLTA 1SEPA 4E5SA 1C0PA 2PU7A 3GLGE 2VC2B 4PG7A 2ZYRA 4BRWA 1OILA 3FLMA 1UMKA 3L0SA 1IU9A 4MPRA 1GO2A 1ZONA 1Y5MA 3GOQA 4JA2A 3GLIA 4KJZA 2BFBB 3ICVA 4ZK6A 2C2KA 5AD1A 2IYVA 4HAVA 4NSNA 1Z73A 3EUFA 3O21A 3GD7A 2LGJA 4LJSA 4REQB 5JJBA 4DB4A 4RMHA 3ESRA 4AMYA 3HWWA 2QN1A 3GGDA 2F1RA 4NYIQ 4WECA 4LG1A 3WGLA 4Y2GA 2FG6C 3ZCRA 3B52X 2VH2A 2AUMA 4PHTA 2A1TR 4MYUA 1UMDB 1YZNA 2QTMA 3UC5A 1U8CB 4EITA 5JC1A 3R20A 1US8B 2Y4NA 5LM3A 4A0HA 3H84A 4JQSA 1SA0B 4OU4A 2IS4A 1EVQA 1U7ZA 2X9NA 4TL8A 3P71T 1SIUA 1FP2A 5GV8A 2QAGB 3AR8A 1IMOA 4R2IA 4BVAA 3GLQA 5JWHA 4RY0A 4W1QA 1KH2A 4R1PA 4ZI3A 4L5JA 3EXAA 4MUIA 4OQXA 3TEJA 5JCOA 9LDBA 4HC4A 1SXJC 4TWIA 1YQTA 1C9YA 2PJZA 4DLBA 2GNOA 5EKSA 3S1LA 1WOYA 3T9DA 2HEIA 1L7PA 1OOEA 5D85A 4CPDA 2CJWB 2VYND 3U1VA 2ZTSA 3O26A 4J03A 4KSYA 3NT2A 1ZAKA 2PD6A 4DV3B 1JUDA 2LKDA 3PA6A 1E6EA 5F5XA 5ICFA 2D1YA 3ETCA 3RVLA 4DQUA 4EGQA 3JVDA 4Q3KA 5E7JA 2QTVB 2VF8A 3A6EA 3ORRA 1H6CA 2WV7A 4G9BA 4HS9A 4MMYB 1QCYA 1Z47A 1CDOA 4M0CA 2IHTA 2PV7A 3BQNB 5AFSA 2CDBA 4RVCA 2PO5A 3E18A 1L4EA 4CKWA 5CBKA 1AHPA 1FRQA 3QI7A 3PK0A 5DLPA 3RIEA 1YDMA 2NG1A 4AJNA 3BDIA 3C3KA 3D3JA 1JHQA 3DSRA 4CQMB 4BQIA 4AM8A 1P9LA 6Q21A 1ORWA 1TM1E 2PZBA 3MOIA 1R66A 4E08A 4Q37A 2IYQA 4M88A 5BN3B 2GYWA 3HYTA 4N6NA 1JNXX 4LZNA 2IS6A 2I62A 1KJZA 3EIFA 1EFUA 4OHFA 4NYMQ 1FVOA 4U2FA 4H60A 4Q93A 1QHIA 3VHXB 1CF2O 4LHSA 4PM4A 4KSCA 3PDUA 4XWOA 1PEDA 4FGLA 4R01A 4Z54A 1MQSA 4IO0A 2B94A 1X38A 3IH5A 3QELA 3WHPA 1D9ZA 3T0IA 1YZFA 1IQPA 2NO5A 3FFWA 5JFGA 5KYYB 3IEIA 1N0IA 2YV3A 3SZ3A 5F4ZA 3ENNA 5T6BA 4HTAA 1Z3CA 2MSCB 3TWOA 4D74A 1EMDA 2EZUA 3KYJB 4PSVA 1G8FA 1ZYUA 3OICA 5I5GA 1FVHA 4QXPA 3R8CA 4EOGA 2XVZA 2VR1A 4ONEA 1L8AA 4QU5A 2DPGA 1USGA 3EC2A 1K27A 4YT4A 4NJMA 2INGX 2A35A 2PWZA 4RK6A 2ZJYA 2XKBA 1S4MA 4R40A 2EQAA 3M5PA 4B74A 3LVRE 3BTVA 3M6MD 4R8RA 5JJLA 4NU6A 1DCKA 1Y7HA 1R0RE 1RJGA 2F8MA 2ZKLA 4MI1A 2QVGA 3S1AA 4L51A 3BJZA 4RTMA 1AKRA 3K8QA 5H81A 4W5OA 1YOVA 3W90A 3RVOA 4MCJA 3OLQA 2C83A 4JLSA 4TS3A 4WMLA 3RWBA 2ZYTX 5K0JA 2PBRA 2Q2OA 3UPUA 3ZDAA 1ISRA 4A27A 3PEYA 1BXGA 1QYIA 4PPQA 2PGLA 4S3MA 1BGVA 3T12A 2WK1A 4B2LA 4C08A 1VJCA 2RJOA 4ZOEA 3RRNA 3U61B 3CLUC 3IPXA 1NULA 3L7KA 3G5AA 1OFUA 5SY9A 1W5TA 1KDRA 1G21B 2WUWE 3A6LA 5LQSA 1FE8A 4HRXA 3TIIA 4FBLA 4DLRA 3DE6X 4IUBS 4NX2A 3CLRD 1T6ZA 5EKXA 3OJOA 4ZDJA 2CYCA 3NWBA 4B3RB 3HSYA 4OYHA 2IYFA 4FONA 2Z2YA 4RGVA 4DMFA 4UHJA 1JG4A 3X0DA 3F5QA 4BB6A 3N2GA 1NV9A 2J7PD 3IT2A 3WGVA 6CHYA 4R7GA 3FTFA 1T0JB 2CXXA 3BWYA 3MMXA 3O4HA 5BSTA 1HT1E 3L06A 1SXIA 1XCOA 4BU0A 2G28A 5M04A 3NTQA 1T1EA 3PRKE 1KQNA 1UBSB 3MT8A 4OXIA 4BX0A 5EZ6B 2QMOA 3UAZA 3UG7A 2ZRGA 3S8YA 2AJ8A 3OTOB 2XNKA 3PU6A 1WUJS 1I3LA 1UMBA 1HX7A 1Z2OX 4JI6B 3CXUA 2RK4A 1WUYA 3IDOA 3NQ41 4IIHA 4WVFA 3JYPA 3NHUA 2HYIC 5TQ0B 2NVUB 3V80A 3RM3A 3HDQA 5I3ZA 5JAPA 2IBSA 2EP7A 2NU9A 4QGHA 4II3A 1G5QA 1RWXA 1ZUD1 3BMCA 2O8CB 1QFZA 2VQ3A 4HEA6 4NZOA 4AZVA 4BWYA 3DMPA 3DM9B 2DCMA 3C1OA 3EVGA 1YCHA 1SUAA 5JPCA 1GZVA 3PJEA 4BFXA 5J47A 1UANA 2IDKA 2PH5A 4DQKA 4BXOB 4EB6B 5D1NA 1DXOA 3HKCB 3WO0A 4EG6A 2IVZA 1GTL1 4INOA 2JIZD 4HQFA 1NURA 4H7PA 3HEAA 1JALA 1ECGA 2IUYA 2Z8YM 1Y42X 5JBQA 1WQ4A 1RDFA 4MZXA 2ARKA 4YYEA 4BVFA 1MOSA 4QAJA 5K7SA 1SBHA 2PBLA 4WBSA 1JG2A 1KETA 4IXMA 5F7OA 4BMXA 2Z5LA 3MGGA 1D2NA 1KI6A 3NDPA 3OU7A 3QOXA 5ECDA 3P1JA 1A96A 2C58A 2EDCA 2V8OA 4OHUA 2H5IA 5LYYA 2AOWA 5B57C 3H2SA 4K9KA 1XRRA 3GZJA 4D2IA 3E5HA 1YB7A 3WYGA 2D2FA 5ITVA 2HO4A 1HZZA 1H6DA 3CEAA 2YVKA 1IE3A 3ZLBA 3NEPX 1U6KA 2AQKA 4ZFNA 2KWIA 3EY4A 2QVBA 4HLQB 2RGWA 4EG8A 2CLSA 3P26A 5HQ3B 4B84A 2I99A 3ELUA 4FW9A 1TYEB 2YFQA 2XCTB 2ZTLA 1R00A 4D9CA 4ZZ0A 1DV2A 3MGKA 1L5RA 4QQKA 1ZLYA 3N8GA 4DJAA 5DX8A 4RD0A 2DBQA 3KFXA 2A9FA 3EXHA 3D2CA 3RRBA 3I9V1 2XMPA 2G8NA 3II6X 2X8JA 4CTNA 2A9QA 1JSCA 1YJ8A 2ALJA 1KARA 3CRW1 3DO6A 3D8BA 1SBIA 4FZVA 4YRBA 1T26A 1T3HA 5A5DA 4HCJA 3R0IA 4JFAA 3KKNA 3QU7A 4U2EA 4U02A 1V7CA 4W82A 3RTBA 3ITDA 4P7FA 5EGNA 4MDFA 3GPBA 1UPCA 3TSZA 4GPAA 1CNEA 5CFRA 4ARBA 1R5NA 2D8AA 3H8SA 4GGOA 3W78A 1CEXA 4D44A 1ADGA 2ZVQX 4HAXA 1M66A 2DP4E 2ZJ0A 2IYLD 2ZSUA 2O06A 2ZUFA 3E8MA 2QW0X 3H5RA 2WIAA 3AR4A 2WFLA 2Q3DA 2ZUSA 3VPBA 5IXSA 4W7IA 3F3YA 5FBVB 3CB4A 2P5TB 1DWQA 3M83A 1HPLA 2V7GA 1QV7A 5HS6A 4GXTA 3Q5GA 1MEOA 1ZMTA 3FETA 3VNVA 4WBNA 5HJ7A 3S55A 1YCDA 3HYLA 4W9NC 3SM9A 3F5MA 1G21E 4IFBA 3K6SA 1EJ0A 2OD9A 1IXRC 4GPBA 1AMUA 3IUQA 5JJKA 3W5VA 4IJUA 1JL3A 3IBSA 1GNVA 1VLHA 2VP6A 2WUGA 4HLUA 4MWOA 3USCS 2NZ8A 3VV2A 3FUUA 3VX4A 3ZGYA 5E6SB 4N0DA 3MXOA 2QRLA 4ZCRA 3ZD6A 4CVNA 3BX1A 4DV4B 3O8QB 1U5CA 4NCBA 2GZRA 3E61A 3H9BA 3DZCA 3S2YA 3ZZ1A 4AN4A 3SBOA 1NKTA 1PVDA 1YO6A 3EOZA 4QFDA 4RHEA 2QQGA 1J0CA 4A0FA 4D6PA 4WCFA 2P0YA 1H4VB 2Q5QA 5BMVB 4DR3B 5IVIA 2DZDA 3ZDDA 1FFXA 4PG4A 4OL9A 1ISJA 4BVEA 2VFAA 2WJYA 1SELA 1A9PA 2BF4A 3TOCA 4CNQA 1DJLA 2FA9A 3DUFB 2I6GA 4YQYA 3VPGA 1K5HA 2JHAA 4P3PA 1EB8A 2CUTA 2L42A 5CFPA 4DLZA 1CQPA 4FHCA 4TL7A 2IGTA 1KA9H 1MABA 2QAJA 4I08A 4XX0B 4D9HA 3MNFA 4KDFA 5KTNA 5JYBA 1Q17A 1K0UA 3LQ1A 1W94A 3ZGOA 1QFXA 1ML3A 1G6KA 2QYTA 3RRMA 4BHTA 1I2DA 2GFHA 2HSDA 2O23A 1H2WA 5LLTA 4IH4A 4JJAA 3RS5A 3C5VA 4AZ0A 2ESRA 3G79A 2J59A 2MIIA 2QG6A 1WBJB 5JRZA 4L4YA 1PWEA 4PCVA 4DMRA 3OTIA 5AH0A 4CTOA 1ECCA 1V16A 1C0IA 2H2FA 1HG0A 4Q3CA 1QQTA 3OJ0A 4UZFA 4BC1A 2OCAA 5IMBA 2GGSA 4PO3X 4QTYA 5JYCA 4RLFA 4NEGA 2EW1A 1XCJA 1HOTA 2WWIA 1F48A 2OHFA 4AF6A 2X0DA 1PHPA 1K08A 1E3DA 2YWFA 5BNWA 4AU1A 3LCJA 5TY0A 3HYNA 3UW3A 4U6NA 4BAZA 3IXLA 3EF1A 3KALA 3LO5A 4XUEA 5JSZB 3VR4A 2BP7B 5J3JA 1QPGA 4MAMA 1HWYA 2CV0A 3WADA 1BIFA 4TKMA 1NLMA 2FPGB 1U31A 2H7YA 3OFSA 2UYQA 3MWDB 5DGCA 4OOEA 2G07A 3T3HA 4AIRA 3PFKA 1GVNB 4V3BA 1Q3TA 1RT9A 1R8XA 4JXJA 1GFIA 4CF6A 1B2RA 3N8DA 4DWOA 1DXHA 2AZTA 3GO4A 4DV2B 3B12A 5AI5A 3MLAA 4NZNA 2VTEA 3ELWA 4TVBA 3CSUA 3BA1A 4MUHA 3T3GA 1T9CA 3PVZA 3DVQX 1CY8A 1G1MA 1OT5A 2WKQA 3GH3A 4I2VA 1F2UB 4O1HA 5CDFA 4KJXA 2QW8A 3ZNOA 2Y0EA 2JLXA 1N6OA 2C8JA 2G6BA 3B1YA 4CN8A 3BH0A 4F5EA 3UMYA 3ZJVA 1CQIB 1GGFA 1U0EA 4L5CA 4O4HB 3LS2A 4JB8A 3A4TA 5E6RA 3WGKA 2BFEA 4MS4B 1O7JA 1M2GA 3TXYA 1C1XA 5BR7A 4HBGA 2DHQA 5AKYA 2WKRA 5FOUA 1RC1A 4CM1A 1UJ5A 4B17A 1B93A 3N07A 4LRQA 1KAOA 2CEKA 4LHXA 3Q2KA 5AUOB 3MS2A 1FX1A 1IOWA 1E3WA 4ER0A 3OWXA 2E7ZA 3K9QO 4KXLA 5HM6A 5JZ9A 1Q19A 4KACA 5BORA 2Q8QA 3R7WB 2V6BA 1ULTA 4YIKA 4LF9B 3K0FA 3JATA 1YCGA 4FFNA 1E5TA 2GKOA 5FADA 4UPVA 1B0PA 4ZVKA 5CLLA 3UT0A 4EUKA 1JVBA 2O3QA 3EAGA 4O2AB 4X94A 2NX2A 2K7ZA 1X13A 3QE2A 4NS1A 4BCBA 4Y2RA 1Q6ZA 3OFVA 3TD9A 3C3PA 2BEVB 3AUJB 2XODA 3KAKA 2QJTA 5IASA 2ZJ3A 2BJWA 2C2MA 2P90A 2IEAA 4K6HA 4PU0A 2C0PA 3EJ6A 4C05A 1L7XA 3PNBA 4RVHA 3AK4A 3L7LA 3ZKWA 2WTUA 1N34B 4L4UA 3KLBA 3K1AA 3DHEA 1ODKA 1ISPA 4AJOA 1F5SA 4DZZA 1MH1A 3EIUA 5JBNA 2JG3A 4W5WA 3ZBQA 1R4NA 3U3XA 2HSEA 3F7TA 3ZWCA 1EBBA 1RLOA 1BW9A 3QVKA 1D4FA 3VVCA 1M6VB 2GK6A 2HU5A 2P3SA 3DM5A 5ALTA 2DBVO 1N7GA 5EJ2A 1JJBA 4HBZA 1Z0SA 2ZYWX 2P27A 4EENA 3CX7A 4F1KA 3KPYA 1U3CA 4Y6GB 5CVEA 4A8PA 4B82A 2ATEA 2VYNA 3TQRA 4F5DA 5IWAB 1D1QA 3M9WA 5DYWA 2RIRA 1E7WA 2Z58A 1TJ3A 1PZFA 1XEFA 2PEYA 3IVRA 4LJ7A 2A0WA 1N9ZA 1AK1A 3IVGA 3NHMA 1RRVA 4YP5A 1AIPA 5AVOA 4M7PA 5LUBA 2I8AA 1WD5A 3B38A 4OHBA 4UNQA 4DSNA 2HSJA 3LFUA 4IZIA 1X7WB 1Y4AE 1J7KA 3KTFA 3P0FA 4TWJA 3NM4A 4CCYA 1JKJB 1A88A 1OVGA 2AMJA 2P8SA 1H42A 3EZ9A 3LPMA 3U3KA 1L4HA 2NIPA 5EHZA 5JPDA 2M2IA 3CBQA 3WIBA 3PYLA 4LBVA 5LQUA 2GDJA 3BGSA 3VTZA 2PKCA 2VSNA 3EZ7A 3ILSA 4ZCLA 2W43A 3RYIB 1K8XB 3GGJA 4MP6A 1RYYA 2FZLA 3IVAA 4EPYA 1M8PA 2W2LD 4C0SA 5F9FA 4JNCA 4HMOA 5K8TA 1FTQA 5T4BA 4D4MA 1L8OA 1EZ1A 3GA0A 3HI6A 5I9IA 1ZAYA 3VYUB 1RACA 2IYEA 3AUUA 4YCNA 4WLEA 1MFPA 1BTOA 3G5LA 1E6UA 1NM5C 3EGXB 4YH1A 1HDOA 3DVAA 1OE0A 1U1IA 1E1NA 3G2LA 3NG1A 4PLFA 3DDOA 4CLEA 3NMUF 3ZDCA 4PRLA 1ETHA 1Z25A 2V9CA 3CLSD 3KVYA 4EFMA 1SOWA 4HRVA 4E2FA 1VE6A 5CFMA 1Z74A 2MWMA 4DSAA 1XTTA 2WJ3A 4P38A 5H7XA 4FDAA 2VSYA 1BWSA 1LQTA 1ZD5A 4X6UA 3AEZA 3BICA 4ROTA 4F8EA 4B6SA 2BV3A 4I8XA 3IQIX 2O8FB 2Z95A 3I0MA 3RODA 3TSCA 3U1BA 2P3QA 5EXTA 1U3FA 4XE5A 4KE7A 2FY8A 3NVAA 3QFCA 4BNDA 1FDIA 3R3HA 2WILA 1CQWA 4CKBB 3NDRA 5F77A 3PQ2A 1HMYA 4NOJA 2XRZA 1E1CB 4ENSA 1UPTA 4BAUA 5EJ8A 2OHGA 1SPXA 4AYTA 4EEZA 2GJ9A 1UF9A 4ABYA 1TJNA 5LQJA 3COJA 2QHXA 3DV9A 1NJGA 1F8FA 1N2EA 3TB4A 2ILVA 4FOOA 4CF7A 1ZWKA 5KU1A 4G1EB 1WW3A 3U49A 4R1TA 4ESOA 3BXZA 2ZUBA 1UXKA 3PVCA 1AGYA 3LW7A 2NUPA 4AICA 4PYJA 5EIBC 4EZEA 4BX3A 5K3BA 3UTCA 1M3SA 5U9CA 4XOIA 3ZJYA 1BEEA 3UWPA 3VYTB 1UMCB 4BLVA 4RV9A 2O59A 2IVFA 3KL2A 4JR2A 4A2CA 1FC0A 1ZW6A 4RTKA 3ZGNA 3C3EA 1PJAA 3DLPX 3K31A 1G3RA 1P0MA 1KR5A 2D5BA 3K8YA 3RK1A 1GUYA 1FMJA 4J16A 3W5HA 821PA 1QIMA 4LRSB 2I2CA 3I23A 5JAOA 1Q0PA 1TAGA 1GJRA 1SH7A 1VLZA 2UKDA 2ZS9A 3DZIA 5TPWA 1P1FA 2J7PA 3EXEB 4EO7A 3EX7C 1NR5A 3CIFA 4G8BA 4MHOA 5FEMA 5EQFA 3RABA 4U7TB 5HR5A 4YAUA 4ENRA 3H75A 1YL5A 4F7DA 5HDBB 1N8TA 4G1FA 1AQLA 3BD7A 1M6WA 1O08A 1PT8A 1W96A 1KMQA 3AI7A 1K5PA 3V7YA 1NI3A 3SSOA 2BSQA 2E1RA 3FFAA 3QK7A 2GWHA 2J3MA 2TMDA 2VHYA 1T15A 3DJFA 1BCSA 3KPWA 1VKNA 2NZYA 2Z98A 4IUCS 1CUWA 1ONOA 4ZI7A 5TC4A 4YY3B 2IK8A 3E5MA 1CDZA 1PAUA 3AYXB 3KSZO 4Q4HB 4B31A 1EESA 3IMEA 5BWNA 1QGOA 1TPZA 4DIUA 3FAZA 3VC1A 4TRRA 1JHVA 1XN1A 4EL5A 3L0PA 3U6BA 1Q5PA 1X86B 1I14A 2D4HA 4ND2A 3I04M 5K8JB 2XYRA 3CVYA 4XRGA 2UXBB 1LDEA 1IJKA 1SUCA 2JIZA 1X1RA 2X22A 2JCBA 2BEUB 1MIOA 2ON6A 4KQGA 2H1OA 3P9XA 2TRSB 4A4DA 4IIDA 2CZGA 3BKXA 3UAOA 1U1CA 3KVRA 4X66B 2OFFA 5FWXA 5IDVA 4BYMA 4QHTA 5EAIA 1TCUA 1VSUA 2C3PA 2DUMA 3WISA 3IEMA 2BFOA 4RACA 1W36D 4BY9E 4EFKA 1X92A 3AF2A 4FN4A 1W2HA 4BO0A 4XYLA 1U9YA 1ZMRA 2G71A 4C21A 1E5QA 3KE8A 1N6NA 5FFNA 5PGMA 2PEZA 1P4RA 5IN5A 4YP6A 1B0UA 4W9MC 2D62A 4BWGA 2XHZA 5ALSA 4N6GA 4L9SA 1CUXA 2OV3A 2UAGA 4QNMA 2XCQA 2EJVA 4GPTA 1AN9A 4UPDA 3I2YX 5FFFA 1Q1GA 1X70A 1GPJA 3GNSA 4P33A 5MF6A 2Y0DA 4PFSA 2LNDA 3BWBA 5AXAA 2UUPA 1PNRA 3MRVA 3UQZA 3NHRA 4I3FA 1ULHA 1A4UA 5D3KA 5D87A 4PN7A 3TR0A 2J9FA 5FR1A 2VJDA 4H4DA 4NZ9A 1P31A 1FP1D 5EE9A 3G59A 3R3JA 4P81A 3VJRA 3P2IA 3KQOA 1PFKA 3ADCA 1ZD2P 3T94A 1H3NA 3OAAD 4DGQA 1DKLA 3KPJA 2OPHA 2J41A 3CVJA 4TM8A 4KQFA 1L0BA 3WSWA 4XIIA 2IA5A 4F3KA 4CQLB 4GI3A 1JDNA 4IIJB 2GEVA 2DLCX 2XPCA 5C1PA 1O95C 1MUUA 3DOJA 2FMFA 1MX1A 2H9IA 1BN6A 1CRQA 4JBGA 1REQB 2D74A 2AFIB 2DWUA 4UUMA 3ZE1B 1QH1B 5JAZA 1DDOA 4L72A 4IQFA 3UXHA 3LFHA 1FYVA 3MS4A 1LKZA 2A7XA 3B36A 2X1LA 4EY7A 2GZAA 2SKDA 2XWPA 3G0DA 1GZUA 4YJKA 3V6LA 3KJHA 4AZ3A 3K70C 4RNDB 2PIAA 5F3WB 3AP1A 2RAFA 4RK1A 5I4BA 1F12A 1GGHA 4GR5A 3RIYA 1TLLA 1CJBA 1K97A 4KH1A 3Q41A 1DC6A 1WZEA 3U39A 2K2QB 4FR5A 1J1ZA 5B2FA 2BN4A 3K09C 4E5MA 3O73A 3DW1X 1MORA 4PC3A 1FBTA 4GI2A 1XQ1A 4NPAA 2JFPA 3K9NA 4Q12A 3QI2A 3FCAA 4CMHA 1TKAA 4E4RA 1QPBA 2A0XA 1XROA 1G5RA 2JAUA 3WQRA 4BBAA 1NYTA 4KYUA 2Z2JA 4PXAA 2NXNA 4A0RA 4QQFA 2XUPA 3Q3HA 1IK6A 1U5BB 3F6CA 5FTJA 2MCFA 2YYSA 1N5IA 5BRAA 2XWSA 2BGKA 4XUGB 4Z7OB 4DCCA 1IJFA 3F97A 2HSGA 1K8RA 1USIA 2BFAA 4B4OA 4UZSA 1PJBA 4CHTA 1P72A 1RIIA 1SZCA 1DX9A 3MWEA 1JJAA 3TOVA 2VLIA 1RWKA 2H1FA 1Z8HA 2WD9A 2I4MA 2BHSA 3W5DA 3EASA 1JEEA 2VH1A 1Y5NA 3KUCA 4OUDB 4WESB 4BO4A 4QPPA 2R11A 3ENVA 3A4IA 1CY2A 3O83A 1UL1X 3HKEB 3FFXA 2XYQA 2CLDX 2ZAOA 3C85A 1K6JA 5LQAA 3I6MA 5ILGA 5IVDA 3VDQA 1CR1A 3EAQA 4NMWA 3IHKA 3WLHA 5ITSA 3CUVA 3PSHA 1WY5A 5C31A 1T24A 1KEPA 3QBDA 2OESA 5DRTA 1U0SY 5HE8A 3RJ5A 5KNDH 1IIRA 2WKPA 3GRUA 4PWYA 1JIIA 4ME6A 4JLKA 1H5UA 2L82A 2FZ4A 1FSGA 3KG2A 3KLOA 1Z4JA 5KOHB 1OSNA 1DIGA 2HWWA 4MR8B 2P1RA 3MERA 1XKTA 4ZMRA 5KC8A 5JXIA 3PUYA 5JSQA 1LK7A 3RS4A 5MFZA 3WLTA 2BGNA 4B75A 3A26A 3FTQA 1XXHB 2D0DA 4O3FA 3VC3A 2D1QA 1E8MA 3S2ZA 3U16A 5CAEA 5KDDA 1HF3A 2YJGA 3IPLA 1EX7A 3KLMX 1OLSA 1RQXA 3RC7A 4BTLA 4E1AA 1EIWA 2IYPA 2GEJA 2JHFA 3A1EA 4DPMA 1A1SA 4XSGA 4JEHA 1VI6A 2B61A 1EWYA 3HHPA 1CB7A 4K5QA 4LQDA 2WKSA 1OFVA 4B81A 2JAHA 2O7QA 4D0GA 2VDKB 2P65A 3TF5A 1APBA 1GGKA 5B1SA 4ARZA 4G56A 3ZBTA 2W0SA 3S1SA 1XCLA 1E9DA 3T0GA 1D2EA 3KKQA 3UB4A 3IQDB 4RYLA 3LY5A 3FMPB 4QULA 3OOWA 4OHWA 2JATA 3H1PA 2GXSA 1X7ZB 4R6XA 3L8FA 1RBQA 1BC5A 1T1RA 3HQ4O 1JT9A 2VHCA 4Q9KA 1MVOA 3QEBZ 3E0QA 3PWZA 2QD1A 1T9GR 4X85A 1CIJA 3GFQA 1E0JA 5ER9A 3O31A 1ESCA 1UAAA 1D1TA 2AFIE 2WSMA 1YNOA 4MWBA 3MINB 2Y99A 4ZAWA 2PL1A 1DAMA 2VHXA 1EA7A 5DYTA 2PKQO 4GM0A 3AR5A 4P22A 2AC7A 2JEYA 1XZLA 3IS3A 3MWFA 4X71A 4ER5A 4ZCIA 1NQ5A 3EIEA 1SUWA 2YHAA 3ZDFA 5KTTA 2A4MA 1FW6A 1RWVA 5FWYB 1YR8A 3GU3A 2J5QA 1YUNA 3R6WA 4E2XA 1DELA 4QQNA 1C4WA 4TUYF 5KMGB 1R0ZA 1E1YA 4RWZA 5LA6B 1VIVA 5G4KA 3BZWA 1P2FA 4B2PA 4HF7A 1C2YA 5IAOA 2UUCB 3CCCA 4RJ2A 2R8OA 3AY3A 4G1BA 2FUEA 3EXFB 3UXEA 1WJGA 3WWPA 4RPCA 3H5LA 2PGAA 4DOMA 2EHJA 5HP4A 5JY6A 4QSHA 1BQ3A 2YDXA 4EK9A 4D9EA 1FVXA 1NFRA 3H4IA 2CJPA 2BAGA 5ESXA 3WWDA 5EWJA 1WVMA 3AKEA 4PSCA 1MPTA 1PQYA 3BD9A 1QNFA 2QTNA 1KZYC 2GCGA 3D64A 1SUBA 2OXIA 3NYWA 3VHLB 2X6RA 1EM8B 5I4IA 4JASB 4QBGB 3O2SB 1C3XA 1IVYA 4LVOA 5TQ2B 4P32A 2X5NA 2B8EA 5DTMA 5ICGA 1MMFB 1QH0A 1J49A 3MHPA 3MRXA 1Q44A 4YJ2B 5JCPA 4GSLA 4MYSA 5JNWA 5HTOA 1ECLA 4E88A 2BE9A 2REQA 3WWYA 3I9KA 4WEQA 1Q7EA 4H1VA 4OI0A 3I2FA 4WEOA 5HJ2A 2E5WA 4WNCA 1E6CA 3ZWBA 3UMGA 3FJ1A 1RW4A 1PR5A 1OAAA 3K8ZA 1GG2A 4CM7A 4KAAA 4M8KA 4DF3A 1WQ1R 3LUDA 3UBMA 2F48A 2WFZA 3CF2A 1VYVA 4KGDA 1BU8A 1M33A 3L92A 4NPCA 4UDNA 3T6KA 2CVZA 4UAJA 4ZO9A 3TTSA 3ZOZA 2HGZA 4F56A 4DDUA 4Y6RA 1YRLA 4QEDA 4D5EA 2WVJA 4HWOA 1R27A 1ZIYA 2W2LA 3EW7A 3K72B 4UC0A 3RPEA 1QF7A 1TQHA 2JGJA 4FSXA 2WAOA 1XL1A 1NJSA 1ENYA 3WS7A 4LYYA 1MZVA 2IODA 5DJ5A 3COWA 4D9MA 2C2GA 4G4JA 2PZJA 5FO1A 5ARDA 1R9GA 2QV0A 2WG1A 4GH5A 4TYYA 3T4XA 5LP1A 1PR6A 3BERA 1XXHE 3IUEA 2XUIA 3MJCA 2GJ8A 4AMZA 3GG2A 1JQ5A 1ZGZA 5C7OO 4ZO4A 1RC8A 1WB9A 2R00A 1TYAE 1HNZB 3LL7A 3MTDA 2O5RA 2QX7A 2W93A 2IP4A 3AR6A 1SZPA 2CMDA 2XCRB 1E7SA 5FUWA 3EOBI 1TW2A 3BGIA 3U40A 4OHXA 4OJMX 3K94A 2NU8A 4NV3A 3SHWA 3WWCA 1KY3A 1U0NA 4MAFA 4BQEA 1DLIA 5I7RA 4N0PA 3N0WA 1Q7BA 2GWRA 3MW8A 4PSUA 1B2LA 1ZHOA 1DS6A 3K1JA 2FMKA 1YH3A 4LK3A 4OP3A 5K3DA 3PCXA 4X64B 3PPYA 3H8WA 2PXCA 3AF1A 3K2EA 4MKZA 5FOTA 2MYNA 4Z4QA 3B20A 5C5EA 1ENZA 2QNIA 1W25A 3V1YA 4NBKA 5FNZA 4C78A 4CRWB 4RKQA 4WGGA 3KSBC 3WGJA 1JVNA 2VPQA 5JC8A 1NL3A 3IE2A 1ZJJA 1GCIA 4KUHA 4FDTA 1ZNXA 2A30A 5H4GA 2WT8A 3BD6A 3DUWA 1G2OA 1M34A 3BS4A 1C8LA 3C5EA 3T7IA 3CHYA 1FFSA 4XUDA 2NLOA 3SDZA 5U1PA 4B8ZA 1A9XB 2RI0A 2IDMA 2OZLB 2J8ZA 4GHWA 3E27A 4MUNA 4UMEA 2G1AA 2ZU0C 4LWZA 4YAJA 3GEHA 5DEOA 3W1WA 3RFXA 2I9KA 2CNBA 4JXZA 3QXJA 4O0LA 2O54A 1M0WA 1WABA 3EJWA 1UC5B 4OJQA 1Q2XA 5CTJA 5HXAA 3BIFA 4EYEA 1BMQA 3A1DA 5LCXA 5FPKA 2P6RA 3TNLA 5IG2A 4MQLA 3KQKA 3F6BX 3F1KA 1G7CA 2HWXA 4YRDA 3KX2A 3H97A 1Q3HA 2HIHA 1UXHA 3K2BA 3RU7A 2WFAA 1D07A 1F3OA 1KMHB 1YKSA 2OYSA 2I2XB 2YOGA 5EMLA 1Z29A 3L1KA 4GF5A 4CF4A 4KUEA 3VRHA 4JUBA 4PZCA 1B4DA 3DZJA 4JVSB 5BSRA 3RD5A 1N9GA 1EM6A 2QMUA 2GILA 3LQYA 4QYIB 5H83A 3UH1A 4S1OA 3GFSA 4EA6A 2C5SA 1R6XA 4ILEA 2V0NA 1M2NA 2RH5A 5JLAA 2R7LA 5E9WA 5T3YA 3UK0A 2JCVA 3WXMA 4FS3A 1QG4A 4XDHA 4MYCA 3IJPA 2IZ5A 2YR0A 2Q8PA 2EAUA 4GGPA 3WIUA 2YW9A 4I1RA 3TKLA 2YS7A 3A6JA 1PTJA 1HNWB 2O2IA 1DIAA 3CTMA 1H1LB 1J8MF 4QE3A 1M1YA 4J6FA 4JLBA 1NLZA 1LU9A 1K66A 1LEHA 1P2BA 2PUHA 3HP4A 3JQCA 3T8YA 1TQ8A 3I3OA 3BTOA 2CB9A 2A92A 4KIJA 5LYJB 2IUEA 3O1LA 2YRFA 3GB9A 4ID9A 4PE5B 1NZJA 4UBMA 3KWMA 3FPHA 4URHA 3VBEA 2FPKA 1A9SA 4MDHA 1M2FA 3BRWD 4H3SA 4AP6A 1Z5WA 4B7AA 3H0KA 2YIDA 1YWGO 2FR1A 3ZI0A 4D02A 4HV4A 2ZPAA 1E9CA 3IMKA 4OFXA 2DM6A 3SZLA 1UKVY 5IJ0B 2II6A 3WL8A 4MW6A 4L28A 1CF4A 1JJVA 1V3TA 1WS6A 2E5FA 3KYCA 4MUAA 4XGRA 2JNWA 1R6VA 3FYHA 7MDHA 3S8EA 2HRZA 2ZIXA 4NF2A 5HQJA 3JAKB 4OSOA 5JS7A 2XUZA 3AB3A 4RA6B 3AVXA 3AVPA 1A9RA 1ZK4A 2H9AA 4TQUS 2FNAA 3V8NA 1A8QA 4YEDA 4DAEA 3HVJA 3OTGA 4M1QA 3V48A 5A3QA 4BQOA 2K6GA 4D4GA 2P7HA 4A16A 4ZIRB 2FX3A 2ONZA 3PJGA 3G1TA 4UQOA 1M74A 3DCNA 5I8ZA 4EELA 2A33A 1FF9A 1SKUA 2GM3A 3Q87B 1XFDA 4M1SA 3UJ9A 1G2PA 1GU7A 4YUZA 5LKAA 2COUA 1NI5A 2ACVA 3G7SA 4G26A 4II2A 4MGYR 1MVLA 1BS1A 3OAAA 3WZLA 3GD5A 4EL0A 2HJGA 3OD5A 1ST3A 4G5RA 3ZUGA 4NHOA 1K89A 4BLRA 4WQMA 4DT1B 3SHQA 5KCZA 2IXEA 3DB2A 4H16A 1ND5A 4IOLA 3ZWNA 4BJ5A 2PFSA 4GRDA 1H3EA 5ALZA 1TGVA 5ADWA 1VL8A 2GHIA 3RYCB 2FE4A 1ZMOA 3RYHB 1OREA 3R0VA 4HI0E 4FI3F 5DHPA 1MHTA 1JAYA 1DEKA 1G7RA 1NWHA 3LGXA 3N2KA 4KWHA 4HLCA 4PANA 1NTOA 1O8BA 1U9IA 3A9WA 4NV1A 3ZIUA 3DC7A 1GL6A 1GQ2A 4PZAA 3UCXA 2EBHX 4UCQA 1JECA 1R12A 3GT0A 3GEPA 3PQDA 4K28A 4YLYA 1R8QA 1VDMA 1F0YA 1HMPA 2G06A 1R8SA 1W4LA 2HHAA 3OBBA 1U1DA 5CT4A 3RU3A 1L7AA 5FL3A 5B4TA 1H6AA 3NCHA 4BB9A 1G2QA 4EW3A 1V2GA 2AE1A 2HA2A 3Q9SA 4E2ZA 2JLVA 1WXFA 4UUAA 3FR8A 2YX1A 3OUUA 4M9SA 5F33A 3FHJA 3TTUA 4H7DA 2QF7A 3WNCA 3ZH2A 4GXRA 3W6NA 4E30A 4UOEA 5ALPA 1KI8A 3OUTA 4YHHB 4KRFA 4NVRA 1Z13A 2VHEA 2YHIB 1PR9A 4BNUA 1HEIA 1MV5A 1D5CA 5F51A 4PICA 3DGFC 5A9TA 5D86A 2NP6A 1HDYA 1C7ZA 2J9GA 4YAOA 4DHEA 2YNMD 3P8ZA 1S9HA 1E3TA 2V7BA 5AVYA 1NKSA 2XGJA 1P0QA 2I6SA 4Q16A 2RD2A 3SAJA 1FLDA 3DT9A 2YV5A 4G0UA 2XYGA 1ONSA 4Z3DA 1O6CA 5BV2P 4C2AA 1DG3A 3OJWA 1B8PA 1N6KA 2QS9A 3SDBA 2OGSA 4IOJA 5JMWA 1DUSA 1DCFA 1THZA 2AOUB 3JWGA 1WMEA 4HDNB 1OHHD 3ZLUA 1Z88A 1Y1SA 3Q2IA 3C0KA 4GP9A 2B20A 4BGIA 2ANCA 2HCRA 3CEPB 4NZPA 2KSQA 4MVXA 1ESZA 1N5LA 1ZM4A 1NX9A 4GNKA 2UYCA 2DLDA 5IVHA 2W9XA 1IOLA 3MAGA 1NFFA 3PUXA 3BEOA 4IFEA 4NBVA 4OM8A 4QOSA 5D01A 3U44B 1QG0A 3M2TA 4XQ0A 2QJRA 2XOEA 4NDAA 5DU2A 3BRSA 4C7OB 2G70A 3PWSA 2YXNA 2DT5A 3WTBA 1CP2A 5DP1A 3DE7X 3IB6A 1CS0A 2X14A 3N2LA 1KEEA 4BDSA 1E2JA 3HJNA 3KTDA 2HMUA 3SZMA 3KU4A 4AO8A 3MBOA 1MX5A 5HUHA 1V1JA 2E89A 4KFSA 3P94A 1Q11A 5FOXA 2AJCA 3KQYA 1GT91 3LBIA 1LBIA 3ET4A 3JZDA 4HNAB 2YY5A 4K8OA 4D4IA 1N2IA 4L8GA 2OM2A 3WGOA 1YQUA 3TLGB 4BP9A 4CQNA 1XP5A 4PG5A 4YCJA 4WUVA 4BATA 4WFJA 1PJLA 2Q27A 4E6PA 5AJTA 3TINA 2EV9A 3V1MA 4Q7KA 2VKTA 7YASA 4UBLA 4D26A 3EVCA 2VT3A 2G7ZA 4PFJA 4FCCA 1U81A 2AFHB 2KX7A 1E0DA 2J5XA 5A6VA 1JHZA 3LZDA 2BI8A 2AX4A 2ZG6A 3EYAA 2XNJA 1K63A 3BL5A 2O8DB 3OETA 3N28A 4FWTA 3HUEA 2VK8A 3FNGA 4S04A 4KI0A 3UOWA 3LOUA 1TUBA 2CDNA 1IVNA 1Y4UA 3ISTA 2VK2A 2ENWA 1QBGA 3LZ6A 4FFBA 4WCDA 4EA7A 2AYYA 4L16A 2GF9A 4DJJA 3CNLA 3L0CA 5FPPA 4DG5A 3CX8A 3GLVA 2H8KA 1MOPA 3IUNA 3CB2A 5HRCA 2Q1TA 1QGED 1YS2X 4FC7A 2WWFA 4IDHA 1C3OB 1S96A 2B8TA 3ORFA 3T9BA 1E6MA 4CDMA 1CFZA 1TD1A 3IDSA 4DDKA 2CMFA 1LFAA 2ST1A 2XD4A 3AWDA 1HYQA 3NHZA 5HKAA 1OLUA 4DVJA 1SCIA 4EY5A 3IKTA 1J9GA 4QARA 4C07A 3UJNA 5FH9A 3A4MA 3LRTA 4HGZA 4UUOA 2A6PA 1GRQA 4C4ZA 4X84A 1W30A 1W46A 2M1XA 4RELA 5IAGA 2CHUA 3AJEA 3TL6A 1E8NA 1R6DA 1D6MA 4MMZB 3CH5A 1QIGA 1C81A 2BZ1A 2J3LA 2X8AA 3DAPA 4Z86A 4B4WA 1Y4DE 1YS7A 1Y3AA 3AEUB 4B3BA 2IZ6A 4DLYA 1HV8A 3FA2A 2DUJA 2YJ5A 1EEXB 3GF4A 3LKDA 5I8WA 3OPYB 1K6EA 2WOOA 1ZHFA 2HYDA 1O6FA 4GSKA 1WSWA 3GMIA 2QBYB 2EQBA 4TXLA 3I1YA 2VXOA 5KYVA 4PZ0A 2WD7A 3VTAA 1DHRA 2W6MA 4LMAA 4DR4B 4L95C 3HN7A 2C98A 2VSXA 1TU4A 3BXXA 3B5IA 1KI7A 1LH0A 4JC4A 4KVFA 2I2FA 2ZUCA 4NIMA 4LDZA 1FP6A 4Q9IA 3I4FA 4F93B 1PS0A 2IP2A 2Y66A 4AN0A 4LJRA 3KOWA 1EEHA 4J2HA 4M54A 3THRA 4P98A 4X6LA 1UKAA 3OE5A 3O8OA 5A0VA 3MCTA 2PK3A 1V5WA 4G0YA 5C5DA 1GNPA 2VI5A 3V5NA 2Q6IA 3MWJA 1SJ9A 4J43A 1I7DA 4LMRA 3BCUA 3QFFA 4UASA 1E9VA 4LQ4A 4RLHA 4GOMD 1T0BA 4GP6A 4CEIB 1CBUA 4Q4AA 1QLJA 4LXUA 1J39A 4ZVNA 2PH3A 3CYFA 2JK0A 4Q02A 5F1PA 2BGJA 2H31A 4XWTA 3DBHB 4L5IA 3ACBA 2YRWA 4C0JA 1KMMA 3LX5A 2VAMA 4WXRA 3ZU6A 4KXVA 1DHTA 2ORVA 1J2JA 2EP5A 4RQAA 1T8SA 1RYMA 2H1VA 2PX8A 2XADA 3SEQA 1L7EA 4N48A 2J9YB 3AKYA 3UK7A 3VISA 4CL8A 3LHFA 4OB8A 4OHPA 5IBCA 1UPUA 4W1RA 3K9LA 3ROTA 4AY2A 3OCYA 3PT5A 4GP7A 3JVIA 1NXQA 1T0HB 3WMEA 3KUUA 1CV2A 2XY4A 2JLBA 4EKNB 2Y1GA 3ETJA 1J5EB 5FOQA 1LJLA 2XNHA 3KPUA 1E62A 2XMGA 5LMZA 3GWGA 2JCGA 1WWKA 3MMPA 3VU1A 2BIFA 1GUAA 3X2EA 1G17A 1WXEA 3V7UA 2ZAIA 3EBOA 1DAOA 1SUIA 3E70C 3E7DA 3MJRA 3RS0A 1JFTA 3COVA 2AFHE 4DLLA 3OM9A 3SQXA 1JJFA 2WJ4A 2IH5A 1JSXA 3NC1C 4H1HA 4BGUA 4TS9A 1NYQA 2Y8EA 4RTPA 4KC0A 1DI0A 1PW7A 2JD0A 2ZTUA 3OCUA 1ZH0A 1U99A 2Y1CA 1O0BA 2BFMA 4X45A 4ZT5A 3AH8A 1NP3A 1N2JA 3ASUA 2PX3A 1DX6A 2IPNA 1UK6A 1DJPA 1T9AA 4TMWA 4HVAA 5IT5A 2ZI4A 3VVBA 2AKEA 3BMOB 2PKRA 4ARVA 1JILA 1KDOA 2V9PA 4OHOA 5AOCA 3ZCPA 1WXGA 2PM8A 1AURA 4IV5A 5LQDA 5BQFA 3HP1A 4NCKA 2FEPA 3C7KA 4B4DA 2ZZNA 2X0NA 1SK8A 1NMZA 3I9V6 2E49A 1GGNA 3WLIA 3G88A 1D7OA 2HQBA 2QXTA 4YRJA 4RQBA 4YYZA 5AM4A 4TYPA 3FDXA 4POOA 1Y1QA 3IMFA 2X4DA 5JS6A 2CXNA 1CJCA 1KJWA 3EIQA 1AHHA 1QRAA 3L0DA 3QKRA 3KDPA 5HPYB 3WY9A 2Q5OA 2JH9A 4B0OA 4CMGA 5KPDA 2AF3C 4HEHA 4HJXA 3G17A 1WO8A 1XCMA 1XYGA 1HLDA 1SBQA 1FLVA 2HSWA 3KFVA 3KSDO 3LY8A 1O96B 1XHFA 3NH9A 2RHWA 4Y2PA 4PPNA 5CGQB 4A8HA 4D9KA 4MWSA 2ZITA 3UWOA 4KR2A 1UWVA 2BEJA 2VHJA 3QPVA 4YACA 4H1TA 5LL6P 2QROA 5L3SA 2AFVA 1N7HA 1YHZA 1ISIA 1U65A 3DVLA 4B79A 5T4FA 3LFTA 1P4SA 5C8XA 3B3GA 3FJYA 3VC7A 5EIOA 1E2UA 3DFUA 3WP0A 3VUFA 4KIFA 1P4GA 1JHOA 1PFGA 1MXFA 2CLHB 1G66A 3HN2A 2IXDA 3KC2A 1XMXA 4INAA 4IXTA 5DN6D 4U2CA 1H2HA 1BXRA 2Q5EA 4KPUA 4QFMA 2VWHA 4DMCA 3MLEA 1KRWA 3RI3A 3R3ZA 1F8YA 1Q20A 3SR0A 1O77A 5CEJA 1TT5B 2DY1A 3OPQA 5GTDA 2PUFA 5H59A 4RTOA 3EYWA 2X41A 5HOEA 3OI7A 4IJWA 2MHCA 1C1DB 1RI5A 2QQFA