1HORA

Structure and catalytic mechanism of glucosamine 6-phosphate deaminase from escherichia coli at 2.1 angstroms resolution
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
266
structure length
266
Chain Sequence
MRLIPLTTAEQVGKWAARHIVNRINAFKPTADRPFVLGLPTGGTPMTTYKALVEMHKAGQVSFKHVVTFNMDEYVGLPKEHPESYYSFMHRNFFDHVDIPAENINLLNGNAPDIDAECRQYEEKIRSYGKIHLFMGGVGNDGHIAFNEPASSLASRTRIKTLTHDTRVANSRFFDNDVNQVPKYALTVGVGTLLDAEEVMILVLGSQKALALQAAVEGCVNHMWTISCLQLHPKAIMVCDEPSTMELKVKTLRYFNELEAENIKGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and catalytic mechanism of glucosamine 6-phosphate deaminase from Escherichia coli at 2.1 A resolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Intramolecular oxidoreductase deaminase
molecule keywords GLUCOSAMINE 6-PHOSPHATE DEAMINASE
total genus 96
structure length 266
sequence length 266
chains with identical sequence B
ec nomenclature ec 3.5.99.6: Glucosamine-6-phosphate deaminase.
pdb deposition date 1995-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01182 Glucosamine_iso Glucosamine-6-phosphate isomerases/6-phosphogluconolactonase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1horA00
2O0MA 3LHIA 3LWDA 3ENVA 2J0EA 3NZEA 3ENWA 4M8LA 3UW1A 2BKVA 3OC6A 4OQQA 3BXGA 1FRZA 3TX2A 1HOTA 3CH7A 1KS2A 1VL1A 2RI1A 2WU1A 3CSSA 4R7TA 3U7JA 1XTZA 3EB9A 1LKZA 3HHEA 1FQOA 2F8MA 3KWMA 1FSFA 1UJ4A 1O8BA 4L50A 4OQPA 4TM7A 4L4YA 2RI0A 1NE7A 1PBTA 1LK5A 3BXFA 3E15A 3EFBA 3ICOA 1M0SA 4L51A 4L4ZA 1LK7A 3L7OA 1FS6A 3KV1A 3NWPA 2R5FA 3HN6A 1UJ6A 5HJ5A 3IXQA 1CD5A 4X84A 2W48A 3BXEA 4R9NA 2BKXA 3E7FA 4L5IA 1JT9A 1FS5A 4L5JA 1Y89A 3BXHA 2GNPA 4IO1A 2OKGA 3ENQA 4GMKA 1UJ5A 4TM8A 4GO1A 1DEAA 1HORA 4NMLA
chains in the Genus database with same CATH superfamily
1NI5A 3N0RA 4IGEA 3ODPA 2EKDA 3HJNA 2V9CA 1I80A 3NHMA 4L0MA 3I28A 3F6PA 1ZIDA 1CK4A 5B6PA 5JYDA 1XPJA 1YI8A 3GPLA 3BTUA 2VHJA 1NXXA 4AJHA 1R2QA 2G63A 4AJLA 5M04A 4YPFA 4EFDA 3DVAB 1QDEA 2JGFA 2H4WA 5BOVA 5JNRA 1EK1A 3CH4B 4B73A 1MO2A 1PUXA 4RLHA 4OV6B 2NZJA 3PENA 3L8CA 1OZ0A 3VU9B 4KRYA 2OCDA 4GSYA 1J21A 4DQLA 1B8OA 1E92A 1G8JA 2PBRA 5FPHA 4IF4A 4ALMA 3MGCA 3RIHA 3TCNA 3U4AA 4D9EA 3UJ6A 1J0CA 4LNAA 4RIIA 4RY0A 2BGGA 1FTQA 3I2IA 2R6HA 3OC6A 1E4VA 3M6VA 1K7SN 1Q6YA 1UFVA 1WDKA 3MG9A 2XUIA 4TLCA 4ZZ2A 2Q27A 3QITA 3L7LA 4Z1MA 3E6AA 4F86A 5IM4F 4JGGA 1T3GA 1PHRA 3A28A 1KRWA 2Q1TA 4A9AA 4L4YA 3NGLA 4RH1A 1TLTA 3GLIA 4FILA 1QQAA 2OBBA 4KUEA 3ELBA 2XKJE 1MDFA 2XXBA 4REMA 1VE7A 4C89A 1KWGA 2Z8ZA 3DEHA 1Y1KE 5D6OA 1A2OA 3IAS1 4BUCA 1FS5A 3WISA 4K8RB 1KOJA 3LFHA 3G9XA 1I4DD 1YQGA 4KE7A 1CQWA 3TWOA 1THMA 1PJ4A 3PDWA 3O4VA 4RVUA 5AVJA 4FE4A 2WUFA 2FLVA 5KEIA 2BBWA 2RH8A 4XVQA 1UFOA 2VP9A 4MV0A 4NLLA 4AY3A 2JJQA 3QELA 4DT1B 4G0UA 1KO1A 1LKZA 2LWIA 4RVNA 3TECE 1KYZA 1J9EA 2Q6OA 5E6RA 2OA0A 4PZZA 4BLWA 1VYHA 3QX9A 1YASA 4MGKR 2D00A 3F9IA 4P7BA 3VZSA 1IVSA 5KSZA 2C9BA 1ZD4A 1YCDA 3VPGA 4GF5A 4ZV4A 2BE7A 4UEWA 1JI3A 1DJNA 2GHTA 4C2TA 1BMDA 2ZWAA 3QUBA 1VIDA 4OQFA 5J9FA 1QNLA 2XX3A 1JT9A 2YJNA 3KKEA 3WKDA 1DAEA 3GMTA 1JU4A 1MABB 3UWPA 4ER7A 4F85A 1EHIA 4BVGA 5JXJA 1H5NA 1S8OA 1OI4A 2C4NA 4LMPA 4S1TA 5EMKA 1PWZA 4QLOA 5FRDA 5JG7A 3LK6A 4KR7A 5HQ3A 4I7EA 5MDHA 4LZLA 4NFLA 2YICA 1I7PA 3CF0A 3T3PB 2VAXA 3TW8A 1SVNA 3OWOA 3C98A 1ZVVA 2JI7A 2QU7A 4JOCA 4KU4A 3FTNA 4BQSA 4F38A 1N9GB 2C03A 4O6VA 4QL3A 1W0JD 4PS0A 2ZS7A 4C3VA 2REXB 3U09A 1FZTA 1HK7A 1NBEA 1E66A 1E9DA 3GUZA 1OAAA 4FZJA 5L8VA 5BT8A 2VPWA 3D5EA 3WLKX 3I04A 3E05A 2CGEA 4BLUA 3L7BA 2DJ5A 4R7ZA 3MCWA 3L8HA 2BH9A 2JGKA 3IUPA 2CYCA 3U9SA 4B6SA 3M6XA 4N9WA 3CINA 3LP8A 2TMDA 3OIWA 4M21A 4AX8A 4QT0A 1A98A 3ITKA 2NVOA 5FP0A 3RF6A 1UKYA 4ZI2A 3EX7C 1OYVA 5A1TA 2Q46A 2Y1WA 5KTMA 4FGKA 1EPUA 1X1BA 3HZHA 4TUYF 3BDVA 3DA8A 5BWOA 3HABA 5EWJB 1X1RA 2J9YB 3QA9A 1GDDA 3PPWA 1VL2A 1KKMA 4ZOQI 6PFKA 3THWA 1W7AA 1SVLA 2RGAA 4ENVA 3IEXA 4BRUA 2DLDA 4CTOA 5B37A 1K6EA 1ZGHA 4RVDA 1SUSA 5BXQC 4NK5A 5KU1A 1ZIPA 3LUJA 4KO4S 1V8OA 3OZDA 4D96A 1MBZA 1FYWA 3KVRA 1KERA 1NPYA 2JH3A 5CT9A 1X1AA 3KAPA 3ZCQA 2UZ3A 2YDXA 1JDZA 1G20B 1SURA 4O02B 4C7BA 3GZNA 4EK9A 2O3RA 3OZTA 2ECOA 2P1ZA 3R5JA 1VIMA 2AH5A 3ENVA 4XX0B 5CAEB 4C1BA 2D5IA 3EWIA 4GPEA 1YA6A 1GAJA 3I1JA 1MUUA 3I52A 2AUNA 2I4OA 1I3CA 5T7BA 1WJGA 4JUCA 2Q3LA 1LRJA 3K9NA 2EV9A 2REOA 3V1LA 1VPVA 4IXWA 4XX0A 5CDFE 1XVAA 1ETUA 3IDQA 2ZUWA 1C3OA 1CQXA 3O3OB 2ZDHA 1P2VA 1J8MF 1ZJZA 2NP6A 5AKKA 1A2QA 1M1YA 2D1TA 2IQIA 2E0IA 2MYPA 5DKFA 2AOTB 4RTSA 5TE9A 4KAAA 2Z5VA 3FA2A 4OSEA 1VCMA 3AIKA 3JVDA 3KZXA 1M75A 2UUOA 3GMDA 4WNAB 1FU4A 1WXXA 3EZ7A 3NH9A 3OEED 1VZ2A 1QUEA 3NALA 4GRIA 4LCEA 4UUQA 4ARSA 4IZIA 4US0R 2O5VA 4YBZA 1QYRA 4E30A 5CXXA 4OQQA 3EODA 3PD0A 5CTJA 4DFDA 2WF9A 2M6KA 1GARA 1V2HE 3FHOA 1Z4NA 3BXOA 1JE0A 1Y42X 1G18A 1R1DA 1UK9A 3P9YA 4CG3A 3N2YA 2QMUA 2HK8A 3QVGB 3FVVA 2I7VA 2F1JA 2ZRIA 1HYHA 3TI9A 4EKGA 2QN7A 1ORVA 2PX0A 2DG2A 3OM1A 3WK5A 3T5PA 1GL6A 1UEXC 1E18A 1K2WA 2FU5C 2YFKA 2I71A 3A9WA 3I12A 3I9NA 3M3PA 4XYMA 3ZWMA 3ZY3A 2ZM6B 4HDMA 3CJQA 4QOSA 3PNBA 2PT6A 2OT3B 3ADBA 1VZ3A 3KJIA 5B3JC 4NNPA 1YRLA 3IQDB 3GNQA 2BN4A 3HLKA 1ZMOA 2UZ4A 1D2EA 4Y6QA 5CVDA 1ZR2A 2GJ4A 3AJDA 3L82B 2BFCB 4H1VA 1AQNA 4D41A 1K5HA 1ADFA 4UCFA 3SCZA 3U3JA 2K2QB 3ZWOA 5IHPA 3NFYA 3AZOA 2QT1A 3LX4A 4A15A 1SXJD 3AU9A 2PRIA 3TX6A 1JB9A 2P3SA 1DPGA 2LIPA 1NG1A 2Z6VA 3DFMA 5LZ4A 2GKGA 3AEXA 2J3HA 2E5FA 2EYUA 5K3BA 2PT7A 3ZVNA 3AGPA 5C53B 1G6OA 2O8BA 1ZIOA 3K5PA 1TMKA 1TVEA 1YACA 2VBIA 4M83A 3TSAA 1E6KA 1FVXA 5BN5A 2WZCA 3VVCA 4DXDA 5LQMA 1QGED 3GWZA 4JI4B 3DOHA 4NC9A 3OZEA 1M8FA 4KWIA 2QVBA 3TW8B 1ZEMA 4M9XA 4ZT7A 1U3TA 4E1AA 4FYKA 1V7CA 1BFKA 1Y6ZA 4CT0A 4FHEA 3BAFA 1HEYA 1RS0A 4HDOB 5CM8B 4NJMA 3L6UA 1I1NA 3LRXA 4PLCA 2C4MA 1PR1A 3L6DA 4JL8A 5DSXA 2BFFA 2HM7A 1H2FA 2ASVA 4XRGA 1SIBE 5EA2A 3VRHA 1N0VC 3AJRA 4K9MA 1P19A 3I4FA 3UHJA 4B3FX 5KYXB 3P5BA 4LZAA 4YRGA 1IQ0A 3VKGA 1CY6A 2H92A 4L57A 3PLAE 1QOZA 3VSBA 4EHIA 3FI0A 3RT1A 3H4TA 3R0ZA 2H4YA 3FMPB 2ZR9A 2HYIC 9GPBA 5JMOA 3P0FA 3DAOA 3BCSA 1YULA 1BMFD 1ODTC 1GKIA 5F1KA 3R75A 4EGJA 3HUDA 3KZKA 2DBZA 4A7PA 1POWA 1GLGA 1X9IA 2P4UA 3ED5A 3BVPA 3BMOB 2OAGA 4YP9A 5KI6A 4UDOA 3SF0A 4PX2A 2WK1A 1T13A 4GEKA 1USGA 2W6NA 1WSAA 2YINC 5BWBA 3GEMA 1K63A 1Y1QA 4HGRA 1IHPA 1KI8A 1SBYA 4FHDA 1VTKA 1N1DA 4JC5A 2ZI3A 1LC3A 1TJ3A 2BEJA 4QYIA 4H7DA 2GAFA 3SFVA 1C2YA 2YWBA 1P7PA 2I7XA 3O9VA 2Z98A 2WJJA 4C4PA 2R7AA 3EQZA 4B7ZA 1I6MA 3WSVA 4N48A 2CMKA 3OZRA 4BMCA 4BP3A 1MEJA 4IF6A 2QD2A 4KQCA 2NNWB 2WTMA 3UMRA 1QCZA 1A2BA 1U31A 4QE3A 1U5CA 2Z3VA 3BTOA 3L02A 3PHBE 3MRSA 3WXMA 1NDUA 1V7QA 3HWRA 2QLJA 3UKOA 5AM4A 2NUTA 4MV8A 1H1DA 1TUGA 2QX7A 4CMHA 2JIPA 3G02A 4CV1A 1TX4B 2J0SA 2H0QA 3MLAA 2WHRA 2PZBA 2Y9MB 1KJJA 4MHSA 4NPCA 2VHVA 1DHRA 2HA4A 3MTDA 3EVCA 2ACWA 4O8ZA 5HXAA 4BJHB 3QJ5A 2GK4A 4EI7A 1FFYA 4LXUA 3WQSB 4JJKA 1SBTA 2VDMB 3VH2A 3U80A 5D6NA 1NF9A 1EXVA 2Q2NA 1JPVA 2QVLA 1IM5A 2VAPA 3C1AA 4E6PA 5CXQA 2NQ8A 1I7SB 4Q3LA 4J9VA 3WGKA 1EZ1A 5CDSA 1CUGA 2QTVB 3LX6A 4BZXA 2CNBA 3ETCA 2O2GA 4Z4GA 5E6UB 4NE2A 3NI2A 2FJPA 1QQ7A 1QO9A 2P75A 2A9KA 3WXBA 4IINA 4X9XA 3NBUA 3DBHB 1BIFA 4ZHQF 2LGJA 3DMGA 4NBKA 4RANA 2APJA 3F8WA 3FUXA 3HY6A 1WCIA 1DOAA 3N2IA 4GFDA 3M4NA 4XWGA 5EJ2A 2LP4Y 2QZ4A 3QUAA 3BD6A 1E6EA 1V1RA 1XJQA 2QRHA 5BQPA 4QGAA 1NBAA 4ZCSA 1GGEA 1TZCA 4DQVA 2E21A 1KC1A 2RJ3A 1FS4A 2FQQA 3IKTA 2VJYA 4BBJA 5A9TA 1YQXA 1Q1BA 2G0NA 2Q2WA 2IZ7A 2HHHB 3K20A 2ZXFA 1KBZA 2RMKA 1DOZA 4KACA 4OQYA 5DW3A 2C2HA 4ZMRA 4UEKA 2VK2A 3DFKA 3OFSA 5DN6A 3ZNPA 4EOGA 1N36B 4QWMA 3WRYC 1E7MA 1FVHA 1WHSA 3SOPA 5KJ1A 1Z75A 1VYVA 3EXEA 4N8DA 1BNCA 1XFAA 4L8YA 3SX2A 4ZJPA 5A4DA 2ZIEA 2F1KA 1ZGCA 3LLVA 1F0KA 3WGLA 3AG5A 3T5MA 3B52X 1SVIA 2CMGA 1ZX1A 5CIQA 3RSLA 2EG9A 5G4LA 4B4UA 1P2DA 1M2JA 2DVMA 2XSZA 3DL7A 2OHFA 3BGDA 4G84A 3G8DA 3SSOA 3UHAA 3W4IA 1YVPA 1QFJA 1JG7A 3HO8A 4RMJA 4ADSG 1B6RA 2PRKA 5LVAA 2VTDA 4IDAA 1LSJA 1WZEA 1SXJB 1U81A 2I4TA 1S7CA 2L69A 1CS0A 5B4VA 2Z8XA 1R8QA 4HOYA 4IV5A 5T4EA 4E4YA 4FMCF 2QXUA 2XBLA 1M8KA 3WJAA 4EVQA 1YZLA 1JFTA 2MJLA 2NWQA 4URUR 3FB1A 5K3FB 4QARA 3GJ7A 4UTZA 4BNFA 2GPSA 2MU1A 2QJFA 5SICE 4PTLA 2M98A 2DERA 1U7XA 4ZVSA 1E1MA 1QQ6A 4HAVA 3JQCA 5ALEA 3L01A 5JOQA 4GM1A 5DBGA 2QR2A 3TLXA 1Z45A 4P6VF 1VHJA 4DKXA 3EIFA 4F45A 4DB2A 3WWPA 2FKNA 1P62B 5FV4A 3ZDYB 3WICA 1X1QA 3HTXA 3TAHA 4YALA 3DLHA 5K03A 2O1SA 5LP6A 1B1CA 1J06A 1T9KA 1V5IA 1N6LA 2Q3CA 3IQFA 5B4TA 1WPXA 2GPNA 3N0WA 4MUIA 5G0SA 5IRCD 2X4GA 3EF0A 2EHDA 3U60B 4DCSA 2FWAA 4PXAA 1ZUHA 2FPIB 2QW1A 5J40A 1NN0A 3AL0C 1SCDA 4O63O 2QNIA 2CL5A 1PGQA 3OOSA 5LU8A 1Z3CA 5JASA 5M2QA 4Q7MB 1DBVO 1PI3A 3TTTA 4YXWD 5D00A 2PX3A 3IP6A 2PGAA 2PUVA 1BE0A 1E1KA 2H06A 1VRVA 1KAOA 4LIPD 1XTZA 4WEQA 1CY8A 5FWXA 2QXTA 1ZL0A 3G2JA 4YDHB 2OKCA 5BRAA 2IEZA 2NVBA 3ZQ6A 1XNHA 4UFPA 4RTNA 2CLKB 1K3TA 5BP7A 4G0YA 3KFVA 4ARIA 4B9AA 5AKIA 4EKYA 4AN4A 1VP3A 4B0OA 1GT91 2Q3BA 2WVAA 2IUTA 3A26A 3TOCA 1EUYA 1PS0A 3ADOA 1H9CA 4Z8XA 1WY7A 2WR8A 5FO0A 4B6OA 4ZYXA 3H2SA 1TO6A 2H1CA 1ZM3A 5IVDA 3B36A 4P81A 4E2YA 2ZE7A 3GY0A 2I33A 1O97C 4F3KA 4EJSB 2FW0A 1QS0A 4WKBA 4MWCA 4XAQA 3H18A 1MXHA 2YIVX 1FX0B 3V4LA 3EHEA 1FLAA 5JAZA 2O20A 1LFAA 1NVWQ 3P27A 1MT0A 2EERA 3ZZ0A 3IS3A 2CLMB 4KNWA 4BXOA 3G8YA 3E15A 1QFSA 1MQ8B 3R6DA 1FFHA 2VSNA 2HJWA 3R4VA 4D9IA 1L2TA 1NQWA 4KGZA 3DTVD 1LWOA 2AXPA 4EY6A 1SGWA 1A8IA 2HWXA 3R7FA 4K9SA 3NYIA 1GFSA 4B74A 4I1IA 2GETA 4B2IA 2XA2A 2BHTA 2AL7A 4P31A 4P1ZA 2GUGA 3R0VA 3SJUA 4GPTA 3E7WA 5EAIA 3BMXA 4FR0A 2X5JO 2XWJI 4UM8B 1WSWA 2HMVA 2R85A 3GRUA 1KGDA 4MUXA 1F4LA 3W8FA 1VBKA 4FU0A 1CZUA 2BKVA 2ZIXA 4JIMA 3ZW8A 4DNOA 5EMMA 4X7RA 3QPVA 1GIAA 1H85A 4N0DA 3UT5B 5FDFA 3OD1A 2ZEJA 1RHJA 4DV1B 3TLMA 1ZIYA 2VOEA 2AOXA 2BEWA 2QZJA 3P2MA 4R2JA 4X92A 1XB2A 1WEHA 5D5PA 1H1LB 3F47A 4XM1A 4BZPA 4KO3S 1N9KA 4Q1AA 4C6SA 1C29B 3HGQA 4C7OA 1GPMA 4ZPJA 5TARA 2RGDA 4TRMA 5BWNA 4EP1A 4ZXPA 2XV1A 1W8IA 3WADA 3U3MA 5H59A 5I5EA 5I7RA 4HEJA 1WSBA 2NAFA 5A5FA 4CDGA 3WWOA 4O29A 3IPLA 5DGTA 1QFXA 4QPCA 4P84A 4ZALA 2CD7A 3AO0B 2C2KA 1ENZA 4OH7A 4X3OA 3N74A 4YJKA 4BRWA 4CE6A 4UD6A 3FWNA 2CLEB 3MYRA 2P7IA 1UANA 3NW9A 3BD8A 3CPJB 3I76A 1X2BA 2PT5A 4ARUA 3AILA 5BWLA 5FYQA 1H3NA 4YRFA 2YYYA 2YW9A 2LNDA 2QAIA 2RGNA 1ZMRA 5JSZA 2CVFA 2A5YB 1PHPA 1RKXA 1G60A 2CLIB 4OHZA 1ETHA 4HRAA 1NN3A 5ERGB 4ZAYA 3WNQA 3ZV7A 3M9LA 3G2KA 1YZGA 3KEMA 1CJBA 1SB8A 2BEUB 2JCBA 3EH1A 3PGLA 4WXRA 4C5AA 3AK4A 1BSVA 2XT9A 1J0XO 1AKMA 1FC0A 4D46A 1PR2A 4MVWA 3KHUA 5AOAA 2CL6X 4DC9A 1T0IA 2DBVO 1AC5A 5EJEA 2IXTA 3C24A 2YR0A 4BO6A 1GCGA 1ZXXA 2ORWA 5ENZA 1GDHA 1T8RA 4GU5A 1PT5A 1SBCA 3ZV5A 5KVSA 2XUHA 3UWDA 4K6HA 3WK4A 5KNCD 3PV0A 1N4AA 3MWLA 2GM3A 1K5PA 2JFBA 5GONF 4KODA 3AF0A 1OTXA 2HJVA 3M7IA 3NANA 3UK1A 3VVLA 3ZGVA 4RGYA 2ZVDA 3C7CB 4BO0A 5B57C 3TLBA 2EHJA 2EP7A 4BB5A 2CV1A 2WJ4A 3F7MA 2ZJBA 3F7OA 1AMNA 5H80A 3EFEA 5LWHA 2V98A 2ZRMA 3FPFA 1N2XA 4BTLA 3AEKA 1P0CA 4CCYB 4IQ0A 4QELA 2O3TA 4ND8B 3T1VA 4ZEVA 2OV4A 3BULA 1XYVA 1K8XB 1S3IA 3OU6A 2BCEA 1KQ3A 3GZ4A 4YRCA 1VSBA 2X9NA 3KWMA 4LPSA 5L3QA 2FPUA 5HM8A 1RQNA 3RNLA 4O1IA 4FD2A 1F17A 1N0HA 4LK3A 3H1EA 1SU7A 3KV1A 1J49A 3P97A 3AM1A 4HBZA 3R3UA 1KI1A 4EIWA 1M67A 2Y77A 5B64A 1ZCZA 2AJTA 2Y93A 4HO1X 4I5GA 4PLGA 1HTBA 1C80A 2LKDA 3RRXA 4E88A 1AV7A 1U1EA 1YDMA 4YDQA 3BWXA 2H2FA 5HFAA 1INLA 3GU3A 2PXHA 3OMLA 4KBGA 4S24A 1TECE 3GJ3A 1GL9B 1YXMA 1ZH0A 1JECA 1VRCA 4X20A 2Q7DA 4DRXB 1FMTA 5GM1A 5E4TA 1M1NA 1QIFA 1L7QA 5JNUA 4JQCA 2Q8PA 5JZMA 1QF7A 3NT5A 8ABPA 2DQSA 3QWAA 4HH3C 3R7DA 1X7YB 4CKBA 5FTJA 2N9UA 1ADYA 4WBNB 3NHZA 5JZBA 2HU2A 3SQLA 5HUJA 5JW6A 2HPAA 4Z9FA 4HMPA 4B4KA 2CJPA 1LUAA 2PUTA 2QRKA 3HN6A 4R0VA 2PK3A 1ZD1A 2B0CA 2FSUA 3A04A 3HGTA 4RENA 2H57A 3F5MA 1R74A 3PUVA 2JJYA 3ZY2A 3VNAA 2Q3MA 2C9CA 4L75A 1LEHA 3C4JA 1U63A 1GTSA 2OC4A 3G68A 2EF0A 1T36A 2OLEA 4MW9A 4ZAVA 2AFVA 3DMYA 2G04A 1QYXA 2QAGA 1F48A 3GROA 2IXGA 3O0TA 3QY9A 5DBOA 5BSHA 1HFKA 3BJEA 3QTBA 4GI1A 3GUUA 1GAQA 2HN9A 2J6CA 1F9AA 3PUXA 4L15A 4QUIA 2X0FA 4C0KA 2FN9A 5IJXA 5AKLA 1DAKA 2JLSA 3WDKA 4BNDA 4ENSA 1Q1AA 3ANYB 3ELUA 1E64A 1QVVA 1UK7A 2HLDA 2IHVA 2DQYA 1MQ9A 3C74A 1CUZA 3V8PA 4X60A 3VNUA 4FCCA 3OLYA 1R27A 1X77A 1XNGA 1CY7A 3MS2A 4MI3A 4QQRA 4UNPA 4MWTA 5GOTA 4PTZA 1NVKA 2H1OA 4I08A 1SBZA 5JDIA 1LQTA 4YPVA 5J2TF 3VU8A 4UM9D 1YB5A 3L9WA 4TMWA 3LRPA 3M1LA 4IRUB 4UASA 4HWOA 2BEUA 1E60A 2IDMA 4KAJA 4CUJA 3A6DA 3IEPA 4PQGA 4U7PB 5EJ6A 4G0WA 2B83A 3FDZA 3D59A 1JG4A 3UENA 1KZ6A 1WR8A 4F7WA 2HJRA 4XJSA 2BM1A 1W93A 3FPAA 5H81A 5JSZB 3HCEA 2YJGA 1H0RA 1AKEA 4CM3A 2CBXA 3PEYA 3QX8A 4RH0A 4CMCA 3ZBQA 1L5SA 3B20A 4X41A 5TRTA 3ROFA 1DDOA 1EK2A 2ODNA 3H6KA 4CM8B 2ILTA 2ZE8A 1P2SA 1QP7A 4HXGA 4CLHA 5HE9A 1V39A 3IOCA 3RBAA 3VPSA 2IGTA 3IH5A 1T8UA 4UU1A 1U02A 4XI9A 4JUFA 3DFFA 2P78A 3E8XA 1M66A 2OO7A 1QKKA 3AT1A 3DW3X 4QXOA 3VQTA 4UOEA 4YPOA 2F8TA 3FY4A 2CVHA 3WGYA 1XVIA 1R4NA 3HXKA 5LDDC 1NJ1A 4PSCA 4UMFA 1IEQA 3NXKA 4II2A 2OXEA 1SCKA 2Y6UA 3HEBA 3JQ7B 4MULA 3BH7A 4U00A 4QUAA 2YWDA 4JT9A 3TLGA 2XTZA 1M0SA 2GPBA 3NUZA 4BLVA 4D0GA 1W36D 2Q9BA 1MEEA 2BEWB 3DMTC 2KS6A 2ZUUA 3QBDA 4MXDA 1Z15A 5CXSA 4DNFA 3FFAA 3D1LA 4WTOA 3H8WA 4LSGA 3O8QA 5HMLA 3VTAA 2Y27A 3QG5A 2AUMA 4DM4A 6AT1A 4WRRA 4D99A 1EQ2A 3L3BA 1N5OX 1TD9A 4L95C 2D2IA 3F6BX 4FCVA 4WFKA 1CUDA 1IPFA 1X7WB 2H5IA 5C32A 4G8CA 5LOVA 4LYDA 5T8KA 1XQXA 1UIMA 2DP4E 3FNFA 1F8FA 2EF1A 2R1VA 3KQMA 3LQYA 4IUCS 3PNKA 2FWNA 3IBCA 4CDRA 3H3XA 5DGCA 5JNTA 3G23A 3KNZA 3LPCA 4MV6A 4WLOA 5TVGA 3CUSA 4J1TA 3KLMX 1QFMA 2QORA 4FFOA 2NSYA 2RHCA 2V6MA 3EC1A 2JLCA 4GZ6A 4MYCA 4FGSA 1E2UA 4Q3KA 2FHPA 4OHMA 3C39A 4YFYA 3HVRA 2W37A 4GPZA 3QELB 1B14A 1LXCA 2EARA 2IYFA 2NYRA 3LT0A 2YASA 4DCOA 2VYVA 1H2ZA 3GO4A 3DOEA 2CL0X 2Q3JA 1HDGO 3OIUA 2AW3A 3LOPA 3EISA 1X8LA 4F56A 5LUAA 4DJDC 2F9FA 1H2HA 3GV0A 4AS1A 4XIFA 1HDCA 3ESYA 4N6NA 3MJVA 5CD9A 2P35A 1XAJA 1YC2A 2IIVA 4C4RA 1TCAA 1PQYA 3A1WA 3FLAA 2HA0A 1MC1A 1NVEA 1O8BA 1Z4IA 4MRMA 5DM1A 1T3LA 1KFJB 5LBUA 3A58B 3QV2A 3UJ9A 3QFRA 2B78A 2JCVA 2VAVA 4OXQA 4BN0A 1H0KA 1HDIA 2OBNA 3B6MA 2J9ZB 3D0KA 3TL3A 2YJ4A 2FWJA 4GOLD 2ZT5A 1EFVB 3HBNA 2HSGA 3SN6A 5JCPA 1KO8A 2PL1A 4LOKA 1D7OA 4WNIA 1RMQA 1O9GA 2JJ1A 3AM5A 3ZWKA 4BKUA 4DZZA 5KYYA 3IIJA 5F1OA 2WFAA 1YRHA 3JCZA 4QBFA 2XDQB 1M2HA 3LY5A 5CFPA 2V7TA 1WXEA 3FGPA 1RMYA 2O5EA 1ZI6A 1UADA 2G76A 3GEBA 4J4HA 4PG4A 2WM2A 3K73O 1YBMA 1SHTX 4UAUA 1OFTA 2JAUA 1GPKA 1SOMA 2OXCA 3CRW1 5IJZA 4CTKA 3OZXA 3JQRA 4NPAA 4NIMA 5JWOA 1HDZA 3MLEA 2AFHE 3UQZA 2XCLA 2ZB7A 4U39A 4BLSA 1NUQA 4JI2B 1JMKC 1DTWA 3IE0A 3TZCA 3OPMA 1MJNA 2D54A 3BX1A 4R6XA 4D3XA 4V1CB 5LKAA 3MJDA 3FN4A 3SBXA 3JPYA 3N6VA 2CCJA 2FV8A 3MTIA 2PCJA 1K1EA 2D3TA 1Z0JA 3KPUA 4JUIA 5AJWA 4Q4AB 2BI8A 1R0WA 4I6GA 3UT0A 1JHDA 4ZRMA 5KTRA 3CZ4A 3QVKA 1UMBA 1JHMA 1O6ZA 4GD3Q 3MT7A 4ER3A 2BFBB 5K8JB 1C5KA 4S0XA 3AJAA 2VYQA 3K0KA 3LV8A 4ATNA 2AG8A 2J9FB 4QECA 2BFMA 1OH6A 2ZSUA 4OP3A 3SHQA 2JIQA 3UY4A 3ZCVA 1N5JA 3EXFB 4ARAA 1BH2A 2V3WA 4OGWA 5CVUA 5KNLA 1QC5A 3OLCX 4XWWA 4N3BA 1CS0B 5DK4A 1R9JA 1NQTA 3ZXSA 3AF6A 1C30B 4GQAA 4YJGB 4CMAA 2GHQA 3WLPA 4GWKA 4DJTA 2FPRA 4G89A 4GAEA 3R4CA 4ZYZA 1S8AA 2X7JA 1G5TA 1P29A 4AF7A 4E5MA 3BL5A 1PN3A 1ST2A 2C31A 2W2PA 3Q0TA 4I55F 2VSYA 4CKCB 3PSHA 1KPIA 2CXQA 1NBME 2EGHA 4XW2A 2PUWA 3I6YA 2NXCA 1OX6A 3I5MA 4Q4DA 2QE7A 4YC7A 2OV2A 1XRJA 4UE2A 5IBPA 1RC0A 4B4VA 2VR1A 1DQYA 4FC6A 3JQGB 4A27A 1CUCA 2BP7A 2ZJ7A 2C96A 3AMVA 3JSXA 3SS8A 3F3KA 2AZ4A 3MA0A 1Z0AA 2EJBA 4FDLA 2IEYA 5DXJA 5KTKA 4DCNA 4ZTUB 5HYVA 1SZJG 2B5OA 2WJGA 5HQJA 4KVFA 5KYKA 3JWHA 4Q01A 5K2OA 2RK3A 1F2UA 4DDUA 2FGKA 3IPCA 4BZWA 1YR7A 2E3JA 1RBMA 1SU4A 1UUFA 2BGRA 4PANA 3UT6A 3TPFA 1IY9A 4B6EA 2B6HA 1LF0A 2XA1A 1NOKA 4M0DA 3TLCA 521PA 4XD7A 2I3DA 2RC6A 3UG6A 3AL3A 4OHXA 3AHJA 4HEHA 1BEEA 4R2HA 1M10A 1USKA 1QYVA 2BKAA 2JGAA 3C5WP 1EEXB 4URHA 1U5BA 3PRKE 1R6TA 2WVGA 3GUHA 3HCDA 3MF4A 1K7YA 3H1TA 5FOWA 1OOEA 2JK0A 4FMBB 3BF8A 4P38A 4X6LA 1AU9A 3Q9LA 3NKVA 4L0QA 1TIBA 4R1QA 4B3IA 4F2DA 1Z0ZA 4KXLA 1TM7E 4BP8A 1TNDA 2Y92A 3PHIA 4OF4A 4TWIA 5KQMA 1LPMA 5EINA 3FFBA 4JDUA 5A3JA 1BMTA 2J6HA 5IS2A 1JSZA 1F20A 1GSOA 2ZJ5A 3CIOA 3D8BA 4QC2A 3RUAA 3WRVA 3J7TA 1WMDA 4EFLA 5EE0A 5LJIA 2JH8A 2G0AA 1BHJA 1PTJA 1Q7GA 4JN6B 5KYTA 2RE8A 3EEIA 1YRWA 2LVBA 3IODA 3PR2B 1GPDG 3I6BA 4INPA 2AQ8A 4TWJA 1E2HA 4F1KA 1HXHA 1QIKA 1FDRA 2V55B 4J7CA 1UEIA 4RDIA 3RPEA 1KJWA 1AO0A 1N2JA 1QGUB 5KB3A 5LIPA 1ZVKA 1MAVA 2FG7C 3FZYA 1L1QA 4YIHA 4MVJE 1WB9A 1D0SA 4PBTA 1BN7A 1JHUA 2B2XA 4RSHA 1YI1A 1S6YA 5CB6A 1DWQA 4J0FA 1C9DB 3RK0A 1FY2A 2BGWA 4TMFA 2DTDA 2RGCA 3BXEA 4RE5A 3DLBA 4CQMD 3BWVA 3HVJA 2VTVA 4LY9A 4ESOA 3DT8A 1W87A 5F7ZA 2C1EA 3CMMA 3N1UA 4JS0A 3SS7X 3FPBA 3AINA 4W9NA 4W82A 2W6ID 1TIPA 4H7IA 5FNVF 2AZMA 5EIXA 3LU1A 4DANA 1VL1A 3C7DB 1NQAO 2MIIA 2YMPA 4LGMA 5B30A 2I99A 4YWJA 5HKKD 1E5VA 4MPDA 3IEUA 3NPMA 4TS4A 1O5OA 2C04A 1CP3A 3E2MA 1MIOA 2PZKA 5JS1A 4BMNA 1V4VA 1JAZA 1C41A 2OHHA 5ALNA 3UCFA 2XT0A 1WUYA 2IFTA 4L85A 1D1TA 2XUFA 4LXTA 3UAXA 4QA9A 4UHFA 5FLEX 1LB1B 1NN5A 2CJWA 3KRTA 4PYMA 1QTIA 2HV8A 3BRWA 3AHHA 3WFIA 3EDCA 3RVQA 2NAPA 2ZBUA 2UUBB 3C8HA 4KSYA 4IDHA 4UZFA 1JWAB 1R0KA 3FWPA 3QYFA 1P3Y1 1UDAA 3IVRA 2FUKA 4JYCA 1OAOC 4K3VA 4TROA 3TDMA 4B7XA 2C7BA 2YFHA 2C42A 5IKPA 1C0LA 5JD4A 1X80B 1SRRA 1RWBA 3P9IA 4P5PA 4E15A 2FSFA 2C8LA 3WTBA 4KQ2A 3LRTA 3NYRA 5BN5B 1KDZA 2RC5A 3UBMA 2XVMA 4LYEA 4E0BA 2YY5A 3E7DA 4G85A 3GAZA 4YA6A 3NNNA 4J75A 5IF3A 1YD7A 2XUPA 5L53A 4NEHB 3K0AB 3CEHA 1FUKA 1KMCA 2C5GA 2SKDA 3C3MA 3G17A 3K6KA 4KG7A 1A8UA 1S2LA 4X6XA 2R4QA 5IH7A 3R0JA 1R16A 1B74A 3LQ2A 4FSHA 4G97A 1IM8A 4AZ3A 2X14A 3D8SA 1U0HC 2BD0A 2JIDA 5GZ3A 5KC8A 2VZEA 1YU6A 3FM9A 3K9FC 5JI3E 1ADCA 2VHCA 3IP1A 4HNTA 1GZSA 4LDZA 1NR1A 2HUNA 2FPKA 2O07A 2EBWA 2W6ZA 4R0MA 3FSEA 4QVKA 5FV7A 2IP4A 5EL0A 4RGQA 1WUIS 3T7SA 1U7PA 2X7HA 3IUYA 1KMQA 1SQGA 1U3UA 2PKRA 2Q5OA 4Q9HA 4U6QA 4LGCA 3F3SA 4GC5A 4A16A 3UJ3X 3AHEA 1ZKDA 3FOWA 1VJRA 4BCBA 3ZJVA 4AKTA 4TTJA 1ZRNA 1VIYA 3PR3A 3R3WA 5PNTA 4BMYA 2VF8A 1TYEB 3HM9A 3DHYA 4TLDA 2QYSA 1N2CA 4L5JA 2VRCA 5CA0F 2DQZA 3T6KA 2REBA 2GQ0A 2D2EA 2VSOA 1VDMA 3A37A 1CVRA 5DOVA 3TLJA 1DUSA 2HDHA 3JW8A 3BRSA 1EX1A 2C3YA 1D07A 4IZ6A 3ZWNA 4UU0A 4C3UA 3C15C 5FWYA 3JRXA 1R7RA 4NZOA 2QTNA 2C2ZA 5JBNA 2XI4A 4XYGA 3S8MA 1LBIA 2DKNA 4IXTA 5T5QA 1Z56C 4RCZA 3L8MA 1SOVA 4CDNA 2PGIA 1G4AE 3FE2A 2R66A 2XBMA 1E4EA 1A69A 1OIWA 2Y1OA 3L7NA 3I45A 2R48A 2P9TA 3ZDBA 1WDMA 1KZ1A 1VB3A 1SC4A 1R9NA 2PS0A 4UE6A 1FQJA 1V4BA 5LMCA 4S05A 3LQFA 1WEKA 4H77A 1G20A 3RC7A 5KYWB 2IOFK 2OD9A 3SZRA 4Z3DA 4R1PA 4KXXA 1EWYA 1VBFA 3OPYI 4J1NA 1NSFA 4UUAA 1O94D 1F14A 1UBKS 4Q39A 1ZGGA 1JT2A 1KS9A 3FUCA 3PKZA 3K0BA 1P74A 5KYNA 3U7RA 2R11A 3GOQA 3RFUA 1DTSA 1J8DA 3GLHB 4GI2A 3KL4A 3VHRA 3PRJA 1TTQB 3GI1A 1V47A 5BSGA 5D3MA 2Q50A 1NR5A 1PFWA 1CUVA 3WDLA 1SK8A 5LZ9A 5JVDF 1Z4QA 2IY8A 3ORYA 4WZBE 2A3RA 2I87A 3GGJA 3PPXA 3WVNA 5K8LA 3GA7A 2IH5A 3H0EA 1K4MA 3NAQA 1E2EA 1C8LA 1JG3A 3NKLA 1OZHA 2F48A 3RUPA 1NVVR 3CX8A 2TMKA 3GUVA 1IAQA 2QAJA 5DYTA 5LCXA 2VQFB 2CDBA 5E38A 2I6GA 2O2XA 1B73A 2RGUA 1JN0A 2KI5A 2YHUA 4WLEA 4CL0A 4ACBA 3BXFA 3FJOA 3H4VA 3LC2O 1OGIA 2ZIFA 2NU9A 1ORWA 1GPH1 1FE8A 1XDZA 4NFYA 1JBKA 1U99A 3BMOA 4LJ9A 2DT5A 4N5MA 1G5QA 3WGOA 5AVTA 1FBTA 2W2MA 4DEVA 1BHO1 4BGVA 4DIKA 1C9JA 3LG2A 3I04M 4UXHA 5I01A 5G0TA 1DAIA 1Y7LA 2NO6A 1YJ8A 1M0EA 3KLPX 2NLOA 3F46A 3NNSA 4GXRA 4Y0VA 1S89A 3ZNOA 5EFZA 4FB4A 3A05A 1X13A 1X7GA 3LT4A 3P0RA 4LG1A 4HXFB 3VR5H 2BSQA 1I3LA 2BHNA 3GHHA 3TQIA 1ZNYA 2XCTB 1K7EB 1PK7A 1RRMA 1NW3A 1U2SA 1P91A 2E4AA 2WF8A 4P54A 5EGSA 1QIIA 1JR3E 3RTEA 3WK7A 2EFCB 4GYJA 3P32A 4QXPA 3U62A 1RI3A 3PHGA 4HD8A 4LXIA 3WNZA 5ALMA 3H11A 3PUWA 3ZE7A 2NSJA 2VTEA 2XOKD 3P9RA 3U13A 5I7WA 4DR7B 2WY2D 3P9XA 3IELA 2JAQA 1M6EX 4EW2A 1ICEA 1Q1QA 3MINB 2I62A 4ZVLA 5K01A 1NVTA 5GIPE 2DTEA 5DTEA 1L7VC 2R86A 3VHXA 4D8YA 2O8BB 4Z4IA 4N3NA 1NONA 5F9HA 3LGSA 4LOHA 3IAXA 2YXPX 1NTOA 3KSMA 5JSHA 1H8EA 3H86A 2BKUA 4E5KA 1D5CA 1DX6A 3Q40A 1LK0A 4OA8A 4NCBA 4QTUB 1GZVA 4LVUA 1O95A 2BMJA 4YJ2B 1L5HA 4IEIA 1T8YA 1M6VB 4JUBA 3BPSA 4ZAWA 1BGXT 2DHDA 3PHHA 2PSFA 3EIEA 3QFSA 2QL6A 2NUBA 4JELA 4HN4B 4GIBA 3HZZA 1C0KA 4GBJA 5JSQA 2BMWA 2YVUA 4YRPA 1RKVA 2GCNA 3BXHA 2RAFA 1L9KA 1KO4A 1ECPA 1KL7A 1IB6A 1LSOA 1G5IA 1TYZA 1ZKMA 2PRJA 3BUSA 4IDPA 5CM2Z 1T1RA 3WKCA 1G3RA 3ZD8A 2Z83A 4TKZA 1DC5A 1O94A 2EJVA 2ZYWX 4V0NA 2B3DA 3PLRA 4UFOA 5B55A 3LZ6A 1CY4A 5IYZA 3PCTA 3NH6A 4DDKA 5CEEA 3VDRA 4N5IX 3W2GA 1JVBA 1YUBA 2BZSA 2RHGB 1H1LA 2BZ0A 2QTBA 1CQJA 2IHTA 1ZD8A 1E4EB 2CLCX 3Q3HA 4G5XA 3R7WB 3H5AA 3MM4A 1T5BA 2AYYA 2P41A 3MN1A 4OU4A 4QDKA 4DSUA 2PEYA 4MR8B 2JRLA 3GLHE 1QOQB 2OO3A 3WMWA 1W85B 4CIBA 1HG1A 4QBHA 3BHJA 2TSYB 4PZAA 4YJDA 3X1JA 3N05A 2SBTA 5DX8A 4F11A 2JJ8A 4NYJQ 5FI5A 5HKKA 4PGMA 1A72A 4U7WA 1TB4A 1HT0A 2DBYA 2PD3A 4MV3A 2I2WA 3FCSB 3A9VA 1G8AA 2Y1FA 4E2ZA 4M0CA 3U7HB 1KEKA 2WEKA 1X94A 5KNBA 2GA8A 1ADBA 2JLXA 5I5GA 2ISSD 3CH5A 4M1ZA 4OLBA 2IYPA 4PZCA 3BD9A 2HQRA 2FX3A 3WYGA 5JSUA 3I9JA 4NX2A 4L3VA 4Y7CA 3UJBA 2R65A 3ZDZB 3TI7A 1UDBA 2FUG6 1T2UA 2ZAIA 1BWQA 2COKA 2HO5A 10MHA 1FPMA 1WULS 2D1RA 2QUAA 2X9QA 3I6QA 3WIOA 5BV2P 4JAVC 4BE4A 1FW8A 1B76A 2H7CA 2SECE 4ALLA 5K45A 1GM5A 5JC1A 5LYJA 3PUZA 3E3NA 4LSZA 4WXEA 2BAGA 1BA2A 1UKVY 1WPGA 2UUAB 1ZAYA 1KVQA 1WABA 3KPWA 4JJFA 4PLTA 4R8KA 4B47A 2R6GA 4G4GA 3D6NB 3HYSA 3L1IA 5AI6A 3RUIA 4CM7A 1Y1LA 2Q4DA 1ZUD1 3S70A 1E2GA 1VQ1A 4EPRA 3AETA 1BKYA 2R6FA 3P9KA 3O47A 5AHOA 2XVYA 1GA6A 3IVGA 4B8WA 5JQGA 2X0NA 1QYWA 4G5HA 3OT4A 5EWMA 1CERA 1ZNWA 3E7FA 1ZA1A 5CLHA 4JVOA 4QUGA 3CWZA 3LPLA 4K9NA 2CXRA 4NEQA 1N2EA 3NAZA 3OBIA 3QBVA 3QBEA 2J3EA 1Q3HA 1IONA 2A57A 4U2EA 5CB0A 3P2EA 1MJHA 3BWMA 5DBEX 4EW1A 1WDTA 4WBSA 4N01A 1XL0A 3W1EA 2ZANA 1I7DA 4B43A 1VL8A 1P2GA 1Z7EA 3UT5A 1QOPB 2BF4A 2YBDA 1YZQA 4OA5A 2HK7A 2ZE5A 3CEPB 5AHXA 5DEIA 3VVBA 5H4HA 3RDPA 4KFCA 1FXWF 1IXSB 1BX3A 2GCOB 4Q9JA 5FPKA 1GDTA 2CBGA 3FPLA 4OBWA 4YT4A 2C8JA 3RRJA 3TRFA 2XZTA 2DFVA 2QVYX 4K03A 4NU0A 4PZPA 1GITA 1DUIA 4AF6A 4QYTA 3H5TA 4BAGA 3NBZC 4M9RA 4QUDA 4H7PA 1WLYA 4EBBA 1CD5A 5BQ3A 5U9CA 4HS9A 4RSRA 1PSDA 2QL9A 1B93A 1P1CA 3BA6A 4XFKA 5IC5A 3VMFA 1EINA 2ID8A 2R8ZA 3H9CA 1V11A 1VJTA 4LEIA 4M9QA 1TVCA 3JQQA 2W2OA 1UPAA 2CZQA 3HY4A 5M7EA 5K0CA 1ZHHA 2OB1A 3I9MA 4OI4A 4GPAA 2KW5A 1G3MA 3A9TA 4PQYA 1UDWA 3CW9A 3LP6A 5KWVA 3VZRA 3Q85A 5E7IA 3OKFA 3B3FA 4RMNA 4DUPA 4PWZA 5CCEA 1JFVA 5F51A 4WBNF 3O26A 2H0RA 3GPBA 1DG1G 2CFTA 3GXOA 4U3JA 4CG0A 1FDVA 4UHEA 2RAUA 2BFOA 3JZAA 4UHJA 1QCDA 1ZRHA 4HDAA 1BA3A 4YT2A 4L3OA 1OV4A 3IEIA 4TSFA 4LZOA 4AC9A 1VHQA 4Z0HO 1AG9A 1MXFA 3V1KA 2YY6A 4C14A 3FKSD 4HFMA 5JT1A 3DMTA 1AD2A 1ZVJA 1DS6A 3LP5A 2EW2A 1DEKA 2IE0A 3KUXA 3G88A 4JJAA 2CXSA 4JLDA 3QMWA 5EQJB 5TQJA 1NLUA 2WF6A 1OE0A 1QRAA 1UT6A 1U2EA 4KVZA 3DXFA 1LI5A 3DDOA 1PGPA 2EZ8A 2Q8NA 3JU3A 2E9SA 3ETHA 4HAXA 1YQDA 4L4SA 4QRHA 5D7NA 5DV9A 2B99A 4D98A 3OCCA 4YMSA 3TW4A 5EUMA 1GYQA 4ARBA 2QHXA 5ALXA 3B3QA 1PJBA 3BRQA 2QK4A 2PJDA 3B9RA 4AROA 2EG5A 4ZARA 3OPNA 2BGNA 3U9LA 3W3AD 3DZBA 4U0KA 1V8ZA 3OPXA 4KDEA 1WHTB 4LW8A 1Z2OX 2CXHA 2I54A 5BUCA 3N8DA 3T3DA 5F52A 3UZUA 5BQFA 1N8TA 4IDGA 3I01A 4HQFA 3GAAA 3JQBA 3N2LA 3M2PA 1YMUA 3AW9A 5CA0A 1CUJA 4IY1A 1Z8FA 3Q2KA 2HOQA 4KJXA 2YMLA 3TRHA 3NHJA 2MMCA 2XZDA 3WLTA 4AJPA 5KDOA 4KUGA 1TO2E 2PJZA 5DX1A 2ZJ6A 3WLIA 4YS6A 2WZQA 4F4JA 1UQRA 3TLKA 1GPWB 3U7QB 3L7MA 3QMVA 3OO1A 4KI7A 5CD1A 1CB7A 4KZPA 3I5XA 4F6LA 3LPMA 3RTGA 3SBOA 4MDYA 1NC3A 1FYDA 4BBZA 2FN4A 3QXCA 4RUKA 1OV6A 5DP2A 1RM4A 2Z3ZA 1SKYB 4A4DA 3TZ6A 1SC9A 2I2CA 4HR7A 1CR1A 4J29A 4MEBA 5E3HA 2H3HA 1K4KA 4AP6A 1V3VA 2NTNA 2GCEA 5ALLA 5DSZA 4Z4HA 3R2JA 5A62A 1W4AA 4A82A 1QKJA 2VPQA 5CLIA 1JTFA 1F2UB 5T6BA 1NXWA 3V00A 6REQB 1FW6A 3E9NA 1E0AA 1JSXA 4MS3A 1UFQA 2HCJB 3GDGA 5NLLA 4HQLA 4CKEB 3WGIA 3U44B 3L6EA 1KJ9A 1M34E 3HV2A 4EUEA 3L8DA 3R40A 5C1DA 3K0FB 4FUTA 1KNXA 1QAMA 4JBHA 1CUBA 5K1ZA 4OGGA 4JA0A 4RHYA 1NXTA 4L8FA 2VJAA 3EXIB 4CKEA 3U44A 2VO1A 4NBWA 2SCUB 1EU1A 4LV6A 1NYLA 2A2ZA 1L4NA 1OLXA 4ME6A 1L5OA 4N0QA 2O2EA 3KZMA 3K8QA 4MS1B 1VFPA 4CR6A 4M0KA 4LY6A 2QVXX 3OIYA 3GZTB 4ZMSA 1T4CA 3LY7A 4D3YA 2PRYA 4LF4B 5T4FA 4YIKA 5LMZA 1D7AA 1DB3A 4MQ5A 5LM3A 2AKEA 3LI2A 3OG9A 4TXLA 4ZC8A 1OILA 1ONNA 1P7YA 5JD3A 4FZ3A 2XJ4A 1RQPA 1OLSB 3BFKA 1X1EA 4HB2A 1NRXA 2XCIA 4RVSA 4U9IS 1GUAA 3DAFA 4LVNA 5I9LA 3HC7A 5FLXA 3IHKA 2WG0A 3PVSA 1A88A 2VHEA 1JILA 1L1FA 5EG5A 1MQSA 3S2YA 1KK3A 1U2QA 3ZGYA 1ARZA 1XI2A 2MYUA 1J0EA 2R1TA 2PKCA 1BN6A 2GN6A 4RV5A 3VR1A 4C76A 4KQXA 5JAQA 4RPIA 3TL2A 3PI6A 3H4MA 1OU4A 1DT5A 4H7JA 5J2TA 2WUEA 3EQ8A 2DWQA 2F1IA 4G5RA 3H5IA 4PO3X 1U3FA 2ZT7A 5EIBC 3OUZA 3MOIA 2XNHA 3O1IC 5AKZA 3QOYA 1RW4A 5JS7A 2J3MA 3CUUA 1JR4A 5DT9A 1RSZA 3S27A 4ZYLA 1SG0A 3VAAA 1L9XA 1NSTA 2EJWA 4MKRA 4TYPA 3KPYA 2RD2A 1WV0A 2JIOA 3FGNA 2FPOA 1O5IA 1Z35A 1UKZA 3S0JA 5HBGA 3K4HA 1VDZA 3A1FA 2VAWA 3CIFA 3PGJA 4JLKA 5CX4A 5F12A 3U4CA 2IS1A 3I2JA 5BWMA 1DV1A 2G6BA 3NBYC 2Y68A 3T3NA 1YDWA 3NC0C 5I9SA 2FVYA 1PGOA 2GXSA 2OEPA 2X6TA 5EMHA 4GI5A 1GRVA 4RZHA 3DF7A 3U0BA 3GR6A 1RAGA 2G3YA 1SQ5A 3JVUA 1R0YA 2YWEA 1YR1A 4OHWA 5ALVA 3CXRA 3SX0A 1YT5A 4IH9A 3URKA 2C95A 1Q50A 1ZONA 2OOKA 2RGBA 1IIRA 3NJ4A 2HA2A 4MRNA 3P26A 2YN0A 1DL5A 4MITA 5AW5A 1NMQA 4OI1A 2A5FA 3ROEA 4KR3A 4BMPB 3C6BA 3MJCA 3THSA 1KORA 3M3HA 4EUKA 1TT7A 2DC1A 1MVNA 2HFJA 1CBUA 4NF2A 1V9CA 2VN8A 3D7RA 3HDTA 5C8DA 5AI0A 1J1IA 3R74A 3DBOB 1H4SA 1QR6A 4MUGA 3TLAA 1AHNA 4GNRA 3GAMA 4LXYA 4IGFA 3GX1A 1P18A 2H2AA 4H9GA 4DIMA 5A5GA 3IOYA 1Y9JA 3KB1A 4PW0A 4JJGA 1T15A 2M1XA 2QGZA 2D59A 3EIXA 1M1YB 2C07A 4TPKA 1VMDA 3NR2A 2YOGA 1KQNA 1IM2A 5H5JA 2P9FA 4IFTA 5DF1A 4NOKA 4E7OA 4MAMA 1XGKA 4NAVA 1D2NA 3H8SA 1VC2A 3PTZA 1YRYE 4HDKB 2ZYTX 4YYZA 3KWFA 1JEEA 2F64A 5IDVA 2OAQ1 1KQFA 3TGLA 1A1SA 4U2BA 4DQDA 4TV8B 3ICQB 3LX8A 3RG8A 1H42A 1XMOB 3FZQA 3WB9A 2O7SA 3OA2A 1WDLA 1TQ8A 4Y2YA 3I2GA 2QENA 4BFUA 1HH4A 2ZRAA 3JQ7A 4BUJA 1JFLA 4UDXX 4FGZA 1WP4A 4KNVA 5HILA 1YFLA 4D9GA 4J1TC 4D3ZA 4ILEA 5HM6A 3DFUA 1RAFA 5KNDD 1NZDA 2NV0A 4I36A 4RADA 4N6OA 3W5AA 3NU1A 1JEQB 3HBFA 1OJ7A 1TYAE 3V2UA 4CF4A 3VO8A 4G1BA 1ID1A 3CGGA 3ETLA 1XR3A 5K9ZA 1US8B 3PGKA 3B6EA 5SZHB 4A0SA 3OHSX 5CDYA 5ERYA 2B61A 3IHTA 3UWKA 1YOBA 4GMHA 4UAVA 5IYZB 3SF8B 5JQGB 3EG9A 1N7GA 2QM8A 2VATA 2X1MA 4U2FA 5ALSA 4J0HA 1XVUA 4KO8A 1EDEA 4AY6A 1XWFA 2GPWA 5TGTA 3RHFA 1FMCA 1MAWA 3FFWA 3EG9B 4YUYA 1YI0A 2UZIR 5EPOA 4FBLA 4JB0A 2AJDA 3QOFA 5HDBB 2CHEA 3R7AA 3VDXA 1WSDA 3QVUA 1HSOA 1LZLA 1V6SA 1YQUA 1PR5A 2HNAA 3L93A 4W5OA 2X5OA 4AKIA 5J5CA 1IWPB 2IBSA 3HXMA 1LI7A 4J0GA 4V2UA 4WESA 4ZZIA 3H7IA 1IVNA 1GRQA 2WIBA 2VLBA 2FSHA 2HCFA 4IMPA 2Y76A 4KIUA 1ES9A 5A6VA 1CTQA 5HR5A 4MIEA 5A5DA 5F98A 5AUQA 2PXAA 2WRZA 3MERA 4JI8B 3PNOA 1PNOA 3V8NA 4F12A 1VYUA 2GBPA 4YP6A 3EZYA 3CLSC 4YYEA 4WLFA 3P2IA 1AKNA 3PFFA 5I9IA 3QHQA 5HMMA 1K27A 4Q3AA 4UW9A 3EGWA 1EXMA 3LMKA 4JBIA 4RWEA 1OXVA 2JD0A 4KR6A 3K1TA 4S04A 1O95D 5KX5B 1MO5A 3B6IA 3PEVA 3UJDA 1KI6A 3CRMA 1K06A 2B7LA 3TO5A 3I9OA 3T5TA 2VH2A 1Y4AE 3QLVA 4IMIB 4DNPA 4QU5A 3D8HA 1JYFA 3FUVA 1GOTA 3KR1A 3BYZA 4FFLA 4R51A 4H7HA 3M9WA 4ZVPA 1R37A 1CC1S 3UUEA 3RSFA 5K0GA 4BNVA 4MYRA 1G8GA 1KMIY 3F6YA 2EZTA 1Q1EA 4GM0A 3AESB 5K8CA 1GZHB 3JS5A 2YQ4A 1OUMA 1V1JA 4WKGA 1Q7TA 1HTTA 2FZ4A 1AQ6A 5EKXA 3UW1A 1RADA 4HNHA 4JNKA 2GEDA 2XB9A 4PX5A 4BASA 2BEVA 3LIIA 4CG2A 4Z54A 2QUIA 2VXYA 1EHYA 1PEKE 3TMAA 2Q1SA 4MGIR 1GXSA 2C61A 1QTRA 3GFVA 2YNMA 3TK1A 3HHEA 4BO2A 3SKVA 4YDRA 1IWBB 5KINB 4LGVA 2NU9B 3HJFA 2R0QC 1YRQA 1Z5OA 3EFBA 1FNBA 2PKQP 2VJMA 2WWFA 4MI1A 4ANFA 1PFKA 2H08A 4I1PA 2H2GA 5C52B 1H23A 3RFVA 1UDRA 3TG2A 1OH7A 1E4OA 3T4PA 3L1KA 4XB1A 4M1MA 2NZVG 3LUCA 1UBSB 3WIDA 1ZN2A 4ZDJA 2A0WA 2AKAB 4Q1EA 1LTHR 4TKUB 4CN9A 1M1NB 5EEGA 1CZRA 1CJVC 1DXYA 3L06A 3OZFA 1WY5A 4URFA 5DASA 3W79A 2IEBA 2OPBA 3R6GA 2CLOB 3QLEA 2WWVD 5CW2A 4B32A 4UNIA 1F51E 4FFDA 5EKUA 5AR1A 2A88A 2EU8A 3N2GB 4JI6B 5ITSA 3UUWA 3HN7A 2OP1A 4RXTA 5F2EA 2Y0DA 1XTRA 3EARA 2W2KA 2GLXA 4YFVA 1N25A 3RVBA 3FBWA 4MV1A 3GLTA 4GKBA 4G2TA 2P9CA 2BDTA 2PQ2A 3DDHA 3V9AA 1XF9A 3V4FA 2PMFA 2IHYA 4KAXA 2EDCA 2GEKA 4RC9A 2UYGA 1BAPA 2ZQ5A 3STUA 1ZZEA 5JV5A 3KK0A 2O2JA 2OXFA 4YV2A 3FG9A 4JU8A 5A3VA 4BS9A 2LW7A 3GVIA 5KYWA 4BNWA 1IDN1 4IXDA 2POQX 3IX7A 3NRJA 4AI6A 2V1XA 1SXQA 2ZRHA 4C29A 3FPEA 4MUYA 4WOPA 3DQZA 1EUZA 2QTAA 1V3QE 2XDWA 3GLUA 4OQZA 4ER5A 5JZOA 3F5DA 1C0IA 2GPYA 1SCQA 3W5SA 4GZ3A 5I7FA 3U26A 4WD3A 4EJ0A 3CYFA 2O8CB 5AVQA 1RI4A 4QICA 3EGVA 3T15A 4CMEC 2FJ0A 3QWFA 2ZWIA 3J7AC 1VJCA 3ASUA 1LD3A 4FJ1A 1U7ZA 2ZI9A 1LLQA 3F3MA 1GQ2A 4GX0A 4J8PA 4YV7A 2JFPA 1CG6A 4LI0A 2W6PA 5CH3A 3D1JA 3IOMA 3FSGD 2BKXA 4ZCMA 2CZGA 2X0JA 5BN3B 1ORHA 3OZGA 2WBLC 1PUJA 3STHA 5I6DA 4MB2A 1ZSYA 4HAWA 3WMGA 4AX4A 1NVUQ 3MBOA 5DZSA 3RW9A 3WRYA 4CV3A 1SHUX 4DC1A 3MZ0A 4FDTA 2FFRA 3KSUA 2CN1A 4I1OA 3MXOA 2FSPA 4D26A 3L41A 4XR9A 3FMGA 3BOSA 1A04A 1MOPA 1PWEA 4MA4A 1CDZA 3KTDA 2O2HA 2WKWA 2CNOA 5EJ8A 4IOKA 4ENUA 1KK2A 2IW3A 4O2AB 4CTJA 1LQ2A 2NT3A 1VOTA 1F06A 2HMYB 1U3CA 1HYBA 3OE7A 1TMGE 3G1WA 4PCVA 1XHFA 2K2WA 3NBXX 2O4CA 2RHRA 4OQLA 3PPYA 4FOOA 2X0DA 1TJ5A 1GEEA 1EFCA 1JPNA 2XLBA 4ND1A 3R3SA 2RJOA 4I6JA 3T9DA 2HT1A 4MTCA 1JEAA 4KNYA 1EAYA 2RARA 5D01A 2AVNA 2XLCA 3RVLA 2ZTUA 3RAEC 4D7AA 5KS2A 1T0UA 4R8SA 1GLNA 3WGJA 5FTLA 3LQ4A 2CXOA 4UU8A 1ISMA 2IYXA 1EA7A 1NX9A 1U3VA 3GVXA 1X9HA 4JLBA 1KMMA 2AX4A 3C3WA 4F3YA 3ISVA 3BZBA 2RHWA 3GIDA 4Y98A 5DHAA 3RVJA 1ZLXA 3M6MD 4U2DA 1TA0A 2MYNA 5TMDA 3OEYA 4AN0A 1CF2O 1S9HA 5KSYA 2ZBRA 4AECA 2FG5A 1E3WB 1AO3A 3DOFA 5EJ9A 1UR5A 3KZVA 1ISIA 3CNBA 4A8PA 5BN1A 2D4HA 1XJ5A 2ODWA 5D51S 1CUSA 1N5IA 2VPYA 1DQPA 3ZK8A 5A71A 1GUBA 2NU6A 4I8XA 1MC4A 5AM2A 3GFTA 5C34B 3DV0B 3CF6R 1XC7A 2YIMA 2CKDA 5I4BA 1O58A 2B25A 2A9RA 2IXDA 4Q9NA 2RHOA 1WXQA 3IQIX 2QE7D 3V7YA 4E4RA 3VU0A 4E51A 2F6RA 3KKZA 2J4DA 4JT8A 1SA0A 4CQLA 1HE2A 1NFFA 3BQ9A 4TKLA 1EFKA 5ECWA 3KJQA 3UK7A 1R3DA 1Y7PA 2PTHA 4TUYB 4NNOA 3ZWQA 4MVJI 4PZEA 4HNVA 1T1JA 1VMEA 4U2GA 3OIFA 4IWNA 4ZU1X 3M5WA 3ZZNA 5DHPA 3U1BA 4GC9A 4X44A 5K8TA 1FX0A 3EMBA 1M6HA 4WNCA 3GVPA 4UTOA 2GBLA 2P3QA 3TR5A 4KN6A 5ADHA 2C3OA 2ERCA 3D7KA 1IPHA 3SG0A 5C1OA 5KTYA 2BI7A 5KNDA 2WNHA 3MTEA 1EFUA 1K5GA 5J2UA 1EVYA 3AHCA 1J4AA 4PSAA 1Y3HA 3SJBA 4KN5A 5KKAA 1UBEA 4NZZA 1EXDA 2HH9A 3O0DA 5EYPB 3I61A 3UN1A 1CT9A 1PVVA 1FFDA 2BHSA 3ME5A 1GTVA 3EZ6A 1KAHA 3WLHA 2FMFA 4G26A 1ID8A 4PFQA 3U6BA 5LA6A 4RVHA 1SQFA 2CDCA 3TIXB 3JQ6A 1WOYA 2CZCA 3CWCA 4NHEA 1Z74A 4IPTA 1CW2B 2FMKA 4LNUB 1NULA 2R8OA 3Q7QA 2WP8J 2H6EA 5CR9A 3ZEIA 4A6EA 3GEHA 1XA0A 4AY2A 3D5QA 2XQGA 2E48A 4XLZA 3II6X 1BH6A 1Q0HA 5GQSA 5SY4A 1T5IA 4AJNA 5DN9A 4N7JA 4DV6B 4WXMA 1U9IC 5AOVA 3U7JA 4DLXA 3OLVA 4PLFA 2BGJA 2RG7A 4XJXA 4KH1A 1P1BA 3ECCA 1D04A 1MX9A 3KVVA 4FOTA 1U1IA 3MQFA 4L72A 4GDFA 4PPYA 5FTKA 5I7OA 3KCNA 4WSOA 3KKOA 1M1ZA 3HB9A 1RXSA 2QQFA 4DBLC 1K08A 1DC4A 2Y67A 2JFHA 2I2FA 3EDMA 3ND6A 3D6TB 2AB0A 2AMYA 1SH7A 3W06A 2DSTA 1IJFA 4OXYA 4Z9AA 3USZA 2XODA 3QH4A 4H1HA 4JP1A 5TX7A 4I3FA 3TD6A 5DM4A 3ZHQA 4WADA 2JJMA 2ZVQX 4ZHSA 2IK8A 4A0FA 1UBRS 1ZNZA 1VL5A 1TMYA 5IVPA 3BFXA 3F8SA 1WBBA 4JA2A 4LZWA 2HU5A 3G9UA 4YLGA 1BQ3A 2GBFA 3WLFA 1R6UA 3B3JA 3L6OO 1QLWA 1P6UA 2QS9A 3M5DA 4FHGA 4G9EA 3ESDA 4PHTA 2IBMA 5I8PA 5LXTB 3A36A 2ZUBA 5HHTA 1ACMA 3AF4A 2NYUA 5EUCA 3PIIA 1OZAA 1VKRA 3RYIB 1HYGA 3L1JA 5BMVB 1XA3A 1KVRA 1HURA 2JVIA 4V1CI 3R9WA 1W8DA 1B26A 2Q3DA 1LLFA 4RIEA 2XD9A 3WC4A 1WCV1 1K6XA 4RF2A 2VSQA 4LOLA 1OY1A 1L5VA 4PX9A 5DFAA 2ZB3A 2XXAB 2H9AA 1PL8A 3IXLA 3KXLA 1EGQA 3R5XA 4C03A 2A0UA 1A4RA 2AGVA 4ZK2A 2XW6A 2R00C 2VF7A 3LFUA 1VL0A 3IR5A 5BPHA 4LQLA 4G37A 5CH5A 3R6LA 4Y9UA 3UA4A 2WT8A 1FP7A 5JY6A 4C78A 2VQDA 1W4RA 2D5AA 1K6JA 3IQXA 2ICAA 4NABA 3DZFA 4C7VA 1NOJA 2YRFA 3KWLA 1N5RA 1OKKA 2OAP1 5DPMA 2V59A 3HU5A 4TRRA 3ZTWA 1KZ4A 3N6RA 1K92A 1OBCA 1X0XA 1U9JA 2AVDA 2BMVA 2XNDA 3H2YA 3QIVA 2HR1A 1JJVA 2FMHA 4E2XA 1ND5A 4FYYA 4Z1OA 3I83A 1QH1A 4RORA 3WIVA 1SCNE 3PJDA 4Y2RA 3A06A 2I6TA 2NQTA 2JHCA 4HDQB 2YHAA 1PJZA 4GSKA 1QV6A 3DDWA 3OOEA 3EQ9A 3QPAA 1OWMA 4KLAA 4L9RA 4MCIA 5BN4A 3DL4A 2C82A 5A6SB 2FOXA 2W5UA 4QEZA 3WBFA 5GZ1A 5F9FA 2NU8B 2DFNA 2G7MC 1CJSA 5HIKA 3HO1A 1VPEA 4R2WA 2FSVA 5SZJA 2CL7X 4JHXA 4KK4A 1ZJJA 5EFOA 1DTWB 1H6CA 3ASZA 3V42A 1K7FB 1L8OA 4RHTA 4AJOA 3AIMA 4LCBA 2UZ1A 5ALQA 3HR8A 4FLEA 3S29A 3E18A 4IMJB 1PV1A 3OPQA 3RVMA 1W5SA 2GJ9A 2ZBEA 4JLSA 5G3YA 5EESA 4US2R 3KKKA 2JFUA 1U7UA 1K4YA 1B8PA 1LZKA 2ATXA 4U6SA 1KI3A 4PFKA 5FQOA 1U8EA 3V80A 1XQ6A 3C1OA 3PQ6A 4IBOA 5F2KA 4HQ6A 4F6RB 1V95A 2AG6A 4K6MA 1ZISA 4X64B 3OQMA 4D0SA 1QTNA 3DUFB 1NW7A 2VCHA 4YRAA 1NJ6A 3QJGA 1KU0A 1Z6GA 1DEOA 3CY6A 1P0MA 1CDOA 3FLMA 4L8GA 4L5BA 2JZCA 3C1UA 1RR6A 1SR8A 3JTEA 3T4XA 5DYGA 3FTEA 2JCSA 3FHTA 1XKXA 2IDZA 3DO6A 4KK3A 3VO9A 2FZKA 3R0QA 3I37X 3JALB 2B9VA 2GK3A 4HLCA 1OFHA 2OZLB 2XIJA 4C1NA 2XE6A 3DDNA 1MX3A 1USVA 1R5BA 1MX1A 2EAUA 3E82A 3TTSA 3BKXA 1EBFA 5E2IA 4KWHA 3U5TA 4X62B 1F6WA 1QPZA 3LT1A 1P6XA 1II8B 1S8FA 1LPSA 4FQ7A 3X1DA 1KOGA 4BVBA 3AR3A 2GNAA 4DJAA 1E5QA 3PXDA 1UF9A 1J20A 1QGOA 2V6JA 3KSDO 4FPXA 3UOWA 3VGPA 4BO4A 4JCCA 2IH4A 4X1YB 1Y98A 1APBA 5DO9A 4MJXA 3ZIAD 4MK4A 4PLVA 1JXMA 1BXKA 4EAAA 3OCJA 4AD8A 3EIWA 1E1QD 4OHPA 4YRDA 3X2EA 2H16A 2Z56A 2GVDC 3VBEA 1VE9A 5AUNB 5E7JA 5KC9A 1ZOIA 2JFVA 3BL6A 1RCUA 4KLNA 3SX4A 2V6BA 3NVMB 4RTMA 1CP2A 2G36A 3HDGA 3X2SA 1V8PA 5KTOA 3L04A 3WOVA 5ANRB 2W4IA 4TM8A 2FK8A 2OTCA 5LDGA 4V24A 1TAUA 3OFNA 2NG1A 4I4LA 4RJIA 4V02A 1W36C 4OB8A 4EWLA 3KOXA 1QF9A 1JW9B 3IUBA 3U4HA 3WBJA 4F4IA 1PLJA 1L8QA 2BZGA 3Q9UA 4ID3A 3L4JA 4CFSA 3STWA 1Y7TA 4GKKB 1V43A 1JSRA 3BGWA 2OGWA 4ZREA 1PL0A 1D09A 1DXQA 5G4KA 2O7NA 2H65A 2Z6AA 2HC9A 4NJEB 1U0FA 2OQVA 1TZBA 2G5GX 4BVHA 5K4GA 4EEZA 1GGJA 4J0CA 3RRBA 4LXQA 1GKUB 3T4UA 4HJRA 4GE3A 4JLUA 5AK0A 1WQ4A 3VYRB 1JKIA 1LRKA 4E3ZA 4P32A 4IUYA 2IX9A 2ZKIA 1IUOA 5IJ9A 2X77A 1TC1A 1Y1RA 4OUDA 4R8VA 2IXEA 4UTVA 5B2EA 4KWTA 1IB0A 1NQVA 2HLNA 2IZOA 3T7DA 4YCDA 3RT7A 4K0RA 5IARA 1Q3KA 1UC4B 4KXWA 3K09C 1TZKA 3RIMA 3WIEA 4AT1A 4KPGA 2ET6A 4QBTA 1PR0A 1US8A 1E1DA 4UM7A 5IZ4A 2I03A 4KLZA 4C7XA 1Z7BA 1G5RA 1NBIA 3L2OB 3NIGB 1CUXA 1DO8A 1X42A 4AURA 2D0OB 2XNJA 4QJBA 3RROA 1L5GB 3LHFA 1E63A 1YAJA 1RXYA 4NCKA 3C41J 3ENZA 1P0FA 2J5BA 1U3WA 2YVQA 4Q6BA 3AY3A 4I1YA 3TD2A 1Z6YA 1S2OA 3STXA 3TLYA 5H8WA 2VPTA 4O4LA 1IDOA 4X8OA 5DULA 3PC4A 1Z6AA 2BR5A 4X97A 1H2RS 2KX7A 4HN2A 2UVPA 4MLCA 4MLDA 3Q72A 1XD9A 2WSMA 1XZJA 2WJAA 3JASA 4JFAA 3QX3A 9LDBA 5FULA 3UAWA 3GDWA 2WU8A 3UAZA 3DEAA 4G0NA 4I46A 2N46A 3COPA 4AP5A 1QGAA 4I50F 2J7PD 1JIKA 4NRDA 4BQPA 2AC2A 4TV9B 3PXUA 3MJ4A 1ABEA 3LBAA 4MYDA 4EHLA 1G42A 5A9SB 3M0EA 3WZ2A 6ABPA 1UBCA 3ZU6A 3LY8A 1TAQA 2HIAA 2X2OA 4WFQA 5JPIA 1CQJB 3DOUA 1OYYA 3S2IA 1I2AA 1Z83A 3ZIDA 2IIBA 2OQRA 2XMRA 1ACLA 1JLSA 1ABFA 1W2WB 4DMCA 1JMVA 3IULA 5HZMA 3TJZA 3D2AA 1U0TA 2GM9A 2WSLA 4JVNA 3SZLA 3QTLA 1RLOA 3DT6A 1FCJA 3MMPA 4KFRA 2J08A 4Q1DA 4YVFA 3RRFA 4BTVA 1RP1A 3HDYA 3KQLA 2VA8A 1YR6A 1C1DA 2BY4A 2HHJA 3ZJUA 4W9MC 3VR5A 5KDDA 2ATIA 3CR7A 3SZUA 1YS9A 3G2IA 4INOA 121PA 4JJIA 4YP7A 4P58A 2C8VA 3FZEA 2WWGA 3SMQA 3ZY6A 4B45A 2XB2A 5IJ0B 1D6JA 2HREA 4QDTA 1UFKA 3LT2A 2G09A 2HQBA 2YJZA 4FSDA 5EE1A 4MR9A 3AV3A 2X8LA 3VR6D 1H6DA 1UOPA 4GBED 1RAIA 5D5HA 3SFTA 3ZLVA 3HFSA 2OBYA 1CUUA 1J8FA 1HLDA 2QD1A 4GUAA 5DNWA 2UYQA 2R8PA 2EBHX 4G0PA 1UAAA 1NNI1 2G88A 4YRTA 3NHAA 1GAEO 4WH0A 2OCGA 3FDZB 3PKIA 1RQXA 1BVHA 2ATCA 3CMCO 3GFRA 3A10A 3OJCA 4RCYA 3TAUA 4F9GA 1GL7A 3K1YA 1IK4A 1T9GR 4ITVA 4MZXA 3DWGA 4AW9A 5FBZA 5AJHA 5C31A 1RKQA 2C5FA 3FYTA 3OE5A 5FOUA 5GJWC 2OD2A 2QYTA 3IT0A 1PQUA 1JIVA 1AUQA 1AF7A 1EKXA 1L4MA 2UUPA 3CNNA 1YE5A 3IUSA 4X8LA 3OF2A 3HBLA 4KYUA 1KSGA 4DMUB 2JAOA 1T9BA 3WNBA 4QYXA 4OQ4A 2QLMA 1Z0SA 1SZDA 3I92A 3Q0IA 4IW3B 4NMXB 2MSLA 2PX2A 3JV7A 1L3CA 1VSTA 1WZUA 2CJWB 2H1IA 1KI7A 1T9CA 2P9QA 1CQPA 2PO7A 3H0CA 4LECA 4LJ7A 3WY9A 4XIGS 4BFSA 3QLVC 4EY3A 3PNQA 4Z9YA 5LQSA 1XTVA 1XCLA 4CMKA 4E1VA 1OXTA 4BO9A 3UATA 4G9BA 2P5SA 1KEUA 2ORED 3WLNA 5HS4A 5IK2D 2NZYA 1S1CA 1ZN9A 3NEJA 4J0IA 4QFBA 4MAFA 3KLNA 1C9EA 5EXPA 4YUWA 3D6UA 4PBRA 4NV0A 2DULA 3HUFA 3Q15C 4C0SA 1X86B 3LC7O 1ESCA 1X7XA 2OFPA 1PGNA 1RYHA 1PJAA 3HKDA 3O4FA 2FN7A 5KWEA 4ZEWA 1JEOA 1N7JA 5E8JA 4DGSA 1B6GA 4L6CA 2F55A 2P4SA 3RB8A 2WC1A 3ZV3A 1NXQA 5I3ZA 2JK1A 4LZPA 1N77A 3A4TA 1JVNA 5KOJB 3HEAA 5BOSB 3ZD7A 4ON9A 2GEUA 5AJZA 3B1VA 3MTJA 2ZUFA 4NVRA 4ENWA 1OCEA 3O7MA 2IGBA 2VDKB 4C3ZA 1DKRA 3GFOA 1D03A 5KWIA 3U1TA 3D3NA 4FFWA 4PQEA 3WRXA 3K6RA 5HA5A 3UVEA 2NZXA 1G8FA 2R5FA 2EL9A 4K6KA 3VAYA 3W6OA 3GPIA 1SVWA 3TJMA 4X3PA 2OLJA 4EGCB 3KHTA 1P4GA 3C6YA 4R1MA 3VU3A 4WK4B 1AJEA 3LCMA 1J56A 2CHUA 3CUWA 4MQUA 3FNEA 1A5ZA 3HB1A 5C5DA 4F71A 1QK4A 1X92A 4EHJA 2V4ZA 5CNIA 4R68A 2A30A 1UPUA 3NTLA 5FL7A 2PV7A 1ODKA 2DH6A 3B82A 1Y7HA 3CG0A 4LJYA 4TMVA 5I7SA 4AUKA 4LHSA 1A9RA 3KQVA 3VYWA 3AKZA 5FOQA 5JBQA 2ODBA 4L0CA 5E9AA 2QD4A 4YK7A 3ZUGA 3D6VA 5A6SA 1CDDA 4RJLA 2I2AA 4FI3C 4ZT3A 1R5NA 2IU0A 2DU8A 4MWZA 1BCSB 1SKAA 1QE5A 2AFIE 3KAKA 2P2NA 1UPFA 3SU8A 4F8JA 5EWLB 1FNNA 1T8WA 4EW6A 3JWIA 1MF7A 1PF7E 2JHAA 2O1WA 2IJGX 1BS2A 3JYPA 4O2BA 3QQPA 4OIMA 5G41A 1U98A 3F90A 5IW8A 1ZM9A 2IYLD 1D1QA 3O4JA 4OXXA 5IAEA 1B0ZA 2ZT8A 4E11A 1SOUA 2FUEA 2OQ2A 3N76A 2FPXA 4BNKA 1DELA 5BYJA 4LOJA 2AJBA 5FWYB 4LY3A 2JIZD 1T4CB 3BREA 1A8QA 2R7MA 1HDEA 3UWSA 1U1CA 2RGYA 1H2YA 3GRRA 4M36A 2Q7OE 4AUMA 3LDUA 5HOEA 5LQJA 2RGNC 3OQ6A 2V96A 3PWSA 3AUAA 4LV8B 4NY1A 5CDFA 1A8SA 4MGYR 4B31A 3EYWA 4FYIA 2YH2A 3ZE1B 5FF9A 3RSOA 4DLSA 2ONKA 2QMZA 4C5BA 5C8VA 1OH5A 1FYVA 5KQSA 2FW7A 1P61B 3A4LA 2IXBA 4KWCA 1KJZA 1T3ZA 4MWBA 4K9PA 2DUUA 3ORQA 2RHHA 3ZJYA 3A11A 1GQSA 2FMIA 5GM2A 3M4YA 5B6IA 2M1ZA 1P7CA 2G4LA 2VP4A 3H9GA 1T0BA 5DYWA 4RJJA 5JD5A 3U49A 3HVKA 3OQJA 2PQ6A 4FOPA 5DGHA 5K6AC 4FNAA 2JCGA 2G1JA 2JGIA 4LHWA 2DLCX 3PUJA 4MUHA 3S28A 4UCXA 1GPUA 4NZMA 4YO7A 4KR2A 4IICA 3BSYA 1AT1A 2HA5A 4V3CA 4BWYA 3GRZA 2FPSA 3HJTA 2PTGA 1Y6JA 2AMLA 5A7GA 1B2LA 2Z2ZA 4NQZA 2QTGA 4H7FA 1X74A 4IX1A 1HDRA 1AXRA 2O52A 4ECEA 2X22A 4P4SB 2C54A 4KXNA 3DL2A 1N3LA 3ZCPA 4PO1A 1FP1D 2P65A 2C3UA 1CRWG 4HGQA 4BNXA 2I67A 2WQ6A 5FWXB 2JAWA 4Z5XA 4ILKA 2O48X 4N0PA 1BYUA 1AK2A 1R4MB 2A92A 2DCUA 2IXFA 2AD1A 3B6JA 1WUTA 3EE6A 3KALA 3OQ1A 4JJ8A 4KQ1A 1G8PA 4LSMA 2Q45A 5K3DA 1IBKB 1HUQA 1BMQA 1XQYA 3WGVA 3G9ZA 5KTPA 3CKYA 3CNEA 1PZEA 2B0JA 4JQOA 3VOTA 2Y9PB 4P0QB 3FTFA 5KO2A 3ONVA 2FDRA 1ZGJA 1JJ7A 2OLKA 2H52A 3A14A 3KPJA 2HJGA 1QQTA 3N59A 4UBOA 4B3CA 5JFOA 1KZ9A 3FNQA 1O77A 5JFGA 2DR0A 5SYMA 5FB3A 4HAOA 4MX8A 5TQ0B 2AOWA 2QAGC 3LE8A 1JUDA 4V1CA 1L5LA 2XB8A 2EZ9A 3JQ8A 2ZYSA 2CD9A 3LQ1A 2X5KO 4RK0A 3GCGA 1IBRA 16PKA 3VPBA 5TMEA 1XWWA 2PIAA 1U9CA 3PC2A 3WL6A 4G5OA 2H48A 4KDCA 4NCIA 4NNJA 4N8EA 4TKVA 5AVZA 3EXG2 5LA6B 2PH1A 1Y4SA 2IHNA 1KHHA 3LUGA 2JS7A 5AM3A 4NR0A 3VPCA 1C3LA 2ZAOA 4TGLA 3MTGA 4RSMA 3G2QA 5TJ9A 5D85A 4C0XA 3L05A 6CHYA 5F5NA 3CV3A 3UH1A 1Q0PA 4KQ9A 5KYYB 4FHCA 4HJXA 2FZWA 5KAMA 1X3SA 5EWMB 3CVYA 1UMCB 3JVIA 4NMHA 5DLPA 1FUYB 1QYIA 2I2BA 1B0PA 2QMYA 2BMDA 4LYYA 4V2IA 4D1YA 3GLGE 1W9HA 4Z51A 4MWSA 2Y1KA 3D3KA 4ZCPA 2VTBA 1X7ZB 4H2DA 3IQGX 4DIEA 1ORIA 1RLJA 3ZVRA 1E4YA 1G8KA 1I24A 3SDSA 2IODA 1PVDA 1NJFA 2F3UA 1CJMA 1DC8A 1PSZA 1WUJS 3G0CA 4Z86A 2OYRA 2A5LA 3X1ZA 3QK7A 1BD3A 2YYAA 2B21A 2GXQA 2H9IA 2H5JA 4X66B 1O8CA 2F1HA 1XHLA 4KN9S 1QGUA 1FIUA 1RHKA 2AOUB 5ES3A 3WA6A 2HTEA 3OJLA 3DV0A 2X76A 3D7MA 1RPJA 4MVCA 4S1OA 5IAJA 1MT3A 4CT4B 3SNHA 2JKVA 3DAYA 1ATIA 1P8JA 4JQSA 3OMXA 1R6DA 1HQCA 2EVWX 3G2LA 4QWWA 1E7RA 4C2UA 1QIHA 2DRIA 3UMCA 2AG0A 2R44A 4WA8A 2Q4OA 1H9AA 4EYQA 1BJTA 4TKVB 1H0SA 2AK3A 4YECA 4BYMA 3AKCA 4D45A 2WWRA 4H31A 3F98A 4QO7A 4BJ6A 1CF4A 3EVZA 1I94B 1ZCAA 1WP9A 1JDSA 3PXGA 3S2UA 1XROA 2FNAA 3H9EO 2Z08A 4CW7A 5BNIA 1P1KA 4YT5A 1AS0A 1NUHA 1NJ2A 4PSUA 2CNWA 2H18A 2EX4A 4C7KA 2VUUA 3LC1O 3BZWA 5DM60 4QUJA 3TS1A 1VI2A 3IIIA 3CPEA 3OF3A 4WERA 3NG1A 1RYBA 5ITVA 2ZS9A 1M76A 3UV3A 1P5FA 1W49A 2IEAA 4BQRA 1P9LA 5JAHA 1TGVA 2C7VA 3SYTA 4FHFA 1K66A 1G2IA 1VPLA 3QOWA 1E89A 1R4MA 1UXHA 2WSIA 1C0EA 4ZPXA 1AS3A 2YWFA 5EI5A 3DWFA 4RQTA 3DL0A 2WF5A 1F6BA 1KDYA 1UBOS 2ECPA 1QK5A 2P62A 3R3XA 3KL2A 4IVRA 1AY0A 4TT3D 2IU4A 3AWDA 3RS7A 1OZGA 4BN5A 1QQ5A 4CNQA 3QP9A 1RCFA 1WF6A 4O5AA 2Q1UA 4OGFA 3ZZ1A 1W59A 1T2CA 1I0ZA 2QUHA 4Q02A 4ZOCA 4F4CA 5IKEA 2P9ZA 1KDTA 5ETJA 3KJFA 1P72A 4G1VA 4PZLA 3Q11A 1WQ1R 1J99A 3T3IA 1GPLA 4HLUA 3U4GA 1W5FA 3OX4A 3FUTA 1MPXA 1HZZA 4IIUA 3EXG1 5D5QA 2AF3C 5J5AA 4PONA 1F5SA 3ODGA 1YQ9A 2DJIA 3IUJA 1P4RA 3A9SA 3INRA 4B75A 5K0TA 4WXPA 1TI7A 2B34A 3ILYA 4X90A 5DWQA 3ZUPA 1RXCA 4DGQA 5ALPA 5CEJA 4FM9A 5GADl 4QT4A 3U7FB 3SXUB 5HCNA 4QYSA 4ZEOA 4EB3A 2JJ2A 4H3KB 4PHGA 5F4ZA 5DT2A 2XOEA 1AA9A 3GEIA 2IPMA 3VZPA 1OC2A 4YMWA 4J0EA 4R5HA 1GGMA 1QG2A 2WU1A 3F6RA 2OCPA 1K97A 4RETA 2VKTA 1BMFA 1RMTA 2GBCA 3EXHA 5T8KC 1PW5A 3SY8A 4XWOA 2PNFA 4YJHB 4UPDA 2YW2A 1XQ9A 1UP6A 2Z95A 3FYDA 4LX0A 4YRQA 4RIHA 1BROA 1E1YA 3UA3A 3QKSA 3RKRA 3DBHA 2ACKA 3RTCA 4D02A 4WOKA 1O6GA 4ZO7A 1OJLA 2VWHA 3QEMB 2Z8YM 5KVVA 1K86A 4EJSC 1TEZA 3A0UA 4H0FA 1U65A 3BE5A 4GMKA 1G5PA 1NDHA 3UKDA 1E3DA 3D6JA 1BCSA 2Z9BA 5DLEA 4A0GA 4G5GA 2MSEB 4I55B 3ZEAA 4QEKA 2QR3A 3L43A 2Z4SA 2VJKA 4NJMB 3BCUA 1L6RA 2QRVA 3QXJA 4EHDA 1P5JA 1EGVB 1GA1A 4HWRA 1XMSA 3ABIA 3BWDD 1WXGA 1HC7A 4J3JA 1TKCA 1I3NA 4G6ZA 1X7DA 1BG6A 3DVRX 3WQRA 4DLPA 4ZVMA 4U1RA 1TYCA 2JBWA 3WZLA 1RWQA 1WX1A 4IJUA 4BPRA 1RBZA 3BB1A 4W1QA 2Z9DA 4MUKA 1U11A 5CJJA 2FF5A 4X65B 3DE3X 2IQ5A 3KJGA 1ISPA 1T6BY 2V7QA 3BSFA 3KT3A 3M9XA 1UXKA 1K98A 4GHWA 4H6PA 2ZRJA 2O57A 3PITA 1Y3AA 4JOSA 5F77A 4B40A