1HORA

Structure and catalytic mechanism of glucosamine 6-phosphate deaminase from escherichia coli at 2.1 angstroms resolution
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
266
structure length
266
Chain Sequence
MRLIPLTTAEQVGKWAARHIVNRINAFKPTADRPFVLGLPTGGTPMTTYKALVEMHKAGQVSFKHVVTFNMDEYVGLPKEHPESYYSFMHRNFFDHVDIPAENINLLNGNAPDIDAECRQYEEKIRSYGKIHLFMGGVGNDGHIAFNEPASSLASRTRIKTLTHDTRVANSRFFDNDVNQVPKYALTVGVGTLLDAEEVMILVLGSQKALALQAAVEGCVNHMWTISCLQLHPKAIMVCDEPSTMELKVKTLRYFNELEAENIKGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Intramolecular oxidoreductase deaminase
molecule keywords GLUCOSAMINE 6-PHOSPHATE DEAMINASE
publication title Structure and catalytic mechanism of glucosamine 6-phosphate deaminase from Escherichia coli at 2.1 A resolution.
pubmed doi rcsb
source organism Escherichia coli
total genus 96
structure length 266
sequence length 266
chains with identical sequence B
ec nomenclature ec 3.5.99.6: Glucosamine-6-phosphate deaminase.
pdb deposition date 1995-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01182 Glucosamine_iso Glucosamine-6-phosphate isomerases/6-phosphogluconolactonase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1horA00
2WU1A 3HN6A 3HHEA 3KV1A 3BXGA 3NWPA 1DEAA 4L4YA 3BXFA 1NE7A 1XTZA 4L50A 4R7TA 3LWDA 3ICOA 3U7JA 1FS6A 1UJ5A 1Y89A 4TM8A 1VL1A 3BXHA 1LKZA 4R9NA 3TX2A 2RI1A 1HOTA 3KWMA 4M8LA 1JT9A 3E7FA 4OQPA 3CSSA 1M0SA 2W48A 2R5FA 4L4ZA 1FSFA 3ENVA 3BXEA 3LHIA 1FRZA 3OC6A 3L7OA 1UJ4A 4L5IA 4GO1A 1LK7A 2OKGA 3CH7A 1FS5A 2O0MA 1CD5A 3IXQA 4OQQA 4TM7A 2BKVA 4GMKA 3ENQA 4NMLA 5HJ5A 2BKXA 4L51A 4L5JA 2J0EA 1FQOA 1PBTA 4X84A 1HORA 2GNPA 2RI0A 3EFBA 3ENWA 4IO1A 3UW1A 1LK5A 1UJ6A 3NZEA 2F8MA 1O8BA 1KS2A 3EB9A 3E15A
chains in the Genus database with same CATH superfamily
1TT5B 2FPRA 4BFZA 1NBHA 3D64A 1RS0A 4CI9A 1RZRD 5SYAA 1W9HA 2BSXA 4B5LA 4RXMA 1H4SA 3VSBA 1M5RA 1WXEA 3VDNB 3EG9A 1YNSA 3OZRA 3DQQA 3OZVA 3FCYA 4Y6QA 2A94A 2HQRA 3X1ZA 2PDAA 3C16C 3G17A 5DT9A 1EFRA 3A2MA 3EVAA 4RIFA 5T4FA 1R64A 1DAEA 1SJ9A 3L8CA 4NDNE 1WAMA 4CKWA 1MAVA 2BBTA 3FFXA 4PWYA 4CLXA 2JLXA 2G71A 1N0VC 1DJOA 2IP4A 3I72A 1VLQA 3K73O 4KE8A 4IMRA 4GFDA 5BWBA 3ZBTA 5JC1A 3ELDA 3V1UA 1MKYA 2ECFA 3AM3A 4AC9A 2FZVA 2WTUA 5IUKC 2JI7A 1MXHA 2BEVB 2CDBA 3A9SA 5U1PA 3ZWNA 4PINA 5DH9A 1L6IA 2NVUA 1UMKA 3C5EA 3NDRA 3OQ1A 4JLKA 2FEKA 2V65A 1TCCA 5KAMA 2RHCA 1ZH6A 4OO3A 4B35A 1KDPA 2BF7A 2ZIXB 5COAA 1C3OB 5B3JC 2XKKA 3AUJB 4REQB 4ERXA 2E6UX 3W3AH 4NHEA 1L7PA 3A6HA 3HXLA 3LYLA 1GV1A 3VI4B 1QYDA 3BS4A 3DSRA 3GPDG 3T1TA 2CLOB 1QRUA 4FCVA 1K66A 2CB0A 3SHFA 2WY2D 2VLBA 4H1WA 1YC5A 2AEMA 1N3IA 4XE5A 4Q93A 3VSEA 5JHHB 2YV5A 5J1TB 4V0ME 1P6QA 3R6WA 1PGOA 1MO4A 4INOA 3FHTA 3OZEA 4RIGA 3QVTA 1T8SA 4ZVKA 2YZMA 1TD1A 3ZG6A 2F3TA 3MIZA 4TYPA 2CLFB 3AR9A 4RNCA 4Z0NA 4DFDA 1T1EA 4A2CA 1B3RA 2HZ7A 2A7XA 2Q5QA 1X77A 4J0FA 2QGFA 4MR9B 4NV3A 2JAOA 3LD9A 4LOLA 2YYAA 4FW9A 3L1UA 4ND2A 1EFPB 1WHTB 1JXOA 1B3BA 1YS2X 2C83A 2BFAA 3C8MA 3EVTA 1OUMA 5LXTF 3DZDA 1LA2A 4Q3CA 1JR3A 5DTQA 4X44A 5DCYA 3AR5A 3WYBA 2X13A 3DZIA 1G2PA 3Q7IA 4HB3A 3T7EA 5E1MA 2FR8A 5DN9A 3EZYA 1H69A 4U2FA 4UXHA 4UVEA 3ZZTA 4C06A 1I2BA 2ZPAA 2V55B 2Y1XA 5IDVA 3V33A 4URVR 2VDVE 3ZZUA 3DBRB 4DR1B 4MA5A 4O29A 1M0TA 5LQNA 4OXIA 1A72A 3K1TA 2CDNA 4KZKA 1IYZA 2PKXA 2WU3A 4L6IA 3ES9A 1VIVA 1W0KD 5JDCC 2G07A 3LOUA 2BGUA 4HQNA 1F4LA 1D2EA 1OY1A 2I22A 1P2UA 1VC2A 1Y82A 2QAGC 1V95A 3GLKA 1O4WA 4A23A 4F6CA 5AI0A 1E3MA 1WJGA 2ANBA 4NX2A 4WY5A 5IC5A 3VAZA 3PI6A 4B8WA 2TECE 4HNUA 4DR6B 5J58A 1EVZA 2B98A 1RMYA 1ZJ5A 3E9DA 1FNMA 2QTWB 4HNRA 4MKHA 3AB7A 3UTCA 4A91A 1J8VA 5FWDA 4NAUA 3ET4A 5K20A 2JCGA 3N2KB 1RHKA 3VU8A 3IAM6 4CEHA 4EYQA 1IC6A 3INGA 7GPBA 3P52A 1XLWA 3D8HA 4JP1A 2RAPA 5CA1A 3GD5A 1BCRB 1YHZA 2O8VA 3DXFA 3IAHA 1UM9B 4HB2A 5SYMA 1J25A 1RABA 3GH1A 1XPJA 2HU8A 2C2OA 4MIOA 3WV4A 3KJEA 1IHDA 4C3UA 1FU8A 3CA8A 1JG6A 1HYHA 3LL4A 1VBKA 2GZRA 3VI3B 4ED9A 4RJIA 4EK9A 3O84A 2FWNA 2OCIA 3H9BA 3IDZA 4KN9S 4TVBA 4EB6A 1WB6A 3VU9A 2CNOA 3VYVA 2J46A 4PLPA 3WLOA 2BP7B 5KTYA 4YRZA 3VKVA 1MAAA 2AFIB 4QT0A 3WMFA 2ON6A 3H6GA 1OH7A 2H7XA 3T3OA 3AF5A 4HL6A 5GPBA 5T4BA 3W4IA 4DSAA 2XOKD 1SURA 1LSSA 1OXVA 4QLOA 5I7HA 3A3KA 4V0KA 3B1FA 2JCXA 3BXFA 4PY2A 5A4JA 1LPOA 4GECA 2BLLA 3T9DA 3B2NA 3KR1A 1COWA 1YZFA 2GX6A 2OYSA 1NZFA 2QAGB 1W8DA 2QJWA 4BVHA 2BFCB 5HVNA 1D09A 1KI6B 4QU0A 1EH5A 3L05A 3NIFB 4II3A 1C1DB 5EUCA 3V1KA 2I80A 3NGXA 3QNWA 4W1SA 7REQA 1ZS9A 1DU4A 1I6MA 1CIJA 2XUDA 1FFDA 1UZUA 4EPRA 3WISA 1VLHA 2YWRA 3HUFA 5EKDA 1GD1O 2BW0A 1HXHA 3QLUA 4N3CA 4JV5B 2EJTA 4RD4A 3QMVA 1YOBA 4R8RA 2MOKA 1ADGA 2UUOA 4ALIA 4E5VA 3FUVA 2VR1A 1CKEA 2EC5A 3GVPA 4MVJM 1JDUA 3WBKA 1WX1A 2ORIA 2FMTA 1YDFA 1QDUA 3NCTA 4NSNA 3M33A 3G2IA 3ZD8A 3K9HA 1DWQA 1BH6A 1QZ3A 2D1QA 2IF2A 1IN5A 3IIKA 4D9IA 1WB9A 1WBDA 1AK2A 4RS3A 2A1UB 4YMIA 4FGLA 5A4KA 3ENVA 1RI3A 1E5VA 1OBOA 2EZTA 2DUMA 2B7CA 3D0KA 3V2UA 3G0IA 2B6NA 3U48A 2DT8A 3AY6A 1QYIA 4BJ1A 1Z6XA 2WU4A 4ZK6A 3BMQB 4KGZA 2PUAA 1JWLA 4HSGA 4TYNA 1NULA 2VHEA 1EX7A 1FYEA 3BCRA 5BW5A 5BWNA 1N5KA 3VISA 1YAJA 4DF3A 1EFVA 1CRWG 1GCUA 4NZ9A 4QDOA 3FPHA 2ZE5A 1QO0A 3TLGA 4ZXFA 3E5MA 4TKMA 4TTRA 1N7GA 1FFXB 3OJXA 1RHUA 1ENZA 1QM5A 3ML1A 4IZIA 1V71A 2BYTA 2HU7A 2LRHA 4Y2VA 3GUCA 1NASA 2CUNA 3OUZA 4H1HA 1WXXA 2M6RA 2O5CA 2QE7D 5DCWA 2AOXA 1HE1C 1Z0AA 3QHPA 3PL5A 4XVUA 1RAEA 1KBZA 2C2YA 2C1EA 1XZNA 2BHNA 2GTPA 5TRTA 3E9QA 4Q3KA 3I42A 1KK0A 3NEPX 1YB7A 3FD8A 5J23A 5L3VA 3PD0A 5I7RA 4P2BA 3I1JA 4IKPA 4D42A 2E48A 2QLFA 1NURA 4LSZA 2R6JA 3U7QA 1LK0A 2KYRA 2ZJ3A 4B2IA 3BYZA 3K1YA 3EZ6A 1WY7A 1Y42X 3ZWWA 1I6KA 1WXIA 1NXTA 1E9DA 5KWVA 1N6LA 4WJZA 4V0QA 3OTGA 3TG2A 1CPYA 1EBBA 3SHOA 2VA9A 2QMHA 4EB3A 2CNWA 1LBSA 1TX4B 4Q02A 4ZMSA 3NAQA 1U7UA 5FAXA 1XYVA 3PKJA 2IUYA 2XNCA 2JDID 2P4HX 1DTEA 3F98A 4KPFC 1OXKB 2OG2A 4B6JA 1EM6A 2EYQA 1YMQA 4B75A 2ZZMA 2YL2A 5DZSA 4IJ6A 1J39A 1OWPA 4YQEA 5C4MA 1ZJZA 5FOTA 2G9NA 2D7DA 1IZ9A 3C2QA 2A3NA 5KSOA 4QYTA 1W4LA 1BS9A 3IAEA 3KUKA 5LVAA 4QO7A 1J2YA 3UNXA 2WUDA 2YIMA 4E33A 1RMTA 4U0JA 3PEYA 3LKBA 4BDTA 4KQIA 4ND8B 2VCYA 1GGVA 1C8KA 3KVVA 4PR3A 4S3MA 3QXXA 2P30A 4MUMA 2VH1A 5I47A 1BVRA 5G4LA 4XQGA 4OB6A 1E9EA 3CX8A 4EKDA 1NMZA 4C4XA 2HBQA 3N76A 3WB9A 3S8YA 5LD2C 5JZSA 2Q8PA 1W87A 3ZXUB 2HSWA 2IA5A 3Q41A 2G7MC 2B34A 2IYSA 1C9YA 3N59A 4TUYF 3T52A 3IUNA 3RIGA 3AGPA 2QPLA 1MW8X 3SR3A 4JVSB 1HL3A 1U5BB 3F67A 3L0PA 2RKOA 3K9BA 4FUTA 3AFNA 521PA 3CW9A 2QG6A 4ZYTA 4H31A 4JR1A 1EZZA 1JT2A 5JCOC 5F2NA 5TQJA 3NM6B 3A4YA 4HRVA 2OLKA 2QUBA 1NVAA 2IE8A 3DFMA 1OI4A 3EXG2 3EXEB 3QBTA 1LI7A 1DC3A 2Q1UA 4DJAA 1XIVA 2ZITA 5KQRA 2RJNA 3A11A 4N82A 2D0DA 3A8TA 3AJ9A 4QAJA 1RBYA 1SXJA 5CA0F 2WQZA 4RV5A 1H85A 3CY6A 3OF2A 2ECOA 3K8OE 4ZOLF 3QW2A 2HPHA 2GK6A 3WLSA 1R0SA 1JNXX 4BZZA 2C97A 2X8WA 8LDHA 2WHEA 3IIEA 4MYSA 4MWDA 5AKGA 4RLQA 3A04A 3U7EB 4EJFA 1QP4A 1QQBA 4CG0A 4Z4CA 1N32B 4TTAA 3N0VA 3OZWA 1S6YA 4LHSA 5DHRA 3PUYA 1E4EA 2TYSB 2UV8A 5ANRB 3ABZA 1ENYA 2QD1A 4Z2YA 1VE5A 3FOFC 2RDMA 4AXXA 3UOAB 1TAQA 3BJZA 4RF5A 5HZKA 4PYJA 2FGKA 4Y9SA 2ZRCA 1N6RA 3AEKB 4TQUS 1QGUB 2IHVA 2YIVX 2YMQA 4Y8VA 5FCDA 3L0CA 3PR1A 4HS9A 4P32A 4QHYA 4O6VA 2VUIB 3NETA 3QEKA 3KNZA 3PZRA 4DGSA 4Z4QA 1EXDA 4DJTA 2AN4A 4JOSA 1NVTA 1N34B 2G6BA 1RZUA 2VYNA 3OETA 3B6IA 4CTNA 1OXBB 4L72A 2P6RA 3MAGA 3OLQA 4A3SA 4QUKA 4BRSA 5I01A 4G4JA 2FE4A 1KEKA 1IZ8A 3BWMA 5HIMA 1Q7RA 3F6SA 3PRKE 4J1TC 4MRVA 3UC5A 3LXMA 1N6NA 3Q72A 4N6NA 2H07A 5A7FA 2ZBPA 5T41A 2V7UA 2PH1A 4X1KA 4DUYB 1Q7EA 3QK7A 4BUCA 1SCUA 2CJPA 2VDMB 2XEXA 2G80A 3GRCA 3HI4A 1PR1A 3MJCA 1TZMA 5IANA 1YQUA 3B38A 2FW8A 3UANA 1XZLA 3G9ZA 4UEJA 3A3OA 4BGEA 2WVJA 3AH8A 1BQ4A 4GMHA 3UKOA 3C45A 3B3JA 1M2EA 1ENPA 3L7YA 4ZGBA 5C18A 1NU8A 4LG1A 1TM2A 4D3YA 4EY8A 2FPIA 2R6FA 3RC2A 3AVYA 3VDXA 4HWOA 3RAPR 3PFHA 1W6UA 2FN7A 3BKXA 2A4MA 2NQTA 2FW6A 1BTOA 3MTDA 4ER3A 2WIBA 4W9RA 4OHMA 1IAVA 1OV6A 1R0CA 2YYZA 1VJ0A 1KIFA 2ZJ7A 2OILA 3MELA 1FCJA 1WCWA 5DYTA 2L82A 2Z95A 3AF1A 4QUDA 4MVWA 1Z25A 5FUWA 3W5DA 5CVDA 3A1DA 5IK2A 2AQKA 4UNIA 2R5NA 5DX1A 2ZJ5A 5KTTA 3VPSA 2BWJA 1RKVA 4MRMA 3RNOA 1U2DA 3O8LA 3TXXA 1EFAA 3D8NA 4ZTZB 1G1MA 2WHRA 1T4MA 1N25A 3A2NA 4EW6A 3AP3A 2I2CA 2Q2WA 1K0UA 5T57A 1NN1A 1P29A 4JK3A 3BL8A 1SCAA 4GKJB 1KYTA 4HNQA 1YK0A 1VI2A 4MS3B 4AM8A 5HKKD 2NUAA 3W2FA 2XXBA 1RXSA 3V1TC 3FLEA 1MD9A 3HO1A 2ZWPA 1NI4A 3CMMA 3RS8A 2DC1A 5DTEA 3V6MA 2V9CA 3X1JA 1RM3A 4XRGA 4ZMBA 3KSZO 1L5QA 5DCLA 3KKKA 3T35A 2C88A 3I04M 4FFRA 2QRUA 1OX4A 4N0MA 3PNMA 4RM3A 3TCKA 4ARSA 2H29A 4B3IA 1B15A 1UKBA 4JC4A 2PUTA 3DO5A 4WA7A 1V5GA 2YUTA 4WLOA 4HPWA 2VJKA 4D4LA 2C04A 4LRYA 4LW8A 2VTVA 3OOEA 4UARA 1V8PA 1K7YA 1ZN9A 4Q9IA 5BQPA 2JLYA 3NWBA 2BI4A 4M9QA 5E2AA 5B1HA 4G8CA 4XYEA 1BKYA 3PJRA 3VXKA 3FYCA 3Q0EA 3KKQA 1Z2AA 1DAPA 1TJ4A 3PSAA 2KMLA 5TC4A 1P44A 1QLJA 2CLEB 1FEZA 4RSRA 5KTSA 2RHDA 4P4UA 1VBFA 1DXYA 1E7YA 4NFSA 3OI7A 1ZIOA 3PQEA 3IEVA 1P81A 5HF9A 1JBEA 2XT0A 4PNPA 3ZV5A 5AUQA 3SAJA 2NVWA 4G8DA 4IS3A 3ZWOA 5IM4A 3M4NA 5EJ6A 3GGOA 1HLFA 1M7GA 4UMFA 5KSYA 5KTOA 5E9WA 3ZXYA 2IXGA 4DV5B 1Z38A 1ZQ9A 2ODQA 2GCGA 6YASA 5JYCA 1AF4A 1PWZA 2VS1A 1QHFA 3CW2A 4O1HA 3AU9A 2R1TA 4IIFA 3UJ9A 5BN4B 3WKBA 2RGYA 3ZY4A 4IXTA 5JVDF 4BB5A 2I29A 3K70D 1TF5A 1FP4A 5KOYA 5KYVA 3NIDB 4QQFA 2H5EA 1E3IA 1WZUA 1WMSA 3ZHTA 4EUEA 5JSKA 4LUCA 1GAEO 4PV7A 1AA6A 3BWEA 3GT3A 1X0XA 5GJCA 4C3OB 5LQAA 3IBTA 2PSJA 4LBWA 3OCCA 4V24A 4HUQA 1AH2A 1BGWA 3MQ4A 3MXTA 3GP5A 4LXXA 3SZOA 4ZYLA 5EJ8A 1UC5B 3FNBA 3R0XA 1DNPA 1GP2A 3IJ5A 4LQDA 4MR8B 4O3MA 1DQRA 1YB5A 1MLDA 1FMFA 3OE7A 4MXDA 1PFWA 3R3HA 2KBFA 4A92A 4DNXA 1JG4A 1QWOA 2TMGA 5EUMA 4ZZIA 1YQEA 2NLOA 2A4KA 4IIVA 4QBIA 1G8SA 2XGMA 4EL5A 5IABA 1GG9A 1G8YA 3CLTC 4TXMA 1TIBA 2CCJA 2WPNA 3HHPA 4I1YA 1U99A 2CXRA 4LY3A 4XWTA 5DRTA 3VJMA 3CG0A 3UN1A 2QU8A 4BLVA 1NTOA 1E94E 1XZEA 3LPMA 3BSWA 3RVLA 3WMEA 2CZGA 4MW0A 3MCVA 1IHUA 4PX3A 3HM9A 4IGIA 1FW8A 1NDQA 3PDCA 3N07A 2BFEA 2Z3ZA 2AI1A 1TAHA 1Q1GA 2WIFA 3ZHYA 4ER0A 4YBRA 1T0IA 2VOJA 3BGDA 5JRDS 4GE0A 3GEGA 4Q6WA 1CUAA 4WL0A 5EXEA 2Q27A 4NE9A 1G8KA 1GTVA 1QNFA 2JFUA 3G1TA 3MILA 1U0HC 4Q1EA 2A0UA 3Q0IA 3VV2A 5MDHA 4GLLA 4ZJZA 2G5PA 2QGZA 3F6YA 4ZCLA 4MEJA 3BXHA 4PSKA 4GOXA 4YA6A 2I8AA 3E58A 3D2BA 2XADA 3A10A 2CDCA 3VDQA 3NHYA 1L8LA 3E9CA 3ZBUA 2H9AA 3AF3A 3NI2A 5AVWA 4AO6A 1FW6A 3V8NA 3W77A 3E8SA 1BJKA 1VJDA 1E3EA 1D8AA 4TL8A 5KYUA 3LC2O 4BBJA 4C4TA 1NA5A 1EDZA 1SWWA 2W98A 4FP9A 2BHTA 2GYVA 4JL8A 4K9NA 3VJKA 1EU1A 4JEUA 3L1VA 3HDTA 1TEZA 4I36A 1DP4A 2GLTA 3VVLA 2VRCA 3VR5D 3HCNA 5KOHA 2DFKB 4JLAA 3D31A 3KE9A 2PUJA 3FFWA 3KFXA 3D0QA 3TRFA 1JQ3A 2Z56A 2R8XA 5M7EA 3ORSA 1NUAA 3KOUA 4GOND 5F2OA 3ED5A 4B17A 1YOVA 1GKUB 4BBAA 3LLCA 2IYAA 6Q21A 1IEWA 3WFJA 3ETLA 3GZNB 4ZCIA 1D2GA 1M74A 4GUDA 5KTKA 4ZO8A 5SY6A 4IIYA 3B5JA 4G0MA 3GQBA 1D04A 3HU1A 3UEOA 4I55B 4RVNA 2CLKB 5D5QA 2IDMA 1SA0A 4X1OA 4IKEA 1XAHA 2RIPA 2VNAA 3EY9A 2P2DA 3H1FA 3P9PA 4FS3A 4AY4A 1KWKA 2WT4A 4ILKA 2YVQA 4TQAA 3ROEA 3GW8A 2XGJA 2FPPA 5D5PA 4N3AA 1T9ZA 1BXGA 4EL0A 3F8SA 4QREA 3MMXA 4MUAA 1K5HA 3CF4A 2ERCA 2IT1A 4IKOA 5AVTA 2C0QA 2ZXFA 1DMSA 1JMVA 1SBQA 2WD7A 4GVXA 1QIMA 2ZI9A 4B74A 3DVQX 4EATA 1II8A 3PC4A 3DAGA 4WECA 4H6VA 1ZBDA 4RMIA 5C3MA 2BBOA 5B2FA 4RESA 2ODWA 3REOA 4LF8B 2J0SA 4P80A 2UKDA 2F8MA 3BAFA 3GLIE 4E88A 4PSAA 2C29D 2Q9AA 2ZVQX 2G1UA 3C3JA 3NPMA 4X1IA 5EY5B 2RJOA 1IM2A 3QGMA 4FFSA 2W6JA 3RAGA 2NUPA 4GT1A 4XGNA 3OM0A 1NSFA 1AB6A 3M3PA 5BN3A 3T34A 5HX7A 4CQLB 5ALLA 3D1JA 4ZALA 4WOBA 4BX9A 1VHJA 2KS6A 5IUNC 3DOEA 4RXTA 3HJAA 4CVNA 3LLUA 1NC1A 3URKA 4E5DA 5F3DA 3RYFB 5KNDA 1A8IA 4YBZA 1V9LA 3A06A 1ZKMA 1QRRA 3EEIA 2PJDA 1DV2A 1FMTA 2J0UA 4PWZA 3VFDA 2J48A 1L4KA 1LDYA 1SUCA 1Z8FA 2QM8A 3H1TA 4MUGA 3T7SA 4EO7A 2HQOA 4N0EA 2GN8A 4LJ8A 5CB4A 2YXDA 4BUZA 2P90A 2Y9PB 1B2LA 5LB4A 2P9TA 3G85A 4OI4A 4TMFA 4IYJA 3C1TA 4C2TA 1ULAA 3DB2A 2IYRA 2HSGA 3L7IA 2OBMA 2Q2OA 1TQDA 4KFRA 5HUQA 3FJOA 1ZGGA 3BEDA 2DPXA 4NFHA 3FGOA 1XAIA 5DX0A 1SQFA 5BR8B 3Q0TA 1XX6A 3OPQA 2OHVA 2OFFA 3ON5A 4OLAA 3N2EA 1UAGA 3JPYA 3EUFA 4C0LA 4LXIA 1YAHA 4E14A 3AZPA 4DC9A 3PA8A 4H16A 1JLSA 4LRXA 1DKPA 2GESA 4RHTA 3J80A 3DONA 1PF7E 4OQPA 2IZ5A 3ZGZA 2IPAB 2C7BA 2I8CA 4G67A 4IMIB 3BXEA 2Q7DA 3TS1A 1E8NA 1TJ5A 2H9YA 4BJ3A 4EJ0A 2CHFA 5HR5A 3NYQA 1J21A 4LMPA 4YWJA 1GRCA 1T8RA 5AJWA 1JH8A 3LCMA 4OP2A 1RAAA 1RTTA 4REMA 2B35A 3UT5B 2WYUA 3DVAB 4AMGA 4B8YA 2RI6A 2X1VA 4BVBA 2R7KA 4ER6A 5HSGA 2NZVG 2ZYUX 5EE0A 3RADC 1OZFA 2A30A 2VZLA 3ESZA 1G42A 1N5LA 3OZAA 1ULUA 4FIZA 5FLYA 3RROA 4BQSA 5CFPA 2PUBA 3Q3JB 2WHXA 1T2DA 4G2TA 4RQUA 1XQXA 2JG3A 4KO4S 3PEFA 4F0JA 2IHKA 4J0KA 2AC7A 4IJMA 4PC6A 3BD6A 3LA8A 2GXQA 2C7QA 4GMFA 1ZOOA 2XGGA 2DF8A 2Q3EA 2Q21A 3JWGA 1N4AA 3PYXA 3H9CA 4CM1A 5LZ9A 1OQAA 1FDOA 3MWLA 4GL2A 2DLCX 3ICVA 4HDAA 2JJYA 2Y6UA 1QPBA 1TB4A 2RSLA 1MGOA 5AQEA 1YI1A 5JROA 5K9ZA 1CR1A 3TFQA 4M0PA 4EG0A 3IVXA 1I2ZA 2X0EA 1VLLA 1D2CA 3C1OA 2HU2A 4FDTA 4IWXA 2RI0A 4FYIA 2R47A 3F7TA 2AVDA 3RCBA 1OILA 4OSOA 4GYWA 2JJ1D 3VU3A 2VBGA 3THXA 3PKZA 3X1WA 1YJ5A 2QRZA 4O0LA 2GHIA 2NYUA 4O2AA 3ZHUA 1W9MA 1Q0HA 4UTPA 2FKNA 4AQ7A 1H1LB 1Q0UA 1WPXA 1P2GA 1NVUQ 2Z83A 1XDZA 2B5OA 1NR1A 3KLPX 5D01A 3W2TA 2HDOA 3T5PA 1CQZA 4EGFA 4UULA 3VC3A 3DPUA 3AETA 2CHEA 2BKEA 3HJGA 5ADVA 5CBKA 2QRNA 1U1DA 3K0FB 4NU6A 1H3NA 2IW1A 3GARA 3KLBA 3E18A 4KGDA 4WLUA 3U0VA 2J09A 4L8GA 5CDGA 3A6LA 3H1GA 4GG1A 3A4IA 3KKEA 3OZ7A 4R81A 4AKGA 1Z6GA 5KTRA 4IM7A 3BQ9A 2PUGA 4DXHA 1ACMA 2E6KA 3BGVA 3OFJA 3U81A 2DECA 2OHFA 3AJAA 4N9WA 1KORA 1TAGA 5EJIA 3ACDA 1P6XA 4OMCA 4ACBA 4A6PA 4UW9A 1N2EA 1M67A 1SC6A 2P9ZA 2G08A 2FW0A 5LWHA 1ZITA 3ETEA 5HQJA 1N6IA 5HDQA 1QORA 5B1IA 4H17A 3O1IC 1QE3A 3QVXA 4X6UA 2A35A 1XVLA 4JUAA 2OBLA 4DWJA 4DDVA 4ZVQA 5IKEA 2ZT7A 1VYUA 4L0DA 3IC5A 1KDRA 5ELXA 3PNVA 3ISTA 3BCSA 3WGJA 3GV0A 1Q0PA 5IJXA 2PFGA 2QSZA 5ENZA 1FXWF 1OWOA 1RWVA 3ZU6A 2N3ZA 2ORED 2WUFA 1THTA 1W6RA 3H7AA 2YWBA 1W5SA 1VZ3A 1NUPA 3FMOB 3NKFA 3KVRA 3MCUA 1SXGA 1Z36A 3S2YA 4D9KA 1KR2A 2JLUA 2HXYA 2EX1A 2IUUA 5H4GA 2ZEJA 3I9V1 1Q3TA 1RM0A 4JJFA 1VCNA 3ABIA 1SVKA 4OU4A 4F97A 1CJUC 3DEFA 3ESDA 4CGYA 4IDDA 4LF6B 4LK2A 3IT3A 1O54A 5BT8A 1GEGA 2WSSD 3KQYA 3EBLA 4HVAA 3SS8A 3RSGA 4AMZA 2Y66A 3CF2A 3VDRA 3IP9A 4PZZA 1TXGA 3GJTA 1V8DA 2GEUA 4IHJB 1AF7A 1I0IA 5H80A 3ANTA 1E1NA 1H3FA 3HQ4O 4P54A 2BR4A 1I1NA 1P7PA 3EF3A 4BNLA 3K0CC 4D9JA 3I05A 5JOQA 1Q74A 2HIMA 3OZCA 4JP3A 1I6WA 5HIJA 2PD4A 4RTOA 1LTHR 3N86A 3L2OB 1QHIA 2NUTB 4JQCA 4DIBA 4Y2YA 5BQXA 2P9EA 1PJBA 3HU5A 4UEKA 3UKDA 4P3XA 3IP7A 1ZONA 1NP3A 4EBBA 1E98A 4JL5A 3RSCA 4UM8B 1CUGA 1CF9A 4MB0A 2OV3A 2YN2A 1AUVA 5ED4A 1TW2A 1T1SA 2E37A 1D07A 3W5HA 3WWCA 2XA9A 2X2OA 1GLVA 3G8DA 3IELA 4IICA 4QAQA 4DLLA 3DYVA 4EHLA 4EY3A 4PZ0A 4F5EA 1TQHA 1EWTA 2GLUA 5E2BA 1G3IA 3PHIA 1PX2A 4WTOA 3UMRA 3MRXA 3GRRA 4CM6A 2EFCB 3WLLA 5A5VA 1RZVA 2E49A 4RL4A 1VE9A 2GM9A 4TKLA 3AY0A 4AKHA 2FFAA 3TXYA 2CJXA 2ZULA 3R5JA 4F84A 3KV3O 3FBGA 3EWSA 3Q3HA 1ABFA 3CF0A 3P0JA 4NOLA 1SFRA 3RU7A 3SK0A 4BKQA 2AEEA 3NCHA 2A88A 4DDMA 4IHQA 3WO0A 4WFKA 1L5VA 2BL4A 2LCFA 3FWPA 4ETNA 1JALA 4NZZA 2IS1A 2A9QA 1Y4SA 3MJHA 1IIRA 1AGPA 3GEPA 1T6XA 2JFYA 3NOXA 3T5AA 1UK7A 4M9ZA 5LB2A 3GLHE 2IGBA 4MQ4A 2Z6UA 2GDZA 4F4JA 3C8ZA 5EJMA 1IU9A 3I2IA 3BE5A 3KXDA 5BN5A 1SXIA 4DYDA 5HE8A 1YZYA 4DLRA 1DIOB 4RC9A 2CBZA 1VPDA 1ZZGA 2FTKE 1Q50A 2UZ3A 4RVFA 4URFA 4EQ6B 3MS4A 3EIFA 1SN7A 2NV2B 3HNPA 4JZKA 2ZTVA 2ZR7A 1C8BA 2O50A 5EFOA 5G4KA 1LW6E 4JC5A 4WKCA 2Y1DA 2ZIEA 3T7KA 5DBOA 1NHWA 2H8KA 1BNCA 1YBAA 3M3HA 2W0SA 3TM4A 4JB8A 1WBJB 3H17A 4FQ5A 3U16A 1PS0A 1MO2A 3A25A 5ALOA 4JBNA 2QZPA 1FFSA 1KBQA 4RE6A 5JQGF 1B73A 2R6AA 1UOPA 1K6IA 4GICA 4PLVA 3VR0A 3HSSA 2DOKA 2QM0A 4JNKA 2ZYAA 4EHKA 2BEVA 1GUZA 2PZBA 4H27A 4MYUA 3S3TA 821PA 3F73A 4P4SA 3LBFA 1XOIA 2DR3A 1ZMRA 2YZGA 3EA5A 4FSXA 4KGXA 4US2R 4BNJA 2ZBQA 4HBZA 4OHCA 2CNBA 3ZE9A 1IBMB 1DDOA 2ZSAA 3DZBA 5EZYF 1C3OA 5DMHA 4LX0A 5IF3A 1I2AA 1Y3HA 3PNSA 1VZ2A 4JQYA 1TJ3A 4REQA 4WCVA 1Y8RB 2WWTA 1MTOA 3UFXB 1Z5GA 1V37A 1UINA 3UK6A 2Z5GA 1A96A 1VQ1A 4OHUA 4G56A 5ABPA 4QXMA 3M8KA 5GV7A 1VOTA 5F98A 4MVJG 4PTLA 3B2QA 1PO7A 4MROA 1E61A 5JD3A 3V4VB 4E7OA 2NW6A 2JGKA 4ZVRA 5BVGB 4DCTA 3LHIA 1RI4A 4IUCS 2XT9A 4MGIR 3V46A 1ZW1A 1UJ4A 2HB6A 3G59A 4OU5A 4YB8A 3ZDYB 3D59A 2HK6A 2WINI 4GQIA 4RSGA 1I1OA 3NONA 3CH7A 1JPVA 4KU4A 4MR9A 1CJBA 2XQIA 3DYIA 3WJ2A 1UPXA 3ZXIA 4CV3A 2UZ1B 4P08A 2RONA 3R6TA 4NE7A 1E7SA 2A9OA 4AX8A 2NNWB 1ZI9A 4KACA 1Y9ZA 3E4CA 3NHKA 3OKCA 4ZODA 1NVKA 1WHTA 3RM3A 3TIVA 1WIWA 1NMEA 4I2NA 2RHBA 3OJLA 2JI8A 1IXZA 2WHQA 2ZB3A 4YCJA 3MGAA 1JZTA 1WMAA 5A3VA 3UZUA 2Q3MA 3PUVA 3UG7A 3SNKA 1YZUA 3ZI0A 4QPZA 2CXOA 2QI9C 2W2TA 5KWEA 1F17A 3BWVA 2HJ9A 2W2PA 4V0OA 1I7QB 4XB1A 2YMLA 1XNJA 2DAPA 2O5RA 3L0OA 3REFA 2YXPX 3NWEA 4F1KA 1RLMA 3DBRA 1E2PA 4D0SA 4I4IA 1ZJYA 4AIRA 2VAVA 3TTXA 4OHOA 4WJKB 5FBZA 1M8JA 4J7AA 5ILGA 2BFFB 5ETJA 4CLHA 2NZXA 5EJ5A 5ALJA 2NACA 4BKRA 4KG7A 2E4AA 2HK8A 2ZI5A 4YYEA 3UMBA 4I4TB 5EJ4A 2VZ0A 3JATB 3NX4A 1YE5A 2HTEA 1FRFS 1HG0A 5IZCC 1KKMA 3RRFA 1FF9A 3HU2A 3NZEA 4NYMQ 2JGJA 4FYKA 4QQKA 5BXYA 1E0DA 1VI6A 2I6GA 2AD1A 1KMNA 3CEHA 1UMCB 3N2KA 4AK9A 5LNK1 2J3EA 3GB9A 1TUGA 3UWPA 2HNBA 3TLCA 3PHHA 4A1OA 4YACA 4E03A 3W1VA 2XXAB 1U4NA 3RUDA 1BCRA 3CLSD 1XE3A 2PX3A 4G2NA 5HWSA 1GGFA 3Q8XB 4MJLA 1UM9A 1VIYA 4GZLA 3I1IA 2WJJA 4ND5A 2XRFA 3KV1A 4J16C 1UL1X 1Z83A 1JJFA 2A92A 4RYDA 3R09A 5LZ8A 5FUVA 5LM3A 4WK2B 4HVLA 2VT3A 3MRVA 3ZGVA 4YMGA 4RKFA 2PZEA 2QUJA 3WIDA 1B23P 4HZIA 3CVWA 1W88A 1JMKC 1NR5A 4BNYA 4G8BA 1UBOS 4P4TA 1KR5A 2ACKA 4BNZA 3O4VA 5M29A 2UYOA 2BP7A 1RJ9B 3M70A 4QYMA 3CUUA 1V8BA 4HNHA 4A0HA 2X5OA 1CE8B 2WFLB 4FGZA 4TMTA 4KI7A 1DB3A 2XA2A 3DDCA 4UTRA 3M3DA 3F6PA 2B8WA 5AMXA 2Z04A 3L77A 4OQZA 5BRJA 4E7PA 3BWCA 1B8OA 3CZ4A 3H87A 5EEGA 5JDCA 3SOPA 3NT4A 5HFJA 1AZLA 1UEIA 2BFCA 3M4XA 3ROFA 4AZ3B 2H8GA 1C1DA 3VZPA 4O2RA 4Y9UA 2PPVA 4XUEA 1FTYA 2VRNA 4MV5A 3H0CA 1IBCA 2XITA 1I2DA 4F8YA 5FL3A 4UU0A 2FZWA 4I50F 3IEIA 3FDZB 3I9JA 4MJ7A 1G7TA 1WXHA 2B6HA 1QG2A 2H18A 3TGPA 1MJFA 2FSUA 1DE0A 4GX1A 1ATIA 3WVNA 2A6PA 1TYBE 2AR0A 3LPNA 1D9XA 2CMDA 3WFZA 1UFQA 4M0LA 3FX2A 5JTUA 3DVSX 3D2LA 1Y4UA 3WIOA 4PVCA 4PYQA 4QPPA 3ZJTA 2PUWA 3TTSA 1DIRA 1Y63A 1IVSA 1GEEA 2BDUA 5KCZA 2BC9A 1QGZA 4X90A 2QTTA 1JE1A 3C3YA 3OLVA 1NJGA 1DBWA 1E0JA 2PT5A 1ZN8A 2V7QA 3BMQA 1EFCA 3G0GA 4KO3S 1Z0SA 5FI5A 2AG1A 4OHXA 5ALUA 3IR6A 3H8VA 4GRDA 5H83A 1WPRA 1AZSC 4JHXA 3WA6A 2UYQA 3VH2A 4Z1OA 2V6BA 1RQGA 2VF4X 3QA3E 4JSTA 3QWAA 4OPMA 5KOIA 3M6UA 5IFLA 1FFXA 3PX2A 5DCUA 1XMQB 5TMBA 4KPEC 4HNAB 1UBKS 5CLJA 3BJIC 4ZEVA 1FTQA 3QPVA 3TQTA 2JW5A 3EDMA 1VSTA 5J5AA 1HEUA 4OAPA 4RIEA 4ZT2A 3O21A 2IHUA 4QHTA 3K70C 3MJSA 3HYLA 1A8HA 1T36B 3KKMA 3NOQA 1IEVA 3CUYA 4U7WA 3R3YA 2JAPA 3URMA 3RTCA 4YV1A 2ENWA 3LKZA 2PRKA 3D5EA 1G59A 4MCJA 1IJKA 2IZ0A 2RCYA 1U9ZA 3CVOA 4OAQA 2CVQA 4S1NA 3FHOA 3ZE1B 4WZZA 1IM8A 4R5HA 1B41A 5J63A 3L0ZA 3AM1A 2NP6A 1GTG1 1HURA 2JGNA 3DAFA 1KY2A 1EIWA 5BQ5A 1WKVA 5JZ9A 3BRSA 1PR6A 3G9UA 1X1DA 1Y34E 1OB5A 3HY6A 4TYQA 1G66A 4UHDA 1UBMS 4V02A 1QRDA 1Q44A 1U2QA 3BWDD 4K9MA 5J5CA 5LUBA 4ERNA 5ICEA 4FT2A 3HZRA 1ZRSA 5JNLA 3S6JA 3S70A 3SS9X 3ZX4A 4EVQA 1BC5A 4MQEA 3WIVA 3A58B 3IMFA 3RASA 3K8ZA 4MJ3A 3EEQA 1XKXA 2VP3A 3EVBA 5REQB 1XEAA 3Q12A 3PXEA 2JGMA 4PTZA 4E2XA 3QQPA 3I5MA 4HGRA 5A04A 2EOAA 2AUTA 1OX5A 3ILXA 4YJ2B 3G7SA 2RJ3A 2JVJA 1ULHA 2YJNA 5DHPA 4S1VA 5HFAA 1YFKA 4FB4A 5DHAA 3S27A 1R1DA 2B1JA 1JZSA 2WW8A 5BUSA 4V1CA 2FJUA 2O6LA 4W5HA 4Y1RB 4XWOA 1NXQA 3AM5A 3ET5A 4EA9A 4ZQGA 5FYDA 2IYVA 3S5JA 3LOPA 2FK7A 1XQYA 5T3UA 4ZT4A 3Q15C 4ND8A 1XNRB 4LNAA 4H15A 1PLJA 1PTJC 5EPOA 3MWEB 3K70B 1BXRB 5TX7A 1H9BA 2I99A 2ZUEA 3JQ9C 3DLHA 1NBME 2XYHA 1AQIA 4AW9A 1J33A 4RTPA 4UREA 1HMPA 3QFRA 1K3TA 2VBIA 2Y4NA 4CTJA 4R9NA 3TD9A 4V0RA 1W4AA 4BNXA 1MN6A 1Z6TA 3AFGA 5A1JA 5CB8A 3UJCA 1M76A 1R6UA 2G63A 3ZHZA 4ARZB 4D8XA 4Q1CA 5DM2A 2YV4A 4EMBA 2VWPA 1B8PA 3AR2A 4IZOA 3ZUGA 3RHTA 3OESA 4OK3A 3B89A 2YC2C 1XD2A 3RYCA 1A9YA 5B3AA 1PVOA 5KVAA 3KSUA 1YVDA 4II7A 3RRJA 3G0BA 2ZSHA 1GRRA 3JYOA 1MVNA 4ZEOA 1M8GA 3JVVA 4LC9A 2XDYA 4YNBA 5SY4A 2DTXA 5DYIA 1CJMA 1SC4A 4YO8A 3ZQ6A 4MZXA 4XARA 2X3UA 3DTVB 3AJEA 4BHTA 4HCJA 5AUNB 4KXLA 3EXEA 4KOEC 2MMGA 1DZ3A 4FFMA 3OMLA 4U2DA 5H9VA 1VE6A 2I3BA 3FN4A 3PNYA 4POOA 3T7JA 5F7XA 4M6WA 4DNFA 1NTRA 2CJFA 2R87A 4ROTA 4YXWD 4MRRA 2W2VA 2C7PA 4KXMA 1KGSA 3EXHA 1FUYB 4P7KA 5CXXA 2HYDA 3D2AA 4Q3EA 2FFJA 1Z2OX 4LDPA 2B2NA 2ATCA 3PL1A 3UJNA 1E6KA 2XZOA 3KXPA 3C7TA 4IJQA 2JLZA 1A7AA 1ZUNB 1A8SA 3MFYA 1MENA 1G21A 4PLTA 1Z82A 1LPPA 1N2HA 3LL7A 3AEKA 3G0OA 1QGUA 5J5VA 3SDBA 3H1AA 4MUIA 3RAFC 1DHTA 1R4NB 5HF6A 3NHLA 4C29A 4E11A 2LIVA 4OI2A 2XUQA 1X1QA 1EUDB 1QRTA 4HUTA 4CBVA 4LYHA 5DGCA 2W71A 4DV3B 1VIAA 1VI5A 1KI8A 3ZDAA 2IS6A 4QUEA 5A0VA 5DYYA 4LY9A 1UEJA 2QQFA 3KKLA 4TSRA 3HWRA 4OBEA 5KHAA 2PY6A 3CEAA 3QUTA 3TE7A 5A0TA 4QUGA 1NZJA 5A03A 1JEQB 1MF7A 3LT1A 4ZA2A 1Z6QA 1R2QA 4B4UA 2XZLA 3ACBA 1LDMA 2QVXX 3A1VA 3P7MA 4K6KA 2OZEA 1SCNE 1BFUA 1TTPB 3A9VA 4OUDA 5CMLA 1YMVA 1Z0UA 2WBLC 4RTJA 1KOGA 4GI7A 3CGWA 3R5XA 1M8FA 1ZK1A 1H8HA 4PS0A 1Q6YA 2GETA 2I2FA 4MINA 4MV6A 4TTSA 3JD2A 2P67A 3GOQA 5LQSA 3ZDRA 2E4VA 3TDMA 4P3OA 1VRVA 3HH8A 3VC7A 4CL0A 2AMYA 1X7GA 2DCMA 2VH2A 4QUAA 3K92A 3UAOA 2YJGA 2Z4SA 1C9KA 2H1SA 1QONA 2CYBA 2QWXA 3MJFA 2HJWA 3PDIB 4CKEB 2HWWA 5DPMA 1NIJA 5K03A 1SHTX 1SKMA 5LDGA 1QGDA 3EIWA 3LWNA 2HJRA 2XMDA 1QFSA 4JC0A 4NMWA 5BSRA 4ZCMA 4RV4A 3Q1KA 4ANFA 1IOWA 3KYBA 1Z6ZA 5JAZA 1YWGO 3TEJA 1H2RS 5GWXA 2YVUA 3DGFC 4LKRA 3OZXA 1HDYA 3R7NA 2VQ6A 3WSVA 1MRZA 5GVRA 3U17A 3GLUA 3VPXA 5T5QA 4PZUA 3ODGA 3E23A 1L7XA 2PIDA 3DB1A 1GN8A 1G3MA 5A3JA 5JADA 3PNBA 4R98A 3I2GA 3JAWB 3KWMA 3RIYA 1XCOA 1EI9A 3KT6A 4J1TA 4MS3A 1ZESA 1QHXA 3OO0A 3WYCA 2IVFA 5THQA 4GI3A 1NXPA 1CG6A 5IC4A 1U3TA 4JKIA 2FPWA 2P9JA 5A5FA 3PPIA 5IAOA 2Z6AA 2JBHA 4DY4A 4L74A 4CF7A 5AKXA 2PMWB 1GARA 5C51B 6LDHA 1PWHA 3CZAA 2UVDA 1DPGA 3L0DA 2WABA 3GDFA 4HWSA 5EXDA 1XTJA 2YFKA 3I64A 5E2IA 1MA0A 5EQTA 5HZHA 4DRYA 4XEUA 4RQTA 3EZ9A 1KDZA 1QYVA 1OWMA 3DBLB 3KQTA 1QLWA 3U7IA 1D1TA 4OHBA 4ZYYA 2OCBA 4OATA 3O38A 4FSDA 3PFFA 2YDXA 4ZO6A 4M4SA 4FFBB 3BL6A 1OYYA 4AY5A 1RBMA 2GAFA 3ASVA 2UDPA 3OD5A 3FI9A 2IXBA 3U2QA 3Q7PA 2EU8A 2W8ZA 1XWFA 5IRCD 3W2HA 3KVNA 1Q1NA 1AD2A 3ELUA 2XW6A 4ZAXA 1X7DA 3D1LA 4K0KB 2ZWOA 3TH5A 1R9MA 5LBIA 3L01A 1M2VB 4IV0A 1ZM3A 2OAEA 5EVCA 4GYYA 2IIVA 3LUDA 5T3YA 5BN4A 1R27A 2JH9A 3VVCA 5CXUA 1BA3A 3KHTA 2ZYSA 5KDOA 2FSGA 4FMCF 1MABA 1KC1A 5DV9A 3HSYA 1PHPA 3ZIAD 4B4OA 1JJAA 2ZRDA 4RD6A 5EYPA 4FZVA 3NPAA 3TR6A 3A1NA 4OY3A 2NSHA 4OF4A 2EG5A 5FA6A 3S99A 1E92A 1RIFA 1S2DA 2KBEA 5C1IA 3E5NA 2WPDA 2DWUA 1N5OX 2LV8A 4X94A 4HQ0A 3WIEA 4B7UA 4MPPA 2FEOA 1SEPA 5I4IA 3GCWA 3UWOA 4L27A 2XKAA 3FMPB 4F3TA 1TVMA 3F5SA 3E1KA 3QKRB 5EQDA 1WUKS 3RVRA 2DHEA 3RVPA 2VYQA 4RVGA 3C6BA 4EGQA 2AV6A 3JTMA 3N05A 2Y67A 3AW8A 5C53B 3QX3A 2I33A 3T4EA 2GHTA 3WKDA 2IXFA 4DOMA 1THZA 2CN1A 3DPIA 1LSJA 4MK4A 1QP8A 2RH4A 4BEVA 3WLQA 2GH1A 2QL6A 3NHWA 3QV1A 5L95A 4PCLA 4D4MA 1ZINA 2OO5C 3V6LA 1WMBA 3W90A 3DV9A 3E61A 4UU7A 2D5AA 1PLKA 1XZKA 3W7BA 2FZGA 1ZIYA 2F3SA 421PA 5K8JB 3GX1A 3VU0A 1KOJA 3F71A 1PT9A 4QJ4A 1H0HA 1KMCA 2GK4A 3JZIA 4I8IA 3FPGA 3QHQA 1CUSA 3IAUA 2A9RA 1JVSA 1DFHA 1JKXA 4KOAA 4OFZA 5FBRB 5C8VA 2RHTA 2Q46A 4HDNB 4K6MA 4X8HA 5LQRA 4TROA 2PGDA 2GPJA 3AFHA 2X14A 4FSHA 1P1BA 2WTNA 5EFZA 4TGLA 3WQSB 1S2NA 1GYQA 1JDTA 3KZKA 1ISRA 3T1NA 1R4AA 5EKXA 3VTAA 4RMHA 1C29B 4BU1A 3BRCA 1J4AA 2RGUA 4MEAA 2QPAA 4KCGA 3WZMA 4ZK2A 4HAUA 3B7GA 3VSDA 4YUYA 3FR8A 3DXZA 4Z0PA 4D79A 1NFQA 3TIXB 5JD5A 4IINA 2ZRLA 1PR2A 1GQQA 5EE5B 1K5GA 1KMHB 3MD9A 1UM8A 4TV8B 4WEOA 5JSYA 4MP8A 4TN1A 3UPDA 2ZDQA 3MBKA 3PJFA 5G02A 3IQHX 4W5QA 2ANCA 4PAOA 2YOHA 4QUIA 3WNCA 3BMCB 3GZ4A 3IGFA 5JNSA 2AA3A 5KYGA 1DZIA 3U5TA 4O25A 2OWEA 3KTAB 1E5LA 1QE5A 5C8ZA 3RUIA 3ZCXA 1XRPA 1XYYA 2BR5A 2GQ0A 5A6SB 3GZNA 3WGVA 5B6PA 2R8BA 1Z3IX 4L5JA 1PFKA 2VBFA 3WRVA 1GPDG 3C5WP 1VFNA 1Q12A 4MLZA 1PZNA 1ST2A 4I55A 4H4CA 3ZE7A 1M2GA 1P0IA 1G5IA 1UP4A 2IHZA 3CX4A 1CEQA 4MMXB 4QTZA 3NASA 4FYMA 5FPYA 4ZZ0A 3QU9A 3ZW8A 5CEFA 4D2IA 1GAJA 1YCFA 3WJ7A 4PQEA 3ZHBA 1T2AA 2EQAA 4E2FA 3H6HA 3IDOA 4KH0A 1R5NA 4UFNA 1YGPA 1MIOB 1IJBA 5A06A 4KV7A 3CKKA 3C1AA 5EPUA 4QULA 2OY0A 4LTNA 2MSLA 2JK1A 2B92A 1ZXBA 2XVXA 2IYQA 3HGMA 1X7YB 4MCHA 3DOFA 1GO2A 4UOQA 1KETA 3EGWA 4L9WA 5FOXA 3ZKWB 4RD0A 5ALQA 1PNRA 4G0QA 4RA6B 4F5WA 2ATEA 3AG6A 1FRQA 3G2JA 4X3PA 4M9CA 3TK1A 1DOZA 3THWB 2WWWA 4HXGA 3V7FA 4JGGA 5FL7D 4A8PA 2CLCX 3Q8WA 3PGKA 3B78A 3GO4A 4JB3A 4JL6A 4CQLA 2HZBA 5KC8A 1KU6A 4AKIA 4C7JA 2PUCA 3O31A 2SNIE 3AF6A 5TPZD 1MW9X 1H65A 1M7BA 5BW8A 5DP2A 2MTBA 3RYFA 2GFHA 3IP3A 1TZCA 2ZUCA 4Q6BA 5C8YB 2H3HA 2PBZA 2R751 4LECA 1NUTA 1Z18A 2VPTA 3ROQA 3TQCA 4GWGA 3A70A 4BGUA 4DMRA 4KAXA 3PCTA 3ESRA 2YWXA 4D0LB 5I9LA 2AUMA 1XRRA 3GFQA 5A1TA 4IRMA 2P2ZA 2EFDB 1W19A 3K9LA 5DVZA 4PC1A 1E5TA 3GHYA 4NABA 2AN5A 4PFKA 3O4IA 1VLZA 4X8OA 1AV7A 3FTEA 2DPMA 1MC8A 1UZAA 3B6KA 3C3PA 3P9ZA 4D5EA 3UB2A 2WHYA 2X41A 5ARBA 5KVCA 3QE2A 5CA1F 1TKAA 2TSYB 1GVHA 4M1MA 1P75A 1QB8A 2CBXA 2ONZA 3AY7A 3L43A 1XTPA 5CP8A 1U0BB 1U4OA 4CMKA 1Z16A 2OHGA 2GN1A 3CSSA 2WFMA 3CXRA 1AZWA 1Z4QA 4EW1A 4Q9JA 1TOAA 2PWYA 3DUWA 2C77A 1V7PC 2W48A 4JI1B 3FZGA 1AS0A 3IX7A 3LFUA 4L4ZA 4QSHA 4IIJB 5HCIA 4YCSA 5CDFE 3TLAA 3H4VA 3COYA 3TL3A 4G5QA 1X1BA 4L5IA 1CUDA 5AJZA 4YRJA 3UK0A 4YP7A 4AX4A 1WVGA 3SZGA 1RZRA 4G0WA 4CQNA 4JJAA 4Q3OA 2DTDA 3CRQA 4GX5A 2DR0A 1C9NA 3CB2A 4R2XA 4AP6A 3GT4A 5IDQA 3N6XA 3T3NA 5E6SB 3O94A 2BE7A 3EH2A 4GPIB 4KQFA 2QX9A 3B6ZA 3TAUA 3RGGA 1MJ5A 2JFVA 3RKRA 1JQJC 1JBKA 4NOKA 1QK3A 3O2JA 3UT5A 4EEZA 1AK1A 1H6DA 1JKJA 2XUHA 4PGAA 3WC4A 5F1OA 5ENDA 3U19A 3OY2A 5H3LA 3GIWA 3BWBA 1OOEA 5BSWA 3QLTA 1CK4A 1G64A 1R6XA 5LDHA 3PXUA 2CUKA 4K9SA 1CUWA 1D7AA 3LBYA 4KSCA 4BZQA 3C1UA 3I34X 1A2KC 4L28A 4PYMA 2QV7A 2MYPA 5GMOA 1L4UA 3BFXA 4BFTA 1ISJA 1ULBA 2Q5FA 4Q1DA 4XRRA 4RTRA 2G5TA 2ZJ4A 1JDNA 1MCZA 2R96A 3JVIA 3L3BA 3QOFA 4XXHA 2GNPA 5E8JA 3VX3A 5BOSB 3UQYS 4KHZA 4EM6A 4QUBA 4W5RA 3N8GA 3OZGA 2ACEA 2P5TB 5JAIA 5A05A 1Y7PA 4HEA6 1GL6A 1TQ6A 2WYHA 4N5LA 5ALIA 1D4ZA 1K0FA 1LPBB 1E8MA 2QTHA 4GC5A 3N2YA 3F6BX 2ZI6A 4HFNA 4J29A 5ALSA 5LOVB 3QKTA 3EVGA 5CHEA 4AQDA 2Y93A 3DDHA 1L5SA 4UTOA 5CDSA 3LIPA 3KUXA 1UJCA 4EB8A 3KOXA 3ZYZA 1QHNA 3SFZA 1IK4A 1H1LA 3CUWA 1RYHA 1V25A 4JY7A 3CE9A 4O4HA 4TL9A 1T13A 4DMMA 4K7JA 5FR2A 3ND5A 4XH9B 2HFJA 4NTZA 4DIEA 3PJEA 3K0FA 4U7HA 4ZI7A 3CLSC 1W48A 5BQ3A 4BJ6A 4NXNB 2X5KO 2ZUWA 1JU3A 2XCUA 2NSJA 1VKNA 2JANA 1X7XB 3AT1A 3H97A 3O3NB 3PC8C 3ZNOA 1E1DA 2HL6A 3TN7A 3LECA 4EF5A 3IALA 4ZU3A 2X15A 4ZEWA 4BMCA 1FTSA 4Z7QB 3DJFA 1M6WA 3IJRA 3CWQA 5TLSA 3EOAI 2AE2A 1H4TA 3FPLA 4LJ5A 3QEOA 3W8FA 3OF5A 3JQAB 2VTEA 2VF8A 3W7AA 1Q21A 2IE0A 3CH4B 3H16A 1C7IA 1FNBA 1MUUA 1V8OA 3K9QO 5LA6B 4JUCA 2X0FA 4PCVA 2HGSA 4KBGA 3H1BA 2C1XA 3VA7A 4BV3A 3DO6A 2YRWA 5AK0A 1T0JB 1MXFA 4MDFA 3Q8LA 4Y9DA 3PX7A 1IQ0A 3N0WA 3V3TA 1DC4A 5DXAA 1ODLA 4Y6RA 4MUBA 2E87A 3A27A 2IXAA 5K3CA 3AQ4A 1DG9A 4QD3A 4QDXA 1W52X 2WZDA 1AO0A 1NQ5A 1NUQA 5JQWA 3DC7A 3E7DA 3TL6A 2FH5B 2J5RA 3JQEA 5DN6A 5TJHA 1XRLA 4M21A 4DCJA 1TD9A 2QVZX 1C0KA 1TO2E 1W59A 4KDRA 1V26A 1MNAA 3QI2A 3RK0A 4JJ6A 4EUKA 2GVZC 3HO8A 3MG9A 5H8WA 3TR0A 3WB2A 4G9GA 1ORWA 1YDMA 1US8B 1EXWA 2JAHA 3RJZA 1F51E 1A4UA 3SJAA 3JW8A 2H3EA 5FXMA 1WSAA 1XQ9A 1YCGA 1TIKA 1CRLA 3DMTA 2ROQA 2COKA 5GV8A 3J7AC 3C6YA 4FX2A 3W6OA 1KTIA 1A2QA 1VGVA 4OBBA 4HDKB 3CKLA 1B93A 4JSYA 1VA4A 3LT5A 2XYQA 4GBJA 2X86A 5DT2A 3M6IA 3AEZA 3MT8A 5KYWB 4E09A 1M0WA 1ND5A 1MOQA 4R8VA 4XM1A 5JEDA 2VWQA 4PGFA 2YWJA 4BMZA 5K0CA 4RETA 2Y1FA 2ZRQA 4PXYA 3SHWA 4ALJA 1YZNA 4ZYXA 5L3ZA 2EEPA 3A6DA 1RACA 3DNPA 3EQ7A 1TEXA 3CU5A 4RZQA 4BLWA 2RARA 2X76A 4U7PB 3P8ZA 3G2PA 3IAS1 3TDKA 4OCZA 3ZJYA 4I14A 1WDLA 3FAZA 3AEQA 3N5KA 4QU5A 4XIJA 1RYEA 4C0XA 1LS6A 2DKOA 4QRDA 1OCEA 4BWGA 1XZDA 3AF2A 4LF4B 3T5TA 5LIPA 4GOLD 2P11A 5EKUA 1EJ2A 4BP9A 5JAOA 2VT7A 1Z29A 3PNKA 4JVLA 3PC6A 1NF2A 2ETVA 1BRTA 2JLQA 2GWRA 3DV2A 2Z2YA 1UBRS 1IJFA 3OEWA 1QV7A 4BQOA 2EBFX 2AFVA 4UD2A 4DA0A 1L7QA 5IKPA 5ICCA 1VMIA 4NBKA 4RU1A 4I9FA 4BE9A 1IB6A 3K0HA 1I0LA 2GO1A 1NBEA 2UU9B 2EIXA 5KYYB 1VBMA 2YIDA 3EIHA 4UJ3A 4AROA 1AKTA 1ZBQA 1XT6A 3ESQA 2BLNA 4HQFA 1DLJA 2IQIA 3BWXA 1N8KA 3AIMA 4FDVA 4KN6A 4ME6A 4ZJYA 4Z53A 4LFBB 2W22A 1A95A 4I66A 5AO9A 3LPLA 3RC1A 3ZVKA 1JJIA 3CR3C 1WQ3A 2OZLB 4ARIA 1UDXA 4ZCRA 2P5UA 1M1NA 2W2LA 2JIZD 3QE3A 2RG1A 1LW7A 1N2GA 3ODPA 5FV4A 5KSPA 3O9VA 5JJIA 4EQ6A 1XFAA 3DP9A 3SBDA 1D0IA 2CNNA 1EBFA 4IOKA 2FW9A 4YRAA 1I10A 1Z88A 1TYAE 3KAKA 1WUTA 4GBMA 3MCZA 3MD0A 2AXEA 2FZCA 4IX9A 4EZBA 4NCHA 5LP1A 1JG3A 4EGSA 3BFPA 1EXNA 1M34B 3H1PA 1VM6A 5DK4A 4RY0A 1FY2A 5M04A 3PRHA 1PR0A 3EYAA 1QF7A 4OK6A 4U9UA 3RRYA 2GBIA 3WNDA 1N1MA 3NP9A 4MITA 4HLDA 3H2GA 3SBEA 3TTYA 3BIXA 2O0HA 3IE0A 4D99A 4C5AA 2QROA 2Q1YA 1EFRD 2YWGA 5AIAA 4DA4A 3U7HB 3EQ2A 5BUZA 3TKAA 3JQBA 4NPAA 4YDSA 1WXWA 1WZIA 5AQ1A 5LKRA 3FHCB 1L7BA 4EQZA 3HVRA 3K6RA 4JLMA 2G09A 2EQBA 2W6QA 2X8JA 1RPZA 2YVLA 4UAUA 2C0CA 2C94A 3FNHA 3K7EA 3FH0A 3HCWA 4JJEA 1H9AA 3A6ZA 3G2HA 1FDSA 3Q5DA 3RG8A 2R6ZA 5CBPB 3M6XA 4M54A 5DNCA 5HK9A 3AR8A 4P84A 4KP7A 3UFXA 4Q4LA 2ZJ8A 4INJA 5JJBA 2Q6VA 3AFMA 5JY6A 2OP0A 3NJ8A 2E5WA 2DX7A 3K0AB 2CF6A 2D0IA 1BVYF 1WEHA 4ZQCB 3COVA 2OFXA 3GRFA 4AZ0B 3RTEA 1GM5A 4NYIQ 1BGVA 4KNWA 1Q92A 1QH8A 4Y2HA 2G82A 1F9AA 5DXJA 2IUEA 3CWZA 2XAAA 2V5UA 4J0DA 3VZDA 4KYUA 4QICA 1X13A 1HSOA 2RH5A 1SC9A 2ZQZA 1TK9A 3ETJA 1VIMA 4YRFA 2I1LA 3LY8A 3PEUA 4W99A 1MPTA 5IG2A 3IERA 4D98A 1FX0B 2XQVA 1FRVA 2ZTHA 1WPGA 3OJOA 1FC0A 2UZ1A 4G9EA 4B9AA 3FG9A 3OLCX 5LC1A 1G6OA 5HF8A 2O0KA 4LYYA 3TBFA 3C70A 2ZAMA 1T8WA 1GY8A 1OFHA 4EWLA 3TOCA 1BYUA 3H19A 1NRIA 1FYXA 1D6MA 3MJTA 2BKXA 3OCWA 1TUBA 4M7PA 2FQQA 1F6DA 4HNSA 4IPTA 5AI4A 2GD2A 1MRNA 3F8TA 1SXQA 2OO3A 2PGLA 2Q3HA 4X84A 1G8PA 1O7JA 2J3KA 2BEKA 5K0LA 1JR3D 4NECA 3U9LA 4W63A 1BJTA 1WCIB 1ZH2A 3H5IA 1N2CE 2HRCA 4IIUA 5E4TA 4DA9A 4F72A 1KFJB 3P2KA 1M6VB 5AKYA 3LQYA 2BFFA 3OPXA 1XQ6A 4EUSA 2JRLA 3E6AA 3OAAA 4IGFA 1GUAA 4PO3X 2ZRJA 1K89A 4IVQA 2FR0A 2WTXA 3CZQA 7YASA 5DE3A 1U90A 4I4TA 2FWMX 5KS2A 3JATA 1MTZA 2IHTA 1QCDA 3RYTC 2IZ7A 5B4TA 1JYFA 4HAWA 4RH3A 3KYCA 3PPVA 1LF5A 3IP5A 2WJZB 3QVOA 3RSOA 3VKHA 2I62A 1KZ7B 3FHJA 4Y7DA 1CULC 3K96A 1DKQA 3HA7A 1THMA 2UXDB 4O1MA 1L7EA 4ZIRA 4JBGA 2R85A 3IBGA 3LF1A 5I8PA 1L5OA 2ZK7A 1MJHA 3E0QA 1N2BA 3PXDA 3PQ7A 3R3ZA 1L5NA 1XMJA 1WDTA 2YV2A 2QZZA 1UIMA 3K15A 1RRCA 1L3CA 5K3FA 4RVOA 1KOLA 1S1MA 3U3JA 1GGEA 1TCAA 2LKDA 4N47A 2FY8A 5IM4F 1LSOA 3QOYA 4ITUA 3W2IA 3B1ZA 3KAPA 3VVBA 3W79A 4E07A 1XKTA 1OVGA 3NTLA 4P98A 4UVHA 3I04A 5INTA 5JY1A 3CBQA 1Q17A 2QG4A 5CAEB 1ADCA 1EAMA 1W49A 4A6EA 4B84A 2QJRA 1RJ9A 2YMPA 3U6BA 4W8GA 4IXDA 4P34A 1CE8A 2J6BA 3JQQA 5K0GA 3OFVA 1V43A 3T61A 3DMDA 2ID4A 2G6TA 4O08A 4JQZA 4EHJA 5KYXB 2ZAGA 1ZZEA 3IS3A 3UY4A 1XSEA 2VAWA 4BDSA 2NIPA 4A6DA 4BLOA 1UWCA 5KSWB 2AI3A 4UASA 3R9WA 2G5CA 3GLQA 1AHIA 3TKYA 4AZ3A 3DOCA 4TZ0A 1FJHA 1EKXA 1JZQA 5IZCA 1COWD 5F4BA 3TNDA 4UD6A 4BN5A 2ZM5A 3OZFA 3NHAA 1YZVA 3G88A 4PX9A 3E7PA 3HVUA 4J8PA 5AOCA 4M89A 3RF6A 3DKRA 1EGQA 4NZOA 5F2KA 1F0YA 5FH9A 1IY2A 3QYAA 4WNYA 4KQHA 2X9QA 1JEDA 2EKDA 4B3DA 5KJCA 4GO1A 3MUOA 2RBEA 1LS1A 3KQQA 1USWA 2PFKA 1UXJA 3B36A 3HM2A 1QB7A 3IRUA 4IWNA 3ZCVA 3D7MA 2YS6A 5FWYA 3NEYA 1CRPA 5HXAA 2CLSA 1PG0A 4WFIA 2JHGA 4X6YA 5HMLA 3DL7A 4UATA 5PNTA 1Z0JA 3DEKA 2RHJA 1V48A 2UVPB 1TQ2A 1I3OA 4Z4FA 1G3RA 2Q28A 1ABEA 4YJHA 2C4NA 5ULLA 1QMGA 3T1QA 4FB5A 1BWRA 2FX3A 4X5OA 2LWIA 4QT4A 1EZ4A 4FI3F 1OPXA 4LGMA 3C8HA 5KNBA 2QTVA 4AICA 1U7WA 1NJSA 5ALYA 4ASUA 2XBMA 3MOSA 1YZQA 3FOWA 4HNAA 4RANA 3EZGA 3TINA 3IB3A 5CFZA 2VDQB 1XEWX 2DRIA 3G0CA 1II9A 1QO0D 2FFBA 3KK0A 7MDHA 5CVVA 2NTYC 2RHGB 5ED0A 3PD1A 3O9MA 4F9EA 4AN4A 3LDUA 5EXXA 2H7CA 2HRBA 1SUSA 2BM1A 2ZAOA 3L7NA 5JXWA 2DB3A 1JDSA 1M3SA 1I14A 1U0LA 4RY9A 4FMPA 2FPUA 3PDHA 1V6AA 2IY7A 3GDGA 2ZIGA 3HE3A 2XAUA 1Q1BA 5H0IA 3WLNA 4YVFA 2X23A 3LDGA 3A3YA 4AWBA 3ESYA 3OJCA 3HVJA 3BXPA 5GONF 4DIDA 1GQFA 1TPYA 1N5MA 1Y5LA 2JL1A 5FOWA 2OFOA 4FDMA 3NXSA 3KYDB 3HXMA 4YT5A 3EMDA 4DAEA 5DKFA 4LWOA 3TD6A 4HQLA 4L3VA 3QPDA 4Q4HB 4BNWA 3FPBA 2P1DA 3KR9A 2P5YA 2PZKA 2ZCUA 4DLAA 6CHYA 3FCSB 4PC2A 2ZETA 3FI0A 3KZNA 2II6A 3GDWA 1Q57A 3SR0A 2QT0A 4XVHA 4A4DA 4O4JB 2BCGY 2C61A 4RHXA 4W8OA 5REQA 2ZAYA 4OJTA 4X8LA 1LLCA 4J3NA 1H23A 1WVMA 3WGHA 2JIRA 1L7OA 2CNWD 4LVCA 5IH3A 4TXJA 5TDHA 3ZC3A 1DXHA 2VHXA 3W05A 1JEEA 1R3DA 4JH0A 3KQUA 1Q0TA 1HGXA 1MVOA 2RAUA 1S1CA 4XWAA 1J90A 3W6PA 2NPIA 4Y1RA 3IVMA 4CT4B 4YI5A 2B1QA 4ND1A 5DYGA 3SZUA 2HDWA 5KYNA 3FVQA 4CM3A 3Q9SA 8ABPA 1JB9A 1ZL2A 5EE3A 1BXRA 1RWBA 3WYAA 4PC7A 4K2AA 4M1YA 5JFGA 2EBUA 3UJPA 3QUBA 5LBUA 5ER9A 2WJYA 3DBOB 3DE0X 3V4FA 3I0NA 3PWKA 2WJ3A 3JY6A 1UBHS 1RWOA 3K9GA 2GFQA 3PJDA 2AN3A 2DJ5A 2QRPA 2AUNA 1DKMA 2JD1A 2XDAA 3LI2A 4ARZA 2J6IA 4RA9B 4LN1A 1PSZA 1U0OC 3FPJA 1XJ5A 1B6SA 3LY9A 4KHPB 4U2GA 5E7JA 1G4HA 3EFOB 2H92A 3SJCA 4WV3A 4RELA 1VHQA 4AJ9A 3UJ8A 5TT1A 5BNFA 2PMBA 3P9SA 5H82A 3CW8X 3AOGA 4MWZA 4F06A 3WWYA 1DOHA 1H0KA 3D81A 4C01A 3DTVA 2OYRA 1P5RA 2C42A 1X3SA 1RXYA 3PHBE 3O4JA 2R7NA 3P0FA 1DAIA 3HS3A 4MDHA 4OSEA 1M33A 3CRMA 4BO3A 3OHPA 3OX1A 1HLPA 3HLYA 4YJDA 4LDQA 1NVXQ 1PI3A 4YUVA 1L5GB 5HGXA 5EQJB 2OXIA 1HLDA 3KLOA 3QENA 4HXEB 4PPYA 3UO8B 1K08A 1HF3A 3V7YA 5HOQA 2V0NA 5J2UB 2HCTA 3QA9A 3SXUA 4QBFA 4YP0A 1XKQA 1SXJD 2P62A 3LCUA 5T67A 1JVNA 1C8LA 4ZYUA 1DCTA 4LPKA 3I8SA 5ALHA 1N7IA 1S02A 3SC3A 2HBYA 3FNFA 3PT9A 4X62B 3JQ9A 1EJ0A 3HVKA 5FUYA 3DHVA 3SM3A 5LQUA 3GMSA 1BHJA 1P77A 1HETA 2WYVA 1LK5A 1TZBA 4LQCA 4RHYA 5AHRA 3T7CA 3RS4A 3IQDB 5A4AA 3WYEA 1NUUA 4CU5A 3HDGA 4V0MA 1E63A 3OQMA 4BJHB 3KQSA 1U1EA 3Q11A 6NULA 4BLQA 1EUDA 3VGPA 1SEVA 2JA1A 3B3FA 2V03A 3NTRA 2Q5IA 1YQGA 2NV0A 2QRMA 2J3MA 5EP2A 5IJZA 5KKAA 3W06A 4ESEA 3DT6A 1QVAA 1J0BA 4QXRA 5CXSA 3WGUA 1JEQA 1B8VA 4GR5A 3LWBA 3QI7A 3SOZA 2VYND 3LRPA 3DW1X 4EY7A 1CZUA 5L4LA 1V7ZA 3GPLA 3O8DA 1BH2A 1HQYE 3AUAA 1CWUA 3DD5A 3HXPA 3PXCX 4O63O 3STHA 5HIKA 2E82A 3H9QA 4OQDA 5JO0A 4AJLA 3SC4A 5JH7A 3PUHA 2VYVD 4J76A 2JPDA 4EEXA 1AMOA 1P7WA 4D3ZA 1OI3A 3AHGA 1U3GA 3SQNA 1DKRA 4MB2A 2NO1A 3WL8A 3CLKA 3FVVA 3I5AA 3M5CA 4GYKA 5EHGA 3WLEA 3C85A 3K53A 4I4NA 1GA4A 4JLJA 4BN4A 3RHZA 2PYDA 1FP1D 3PDIA 3EVEA 2DH6A 1I32A 3E3AA 2FRDA 4WA8A 4CKEA 1UCFA 5AKLA 5EIEA 1SBNE 1YQWA 3KZCA 1XZHA 4F91B 4O8CA 1ISMA 3SM9A 2DHRA 3ZTTA 4K87A 1WR8A 4XEHA 2IPXA 4O2AF 4YAGA 3RLIA 3C3DA 1JILA 2H1RA 3DNFA 3LCRA 1IN4A 4HEJA 2LDBA 1CQJB 1LVUA 2I6UA 3ANNA 3JQ8A 3WLTA 4EY6A 1UKZA 2ZRAA 2V4ZA 3HXTA 3LZDA 4PIVA 4TM8A 3CRRA 1SU6A 4N7JA 2XH8A 1F7UA 5CK4A 3QPWA 2OQ2A 3MB8A 3QLEA 3OEEA 4TTQA 3T95A 3HPRA 3PGLA 1HNWB 1JDJA 2DERA 1YDGA 1JQDA 1WXFA 2KM1A 3I9KA 3MUNA 5AW1A 2AYXA 2G5GX 1A27A 3ZCPA 2D3WA 1Y1RA 3JAWA 3L7BA 3ND9A 3VYUB 1XRNA 4TS9A 5AXBA 3FPKA 1O3YA 3LUAA 2O9JA 2IZ1A 4FYPA 1B14A 2ZW9A 4LYFA 4KIFA 4W1RA 4HN2A 4B8ZA 1K4MA 2P65A 4ENVA 1NMQA 2JFXA 1X9GA 1F3LA 2B83A 1LEHA 1M2FA 1CC1S 2WOOA 5EZQA 2OUKA 5ALVA 3K9CA 1Z15A 2YTZA 4J0IA 1OFIA 1WMFA 2P2SA 1T2EA 2GSDA 4I5IA 3B9PA 3EDRA 3I6QA 4Q82A 1E96A 4GC9A 4UHJA 3D3JA 4EF6A 4DY6A 2LTAA 1XG5A 3DAYA 4LZWA 3ZUPA 1YR7A 2AJTA 1EJ6A 5U4XA 1N5DA 1CT9A 4RKQA 4LYJA 4TLEA 1D2AA 3MFQA 3UT0A 1RKXA 4B6FA 3DBLA 1TEHA 3FJ1A 1RRFA 1SC3A 1NW5A 3RYIB 4R7GA 1C7ZA 3MT9A 2Q5CA 1GZ7A 4HMQA 2FXIA 3H5OA 4HZUA 4R31A 1R5JA 5EE9A 1ZD4A 1M1YB 4CU2A 2CV1A 2J87A 4FFBA 1Y6ZA 2X6QA 2GVDC 5ARDA 4UJ5A 1O5OA 5FJJA 5I9IA 2KSQA 1IBKB 4FPXA 3CWCA 1FQOA 1SCDA 2FMHA 5DM1A 4F2GA 2PH5A 2D2EA 1BHO1 3L8DA 2ZTLA 2NO6A 1NQWA 3NUZA 4AY6A 4O5OA 4PZAA 2P7IA 3ZQ4A 5JARA 3IVCA 3VGJA 2DPHA 4QWWA 5JMOA 3IKLA 3DYBA 2AFRA 2DP4E 3W1WA 2VL7A 3OWHA 4OHRA 1Y6GA 5ALXA 3BA6A 1U2TA 4NK5A 3K1JA 5K45A 1YSCA 4E3ZA 1C81A 1RWKA 1YASA 1ZK2A 1T5IA 4IHAA 1NM5A 3ZV6A 2YWEA 2FEXA 1AKRA 3N7UA 2ORYA 1YBVA 1E2JA 5H16A 2H5LA 1Y1QA 3WK4A 2P0YA 3BC1A 2X7XA 3R7DA 3ISVA 1G5PA 1NF3A 1XZPA 4KUGA 1HT2E 1QQTA 1GTJ1 2WE7A 2Q4TA 4G5FA 1XU4A 2R6DA 3A4VA 3KG2A 1POXA 2XHEA 3E4DA 2C95A 1E99A 1HDEA 4CCYB 4R3NA 1F12A 4F86A 4KREA 2HSEA 3E53A 4OQXA 1IFXA 2W2XA 2QN8A 2XCRB 2H00A 2PVSA 1Z5UA 4UHCA 4KN5A 4LJ6A 3TUZC 4HMPA 3BHJA 2HBRA 1SUFA 2E4WA 2OV8A 2B5WA 2GEKA 4C6TB 1DKOA 2ZI7A 3JD0A 2RE8A 1F2DA 2BOVA 2JAUA 2REXB 3OE7D 5HZGA 4HAVA 4FZRA 3P5SA 3QXHA 5K0NA 3I6IA 3ZY6A 4BV2A 5FD8A 5K8CA 5AW3A 3BE8A 4IV5A 4NBVA 1ELOA 3CF6R 5C1BA 1E3JA 2JHFA 3ICQB 4EJ2A 1E6UA 1U5AA 3THYB 1E64A 4YP1A 2GZAA 2JGEA 4MO2A 5B6IA 2YJ5A 2JH3A 5AW9A 2RG7A 4PQFA 3WYNA 4ZYZA 1A0OA 3WZ2A 4DV0B 2GD0A 3GL9A 3DZFA 5JZVA 3WRYC 2RI1A 4XB2A 2I7XA 3ZU3A 1SIUA 3H9GA 4OLJA 3ZY2A 2ORWA 2QR3A 4IEEA 5MHTA 3U7GA 3G5LA 3DE3X 5FWXB 2O5EA 2YASA 5CURA 2JCBA 1L0BA 4H60A 1U8CB 1ZY2A 4EDHA 4PLHA 2F3QA 3B1YA 1S7CA 4HDNA 1MVLA 2NXJA 2C9BA 3H5WA 1L4YA 3L1JA 4FC7A 5HS6A 4BO7A 3PKIA 4V0SA 1DJNA 4QPJC 2VNIA 4G5RA 3CNOA 5HIIA 4UAGA 4RDCA 3ZZNA 3NHUA 2BTQB 2BMJA 1HYQA 4XSVA 2JLWA 3RVNA 5JNWA 1NJ8A 3LC1O 2KJQA 1QFYA 4MKIA 5H59A 2E4ZA 2EW1A 4DDHA 4DT1B 4RK6A 3QX7A 4PAWA 2WSIA 3ZBPA 4AZWA 1ID8A 4MJXA 4Z1MA 4K46A 3RVDA 1ZGZA 4N39A 2VH5R 3LFHA 4DRZA 1Z5VA 2ARKA 4DWVA 1FNNA 1MOZA 1F0PA 2R8YA 3HDYA 4TV8A 3V8RA 4RVHA 1HT1E 1GCGA 2QY6A 1B4DA 2VRCD 4O4IB 2FMXA 2OCLA 3PQCA 5JPDA 2XOEA 1G0NA 5DLPA 1G3QA 4AZTA 4XUGB 3R7SA 4EJSB 1JJVA 5JEEA 1TYCA 2ZI3A 4OQLA 2IIPA 3FRIA 2GKOA 5A6SA 3OT1A 3PTLA 3LVQE 3SEQA 3OPNA 4US1R 1RRMA 5KNCA 3ND8A 2V6IA 1NWCA 1P6UA 2WKQA 3DQPA 2XIJA 4BMOB 1ZR2A 4M1QA 4ZC1A 3KHKA 4UTZA 1U2GC 1UZMA 4CLOA 3KETA 4XJVA 1V39A 1YB4A 1E2HA 4TMYA 1KZ1A 3R3WA 3TSCA 1RI2A 4PICA 2QLTA 1HQKA 2YH2A 4OQNA 3GBVA 1G20B 4IOLA 5A3QA 2WSSA 1SZDA 4PC3A 1QX3A 4WY2A 3RUAA 1V9SA 3FF1A 1EK0A 2XMRA 1R0KA 4QLAA 4V0NA 3PFWO 1KPHA 4KFCA 1DQPA 2JI9A 1RKUA 3B5IA 5TXGA 1VKRA 3D4LA 3PPXA 3AB3A 1MIOA 2B0CA 2F6RA 4HWPA 1CRZA 1OKKD 2E18A 4UDNA 3WNBA 4A5OA 3R7WB 2HRZA 2H06A 5JRZA 5HJEA 3MBIA 1ZNYA 1USVA 2CFCA 1UFOA 1LWNA 1X7YA 2P79A 4IH1A 2NYVA 3RIXA 3MPUA 1F4PA 2QEQA 3AJ8A 3L84A 3GRKA 2BTOA 3GJ4A 1IM5A 3ADKA 1VB5A 3DL0A 2IFTA 3IEKA 3ZKWA 3OIFA 4RHUA 1GA6A 4GX0A 3VO9A 3AQIA 4DAOA 1NN0A 1Q16A 3OMXA 3QELB 4DR4B 3THWA 3MAJA 2YZ2A 4PYIA 4UTVA 2F1RA 3PWZA 4EHNA 4S0XA 3DWGA 2XGOA 1CY6A 5LU8A 2W6JD 2J07A 2J31A 3ZHQA 1LJUA 4EHIA 4KNYA 2V6JA 1FRNA 3MTAA 4ZAFA 4W5TA 4D3SA 1ZPDA 2C3MA 2HUNA 4XWWA 3EYWA 1KTVA 4DLNA 2V58A 2R44A 3RBXA 3CJQA 1BOOA 3SFTA 1KVSA 4M98A 1ILWA 2TRSB 1Z5PA 1T1JA 3H2YA 3PG5A 4PEVA 1NATA 1LUAA 2QTCA 4GW3A 2OR3A 2W5UA 1A9ZA 1AKQA 5KNDD 2IIQA 2PAAA 3ZD6A 2HMVA 2LXNA 3E3OA 3VUEA 4F2WA 1Z8DA 4MHTA 4R2WA 3ITEA 1DX9A 1JR2A 2I5PO 4PPQA 4RMGA 1KJ8A 3W5UA 4C7BA 1UXHA 1JAYA 5EIAA 4GRIA 2VEDA 3BAZA 3DA8A 2BFBB 3C8DA 1B16A 4JLVA 4PXSA 4NZYA 2VPXA 5JSHA 1HE2A 3FY4A 2AFHE 2Q6KA 5EG5A 3SCZA 1PQ4A 3GA7A 1U7OA 4LGYA 3AEUB 3I1YA 1XYGA 4MW1A 2ZR0A 4LZPA 4WCFA 3WK6A 4PAGA 5HPYB 5LQJA 4MUHA 2V8BA 2ADMA 3Q5GA 2GXUA 2PL5A 4U8HA 1MFPA 5HBRA 1W7AA 2P9QA 2QZ9A 4ER7A 1AURA 3WQBA 3RT7A 4A8JA 1CY8A 1OV4A 1U28C 1EZ1A 1OTXA 3ANMA 3EXFB 4QVGA 4UUBA 4YN3A 5JS6A 4ILEA 1P3Y1 1SOWA 4YRRA 1H4QA 3WK7A 2MT9A 3EDOA 2Q4BA 5ERGB 3UHFA 1Z5OA 4Q9LA 2DFNA 2NXEA 5E3JA 3AM4A 4GXNA 1FL9A 3RC7A 4B6GA 3ZV7A 4ZKEA 4YMTA 3V55A 4YV2A 3R9XB 1VA5A 1W96A 1CZHA 2E3JA 3ZCTA 3ZY5A 2PSDA 1H05A 1QHHA 2NTEA 4L57A 3KDSE 4B2YA 5CR9A 3OOJA 4IG9A 5EUQB 3IEUA 3WK9A 3VSCA 3GH3A 1V3UA 3SQMA 1WTCA 4PR0A 3MEQA 4F7WA 2EHDA 1MG5A 2VPIA 3O0DA 4TMVA 4CT0A 2PQ2A 3GBSA 1X6VA 1EXMA 3PA6A 5EN4A 5BV8A 1IVNA 1AM4D 3WLPA 1Q7GA 2J0EA 4UBIA 3U5ZB 4CKWB 1Z62A 5CFOA 3T7AA 4C22A 1CUZA 4WNCA 3DMHA 1IXYA 2CKMA 4FR0A 4CLDA 4G5HA 4Y2UA 5K1ZA 1Y7HA 1Z0DA 5JAHA 3PXAA 4HLQB 1OMOA 5AXDA 3QKIA 2NVUB 4JHLA 1UXGA 1W4ZA 2GD1O 3PIRA 3S44A 3A1EA 4ES6A 1JG7A 3RVQA 1E32A 1EEXB 2Q9UA 4IGAA 3V4SA 5JI2E 5AH0A 1CB0A 2X1MA 3E5HA 4UFOA 4FHDA 4D0RA 3NAZA 1EVYA 1NVWQ 5LOVA 3H5AA 3EZ7A 1LCIA 4MUNA 4KVAA 2O8FB 4C6RA 4LHXA 5IBQA 2ZTSA 3FUXA 1OBVA 1PT6A 1JF8A 1QAOA 1LFDB 1GTZA 5C4IA 1NVMB 1U2RA 1NHGA 2HMYB 2HW8A 2IP1A 1UWLA 4RY8A 1C3JA 1JUDA 3WE7A 3JYQA 4IILA 1PQYA 1N6KA 3O95A 3TLYA 2YHIA 3DHEA 1CJVC 3HRHA 1E59A 5TQ0B 2M9MA 2VHUA 4Q3LA 2RAVA 4F6RA 9GPBA 2HT6A 3BH0A 1MX3A 3DEAA 2AW3A 1QU2A 3HWWA 5ECGC 5AW8A 3PRYA 5L4NA 2WWYA 1J8YF 2QBYB 2QN9A 1X2EA 3JQAA 1C3VA 2YJ4A 3OFKA 4IJWA 3KOMA 1ZH4A 4F85A 2AEFA 1B0AA 3NUGA 1ZKDA 5LA6A 4DEYA 2GAJA 4CDGA 1RT9A 2P9BA 1UOEA 2I1VB 4EDFA 2HMAA 3LNTA 4FU0A 1VMEA 2CW5A 4Y2PA 5B1YA 4UEQA 4Z99A 2GN4A 2R25B 3SSNA 1YTUA 4MI9A 2PK3A 2Z8YA 4EVRA 5KPDA 2J4DA 1AKVA 4XGKA 3SZRA 2JHCA 3KVYA 3ZNPA 4KWTA 3Q10A 3AKZA 4P0PB 3UGQA 3PR3A 1W35A 5DXFA 3FMIA 5DNDA 2HJSA 5BNTA 1SOVA 2XBLA 4KQ9A 4MRNA 1ECJA 4NPCA 4PN3A 4BWVA 3QYPA 4OBXA 3R5SA 3CX6A 4M88A 4OBWA 3SKYA 4AD8A 1K2WA 1PYDA 5E95A 3ZE8A 2Q4DA 2UZAA 4ZU6X 1MC4A 2FF7A 3IILA 8MHTA 1PGNA 1RXVA 3DLIA 1US8A 3BICA 2MR5A 4LJYA 3CLUD 3CEMA 4AJIA 3GCXA 3WJAA 5JAQA 5BORA 1NLYA 4DMHA 1Z3CA 4KQWA 3QLUC 3UPTA 3A9RA 3PC8A 2HJVA 4CEHB 1PUXA 3O7MA 2GKSA 1P8JA 1CX9B 4K6GA 3FDXA 4LMAA 3RS5A 4BX8A 5LU9A 1M5TA 5HKOA 1JIJA 5DK6A 1Z28A 3DLTA 1SVUA 2OV4A 2J1LA 4IYRA 3V97A 1NVEA 4H9GA 2FJPA 2ZB2A 1NE2A 4ZAGA 3RO7A 2B1RA 1LPAB 4L5CA 2OWDA 2IPNA 4S2EA 4XD2A 9ATCA 1AHPA 4HAXA 3ADDA 1L5MA 3ZW9A 2Q5OA 3WTBA 2I9KA 1FZQA 5FPKA 4YRQA 3F6EX 2P2LA 1YQQA 3X43A 5GJBA 4S05A 2B0JA 5B58T 1AQ6A 5JAPA 1V45E 3EMBA 1HORA 1Y33E 2CFOA 4UBNA 4DIOA 1G5QA 1NX6A 3INYA 3PVSA 3TOZA 3CURA 2PO5A 4R0MA 5A2GA 5DHUA 1BFDA 2ZUBA 3ZGOA 3Q7SA 1YS9A 1XAGA 4K81B 1L9XA 1RIIA 5AVZA 5TNXA 5KWIA 3JQCA 2IYOA 2W6CX 1L5FA 4IDOA 4JA0A 3QPUA 5A3RA 3Q7RA 1P73A 3BCUA 1EUCB 1SU8A 3PFCA 4CCSA <