3H04A

The crystal structure of the protein with unknown function from staphylococcus aureus subsp. aureus mu50
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
272
structure length
272
Chain Sequence
EIKYKVITKDAFALPYTIIKAKNQPTKGVIVYIHGGGLMFGKANDLSPQYIDILTEHYDLIQLSYRLLPEVSLDCIIEDVYASFDAIQSQYSNCPIFTFGRSSGAYLSLLIARDRDIDGVIDFYGYSRINTEPFKTTNSYYAKIAQSINETMIAQLTSPTPVVQDQIAQRFLIYVYARGTGKWINMINIADYTDSKYNIAPDELKTLPPVFIAHCNGDYDVPVEESEHIMNHVPHSTFERVNKNEHDFDRRPNDEAITIYRKVVDFLNAITM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein
publication title The crystal structure of the protein with unknown function from Staphylococcus aureus subsp. aureus Mu50
rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Structural genomics, unknown function
total genus 97
structure length 272
sequence length 272
ec nomenclature
pdb deposition date 2009-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3h04A00
4BTLA 2WIFA 4G8CA 3AILA 5K5EA 3K2IA 3BIWA 3DOIA 3FLBA 2QXUA 2C5FA 4JYMA 2K2QB 1UWCA 1M33A 3H18A 2PSHA 1CUSA 1EK1A 1YS1X 4HS9A 2HU5A 1VZ2A 2WIKA 5BV7A 5JALA 4ITVA 5CXUA 3R3UA 3QPDA 3ZI7A 1MJ5A 1RYYA 1GGVA 1FFEA 3SK0A 3H17A 3R3XA 4EY5A 4J0HA 1H2YA 1C4XA 2WM2A 2Y2VA 2DQYA 5AKZA 5I7UA 3DL4A 2XUJA 2YH2A 3ZLVA 1K4YA 3ESCA 5CT8A 5AK4A 4BP8A 2CKMA 4L72A 4I4CA 4WJLA 1SFRA 3G0DA 3HI4A 1MPXA 3O4GA 3C6ZA 2GBCA 2OLEA 5LZ2A 4UHDA 1H23A 4LKOA 3D2CA 3PDCA 1C7JA 4FOLA 2AJBA 5HKAA 4U2FA 3DYVA 5AP9A 2XQGA 5AKLA 1B6GA 4XX1A 1CUHA 4G4IA 1N5RA 4FKBA 5AIAA 3WWDA 1USWA 4ZRDA 5A71A 1DWPA 1TK3A 2AJCA 3FVRA 5ALLA 2HHAA 4AXBA 3IUJA 3WLAA 4QDXA 2VJAA 4P9NA 1IUNA 1UKAA 1CVLA 4UBJA 1N8SA 1NX9A 2XMQA 2EDCA 3OTQA 1ACJA 4IHAA 5ALVA 2OG1A 5I8PA 2PX6A 2X5XA 2ROQA 3BJMA 3L1HA 4V2IA 1CRLA 3HJUA 5AKKA 3QITA 1G66A 2VSQA 3E1GA 4OB8A 5BWBA 3OOSA 2WHQA 1HL7A 1EA5A 4J03A 1XZKA 3FBWA 3Q8WA 2V9ZA 3AFIA 1UKCA 3FAKA 2O2HA 4H7JA 4XJVA 4JYPA 3EQ8A 4N8SA 1HDEA 4GXNA 3MUOA 2QMQA 1BE0A 1ODTC 4RE6A 4C01A 4FMPA 1A8QA 5ALEA 4MYDA 4CCYB 1UFOA 5DYYA 1XLWA 2YASA 5HF9A 3I2KA 4RGYA 1GPKA 3BDVA 1BS9A 2WUDA 3HLKA 1EI9A 3RKSA 3WWEA 4IQ4A 2WHRA 5FPQA 3PI6A 1K8QA 4Y2XA 4W1QA 1VOTA 4BATA 3STYA 1GPNA 1QFSA 5A6VA 1ZGCA 3D0KA 3ZLUA 1J1IA 2P8SA 5KBYA 3TEJA 4QWMA 1CFJA 1GKLA 3D2AA 3R3VA 1ACLA 2XMBA 4KAAA 2XT0A 4C4YA 1TCAA 4DIUA 2BGRA 2PU7A 3ICVA 3H2IA 1JU3A 1RP1A 1YSCA 3N2ZB 4C88A 1QIJA 2RHWA 1ETHA 1XQVA 4UBMA 2XMRA 4EZIA 1A8UA 4BTVA 5AOCA 1XQXA 1DINA 5C7YA 3UUEA 3WKAA 4E11A 4HRXA 1ZOIA 2IITA 4MJ3A 1LPOA 4H7IA 3GUUA 4AO8A 1CUGA 5HZGA 3LS2A 3G0GA 4B6GA 5ESRA 5K3BA 4AN1A 4N8DA 3BL8A 3IIIA 2HA2A 5K3AA 4J0JA 3F9CA 4KE8A 2WUFA 3WKCA 1P0PA 1MTZA 5CH8A 5I9IA 5LZ8A 3HABA 4BE9A 3ZLTA 1MO2A 4H0CA 1CUZA 2ZVDA 4BVLA 4LIPD 3C70A 1K63A 1QIEA 1E8NA 1J2EA 3K9BA 3WJ1A 1XZGA 3KDAA 4M0FA 1MX5A 5IH7A 2VEOA 1DX4A 5LIPA 2WIJA 5AM4A 5CT4A 2DHDA 1IUOA 4OU5A 2G63A 4Q3KA 1Z68A 3ZV7A 5AKEA 2RGUA 5AI6A 1YCDA 5E2IA 4BC0A 1CUDA 1QTIA 3UUFA 3D7RA 4AO6A 2JGLA 3R41A 5IVKA 4G1FA 4B9EA 2R11A 4C87A 1CPYA 5JAHA 4OB7A 3HSSA 5ALPA 4M0EA 2FJ0A 4Y2SA 1T4MA 1XRRA 1QIHA 2Z5GA 1W6RA 5E4TA 5JAPA 1XZBA 2ACKA 4DMFA 1MNQA 5LZ9A 4JEIA 1E66A 1WM1A 2PBLA 1ZIYA 1XZJA 5ALGA 3CN9A 1XZCA 5AK5A 1FSSA 4UHHA 1CQZA 3QVMA 1CUVA 4N5HX 2OGTA 3IVMA 4QLAA 2AJLI 1Y37A 5AI5A 1BCSA 1K5PA 4EHBA 4MXDA 4DNQA 4QDOA 1R88A 2QR5A 1ZD3A 5IVDA 5AKXA 4J0CA 2I78A 1CUJA 1EH5A 4JUIA 4G8BA 1TIBA 3GFFA 5HF6A 1TCBA 3M81A 2J4FA 1CUXA 5KWIA 3KD2A 2VJBA 1AKNA 4Y2PA 2OCKA 4UHCA 1CUCA 4CCWA 4BCDA 5AM2A 5ALXA 1AUOA 4NZZA 1QLWA 1U8EA 3A70A 5K3EA 4BCCA 3FYUB 4X3CA 4DSAA 1VZ3A 5FOQA 4XVCA 5ALFA 1O6GA 2QRUA 3IUQA 2C58A 4I19A 3VVMA 4QDZA 1SCQA 2WILA 5HKBA 5FV4A 3WL7A 4PSDA 4B84A 2OGZA 4B82A 2PSJA 4LXIA 2JF0A 5AHXA 4GW3A 1HKHA 2QOEA 2WG0A 3QH4A 2RHTA 2C5GA 1JT2A 5ALTA 4C6HA 1THGA 2O2IA 1YASA 2WU4A 4UFOA 1IZ7A 3PUIA 4C4XA 1XZLA 4AQDA 2I3DA 5AICA 1CUFA 1IUPA 5FLKA 1Y7IA 2QKYA 4KR0A 5A62A 2XB6A 2Y6VA 2XMZA 5HFAA 3V1KA 1OILA 3LCRA 2C7BA 1CUIA 3FYTA 1XZIA 1ODSA 4DLNA 1WB4A 1LPAB 4E46A 4QE3A 4LHEA 3WL5A 4KE9A 3EBLA 1F0NA 1H2WA 5AM1A 2GBFA 1MNAA 3V1NA 5CW2A 3LIIA 4GWLA 4O08A 2Y2UA 4LXHA 3ZPXA 2XQJA 4BB0A 1QIIA 2VA9A 2GZSA 3G0BA 5C8ZA 2RAUA 4AZ3A 3HZOA 3D4LA 1XRQA 3MUNA 2H7CA 1S8OA 4MEAA 1JKMA 2PSDA 3AINA 4EUSA 2XUPA 1H2ZA 2H7YA 3QPCA 3S2ZA 5JARA 3WZLA 1CUWA 1ODCA 4TVKA 3QPAA 1TKRA 2WHPA 4Q3OA 2XMCA 3C6XA 4UBKA 5KWJA 2XQIA 3B5EA 3L1JA 3U0VA 1AMNA 4H35A 4Y2UA 2DFPA 3A6ZA 3I6ZA 4H7EA 3WYDA 2HDWA 5CT5A 2BUBA 2D0DA 2HM7A 3R3WA 5ALMA 4G8DA 4QLOA 1JJIA 5AKHA 5JADA 1GT6A 3OPMA 2I3ZA 5HFNA 1K6EA 3CN7A 4IH4A 2XLBA 1Q83A 4PSCA 5EIEA 1AGYA 3M82A 1LPPA 3U1TA 4BP9A 4B0OA 2XUIA 1TAHA 5EHQA 3SC2A 4B7ZA 5HF8A 2OXEA 1QZ3A 3K6KA 5CT9A 1WPXA 4B83A 4FNGA 4UUQA 1DT3A 3NOXA 2Y1KA 4GHWA 4KE6A 4ZXFA 4CI9A 5C8VA 3CCCA 1QJ4A 3VVLA 3Q0TA 5ALKA 1UK8A 4Y2VA 3MGAA 4PV7A 3LIPA 3LLCA 4HXGA 1UK7A 3A2MA 4YK7A 4KE7A 3KWFA 6YASA 4DMKA 3YASA 4BDTA 4KRXA 4AMZA 1F0PA 4NMWA 1UT6A 3OM8A 1CIJA 1XLUA 1CQWA 3DNMA 3R0VA 1W76A 1SCIA 1XKLA 2H9YA 4B85A 1J07A 1L7RA 2PL5A 2FJPA 3C8DA 3IBTA 2JGKA 2HU8A 3H2HA 4B81A 2VF2A 4TGLA 2BKLA 3DKRA 3WIOA 2Z3WA 5JANA 4WDQA 1DWOA 2BJHA 4Q82A 1CUAA 2GYUA 4BAUA 1EHYA 2HL6A 2WFLB 4X85A 1MT3A 5K3FB 5HQ3B 3WKDA 3P2MA 2FUKA 1XROA 3M3DA 2WJ3A 4CIBA 1I6WA 1JJFA 5AOBA 1EDBA 3QBJA 1VA5A 2V97A 4QNNA 5EHZA 3ESBA 2O7RA 3O4JA 4W63A 4Z49A 4MQLA 1HQDA 2NW6A 1OCEA 1CUUA 5CT6A 2GYWA 4E15A 1E8MA 1P0MA 4CG2A 3N0TA 3AZOA 2QUAA 1XZHA 4DSZA 5JAUA 4BZWA 4QDUA 3RK4A 1C7IA 1QOZA 5DTJA 3VISA 3WQHA 1JFRA 5AM0A 5CH3A 1P0QA 5A2GA 3PF9A 4N5IX 5ALDA 2CB9A 5A7GA 2EEPA 3VJKA 3ESAA 3PICA 3WL6A 2XE4A 1YS2X 2LIPA 3WK8A 5JZ9A 4OYLA 5F4ZA 2HIHA 1R1DA 2ES4A 3ANSA 1ZGBA 3FCXA 1YR2A 2QUBA 2Q0XA 3BDIA 2B9VA 3ILSA 1U4NA 1YAHA 1XZAA 2DSNA 1EB9A 4X91A 5AJHA 4Q05A 1CUEA 1VJ5A 1FFCA 3IA2A 1XRNA 3M83A 2PM8A 5LZ7A 1D07A 2XQKA 1AZWA 4WCVA 4Y7DA 3E0XA 3A2NA 5ALRA 1PV1A 1QIMA 3FYUC 2VTVA 4B80A 1ISPA 2OCIA 5ALWA 3RARA 3PFBA 4AZ0A 4HXEB 3WKEA 5BOVA 4OD0A 2XMSA 3WMRA 4HZGA 3WWCA 4DYHA 5EFZA 2QM0A 2WG2A 3DLTA 2ACEA 5HCUA 4Y2RA 3WI7A 2QJRA 1GPLA 1XRMA 3C6BA 3TGLA 3IUNA 4QWWA 3WKBA 1N1MA 1EK2A 4PO3X 3STVA 3I1IA 2ZYHA 1PJAA 3QMMA 1X70A 3AIMA 4J0GA 1QIDA 2WJ6A 2BFNA 2XUHA 3B3QA 2HFKA 1DT5A 1SC9A 3AZQA 5ALZA 4EY8A 4MWTA 4U2EA 4AO7A 2JBWA 1R4ZA 4DNOA 3BXPA 2JGIA 5JIBA 1UK6A 5FDFA 1FFBA 4CCYA 4UFPA 5D3KA 1E3QA 5FPPA 4U2BA 1TQHA 2DR0A 3IDAA 4F60A 2RIPA 4OCZA 2WQZA 1QONA 2CMFA 5EI5A 4IH9A 4DM7A 2DHEA 2JGMA 4EY7A 1BRTA 4FWBA 2R8BA 4JNCA 2WIGA 1ZJ4A 2W6CX 3GBSA 4OSEA 5AK3A 1DWQA 4ETWA 3EQ9A 4TPKA 1L7AA 2DQZA 1IMJA 5AOAA 2VAXA 3G9XA 5DYWA 4BVJA 4BAZA 3WA7A 1YB7A 4L3WA 3WWOA 3AUKA 2BGNA 4FNMA 3I2GA 3C5VA 5AI0A 2WG1A 3QMWA 2FX5A 1SCKA 1IZ8A 1LNSA 3BWXA 4Y2TA 5IVHA 3X3HA 1TRHA 2DCMA 2ZYIA 2ORYA 2Z8XA 2VT6A 2ZYSA 1QTRA 2OAGA 4H7HA 1KU0A 5CTAA 1QIFA 1WHTA 3W9UA 4U2CA 5AKIA 3I2JA 5FKJA 1EDEA 1YB6A 2PSEA 5ALSA 3G02A 3H1AA 5JZSA 4PF1A 4QDTA 1WB6A 2WFZA 4H77A 4NVRA 1H22A 1XZEA 4FBMA 5BWCA 1BCRA 3KXPA 4OYYA 1JJBA 5D6OA 4A16A 5JD4A 2J3QA 5C81A 1QO7A 4FBLA 3D2BA 3SWWA 1BROA 4WDRA 2V98A 5T4BA 3G0IA 1Q84A 3SX4A 5AKYA 5AI9A 4X95A 2PU5A 1Y7HA 2OAEA 1YAJA 4UBIA 2WJ4A 2HA5A 1ZI6A 4XWGA 1XZDA 3PF8A 5K3DA 3E4DA 3DOHA 5A7HA 4F21A 3QMVA 5LLSA 3T4UA 4XIIA 4GI1A 3QYJA 4A5SA 4NS4A 4CIAA 3H19A 2HFJA 3O0DA 1ZIXA 1ZD4A 5H3HA 3VDXA 1E5TA 4W1SA 2HA6A 4LXGA 4P93A 4Q3LA 2XUOA 3G9TA 4BE4A 3QM1A 1BEZA 5DJ5A 2B4KA 4AN0A 4MWSA 2BCEA 3O95A 1VKHA 1DU4A 2W22A 4ZV9A 3DDUA 3LP5A 4H18A 1W1IA 4WY8A 4EY6A 1N5MA 2J4CA 2JGEA 3JWEA 2JGJA 5ALNA 2JIDA 2PUJA 2XDWA 5D7BA 3DS8A 3VXKA 1R50A 2IIVA 5YASA 4ZI5A 4K6KA 2HA4A 3F67A 1LPSA 5ALYA 4KACA 4X00A 3C8HA 4PNZA 5EIHA 4FDMA 3T52A 2ZJFA 3NWOA 4M0MA 1QE3A 3IULA 1ORWA 5HK9A 1LPBB 1AX9A 3H04A 2EDAA 2DHCA 4KRYA 2CUTA 1J06A 5JAOA 5CXXA 2JEZA 4DMCA 1VE7A 2HA3A 2JGFA 5CURA 3OG9A 4ARBA 4IO0A 1ZD2P 2QZPA 5ALJA 2RI6A 4UPDA 1CLEA 4X90A 3W06A 1HLGA 1BU8A 3I6MA 2BAGA 3W2TA 4UBOA 4EY4A 2Z3ZA 1MAAA 1VLQA 4MYSA 3TJMA 4BRSA 4KEAA 2GYVA 3FYUA 2UZ0A 3O9VA 1EVEA 2XMGA 3BJRA 3NGMA 3PFCA 2H1IA 3AIKA 1A7UA 1NU8A 4FLFA 1DTEA 1ZD5A 4BZZA 1LGYA 1XFDA 2VJCA 3H2GA 1EVQA 2HU7A 5ISMA 2XLCA 2ZJ7A 3GROA 4AX4A 4B9AA 1U2EA 3OURA 4OPMA 1Q0ZA 5AM5A 2HRQA 2XI4A 5DLPA 3STXA 4CFSA 3VKFA 1EINA 3WA6A 3ICWA 4Q1VA 1FFAA 3DCNA 4P92A 4X6YA 4ARAA 4HTAA 3I2IA 2GZRA 1U65A 2AJDA 1UXOA 1O6FA 1AURA 3R40A 5LZ5A 3FCYA 4DNPA 3I28A 3IURA 2ONCA 3FNBA 3G8YA 3WIBA 5DNWA 3UMJA 2BUCA 2WU3A 1QIKA 5ALQA 4S0XA 1LBTA 3C45A 4G9GA 5IKXA 5CRIA 5D3ZA 2VJDA 7YASA 2G5TA 2VQ6A 1QIGA 3GZJA 4Q34A 3L1IA 3F98A 3KOOA 4X6UA 3HYSA 4X92A 4FLEA 3QZUA 3O9MA 1X2BA 2PKYX 1DQZA 4Y2YA 3FLEA 4X71A 4J3JA 5ALOA 2WUGA 4BCBA 4HAIA 4GDMA 4PW0A 1EDDA 3BF7A 4J7AA 3ED1A 5K3CA 3DL7A 3EQ7A 1GKKA 4KJXA 1ZICA 5JASA 1L7QA 4ZGBA 1F8UA 5ALIA 3WK7A 1XRPA 2X8BA 3S8YA 5AH0A 3OC0A 2VT7A 4PQEA 2O7VA 1XZMA 3GA7A 4KAFA 3STUA 2Y6UA 4WFJA 4WY5A 4DTCA 1X2EA 2J3DA 3AIOA 2G5PA 3BIXA 1G42A 4EA6A 1XLVA 3CCBA 5LYYA 4F5ZA 2QTBA 3C43A 1T2NA 3E3AA 2I03A 2WLSA 1ZJ5A 3R3ZA 4W1PA 1PFQA 5AK6A 2JEYA 2WTNA 1MX1A 4GEGA 4P08A 2QJWA 3TRDA 2XUQA 1BN7A 4BRZA 4X97A 4W9RA 3HC7A 3FLAA 3PUHA 3STTA 5DYTA 1Q0RA 2ZSIA 1H2XA 3IB3A 5JZBA 2XUGA 5J3JA 1LPMA 1XQYA 1BN6A 4MQMA 4X93A 2G4LA 1DQYA 4UHBA 3DKKA 4WFIA 3V1MA 1A8SA 4H7FA 5A7FA 1E8DA 4KAJA 4FTWA 3VJLA 1WB5A 4DNFA 1MN6A 1VA4A 1VXRA 5FP0A 1JU4A 4H7KA 2E3JA 2VATA 4FLMA 4JH0A 3FSGA 1WOMA 2RONA 5JATA 1MX9A 5E4YA 2ZYRA 3WWPA 3GELA 1UKBA 2C0PA 3DEAA 3EF3A 2HRRA 1AQLA 2XUFA 1JMYA 4E14A 2WIDA 1LBSA 3AJAA 1WPRA 5T4FA 1VE6A 5T4EA 4HXFB 5E4JA 4A23A 3WZMA 2WKWA 3HEAA 4PSUA 1E89A 4UHEA 2O2GA 4FHZA 1NU6A 1W4LA 4UBNA 4G4JA 1EB8A 4K5QA 4BBZA 3A2LA 2AJ8A 2WFLA 4UFNA 3R3YA 3D5EA 2B61A 5ALUA 5K3FA 4N8EA 3FOBA 5HQ3A 3FVTA 3W05A 4ZREA 2V96A 4J0DA 2CZQA 3HRHA 3O4HA 4QA9A 4F0JA 2OGSA 5DNVA 4ZWNA 1W52X 4B0PA 2CBGA 4WFKA 4K6HA 4KYVA 3H1BA 2HA7A 3WK5A 1F6WA 1KEZA 1R9MA 3I6YA 5AIBA 4AB1A 5HF5A 2WUEA 3CXUA 3KSRA 2QVBA 2PVSA 4FFVA 2D5LA 4CG3A 1GXSA 1CV2A 3F8SA 5FXMA 2XMDA 3V48A 2OQIA 1CUBA 2XUAA 4YX9A 5DTIA 1ZI8A 2WTMA 2C0QA 2PSFA 2YXPX 1JI3A 5SYMA 3B12A 1IVYA 3C87A 3STWA 1AC5A 2GBIA 5LKRA 4G4GA 1TCCA 4UHFA 1G4HA 5JD6A 1YA4A 3I1YA 1UZAA 3I2HA 5AO9A 3FWHA 4OUKX 3V9AA 4J0KA 4RNCA 4HVTA 4BC1A 2PUHA 2H7XA 2WSLA 3WYNA 1R9NA 4BDSA 4HRYA 3H0CA 2PPLA 3D3NA 5AI8A 3MVEA 3DYIA 4BYMA 2HA0A 4QZVA 4X7BA 2WHPB 5DNUA 5IVIA 1P0IA 5LZ4A 3HXKA 3RM3A 2OPHA 2Z8ZA 4QEKA 4X94A 5CMLA 1XZFA 1LZLA 2B20A 4UBLA 1G5FA 4EB0A 4I3FA 4YASA 4L9AA 1SOMA 3W9BA 4G5XA 5EHXA 4G9EA 5DWDA 1WCYA 3WK6A 4INZA 2XUKA 4GECA 1FJ2A 4GLBA 2XUDA 3BE8A 1GQRA 4Y2JA 5EHNA 3H2JA 1OXMA 2XQFA 4ROTA 3G9UA 2GBGA 2QXTA 3KWJA 3DQZA 5EIAA 1XQWA 3O4IA 4OB6A 3D59A 5FUMA 5CH5A 4BVKA 4LYDA 5LKAA 5CBKA 4U2DA 5LP1A 3G7NA 2BUAA 3WK9A 5FRDA 1DX6A 4W1RA 4J0IA 5AI4A 2AXEA 4C89A 3BF8A 4OU4A 5AM3A 3C6YA 3G9ZA 4K6GA 4LYEA 4AMYA 2ZJ6A 1JMKC 3DD5A 1R3DA 3H2KA 1UOPA 3V1LA 5KREA 1KU6A 2CJPA 4RPCA 3I2FA 3ESDA 3JW8A 5HK8A 4C4ZA 3EIOA 1EXWA 1THTA 5EGNA 5JD5A 1HBJA 1W75A 3ANTA 1LLFA 2QT9A 3RLIA 4D9JA 1YA8A 3W04A 4MEBA 5AKGA 1MAHA 1B41A 3G0CA 1UK9A 1HPLA 5JYCA 3NUZA 3ZWQA 1FFDA 1LZKA 2YYSA 2ZSHA 1BEEA 3JYHA 1GZ7A 2HADA 1UOOA 1ORVA 4IH1A 4RE5A 1GQSA 3DJYA 3F96A 4U2GA 2QS9A 1WHSA 4DGQA 1VXOA 2IX9A 1LPNA 5SYNA 1A88A 1MU0A 3AZPA 2X76A 1ZI9A 1QGED 4BAGA 1QO9A 1CUYA 2C4HA 1CEXA 3C5WP 3PE6A 4H7DA 5T4HA 3FSGD 4L0CA 3IUMA 3WL8A 2OCGA 1EX9A 4DMHA 5ALHA 4YPVA 1RWQA 3VJMA 3WK4A 2WFMA 1QFMA 3HACA 4Y9SA 1XKTA 3WJ2A 4EBBA 2VAVA 1UOQA 4Y2QA 4CG1A 4X6XA 4K2AA 4ZV7A 5AKJA 1XRLA 2ECFA 3F97A 2OQVA 2OCLA 4FFWA 5C8XA 1CR6A 2CEKA 4GBGA
chains in the Genus database with same CATH superfamily
5LSAA 2JZOA 1KMHB 5ITZB 3I5AA 3IT0A 1SN7A 4NAVA 1Z7EA 3AUFA 3FKSA 1U98A 3VO9A 4G0VA 4WZAA 4EFKA 2FUCA 2IIQA 2BM1A 3K2IA 1OXVA 2HK9A 4OGWA 1RXWA 3DOIA 4DMRA 2W6MA 1E0DA 4V3BA 3TMKA 2XWJI 5LDDC 5KHLB 2W48A 4DLZA 3T1YB 4MSUA 1ESMA 2DUJA 2DP4E 2ZKLA 1UFRA 2QX6A 4CKBB 1M33A 4KLAA 1YI8A 2BIFA 1CUSA 1JV2B 1W4AA 2FVXA 4K9DA 1CETA 2GM9A 4OSPA 3GRPA 3IOMA 4CKXA 2HU5A 2RH5A 2V7TA 5ARBA 1ZMXA 2Y1WA 4PAMA 3VV2A 1TC1A 5ABPA 3V7WA 4PZAA 3U7GA 3GQBB 3UJ3X 3EVEA 1M7GA 3ZI7A 3I5XA 3VA7A 4MUGA 1C1DB 2CXOA 3MWLA 5JH7F 1Y80A 2QP4A 4B87A 4B75A 5JI3E 4YO8A 1KERA 1N6HA 3H17A 2QRHA 4EY5A 1VL6A 3L7LA 5M7EA 3H2SA 2E5FA 4BEBA 2WM2A 4H1HA 1G7TA 3B2EA 2QHXA 4MA0A 2DQYA 1E0JA 5GJWC 4MCJA 1H3NA 1OBOA 1N2BA 2FSVC 1VGVA 3NNDA 4MYCA 1ZW1A 4XGIA 5KQRA 4ZU3A 3EC7A 3TOSA 1Z4MA 1Z45A 1K4YA 5JC8A 3WDSA 1LK0A 2OYSA 3ESCA 1B8PA 1KIAA 2O7NA 4BVFA 1BU5A 4O59O 1KYIA 4BUCA 4BP8A 2CKMA 1QE0A 5K8JB 1GTSA 1QH9A 2JHGA 5HDQA 3RJ9A 3Q7PA 3VOSA 4Z4IA 3K8QA 3RB8A 3LF1A 3IQWA 4LPSA 1GZHB 1ISHA 1EFRD 1YDEA 3IR7A 3TIFA 2I71A 2IYQA 2OLEA 1SIUA 1B16A 2WVHA 3O2JA 2XV1A 3G6KA 2GFHA 2R48A 3BMNB 4G67A 4LKOA 1S1MA 4PICA 2BGGA 4QC2A 3A3KA 4I4TA 4HNAB 2YJ4A 5LQCA 4M8LA 5I9MA 5IM4A 1JXOA 2ZPTX 2RAPA 3CSSA 3HVHA 2Z2IA 2C2WA 5J2UB 2PGOA 3HU3A 4IP0A 2WW8A 3VR5A 2BFEB 2PMEA 5AP9A 3X1DA 4EVRA 3EGCA 4EH1A 3R7AA 4POOA 1B6GA 1OLUA 4HPWA 4R6WA 3DTNA 1CUHA 3QW4B 3FHOA 4JHLA 4KPUB 2IPAB 1UANA 2I2WA 3L8YA 4XFJA 3RYIB 1LTQA 4A0FA 3ZVKA 4DLVA 2WF8A 2BW0A 4LYJA 4XIYA 3AXTA 3HXOA 1TQ6A 3QNWA 3QVUA 3WISA 1AMUA 1J8DA 1UKEA 4UEOA 3IOBA 3GAMA 3VH3A 4HQRA 1D2NA 1UPFA 1H2BA 1Q44A 4PZ9A 3WWDA 1AKQA 1EUCA 1QE5A 5JT1A 1WSWA 3CKYA 1DCMA 1K7FB 4UARA 2R6FA 2C3OA 1ICIA 3NASA 1NVVQ 5A71A 4EO7A 2AE1A 3QFCA 1Z25A 1WXFA 5E9JA 3T94A 2JLVA 3W6UA 1KAQA 2RHJA 5ALLA 4ZFNA 3LCJA 4AXBA 3IUJA 4FMBB 4KK3A 2HV9A 1IG3A 1KI6A 1O77A 1POWA 4Q9IA 5DWVA 3B48A 3TPCA 5JQWA 1E9CA 3PTZA 2XTAA 3ZCSA 3VR4H 4EVSA 4UBJA 1NX9A 2XMQA 3OZ7A 2NU6B 4P3XA 2ZS7A 3L46A 5EKDA 4ZU6X 2LCIA 1WF6A 2FPGB 1YB5A 3CB4A 4RACA 1KORA 4KX3A 3E8MA 2XODA 4EYSA 5ALVA 1YL6A 1G1AA 3HYLA 1KQFA 2YJGA 4W5NA 1II0A 4ZCRA 1Z6ZA 5FUYA 1VBKA 2G0NA 2WDPA 9LDBA 3UK2A 1QHNA 4EITA 4V2IA 4J4BA 2X58A 2C9BA 2ZWVA 3LNTA 2PRYA 3DTVA 5F7JA 2Z04A 4RQAA 1WG8A 1XPJA 4BHTA 3NHZA 3H2BA 4GI3A 2X42A 3RSLA 1KSFX 2Q3DA 1GAQA 1HL7A 3WO1A 721PA 5HWSA 1E5VA 4HEHA 1D2EA 1XZKA 2OHIA 3FBWA 2WKPA 3QHPA 1SG0A 4LQ4A 1FJXA 2QA5A 4MO9A 5DGTA 1A1SA 1RJDA 3RHFA 3CWZA 3FAKA 3P5BA 4GR9A 3DVLA 4PXAA 1TI7A 2O2HA 3W34A 4FONA 2O1XA 5LBTA 1NL3A 3UOAB 2OHHA 1JS1X 4B6JA 1S89A 4FEAA 3OLZA 3EQ8A 4IVNA 1HDEA 1SVMA 2WJJA 3WLNA 2X0EA 2CLCX 1IU9A 2F1RA 5EUBA 4D9KA 1NYTA 4JLDA 1CZLA 4WXRA 2H8GA 5EXPA 1UM9A 1BE0A 4S1NA 5TPWB 5DU2A 4Z4CA 2ZWMA 4ZTUB 3TOZA 1KYTA 1PBTA 2PAAA 5BSHA 2G1JA 3GCZA 4JP8A 2CZGA 3NTQA 1IULA 4CCYB 5AJVB 4OHCA 3AF3A 4DXDA 1QX3A 5CDYA 3U31A 1KK3A 2AB0A 1TZMA 5DYYA 4I3GA 2Z6VA 3CF6R 3AR2A 2YS6A 4MK4A 4W6QA 3AVWA 3C8ZA 2B78A 2WWHA 4RGYA 2C54A 4KOEC 5IFKA 5ILGA 1P2GA 4WBSA 7REQA 5FWXB 3VZBA 3C3MA 4KR7A 3RKSA 1R6XA 2G06A 1UPCA 2WHRA 5JS2A 2FMIA 5HPYB 2FDRA 2GKGA 1VOTA 3IX7A 4EHJA 3VU3A 1H6CA 1PJSA 2ZJ4A 4WA8A 1XTPA 3STYA 3RYHB 1Y9JA 4HL6A 1AK1A 4O33A 5AOVA 4KXUA 3KV1A 2WQ7A 1AF7A 1JHRA 3N7TA 4D42A 5EWLB 3G88A 1BOOA 5DNEA 4IDGA 2VHJA 1ISSA 1ZGCA 2OQRA 3JASA 1CQIA 1J1IA 2PZJA 3GJ7A 4M9XA 1BS2A 2GWRA 5C7OO 3EQ6A 3CRMA 2GJAA 1DIRA 2VSFA 4G84A 4QWMA 2FWAA 2KS6A 2IYRA 3D2AA 3PB3A 1M75A 1ACLA 2HLHA 2F3RA 3R3VA 2XMBA 4KAAA 3LUGA 1FDTA 1SVWA 3KAQA 3FOEC 4W5OA 1S2IA 4BLOA 4NXNB 5J2TF 2BGRA 1XEXA 2PZMA 5TGZA 2ZGVA 1GNLA 2PU7A 2XITA 3A9VA 3F6SA 4KU4A 2O2CA 5IK2A 3BZUA 3Q0EA 5FLYA 2IKQA 2QW1A 3IL2A 3MHTA 1L5HB 2LDBA 3C4VA 3V7FA 2IHNA 2EX1A 3LL4A 2C8LA 2ZUUA 1WZIA 3N2ZB 3QOXA 2B3TA 3IBSA 3WGLA 4W4TA 2FHSA 2RHWA 1XQVA 3HCBA 5CNKA 4RK4A 2JNWA 1A8UA 1WLYA 4WBNF 2SKCA 2Z30A 3RYCA 2OZVA 3CUSA 4KVZA 5DTMA 5CFOA 4XM1A 1AOXA 2BEVB 3AUYA 1VB3A 4BTVA 5LLDA 5AOCA 4IWXA 2W4QA 1D9ZA 3A4TA 4IYRA 2QVLA 4PIMA 1DAHA 4HNQA 4GWKA 4MUEA 4YMHA 3RWBA 5LA6F 5KJEA 3E9RA 4BQNA 4BQRA 5I7AA 4DIBA 4HRXA 3SZRA 1NASA 2MR6A 2IITA 2P4UA 2VA8A 4MJ3A 4MV5A 1GGNA 1OT3A 5GPBA 4F72A 1Y82A 2FPOA 4O0MA 5KSOA 3HNOA 1OH8A 4OV6B 3WGVA 1ID8A 3OT1A 3QY9A 3M6IA 1CR4A 4JI8B 2LW7A 3UMMA 2YOFA 3NEJA 2W6OA 5HZGA 3KBOA 4OJKA 3PC8C 4TZTA 4TXHA 2FWRA 3LS2A 5ETJA 2XE7A 2NM0A 3G1TA 1TQ8A 2FN7A 2VF5X 3LHFA 3EIUA 4GM4A 1AB5A 4O2RA 4ZDKA 2EW8A 3IIIA 3FNQA 3FFBA 4KSCA 4ZTBA 4P4NA 4TVBA 2P79A 4O4HA 2NU9B 4HQ6A 3TX6A 3UICA 3F9CA 2JAQA 4JI6B 2HLDD 1LLQA 4YFVA 4C22A 4U9UA 4EGSA 3WKCA 3ZLJA 5CCXA 3NFRA 2R8OA 5LQJA 2EX0A 2PNJA 4W7SA 1HDGO 3JVEA 5I9IA 1IE3A 1FF9A 1FZQA 2XSZA 3B8EA 1EWRA 3HABA 4Y1RB 5FUWA 3HKDA 4EARA 1RABA 3OKFA 3DAYA 3TZQA 4FMCB 1RT9A 4C07A 2MMCA 5IM5A 4C78A 2VH5R 3AYXB 4EG1A 3CVWA 2ASVA 1VG9B 2C83A 1CUZA 1H0HA 3SJAA 2R7AA 4E3WA 4CR7A 3HUFA 2P90A 3F74A 1BHQ1 1NFRA 2FPMA 2LIVA 2OGWA 3E70C 3AVPA 3TW0A 1IQPA 2JB9A 2WT9A 3U4IA 4CMEA 4LIPD 2R7KA 5DTRA 5JRDS 1GTL1 1T36B 4LC9A 4M0CA 5HJEA 4GO1A 4P3KA 1J2EA 1HSZA 4XJTA 1YB2A 3DEFA 1HYHA 2BSXA 1JR3E 4N7RA 1E32A 4QOSA 1FVOA 1G8HA 1SUPA 3ETCA 3KKOA 3KDAA 3OCUA 4PHFA 5KVQA 5LIPA 4YCNA 4MB2A 2JKYA 1MW9X 2NLOA 3NT2A 1SBTA 4D9IA 5BN5B 2FZVA 2ZRCA 1Q7GA 2IS2A 3FH0A 1NKSA 1T0BA 1NLYA 3ZGYA 2ATVA 4BS9A 1AKWA 2XT6A 4Q9HA 1OTXA 4OU5A 2X0JA 4Q3KA 3WL3A 1Z7BA 3K8YA 1QVWA 2EV9A 2Z4TA 3O8OB 3PNBA 1CX9B 4JITA 3N6XA 2I3AA 1JR3D 1S4MA 4M49A 2RGUA 5AKEA 3T34A 1YCDA 4MIYA 2H18A 5E2IA 4MTLA 3R3JA 2RHLA 3B1XA 3OQIA 1QTIA 3UUFA 2OK8A 3EXG1 4MICA 1KJ9A 5CNMA 4XLTA 3VNBA 3BUSA 3D7RA 4PVCA 5FBVB 1PQYA 8OHMA 4AO6A 2FUNB 1G7RA 1XK7A 1VFPA 2JANA 1LKZA 4S12A 2PGAA 1AMOA 1P33A 4DIEA 1H5QA 4K9QA 3FKSD 3R41A 1XD8A 2HSWA 2QQEA 2ZDQA 5EESA 2R11A 4NJMA 3PNPA 1N92A 3NCHA 5C0OE 2WNIA 1E6WA 1CPYA 2J33A 1E2JA 2GO1A 4P58A 3D4IA 1SQSA 1QGAA 2DMRA 3CNOA 1XFAA 1V1MA 3O6VA 1E5XA 4MLDA 4MQBA 3LPMA 3L0BA 1Z38A 2JZCA 4HEA1 3T7CA 4D6YA 2VS1A 2RGXA 2WD7A 2KW5A 2XWBF 1GGHA 2IZ6A 3CVYA 2UUCB 1T6BY 3UAYA 2CW5A 1JAZA 5K0GA 3EZNA 3ELYA 1EMDA 3H4TA 5B6IA 3GA5A 2Z5GA 4O2LA 1CQJB 5LR6A 1RYNA 3EEQA 4ZQHA 3B1KA 2YFKA 4ER3A 1XZBA 4DMFA 2A1UB 3QF4A 1MNQA 3UFXA 5LZ9A 3FNGA 1P2VA 1E66A 5EE3A 4D0GA 2VPQA 2X9QA 5IUJC 2NXWA 1DUIA 2WVAA 3USES 1FXSA 4AIRA 3C5HA 4BO6A 3RFUA 1OH6A 5ADHA 1XEWX 1DAPA 4MUFA 5CB4A 1IBLB 1K89A 3WGTA 1CE8B 5JLAA 1FSSA 3G5MA 1V1RB 4TVOA 1GSOA 1G8PA 1GN9A 1JR2A 2A94A 1NX6A 1FMTA 3OE7A 1CUVA 5F51A 4QBTA 2OYCA 2VNJA 1IWOA 3GJ5A 1LI4A 4UUAA 4S1PA 1USVA 1N34B 1BCSA 1JG2A 1K5PA 3MOSA 2PD3A 3MSXA 5EXXA 4GX0A 4PVDA 1P5HA 3SNHA 3N2YA 1V43A 4MXDA 1DAOA 5TQVA 2GERA 3PDIA 2WM8A 2V4UA 3U2QA 3HMKA 4LBZA 3ZYCA 5IVDA 2VAPA 4FILA 3TLMA 1MA3A 4J0CA 4RTJA 3NDIA 1Z35A 3A1UA 4I9NA 1CZKA 2I78A 4PYIA 2CD9A 2QZZA 4HSGA 3SF8B 1JNYA 3D64A 1EH5A 1KP2A 1NG9A 4JUIA 3WFZA 4ALJA 1E3JA 3EYWA 5H81A 1IOZA 3PJDA 3F7NA 5FFNA 1ULSA 4QGHA 3GGPA 4TWIA 2OV3A 3VR5D 5DV9A 2FQXA 2J6IA 1MB9A 2PXXA 3D3KA 1J1ZA 5HF6A 3M81A 2J4FA 4ROSA 2V74B 4EDHA 1BQ3A 5JISA 5G53C 3DT9A 3S29A 5KWIA 4MQEA 4I99A 4DV0B 1E9DA 1JHDA 3T1HB 3EHDA 2PRJA 1QF6A 4IGKA 1DTWB 3ET4A 1GYPA 3OJXA 1W4CA 1EDOA 4IF6A 3NRJA 1CUCA 3D4PA 3T5PA 1WJGA 4V3CA 4Z7QB 4Y9TA 4BCDA 1A5BB 3N87A 5AM2A 1U2ZA 1C0IA 3IP1A 1DKOA 2IELA 821PA 1NMYA 1U8EA 5FPHA 2EHDA 1E20A 5K3EA 5INTA 3KQLA 4LFCB 3GPBA 3MAJA 2YUIA 4REQA 3I34X 3T7RA 1Q74A 1VZ3A 4DV4B 3IPAA 3AESB 4G1UC 3W8DA 1O6GA 5GMOA 3I8OA 3TGWA 4HMQA 3VVMA 1RLTA 4OI1A 4DC0A 1N78A 4GLFA 1VBFA 4P82A 1T2FA 2P6UA 4RF2A 1XNRB 2RKBA 1JIUA 1NW5A 5FV4A 1OYYA 2PLFA 1NE2A 2I6XA 4E5DA 2H59A 5JMOA 3EA5A 3P9QA 2A1IA 4BNIA 4QUGA 3FPGA 1OFUX 1RKXA 2D7JA 4B6PA 4BBJA 2PWPA 3GYBA 3TMAA 2WG0A 2G9QA 1NW7A 3UUWA 1XCMA 1QYWA 2QTHA 3BIOA 3DTVD 2OAQ1 3LDUA 3NWEA 4KK4A 4WKGA 5B2ZA 3OICA 4JN6B 4TLBA 5JEEA 4JLWA 1ZH4A 1E3SA 2C5GA 3P9NA 3TSZA 1UOEA 1JHZA 1ZN2A 3AGPA 3D3JA 3PKJA 1ZOOA 4M38A 5H68A 1CY6A 2X4GA 3H9GA 1R0RE 4JVLA 2ZJ1A 2ZSUA 4TMYA 4B4UA 4AQDA 3R5JA 2I3DA 3B85A 5LMNB 4YRAA 1ZY2A 5E4FA 5FLKA 1XHEA 2QKYA 5I9NA 1IHXA 2G67A 3NHBA 4CKWA 2F90A 5BN3A 3ZDRA 3L01A 4KR0A 2EZ8A 5A62A 4Q3AA 4HNUA 4L7QA 2VJMB 1Y3HA 3HGQA 2QN9A 2B37A 3NHYA 3NX4A 5GVRA 4BO0A 4RSRA 4N49A 2GRJA 2JHCA 4ND2A 5HFAA 4ZIRA 5A6SA 4H6PA 5B55A 6PFKA 4W5TA 1ZNQO 1OILA 1Y6JA 4XXHA 3MJDA 1HX7A 4GWGA 4JK3A 1TQ4A 4I50B 3PHGA 4ZMBA 3AB3A 3VDNB 5HZKA 4XX0A 3IDSA 3NQ41 3FZQA 1U0OC 3MPUA 4H4CA 1ISIA 1XD2A 4PNPA 4ETMA 5A02A 2J3KA 2EKBA 4M21A 2NAPA 1I5RA 4TMTA 2ZXUA 4Q01A 4JLJA 2PX8A 4E46A 1L5MA 3KUUA 3PQ2A 4E88A 5ESXA 1L4HA 2CMKA 2QTAA 4G5OA 4V2UA 1AKVA 3QU4A 1P1HA 1W49A 3ND8A 3F5MA 4LHEA 3V97A 1X1SA 3HJBA 1PEDA 1R9GA 3NRBA 2ADOA 2ZKIA 5ANRB 5EJGA 2EBHX 3UIEA 3W7AA 3P0JA 2BZ0A 1NVUQ 2IU0A 4C0QC 3AC0A 3ID6C 4W6ZA 3J81k 4Q4JA 1K2WA 4E2XA 4JGGA 2PD6A 3FNIA 3QKSB 1NSFA 3P8ZA 2D1SA 3CH5A 3I12A 3HNRA 4JC8A 4N7JA 5C8YA 1ARZA 2Y2UA 4MJ7A 2HDOA 5GONA 3HXQA 3ZPXA 3HKCB 3BFPA 1QK5A 2XQJA 4FHDA 2HNKA 3ZNPA 3IIMA 2GZSA 3B78A 4ONEA 3RC3A 4ZANA 3FRIA 1I80A 2BEJA 2JK0A 4IMIB 4AZ3A 4BASA 1XZNA 3D4LA 1X15A 4O25A 2OQ2A 1SHTX 4N47A 5EUQB 5IK2D 1S7CA 1M1NB 3WV4A 4JZKA 2X8JA 3ORFA 3H9BA 3E7FA 1W5TA 2PSDA 3KPVA 3LT1A 4YO7A 3MBIA 3QIAA 4BX0A 1ZLYA 3NR2A 3DEYX 1H2ZA 2VC2B 3OCVA 2GPTA 1WXDA 3QELB 1EE2A 1THMA 4NH0A 2FPIB 5KNBH 1E4EA 3W8FA 1KDRA 4MKHA 3I72A 5I7FA 2NVBA 4F86A 5JARA 3WZLA 4OK6A 3LX6A 1LDEA 5DT2A 3ZGNA 3ZV5A 3PXUA 4INJA 2ZIFA 4H1VA 4R7ZA 3K0BA 1T2VA 2GN4A 4N3NA 3CT6A 5JNLA 5A1TA 2A0KA 3A1VA 4Q3OA 5GINE 1E9RA 2XMCA 2ZI9A 3C6XA 2D2EA 3R1IA 4UBKA 3LDHA 3VPSA 3JR7A 1X92A 1HNZB 3PGLA 1HMYA 4WA7A 5DX0A 3L1JA 3WR5A 1J8YF 2A5LA 2QRVB 2YZNA 3U0VA 1NPTO 1PVVA 2XNJA 3WGNA 5MN5A 3K71B 3ESYA 3VO1A 3LUPA 1HM5A 1CRQA 4V0ME 5FOVA 1FSPA 2O8FA 4QBGB 1UXGA 4IEFB 4TT3A 3KTAB 3RHSA 3I0NA 5B4VA 2BUBA 4RZQA 3ZH9B 3II6X 2Z58A 2AYYA 1LH0A 1E3IA 5EEGA 5ALMA 3OCYA 2OFXA 1HOTA 1U7WA 3B52X 1PL0A 3FW1A 3HUTA 4HMOA 3JZDA 4MB0A 1EX1A 2PKWA 4O3FA 5GOZA 5AW2A 1IWBB 2PZ8A 1GT6A 1GEEA 1LI5A 3I39X 1UQRA 4F9EA 2ZQ5A 1K6EA 2I4TA 2QTZA 4M83A 2JJ2D 5BT9A 1T2DA 2ZSKA 2BGWA 5H9VA 3EXIA 3VR0A 4OXQA 5LM3A 3TW6A 1UBMS 1AGYA 1QDEA 2AXQA 4L3OA 1C8BA 1LPPA 1TFRA 1TKAA 4HFNA 1YRLA 4BFSA 3ZY4A 4TLAA 4DA7A 2XSZD 2IUEA 4YRSA 2X13A 5JMTA 2H5IA 2C5SA 3H1PA 4ZVUA 4MV8A 1CY1A 3K6KA 2FEMA 4QHTA 3GQVA 4RVHA 5CT9A 4GKJB 4A2WA 2YBEA 3FCUB 1AO3A 3BWCA 1PUXA 4C3VA 4EATA 3GVIA 4G5FA 1MA0A 4UUQA 5LC1A 1W7AA 4LI0A 2EJCA 1ORTA 3NOXA 1GV0A 4GHWA 4ZXFA 1GLNA 1XXHA 2C5AA 2UKDA 2XPCA 3PITA 4ZZ2A 5CDFA 4DHWA 3CCCA 3OPQA 3TSOA 3PC4A 9ABPA 5K8TA 1SUCA 4UTXA 3CMCO 1MX3A 1OA1A 1J97A 1CU1A 2JFUA 2VQ3A 3G6WA 3LCVB 3PQ5A 4KUEA 4Y2VA 5K6TA 2ZRKA 2VK4A 3IHWA 1E3WA 4BNHA 2X2FA 4AS2A 2EP5A 3QJYA 2HYIC 1WMFA 4CLHA 1RAEA 4KR9A 4D3ZA 3VC1A 1T9GR 2DFNA 1G8SA 2RK4A 1ULZA 3BA6A 4PGMA 3KWFA 1IY9A 4RHYA 3ICPA 5JVDF 2XADA 2VHCA 1KQNA 2IYFA 1X39A 4TRMA 4HGOA 2ACVA 2WFAA 2IS4A 4L74A 4ZQEA 4IIJA 2YINC 3G8AA 1A77A 2YWJA 3ULKA 5FI3A 1BS1A 5EJ6A 2GFQA 2V7UA 1G3RA 3O84A 3ZW8A 4NHEA 1KJJA 5KYXA 5I9SA 1NAHA 3IOEA 1T3TA 4E7OA 1ZGGA 1D2CA 1XLUA 2AD1A 3PQDA 3NWJA 3DNMA 1W4RA 1KFEB 1XD9A 2JFYA 1VHQA 3DONA 3P2YA 3K4HA 3P2OA 3R0VA 3P0HA 5L40A 2CYAA 4CM4A 4DR6B 2W7TA 1ZRSA 1IZ9A 2CC2A 1XKLA 1XTRA 2HC9A 3GCGA 3Q9NA 3HMQA 1QAQA 3LP6A 4TS4A 3PQ3A 4TMZA 1EUZA 3ZVLA 1Z2AA 3ESZA 5JNRA 4JI7B 5D3MA 3K0SA 1M6WA 3IBTA 5B3KA 2ZVQX 3I92A 3R0IA 4YCBA 3FVVA 2F43A 4L0MA 5DN9A 5EJ7A 3DKVA 1CR1A 1VLHA 2H63A 2BKLA 3OPYB 4L6AA 2AG1A 3DKRA 1YBVA 1XAIA 2QD3A 5ERGB 4LYFA 1L3IA 3CWCA 4L8WB 1DWOA 2BJHA 1Z62A 3H5TA 4X24A 2NVUA 3RJTA 4BGUA 2VDLB 3SPXA 3ROEA 4E4RA 2RK3A 4KZKA 4XVUA 3EXFB 3VNQA 2ZBGA 3QX8A 4BAUA 4BX3A 4NBNA 5FJIA 3UNXA 2DWUA 4QECA 4PXSA 2V0CA 2N75A 1ZU5A 4GR5A 3N28A 3IKVA 2WJZB 4GMGA 2J3LA 2OWEA 2H57A 4DJAA 3OJFA 4MKGA 4N48A 5SV2A 2I8LA 4LWQA 1UP6A 1RS0A 4EP1A 4OHOA 1Z0AA 4QU8A 1GZUA 3GYGA 5U4QA 4JOCA 1D0IA 1ZJZA 3ZXUB 3HFSA 3PUZA 3OE7D 3QU9A 4ZQFA 4ZVMA 3P2MA 2AHRA 3SYLA 2OSBA 3WKDA 2FUKA 3RRNA 5IUNC 3O3OB 5TARA 3M3DA 2WJ3A 3WQSB 1TU3A 2GF2A 4ZQIA 3TB4A 5K99A 4NU6A 3P9IA 4CM5A 1J49A 3GO4A 5AOBA 3W5VA 2HMTA 3MS2A 1H3EA 1N6IA 1PT8A 3PDUA 3VC3A 5CLGA 1XNJA 1QHGA 4DCOA 4D9FA 4UTOA 1D0VA 4LF5B 3F4KA 1VA5A 4JQCA 1PFYA 1ZKDA 2VJOA 2P1RA 2W0MA 4FEEA 4CF6A 4QRIA 1J8FA 2RI1A 1ODLA 3U7QB 1EVKA 5JNVA 3BSSA 3DOOA 5LP6B 3HSKA 4UAGA 1FL9A 4W63A 4Z49A 2HAEA 4MQLA 3B70A 1E1CA 2OMKA 3AY7A 3DE5X 3O75A 1Z34A 1Q77A 4R1MA 4HQFA 4UTVA 1G60A 3PNKA 4U02A 2FEPA 3FCOA 4OL0A 1TUGA 2CXSA 2YWFA 1CUUA 3BG5A 2FK8A 2NU7B 4PLPA 3H5VA 4DR3B 1M2NA 4F2PA 1RRVA 2I4IA 4US2R 3DVQX 4PX9A 4KUGA 3SC4A 5KVVA 3CF0A 1P6QA 4UM9D 1WCIB 4YP7A 2Q1SA 2I6QA 5K8LA 2BFOA 3HU2A 4GMDA 1SHUX 3M4XA 3OH8A 4MW4A 1QGUB 1SCAA 1QH0A 1JILA 4RCVA 1Q19A 3HDTA 4XPIA 4O1MA 4DSZA 1XWIA 1AV7A 2FG6C 5JAUA 1ZSNA 4GZ3A 1MO5A 3OJ0A 1C7IA 2J5RA 3IJ5A 3OZUA 1JH8A 2CDBA 3N2GB 1V5FA 4MVJD 2QI9C 1J22A 3H11B 2P2LA 3OTHA 2B7CA 3HB7A 4IYJA 3SFTA 3DMGA 3QE4A 3UM9A 1KMHA 2AFHB 5ITZA 1QRTA 4KR3A 1I32A 1SZJG 2A67A 5CH3A 2XZOA 1GNVA 4PAWA 3AYZB 5FL3A 5E3HA 1Z6YA 1L9XA 3G2MA 4C1BA 4CMBA 1Z22A 5A7GA 1I94B 4D02A 1E98A 4HAYA 3VJKA 5JSFA 4RPKA 3RLFA 3HFJA 2RCYA 3PICA 2JJQA 7MHTA 2E21A 4CHTA 3DZJA 4TMWA 4CKBA 1Q57A 3WK8A 1L5LA 5F4ZA 1JG4A 1L4UA 1UZNA 1FXWA 1E9AA 4HWRA 3PIIA 5AVWA 4F4UA 2D5BA 2C2KA 4QICA 1YR2A 2JVJA 3GQBA 4C5AA 3W5CA 3MWYW 1GQYA 3AO0B 4PLFA 4D8XA 2FWBA 3ER9A 1C1DA 1QQ6A 1W44A 4NFSA 1NZFA 2UUBB 1KMCA 1JSRA 4EJFA 2CHGA 1KQ3A 1VJTA 2GMWA 2HPZA 2VCHA 2KMLA 1SM4A 5IAAA 2O06A 1KWKA 3KJNA 1ODFA 4KFTA 3ILSA 2W6PA 3OT5A 3KOUA 5TR9A 1JL3A 4LMRA 2DE0X 3NLLA 3F73A 1ENPA 2B4AA 1U4NA 1YAHA 1XZAA 3B9QA 1EB9A 3DVRX 4CL2A 3OJCA 4C0JA 4X91A 3KJQA 1U0RA 5LQAA 5IW8A 3RJ5A 2MT9A 2B1QA 5EZSA 3L8DA 1YQ9A 1X8JA 2DUUA 1ZRNA 1B2LA 1CUEA 2QAGB 4MR9B 4P5EA 1H6DA 2UVPB 1JQDA 2D2FA 2O6LA 4D0RA 5KNDH 1QUFA 3NTLA 121PA 1UFKA 1XRNA 4CHGA 3M83A 4YBZA 4HEA6 4HDKB 1EIZA 1U3DA 2PM8A 4JUAA 4F3RA 5LZ7A 1ZHOA 4KXLA 3BD7A 1AZWA 3N39C 1OE0A 1GR0A 2RGNC 1IOWA 1JLRA 1FRNA 2XVYA 4DRXB 3A2KA 5B4TA 1FTYA 4D1YA 3G49A 3E0XA 3BMNA 1RMTA 3KLOA 3KSBC 1R10A 1SAYA 3SXPA 1A9XB 4HNAA 1XKXA 4Q4LA 2W6JA 4ALMA 1JG6A 3OLXA 3NBXX 1GPYA 1YUNA 4QPNA 4EMTA 5HGXA 4KXYA 4YI3A 2ATCA 1O1YA 4LJ6A 4J9UE 1UJ5A 1UJ2A 2NYVA 5J2UA 1ECPA 2BFEA 4XB2A 5AW7A 4LOJA 1BAPA 3KB2A 2N47A 3IKJA 4CIYA 4B3JA 3TXAA 2FDCA 3RYIA 4KPUA 3KTDA 2DUNA 2R6DA 3ZE8A 4OD0A 3IVCA 4PHHA 3SSOA 3WWCA 5A1JA 4OQDA 2OBFA 3RVPA 3G2PA 2BI8A 4MQ4A 2C57A 1DAMA 5CFMA 1ZMBA 3OOWA 1GZ4A 2ACEA 2YKGA 4PC1A 2ZK7A 2WA1A 4Y2RA 2B4TO 1GRCA 4RH1A 1ADGA 3WYFA 3WMXA 2HIAA 4ACBA 4B6EA 1GPLA 5MFPA 1F7VA 1LD3A 1X1QA 3AV3A 3TINA 4MHTA 3VKUA 4KH0A 1T91A 4AYXA 4KPYA 3IUNA 1L1QA 4BLTA 3KSUA 1I10A 1X87A 3BSWA 2IYXA 3S5UA 2PJRA 2Q9BA 1GL7A 3WNVA 1FPQA 3PK0A 4ND4A 1KVTA 1UL1X 2DR3A 4XUEA 5F7ZA 3LUHA 3DBIA 3NEPX 3PQCA 3HO1A 4HN2A 3STVA 2NU6A 3SM9A 3ZJYA 4E51A 2FPGA 3A26A 1CBUA 1NN3A 4R6XA 1OVGA 1U3VA 3QMMA 1F9EA 1FTGA 1VHDA 1XAJA 5SZJA 1TZKA 4JUDX 1I4DD 3PS9A 5JPCA 3MB8A 5L3RA 4TROA 4B32A 5FOSA 4R2LA 3QUCA 3P94A 3AIMA 2G80A 3ZV4A 1T9ZA 4J0FA 5HM8A 1VE5A 1GGMA 2GK3A 1TVKB 4A91A 3DOJA 5TV2A 3SLGA 2HFKA 2PGLA 3G7UA 3WWYA 2VP2A 1NP7A 4MPRA 2IBTA 1U7ZA 3ENKA 3SQDA 5HIJA 3U4GA 4TTAA 4TT3D 3LUCA 1TO6A 3T1NA 5JYBA 5LIRA 1UBSB 1RSZA 4U7WA 3S2EA 4DCJA 4IDNA 4QU9A 2DPXA 3VNAA 1OB2A 4Q9KA 1PSWA 4GSLA 1E6EA 5FUQA 2VNIA 4EUFA 4JC5A 3UXYA 2R8ZA 1CIVA 1X1BA 5BXYA 1DAIA 3A1WA 2M6SA 4N39A 4QPZA 3IUPA 1AQYA 2VRWA 1D4FA 1ZOSA 2DU8A 1U3GA 1GWNA 5DPMA 4AO7A 2B2NA 3JARB 3TSAA 4DNOA 4UDXX 1CB0A 2GNPA 3H5WA 4HKTA 5TPWA 2FPLA 3B51X 4R1PA 3ZV7A 1C9MA 5JZMA 1TXGA 3TTXA 1W2HA 3KP1A 3U6BA 4NAUA 1NQWA 4H27A 5M34A 1PS9A 2VLBA 4QDJA 1T5TA 5DRYA 5FDFA 4CCYA 4QNRA 4WNCA 5DM60 1XK6A 5CDFE 2CL6X 1K5DA 3OQMA 3AR3A 2R65A 3EB9A 4W5HA 1JDSA 1JXAA 2HZBA 4EI9A 3BFXA 3C39A 5B30A 3L8GA 2MDTA 3AW9A 3C1TA 4E1AA 2P1DA 1OGJA 3GRKA 1QS0B 2PEZA 4WKCA 4A6PA 3T5BA 1YIOA 2IWRA 3QTBA 4PBTA 3UPDA 5FWXA 2GXQA 2ZSJA 2IBMA 3BSYA 4RD3A 1UJ4A 1ZVVA 3LZDA 2H5EA 4R9RA 2WM9B 1EUYA 1PQPA 2V3WA 2DUWA 4DN6A 3ILVA 3D1LA 1K8ZB 2E6UX 4H3KB 3VAAA 1DAEA 1DXYA 1H93A 1QONA 1Z73A 2ZZKA 3D6HA 4LFBB 1GV1A 3KQSA 3RYHA 1YKSA 2CMFA 3JATB 1X1RA 1QQ5A 1JAXA 2BGIA 5DOVA 4C5CA 4P0QB 1T9KA 2R68A 5EWLA 5L4SA 4EY7A 1BRTA 4FWBA 4DLBA 1Y34E 3LWZA 4HO1X 5SY9A 2YV2A 1EXMA 4AY5A 1R5OA 4DIFA 4YP6A 2IYNA 2C5EA 4HD8A 4JBIA 3TVDA 1ZJ4A 3A11A 2W6CX 3TUZC 3DBHB 3ZE0B 3T0IA 1G16A 1GTZA 1XI2A 2BM0A 2JVKA 4P84A 3ZZUA 5KVAA 4TPKA 3VZRA 4UEJA 4G85A 1IMJA 3CVOA 3NHMA 2JFQA 4C4RA 1W46A 3CEAA 1LFAA 4TWBA 5DYWA 4ZAFA 4BVJA 5JYEA 3IQEA 5CD1A 2VH1A 4BAZA 1K7YA 5JNTA 4M98A 4WUVA 3SMQA 3RRXA 3S7TA 2JAPA 3KJZA 1UODA 3L7AA 3D7MA 2CCGA 4XGRA 4Z0NA 1L5HA 4UM7A 1YR6A 3KLNA 3RVJA 4AKGA 4ZV4A 3ASUA 3I2GA 3QLUA 4PFSA 1ZJYA 5AI0A 3RWOA 4BO4A 4J1NA 4XR9A 1JFLA 2TRSB 3VOBA 3AJ9A 4TS1A 3VO8A 3RVOA 4W7HA 5J4YA 2BEVA 4ZKDA 2Q41A 1C80A 3C3BA 1PHRA 2P65A 3BGIA 3L4KA 1IZ8A 1YE8A 4GOLD 1JQJC 4BZPA 4GPAA 3VUFA 2QLFA 1U8ZA 2TMGA 5IVHA 1DCTA 1ISRA 3FR8A 4U0JA 3IPYA 4PM4A 2AMJA 3LTEA 1DC5A 2AEMA 2YOGA 2P9TA 2W2KB 4IFBA 5TMPA 4JP1A 1YFJA 3G68A 3BS4A 3NPAA 1PFWA 3A6EA 1RDFA 4YJDA 2FP4B 2AWNA 1NONA 2J6BA 1NOJA 3MPOA 4ENSA 1GVNB 2GM4A 1ZD1A 4YRNA 1Y9DA 1JIIA 1G8FA 3W9UA 4U2CA 5IJ0B 2J5KA 4Q19A 1RW4A 3I2JA 2N0SA 3LK7A 5FKJA 2A9VA 4QTYA 3D0OA 4XARA 2HBZA 3D2LA 1RHRA 1P1KA 2O8CB 2TECE 2YMLA 3AJRA 4OA8A 4LISA 3H2ZA 4YJHA 1OLOA 1B76A 1NKTA 3L6EA 3OI7A 4QDTA 1ZL0A 5K5EA 3FHTA 5CJJA 4H77A 4RDXA 4M53A 2P2CA 1NURA 1S9HA 1QYCA 1KQPA 4AW9A 2I7VA 4FBMA 4IAOA 4C6RA 4YRIA 2GXSA 4QFMA 4Y1RA 4EJ2A 2AD5A 1QQAA 3BGWA 1SUWA 1LNZA 2FWJA 1JEDA 4YV0A 4UM5A 1CJMA 3X1XA 2HBRA 2NPOA 1PP4A 2J3QA 4TRNA 4A16A 4BL5A 4FBLA 2EU8A 3FGOA 4DUPA 3INRA 5CA1A 5T4BA 1OTYA 4CEHB 1SU7A 5EJAA 5CYPA 1Q84A 2IP2A 2TMKA 3ASVA 1RYFA 4FI3C 4KVGA 4PFJA 5CX4A 5WRFA 4JXZA 5CM8B 2PU5A 3B6JA 3NONA 4JYZA 1RP7A 2OAEA 1GG5A 5IXYA 4ITRC 1RZ3A 1X86B 4PG7A 1WPQA 2O54A 4UAJA 3LY8A 1P72A 2CXXA 2WJ4A 2OB2A 3IVAA 1ZI6A 4Q0MA 1T36A 2HWUA 3OQ6A 2OOKA 3LH5A 1A5TA 3BC1A 3GDOA 5DI9A 2GLTA 3LLMA 1U7HA 4Y1FA 4YN3A 4QYSA 4W5RA 3L3BA 4QO8A 5DDIP 4LCBA 4F21A 3D6MA 1KNXA 2P5YA 1ZUD1 1ZO8A 3IQDB 1KOFA 3T4UA 1V8DA 4EFLA 3IBYA 3DNFA 4KJZA 1T5SA 3FAZA 3SS8A 4HT3B 5BN5A 2Z95A 2BONA 4YRZA 1BMQA 2I9KA 1KR5A 3A4MA 1U81A 5DP2A 2PZFA 5EMJA 4KR6A 2RBGA 3IQXA 3H19A 4MR7A 5B1DA 2P4QA 3DGFC 3QFTA 1ZISA 2FFRA 5F77A 5KYYB 3UAZA 2OCXA 5HILA 3U3RA 2AC7A 1LS6A 2ERXA 5CA0F 3ZG6A 5IKMA 1T6YA 3R44A 4XCVA 3R75A 2PXCA 2FRDC 1NXOA 3EA0A 1SC6A 1KEWA 3EC1A 4OA5A 3IQIX 2XWPA 1UMKA 4OQPA 2L42A 4ZEMA 3LHKA 1J39A 4DA6A 3PPIA 2AK2A 3CEJA 4PLCA 3R0JA 3SHWA 4WV3A 4E32A 3O8LA 4CFZA 3KE9A 4BE4A 2ESRA 1XCLA 2QL7A 4GMHA 5BW4A 5CLHA 4O3MA 4GP9A 4CIVA 1BEZA 3M6AA 5C7LO 2OFFA 4U7TB 1N0UA 5JCPA 3L49A 4A1OA 3L7DA 2KSQA 3Q2IA 1QV7A 1JE1A 1M10A 2OM2A 5KI6A 4G3XA 1SC1A 4YAEA 4RK0A 5A4MS 4KI0A 1Y6GA 3GMIA 2SICE 5AVSA 3PLAE 2FVYA 1PGPA 4AXXA 1P4HA 5TVKA 3RVQA 3HBFA 1S1CA 2CJFA 2AFVA 3C7TA 3DLCA 1UPBA 2ODTX 3GAZA 1RI1A 4A82A 1M2HA 1KYVA 2BMWA 3Q5GA 4RZHA 3SX0A 1I5OA 4WLOA 2V6JA 4KZPA 1N7IA 1NFQA 3GZNB 3OHSX 5EJ4A 1LBIA 3AERB 4S05A 3DDUA 3M1LA 3HWX1 1HDRA 4RVUA 1WPGA 4I6JA 4OYRA 4NF2A 2VWPA 1CQJA 3AGQA 1KDTA 4WY8A 1N5MA 4GH5A 3ZKAA 3WYEA 3QX3A 2EX4A 1PU2A 4RULA 4YV7A 3UCEA 1G4AE 2VK2A 4JLOA 2A1UA 3SM3A 1AV6A 3EVFA 2PUJA 1FFSA 1H1DA 3IIEA 5DHUA 3T7KA 3KXLA 1OBFO 4UEQA 5LP6C 1CJSA 2OTCA 5L7TA 1FC0A 5YASA 421PA 2OXFA 3V4RA 4ZI5A 5C80A 4JQOA 2VTKA 3M9XA 1UINA 1G8MA 2B8WA 2B4YA 3BRCA 3PNSA 1V1RA 4LZNA 3ZY3A 2O8NA 1OBHA 2AHOA 3OCJA 3PJEA 1XDBA 2GN6A 1N2GA 1RRFA 5ALYA 3ZQKA 2HYDA 3FYDA 5EIHA 4FDMA 3T52A 3RFXA 2PZGA 1HZJA 1J7JA 1L4BA 3HCOA 3NWOA 4X7PA 3R2JA 3ZDFA 4CV1A 3GLFB 1J1UA 3N6RA 2NSYA 1U8CB 3UPUA 3H1EA 4MMYB 4LBWA 1XVTA 1Y6FA 4DQ0A 1ORWA 3IOCA 1F0YA 4QXMA 2IQIA 4JLPA 4Z6KA 4G0YA 3H04A 3UGTA 4KRYA 4NG4A 4GOMD 2P2DA 1FU7A 1PNQA 1KTVA 3SF8A 3FPSA 4P86A 4NU5A 1E3DA 3ILYA 3PLNA 1V37A 2W6JD 3ECSA 3I9V6 3PE4A 1UBTS 4HDNB 1QHHB 5CXXA 3FWKA 4P32A 4YMWA 4ENQA 2GZMA 1HLFA 2HTFA 2JI6A 1Z6GA 5LPNA 1IIRA 1MR3F 4O4IF 2BR3A 3VYTB 4DAOA 1VE7A 1P19A 3WQQA 4HVLA 3KT0A 1T9BA 1KWGA 4NZYA 1VE3A 1EM8B 5CURA 1JHQA 1TO2E 1OUMA 3NXSA 5FBWB 3KZMA 4N76A 4IO0A 4N65A 2R3SA 3AUXA 3CO5A 4V02A 3UT6A 1DTWA 1Y9ZA 1HG1A 2GDJA 4NBSA 2J7PD 4MKIA 1E2UA 5EAIA 3BH6A 1FRZA 4C4SA 4DA4A 4YTEA 1YDHA 1YZLA 4X90A 5DEIA 2IW1A 1BU8A 2I6SA 3WY9A 3BXEA 1SMKA 2EFJA 2J3JA 1YACA 4NR0A 2RGNA 5AYVA 2RH8A 1M2OB 3WAKA 2XIJA 4EY4A 2JFHA 5BWLA 1Q7BA 2A0FA 2SBTA 3MF4A 1WDWB 4A92A 4P54A 3ZDQA 4WFQA 2O3UA 3KWLA 4IIYA 5GIPE 1IJFA 4BRSA 2GYVA 1VHTA 3O9VA 2B6HA 1Q7CA 2ZYVX 4BN5A 2Q4RA 3AESA 2XYRA 1DRWA 4E5NA 4MGEA 3PFCA 4WESB 3VZQA 1NU8A 1WA5A 1SUEA 2ZRJA 3EZYA 3IDFA 1QM5A 3CC8A 5FTWA 3H2GA 3S28A 4R05A 2GRAA 3CH7A 1Q1GA 4Q1EA 1PFKA 1V8OA 2PKEA 2QVYX 2XLCA 3D1VA 3TI9A 2QAGC 3VPBA 4AX4A 1FW6A 2LP4Y 1K06A 4B9AA 3OX4A 3BMQB 2WAOA 4XQGA 4BJ1A 4PZYA 1D7OA 3ONVA 4KO8A 3RRBA 5KJ1A 3M6LA 2O7SA 2G1UA 3KKPA 1D1TA 4MX8A 2GF0A 1BVUA 5CHYA 2XI4A 2P62A 1IXZA 3TRKA 4BMPB 1QFXA 4MI6A 4B2LA 3HGTA 2YQ5A 1EINA 3WA6A 5LOVB 1PV2A 3S8MA 3V1YA 2PJZA 2BBSA 3T06B 1W19A 4L16A 4OQNA 4BFZA 5HUJA 4NMLA 4ARAA 3QI7A 4X65B 3DW3X 3EVGA 4DPMA 4AS3A 3CPSA 3ZU3A 4CM7A 1O6FA 4DSNA 4JMLA 1BKSB 1LC3A 4JLKA 3LKBA 5L7WA 1U0LA 4CMGA 1SIOA 2P0AA 1PBNA 3EEIA 1N75A 3HHEA 4JV5B 3FCYA 2V8OA 4OXIA 3I9FA 1N57A 2LKCA 2XMPA 4FGJA 4LGYA 3BQ9A 1SQ6A 1YZQA 1QRSA 2VJMA 3B7PA 3DUFB 2O6HA 2ONCA 3FNBA 4AUMA 1J6UA 3R76A 2FH5B 4LJKA 4N9WA 4LPKA 1ZM9A 3ZU6A 4DDUA 5DNYB 1EFPB 2BUCA 3NTUA 2ETVA 1GUFA 1P9LA 3QTTA 2O8DA 2JJ1A 3UUGA 5BSEA 3CURA 2Q9UA 4MV4A 4QOIA 5ALQA 1HE2A 2ZRHA 1INLA 1KYQA 1GNQA 1WEHA 3CX7A 3KUKA 3C45A 3EA4A 2Q2VA 5E6RB 3E2IA 2XYPA 3K1ZA 4K6MA 1W4BA 4TYNA 1NRIA 5LWQA 3WBFA 1MQSA 3TK1A 4Z51A 7YASA 5K9ZA 3NHLA 1TYCA 3TZHA 3RD5A 2G5TA 2C9DA 1YULA 1E1YA 3DHWC 3GZJA 4TKUB 4Q34A 1PNOA 2OY0A 3L1IA 4LOHA 1GPDG 3U7IA 4BFWA 3KOOA 5J4HA 1LSSA 4MRRA 1J5XA 1XRSB 5JD3A 2FI1A 3TCXB 3RVNA 5CEEA 2BMVA 2J1LA 4G23A 4HX9A 1L4YA 3QZUA 4FCWA 1Z5ZA 2FW6A 4DG9A 5SY6A 3U5TA 1KGSA 3X1ZA 2ANCA 4Y2YA 3QKSA 3DXYA 3VYUB 1FRQA 3O93A 1XNHA 1I9GA 5GZ6A 1NUHA 1JHPA 1WNFA 2JASA 4M54A 4DDVA 3K15A 1GZ6A 4XWAA 2BH2A 5EUMA 2I4NA 2VFAA 3QU7A 3W4IA 3ZLBA 1QVVA 2FF7A 4KIJA 1G8JA 3NNNA 5LDHA 2XOXA 1YQDA 1RAGA 2BT4A 2XCUA 4OJMX 2QGNA 1EDDA 1H4TA 3GC6A 3SD7A 3UAXA 2RGEA 1M1NA 1D6SA 1FUEA 4B8WA 2IHBA 2OM6A 1G0NA 2YC2C 3C3EA 4ZHSA 2Y71A 4TL8A 3CUEF 1UWVA 3RGGA 3EQ7A 3ZGXA 4EKEA 2IC5A 2E4WA 3G1WA 2OO7A 1M6EX 1Z5VA 2IEZA 1P7ZA 2X14A 1Z37A 2O14A 3QELA 5E1DA 2FPIA 2J32A 1B93A 3K9WA 4E4YA 3ZDCA 1SG6A 2D62A 2I65A 3JZAA 1E7RA 1B6RA 2PKXA 3FHJA 3G2IA 3JQ6A 1YQGA 2JJ8A 4L3VA 3TEMA 3WK7A 4DCCA 5TS3A 4DCGA 4ANFA 4A15A 1GZVA 1JIJA 2X8BA 4HYQA 5A9TA 4BGVA 1JFVA 3KFLA 4LOAA 3OC0A 2WP8J 1G2OA 1ZUIA 3IDOA 3ILHA 1QNLA 4PQEA 2QRVA 5TJHA 3TQSA 3SJ7A 5H02A 3H4IA 1YJAA 4D7AA 2HEIA 4DQLA 2HCRA 4OH7A 3KVRA 3M8KA 3T9FA 1RM0A 1LX6A 1W1WA 1EK6A 2Y6UA 4QUJA 4TXLA 2ILTA 4XW2A 3VU1A 4BBPA 1X2EA 4E13A 1MF7A 3FMFA 3KTAA 4JXXA 1G3MA 1OFTA 3KUDA 3HJTA 4NCHA 2GUGA 3A1NA 3HVJA 3S7ZA 4G81A 2Y9PB 3BIXA 4NRDA 3T35A 3DZIA 1RWPA 2J3IA 3BCHA 3VPXA 4G5YA 1RXEA 3PRJA 1C9EA 2DKFA 2VRNA 3FTPA 4MIEA 2EAUA 3G3EA 3HXPA 4P2GA 2G83A 4XUCA 3CCBA 1JHVA 5LYYA 1QOQB 4F5ZA 2J7KA 2QTBA 3IOYA 3C43A 4CCAA 3IXMA 1ZGHA 3MMXA 4LSMA 4E3ZA 2BSQA 1TKCA 1V26A 1TF2A 1QV6A 1PGOA 3GLRA 4MRPA 4WXMA 4LA4A 1T2NA 1DAGA 3M7IA 1T8PA 4W1PA 3MMPA 1YZVA 2WTNA 2ZUCA 4M1ZA 3THYB 1Q14A 3OT4A 4FS3A 2A6PA 3EEOA 1ZN7A 2I5PO 3GDGA 4W9RA 3QLEA 1A2OA 3HC7A 4IZ6A 3PUHA 4RENA 4Y6QA 1PZGA 3HO6A 1OIVA 4ZO8A 1E61A 4EX7A 1YMQA 2BEKA 1OF1A 1FFHA 3ITKA 5D87A 3OQHA 4R98A 4FR5A 1Q0RA 2NUBA 3R24A 4FJ0A 4JFRA 4JIMA 2OORC 2CUKA 1KMIY 2XUGA 3D8BA 2B0CA 1DG1G 5EJ2A 4AKHA 4DOMA 4CKYA 4LJ7A 4ZI7B 4K81B 1EGQA 1RAFA 2YHBA 3H87A 1G7SA 4MQMA 5AVYA 2B6NA 5G40A 1R66A 1IJBA 2I62A 2F1HA 3LKZA 3SBOA 1WY5A 5H70A 5IS2A 3LAWA 4HDCA 4ZI3A 4RTSA 3MWDB 1XZ8A 4KWHA 3MYYA 1DQRA 1T6NA 1HDXA 4G9BA 2AZ4A 1WSAA 4UHBA 4Z4HA 1F1JA 3C6QA 10MHA 1I3KA 3ZY2A 2X7XA 2PG3A 1A8SA 1DO2A 2PIAA 1E7YA 2C31A 2FP3A 3MT9A 5ENVA 2FZGA 1SD5A 1F6BA 2QLLA 3BULA 3QLVC 4Z7OB 2BKEA 1Z33A 3UAGA 1EM6A 4LAFA 1BYUA 3QJGA 3U9SA 4TZ6A 8ABPA 3NM6B 5DI3B 1EGHA 3AF4A 1V2HE 3E7XA 4P5PA 3M5CA 3ZWVA 4DNFA 5HM6A 2X7JA 1U8FO 4G4SP 4PYRA 4WLNA 4FB5A 3JSXA 1JU4A 1YF3A 1YCFA 1ZM3A 1Z63A 1OX5A 2RGCA 3AX6A 2E3JA 2OCPA 2QPLA 4FLMA 4KKXB 1MVLA 5IJZA 1MW8X 4CN9A 2Y99A 4MA4A 4EY3A 3S8EA 4FYPA 4FM9A 1EZZA 1XP5A 3OF3A 2Z2YA 1JKJB 1RI4A 4XQ9A 4KNVA 5IHXA 1XYYA 3FJYA 5E4YA 4EB3A 3KCQA 3WWPA 3PA6A 4HAXA 4QGAA 2IE8A 2EBWA 1HTBA 1M5RA 2DC1A 1A4UA 1LBSA 2GCEA 3UOGA 1L1EA 2HGSA 2OVBA 2ZSAA 3AEZA 3FDZB 3N58A 2NADA 5E3IA 3GFGA 2PSSA 1WMAA 5LXTF 4U6SA 3TLYA 1K3TA 1Z5PA 3OIYA 4LXUA 3UHPA 1WTAA 3UH1A 5IT5A 3SQOA 3BL5A 5A4IS 2YHUA 4U00A 4ZYVA 3KETA 2VHTA 3E3LA 1CY8A 2M32A 2WKWA 1EESA 1OSNA 2FYTA 4D4JA 3FTFA 3OPYA 3W79A 4DG8A 2DH5A 2BKVA 4YAKA 2IYWA 4W5JA 3K0AB 3Q7EA 3GT7A 4F12A 2UYHA 1VMKA 2FF5A 1QYXA 2OBXA 3DO6A 3EXFA 5BMVB 1NU6A 2WAXA 3A6KA 3M4NA 4EPWA 1JLMA 3BB4A 1ZCAA 3M34A 3A2LA 3CNNA 3BWMA 4IW3B 1GFWA 3TQOA 3ETDA 2W5UA 3R3YA 2OXTA 3D5EA 3GOQA 4LI3X 2FFBA 1AF4A 2R6GA 4FZ5A 1UBLS 4OJNA 5ALUA 5A4FS 4NLLA 4N8EA 1CYDA 4G0NA 1XTBA 1K3FA 3HKBB 2WUWE 2WY2D 5K4GA 4IHQA 4ZREA 4NBTA 1SBZA 2WPDA 2OE2A 2O23A 1X77A 1BZYA 1I2MA 1EXDA 1MUUA 4HB2A 5I48A 4WEQA 1OWNA 2W6IA 4RC9A 2CZQA 3HRHA 4F0JA 3DAGA 2WVJA 1OZGA 2YMMA 5BW6B 2HUPA 3DQQA 3WNCA 1PGNA 1A2KC 2ZRQA 4BNJA 2UZ3A 4NS1A 1M6NA 1V9CA 1S96A 2ZREA 3E9CA 1XPOA 3OD1A 2NO4A 1V5GA 1QHIA 3E5RA 1CNMA 4FD2A 4FE4A 3OIUA 2ZS8A 4KYVA 4WFKA 3U7QA 3UGQA 4E5KA 5J4LA 5LP6A 3SHQA 1V11B 4OHRA 5FD8A 4RGVA 4WX2B 5E38A 1EP1B 2WSIA 2I80A 3T3NA 5LBUA 4F4CA 1IBMB 1A9RA 5JS6A 4D4LA 2P6RA 4EO4A 1XDUA 3L05A 4FJ1A 1YOBA 3X2SA 1M34B 3MMNA 4RKFA 2YJZA 1QPZA 1YGYA 1WCIA 2DPHA 3KQYA 3TD9A 3ASZA 5M3BA 1S2DA 2GK4A 2PVSA 5SICE 1L5GB 2ZUTA 4DEXA 2D5LA 1QGUA 4A4DA 2Q9AA 4ZVTA 2EGUA 1KO7A 1RAIA 3VYWA 3SDSA 3ZEIA 4ICIA 2BYTA 2OQIA 3VGJA 2D3TA 2P6OA 2H4JA 1R9JA 2MWMA 3HH8A 4YPFA 4EENA 2XUAA 1KQOA 2PBFA 3NJ4A 4JJEA 4DPKA 3KAKA 4YX9A 4TLLB 4WN9B 3IALA 3N2GA 3WLPA 2PMWB 2PSFA 2DJIA 3H11A 3HV0A 5BNZA 3DFMA 4AZTA 2PK3A 4CNBA 5CPBA 3VYRB 2A5YB 5B7NA 3ADBA 2AFHA 1PL6A 1N7JA 3Q87B 3FPCA 4U7DA 4B3RB 1AC5A 2GBIA 5JHHB 3ZDYB 1NVDA 4M7PA 5TY0A 2VXBA 2GJSA 3ZNQA 2XZPA 3PFKA 4JOBA 1UJBA 4L1KA 4DR7B 4UHFA 1VKNA 3K53A 1PX2A 4YAGA 4V1CA 4GRIA 3AQIA 4IPTA 1RKUA 1UZAA 1YRHA 2Q3MA 2Z83A 4GR4A 4H1UA 3I2HA 4JR2A 3U40A 3W8EA 4F93B 1LLUA 2NUAB 1KOGA 1RLJA 1VG0B 1X1EA 4J0KA 4BIIA 1TLLA 1W35A 1RPNA 3L93A 4BNFA 1TX4B 4DEVA 3L7BA 3QPWA 1KEUA 3ROFA 2H7XA 3KVNA 4EJ6A 1A1VA 3EGXB 3TTWA 2BSAA 3WYNA 1RFLA 1R9NA 2A2ZA 3FB1A 2IZZA 3OCXA 4QHYA 3ZHRA 2J9FB 3G2LA 5CVVA 2QTMA 3LYLA 4ADSG 3MVEA 2PNFA 1KC1A 4WHMA 3VGPA 1CEEA 2FFQA 1JPUA 2BHSA 1F51E 4D56A 5IN4A 2I1QA 4K03A 4BYMA 1EWYA 4RAQA 3DF9A 3UWSA 3JSAA 3EPLA 3GFBA 3RAGA 1B15A 2ZI7A 3CTPA 2I3BA 2OCDA 1WTCA 1E2BA 3EXG2 4YFYA 4EAQA 4OG2A 5DNDA 1L8LA 4RO0A 4X7BA 5FBKA 5LUBA 1PZXA 3CBGA 1EFUA 5HNKA 1KO8A 1PR0A 2CCJA 2WHPB 3H65A 4HFMA 4M1SA 2QAGA 4MR9A 4WOBA 9GPBA 5DNUA 2UVPA 4GVXA 4KHPB 2IHUA 2NUTB 4ZVQA 1XMJA 1B8UA 2X6TA 4E2FA 1E2NA 1OLSA 2XHEA 1H5UA 4QEKA 3CV3A 2JJ1D 5DLYA 1J8VA 1JYFA 2B20A 4DBVO 2COKA 4L9RA 5HYVA 1C30B 4I3FA 1YR7A 4LK3A 1FUIA 2VPXA 1O3YA 1UPUA 1JEJA 4L9AA 4JCOA 4JEMA 4DRXA 3W5JA 1WP9A 3ZVRA 4ZALA 3UK1A 3IQZA 1NC3A 4LRUA 4YYZA 1UEXC 1A9XA 2VL7A 5H5JA 4ZYXA 4BLSA 2A5JA 4A73A 3MJTA 4M1KA 1ZJ6A 2R1ZA 5D6NA 1URPA 5C4IA 1TTQB 3IDQA 2YV1A 2DQ4A 3E27A 4M86A 3M4YA 2FOXA 2ID7A 1B8OA 1DKNA 5EHNA 4Q18A 3V7UA 4URUR 1ZIPA 4WLFA 1OXMA 2O4UX 3O8BA 3MM4A 4ROTA 3HR7A 3NC0C 1X7ZB 4YRTA 4AYWA 4MV3A 3SEZA 1SVUA 1OXTA 2DWPA 4WXYB 4LNUB 4UXJA 4R51A 5AVOA 1QGDA 3N70A 1NYRA 3F9IA 2Q3EA 4X8LA 5LQDA 3KWJA 3NDJA 4KIWA 3LQ2A 1B1CA 3D59A 5ERXA 2PV7A 2XR1A 3OA2A 2E1RA 5FUMA 4Q1DA 3E22B 3INTA 3MJEA 1KH3A 2R2AA 3AEQB 2I4LA 5HBGA 4LYDA 3ZVNA 2E49A 2FZKA 1Z4PX 2O5VA 2J9ZB 2NN3C 2Y0CA 4PN3A 1PJBA 1COZA 3WK9A 2A8YA 4R2HA 5EP3A 4FHFA 5ADUS 4YJ3B 3D3EA 2QRPA 1JEAA 3ABOB 1DBPA 4M87A 1E62A 3PIRA 3BT7A 4YIHA 3EQZA 2ZEJA 3QPBA 2FZ4A 4MWCA 5H0IA 3NDPA 1HC7A 1G38A 4OU4A 4L51A 2YCBA 3C98A 4ZA2A 5IAGA 2EZTA 3G9ZA 4CETA 2BTEA 4K6GA 4LYEA 2YFQA 2IA5A 2HD4A 2C3UA 3EH1A 5DASA 3WB9A 4N7MA 4AIIA 5U4XA 2HF8A 4AMYA 4ZP1A 2DPLA 5IBRA 3THOA 5LQSA 2EKDA 4J0EA 3TLBA 3DD5A 2XH8A 4G97A 3TL3A 4QQRA 3OZXA 4RTOA 4RVGA 5EIXA 4YRQA 5F76A 2CJPA 2IK8A 1SELA 1JE0A 3JW8A 3SKVA 4B4OA 1XU9A 2YY7A 3EIOA 3HNPA 2R62A 1L5ZA 1T35A 4WNIA 4IS3A 4IRUB 5T7BA 1HBJA 2RG7A 3BN3A 1OZAA 3RIEA 1UDCA 3X0DA 3LUDA 4Q4DA 3I4FA 1MOPA 1PL8A 1W25A 2C4NA 2Q5HA 2XGGA 4I1RA 4J3FA 3RBZA 4DQUA 4RKEA 5JJCA 2QT9A 1X8LA 4YRFA 2YVKA 2NIPA 4OQLA 5IBQA 3VHQA 4INOA 2VYQA 4RHFA 3W04A 4MEBA 4PINA 4XZ3A 3QPUA 3T5CA 4BJHB 5AKGA 1WL8A 4I1IA 3L1KA 1QX4A 3G0CA 3H1GA 1KJ8A 3HDGA 3LVFO 3P4UA 3T3DA 1N6OA 3UEOA 1NWHA 5I6DA 5JYCA 4TYQA 2OR3A 1QS0A 3QE0A 5FB3A 1A8PA 3ZWQA 4BUZA 1LZKA 1Z26A 1T15A 3O4FA 2I1VB 2AS0A 3IEVA 1EWQA 3DWFA 1OWMA 1JQKA 4NBKA 3P0FA 3EPHA 1SY7A 4QJ3A 2H4ZA 4MWOA 1ORVA 4OLJA 4IH1A 4KMSA 4OHYA 5FWYB 5AW0A 3DJYA 3OO1A 2QRQA 1YJCA 2ZCUA 4K87A 4XWWA 5A06A 3ABZA 4NWIA 3JATA 1UC5B 4BAGA 3QKIA 4IIUA 3KHKA 3N8DA 5H8WA 3GLKA 3PEWA 2YRXA 4HC4A 4RFLA 1QG4A 4IBOA 1USGA 4O5OA 5KIAA 1NR5A 4QATA 3RC7A 2Q2OA 4WW0A 4CG0A 2WAAA 3ZJTA 1ECCA 3DMRA 3DL0A 1IAVA 4YCCA 3FPFA 1EWTA 1SBQA 3N2KB 3HBJA 4D97A 5CCEA 4NIMA 3W2FA 1CZOA 2ZANA 4EF6A 1ZI9A 4EGQA 1JA9A 4I9UA 3U4QB 3NHWA 3L0DA 3EVNA 1FNBA 2BFBB 3K9QO 2OORA 2XJ4A 3GEBA 4X1IB 4F8YA 3KAJA 2IT1A 3EIEA 4HV4A 1DC7A 1CEXA 4J6EA 1T3SA 2VHYA 3VNSA 5CAEA 4HN4B 2XCSB 3OY7A 2DVMA 3KHSA 5T4HA 3IUMA 2H1LA 1IZYA 3BSFA 3G0HA 4JEUA 1PTJC 4YONB 1XBTA 1FNSA 2ZPUA 4BQIA 4YPVA 4Z4FA 1XR3A 1Z2CA 3DDCA 1P7PA 2JLUA 1RWQA 2W2PA