1HORA

Structure and catalytic mechanism of glucosamine 6-phosphate deaminase from escherichia coli at 2.1 angstroms resolution
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
266
structure length
266
Chain Sequence
MRLIPLTTAEQVGKWAARHIVNRINAFKPTADRPFVLGLPTGGTPMTTYKALVEMHKAGQVSFKHVVTFNMDEYVGLPKEHPESYYSFMHRNFFDHVDIPAENINLLNGNAPDIDAECRQYEEKIRSYGKIHLFMGGVGNDGHIAFNEPASSLASRTRIKTLTHDTRVANSRFFDNDVNQVPKYALTVGVGTLLDAEEVMILVLGSQKALALQAAVEGCVNHMWTISCLQLHPKAIMVCDEPSTMELKVKTLRYFNELEAENIKGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUCOSAMINE 6-PHOSPHATE DEAMINASE
publication title Structure and catalytic mechanism of glucosamine 6-phosphate deaminase from Escherichia coli at 2.1 A resolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Intramolecular oxidoreductase deaminase
total genus 96
structure length 266
sequence length 266
chains with identical sequence B
ec nomenclature ec 3.5.99.6: Glucosamine-6-phosphate deaminase.
pdb deposition date 1995-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01182 Glucosamine_iso Glucosamine-6-phosphate isomerases/6-phosphogluconolactonase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1horA00
1FS5A 4L5JA 3OC6A 1HORA 3L7OA 4L4YA 1FSFA 1Y89A 1CD5A 2BKXA 2BKVA 3CSSA 1KS2A 1UJ6A 2R5FA 3EFBA 1LKZA 1HOTA 1FRZA 2RI1A 4L5IA 3TX2A 2W48A 2J0EA 2O0MA 3ENWA 3KWMA 4GO1A 3ICOA 4L4ZA 1XTZA 3UW1A 4M8LA 1DEAA 4OQQA 1VL1A 1LK7A 1NE7A 1FS6A 1JT9A 3HN6A 2RI0A 2OKGA 2F8MA 2GNPA 3BXHA 3BXEA 3ENQA 4R7TA 1UJ5A 1UJ4A 3LWDA 3BXGA 4IO1A 1PBTA 3NZEA 1O8BA 3U7JA 3KV1A 4GMKA 3NWPA 4X84A 3ENVA 5HJ5A 3IXQA 3CH7A 4OQPA 3E15A 3EB9A 1FQOA 4L51A 2WU1A 1M0SA 3LHIA 3HHEA 4L50A 4R9NA 4TM8A 3E7FA 3BXFA 4TM7A 1LK5A 4NMLA
chains in the Genus database with same CATH superfamily
1FS5A 1VFPA 3EGIA 4H2DA 3X0DA 3P32A 4F3RA 1J2TA 2YOGA 3V3KA 4MICA 3OIYA 4TWIA 4MV3A 4E30A 4A26A 3IA2A 3CR3C 3CUUA 2ZATA 4WESB 4LSWA 3QW2A 1YV9A 3ETHA 2I91A 1R8XA 4U9UA 1DRKA 1CS0B 1QE3A 5D51S 4MW0A 4R6WA 2ZBGA 1MD9A 1TMOA 5E6SA 1C50A 1P17A 2Z83A 3DFIA 5FBQB 4CBVA 2AG5A 2R9VA 2B4AA 4ZVVA 3QOXA 3T0IA 1YDFA 3ZZ0A 1IXRC 1O4WA 1JGTA 3W7BA 4D0RA 3C1TA 4EG8A 1KR5A 2QMUA 2EFJA 3V1LA 3CX7A 2XCIA 1UJ6A 2GK7A 1SVKA 3JVEA 2O7QA 3HABA 3GI1A 4R54A 1DQYA 3GPCA 4BEWA 4C4YA 3R41A 4AJJA 3CH6A 1E2LA 1E96A 3KYCB 3BB4A 3MGCA 2J4DA 4OQMA 4ARAA 1BW9A 4ZJPA 1IBMB 1U31A 2RD2A 1WZCA 1HQCA 2HF7A 3MMNA 1YJ8A 3OLWA 2B9EA 4DIEA 3O92A 1J5PA 4GG1A 1QPBA 5KEIA 8AT1A 5C5CA 3BFVA 2FMTA 2H1IA 3SG0A 3AONB 4RJKA 1N1MA 5SZHB 1LVHA 1W4AA 2VUSA 3QXXA 3FOFC 2NZ8A 2XDQB 2GS9A 5EXTA 2WTUA 2NO7A 3SQDA 4CT4B 3WJ7A 5CCXA 3VJLA 1PR4A 3TLGA 4K28A 4N6OA 4R0NA 1KO1A 1SUSA 1GDTA 1JVBA 2FGKA 3N1UA 4LDQA 3SYMA 4TMZA 3ZHYA 5LVAA 2QXTA 3WGHA 3M9LA 4DUZB 4K8OA 5C1BA 3PRHA 2O20A 2VK4A 2VXYA 1XHFA 3C70A 2G1AA 4M60A 1M1UA 2P27A 1TYZA 2H8KA 2OORA 2CZGA 4ETMA 1CB0A 3F4BA 4NHOA 2O7NA 3BXHA 4DUGD 1E1YA 2O54A 1BO6A 3WLLA 1RRKA 1QQTA 5BSRA 4CI0B 1DHTA 1G7CA 2B2NA 5DASA 2P62A 1JKJA 3FPFA 2FUKA 1YSCA 3ESZA 1A2QA 1U8UA 2FJ0A 4LRQA 3WX0A 4DLPA 5BWLA 5GVSA 1NMEA 2MOKA 4NIMA 4OYHA 5A3QA 3DMPA 1NWCA 1VL0A 2HBYA 2X5OA 3I9OA 3IFSA 3QITA 5A3JA 4PG7A 2F4NA 4L9RA 4F12A 4E2XA 2OXCA 4CQLA 4LMPA 2VWPA 4C4XA 2VQEB 2X6RA 2G9RA 1V5FA 2B1IA 3EQ9A 1AB6A 3P5SA 4FT4A 2HPHA 4AK9A 5JTUA 1E8MA 3C3MA 5AUQA 1RXWA 5EQJB 4CCYB 3ZDQA 1R4MA 4AX8A 3WYGA 2CUZA 1RRPA 2VT6A 2WM8A 2IHUA 2XYPA 3HUTA 1ILWA 5H4GA 4JL8A 3JQAD 4RVGA 1W36D 1UC8A 1UPAA 3LQQA 4HVLA 1OKKA 3AWDA 4G24A 5K0GA 2HL6A 4JQSA 2OHFA 4NMWA 3AFHA 4O4HF 4YRDA 5DNEA 4FFWA 2KYRA 3X2SA 4RDIA 2IPXA 3SXJA 3MS4A 4MV1A 1O97D 1U9ZA 1F60A 4H7JA 4RMHA 1T2EA 3WE7A 4F5EA 1L0BA 1VLJA 1XWWA 1Z47A 2VYND 3EWSA 4W99A 3MELA 3PNSA 3H4TA 3T3HA 4DIUA 4MUIA 1Q0HA 1RBYA 4N3GA 2P2DA 4URHA 3LT4A 4E7OA 4DM4A 4X24A 1BGXT 2GPWA 1E3LA 4GSYA 5JLAA 4DSZA 4AZWA 2ZJ5A 2H9YA 4KN8A 3K70B 3ACCA 3TEJA 4LCEA 2H6EA 4P7GA 1F7VA 2PT7A 3KXDA 1Z17A 4IIEA 2PUAA 3QRWA 2QNIA 3LJKA 3HK2A 2A5DA 3KZ1E 4CE6A 4DG8A 1V6SA 4QDZA 1FDTA 2GN0A 1N6HA 2EX4A 4CF3A 1QG4A 4F5YA 4H77A 1U0EA 3U1VA 4E5UA 5J47A 1IRIA 1QF7A 1KAMA 4YDRA 1BTOA 1QZZA 4LS3A 4NDZA 3G2OA 4S24A 3WLOA 5B1EA 4AQYB 2L82A 5KTPA 4TQ9A 4C7BA 1IIRA 4QYMA 4BO0A 2Z8XA 2ZI9A 1XD8A 4DUPA 4PN3A 1LKZA 2VT3A 3NORA 5E7QA 3BWVA 2Z2YA 3OUZA 2G25A 2JFBA 3U3KA 4ASUA 5HQ3B 1W59A 4Y6LA 5IXSA 3LQFA 2BH9A 5JY6A 3FR7A 3QVSA 4MVJD 4L5IA 4M6WB 4V1CA 3DWEX 2X4IA 4IWXA 4JQCA 1X1TA 2VDPB 3FUWA 2DPXA 3MXTA 2K7FA 2OVBA 4IVNA 4LFBB 2DMRA 2HFKA 4MQMA 1IEQA 1HQKA 2BE9A 2FPPA 2J7KA 2LE0A 4UW9A 3FYDA 3CVWA 4JI4B 1YZFA 4ZQGA 3T1QA 3DKPA 1RT9A 2HMVA 4TL6A 4ZMSA 3EE6A 1ZY2A 2ZIEA 3FPLA 1I4WA 2Y1DA 2AFVA 2IP1A 4LV5B 5AI4A 1UBNA 2ONCA 4N6NA 3PFHA 1Z2AA 5CVEA 2AW3A 4JXJA 3TSYA 1Q1GA 4ZRNA 1MQSA 3E9MA 4N5HX 4BAZA 3JYQA 2VAXA 3OHMA 3T5CA 1MTZA 4ALKA 2W2OA 2HLDD 5D3QA 4JT4A 4BJ5A 4LF7B 3R9KA 1SHJA 3MIIA 1A9OA 1G63A 1AQUA 3RIYA 1NW9B 4R4JA 1WPXA 1JHUA 1MNQA 2OUIA 3N2KB 3U60B 1YL7A 4IHAA 1A7KA 3D0RA 4INJA 3JRWA 3PFFA 1IN7A 1I4OA 3ACBA 4LQLA 5K3AA 2E37A 3MJDA 3UMYA 1L4GA 5J2UA 2GK3A 2IZ0A 4MWDA 1QCCA 1D2MA 4H17A 4S1OA 1D0VA 4XUGB 4YALA 2PYDA 1W5EA 4TVSA 4NZOA 4UOEA 2IX3A 4RV9A 1UKVY 2SCUB 1FDVA 1ZI6A 4NJEB 3T9BA 5BV7A 4RTRA 2WLSA 5DP2A 4B4UA 3CB2A 1LQTA 2FRVA 4R31A 5DNCA 4GKJB 2WU4A 1Y7TA 3JWIA 1YHYA 1UQRA 4EY7A 1KP3A 1GPKA 3HVKA 1E7WA 2ECOA 3PEYA 3PX2A 4BLWA 2ZRKA 3LQ2A 4BHTA 3CURA 3HU5A 4WCFC 2ZI4A 1Q7BA 4PHCA 5FADA 3RVNA 3WAKA 5CH3A 3H9JA 5B30A 2Q27A 4WESA 1ICIA 4WY2A 3WLFA 2JLRA 3DPIA 3C6BA 2IU6A 1ZJJA 4LV8B 2QRUA 1BN7A 4H0CA 4OQLA 2OB1A 5CDHA 4HP8A 4N5DA 1M1NB 1PJ8A 4AWBA 2B7CA 5LP6F 1ODCA 4YAWA 5JEDA 3V8NA 1L5FA 2GDZA 1JHVA 1EXWA 2HQBA 3MWKA 4UTXA 3HWRA 3DMFA 1RAGA 4HH1A 4G89A 1MOPA 2CMFA 4HWPA 4ALLA 3H6GA 3IL2A 3AVVA 4CODB 1ZD5A 3BKXA 4AUNA 2OBBA 2WFLA 1P29A 3H9CA 3GNTA 1N2HA 2NYUA 3VNRA 2XSZA 3TOXA 1SCDA 2AFIA 3MYRA 3D8NA 1SA0A 3IKJA 5CLLA 2PZAA 5DX8A 5TQVA 3I6QA 4PLZA 2QTZA 2OC4A 3KYCA 4EO9A 1SQ0A 3B52X 3BREA 2X0IA 2IDMA 4XOIA 2XPCA 2W43A 2ZBQA 1E98A 3FGPA 4XXHA 5FYDA 4HFJA 4MIOA 1V25A 4DLNA 4LJYA 4NYIQ 3VM6A 4TKMA 4KQXA 3HWSA 2DE0X 3P45A 4ZGGA 3ICCA 2D00A 1JHAA 3WK8A 4L5AA 1DAEA 5DLQC 1WR8A 3LNTA 2FR0A 2GBPA 3EXEB 1VIDA 4KO1S 3KQLA 2FPXA 5CVCA 1M74A 1IATA 1SOUA 1V48A 4GM4A 4R01A 3ZWVA 3MWYW 4P4UA 3D4OA 3WICA 3ZBTA 2ZP1A 3U49A 5BQXA 2DFDA 3L5OA 2H52A 2V74B 5AKGA 1XCJA 1GTSA 4U7FA 3HMKA 4GMHA 4PQFA 4ZCMA 2B83A 4K26A 4PPYA 4ND5A 1ZC4A 3EZNA 4I6JA 1C7FA 3H8VA 4KGZA 3H42B 4YRKA 2OECA 3I4LA 1N0WA 2JC3A 3T7RA 2BMDA 1P2VA 3FNBA 4RDHA 1CDDA 1HMYA 4BNJA 4G1FA 5EERA 2F3UA 4BFTA 2WUWE 3AUAA 5KTOA 4ONEA 2C2ZA 2O8BB 3K5IA 2X0DA 4KO4S 2E0IA 4MRPA 1A50B 1P9OA 4YMGA 5E9AA 3JASB 3CV3A 2ZSAA 5LQUA 1PR9A 3NHAA 4B79A 3VGPA 1N2BA 1QBKC 1G8KA 3P9NA 1DT3A 1ESMA 5EA2A 3BXZA 4CKZA 1P5HA 3LGSA 3S81A 4V0QA 5GONF 1IQUA 2I2DA 3WKAA 4D4JA 2AD1A 4UEWA 4LEIA 4WEOA 3S1AB 3R5FA 5BT9A 2ZQ5A 1GPDG 3RS8A 1AKYA 1BD3A 1UMBA 4Y6PA 5G1PA 3OZXA 3CG0A 3LUJA 3DV9A 4B2YA 2VN8A 3EG9A 4TTJA 1L7OA 2V0NA 4QUEA 5I7AA 1YB7A 2IV7A 1I10A 4Q37A 2CWWA 3AHJA 3B1YA 2CZCA 3BJRA 4FBLA 1UJMA 1K2WA 1OXKB 1KEUA 4ETIA 2CEKA 2WIDA 3FPHA 1BHO1 1H4TA 3LXXA 1TUIA 3O47A 3PC6A 5GQSA 5TVGA 4F4CA 5LKRA 4UVEA 5JCPA 1CUSA 3DM5A 4OL9A 3LYLA 4HDNB 1YQ9A 1EYZA 1YZVA 1OBHA 3GZ4A 3GCZA 4J94A 5EEHA 3LXMA 3UAYA 4AXXA 4CL3A 1VKJA 2OMEA 2DT8A 3F1LA 1JMYA 2Q3DA 2YJ6A 5E9WA 4NU5A 1CJVC 3QM1A 4W1PA 5EFZA 5IW8A 2YS6A 5M5BA 5DSZA 1XF9A 4U2DA 1TF2A 1JQAA 3QEMA 3FOEC 1JXMA 1ZMRA 4D9EA 2OWEA 1P8JA 2CY0A 2FN4A 3HR8A 5DBEX 3AZOA 4YCMA 5JD4A 4D4KA 3PFBA 3PF8A 4TYNA 1Z38A 2IY7A 4U02A 5B2ZA 1M2EA 4GI7A 4W8HA 4WK4B 3R3WA 4Q9NA 2LNDA 3NWJA 4BFXA 5JAMA 5DRTA 3JX9A 1O58A 2DWUA 1AJEA 5CBKA 1CQIB 1G0OA 3KE8A 3VSEA 4PM4A 1SCNE 4N4AA 4N0EA 4M1TA 4R83A 3QVTA 4L5CA 3SJAA 3URKA 3DJFA 3DDSA 3VH4A 2KMLA 5DM60 5EIBC 1R5JA 1IVNA 2YUTA 3UKOA 4M6WA 3UTDA 1TDJA 1TQ2A 4ME6A 1Q5PA 5EIAA 2IHZA 1KSGA 2PKCA 1BVYF 4EY6A 1B00A 2LDBA 5AFSA 3EK2A 3SLGA 1BVRA 4JI1B 2D2VA 4K9QA 5T8KC 2QAIA 2YMQA 3N53A 3QVOA 1EG7A 2W2VA 4A2CA 1SVNA 2B25A 1DAGA 2DFTA 1UKBA 2IGTA 1Z0ZA 2XF8A 4CR7A 2MCFA 5HK9A 5JV5A 4PC6A 4DEXA 1SKMA 4HQ0A 3DL2A 3KG2A 4JQYA 3EXFA 4B74A 5K3OA 3U9SA 3GLGB 2J0SA 3RC8A 2EHJA 1SNYA 4RJLA 1ZI8A 3F98A 4C9BA 1DOHA 1NKVA 3OCCA 4OB7A 4ESHA 1SUWA 4UD6A 4QYIB 4G5OA 3OZVA 3M1YA 1U0NA 4IVQA 3JPYA 4HF7A 4QFBA 4PFJA 3OPQA 3EPKA 1XTRA 1IPEA 4RTJA 2D3TA 4PO8A 3NJ8A 5K0TA 3KXPA 5DYWA 4KE7A 2F8MA 2H4HA 2OBNA 3FWYA 3TS1A 2QRMA 1Q84A 4XWAA 1FNBA 1G66A 4CETA 1ZJZA 5ENDA 1YZYA 3K0FB 3J7AC 1RYEA 2Y05A 3JD0A 5THXA 3V1YA 1O95D 3K6SA 3V34A 3RK4A 1U8EA 5KTKA 3F7TA 2ZYIA 4KIJA 4Z1OA 3UOAB 3I92A 2ZBVA 2YCBA 3GNSA 4AW9A 3PEFA 1W96A 2HA3A 4X54A 2Q7XA 5GINE 4NJEA 1H5NA 2FW1A 1SB9A 2CF6A 2XI4A 2QUJA 2FTKE 3M33A 1GSAA 3SI7A 2BEKA 3EGDB 4B7CA 5EZ6B 3CXUA 3CX4A 3PJRA 1L5RA 4W5OA 3GEIA 3IE1A 3M3DA 3U7FB 2HBZA 2Q6IA 3IO3A 1O6BA 1NULA 3NWPA 1J2YA 3THOA 1K86A 4FQ5A 3O8CA 1N34B 3DFKA 4PAOA 4S35A 1EDDA 4ZO9A 1HQDA 4DCTA 1U28A 3A2KA 1KMCA 2IUTA 4EB6A 4FS3A 5B4UA 3BB3A 3ZCVA 2MYUA 1ORDA 1SOMA 1KEZA 3CLRC 4OL0A 3CLUD 4C4SA 2O0HA 1M1NA 4L9WA 3QPBA 3ESAA 3A4MA 1T3SA 4JBNA 1Y3FE 2BN4A 4LJ6A 3HUUA 5A6VA 1PFGA 1QH8B 2VHCA 5FPYA 1NAIA 2CGEA 3BD9A 3L7KA 3O7WA 4HEA6 1K6MA 1SU8A 1Y5RA 1KZ9A 1SC4A 1X7WA 2BM0A 1PQ4A 2VP9A 3OZCA 1W9MA 5A7FA 5HOQA 1V8ZA 1DXYA 2Q41A 4MSUA 4OJNA 3I9V6 4WKBA 5A9RA 3R7WB 5HIAA 4PXYA 2JFGA 1Q83A 4DLRA 2BMWA 3C39A 4GI5A 4K9RA 3T15A 4E5YA 1YONA 2A9PA 3MLBA 3OZDA 3HO1A 2OZKA 1GT91 2P0AA 3FYUB 3PX3A 3C7DB 5JG7A 4CEIB 4X7PA 2C0CA 3NHWA 4G84A 4HV4A 3HMQA 1HL7A 4RYLA 5JNUA 5JXJA 4NQZA 3TSAA 4B40A 3QWFA 3IDAA 1I1QB 1KZ4A 1Z6XA 4P3PA 5FP0A 2NYAA 3BHIA 3L0DA 4FDVA 4IIXA 1BHSA 1N2CE 1RYYA 3ASUA 1RWQA 3HCPA 1GUFA 1H65A 5CHYA 2LPMA 4UAGA 1Z8HA 3WQBA 3ZQJA 1J23A 3WVNA 5JQGF 1VG9B 1K5PA 1EHYA 2JCXA 4KYTA 2AMYA 4RHCA 4J1QA 1Q0LA 5BMOA 5C18A 1OYOA 4O02B 2YWXA 4TLLB 1VJGA 3VAZA 2VKTA 3SC6A 3KZXA 1NU8A 3MN1A 2J0UA 4FLEA 2D0IA 1TUBA 2X5NA 2H2HA 3T5MA 1UKZA 4WBNF 121PA 2JH3A 4L08A 1CRQA 4XQCA 5L9AA 2PU7A 2QTAA 1S2DA 4MVYA 2IUSA 4UMVA 4DJAA 2WSIA 3IV9A 2O8BA 2Y67A 4P5PA 2OCDA 2YN4A 1KGSA 4A7PA 5IT5A 3HVJA 1GPH1 4FWBA 1WP9A 3JASA 4G8BA 2B37A 4RK4A 1LDGA 4DLVA 3WLQA 3I62A 3K09A 1FSPA 2ZR7A 4A8JC 5DZSA 1QVZA 1C3OB 2HJSA 4JBGA 2EKQA 3LSYA 2GEFA 5BWMA 5IC4A 5JZ9A 2C1ZA 2NXEA 1QR6A 4LDNA 1RP1A 3PL5A 4HLUA 5D2CA 3U37A 3ZCUA 1H2BA 2OGTA 3S1AA 1S2IA 1X92A 5CK5A 4DVJA 3WIOA 2W7TA 4LY6A 3FWZA 2IYWA 3H2HA 5GV7A 2F8LA 3QZUA 4M55A 4KH1A 1H05A 4LX0A 4Q3CA 4XGQA 2WSYB 3RYFB 4AP6A 1GQRA 2IU4A 3CPEA 4QLBA 1UDBA 2JNWA 1J4AA 2XUKA 2Q3FA 4K6GA 3RTAA 4A92A 1U2TA 4GYKA 4ZYWA 4ZZ0A 4RVDA 3W6ZA 2BBSA 3I72A 3QGMA 4N65A 1JEQB 4R1NA 4J2HA 1DXQA 4HL6A 3MAJA 3ZHSA 5HZMA 2XQFA 1X1AA 5GONA 1JA1A 1URPA 1VIYA 1VSVA 3AM5A 3G0IA 1GAJA 3U7JA 4CRWB 4MVJF 4LJ5A 4FCTA 2DPGA 1YO6A 2GXSA 5E2IA 3OMXA 1IAVA 1TQ6A 4M9UA 5EE3A 3ZR4B 4Z3KA 3ZI7A 4ZFNA 4ZOQI 3EPHA 3KFXA 1JHXA 4CKBB 1QPZA 4EQ6B 1G5TA 2QAGA 2FUCA 2DBQA 4QUJA 4UM7A 5EI5A 5SZKB 1WBBA 2EEZA 4ZALA 3C8MA 3E05A 2JVJA 4B7AA 4IKOA 1KDOA 2QZ4A 5G1NA 4FNMA 4INAA 3TZCA 3G23A 5AYVA 5B58T 1QRTA 5BV1A 5ADHA 2QZPA 3UGJA 1WHTB 1AS0A 2C88A 2P35A 2V4MA 2Z2KA 5AHOA 2VRCA 2JH9A 5REQB 3TR5A 4UMEA 3CS3A 3T7JA 1FSGA 4S1NA 3C48A 2NIPA 1SXJC 1GGKA 1E79D 2UUBB 3G9UA 3D0KA 1X1CA 2YFHA 3I8OA 1RPTA 3LFHA 3OY7A 4LOJA 2BFDB 2SECE 3B6IA 4YIKA 1KSHA 2YIJA 1CQIA 4AY5A 3ZDBA 2GZ1A 4ER3A 2CT8A 3OT5A 4NS4A 1L7QA 5ALKA 3V8EA 5CFNA 5IJ9A 2UYOA 1TE2A 2I71A 1W5FA 4AY3A 8LDHA 1ZFNA 3Q5GA 1RWPA 2WB2A 2D3WA 4FMCB 3C5HA 3PGVA 5KOYA 3KETA 2NP7A 4MRNA 4GH5A 1HWYA 2B2CA 2QTBA 3MTAA 4IG9A 4E5SA 4EPTA 1VMDA 3D3NA 3PQCA 3S55A 4BVLA 4FR2A 1J00A 1PJSA 2RHOA 2JAUA 1RDFA 1XEXB 1XZMA 2XWJI 3F3MA 1QTRA 3N5CA 2FH5B 1HT3A 2XGOA 4HO1X 4V0SA 2AQKA 2WZDA 3SHOA 3UKDA 3ZZNA 4EI7A 3OE5A 5LD2C 4KMSA 2IKQA 1CFZA 1ATZA 3GLGA 3HV2A 2QMZA 3C1OA 3QI2A 1X39A 4U0JA 1Z0IA 5CM9C 1XN4A 1PRYA 2KSQA 3LHDA 4QYIA 4RD6A 3RJMA 2YY5A 1I6KA 3TMYA 5JO0A 1L5SA 3AFGA 3SZ3A 4PZCA 3W7AA 3W1EA 3TBKA 2WHEA 5IT0A 1WXQA 4BNVA 2XZLA 3FYCA 4UATA 4AKEA 4YDSA 4YGYA 2FWIA 4XKJA 1JIJA 3I9V1 2R3SA 2J3HA 1ESDA 1FNDA 2H4FA 1U6KA 1VECA 2XAUA 1VKHA 4PAWA 4X6LA 3ASVA 4BLRA 3K0FA 4EO7A 4YAOA 1IEWA 5AI6A 4US0R 4JAVC 4UTRA 2P9EA 4KO8A 1BFUA 3QQ5A 4AZ0A 4LF4B 4F6RA 2X7JA 1SXIA 4GX1A 1D2RA 3THRA 1P1JA 3MT8A 3DP9A 1PV1A 3REOA 3WDMA 2FOXA 4QYXA 3C0KA 1GL3A 1I36A 1O6FA 2DWCA 5I8ZA 1IPHA 3WGUA 2G0TA 4MS3B 3K4PA 3EGDA 4G4IA 5B7QA 4LTNA 5KWVA 1YWGO 1Y34E 3RKSA 3A9CA 3IOCA 4J16C 2Z04A 4EB0A 5ILQA 1RQNA 2XBUA 1DO2A 2Y1EA 4D42A 3LT0A 3AFOA 5GZ3A 4RSHA 1WV1A 2VT7A 4MTLA 1H8EA 1TPYA 3L04A 5L3QB 4G81A 1JE1A 2IELA 5DKFA 5BWCA 2ZRBA 2ZXFA 1EKXA 2VUTA 4IG4A 5ANRB 3BCSA 5C5IA 5EJ4A 2DRIA 1RCUA 2PN1A 3F5SA 3VMFA 1FUYB 1PBTA 1CU1A 2A3NA 1DCKA 2FN9A 4FC6A 2E87A 4CU2A 1T3HA 2CFCA 2RAVA 1MKYA 3QFFA 3UT5B 3IAFA 4EHHA 5C1IA 3TVYA 2H2DA 2WJVA 2BAGA 1GAEO 1I5OA 3E9NA 3LSTA 3FDZA 3UH1A 1PLLA 2V7VA 3EXG2 2FRXA 1JLMA 4YUVA 1Y37A 5LL6P 4MAAA 4TXHA 1TTHA 5IP5A 3TSCA 1OE0A 1K0UA 1FFXA 5A02A 3CH5A 4L74A 4UDYX 4KNVA 2IUEA 8OHMA 7GPBA 2Q46A 2CYAA 5J2TF 1UDXA 3MOIA 2NZUG 3NT4A 2FNAA 5AW8A 4CM8B 4CEIA 3WC4A 1UPFA 2I4OA 1FXSA 1T9GR 3A31A 3OM1A 2BFOA 2D0DA 3ADCA 3ID6C 4OLJA 1LJUA 2MTBA 1B26A 2YQ5A 1PGNA 3VI3B 1SWVA 4FKBA 1WG8A 3ND5A 4KL8S 3CVJA 4CMEA 3GMTA 1C4KA 1N0HA 2J30A 1AHHA 1X86B 3B1WA 4I2NA 4O3FA 4X6UA 4CM3A 1ZNXA 3RNOA 3FTEA 4NMLA 2YYZA 2LUOA 1RQPA 4RTPA 2RGNC 2HXSA 4D25A 3UUWA 4E13A 1GKUB 3O6VA 2J9ZB 1BWPA 1NXVA 2JLQA 2EC5A 1EFVB 4D7AA 3ABSB 2AOWA 1VJRA 2X5JO 3O2SB 2ETXA 2WD8A 2XOKD 3B78A 3KEQA 4RPCA 4Z4HA 2QTCA 1LGYA 4GKKB 1H85A 1IHDA 3A4NA 1QQ6A 2WHQA 4GUDA 4QWMA 4ZU3A 4BGEA 2C7OA 1FJXA 2QYHA 1KI7A 2SHKA 4NY1A 1B16A 4G25A 4R3UC 3CINA 4JP3A 4RGYA 4WZBB 5CAEA 1BU8A 1Y9JA 3M4JA 4EG1A 1QO0D 2OBYA 2Q8PA 4BQIA 3C3PA 4J2TA 2QVXX 3RIHA 1AK9A 1E9RA 2Y1XA 3OZTA 2IA5A 4JJ4A 4NVRA 3ZIDA 2ZT7A 1BEZA 2ET6A 1XNRB 1K8YB 2WJHA 1OXMA 4UTVA 3UJ7A 5HZHA 3T99A 3T4UA 4ZCPA 2CD7A 3UC5A 1QFXA 1C3OA 1SHTX 3EW7A 4UUNA 2ATVA 3OA2A 4HUJA 4AT1A 1G3MA 5GJCA 1BE0A 5CDYA 2AF4C 2BR3A 3FPKA 2I67A 5B53A 1YK1A 1XTVA 3PHGA 3VR6H 3CWZA 3IHKA 4R98A 4IF4A 2PLNA 2WTBA 3NNSA 2YZ2A 2OHVA 4MJXA 1AXGA 4TRJA 1IG3A 1SCAA 1OI7A 2PVCA 2AE1A 4PG8A 3PDCA 1RM4A 4ROTA 4O5OA 3CT6A 3AX6A 3QG5A 1XDUA 3OD5A 3GRZA 4ZDKA 2HEGA 4XLZA 5TEVA 1O5IA 1GDHA 1K7CA 3B2EA 1SR8A 1ZN7A 4FGUA 4I4TF 3MFQA 3P2OA 4MVJM 3LUAA 3TZQA 3KZMA 3VOSA 3WNBA 1U63A 3U7RA 3K35A 2QM0A 2OGWA 5D85A 5K0LA 2HRRA 3ELBA 2OO5A 3DFUA 3H1PA 4Q1DA 4WQMA 4MKFA 4BFWA 4B2IA 1L5MA 4ZDWA 2I99A 1H6BA 2Z9CA 1RYNA 3PL1A 4W6ZA 5DGDA 4MTCA 3EEYA 4DCCA 1NPDA 2B4RO 3IE2A 2W9XA 1BS1A 1MC4A 1DG1G 1ESCA 3DBOB 3NHFA 3NIGB 4H1HA 4KN6A 5AKLA 3URMA 4BIIA 4EQ6A 5DMHA 4MWZA 5ECYA 2MSCB 2BCEA 2PE5A 1P9NA 5BR8B 1GPWB 2QLNA 3QF4A 3U4MA 2VPZA 1QGUB 2B94A 2RHWA 4ZZ3A 2YW2A 1KJ8A 4P33A 4EUEA 5REQA 1JSRA 1PZXA 3TAHA 1I14A 2I2WA 3ECAA 3Q41A 4G0ZA 4GPBA 3U17A 3V4OA 4CG0A 2XWPA 2NU6B 1RJGA 5TQ0A 2NGRA 3N6VA 4L07A 2ZIWB 3AUJB 4XPIB 5CG2A 3VR2A 4QEDA 3CZPA 4ND7A 3QUAA 2ZJOA 3TX6A 2O2GA 3ISVA 3DWGA 3M9XA 2PZJA 2DC1A 4TRNA 2HUNA 1JLLB 4FR0A 1L5LA 1W5SA 1YCGA 4ADSG 3EAFA 4UHHA 3ZW9A 3AWIA 4DT1B 3LGAA 1Z2PX 1EJ0A 2PK3A 5EHZA 1ISPA 2IEZA 4NYIR 4DJ5X 1TZKA 2RHDA 4CIVA 3HB9A 3G0HA 1XEXA 4LRXA 1JKFA 5EAIA 3B6JA 2Y71A 1SIWA 2WKRA 1ZK0A 3NYRA 4JJKA 4Q7KA 4CF6A 4RFSB 1MAHA 4EKNB 2OHHA 4YMIA 2I8LA 1JIIA 5C7YA 4OH7A 1OAOA 1Q0PA 1VJTA 1QIDA 2BFBB 3LFUA 4FONA 3EIWA 4C78A 3FSRA 4KPUA 3AHHA 3ZXIA 4Y2YA 2MSDB 2X1MA 4QOEA 1DUIA 1NVVQ 1VCOA 3L93A 3OSUA 2FX5A 4ILEA 3QE4A 3EHDA 5EE0A 1AC5A 3WFIA 3ZE0B 2L0XA 2Z30A 3F8TA 1T8UA 1G1AA 5BQ3A 2RGGA 5KQMA 2IH2A 2GFIA 2P77A 3W0LB 4KJXA 4NXNB 3ZWPA 2PL5A 3IAAA 4IHJB 4C4AA 4E5MA 4XD7A 4MUAA 3EODA 1Z88A 5L3ZA 2FZEA 4BBJA 2B4QA 5JE8A 2X4GA 3FDJA 3WLSA 2JIOA 2NYRA 2PA0A 1JX6A 2FSPA 5AK3A 1OXSC 5FV4A 3HNOA 2AVDA 5DHQA 1DSSG 2X3UA 4I9NA 4RVHA 1LX6A 1YRQA 3N59A 4KP7A 2R1TB 5EC8A 5G0WA 2PNJA 3S2GA 1VB5A 1Q2UA 2F8SA 3JQFA 1DQRA 5K6AC 4MWGA 3BDIA 4NDNE 1NZDA 4TX1A 5F7OA 2Y0PA 4TMFA 4TTQA 1SUPA 1X13A 1Q92A 3SIPA 2QN7A 2JIQA 3GFTA 3CXRA 3QXSA 2Q3EA 5EIBD 1YCFA 3BIXA 3VX4A 1EB9A 1JDPA 4P8RA 4AF8A 3KJQA 1R3DA 3OPXA 4BB5A 5K8LA 4KCGA 4HDMA 1J90A 2GN1A 4A1OA 1GPYA 1XXLA 2PO7A 1OB2A 1V8OA 5DU2A 3N3AC 3OQVA 2PANA 3UK7A 1XCLA 4XA8A 5L6MB 4UC0A 1UDRA 5ALEA 3PFCA 4UNQA 1SZCA 1V41E 3UT5A 3Q0TA 4EEXA 1CUVA 1NJ1A 3FZNA 1RZUA 2OCLA 3LC1O 1NF9A 2ODWA 3GGDA 1UIRA 5AI0A 3DA8A 4AQDA 3TAXA 1KY2A 4URXR 4Z4EA 2JGEA 3K6JA 4EHKA 3B13B 1RJ9B 3GNLA 5EP4A 5FUMA 2XB9A 3C4JA 4R1OA 1OZHA 2D0PB 5JSZB 4NEHB 2KQUA 3CX8A 4CM8A 5TGZA 4DB2A 4EP1A 1OILA 1G60A 1NLFA 5T4EA 4W7IA 4A16A 1AKQA 4I1VA 4QDUA 1NSFA 3EB9A 3GB9A 1PTJA 5CFZA 2J45A 3DZ8A 3MUNA 2O07A 3QPAA 1M2OB 3QLJA 3O8BA 1KMNA 3BSFA 4LPKA 2CDCA 1ECGA 2BE7A 2XDYA 1OAAA 1YXMA 2Y0DA 1LZKA 3AGQA 3NOXA 4G4SO 4W9NC 2XJ9A 1N25A 4C1BA 4DG9A 2ZM5A 1PLKA 4PVCA 1Y80A 2B1JA 2ZE7A 4TT3D 1M6HA 1ULHA 2JJ8A 4D80A 2E4ZA 4TLEA 3QE3A 2AQHA 4G5GA 4KGVA 4KWTA 2EZTA 4J0GA 4KH0A 2CNWA 2RG1A 1CYDA 2PM8A 1XDZA 1YQDA 3A2NA 2EKPA 3JQEA 2PEZA 5DWVA 3CRMA 1CUAA 1Q3TA 2F90A 2QX7A 3HVHA 3KVVA 5JSUA 1DIAA 1NOIA 2I54A 4H31A 1MQ9A 4RD4A 2X8JB 5DI3A 3RJZA 3ZY2A 4DC9A 9MHTA 3VV3A 4E5DA 4ES6A 1SUCA 1IB0A 2EIXA 4Q5IA 4F56A 1ZNYA 3LY8A 1J25A 5BSVA 2UYYA 2CVOA 5BQFA 1AD2A 1DKNA 3CLRD 3R3JA 3O8RA 5DWQA 1DOZA 4R6XA 3RT7A 5HRAA 4NC9A 5IZ4A 4EJSA 2HQ1A 4TXNA 2WIKA 2GN9A 3SKVA 4CTNA 2X9VA 4J7UA 4ARZA 3FZEA 4CLHA 4FFDA 2PJDA 4NZYA 4K6HA 5FOXA 1BMDA 1S96A 3GJRA 3OFVA 4NU8X 1MT3A 3AOEA 1FP6A 4ZKEA 1BDHA 1ZH8A 1RCFA 2XITA 3UNXA 2OV6A 3MBKA 4C0HA 1IB6A 3U3XA 1V3VA 3BMCA 1NBOA 1NJ2A 3ETLA 4KX5A 4O2RA 4QNMA 4WZZA 5H3HA 4NBVA 1JFRA 2E4WA 4H3VA 2QUKA 1JA9A 4TZTA 2QXUA 2WF7A 2QMOA 3E4DA 4E22A 4JSTA 1AF7A 2O3RA 2OZEA 3MM4A 4JELA 4AP9A 1X2EA 2XHZA 3NBZC 1ZCBA 2RG7A 3V1NA 2PX5A 3A3NA 3N0WA 4UNPA 2W6CX 1DMSA 1JL3A 1NT2A 2GWHA 3O8QB 4BRZA 1LD3A 3C24A 3FUXA 2HKIA 4QQNA 4E3ZA 3OETA 3DAOA 2CFOA 3DFFA 4UEQA 4DMLA 3NBAA 1L5KA 1G6OA 4Q0MA 1PP4A 5THQA 3CNNA 3HDHA 2QT9A 2BD0A 6Q21A 2VXCA 1STOA 1MC8A 3EF0A 4OQQA 1A7AA 2Y68A 3RG8A 3S40A 1FFYA 3DMNA 1PR3A 5T6MA 4BNGA 3C7TA 4DIFA 4ZIRB 4R1TA 4CHGA 3NG1A 1C7IA 4EUKA 2X2PA 2XRFA 4BECA 2R2GA 2IOHA 1X7GA 2V03A 1L7PA 2J6BA 2ZJ0A 3H5OA 4I4TA 1NVTA 1SK9A 1LJLA 2ZR9A 3AVOA 1DUVG 4M76B 2XW6A 4TMKA 1IMOA 1ZOIA 1KAQA 3KU1A 4HNQA 5TXGA 4P3XA 4HX2A 2AFHB 4HSGA 3ZCSA 2YZMA 1L2TA 2IW3A 1UJ4A 3H2GA 5BSFA 1VI5A 1KH3A 2PMDA 4OYYA 3OP1A 1EUQA 4X91A 3A11A 1PX0A 1NF8A 1EMDA 1NQUA 1VQ1A 5PGMA 1F3OA 4L3WA 3F46A 4BKOA 4UREA 5TC4A 1U8TA 5BSGA 4L1KA 4B3SB 1JPVA 5A3VA 3ICEA 3L8DA 1N8TA 3AJ8A 5EXEA 3H97A 1OVGA 3ZEIA 2QYTA 4DILA 1SWWA 4KSBA 3GBVA 4OQ4A 4X97A 4OQPA 3DZKA 3T5TA 1IZYA 1AUPA 3H7IA 3NEYA 1PNOA 1QGED 2NUPB 5D87A 3VO8A 4ESEA 5KNDH 3BGVA 3H16A 2VUIB 4DCUA 1GY8A 1H6CA 4HBGA 3CJQA 1A4RA 3TZEA 1W88A 1MB4A 4Q66C 1UBRS 1VLLA 3TTVA 5JDIA 1NVGA 2H29A 4PS1A 4AZTA 5KJ1A 5MFPA 2QYSA 3L8ZA 4FSXA 4IJ6A 1GNTA 4RFSA 1LLFA 2HRCA 3I8XA 4C0BA 3RUIA 3CMCO 1BDBA 5HF9A 3TTYA 1O08A 1QRRA 2C83A 2BFBA 3ONDA 1WCV1 3E7XA 5A1TA 1GM5A 5EIEA 2JBAB 4GOJA 2M6KA 2WZBA 4MUEA 3WGQA 4KR7A 2O06A 4J0EA 1W2WB 3VA7A 3MEQA 5F1PA 1EVEA 4R1UA 2OA0A 1UWLA 1C2TA 3MQFA 4GMGA 5DGIA 4ZAFA 3DVQX 3L6EA 4N7BA 5DI9A 3BGDA 2HMYB 3FUUA 4R5MA 4KHZA 2P5UA 3RS3A 5KAPA 3RTBA 3LHFA 1KMHB 3PXUA 5ES3A 1M0WA 2PVPA 4GKAA 3COYA 1ZGBA 2WUGA 1E1MA 3O82A 4LGVA 3Q40A 3TLXA 2FK7A 3QWAA 2E2WA 1HE1C 4X6YA 5B2FA 4XWOA 4MIEA 1QRAA 2XCUA 1YFLA 3R74A 1OV6A 1MZVA 3UTCA 5F52A 1SXJE 4XRGA 5INTA 1BS9A 4MDHA 3ZE1B 2DLNA 2R1TA 3ET5A 1SXJD 4B3JA 1M7GA 5CH5A 4FZVA 2OTCA 1CVRA 4EUHA 2NTNA 3D6TB 4U6NA 1BWRA 2G72A 3EMBA 4QEKA 2OD7A 3D8RA 1RM5A 3E1KA 4X63A 3DE5X 2JJQA 2ZBEA 1ZO8A 1TJ5A 4E6PA 4JP5A 3LPLA 5CFMA 1DCFA 1X42A 4RK0A 3JV7A 2DETA 2R8RA 3H5NA 3MZ0A 4NEQA 3MJHA 4QOHA 2H63A 3ABOB 2WP0A 5JSKA 3GPLA 2P67A 2BFNA 1GUDA 2FWBA 2R6FA 4R40A 3L7JA 4BV3A 1EFCA 2CL0X 2IOFA 1PZHA 2G9ZA 5FF9A 1HTBA 4W1SA 2DHDA 2F1HA 4FNOA 1LBIA 1T9KA 4AECA 3K0EA 5IYZB 5KU1A 5FBHA 3CY6A 5B3AA 1JJVA 5DBHX 1Z12A 3VAAA 5EY5B 1C3EA 1ND6A 5AJUA 3GJTA 4ZU6X 1HZJA 3PPXA 4R9RA 1CUIA 1ICEA 1YOVA 4MGKR 2IHJA 3G0OA 1IY9A 2ZULA 4Y2GA 3C3WA 4K03A 2QD3A 5A2GA 1BSVA 2AXEA 4JJFA 1FFBA 4LHVA 3TTTA 1W2HA 1PU2A 1COWA 3G9QA 3P0EA 1T5HX 4CQLB 2NU8B 5AW6A 1G20E 1Q14A 1NURA 1RJ9A 2ZIAA 1QYCA 4F4HA 3FCSB 2FPIB 3BWXA 3EZ6A 5LMNB 2VHJA 4KBYA 5JSZA 3KAQA 4RY0A 4I9HA 3LY5A 1J5XA 1ZM2A 4HDAA 4D46A 4E5VA 3P9IA 5IVDA 1FRQA 1K3UB 2C7BA 3CNBA 3DCIA 3HP7A 2HUPA 4D82A 4DWWA 1MAAA 3U4HA 5KYNA 5LOVB 3SDZA 3C8UA 3OE1A 2G88A 1GXSA 3TRDA 1GRNA 1O2DA 2QQFA 3NH6A 3H5RA 2RJ3A 2ATIA 3K0KA 3PE4A 4P7KA 4EFMA 3MERA 2EFDB 4NG5A 3O2JA 2IZ7A 2IWRA 4YACA 4QELA 4RENA 1YT5A 2X6TA 4NK5A 3VC7A 1V7PC 4BVEA 1EQ2A 3B9PA 1XZKA 3KZOA 5IN4A 4D9KA 3FG9A 4E5PA 5ERGB 3E27A 4RY8A 3KVNA 2IT1A 3E9YA 4CF5A 2NQ2C 3L7AA 4IDPA 2NPIA 5DYGA 4BFLA 5A4FS 4LK3A 3WY9A 2O6HA 4NJMA 4K86A 1ZLYA 2VSXA 1DX4A 2R87A 1E7SA 4GICA 2BZ0A 3C4QA 4Q9AA 2G9VA 4X3OA 3STTA 3W9SA 3L07A 2O8DA 1J42A 10MHA 5HIJA 4RADA 4UOQA 3O9MA 1YRBA 3WLAA 5B2EA 4WDQA 3B36A 2PLWA 1NN3A 3K9FC 3BORA 3NNNA 1HDOA 4NBNA 4F2HA 3GLIA 2P40A 2WVGA 4H15A 3FI0A 2CCGA 4ALNA 1N5MA 3D2CA 4KRFA 4OXKA 2XMSA 4TKVB 3RV3A 1ZMBA 1PVDA 3WHLA 3QVKA 5C81A 4L5JA 5TE9A 1Z5NA 1UXHA 2V0GA 3GXBA 3H13A 3KEMA 4C3UA 3P9PA 3BE4A 3FCOA 3A4LA 2QTLA 2FSHA 4Z5XA 5IVHA 1PKEA 2NTJA 2QL7A 1XU7A 1UBEA 3CKLA 3I1JA 3ROQA 3MRSA 1R9MA 2FG7C 2Q9AA 2XVAA 4OSPA 4F2WA 3D9QX 4EZEA 1LH0A 1CZOA 3GLHE 3UPUA 3IEIA 3BJZA 1JR4A 4JYZA 2PCLA 3O8QA 4M0PA 3C3YA 4DRYA 4YCCA 1FDOA 4Y9DA 2C5AA 3TNLA 2HA0A 3NWBA 4KPYA 2CLLB 1A1SA 5LZ2A 3PFKA 1E6WA 3LLSA 5FLEX 3WLHA 3K2IA 1MEJA 1U81A 3T7KA 2DCUA 1O94A 4HB0A 1IZ8A 1RQRA 1B4DA 2GN2A 3TXAA 4FB4A 3CE6A 4HEQA 4PZZA 1N7JA 4IIBA 2VP5A 4COOA 1UBGA 4XWYA 4UM9B 2XVMA 4LZAA 3TD6A 1L1RA 4MA0A 3DEYX 1YRWA 3A8TA 2PA3A 3DHEA 1UANA 2ADMA 4CM6A 4ER7A 1DRJA 3PNVA 3AM3A 5D3MB 4FHEA 1WSBA 3NEJA 3T38A 4Q4DA 4D6XA 2J9GA 3JPWA 1NW8A 2WAOA 4C07A 3EW9A 1I2CA 2AFHA 3FFXA 3FMIA 4YJFA 5KREA 5JZVA 1MJGM 1CKEA 1X7DA 2CUNA 4QODA 4HH0A 1LDYA 1L7MA 3UFBA 4N5LA 2WE7A 4KIGA 3RAJA 1R4ZA 2VH2A 5IKXA 4PNPA 4CKWB 3DNFA 5ICGA 4D9MA 1H9CA 1GZ6A 4JITA 3UUFA 5HVNA 1KI3A 3WAJA 4I2VA 1OASA 1YMVA 4WRRA 2GA9A 3ZIUA 1OWLA 2HK9A 3E70C 2IDKA 2IUFA 4YXWA 1G9XA 3FH0A 2F7SA 2BGIA 3L9XA 4IIHA 1MDBA 2V9ZA 2HJVA 2GVZC 4IGIA 1LI5A 3QFCA 5G4LA 4DPKA 5J58A 1CDEA 1TM3E 4MB6A 5EWLA 1I7LA 5TR9A 3VNQA 2EBUA 2BFEB 2EFYA 5CLQA 2IPAB 3RIMA 1T34A 8ABPA 1ZWKA 5GGXA 4PPFA 4RZXA 4YJGB 4E5NA 3VH3A 1EDZA 4M3NA 4AIRA 4HWOA 5CEJA 4YCLA 4GF5A 1WMBA 4PZPA 3KCQA 1YJAA 2F1IA 1XD9A 4V2IA 4NPAA 2LRHA 1ZMTA 2AMVA 2NOAA 2PEYA 3BK7A 2ETVA 4JJ7A 4BMSA 4GDFA 4WBXC 1K9VF 5ESRA 1YB4A 5EJGA 3T52A 3K9QO 3VZQA 5FH9A 4MRSA 6CHYA 1XI2A 3FHOA 3K15A 2JBAA 5SYNA 4JFRA 3NBMA 4BUZA 5C1OA 1C3LA 2HU8A 2J7PA 1RAFA 1AHPA 3FTCA 1RZRA 3KV3O 4Z53A 3DDUA 4QTTB 3BG5A 1R66A 3W9BA 4CFYA 1T9BA 2F59A 5AJVB 2D1SA 1Y3CE 4C3OB 4YNBA 2VBFA 2B8JA 2EKLA 3MRTA 1ABBA 2O5RA 5KZMB 3P96A 2H2WA 1PFYA 2PXXA 3HXPA 5ES4B 5A5DA 1KMHA 5FAKA 2ECFA 4GLOA 3OBBA 5AICA 1NFQA 4XVCA 5BXQC 1EK6A 2EL7A 2WK1A 3QLVC 5ICCA 1Q6YA 1F7UA 1SKYB 4U2CA 2D2EA 4HSEA 4IX9A 5TRTA 4X41A 4J1TA 4BVFA 5KIAA 1M7HA 3QX7A 1PYOA 2F1OA 2J87A 1Z6ZA 4G1BA 2F9FA 4KQKA 5JS7A 1UDCA 2H65A 3VYUB 3UAXA 4L6IA 3T7IA 3M6IA 2AV6A 3TQRA 4NENB 3JTMA 1IIBA 5C5DA 1ZH4A 4OB6A 2XB2A 4IRXA 1OROA 3DMGA 1VPTA 1ZUHA 2AK2A 1ZD8A 2NSJA 3HU2A 4JJ6A 1MG0A 4KRXA 1GPBA 4AN4A 5CDSA 1GL7A 2X2FA 3AHEA 2OFOA 4CPDA 3ABRB 1HFJA 4CTJA 5JISA 1N7GA 1ZZEA 3CZ5A 2FZ4A 4IL5A 4GZLA 5FV7A 2I6QA 5ER6A 4HDQB 4YWJA 4JT9A 3ORHA 3IP5A 3UV6A 4PLWA 1P4HA 5TMDA 1RQ7A 3O0DA 2BW0A 4Q7QA 2AG6A 4WOBA 1QLHA 4JA0A 3BIOA 2GMWA 3QU7A 2WKPA 5C8YF 4WOJA 5CJ2A 2IXTA 1O1YA 1Z4QA 2OGZA 1IG0A 2GAFA 3DZDA 3U3ZA 4AJPA 3ER9A 2G9UA 4FFVA 1P7YA 3EXHA 4RM2A 1E3WB 3KSZO 1BNCA 5KPDA 3L43A 5A71A 2V96A 1YZKA 4Q4AB 2AG0A 3CUKA 5FPPA 1CPYA 3F6CA 4GKBA 4WT7A 2ZT6A 3QFRA 4K05A 1VXRA 1NLZA 1I33A 3HS3A 1D1TA 4I1YA 4NYMQ 5DHRA 4B3FX 2NU8A 2WWFA 3W06A 2XYRA 3B60A 3RIGA 3DKRA 1JNXX 5JYEA 5F51A 4ZTZB 1Q6ZA 1DAFA 2BBTA 1Z3IX 3G2QA 4FQ8A 4HG2A 4QPPA 5PNTA 1Y3BE 1YS6A 4OHUA 3PJDA 4ZARA 5GTDA 2JZOA 5KQGA 1J0DA 1NIPA 4I1RA 1FUEA 5J43A 2GSDA 3HADA 2O8FB 3V7UA 1ZG3A 1ZMOA 2AZMA 1T13A 3NDPA 4M4SA 3RFCA 4OKNA 4JP1A 4CT5A 2DR0A 2QZ9A 4TLBA 1IHPA 4WTOA 4U2GA 1MIOB 3BXXA 3LCVB 5DHTA 3GG2A 2O1SA 4QA9A 1NWHA 2GLUA 4G1VA 4G4JA 3FAZA 4KV9A 1V95A 4N0PA 3VU9B 3L6BA 1PNVA 4RPKA 1CIPA 4BMXA 4C6TB 3VJRA 2X42A 1UWCA 4R1QA 1E0KA 4DMCA 4YLGA 3CIOA 2D0OB 4WINA 3TQFA 4EENA 3BMXA 1QIHA 1YQUA 2GPJA 3BWDD 5CT9A 2I3BA 2RH8A 2ZUCA 3CUEF 2ZI3A 3NCHA 4BVJA 1LDNA 2QDXA 1IONA 2CL7X 2Y76A 4BQOA 4MI9A 3DM9B 2LIPA 4EL0A 4RTMA 1TEHA 4PIMA 3C6QA 4PYIA 1P4AA 4NHEA 5EZYF 2W37A 5AVOA 4R1SA 3A6GA 4TKVA 5JVDF 4KBFA 3T7TA 2OV2A 1PHPA 2VP6A 2AJBA 4LHYA 4Y2HA 5F5LA 4YRIA 3LP5A 4AUKA 4E14A 2DM6A 2AI1A 1XO1A 4Q05A 4IZ6A 1ZVJA 2ZROA 4QYWA 3OMWA 4KR6A 3WB0A 3SJBA 4BWYA 4B1FA 1ZW6A 1ZAKA 2H8GA 1O0SA 3D02A 3EFEA 4JLJA 3QTBA 5KMGA 3T1VA 3ZOZA 2W98A 4TM7A 4X20B 4XWWA 1P3Y1 3GGJA 1CF2O 1GZSA 4IIFA 3VX3A 1YQXA 4RDCA 2ZE8A 1CJSA 4B6QA 5JJKA 1GQOA 2GEVA 5D00A 1JXOA 1P73A 4GEKA 2A1UB 2C2YA 3EN0A 4EG6A 2PUEA 4UBMA 3Q15C 2B9VA 4UOZA 1U0OC 1WZIA 2QW0X 4A23A 1NRIA 5FWAA 4JUDX 5BN5B 3TIIA 1VLMA 1ACLA 3ORFA 2H1VA 2BGKA 3V2HA 4AROA 1KYVA 4YJ2B 4DDHA 4TMVA 3STUA 4FYIA 1WUYA 2CYCA 2QR3A 5AK4A 4X65B 4IVRA 2QLLA 4KUGA 2CLOB 2C4MA 5D3MA 1JTVA 4KZPA 3WKBA 3FAKA 1T91A 1L6IA 1N0IA 4JODA 4ICIA 3ET4A 3AM1A 4LF5B 3O0TA 1N1DA 5FLXA 1NR7A 5AI8A 3B2QA 1K5DA 1QDLB 2NADA 1RMYA 3DD5A 3DVAA 1BXRB 2NTEA 2FYTA 3QXCA 4LQCA 1KHTA 5MN6A 4MH0R 1W1IA 1ZICA 1OC2A 4DARA 2C04A 4R5HA 5CK4A 3TM5A 4CKWA 3VR6D 2JCYA 1DKLA 2AR9A 2REBA 3FKSD 2Z8YM 4FOPA 4HI0E 4O8ZA 3WAGA 2PGLA 5FOSA 1CUWA 1FL9A 1OC4A 1R6XA 2QKYA 3I23A 4OJQA 4PV7A 4RVUA 4BX9A 5HIKA 2I62A 2GPTA 4D97A 5EPEA 4EJFA 1ZXLA 1HC7A 4DDWA 2NQ8A 3FY4A 4K6FA 4V0LA 4YMUA 4O08A 4RMGA 1KHHA 4MQ4A 4DQ0A 2E5FA 1B43A 1XAJA 5AW0A 3BE8A 4P0QB 1SHKA 2W5UA 1P1KA 3C85A 2A9FA 3CUYA 4NEGA 3HYSA 3LC7O 3UN1A 2JFVA 1ATIA 4NAVA 2Z2IA 2IY8A 3IDSA 5CEEA 4G07A 1CQZA 3LHKA 1IRXA 4ZHQB 1LUAA 2NV2B 2VTDA 4TS1A 4C5BA 1MB0A 2I87A 2F3PA 2KM1A 4ND8A 1L8XA 4OHVA 2BRUA 1YMQA 4X62B 1JWLA 3E7WA 3E9EA 4GYWA 4Z8YA 4EAAA 1ULZA 4NJOA 3BIWA 3H4IA 1IY8A 4E03A 1JFVA 1XXHB 2YV2A 4HRAA 4JEHA 2AHOA 3I8SA 3OMLA 1HKUA 4MEAA 2BUCA 1K97A 3RSOA 5K03A 4C6RA 3OTIA 3E15A 5EPUA 4ZMRA 5K0EA 5IAAA 5ADWA 1UMDB 3F73A 5M04A 5CFQA 1UK9A 3CG4A 5C8ZA 3STHA 4R8LA 4S1WA 3BZBA 4EHJA 1VE9A 3FKJA 3HY6A 3G0CA 3HJGA 4WXMA 1N9GB 3JU3A 3WYBA 4N5NA 2G5GX 4NENA 1KKMA 1J0CA 2VLIA 4N18A 5DE3A 1H94A 3KM0A 1CERA 5DOZA 1XVUA 3H1AA 1AN9A 3B89A 1JI0A 4LI3X 4ZI2A 1F3LA 5TMEA 3IVRA 5EZ5A 1SZDA 1P9RA 2WAAA 4H4CA 3RH0A 4RJJA 1YC2A 4RH0A 4MYUA 3WIBA 2H7CA 4DC1A 2VP4A 4GC5A 4N7JA 3V5NA 5U9CA 3EQZA 1Z4KA 2BEUA 5C4IA 1VBMA 5AM0A 1EHIA 1LI7A 4D3XA 4QBIA 2WUVA 4QYSA 4BO4A 4FJ2A 1NXTA 4EPXA 2IF0A 4XGIA 4FYVA 3FVRA 3CN7A 2PX2A 2ATEA 2J85A 1E3WA 1E3DA 2QD4A 1R5BA 2R6DA 1PJBA 4AB1A 1QS0B 4UVHA 4XSHA 3QVWA 1IULA 1AQ6A 1SD1A 2C3PA 4J76A 1CV2A 3LI2A 4F8YA 3PSAA 3DZIA 4IIVA 1A4UA 3NGLA 1BROA 3PQ5A 3ASZA 4X1YB 3DF9A 4Z4QA 4M89A 5DTRA 4EW1A 3BCRA 3QNMA 5L6LB 5FBRB 3B9RA 5HZGA 3F6EX 1DWPA 3DS8A 2FEMA 1L5WA 1WZNA 4R0VA 5DJ5A 3QYJA 5C8YA 4DNOA 5MHTA 3N07A 1FFWA 1ZONA 1WUIS 2C5GA 1M3SA 2QRJA 5JMTA 1EQUA 1WO8A 2VYVA 1NW6A 1UBTS 4KQMA 3EMKA 3E61A 5HG0A 1INLA 4IH1A 1N3YA 4JLNA 5FBLB 3BT7A 5AQ1A 5AW1A 3IQZA 2GJKA 2QSZA 2LDXA 5HQJA 4AO7A 2PGOA 3LX4A 2H1RA 3OO1A 1YAHA 3SF8A 1GQFA 1KMMA 3AOGA 4UUOA 4UCXA 2QVCA 6ABPA 3RVJA 4L5BA 1A69A 2G0NA 3LUGA 2FEAA 3NHUA 1M2GA 2G8NA 1CUCA 2GAJA 3E58A 3HNPA 4G26A 2QMYA 4NBLA 2CNOA 2VG8A 3AV0B 4IICA 3WBJA 3WLRA 1YI0A 3VU9A 2E6UX 2WJAA 1E3IA 3FW1A 1WCWA 1IK6A 4ZAWA 4LNAA 3V33A 3EFHA 3M34A 2Y92A 3NTVA 1LU9A 3IPRA 1HT0A 2REQA 3W8FA 4YJHB 1G8HA 1E77A 2ZUVA 4V1CI 1JWBB 3T4PA 3PQDA 4LDAA 1Y6ZA 3TRHA 2UVPB 3BXGA 4BLQA 1L8OA 1NRXA 1RWKA 2QS9A 1S8NA 3CRZA 4FFLA 4JQOA 4EAQA 1LPMA 5DTIA 2NTVA 1XT6A 2VDLB 2M98A 3RFXA 4DLXA 1NR5A 2C4VA 2N3ZA 4M49A 3E35A 4QXOA 3W5CA 4N8SA 4DLTA 4CQMD 4GDMA 4POOA 5JAOA 4FCVA 1Z8NA 1PJZA 1SK8A 4JS0A 1G9SA 1AHNA 3A3KA 5IZCC 4BWGA 2JAQA 4NH4A 2Z2XA 1Q21A 3UG7A 2ILTA 2QI9C 2N42A 2HV8A 2R6GA 2QRPA 3ZTYA 4YRMA 3N76A 1TQHA 4MQ5A 4YC7A 2XECA 3SF0A 3THWB 4ID9A 4U2EA 3MTGA 2PLAA 4L51A 5JOQA 5C9ZA 4PZUA 4ESOA 4UZSA 5KJFA 1E0SA 4LOIA 5BVGA 4R41A 4RV4A 4YPOA 1QFJA 4J9UE 1N0VC 1IYZA 3PQ6A 4D3SA 1GTRA 1G6KA 3CKMA 4B8ZA 2FVXA 3AU8A 5EZYA 1O0BA 2VQDA 5JVDA 4HZUA 1Q19A 1VMEA 3OLXA 1GLVA 4RXMA 3ZNPA 3MCAA 3OG9A 4QU5A 1RKQA 2NACA 3BQMB 4PF1A 3OPYI 16PKA 4GRAA 3AKCA 4R9SA 3KHTA 1AGRA 1CVIA 5K9ZA 2I2FA 3D3JA 2FXIA 5BN5A 3AI1A 2JPDA 2IHKA 4GP7A 4M7RA 4Y0NA 5F76A 1YQQA 5CFRA 2GD1O 1WKVA 4ARCA 1C9NA 1L5HB 2WWRA 4EKEA 1D4AA 3HJHA 1G17A 1ODLA 4YJ2A 3A6HA 1SCJA 2SKDA 3ZGXA 1C1HA 1AA9A 1TC1A 3OAAD 2R84A 3ORSA 2VF5X 4K9SA 1R6AA 1N32B 4YI3A 2COUA 2N47A 2R8EA 3IAXA 3Q12A 4DKJA 4KIWA 1PYDA 4QUKA 2FP4B 1QLWA 2W2LA 2O8CB 4UUQA 5JNLA 4ACAA 1WMSA 4HAZA 3TJRA 4LSMA 1BXRA 4YQYA 3IAM6 1KO5A 5FO1A 2CHEA 3PF9A 4ZEOA 1D2GA 4OA8A 3V8QA 2C97A 3V4FA 1HGXA 3H3FA 1QGYA 4BDTA 4H7FA 5CX1A 3ZD8A 2IITA 1KI8A 3ROKA 4AC9A 2P6RA 4M46A 2R4TA 3ROXA 4BVHA 4BQQA 2HCJB 3T95A 1OFTA 4Q16A 5HIMA 3KWMA 1D1SA 2VSOA 2IIPA 3AJDA 1A9ZA 1CNFA 4Z1MA 3GGSA 1MJ5A 2LWIA 3K9WA 3KQUA 4MWBA 4GPAA 4D2IA 4EVSA 1L9KA 1CEEA 1N6IA 2BFFA 3LQ4A 5CDFE 1C14A 1OHHD 2J59A 3F5DA 4L16A 1KEWA 2FR1A 4PZ0A 3RS7A 3V7WA 5BNWA 1GA6A 1Q0QA 1V5IA 4L73A 3A1FA 3GQBB 4MW9A 1IN1A 3AIKA 2W6OA 3DMTC 1PZNA 4O2BB 1FP7A 3BWCA 3GT7A 1WMFA 1O6ZA 2OG1A 3NBQA 3QWHA 4ZHQA 5IKMA 1OW3B 5KOJB 2GNPA 3K0BA 1QOPB 2PJUA 5E3HA 4D9FA 4ZQIA 4ZPJA 3E22B 1MV5A 3UQZA 4LZPA 4ALMA 1NVEA 1D5CA 1ZPDA 4LK2A 1XXHA 4XM1A 3SLRA 5BV2P 1R6BX 2PY6A 3U4DA 4G1EB 2CBXA 3DE6X 2J32A 2XNDD 5A05A 3QJ5A 4F8JA 4CIAA 1KZ1A 1VMKA 3UHAA 3PYLA 3SZOA 1U1IA 1F5SA 2CK3D 1KI6B 2VC2B 3KLNA 4CEJA 1YZ3A 5EVJA 4YCBA 1I1OA 2B20A 1I51A 5LA6F 1UBLS 2ZQYA 3COZA 5KINB 1ELOA 1A2BA 5BW5A 3O75A 1YZNA 4JVOA 4NBUA 4QFDA 1ZR4A 1GYPA 2WJGA 3H0KA 1BCRA 3FCYA 3M5DA 4Q93A 1YJXA 1NOKA 3NR2A 1F2UB 3K7EA 2BVNA 3VU3A 4B3HA 4QGAA 3K1YA 4YHHB 4RVFA 3W5DA 1C4OA 3OLZA 2GEUA 3P9YA 2WU1A 4O2AF 2C7GA 2BGWA 1V96A 2VPQA 2HCRA 3ZV3A 3NHBA 1PWHA 3R1IA 2Q1WA 4B81A 2WAMA 3TLKA 4KWCA 1M83A 3IERA 1KERA 3WLEA 1UBSB 5UKDA 1SBYA 1R6DA 2XMRA 4ZOLB 1NQ5A 1XL1A 2WICA 4REOA 3JQAB 2JHCA 2CMDA 5HJ7A 1W36B 3FLBA 3WLMA 2CXUA 2TMYA 3DONA 2AS0A 1K68A 1YDMA 4B3GA 1MOSA 4IUBS 4OCZA 1KRHA 1MOQA 1QDUA 2VJYA 3Q4GA 4W1QA 5DULA 1XRQA 5H81A 4UPEA 1QHXA 5JROA 4X3PA 2XD9A 2PUHA 3K9NA 4U9IS 1J7KA 2WYOA 5IBQA 3X2FA 1DQPA 2FW9A 2YXBA 5IEBA 5F2KA 3B1ZA 3EEBA 5AKKA 4K88A 3U2QA 1YK0A 3NDJA 4X1YA 3AKYA 1DE0A 4L4YA 3BRWD 1VI2A 1NNI1 4GQBA 5ESWA 4BFVA 1JEDA 2EATA 1NTRA 4KKVA 1XDSA 4TPKA 4CLRA 1G5HA 1SVMA 7REQA 2OOKA 1YE5A 4Z0NA 3IPAA 4C7XA 2D7DA 3ENKA 2ZJFA 3JZFA 4U9HS 1UM8A 1UOPA 3PTLA 1GP2A 2GHIA 3HB0A 3WK6A 2H85A 4BJ6A 4MIYA 2V7EA 5FTLA 5GGYA 5C3MA 3TIVA 4DCSA 2O8NA 4DNQA 1RE1A 1RJEA 3QVUA 3UMSA 2YHSA 4Z9XA 3CNEA 1ORWA 3KD2A 4JMPA 1DFIA 3NTUA 1YULA 2WF6A 1VKOA 4K9KA 3ZIAD 2EGHA 3VQTA 3A1DA 4PRLA 3R20A 4FP9A 3JARB 2XXAA 3OZSA 3VZCA 1I2MA 3NCTA 3CLKA 2GZDA 1CBUA 3VBEA 3IAS6 4JB8A 4DR7B 3VYSB 3Q6IA 2RMKA 4A0HA 3FVTA 1RIFA 1KDRA 5A0VA 3HUDA 3BD7A 3A1CA 1ABEA 3LPNA 3B3AA 4HWGA 5JFOA 3VYTB 4YONB 3ZE7A 1JEYB 4UZFA 5K0ZA 5KU7A 4D9BA 1P4GA 4E1AA 3EZFA 4B7XA 3IKVA 2HWKA 4EYQA 2FJPA 1X7XA 2AWNA 3SMVA 4FB5A 4A0FA 5B6JA 5K0JA 5K20A 4PC7A 1TI7A 1XFDA 2COEA 2WV7A 4PPQA 3E5RA 2DTDA 4RF5A 4IRMA 1IY1A 3PIRA 5EWJB 1M7BA 1XTQA 2QR5A 2C9DA 3PLAE 1VPLA 4LW8A 1Y98A 4RVCA 1ZESA 2XUDA 1M6NA 3CN9A 4KOAA 2QVYX 1PV4A 4F4JA 2P11A 4P58A 4YRJA 1YUMA 2I2BA 2OHOA 3QMWA 5GAJA 4XYBA 2HN9A 4LZNA 3RTEA 3T0FA 3GRYA 3HDGA 3TPFA 4K8RB 2GNAA 1K7SN 3K96A 3KV1A 4RK5A 1PNRA 5DB4A 3CWQA 2VEDA 3E7PA 4JZKA 4YUXA 1WEKA 4D3YA 1Y3HA 3WK4A 4RKWA 4EJ2A 1IAQA 1PNQA 1TIPA 2CBGA 1P4JA 3P2EA 5H16A 3B5EA 2GBLA 3KKZA 4TWJA 1E20A 1VP9A 3VAYA 2WJIA 2QIOA 1BD4A 3QVJA 4HGPA 1NMYA 3JQPA 3ED1A 4LYGA 2PGAA 5C32A 1H0RA 3OCVA 1E6EA 4NBTA 5FEUA 2YWGA 2GCNA 4RH3A 4DG5A 4Q7EA 2NZJA 1OFGA 2C9YA 5T6BA 1PL6A 3DL7A 1XZGA 3PXXA 1RABA 1Z25A 2Q5IA 2XUJA 3CX3A 2GF9A 2I03A 4KX3A 1L5HA 1ND5A 2CNKA 4ILKA 1ADBA 1NN1A 3IEKA 3TB4A 2O1WA 2VHVA 3TI7A 4FIZA 1GADO 2C29D 4BMPB 1E5VA 3HJRA 4FINA 3I04M 3DQZA 2JVKA 1K66A 2QXYA 4A0QA 2CDAA 3WO0A 5K0SA 5KSYA 5LQAA 1VRWA 1CHNA 1K63A 2JZNA 4Q4HB 4MKXA 4KYIB 4BY9E 4ENVA 4BE9A 2VYQA 3R8CA 1YA4A 1OTYA 4OI1A 3SBDA 5C8VA 5J3JA 3MAGA 4NDAA 4ATNA 2D5BA 1GVHA 2FWRA 1GFWA 4JU8A 4W8GA 2HMUA 3RYHB 4DE5A 1SBNE 4X1KB 3GVCA 1P31A 1XZQA 4IUYA 3C98A 2Z5FA 4CNQA 1L4FA 1W4CA 2DUMA 3N0XA 4NYMR 3T34A 4CM4B 4HJXA 3ZZ1A 9GPBA 3NHMA 5HGJA 4CMJA 1YGPA 2EIHA 1OGJA 5TARA 1P1RA 3EEFA 3GDWA 4ER6A 2GFQA 5CT5A 3QPVA 3OA0A 4R1MA 1K06A 2DECA 3KB8A 3LF1A 4KLAA 2C3OA 4ZVLA 3H5AA 2GTIA 1XA0A 2GILA 3DEAA 3FMGA 4XUCA 3E03A 3H9UA 3S2IA 3ZJ5A 1VOTA 3SMQA 1NYQA 3NJRA 2AG8A 1T9CA 3HN7A 1DDIA 1ZU4A 3MWGA 5KOJA 3L06A 3U3MA 4GX5A 3BJMA 3ZQ6A 1FRVA 4AMBA 2JARA 3B6ZA 1ANKA 4JLSA 3CIFA 4TWRA 4NCAA 2FJUA 1ZLXA 4IXWA 2YHAA 4WWHA 3H1FA 1OT3A 5JCJA 5MN4A 3GJZA 5EIXA 3DNMA 3LUCA 1KYTA 3ESDA 2XE7A 1P45A 3IUMA 1NDUA 3KHSA 2HIMA 1YRHA 1J07A 4MMXB 2X9GA 4ZO6A 3TZKA 4A2WA 4EYOA 4F21A 1CSEE 2HT6A 3GFFA 5J1SB 1Y7PA 1KI6A 4U3JB 5AXDA 1MF7A 5BSTA 4C4PA 4C05A 2XR1A 3G59A 3KDSE 2CJPA 4DN6A 3R23A 2LTAA 4X5OA 1G4AE 1DO8A 1C9JA 3RS2A 1JN0A 2FG6C 5J9FA 3SWWA 1EXMA 1C9EA 1G7RA 5JD3A 3TNYA 4QM6A 1VPDA 1F2UA 5BOSB 3I1YA 1SHZA 2QG4A 4JLOA 1QF6A 3O5AA 3AIIA 4HRYA 1ZCZA 4I08A 1OLSB 1L4YA 3IQHX 5E8JA 4JLVA 5JC1A 2C9MA 5J5AA 1JLKA 1LLDA 1XELA 1KOJA 1PE0A 3N8DA 2P90A 4L6AA 4L4XA 1MQ8B 1N3IA 4NE2A 4V39A 2VA9A 3Q3IA 1E9AA 3CSDA 3K4HA 4PYKA 3L3BA 1EM8B 2C5BA 3DAFA 2OFFA 3EUFA 3RSSA 1KPGA 2D2XA 3D6UA 4L9SA 5ER9A 2C03A 1QFZA 1AGYA 3NIWA 1K6EA 4OVKA 5A6SB 3DVLA 3SFVA 3W05A 4NAUA 3ZNQA 3L18A 3EFOB 1JVSA 4O2AA 3VPSA 4OBEA 3KQHA 3KKKA 2VYNA 1XKQA 4L0QA 4YRTA 2FOIA 2IE0A 2Y77A 4W63A 3QFSA 4PE5B 2XGJA 1JHQA 4NULA 3ZE6A 2XUGA 1U5BA 4YROA 3ZDXB 1H8HA 5GM2A 3SD7A 1GKKA 2OV3A 1Z74A 1K75A 5CIWA 4XIYA 3V7NA 2HJGA 5J5VA 2OYSA 4A0RA 1NMZA 2VPYA 3G9TA 3OX2A 3K0HA 4NCJA 1JDJA 1BRTA 4MO9A 1E1LA 2PV0A 4MVXA 4NS1A 1TLTA 4TKZA 4YO7A 3DO8A 4I50F 1OREA 2D1YA 5FPTA 3RBXA 3LXRA 4BMNA 5JANA 1K3TA 3ZDEA 2UV8A 2YWHA 4C0LA 1A04A 3S5UA 4GI1A 5AVZA 3T0GA 4UCWA 1N4AA 1LPAB 3RC3A 2IPLA 3EXG1 4UEOA 3LBAA 4PO1A 3A36A 1U2ZA 3HLYA 5HFAA 5AR1A 2BKXA 5AHKA 2FFBA 4TWZA 1EFHA 3AL2A 4RHTA 4WUVA 3HVRA 1ID8A 3O03A 3EGWA 4YAIA 5FTWA 1ZSNA 1X9GA 5SV2A 1BGWA 5L45A 3WQQA 1HSOA 4RTQA 2G06A 2BLNA 2HYIC 2L18A 4OQDA 3RT9A 1K5GA 1DAIA 3O8DA 3PGLA 4DGSA 4RCYA 2XMBA 1OFHA 3NI2A 3GJ8A 5CB4F 3QY0A 4RF4A 1PO7A 2D4AA 3EZ7A 1XQXA 1LQ2A 2O2YA 2QW8A 1HLGA 4GW3A 4QL3A 3TRIA 3VDMA 4CU5A 1JEYA 1AXEA 3G13A 4YXFA 3F2VA 1C8BA 2F9MA 1Y7HA 1SC9A 2DKNA 4M21A 4TVKA 4U2KA 5CM2Z 1S3GA 1UPXA 1ZVMA 2Q2QA 3BZUA 2Q3HA 3CISA 4DLSA 2HW8A 1GVNB 1EX6A 2VAMA 4FDMA 4UPVA 4XM2A 1XP8A 1E2PA 4IDGA 2H1OA 1Z4LA 2OWDA 1KMIY 5AVYA 1XPUA 4UKDA 5EWJA 5A5EA 3W8EA 5K3FB 3GVPA 1WZEA 5F35A 3T3NA 1KARA 3VO1A 1E1RD 3EAGA 4YRFA 5B36A 2HGZA 2CVPA 2YXDA 3LZDA 4KK4A 4C06A 4IZOA 5FNVB 4DC0A 3LOPA 5JATA 3S8MA 4D79A 4AI6A 1GCGA 2BTQB 2OORC 1EI9A 2Z8ZA 3KVOA 5B55A 3JYLA 1GFIA 4HX5A 3G5MA 1ZXXA 4OMFG 2NO6A 1QOZA 3RR2A 1AS2A 5HUHA 3QSYA 3EOBI 3RYIB 3LS2A 5KTTA 5SZJA 4YAGA 3L0CA 4B46A 5SICE 1NNUA 2IWHA 4FKMA 3R3HA 4ZCLA 5EKXA 3GT0A 3PTAA 1EDOA 3NFRA 1SOWA 2XUPA 1PHRA 3FYHA 1J9GA 3TUIC 4O4IF 3OZAA 3ZJYA 2WHPB 3HB5X 1CY4A 2PLRA 5CLGA 4HGOA 4EMUA 5EJAA 1FFCA 5DSTA 1RJWA 4ZEXA 1QANA 1R88A 1WULS 2XNSA 4FX5A 1K08A 1JQDA 5HJ5A 3ZDDA 5F1KA 3O4IA 4G63A 4UBJA 4PIPA 2Q45A 2VJQA 3DDHA 3NRJA 4FN5A 4Q1FA 1LW6E 5F7JA 4Z54A 3BGSA 1I8TA 5B3KA 1IEVA 4B35A 4ARIA 3WIUA 3ABQB 3CRW1 1H93A 1TK9A 2BHLA 3AHCA 3PXBA 3KQKA 3QYFA 4J3FA 5CD9A 1L5OA 2IBMA 1JH8A 2NU7B 1NP6A 2O2DA 3LG2A 4EF6A 4Q4HA 5JCOA 5K2OA 2QL6A 4XB6B 4H0NA 2VNIA 2C5LA 3F97A 4BYGA 5ICEA 2FUNB 4RE6A 1GYRA 2BGLA 2A57A 3DE7X 3NHRA 4MROA 3RYHA 4P08A 3PICA 4PRKA 1V7QA 2QPOA 2VL7A 4ARSA 1FTGA 3NONA 4X1KA 1Z0AA 4RKRA 1E6UA 5G0VA 4DADA 1TT5A 1SPBS 1TM5E 2RHBA 4G8CA 4RL6A 1OYVA 4CM4A 2VAVA 2HI0A 4IAOA 5AVRA 1XTSA 4JOCA 3ZWQA 1R4NB 4U7PB 2H17A 4QAQA 1G1MA 1H9AA 1KJIA 1FJ2A 1M75A 2ODPA 3L7BA 4RD2A 3VU8A 3EZLA 1NL3A 1WNFA 3BILA 1QHEA 3FWKA 4ZCIA 1SOAA 2X13A 4OP2A 1EQAA 4V3BA 1ZUNB 3R8XA 1DS6A 3RUFA 3E84A 3MWFA 3ZH9B 2HNAA 4GLBA 2MJLA 2Q5HA 2QE7D 3WQRA 4BNIA 4E3WA 3AT1A 4GNKA 1MBZA 4OLHA 3FPBA 3BWEA 4UBNA 4UJ3A 4LRUA 4Y8VA 1X1RA 3ZHRA 3B8HA 1XMPA 1TKCA 2JIZA 5HR5A 5KNLA 1JKIA 1DL5A 1XNJA 2AC4A 2DSTA 2ZUSA 3PPIA 4JP2A 1L1FA 4C22A 4DF3A 3BSSA 3CC8A 3WO1A 2OHGA 3GA7A 3EZGA 3BD8A 2EKBA 3DLAA 3R0IA 5CIYA 1N2CB 1B6SA 4EF5A 1H2HA 2IOQA 4K2HA 4Q1AA 4ZYVA 1R6TA 3I09A 4YIHA 1G2OA 4HVTA 4JB2A 1WRBA 5KNCA 4R8RA 1XVVA 3RFVA 4BQPA 1S8AA 4HN4B 1DTWB 4ZYUA 3KSBC 1JT2A 1NW7A 1MCZA 5I4CA 5H9VA 1XZBA 3HB1A 3WGLA 2P1DA 3HACA 4ISBA 1Y9AA 3TEMA 3JATB 1YJQA 4M1SA 4TSFD 1QPGA 4XCXA 2LP4Y 5DM2A 3CNQS 1L7NA 2OLJA 1ODKA 1P5FA 5KOHB 1AU9A 3C8ZA 4O3MA 4BO6A 2X7XA 2NPFA 3Q8LA 1K7XB 1JS1X 1XEWX 2O57A 2ZTUA 2FEXA 1W6RA 5E6UA 2QN1A 1WDKA 3E5MA 4FKZA 1SUIA 3RVSA 5BOSA 1NKTA 5CVJA 1I7DA 1FDUA 3JAWB 1OLSA 1QK3A 5AJYA 1LCIA 1Z0UA 4Y6OA 3RT1A 3UQYS 3HE3A 1Y81A 4R7TA 5AM2A 4GSLA 3TCNA 3SS8A 2C7PA 2JLCA 3SJ7A 4IMIB 4KR0A 2M6RA 3BF7A 3GRKA 4UHBA 4UDOA 1PG5A 1X80B 2RCYA 3M49A 3QU2A 4OAPA 2D59A 2O8EB 1EUZA 1NHWA 1RC1A 5LDGA 5AVUA 1L6RA 4ETWA 2MSKA 3R09A 4CR8A 1U0RA 3ESYA 5A6SA 2JIBA 4LZWA 4LSZA 4QPCA 3WGTA 2QD2A 2YY6A 5ITWA 1YFJA 3IPCA 3EFOA 1RFLA 4TGLA 1AB5A 1XB2A 4WZBE 1PFUA 1WXFA 5FEMA 3TRFA 3WS7A 3UC9A 4CDMA 4Y18A 3D0OA 3IE0A 4FFSA 2L42A 4IWYA 3IYLW 3TKAA 3G8CA 3QJGA 3LVFO 2ZPUA 4DMHA 2BDEA 1ETUA 3HL4A 5LJLA 3NP9A 2C9ZA 2A9OA 5TVKA 2PHZA 2YW9A 4M1WA 4IGKA 4L2IB 1VG0B 2WVJA 1S8OA 3HBAA 2GK6A 4MQBA 5JS6A 1ZBQA 4OHRA 5FO0A 2P41A 4ZI7F 4DSNA 1T4BA 1GGFA 1N6RA 2FU5C 3A6KA 3EF3A 1KQGA 4LMAA 4BFUA 3B48A 3O4JA 3AESB 4LCJA 1XU9A 3AC0A 3IP9A 1KYWA 4R2IA 4FJ1A 4MVCA 4EEKA 3CO5A 1TO6A 4AD8A 1SOVA 3U56A 1A9RA 1MORA 2BCJQ 5LQKA 3EULA 5FCDA 1I5RA 1V1RB 1Y8RB 3OTGA 1RI2A 1NF3A 4X92A 3S5JA 2XWSA 5GP1A 1GFSA 4E1BA 1GLNA 2OZVA 2YS7A 3KYDA 4I50A 1KTIA 1GEGA 2ZAIA 4X71A 3AR2A 1AV7A 3N7AA 4ZI7B 1GKLA 3WGNA 4FDUA 1SKUA 3IUBA 2MU1A 2Y99A 1IEXA 2JLWA 3IV7A 3EIQA 1SBTA 2WILA 3ROTA 3RFTA 1KZ7B 3TXYA 1CQPA 4RJTA 5BYJA 4AJ2A 1ZINA 4XDGA 1QVAA 2C57A 2Z1NA 3NM6B 3VC3A 3ROZA 3W04A 2EZ9A 3ZGZA 1T8SA 5JPCA 3JWPA 2A3RA 4EEZA 4B4DA 1G5PA 3KKMA 3NOVA 4GQAA 3NT5A 3R5SA 1Q1AA 3GMIA 5E2BA 5AVKA 3R9XA 1B73A 2W6JA 3KXLA 4JBWA 4NNPA 5BP7A 1FE8A 1HT2E 4MKIA 5K3FA 2A5LA 3LK7A 1KY4A 2JRCA 5CB4A 5DK4A 3ENWA 3O31A 4J03A 4YV7A 1U2GA 5EIOA 1SUFA 3OJFA 1MPXA 2CJWA 2CZQA 4M38A 5FNVA 4HQRA 3VR5A 1HDGO 1XFAA 1S8FA 3A2MA 2ZUWA 3IH5A 2F43B 4GLFA 4PYOA 5ABPA 2CFTA 1JIKA 1E63A 5AJXA 1A27A 2AN3A 2BP7B 1SHLA 3QKSB 3RYIA 1JT9A 1QO9A 3JRXA 4NONA 2MSWA 3SEFA 1GNLA 3O8OA 1W5BA 2YJ5A 5CXSA 3EGXA 3UKJA 4YN3A 1GCUA 4D26A 1VL8A 1VMIA 2DF8A 3AVQA 3ZS9A 5LXTF 5IEJA 1BX1A 4YPFA 5DO9A 5EFOA 1C0PA 3TFOA 3MJFA 4J6FA 4F5WA 3SBOA 2YX1A 5KHAA 5FPKA 2BTEA 4CLOA 4W9RA 3D6FA 3OO0A 2QJRA 5E4JA 5BWNA 1UJ2A 4PO9A 4PC1A 1EU1A 1WLYA 2ZB2A 4RPGA 3ELDA 5BOVA 3WK5A 1B2LA 2BONA 4Z2AA 2ARKA 5TT1A 1J6UA 2OKCA 4FU0A 3RD5A 2NU7A 1G19A 3KIPA 4NOJA 3VZDA 1BGVA 4YUWA 4AS3A 3UWKA 1XWFA 1HG0A 2O4CA 2FPUA 3FTNA 1WB9A 4X44A 4WERA 4YV0A 4YJ3F 2H3HA 5LP1A 1G18A 5HCNA 3LL7A 4CV1A 3ZVMA 1RPZA 3UZUA 1A8SA 4DQLA 3C43A 4LTDA 1LRKA 1NDHA 3SM9A 2II6A 3DO6A 4UDNA 1FF9A 3D54D 2CFSA 2AOUB 1Y8AA 4MP8A 5I48A 2Z58A 1Y42X 3I2JA 2F48A 1IM5A 2FSVA 3OX1A 5AW9A 1EVJA 1I3MA 3DZCA 3GZNA 2ZJ8A 3HHEA 4N8DA 2PJRA 1RBZA 3UAWA 2FZVA 1R4NA 3DOIA 3BHNA 3DTTA 4I8DA 3SC4A 1YBVA 4YQZA 5EYPB 4MGZR 4QUBA 3I61A 3OJWA 1TJNA 2PXCA 3R5KA 3FF4A 3T7SA 1SVSA 1ZUNA 4B0OA 1PF7E 5BT8A 3HBNA 2PLFA 4O4JF 3FUCA 3GVXA 3NBXX 1KSJA 3EVGA 5K8VA 4J3NA 2B36A 2HXYA 3PGJA 4FHGA 4KNYA 3J7TA 5M29A 1KF0A 3TL2A 1D1PA 2A0YA 1KZHA 1WDMA 4D99A 1SKBA 3I3OA 2QB5A 1Z2DA 3OFND 2TYSB 2Y2VA 3F6PA 4X7MA 4BX3A 3ZK8A 1MC1A 2NSYA 2ISQA 2ZIZA 1XCMA 3ESBA 4RNCA 2UZ4A 1N2CA 3D8TA 3WMWA 1J8DA 4YUYA 4LJKA 4NECA 2R1ZA 1CE8A 4I5DA 2JIDA 3FGZA 1T0IA 2WIFA 1EX7A 2XWQA 1U7HA 2V7BA 1H1DA 5FA8A 3ZD7A 1IQRA 1DTWA 1QV7A 2IL1A 1PS8A 1JDTA 4RIHA 3IBTA 4YAEA 3T54A 4DB4A 1H2RS 1E9VA 2JFQA 2Q6KA 4V24A 4WCDA 4DQXA 3DBLA 3D5QA 3PVZA 2BZGA 4FBMA 4MYTA 3AF5A 3JATA 5HKAA 4EX6A 1EFRA 5B1YA 5IT9A 2XCQA 3LV8A 3G68A 4CG2A 1EK0A 4LXXA 2QN9A 2BGJA 1U6JA 2YRXA 3L01A 2RDMA 4WADA 1PW7A 2J3JA 5JXIA 5KOHA 3EXAA 3TX2A 1RAAA 3P2KA 3NHPA 5FBVB 2Y0BA 4YA6A 2OXEA 1J8MF 3HHPA 1WUKS 3U6BA 1G5FA 3ICOA 4LJLA 3UJ6A 4JOBA 4YT2A 4Y2QA 1A1VA 3FWHA 4GBJA 1A9SA 1T5TA 4RK7A 4TWBA 1RMQA 7AT1A 4F3TA 3JAWA 3P4XA 4LBYA 1FDIA 3TTWA 4EG7A 2YTZA 1EBFA 3HBMA 4W7SA 1R0BA 1X0VA 4YRQA 2C78A 4O0LA 3JZDA 1PSZA 2ASEA 3A6DA 4Q4LA 2P68A 2HF2A 5DLPA 4AMYA 3AEQB 5ED0A 3TLAA 3OT4A 1X80A 1Z37A 3DULA 4KZKA 4DLWA 4Y7DA 1ONNA 2QZJA 2O8EA 1BWQA 4C88A 3RW9A 5HYVA 3ZVRA 1J09A 1Z2NX 5EHNA 1P61B 1P72A 5ILOA 4RPJA 4AYXA 3W34A 3WBBA 4HMPA 4QNRA 4REQB 2CNLA 1ZISA 2J31A 2R96A 3WG9A 3W9UA 4CM9D 1X1SA 3P0IA 3R5JA 4EK9A 5DTQA 4DMUB 4FDTA 4RO0A 3QLTA 4HGZA 3S2ZA 1LPNA 3EIOA 3HYCA 3S28A 1KH1A 1R27A 2ID8A 2X23A 5IN5A 3IJEB 1G7SA 3H5IA 3SGLA 2IEAA 3T5AA 1KOGA 1HDYA 4TMWA 2APJA 4S04A 3QBEA 5CNKA 1IZZA 4PLCA 3QFTA 3O26A 1UOEA 5CB8A 1E3EA 2EJVA 2QVZX 5FIUA 2Y4OA