2TMYA

Chey from thermotoga maritima (apo-ii)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
118
structure length
118
Chain Sequence
GKRVLIVDDAAFMRMMLKDIITKAGYEVAGEATNGREAVEKYKELKPDIVTMDITMPEMNGIDAIKEIMKIDPNAKIIVCSAMGQQAMVIEAIKAGAKDFIVKPFQPSRVVEALNKVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHEY PROTEIN
publication title Crystal structures of CheY from Thermotoga maritima do not support conventional explanations for the structural basis of enhanced thermostability.
pubmed rcsb
source organism Thermotoga maritima
molecule tags Chemotaxis
total genus 40
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 1997-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2tmyA00
3IP7A 1QNLA 3JTEA 5HSGA 2FN9A 4RU1A 5TPWA 3RQIA 3N0WA 3DGFC 3KSMA 4M88A 6ABPA 1YTUA 1B00A 5JNWA 3H6GA 1QP0A 4MQFB 4KPYA 3Q9SA 4MQEB 1USKA 3BRQA 4L85A 5E3JA 4YR7A 1YK1A 2IPAB 2PMCA 4B09A 1EAYA 2FEWB 3F6PA 5JNVA 3C3MA 4EYQA 2FQYA 4RKRA 3OQNA 3E3MA 4F12A 3HUTA 5EWMB 2QVGA 5B3JC 3N75A 4Y9TA 3RVJA 2IKSA 4MGEA 2QZJA 3H5WA 4XAQA 1YMVA 4PE5B 5T3YA 3TB6A 3VNAA 1JFVA 3M9XA 5TPZA 1MIHA 4MQFA 4MQEA 4KVFA 3OM1A 4UHJA 1NXTA 3QK7A 1JL3A 2A9PA 5PNTA 3URMA 1FFWA 1GCGA 3EQZA 5EWMA 3N0XA 2V0NA 4JP1A 4Z9AA 5C5EA 3CHYA 5KC9A 3HDVA 1DCFA 3TX6A 1KMIY 4NCBA 4N47A 1XWWA 2I6FA 4RK7A 1QO0D 4W5RA 2MYPA 4YP9A 1TLFA 1XHFA 3K4HA 4LE0A 5CNKA 3UK0A 2PUAA 3KCNA 3DGEC 3RVRA 1D4ZA 1MAVA 1U2QA 3BILA 3IP9A 1YS7A 2QSJA 3FFTA 3GT7A 2GWRA 4MR7A 3LUDA 3MIZA 3DLHA 1JDNA 1ZH4A 1ZGZA 3NHMA 4H60A 5IBQA 2FMFA 2JB9A 3T6KA 5DCLA 4F06A 5FBHA 2OQRA 2JBAB 3IP6A 3RVLA 5BRAA 3KHTA 4G0OA 4EY3A 4EUKA 3CRNA 3IDOA 3KJXA 3OLYA 4O5AA 2FW0A 4H3KB 1D5WA 1NXOA 2HPHA 1Z17A 2NT4A 4RK4A 3HVRA 4RK6A 2MSWA 4G0ZA 3JY6A 4QYWA 5C5CA 2WJWA 4MR8B 1DRKA 3KS9A 2PLNA 1EWTA 1JYEA 5IC5A 3O1HB 2R4QA 4RXTA 4D6YA 1GLGA 4F11A 3A0UA 4YRZA 2JBAA 4IILA 3NNNA 3O2QB 2LP4Y 3OLWA 3F73A 4Z4FA 3EAFA 1ZN2A 3D8UA 3TMYA 1GUBA 6CHYA 1IIBA 5F64A 1GCAA 3FFWA 1P8AA 4HNQA 4EYKA 1BDIA 4JA2A 4MR8A 2FEPA 2RJNA 1KRWA 1JX6A 3H1GA 5I4CA 3QEKA 3VNBA 2IPNA 3P9YA 4MAAA 2QXYA 5IUKC 5HM6A 4IGAA 2HQBA 5EWLA 3GL9A 2QV0A 1AB6A 5KQMA 2PKXA 3N0RA 1A2OA 3K9CA 4RXMA 3C3WA 2E4ZA 2MYTA 3OMWA 4E7OA 1ZESA 3A0RB 3SQNA 1BAPA 2ID7A 4OBBA 1M2FA 4RY9A 4ZMSA 2HSGA 3M6MD 4OG2A 3NNDA 3Q15C 1ISRA 1I3CA 4RZSA 3O74A 1A04A 2FLWA 4YS6A 4ML3A 5FWYB 5TE9A 4RY8A 2FMKA 4NQRA 1E6KA 4LE2A 4FE7A 4ETIA 3KTOA 3CG4A 2L19A 1EFAA 2HJ9A 4XFKA 4HNRA 3OLZA 3JPYA 3HDGA 4WT7A 1JDPA 3H5IA 3O1IC 3RVNA 4Z4CA 3OO1A 4WXEA 1DP4A 3HCWA 1QQBA 1RPJA 1APBA 3KKEA 2L2QA 2AYXA 4EVRA 1PEYA 2FKAA 5EWJB 1YS6A 3ROFA 1RZRA 2JVIA 2IYNA 3F7NA 4O1IA 4G0QA 3N53A 4OLBA 5FWYA 1P2FA 1VRVA 1YIOA 2WJAA 1DZ3A 3F6CA 3DBIA 4YCSA 5IX8A 2H0AA 1C0EA 4JB2A 3QLVA 5TPZD 1ABEA 1ZH2A 3CKMA 5TQ0B 3UKJA 3MYYA 3IPAA 5IEBA 1PEAA 2PL1A 3GRCA 1K66A 1W9HA 1QMPA 3S99A 2Q5CA 3NNSA 4GNRA 4ZMRA 4Z4HA 3G1WA 5EWJA 3T8YA 4G0XA 5TQ2B 1KRXA 3QEMB 5D2CA 2W42A 1ZAYA 4DADA 2F8TA 1QPZA 3HO1A 1K68A 2O20A 1F4VA 3TD9A 1MB3A 3E61A 4D6XA 4MR7B 4MPTA 4ZPJA 3HEBA 1JBEA 3FGZA 3QLTA 2LBPA 2R25B 3CNBA 3EQ2A 2X7XA 3EDCA 5TQ0A 1S8NA 4MS1B 3MMNA 1Z13A 1ZVVA 3GV0A 5DLEA 1EWVA 4H3HB 4W5QA 2PUEA 1ZHHA 1ABFA 3LTEA 3HUUA 5DGCA 4RSMA 1OXKB 1VKRA 2FTKE 3CLKA 3Q7SA 4MR9A 2WB4A 4RXUA 5TQ2A 4Z0NA 3QEMA 1CYEA 4KQ9A 2PUCA 1NXWA 1U2PA 2QW1A 3H5LA 4ETNA 5FWXB 2FMIA 4JB0A 2VK2A 3HK2A 2E4WA 3L6UA 3TO5A 1CHNA 2VYCA 5BRJA 4IMJB 4Z4EA 4MS1A 5IUNC 3I5AA 2IPLA 2E4VA 1ZITA 4O1HA 3O21A 5JNRA 2E4XA 1Z25A 1TMYA 4HYEA 3RVPA 2QR3A 2PUBA 1FFSA 3OM0A 5FWXA 1DC8A 1FSPA 3CZCA 4QYMA 5BR1A 4Q7EA 3ILHA 3JS5A 3MM4A 4WWHA 2B4AA 2J48A 3FDFA 3A10A 1Z2DA 2XDYA 3N8IA 5GQSA 3HZHA 2RGYA 1E6MA 4N0QA 4GPAA 1NXPA 1A0OA 4LZLA 4F8JA 1M5TA 3LFTA 3LOPA 5EWLB 1PNTA 3BRSA 3LUAA 3EODA 2PUGA 3C3KA 2WWVD 5JNTA 1F51E 3QELB 4LDZA 4RK5A 1VLZA 1TVMA 3RVMA 4P1ZA 3O2JA 2A9RA 1HEYA 4G86A 1DCKA 3C97A 3CZ5A 3QLUA 4OATA 4PZ0A 3I42A 4PICA 1BVHA 2QU7A 1MB0A 3EGCA 1D2AA 1LJLA 3CFYA 3UUGA 1ZY2A 4CBVA 3LKBA 4YV7A 4N03A 4KZKA 4TLMB 4N76A 3QELA 1NXXA 3KG2A 3H75A 1BDJA 3QX9A 1E2BA 4G97A 3CS3A 4XARA 1EHCA 4Z4IA 1UDRA 4Q6BA 4RDCA 4ETMA 3Q7TA 1NXVA 2CD7A 2HQRA 3QLVC 3FFXA 4LE1A 2MSLA 5JS1A 2FSPA 4XLTA 2CHFA 4IF4A 2RJOA 1JHZA 1URPA 4TN5A 1ISSA 5CHYA 3BREA 1M2EA 3EULA 5ED4A 3SY8A 4EVQA 3W9SA 4LDAA 1RZRD 3OO0A 1BDHA 2P4UA 4KV7A 5CNJA 1JFSA 1DRJA 2M1ZA 1SD5A 2P9HA 4TMYA 4G0PA 4EGSA 2JVKA 3L49A 4IRXA 9ABPA 2GI4A 4JASB 2R48A 2FVYA 2BGGA 2HQOA 2M98A 2PJUA 4W5OA 1D1QA 3EJWA 4NCAA 1M5UA 1TJYA 2L18A 4RKQA 4MLCA 4MS3B 4S04A 3GWGA 4JAVC 1OXBB 1XHEA 2F8SA 4WUTA 3HS3A 3OMXA 4Z99A 5KQLA 2CHEA 2PUFA 4KNYA 5HKOA 4MRMA 1JF8A 1FFGA 4N0PA 2GBPA 3GBPA 2PUDA 4FB4A 3OQOA 4WXMA 4FE4A 4MR9B 1RNLA 4L4UA 5KC8A 1SXHA 3LMKA 3NHZA 1JWLA 4MLDA 5JNSA 1SXIA 3T38A 3Q7RA 2LIVA 2E4UA 2VUIB 2WMYA 4MS3A 3RVSA 2AYZA 3CTPA 3SAJA 1MVOA 2JK1A 1SRRA 2FLKA 3T95A 1PHRA 4ZYLA 4UHKA 3I45A 4E7PA 4Q6WA 1QP7A 4OLAA 5JNUA 1VPWA 3R0JA 1GUDA 4XASA 4DQDA 4KFCA 2N9UA 2FQXA 1P6QA 4JOQA 5KI6A 3HM9A 1JH9A 2PAFA 3H6HA 3RVOA 1EWKA 4RV5A 4KK3A 4S05A 3ILYA 2JCGA 1RXIA 5JS2A 4NV3A 4KQCA 3HV2A 1SXGA 4W5TA 2NZVG 2ZWMA 4QPJC 4ZJPA 4EYOA 2B1JA 2QVCA 2YHAA 4QICA 1NTRA 7ABPA 4WZZA 1DJMA 1DC7A 4KREA 1QQAA 1H9CA 2MSKA 3QLUC 1YMUA 3LUHA 2IOYA 4Z9BA 4MYRA 1NATA 3LKVA 4KRFA 2FN8A 1YK0A 4IMIB 4RS3A 2CWDA 4P98A 4F3TA 3HJFA 1YVUA 1LBIA 2DRIA 1FQWA 5IUJC 4RY0A 3CU5A 2RDMA 3H5OA 2YHBA 3JVDA 3A3KA 2JRLA 1PUXA 2FQWA 3D02A 2TMYA 5B3JA 3HXMA 4EVSA 2L17A 3KYJB 1TM2A 4NICA 3FMVA 5T7BA 1QO0A 5IULC 1PNRA 5CNMA 3LUKA 3H5VA 2PE5A 1E6LA 5GOTA 3LUJA 2LPMA 2MYNA 2PL9A 1JLKA 2VUHB 1D1PA 2MYUA 1BA2A 3I09A 5BQ3A 1USIA 2NZUG 3DZDA 5KQPA 1QKKA 4LRQA 4XXHA 3KYIB 2WY2D 1LBHA 1C4WA 1U0SY 1ZGGA 4PEVA 2IDMA 3MA0A 2E4YA 3O1JC 3N6VA 4N41A 3JVIA 4RK1A 2FXIA 1DBWA 1Y1LA 1P6UA 4D74A 4TLLB 3M9WA 1RXEA 5CNIA 5DTEA 1DBPA 3SM9A 5TQJA 5KWSA 2FEKA 2A9OA 3NBMA 3QX8A 1WETA 1KGSA 2KYRA 2WRZA 3MQ4A 2FMHA 1NY5A 1L5YA 3O75A 3GBVA 4DN6A 3OQMA 3KLOA 1LK0A 3LUFA 5FBKA 4OTZA 2NUBA 3Q41A 4W5NA 1DBQA 3HSYA 2H3HA 3ROTA 3RVQA 8ABPA 1CEYA 4KK4A 3H5TA 4MS4B 3O2SB 4EYGA 4KMRA 2R47A 4RWEA 3H1FA 1L5ZA 3RVKA 1AB5A 3DLBA 1DCMA 1ZDMA 3LUGA 1JYFA 1R8JA 5ABPA 3B2NA 5KQGA 3OLXA 2NT3A 3SG0A 2LUOA 1NXSA 1U8TA 3H1EA 2ZAYA 5DKFA 3GYBA 4LX8A 4YGXB 2JVJA 1JFTA 4MRMB 1T34A 2IPMA 3JPWA 4YWHA 2GX6A 1U04A 4RK0A 1Z18A 3G85A 1DG9A 5TPWB 3IPCA 4MS4A 2ID9A 3KLNA 3LUCA 3OLVA 4YLEA 2GKGA 1Z2EA 1Z16A 3IP5A 3GA5A 4G0YA 4Z4GA 4PYRA 4G0MA 4HNSA 3RH0A 3C6QA 1Z26A 1Z12A 3MF4A 1USGA 1W25A 1QP4A 1LJUA 5IEJA 3BBLA 1J56A 2A9QA 5HQJA 3SNKA 3CG0A 2OENG 4YO7A 1Z15A
chains in the Genus database with same CATH superfamily
3IP7A 3LT5A 2XB2A 1MO6A 5AVKA 3P45A 2NV2B 3C7TA 4DANA 5LPNA 4JWTA 4QUBA 5I5GA 5BXYA 1D4OA 1X7DA 1S2LA 5K3DA 2WDPA 4E4YA 4MI9A 1EWRA 1H4VB 2DAPA 1E1LA 1NBWB 5BUSA 4OOEA 5KNBD 8LDHA 2Q4DA 4QPZA 2QMOA 3I01A 4NOKA 4MP3A 4DCCA 3HY4A 3ABQB 2IHYA 1US8A 3FSRA 3SD7A 5L3QA 5HVNA 2AKEA 2WR8A 2LRHA 3EXHA 3WR5A 1XT6A 2VK4A 4NZNA 3C3MA 5LLTA 1Y7LA 3ELBA 3GFGA 4H3SA 1ESNA 2HT1A 1YZLA 1C9MA 1X42A 2ZRIA 5A3QA 1TW2A 1NZFA 3JYOA 4HWGA 5A03A 1YB2A 1G38A 5CJPA 4KAJA 3AV0B 3Q5DA 3RG2A 1OYVA 2BFMA 1DT5A 1FNSA 2WVHA 1KY5A 1ISGA 2JIDA 3EGXA 3I39X 4GBED 4OI2A 4UZFA 5C31A 1TVKB 1U6IA 1ODLA 2GYWA 1E9BA 4KBGA 1C9NA 2WK1A 3OVMA 1XRNA 5DM60 4CVNA 2V7QD 3K20A 2JFYA 5LXTF 3GRZA 1DDIA 2NVUA 4XWWA 3L2OB 1C7ZA 5EWMA 2GR9A 3R5SA 2V0NA 4ZO7A 5C5EA 4P7BA 3F6SA 4A23A 5CX4A 3DNFA 3FBGA 1FPMA 1GHTA 4JJEA 2DR0A 4WK2B 2NPFA 5I7UA 2WVAA 1H0HA 3MTJA 1YCDA 1KMHB 1T13A 2WM9B 3E1KA 4A0HA 3IDFA 2R6FA 1N5MA 1PFQA 1YQGA 2YS7A 4MUXA 4Q3EA 2I71A 3ZYZA 2GF0A 2YIMA 1O97C 1JIVA 4R8MA 4HAZA 3T7TA 3ZNPA 3WRYC 4BMVA 4D3DA 3QTLA 4HQ0A 4FR5A 4OXKA 4BZXA 2I7TA 3U3OA 3A31A 1ZGZA 3IV9A 1E0JA 1KFEB 2E7ZA 2FKNA 2NPIA 2QQ5A 4TMXA 1EXNA 1ZIDA 4I55B 5TS3A 2J5RA 3S2UA 3W79A 3RARA 4CQMD 1MIOB 3U3DA 3L4KA 1NN1A 4WZBB 4CFZA 1II8A 1QORA 2YMLA 3GY0A 1F48A 4ZVKA 5A5DA 3KQNA 1IWPB 2XRFA 3ZGYA 4ZZIA 2FEMA 1E2NA 3IDOA 1YRQA 1FQJA 4PCAA 3ZY6A 3MG9A 1J42A 1D9XA 3PL1A 3QP9A 4XWTA 3KEGA 2CXSA 2UUOA 2V5AA 5CIWA 1IPEA 1UXKA 3MWEA 5C5DA 2R65A 3UT0A 2WUGA 2CB9A 3BWBA 1RD4A 4G5HA 2PUDA 1XROA 2XX3A 5AVUA 2TYSB 3ORSA 4ZIRB 1LZKA 2CJPA 2HHCA 3A6EA 4P3OA 3GRKA 4IH1A 3I5XA 3IE1A 4L0DA 3C0KA 3MSXA 2HW8A 2VRBA 4IWXA 2XKAA 4JKOA 3ETNA 3FFWA 4W9NA 5GJWC 1FXWF 1O6ZA 1UFQA 1LNZA 6LDHA 1G8HA 2W2LD 5GWXA 2PGXA 1P9LA 4KNVA 1CNEA 2FEPA 3CTMA 3GAAA 3IBSA 3NRCA 4JX9A 2F8MA 1U8EA 3DTNA 3PQEA 1NN0A 3SC2B 4EZBA 4N5HX 5J58A 1A9OA 4EFNA 2VF7A 2GSDA 5JCOC 1NNLA 3GEBA 1C8VB 3O4JA 3CZAA 3RTBA 3FOCA 1LGYA 3W3AA 4GVXA 5E9AA 2IUEA 2OMKA 4AWBA 1ZR2A 3WX0A 2GPSA 1ZXBA 1XA4A 3WGMA 3FDZB 1ZESA 5IT4A 4BBPA 4YCNA 4RSGA 4MV8A 1ORTA 3U61B 1DC6A 2GAFA 3OOWA 3ZKWB 4MV4A 4YUYA 1EIWA 1RHUA 3DR5A 2QGZA 1D3AA 4JC0A 1CY0A 4PRYA 4X6YA 2CGEA 2IA5A 3VGJA 3IH5A 1IWBB 1OU0A 1PTJA 2P9TA 5E6UB 4EEKA 5FH9A 3SIPA 1EDBA 5AJUA 4BKRA 3NZEA 4M0KA 1J8VA 1FX0A 1RXUA 2JZNA 4NOLA 4EKEA 4L51A 2G67A 1ZD5A 4X20A 5DHUA 3UW1A 5LQAA 3H5IA 2NAFA 1WDTA 1C29B 5CVUA 3OO1A 1JEYA 2P11A 4M4SA 1KC1A 3KKZA 1V3QE 1Z88A 1HRKA 2I7DA 2MSEB 1GQFA 1SVUA 1NVVR 4JNKA 2NYAA 3BSWA 2PXAA 1KSFX 2BGIA 1CY8A 4M0UA 4ZT7A 4IJ5A 2JGJA 1HURA 2PAAA 3ZZMA 4JVSB 2XGOA 1JDSA 2H4JA 2F2TA 4KQXA 2FWIA 2I4NA 3EK2A 4LXHA 5TQ0B 4URZR 3I3SR 3A7EA 3IPAA 3ZI4A 2BEVB 1B43A 4HNAA 3S99A 2X5JO 1K7YA 3PPIA 3T1VA 4X64B 3NNSA 2G36A 2PEZA 4PZCA 4UE3S 1JG1A 1NRIA 4YJ2F 4NYIR 4CMIB 5JISA 3OZ7A 4BLVA 1W35A 2IGTA 1YDEA 5JH7F 1FS5A 4EJ0A 1E4EA 2JCSA 2CVOA 3MJSA 4U7FA 4ZTUB 1VE1A 3P27A 4LEIA 3GH1A 3WRYA 4LF7B 3SJZA 3HA5A 2FQ1A 3TSAA 2I8LA 3IUBA 1S96A 1WW8A 5G2OA 3PC3A 1S8NA 1XEFA 3MMNA 3GA7A 3SF8B 1G3UA 4W5QA 5LD2C 2HD4A 3GHHA 5TX7A 5CK4A 5LUAA 3BZBA 3FYDA 3IL2A 2PKWA 3IJ5A 5LZ4A 4N3AA 1R0KA 3CH4B 3U1TA 1RZUA 3D6FA 2G1UA 4W1PA 5AIAA 4MRNA 4TTQA 4YK7A 5DSTA 2RIPA 2PUCA 2XSZA 5EZYA 5KDDA 1GFSA 3DMNA 2B94A 2HIMA 3MN1A 3CRW1 3JWEA 3DC7A 2DG2A 1XLUA 2VOJA 4BU0A 3NYQA 1VJTA 3OZXA 2B69A 5I8PA 4DLWA 1BXGB 3T5PA 2WWGA 1N2CA 1M1NA 1XN4A 1A98A 1F8YA 1YB4A 3QU2A 1KMMA 2DQSA 1NR1A 4JP5A 4L5CA 3FW1A 2VF4X 4Q05A 3CVWA 1TMYA 3N70A 1NYTA 2X86A 4QOJA 2B7BA 3OM0A 2I3GA 3CEAA 4C4YA 3PSHA 2I7XA 1WPRA 2HGSA 1QAQA 3AHJA 4FN5A 4HDKA 4JOSA 1IMOA 4L3WA 5DLDA 2ORED 4QAQA 2BV3A 3U31A 3X1XA 4EKDA 1W36C 1K7SN 1K27A 1NZDA 4O4LA 1DKPA 3EGOA 1K0FA 4C0SA 1JJFA 4MKFA 3EJ6A 2OFFA 3WI7A 2AF3C 2JIMA 4TVSA 2A1TS 3VI3B 3LFTA 4I9UA 2QJWA 3MXTA 3LCRA 1V1RB 2RAFA 2QPTA 2Q3LA 4H1UA 4NDZA 5FCDA 3L7YA 3VDNB 3VUFA 3AIMA 4E2WA 2WWWA 4XKJA 3WJAA 1SQ5A 4YCCA 3QELB 5I9MA 3GPDG 2NX2A 3PJDA 4FCVA 3MLAA 4MQUA 2CV2A 1HT1E 4MUFA 4WERA 4I4CA 1QVWA 4CMGA 5B30A 3DBVO 4OU5A 1N0IA 1EUDA 3KHUA 4OJQA 6GPBA 1P3Y1 5J59A 4RORA 3F3SA 3VR5H 1TUBA 5HKKA 4BATA 1GZ5A 8ATCA 1TYAE 1I2BA 1N1EA 1IK6A 1KVSA 3ABZA 1WZ2A 1RWVA 2YZMA 2DFKB 2YWXA 3I9V1 1EVLA 4G5YA 4EF5A 4JLWA 1XJ5A 2NTYC 2R1UA 2Y0DA 4EYSA 2IJGX 3LO5A 4QREA 1R6VA 1RLUA 3U7GA 4GEGA 2V1XA 3KT3A 4N03A 3OZTA 3D6AA 4N76A 1TUGA 3CPSA 3JQGA 4FFRA 3MGAA 2J8ZA 3VZRA 2X13A 2WIFA 2B1RA 3UHJA 4LGVA 1CJUC 3IA2A 5A4IS 1NXVA 1HSZA 3FUTA 1A5ZA 3GGDA 5LMUB 2I99A 3AFGA 4MSUA 3TIVA 2GGSA 2H16A 2Q4OA 2FSPA 2AD5A 3D2AA 3ZCXA 5HPYB 4IF4A 1UWLA 4NU8X 2VI5A 1HNZB 1SCKA 2WP8J 4IGKA 1OY1A 4ZOEA 3WGZA 2A57A 4GE0A 3FPCA 5DGIA 1Q83A 2XDQB 1EVKA 3MJDA 2XT6A 3MJVA 5ISMA 4POOA 5E1MA 4R1TA 4D9FA 1CQPA 5EKUA 3K1AB 4DMCA 1JFSA 1USUA 2ZI4A 1SCUA 4GLBA 3D4IA 2XT0A 1WHTB 2XF8A 3DOOA 4LBZA 3N2KB 4D5EA 5IU6A 2FVYA 3JR3A 3BJIC 1WP9A 2PU7A 5AK0A 3RFUA 1NG9A 3ICEA 1E6CA 1GXSA 4LXXA 1LY1A 4BNUA 3IBGA 1QIFA 3RV4A 2FW8A 5KDLA 2Z9DA 1TJYA 1C7QA 2PRSA 3G5LA 4IVQA 4JDPA 3QBVA 4O4HA 3OFND 3TTVA 4OHUA 4MS3B 2J87A 2YFYA 1T9KA 5D7BA 4DJ5X 4Y0NA 2O07A 4YX9A 1F1BA 2OAQ1 4PPQA 1AO0A 4YAOA 1N6PA 4LYJA 2X0DA 3ONEA 3L0YA 1T9BA 3Q9NA 3PGMA 2QOEA 3JAKB 1OJLA 1L4YA 2VHZA 1R74A 4JN6B 1S3SA 2FUKA 4J0FA 3SMVA 3ZWQA 1YU9A 2FWBA 1O5TA 4TUYA 5DWVA 4UDYX 3NT4A 2Z1DA 1F8UA 2G7MC 4P3PA 1NW9B 3RBXA 5INTA 4ZQEA 3MINA 2IPOA 2HA4A 2WD8A 2NUAB 3SQWA 1WF6A 2C2YA 2IC5A 2CBZA 3DOJA 4L76A 4LJ7A 2F17A 3F3YA 3LWNA 3PQFA 4ZYTA 1MVOA 5B4VA 3HR7A 1Q1GA 1W0JA 4CN8A 1E3EA 4F2HA 4IEIA 1T9GR 2QLJA 1ZGCA 4RTNA 4F56A 3D2LA 4INZA 5A4JA 2IFTA 1BMFA 1BS1A 1N6KA 3O8QB 4CLHA 3RHZA 1U4OA 2VSFA 3DNPA 1KMNA 3HR8A 3FFBA 4XQGA 3RS7A 2WC1A 3GPCA 2NTVA 5AXCA 3HWSA 1MT0A 1WCXA 2H7XA 3AX6A 4FKZA 5JS2A 4AP6A 1NFFA 1VM6A 4L4RA 5CRIA 4OFZA 2AYYA 4Y0VA 1M33A 1GZUA 2O9JA 4MVJM 4BFZA 1XLWA 3FHTA 3D54D 2PZJA 2J4CA 2EX0A 1TRHA 3F3MA 4A3SA 5KWEA 4HB2A 3EVDA 1IAQA 1VYUA 2ON6A 1LW6E 5FUVA 4GKBA 1KPHA 1TZMA 3MD9A 4HYTA 1ZONA 2Y1EA 1XCLA 3VSCA 4WBSA 1DB3A 4NC9A 3LYHA 2CWDA 5JALA 1CERA 1YASA 2PR2A 1JPNA 3ZCTA 3VR6H 2WNSA 5L3SB 1R64A 4OCZA 2C59A 2ZBDA 3F9RA 1DEHA 4RETA 3CF4G 4ZT3A 5AT1A 5B3JA 3PNYA 5CB6A 4YUXA 3ZNQA 1W4BA 4G2NA 4JXKA 2FPGB 5K0TA 1M75A 3Q8MA 1Q1BA 4QQKA 1E6LA 2O57A 4LKOA 1BXRB 5ICCA 3FTQA 4Y2QA 4Y7DA 3EXFB 3WQRA 4N3BA 1UJBA 2VUHB 4J1TA 3LWBA 1U8FO 4RE5A 3I2YX 5SZIA 1V26A 1Q7CA 4X8HA 2OCAA 3QVUA 4PEVA 5HJ7A 4XX0A 1BVRA 2F1KA 4MW7A 4A8JB 5CXQA 2IX3A 3BMQB 2GJSA 4HY3A 1DDOA 3T54A 4CKWB 3GDGA 1TYEB 5KNDD 3U44B 3I34X 3PEWA 3U4MA 5BVGA 4RMJA 1RXEA 1UAYA 3HNOA 2LKDA 1EDDA 5E6RB 2QAGC 3ZHOA 5KVSA 4X54A 4KUHA 4X5OA 3ML1A 3KETA 2W48A 4D4JA 1ZD3A 3LI2A 4L9SA 1ICIA 2VPXA 4CLDA 1USVA 3ZXYA 3BFXA 2M2IA 4YRLA 2QRGA 3EDMA 5TS2A 4GRDA 1QBGA 1TU0A 1BQEA 6REQB 5ESWA 2J3HA 4OGWA 4MDEA 1DBQA 1JDUA 4R1NA 2XW6A 4IR7A 2W71A 1QCDA 5G1NA 2CCJA 1BYUA 2C0CA 5IKEA 1CC1S 3GCXA 4RVUA 1RC1A 3F7MA 4HQOA 4ZCMA 2QQFA 4YDQA 1B1AA 5BSWA 2FG6C 1FBTA 2CY0A 4FZ5A 4NJEB 2CDBA 3MMXA 4EPVA 4HFRA 5CDHA 2PXXA 3DUFB 4C6TB 3ZLBA 4EG0A 4YAGA 2FP4A 1XWIA 4X1KA 5FA8A 1G2QA 2M9MA 3PPXA 5K09A 1Y1KE 1QFJA 2R7AA 3BQNB 3GYBA 2AQ8A 1OKKD 4XE5A 1OLUA 4FLEA 1XDDA 2WG0A 4CT5A 1GG2A 3QE2A 3TQFA 3DTYA 3E8MA 4G9EA 4A36A 2QLMA 2YOHA 1ZLXA 2Y05A 3OLVA 3UAGA 2V6MA 1EPUA 1ANKA 4PGFA 2QYHA 4R98A 4HZIA 3BL8A 3VFDA 2Z5VA 1JGTA 2GCPA 4EFMA 4F84A 4HGOA 1U4NA 1YQTA 1UXIA 2Z8ZA 3CN7A 4HDNB 1G6HA 1G21B 2D2VA 1JHOA 4FFNA 4UZEA 3T3EA 3NX4A 3W5CA 3DXFA 1EJ2A 2E18A 3GFSA 2B3DA 1Z7GA 3HSKA 2HJSA 4M0LA 4YMSA 4R1LA 2PT6A 3C3JA 4HQKA 4HMQA 3B8HA 4BX2A 1JAYA 1GCOA 1DV2A 3I0NA 5ALSA 1GFIA 1V7ZA 2FN9A 3W4JA 5TPWA 1IYZA 2NU7A 4O63O 1Q0PA 1PGNA 4U4AA 4BQQA 1P2GA 3A1FA 1E1MA 3B6JA 3FWPA 3S6JA 1ENYA 5SY6A 4ZQIA 3X43A 4Z1OA 1YTUA 3LM8A 2P27A 1GPAA 3A6KA 3EG5A 1L4LA 4CDMA 1NHGA 2O3QA 1J23A 5EJEA 3T41A 1KJIA 2W6QA 4U39A 1NVWQ 2LDBA 5T64A 1D0VA 4E13A 3KHSA 1SOVA 5TIIA 3GH3A 1V2GA 1EX6A 3EZLA 1C1DB 2W8ZA 3FSGA 4TTRA 3N75A 3BTSA 3BD7A 3DNMA 2HREA 4IM7A 1VPVA 1W96A 2OG2A 3NPAA 5AVZA 2IKSA 4JGGA 1KI2A 1TTTA 3AR4A 4FYIA 4LOAA 1LD3A 3RREA 2XYPA 1F5SA 4ZCPA 2DHEA 2W0MA 3P2JA 4N49A 4DV6B 4RVDA 1JT2A 4R2IA 5BORA 4JFRA 2C82A 3HBJA 4DLNA 3URMA 2YXBA 4GF5A 4IH4A 3V8RA 5IRCD 5K0EA 1TF2A 1UPAA 2C7VA 4HDCA 3EQZA 3HR4A 4BGIA 5BP7A 1Z0AA 4Z9AA 5ICSA 4JXJA 3UJ9A 1DCFA 3VC7A 3O73A 2ZUEA 4MQ5A 4PZDA 3L8EA 3W5VA 4DYDA 1YBMA 4A2CA 2C2HA 1IEWA 2E55A 2M1XA 3QV2A 4OF4A 4RHUA 5E7IA 1HF3A 3E5MA 3HI4A 1OXVA 3LX6A 3VR0A 4AWXA 4ENPA 3ICQB 3AXSA 3SQDA 1JHYA 1M83A 2Q3EA 2ZRBA 4FI3C 5IASA 1UKBA 4YRQA 3SP1A 3IP9A 1Y3IA 5JMPA 3V1YA 5EE1A 5CPBA 1L8OA 2AFIE 2PD4A 5EHGA 4RGQA 1GVHA 3IQFA 3F6RA 2C7BA 2ODTX 3K6RA 1MW8X 1WDLA 2JB9A 1LF0A 1T5IA 3QUSA 2AE1A 2AR0A 3O03A 4QOGA 1WPGA 1KDRA 2Z30A 5H80A 3S7TA 3VNVA 1WLYA 4QPNA 3EOAI 3I37X 3INGA 1QCCA 5ICGA 2C2KA 3GXBA 3E2MA 2JPDA 3C48A 3UWOA 2WWHA 1QYVA 4BE9A 4FP9A 2OTCA 4EJSC 3C3CA 2FJUA 4S0ZA 1VJ1A 1KYTA 2YUTA 3VKUA 4ZYVA 1U2DA 2CXHA 2GD2A 5EZQA 4IJQA 5F7ZA 4RENA 3WSVA 1FW8A 3O1HB 4DLPA 1MCZA 1TC2A 4NG4A 1YB6A 5NULA 4EDFA 2ZULA 3AI1A 3EFOB 4Z9FA 3BL5A 3WV5A 2JBAA 4F3YA 4HRYA 1K3FA 4GL4A 5K03A 2ZRDA 1C0KA 3D3WB 3FZNA 1P33A 3NNNA 4DCOA 5C18A 1XCPA 1Q7BA 3PJGA 3F73A 2VT6A 3EAFA 2FZKA 3MGGA 1K88A 1YRLA 5F64A 3D3EA 4RVNA 5J4YA 3ZD6A 5IC6A 5DXAA 1RYHA 4HNQA 4DLVA 1DKLA 3FTEA 1HYBA 3JYLA 4K6KA 2I87A 4ENRA 3WGHA 5IDWA 3TF5A 1SVMA 2D0IA 1E9SA 2SKDA 3E9CA 1BO6A 4JJFA 4AYWA 4QXAA 4GPZA 3VZPA 4FWTA 2OKGA 1CUWA 1QFYA 2H4XA 2HRDA 3RSQA 3RT9A 3TR6A 2ZJ3A 2FOXA 2PRKA 3SDSA 5EZYF 1HQYE 1LWOA 2QJFA 4Q47A 2W2KB 1VZ3A 2YJGA 1H6BA 4BN5A 3QFSA 4Y7CA 1STOA 2CHUA 4L75A 4D6PA 4D8UA 1O94A 1P5ZB 1X7ZB 2GZ1A 3EEYA 4QWWA 5EJGA 2E48A 5AUNB 4H35A 1PDWA 3NNDA 1ISRA 3UATA 4A7PA 1JKJB 2GYUA 3EG9B 2FLWA 3K16A 5E0KB 4YAKA 1M6EX 3MCWA 5KWVA 1VE6A 5G40A 3P20A 4XCVA 1FVXA 3TCXB 1F0YA 1OLOA 1PK8A 1Z7BA 3ZW8A 5BUQA 5JZVA 3R77A 4WN3A 3KB1A 4JLAA 2BHLA 1QQ6A 1A2QA 4EHKA 5E6SB 4WY8A 3UHAA 5CFQA 2VJQA 5FRDA 1RAHA 4AF6A 4ZAYA 3THSA 2V7GA 4P5DA 2OVBA 4IHKA 1DP4A 2YYSA 2PGDA 4MAFA 4O4LF 1GTRA 5F35A 1GADO 1UJNA 1NU8A 4NZZA 4H7FA 3GHYA 2W2XA 4FYYA 3GOQA 5C46F 3INRA 1P2FA 1C2TA 2JKYA 1G5QA 4FONA 4HQLA 3MCTA 3ZBUA 3ANNA 3CF6R 4QHYA 2H2GA 3H8WA 2GFQA 2ZJ6A 5TPZD 1ITZA 3VOBA 5JSFA 4AJHA 1P1BA 4K9LA 3PJEA 3ZCRA 2ZUUA 3UMGA 1NMSA 4F4HA 1SHTX 1NJGA 2GN1A 3SSOA 2VC2B 1MC4A 1ZGHA 4F97A 2GTPA 2Q0XA 3QEMB 4LKRA 1KJYA 1QPBA 1JIQA 3H1PA 4KXXA 3DF9A 4DADA 3VC1A 5K0SA 2NM0A 3TLZA 2C78A 4S1PA 2WIDA 3B20A 3NHAA 3WYBA 2ZAIA 3FKSA 3G2KA 3FJOA 3WXBA 3E61A 4BGEA 4ZPJA 1NVXQ 5KO2A 1JHRA 1N6NA 3WYNA 1UZAA 3FJYA 3JASB 3PT5A 4YJFB 2X7XA 2FFJA 2RGXA 4FJ2A 4O08A 4BVBA 3USCS 3DMTA 4KJZA 2IV7A 2ZYGA 3VGPA 1WZNA 3IIJA 1SXQA 2FPKA 5ED0A 1OXKB 5C2JB 1QAOA 1VL2A 2I2FA 2ZIXB 1IXRC 5ALGA 2HCBA 3T61A 4BMOB 3RTDA 2NN3C 1I36A 1K3TA 3D6UA 3FPLA 5DM4A 4RJIA 4OBEA 3LT0A 4LHWA 3O4IA 3N28A 4LNUA 5DT9A 1DIBA 3ZH9B 4BJ5A 1OH5A 5F1OA 2G1PA 2MINA 1CUFA 1HDXA 1KC3A 2NUPB 3B3JA 2C96A 1E5DA 1ADJA 2QMEA 3D81A 4QEZA 2BE7A 4MS1A 1GTVA 4AJ1A 1U5CA 3AR9A 3WV4A 4URWR 3VV2A 1J8FA 3K1TA 4IVRA 2VDRB 3G7SA 1JTEA 2H29A 4C78A 3SZOA 5F4ZA 1H6DA 2X14A 5DYIA 1ETHA 2QR3A 3RVPA 3D8TA 3E3NA 4O4HF 4MRRA 2AC7A 3M6VA 1SZDA 4BPRA 3DWIA 2J48A 1LI4A 1ONOA 1PYOA 2OBBA 2VH1A 3FUUA 3QITA 4W1SA 4NU5A 2J0SA 2P2SA 1KFBB 1UDAA 3GVHA 1OYOA 4DW8A 1EWQA 2BEJA 3CIOA 1C4OA 1Y4AE 4KPFC 4CKXA 1WCIB 3GLRA 4LZLA 1M5TA 3V8NA 4RF2A 4H08A 3KOUA 4TUYF 1DBRA 2HQ1A 4RTKA 1RTKA 1SURA 5DJ5A 4YP7A 4BC1A 3D1LA 4GOMD 3F4LA 3V4LA 1E3JA 5IYZA 3U6BA 4LMRA 3BERA 4MRVA 4Z1MD 1YHYA 2JH9A 5DTQA 3I4FA 4Q7KA 5EFZA 2UYCA 4YP0A 1NFQA 1W2WB 2P5YA 4Y2GA 3WOVA 2B4QA 1DV1A 4QNMA 5SYMA 4ZC8A 1I7SB 2PT9A 1D09A 1U9IA 1TIBA 1VBKA 2AL7A 3BB3A 3HEAA 1CHDA 1TDJA 5BXQC 2PPLA 3WAJA 3U3ZA 5A2QA 4MITA 3HB1A 4IGIA 4AUMA 2Q46A 5EIHA 5HKLA 2KX7A 4IDPA 5LZ2A 4F3NA 3MQFA 1QRSA 3PRJA 1F2TB 5GVRA 1PFYA 1ZGJA 3MMZA 4IIDA 1ZOSA 3NASA 2X42A 1OX4A 4ETMA 3AESB 1Y8RB 2HQRA 2I1WA 1E3TA 3FWZA 1RQGA 2ZYDA 3FFXA 3R3SA 1KARA 5LJIA 3PEYA 2GPNA 4OREX 1C9DB 2Q1TA 4NBUA 5AM5A 5C8ZA 1CS0A 4KGVA 1AH2A 1KY4A 1JHZA 5DYNA 3QVVA 3RSHA 2OZLB 3S44A 2VHJA 1TA4A 5IJXA 4BWGA 3G8CA 4DR4B 4KYUA 1TMGE 3I9LA 3CUEF 4LV6A 2H18A 5ESDA 1PN3A 4ITUA 3L3BA 4PFSA 4H6VA 4PSVA 4ZQCB 5GJVC 3TDNA 3WHKA 3X1KA 2M1ZA 1K8QA 1BGXT 4NABA 5AOCA 1T1SA 2RGNC 3JQFA 4R31A 4BNMA 3ENZA 2D4HA 4TV9F 4GMDA 3A2LA 4N40A 5AKYA 5CM9C 1PJBA 4LYAA 4P4SA 5C5IA 4A16A 4YALA 2I9KA 1L1EA 2PJUA 3CR3C 3BMOB 2GT1A 1VGVA 2J3MA 3OPMA 4LTMA 4OHVA 4NCAA 1M5UA 1WEHA 3MJRA 4GX0A 3NBXX 4YI5A 3SE0A 3H2JA 3V2HA 4U00A 2XB4A 4NENA 1YRBA 3ZE8A 1E59A 2DUWA 2BFDA 7ADHA 2GK4A 4I50A 5TGZA 4R7GA 1JZSA 5HJ2A 2VHXA 3DHYA 3OZVA 4HTFA 1FTSA 3GCDA 3ETLA 1PLKA 1KQFA 4HLQB 2M6LA 5JAPA 3ZWOA 3NVMB 3OCXA 2X23A 3X1YA 3I01M 1L5MA 3EUAA 4Y9DA 4DQKA 2A8YA 2OO7A 3IAM6 4U6NA 4DC0A 1DAPA 3DB1A 1QM5A 4QUDA 3IKMB 3L1IA 1RRGA 1YJXA 4BX3A 1L4BA 4II7A 3LYAA 1JA9A 4X95A 1P4HA 3MK31 3I45A 3NFRA 4Q6WA 2VNKA 4AULA 4RLSA 2QN1A 2RC5A 2VATA 4DMRA 3OJOA 3K73O 3OAAD 3RUIA 4JJ4A 4M37A 1B15A 3EAGA 4UHDA 5K2MA 1XX6A 4D3YA 1Z2CA 2ZGVA 2MR5A 1REQA 4DIDA 3OT1A 1PGPA 4WK0B 4TZTA 3ZY4A 1I2MA 2G5GX 4YJGA 1E32A 2ZTMA 1EXDA 2WSYB 3OESA 2EJUA 5K6RA 2VYVD 1U2TA 3F98A 1SUWA 4IOMA 4QVIA 5C8DA 3QVSA 4TS9A 3KL4A 4MKRA 4YJ3A 5TEVA 3A9CA 5TQ2A 3VPXA 3VHXB 4I9HA 1EHYA 4IMIB 4JBLA 4QBGB 3LZ6A 4R81A 1R1DA 5AM4A 4F3TA 1CUSA 1GAEO 5G4LA 4D8VA 1Y4SA 2CLCX 1XJCA 2Y0CA 2NACA 1CUAA 2PS0A 2DMRA 3GQVA 4R0MA 5DP2A 2GK6A 5L7YA 2IZZA 2D8MA 3EEOA 4GDFA 1CUVA 1G42A 1TU4A 2H57A 3TG8A 4EVSA 4OY3A 5KB3A 1UZLA 5EJ7A 4AMBA 3V4FA 1JJBA 2G88A 4ZAWA 4D8WA 2VJYA 5BWCA 5IULC 2O7QA 4OI4A 4F5YA 2C97A 1MZVA 3I53A 3JVUA 3L93A 4Y9UA 3W1WA 4WKCA 3ETHA 4QTXA 3DFKA 1WF3A 4HC4A 1NDQA 1R7RA 4F2PA 4WEQA 5M7EA 1X1CA 2DECA 1BA2A 1K6IA 2MYUA 3ESQA 3R3XA 4H7PA 4LBVA 4X8LA 1UMKA 1QKKA 1OWOA 1QR6A 3LPNA 2FCAA 4JC5A 4MCHA 5H81A 5K0FA 5JU6A 5KYNA 1GR0A 2E4YA 3AVVA 1YZHA 3LK7A 1EMDA 1NKTA 2HOQA 4G67A 5M2QA 1N6RA 4GX2A 4K3VA 3Q0IA 4TLLB 3M9WA 4CMCA 3O8OA 2MSCB 1B73A 4NR0A 4D4IA 4FIZA 1ORRA 4J90A 3R0QA 1TJPB 1B6TA 3P5SA 4CTOA 2HHAA 5IN5A 2R79A 1LDMA 4JUBA 4MV0A 5FOVA 4L15A 4C3VA 1CY4A 5DTMA 1XVTA 5K0GA 3TUZC 3DONA 1RRFA 4IVPA 4DBZA 2FXVA 2XWQA 1PHPA 3FR7A 1B6RA 1M2VA 2W8BB 1KKMA 3DWFA 1ZGAA 1QH1B 4TSFD 5F23A 1YKGA 4RH1A 1XNHA 1QIMA 3IAHA 1QS0B 1HLDA 3KKLA 3NONA 3Q8XB 4GG1A 4HG2A 4ZXPA 4ER0A 2Q0QA 5BN3A 3KJQA 4OQNA 1GPUA 2P35A 3GJQA 1QYXA 2BCGY 3IPRA 2R7KA 4CCYA 1ZK2A 1AIPA 2JGMA 1O9BA 1OQAA 1EWYA 2XNJA 2D1YA 3A27A 2JAQA 1N5JA 3BRWA 4EPWA 4GI5A 2UYOA 1QVZA 2IY8A 4TWJA 1WZEA 3KEOA 4FEAA 3TAUA 4E51A 1MQ9A 2GRJA 3ZGOA 2AC2A 2VXBA 2ZTLA 3IQDB 1YS9A 4IX1A 3K0CC 7AT1A 3HP4A 4E12A 2JAUA 3VR4H 1AZLA 5H68A 4WGFA 4LMPA 1PS0A 1QUEA 5FAXA 3EIOA 2HNKA 3B7PA 2O23A 3O9VA 4YAWA 5CD1A 3GA5A 2J31A 4EATA 3MGKA 1S01A 1ZN7A 1Q3KA 4G1UC 1UPFA 2D6FA 2CK3D 4PTLA 1UC9A 2ATXA 3H2ZA 4M36A 5ECYA 5FORA 3ORFA 2KMLA 2LW7A 4P5PA 4ZRMA 2EL7A 3E81A 2MCFA 5EIXA 1UAGA 4KGDA 2I4RA 3Q7PA 5TQVA 1JR3E 4YO7A 4CNBA 2F1IA 2NP7A 3PQ2A 5CR9A 3LG2A 3MFYA 2M6KA 3ZK7A 1XQ9A 2XB8A 3BMCB 4V0SA 2Q8PA 3WWPA 1OBHA 1WCWA 2ZJ2A 2NV0A 1ESCA 3BEDA 2G9QA 1GPNA 2O2HA 3THYA 2V0CA 1B00A 2HADA 3HKEA 1TEZA 1KEEB 2HJWA 4FKMA 4JJKA 1E1NA 4M8LA 3NETA 4G1EB 1M9NA 2XOKA 3MRXA 3QTTA 4Z53A 4F3RA 1A9QA 1GCIA 3ILXA 4D8YA 1NF3A 5FUQA 2XCRB 2TS1A 3VTAA 1TKRA 4B3SB 4TQUS 3TNFA 5JNVA 3TB4A 4DEXA 4ZHQF 2ZYAA 4REQB 3A1UA 2NO6A 2UUAB 1DQYA 1JQKA 3VOSA 4CLEA 5KNCD 3PNLA 4QELA 1ZRSA 1LNQA 1Q74A 2HN9A 1HL7A 4L4XA 4UZSA 2E82A 2HRBA 1P1JA 3R6TA 3VO9A 3H5WA 4F2DA 4OQZA 1P17A 4BVFA 5T3YA 3VNAA 2RIRA 4U1RA 5AESA 3DR3A 4OHFA 2HSDA 3DDWA 5AOVA 2PR7A 5FBVB 4JI6B 3E5NA 2VFAA 3TZBA 1KFCB 1XNJA 1V0JA 4NARA 4LJ4A 4KO3S 4L9AA 2F90A 5JSZB 2XI4A 1IULA 2VJKA 2JAWA 1RWPA 3JD3A 4JEMA 3U48A 3UG6A 4ID9A 2YQ4A 3EA4A 1XZFA 2CLDX 3W1EA 4XJSA 3GLIA 5JXWA 5EC8A 3SQMA 4CU2A 2ENWA 2PV0A 3RD5A 3SM3A 5CNKA 2O8EA 1E7SA 4IJUA 1WZCA 3T7IA 3L8HA 1RRVA 2P9QA 4AQ7A 3FFTA 2GWRA 2JFQA 4MWEA 4HS9A 3W5SA 1SU6A 3G79A 3A6ZA 5SICE 4BGVA 1L3CA 2XUHA 1G98A 2DFNA 3V1LA 3JWIA 3JQAA 1K7FB 1LH0A 1NF2A 2IE8A 1KY2A 3C98A 3OEEA 5HHTA 4RX1A 1NU6A 2CBGA 4W4TA 3IBFA 3MILA 4DUZB 1ISPA 5K8UA 1SEVA 1PJTA 1M0TA 5WRFA 1DKRA 1SVLA 3CB4A 4V0KA 1Q91A 4BKMA 2XNCA 3TGPA 1NNSA 3TLGB 4W5JA 3EX7C 3D8NA 2IS4A 2HPVA 2YV2A 2WJWA 2NZJA 2X15A 3AR7A 3ZU3A 2W11A 3KS9A 2PLNA 2V5VA 4NE7A 4MUBA 2D8AA 4ZRNA 2A0WA 4YO8A 3F5MA 2RHOA 3WFIA 1ZI8A 3A9UA 1OH7A 1ACLA 1R00A 3IAS1 1LZLA 3SHVA 3Q3JB 3VUEA 2G5PA 3PQ5A 1ZN2A 2QLTA 3WWZA 3I04A 2ZZMA 6CHYA 1L7RA 3OY7A 2V7UA 4FOLA 4H7EA 4W8HA 5JJIA 1MEOA 5E7QA 2EX4A 1VMEA 3AFHA 1RAEA 5EXSA 3BWCA 3OJLA 1Y98A 1G3MA 4PZYA 4ND8B 4KFRA 5IUKC 1PGQA 2AGVA 5EERA 2A5FA 1T1IA 4YRMA 1SCDA 2FW1A 2SCUB 4IIJB 1XMIA 4XM1A 4XEHA 1B6GA 1IM5A 3TLEA 1X0XA 5KQMA 1EVEA 1NR7A 3DWEX 4YQYA 1GPDG 4N7RA 1DEOA 3U37A 4B9EA 4OI1A 4EW2A 4CIWA 4EFLA 4YT8A 2FR0A 2BKXA 1XL0A 1T36B 5BN5B 4CT0A 4DQVA 3DLAA 3SS8A 3ZHCA 3KVNA 1BHQ1 2OV4A 1OHHD 1VCMA 1S8FA 4Y2RA 2PX6A 4Z5XA 5CFZA 2IF2A 3EXEB 3WLNA 4YAIA 4DG5A 3NTRA 1QIGA 1V8ZA 5IH7A 3NWEA 1UEIA 1FNDA 4JL6A 1DCTA 3AETB 3Q98A 1N3LA 1SKBA 3T12A 4BMCA 4DDHA 3EMKA 4IINA 1F2DA 4IIXA 1TOAA 1UJCA 3WOHA 2OHVA 3WMWA 4XDGA 3QE3A 4D9EA 1DRWA 2HQSA 3UZUA 3RYHB 3CUUA 4DNQA 4Z4CA 1C1YA 1QZTA 1DFIA 2G9ZA 3BJRA 1JDVA 2NG1A 2Q5LA 3ELUA 3RS8A 1A8SA 2QS9A 1T9AA 4GOND 1G3RA 3ZE2B 2DHCA 1FW6A 1L1FA 1E2FA 3NGXA 1MZPA 2XBLA 1X15A 1BX3A 4DIKA 5I4BA 4G26A 3PR1A 1P2BA 2IYOA 1IDOA 4M38A 3V33A 2WMOB 3DZHA 5IYZF 1HYHA 2VEOA 3UCXA 3KTAB 1AQUA 2FR1A 4JWKA 1VMIA 1K8XB 4UNRA 1AD2A 3Q0TA 2KQUA 1RHJA 1Y1TA 4J4TA 4MV6A 5F12A 1GTL1 2ET6A 4CG2A 3HH8A 4DWJA 2FDCA 3WG9A 1RP1A 4GNRA 1WD7A 2FPPA 1TVEA 1TTPB 5AVYA 3T15A 2PMKA 3S0JA 4EHAA 2L0XA 4E15A 2DJ5A 2CLFB 4WFIA 2XDWA 3BCHA 5BOVA 4Q7LA 1V2HE 2LZ0A 2ZWPA 4MR7B 4UNPA 1Q7EA 2W93A 2Z08A 4CWAA 1U65A 4D1YA 4BEBA 5HQTA 1GAQA 1NKVA 2PXCA 1Y3HA 2ZUDA 3AUYA 1KAQA 1PO7A 1NIJA 1SHZA 1ZHHA 2AXPA 4WI1A 2P4HX 3T9AA 2JAPA 3BE4A 3X1ZA 4AUNA 3GCGA 3PHCA 1L8LA 2TECE 3DPUA 1EFVA 3P52A 5DNVA 1TYCA 4TKVA 5MGBA 3A11A 3H11B 1DUVG 3W3ZB 2QW1A 4LFAB 1AK1A 2AI1A 3VR5A 2PUTA 1Z6ZA 2A0YA 1ZISA 1ODTC 2JIBA 2P9YA 4J94A 4KQFA 3KPUA 1HDIA 4PCVA 4F93B 5L7WA 4XUGB 2XE6A 2DZDA 3E9YA 5HF5A 2BH2A 2YDYA 2BHRA 1T0PA 4MYDA 5IUNC 1R4MB 1GU7A 2R97A 4PX3A 2LXNA 1XLTA 3B82A 5CX1A 1TUEA 5AK4A 2HO4A 4CMBA 5B2FA 1S0UA 1Z25A 4QRDA 3A26A 2BGRA 1JQBA 1SN7A 2HDNB 3VJKA 1BTOA 1O6FA 3INTA 4JJGA 4WE3A 5CM8B 2QP4A 3IXLA 4I50F 4Q12A 1Z7EA 3GO4A 2WJ6A 2BFOA 3L7BA 5AI6A 3WFJA 4CM4A 4RKEA 4PYLA 4NY1A 2QAIA 3LHKA 3ON5A 4P0PB 1UOOA 1WHSA 2VZ0A 4MUGA 3TNJA 3E2PA 3JYPA 3VDMA 3KPVA 4EZIA 4WUVA 5FO0A 4HP8A 4U2BA 5FADA 3SKVA 5KOYA 2J9FA 3GVPA 3D4LA 4LGMA 2X0RA 5SYAA 1KVUA 5FQNA 2ZCUA 4RPJA 5JAIA 3LQFA 4FHGA 1KPIA 5DNAA 1CIJA 4YP5A 5ERGB 2GETA 3OWHA 2A9RA 1IG3A 4BASA 4JLMA 1TECE 4FHEA 1ATIA 4HDOB 2Y9MB 3K6JA 1FA9A 5AVTA 4BNJA 1N5DA 3I42A 3VVBA 1AUXA 1WSWA 2I6XA 2FA9A 1U3WA 1Z4LA 2UZ0A 2YINC 1LJLA 1Q1ZA 3KYCA 3MJTA 4NZMA 2CHQA 2QMUA 4WLEA 1RI1A 1UMCA 3M9LA 4X1YA 2HLDD 3DOIA 4KZKA 4B2YA 5IT9A 1NXXA 3UENA 3ZNOA 2EEZA 4P4GA 1W5SA 1DXHA 1MW9X 1WEKA 3PENA 1A7JA 1N4DA 1W4LA 2XCIA 3FYUB 4V03A 1IB6A 1WUIS 2J6CA 2IUFA 2R5NA 1BE1A 2J6BA 3I2HA 4Q1DA 5EMMA 1U7ZA 4JVMA 3OTIA 1ML3A 2RJOA 4YJ3F 1BWRA 2LTAA 2RJ3A 2RH9B 4JT2A 2G04A 2ADMA 1EA7A 3WKCA 3G6KA 4ZV4A 1XQ1A 2EW8A 3K5PA 5U1PA 3DQQA 4AD8A 5H0IA 1MX5A 3RDPA 4M7WA 2DSNA 2UYQA 2XMQA 3JD2A 4R2HA 4BVKA 3JW8A 3NM4A 1JLMA 3ABSB 1I24A 1KO7A 4TMYA 4B74A 4CIXA 2HDHA 1RJEA 2QY6A 2X8WA 3DOUA 3U2QA 3Q0EA 4JJ7A 1YI8A 3E0XA 2YMPA 4IVNA 5ALFA 5B2EA 3IV7A 1QUFA 1Z8HA 1X0VA 2JGDA 1PI3A 2L69A 2UAGA 3D7SA 3FA2A 1ZIXA 2QAGA 3OJWA 4NNOA 4UNQA 1CZRA 3EPKA 4RPLA 3HN7A 3WGNA 4CEIA 4LOIA 3H8VA 3HEMA 3IBYA 1E9AA 2P2GA 3FMPB 1AMOA 3NANA 1VI6A 3VPGA 4FNOA 1JXAA 3TTTA 4S04A 4EJ6A 2YJ4A 1HEUA 3E9DA 2F8SA 3U7JA 3CLVA 1JR4A 3AIOA 4OQDA 2C61A 2VJMA 5HKOA 3V4RA 3CW8X 4Z9YA 3HTXA 3D6HA 3ETCA 3L6DA 1P5RA 4AKIA 2CJXA 5IKMA 3ZWPA 3M4NA 4JIGA 1U7PA 2ZAMA 4L4UA 4DR3B 3I73A 2IK8A 3W9YA 3ICPA 1JR2A 1R0SA 4FFBA 2FQQA 1XLVA 3OQIB 2H00A 4Q66C 1P4SA 1G64A 4OP1A 2A30A 3O47A 2BBSA 4HAVA 2FG7C 3QV1A 2CNWA 1IM2A 4MKGA 2F1RA 1QK3A 2DBRA 2J46A 4C07A 4UM9D 3JR7A 1Q14A 2FQXA 4GSYA 3STUA 3EB9A 3W2EA 1T6BY 2YJZA 3B51X 3Q3IA 4NATA 4E3ZA 3J80A 4XDZA 5TNXA 4MVXA 2DE0X 3QVGA 4YRTA 4BKUA 3JQ9C 1W49A 5GZ6A 2H4ZA 2V3VA 3IEVA 1RXIA 2YTZA 2KI5A 4DIFA 4OMUA 2RHDA 3IO3A 4WESA 1W4AA 2EG5A 2B1JA 4HB0A 5K4AA 4CKCA 3TJRA 2GAAA 3LIPA 1YA6A 2H4YA 4PPYA 1GPBA 1KS2A 5TVKA 1FUEA 2GZAA 2QMQA 1Q57A 4KREA 5D87A 3DE4X 1OWNA 1JHVA 1GZVA 3GUHA 4PG7A 4Q5IA 5CG1A 1GARA 2E5WA 3ZJ5A 5JBQA 2DUJA 1J8MF 4OHKA 1ZW1A 2FN8A 1E3QA 3PSAA 1ECCA 4IDQA 3L02A 4MVJP 2V7QA 3QJ5A 4JD5A 1D07A 2H2AA 4LVCA 5IP5A 3UXHA 3WWDA 1G291 3ZUGA 4CUKA 4HPXB 4E5UA 4B7ZA 1Z3IX 3IA7A 3TOXA 4UUAA 1JMVA 2OBYA 3B1VA 4GDMA 4I1VA 3DLPX 4AJJA 3PHJA 3C5WP 4U8HA 1AC5A 5FNZA 2HA2A 4MO9A 1ECJA 2FUG1 4B2LA 2XWJI 4YBZA 1G8GA 3BL6A 3HNRA 3SYRA 3CE9A 4B32A 4FVTA 1T26A 5CXUA 2C0PA 1I3NA 2X5NA 1JUDA 2YFHA 3I09A 1TO1E 4FX2A 5TY0A 3R5FA 4FFPA 3HYCA 3RSLA 2BEUA 3EYAA 4E3WA 4LRQA 3U4QB 2NSHA 4YNBA 1VP3A 2CHVA 2H5LA 4BMXA 2VN8A 5TMBA 3ZY3A 3QX7A 1CUXA 1CP3A 1JTVA 4C4TA 1L7OA 4CQMA 1U11A 4UCXA 4QNNA 1M76A 3REQB 5I9LA 2AKYA 3R8XA 4M0MA 3EVFA 4C7MA 4RK1A 2JCBA 1SWWA 4WNAB 4NOMA 4QIHA 1EP3B 1QIEA 3VO1A 1JIJA 1JEJA 1PFKA 1YS2X 1E2IA 2BDTA 5SY4A 2GHQA 2D2IA 4FR2A 5EINA 5JO0A 3NBMA 4JLSA 4AJ2A 5CEEA 2WFAA 3UXEA 4HOYA 1E60A 3WL7A 2GRUA 2WRZA 1CP2A 1DQPA 2RKWA 2NQ2C 2A92A 4BFVA 2JGNA 2ZZKA 3N5CA 2TSYB 4DXDA 4R2MA 3E8XA 1IONA 2IIBA 5EKDA 3PDJA 4C2TA 2XXAB 5H82A 3D7KA 3DBHB 1I80A 1FFXA 3H5TA 1SK9A 4G0NA 3UMBA 3GDWA 3SHTA 2WQ7A 4GPD1 4Z7OB 4KMRA 3RM3A 1PGJA 2HPAA 3WB9A 1YZFA 3RNOA 3VTKA 5LM3A 3MWKA 1ARZA 3OJCA 4TM7A 4F9GA 3LUGA 3DLBA 1C80A 5C37A 1CDZA 4ZIRA 1B0AA 2NT3A 4EJSA 2LUOA 2Y92A 3AVPA 2WTBA 5EI5A 1FUUA 5KSOA 1ZA2A 3QUAA 4ARZA 1JZQA 1W5AA 1IU9A 2ZI6A 1PT9A 3ID6C 2R6JA 2QRJA 4J0HA 4BCDA 3SQXA 2DBYA 4BFLA 1TZCA 5L9AA 1XKLA 2OKCA 1LNSA 1BHSA 3NDPA 4YB8A 3TH5A 1H6CA 2VPWA 3KYBA 4N65A 4BNXA 3I52A 3ONDA 2UYGA 2XUKA 3RS4A 2ZRPA 4U02A 1J0EA 1WOYA 1ZRHA 1QONA 1XCOA 3TQHA 5FBLB 4HXFB 2OPHA 1HPLA 5SZHB 4AYXA 3QI7A 1SKMA 3UPTA 1VKOA 2G1KA 2P78A 4KE8A 4LE1A 2HBZA 3BN3A 5G1PA 3D64A 4RF4A 3VKWA 1BG6A 4L8FA 3MQ2A 5DN9A 4QU5A 1E6WA 3WLIA 2JLVA 1A9YA 1SD1A 3ZKWA 2Y2VA 3M2TA 4PQGA 2P3SA 2XOXA 4UVEA 4DREA 2PZFA 1KOFA 5BQPA 4AO7A 4MQFB 3SHQA 1X1EA 3KJZA 4LCEA 4MQEB 5EJ5A 5LYJB 1Q6YA 1YK1A 2C3YA 3DZJA 1QJ4A 5DX8A 3VJRA 4EGCB 1XP5A 2EZ4A 2VUUA 4S1NA 4CMEC 4EK9A 3OX4A 4K9SA 3GQBB 3P4UA 4UU7A 1Z6PA 1FTWA 2CW5A 2XHEA 5JG7A 3BZWA 3RC1A 2NTJA 5KQRA 4N8DA 1J9ZA 1JLSA 1H0KA 4G8DA 2B7LA 2OQ2A 1PD0A 1H65A 2RHMA 4ZAFA 3WLSA 5CBKA 3C7DB 2ZIZA 3MT9A 4OH1A 1E99A 4O3MA 2A2ZA 1U8XX 1ZU5A 3M9XA 2QQEA 1SCIA 4CPDA 1HTWA 1ZBDA 1KYQA 2Y6VA 3L07A 3FCYA 4XR9A 4KIFA 2AFHA 3A6GA 1P1KA 3V2UA 1OILA 1V1JA 4PG4A 3VDXA 2IZ1A 4K9NA 3EHEA 2QM3A 3H1BA 4JP1A 4BBZA 5JAHA 5KU1A 1TFRA 1LI5A 4HPWA 1AHHA 4L3OA 1WXDA 1Z82A 1XCJA 5KTTA 1E1QD 1Y6JA 3E9NA 4UMVA 3R7FA 1GOTA 3HZOA 2IU3A 3LZDA 3X44A 4NZ9A 3ITKA 3IUJA 1SCAA 1N6HA 2Q5HA 1CQJB 2PMWB 3HVJA 5FT9A 4CR6A 1E2GA 2P6PA 5ERXA 3ZWAA 4WCDA 5BWBA 3M7IA 3GT7A 1DI0A 3TECE 2OK8A 1I2DA 3ZUPA 3E35A 3LOUA 2B4RO 3GLGB 1ZFNA 5F1YA 4AZ0B 3T6KA 5JBIA 5K8LA 1M1XB 3C3XA 3FE2A 3L0DA 3PZRA 3OPXA 1G5HA 1ULSA 2AFIB 3LT1A 3RFVA 3VU9B 3IV6A 3C8DA 4BQOA 5FX2A 4YJKA 3SZGA 2MOKA 4A1FA 4QQRA 1P81A 3T3IA 3W6UA 4B6SA 2B1QA 1BWPA 1CX9B 2VNSA 1FSSA 1KZYC 2FW0A 2QF7A 3D5QA 2QTVB 1FPQA 2I5PO 2KW5A 2NT4A 4Z3KA 3ECAA 3KZVA 1CZLA 1D1SA 3GEMA 4YFYA 3LP6A 3RB8A 1ZJWA 2MSWA 3AUJB 4G0ZA 1DOAA 3FGOA 1LX6A 1V71A 3KE9A 3CVUA 1JNYA 4Q0MA 2FZ5A 1J0AA 1X70A 1GNVA 4K6CA 3L8ZA 1G5PA 1V4VA 3LWZA 1ISIA 1CBUA 4DQUA 1UK8A 1ADCA 2V6FA 4EBFA 1RSZA 2GHRA 1SEPA 5HUHA 4GMHA 3H2HA 4GI7A 4EY7A 1PLJA 2ZI3A 3GZ4A 4GC5A 1FRZA 1NGSA 2Q0HA 2D2EA 4J9UE 5LXTB 3JSXA 1DEAA 1QRRA 2MSNA 4HF7A 1B93A 2PZLA 2PH1A 1WAMA 2IP2A 3L1KA 1TEVA 4GR4A 2PRYA 1COWA 3HVIA 4US0R 1Y37A 2PLRA 3HA3A 4D2IA 1TEXA 1IRIA 1EG7A 2D00A 3P9YA 4MAAA 3UTDA 3O8RA 1NMQA 1NYLA 4UMDA 3JARA 3UAWA 1ZUHA 3MWDB 2VNHA 1RMQA 2Y1XA 3MSCA 3B36A 2H4FA 3IS3A 4N82A 4AFNA 2ZQZA 3H18A 4U6QA 3R5XA 3W05A 4EW6A 4P54A 4WDQA 5J2UA 2PGJA 3MEQA 1HZJA 1PZMA 2G6BA 4HWTA 4WY5A 2NO9A 4FHCA 2BJVA 2FZGA 2CXRA 3AI7A 3M3PA 4XGKA 2F00A 4QFMA 4BUJA 3CWCA 3K32A 1PZXA 2VAVA 3P19A 3Q3VA 2C7GA 1Q22A 4AN1A 3UMYA 1NR5A 4D82A 2HSGA 1GEGA 5HF9A 1L7MA 3OZEA 2HK8A 3TTUA 2QZSA 1NOKA 3DSRA 3DVAA 4K03A 4DLSA 4F3CA 1CG6A 3FPGA 1CQIB 3KRTA 4LE2A 4G5XA 1GDTA 3HNPA 1X1QA 4FSDA 2K2WA 1JA1A 2ZUWA 4OHWA 5HK8A 3M1YA 4WN9A 2HJ9A 1Z6XA 3VISA 3AM4A 2H92A 1M2KA 4CJXA 2B4YA 1FB5A 2O2EA 2G72A 1OZGA 3GX1A 2P91A 3KWLA 1JDPA 1RDFA 3LW8A 4WT7A 1G59A 2P2CA 3HJRA 1LS6A 3PGLA 5BNWA 1APBA 3BH6A 4NJOA 1DQZA 4X97A 2P9CA 2RHTA 3AM5A 3Q9UA 4ZA2A 3PRKE 3EIXA 3ROFA 3IMEA 3F7NA 4O1IA 3G13A 2P4EA 4G0QA 4LOHA 4ENQA 5BR4A 1KTIA 4DQLA 1K0UA 4FTWA 2EGHA 3OLQA 1PIWA 1RAIA 1YH3A 4Y30A 1VMDA 3NEYA 4RPGA 5F2EA 3VPSA 1QK5A 1PVVA 1NNI1 4Q1EA 3WB2A 4ZDKA 2YWDA 1I1NA 3FVQA 3WMXA 3QEBZ 3P26A 3I05A 1DAKA 1DMSA 3H0CA 1HFWA 3QKRA 4X24A 3NBZC 4GPTA 5IEBA 4CQJA 3N2KA 2YZKA 3GJZA 4JH0A 4Q03A 3R0IA 5JADA 4KBFA 4ALMA 3KC2A 4LJ6A 4C5BA 4Z4HA 2CLLB 2QSYA 3T8YA 4G0XA 1T3LA 1NRXA 3SX2A 4S12A 4DLXA 5CH8A 3EGIA 1WXFA 2I3DA 4ZJUA 1D2HA 2RGNA 4CM5A 1L7DA 1ZA1A 4JB3A 1QWOA 1WXQA 2BR3A 3QG1A 1II9A 3CUVA 1P45A 4OX9B 3BZUA 3HLKA 1KI1A 3P4XA 5JFTA 4QQFA 5AO9A 2O0JA 1GZ7A 3OETA 2VHUA 1PG0A 1Z13A 2PKQP 3AKEA 3JAKA 3DLIA 4W82A 4ASUD 1KHHA 5ALWA 4K2HA 1DPGA 4TZKA 5EJ6A 3CCBA 3DYBA 4U0JA 3F7OA 1NC1A 3IPXA 4M9QA 5B57C 3DAOA 3G8AA 5M5BA 2BR5A 1HLGA 1J2RA 4GM4A 3DDNA 3RS0A 1L5VA 2WSLA 4V39A 5MFPA 3N2EA 5FWXB 2WIKA 4YASA 4IIUA 4OYRA 5GINE 2HSWA 3MTQA 1PR6A 4PG6A 4YRKA 4Q4AA 1TJ5A 3NHPA 3TQOA 4P3YA 3EFHA 2J5KA 1XMVA 1Y63A 2GSWA 2BDUA 3AB3A 4OUDA 4WLVA 1GT6A 3AJ9A 5BRJA 5DYTA 5H9WA 4LJRA 5YASA 2OECA 1X1TA 1PS9A 3ROXA 1DO2A 4KR9A 1UC8A 4ZQBA 3CMMA 4XQ0A 1P4JA 2OB1A 3D8RA 3NS7A 3P1JA 1PD1A 4QYIB 2PK3A 4DRZA 1DC8A 3ESRA 4L7QA 3RFXA 1R15A 3S2IA 4PQYA 1VL0A 1NSTA 5HKAA 5I7RA 3ADCA 2XMCA 4OL9A 4X7RA 1GYQA 2B4AA 4EI7A 3LY5A 3H05A 4BEWA 5I9BA 2C2MA 2QW8A 2GNPA 2H7VA 3S1SA 5CA0A 4YJ2B 5E1OA 2ARKA 1S2NA 2HHLA 2JBWA 2Z8YA 1DJOA 3WWYA 2O8FB 5T41A 4EHIA 2Q1SA 5A9SB 4HDMA 3SBDA 5JH7B 4NX2A 1F8XA 3AHCA 1SR8A 3I1YA 1ZK1A 1U8UA 2ZEJA 1XK6A 4MYCA 4PO9A 4PSDA 4RUKA 1AA9A 3SOZA 1NKSA 3TBHA 1XNQB 3FNFA 3U4CA 2WHEA 2ZTHA 3O91A 3VKVA 1NBHA 1V8DA 4HEA6 2XADA 3A37A 3GD7A 3N2YA 2BKLA 3MJHA 3NT5A 3PRYA 2O8BB 2WSSA 5FOQA 3VZBA 4FS3A 5BRNA 4UQOA 5FL7D 2Z3WA 1W5EA 1TA0A 3KD3A 1HKUA 1RADA 3DS8A 3EMVA 3B1KA 2CB0A 2O8NA 2D54A 2QR2A 3IOCA 3EY4A 2JI4A 1MO2A 3VSDA 4PVCA 4JELA 4CGYA 1SBZA 1BJRE 4M6WA 2FPIA 3PJFA 4DB4A 2B6HA 1N9ZA 2WE7A 4KE7A 4KYIB 3ZV7A 4Z4IA 2WJZB 4RHFA 4J2OA 1WJGA 5JD5A 1BHO1 2BONA 1HE3A 5CD9A 5CDYA 4WASA 5LQJA 1YIAA 2BISA 1E9DA 4B43A 2X7JA 1LRJA 1K75A 1OTHA 1QKIA 3B9BA 2D0OB 1CZKA 2IYFA 2PGLA 1NAIA 4V0MA 2X1MA 4JUDX 4KO4S 1YZQA 3PHLA 2OYRA 2X9NA 1QYDA 4EMTA 4NBKA 4OK3A 1I7LA 2C8LA 2QKYA 2X8JB 4LDAA 2A3NA 3OO0A 4EDHA 4ZALA 3JQQA 2VG8A 5F9MA 1J7KA 1DRJA 3FTFA 3T9FA 3FVWA 2GAIA 4G0PA 1TCCA 5HW0A 1YQXA 2JRCA 1VPTA 1EH5A 4RAOA 1YS4A 4ZO4A 2I1QA 1GY8A 3Q87B 4I4TA 1OH6A 1ZNQO 4KGZA 3GK3A 2ZB3A 5UKDA 1R0WA 3LDHA 1F6BA 1N2EA 4G5GA 2IHTA 1AG9A 3A1SA 3CH6A 1GGNA 3KPJA 4UKDA 3EVBA 2WFLA 2ZSAA 5D6OA 1VSTA 2H8GA 3KR1A 2V96A 4IBOA 2AJ8A 1ZN8A 3QXCA 5C1BA 1WNTA 4ZCSA 4Q4JA 2H51A 3IRVA 2OOKA 2IEDA 1JB1A 1FYFA 1KFKB 2X8BA 4LHZA 3IQZA 4LY3A 2WWYA 1N8NA 4XGIA 4IUYA 1WXWA 2PMEA 4LSGA 1GV1A 3U1VA 1BKSB 3W5IA 3EXG2 1DC5A 1NF8A 1QWSA 3K0HA 1IZ9A 4G1FA 3M2PA 4LVUA 4RTMA 1SXHA 5F33A 3ZLUA 1SC3A 3WL4A 4BJ1A 3QWIA 1JWLA 1SQ0A 4PAGA 1U63A 1Q95A 4TMKA 4FI3F 2H85A 2LIVA 3Q7QA 3KQUA 1I1OA 2P8JA 3BA6A 2WILA 2PX2A 4J3JA 3WLAA 1A5AB 2PWBA 4IMRA 1AQNA 3U7FB 1UODA 3N05A 3K0CA 3OPYB 1PHRA 3G2MA 2WF7A 3G6WA 4QOFA 3V1KA 3VH1A 3F49S 4AZ3B 4RLHA 3WWEA 2NTEA 3HM9A 3I2KA 2DC1A 3E5RA 5J4HA 7MHTA 2ONZA 3RVOA 4C7XA 4S1WA 2VYNA 3AONB 1KA9H 4NPCA 1I7NA 5DNYB 2YZ2A 5BQ5A 2VRWA 4F5WA 3CLRD 4KP7A 1FVFA 3OE7D 2XB6A 2C04A 1E2UA 5K0LA 3TR0A 5BN1A 1T15A 2FZLA 3ZKAA 2I80A 4JZKA 1UCFA 4PQEA 1NW7A 5TR9A 3SXUA 3H5NA 2A3RA 1L7QA 2GN0A 5K0BA 2PSFA 2QVCA 3QH4A 4L78A 3TD2A 1NI4B 2EBUA 3FOAA 2OCDA 2YHAA 3AFOA 4QICA 5CDFE 2ZRQA 5GIPE 3VR4D 4HLCA 5EGSA 2GAJA 2QUZA 4QFDA 1N0UA 4BNWA 3IKTA 3CH7A 2QRNA 2O0LA 1RWNA 5JZSA 1QG4A 2QPLA 3LKVA 5ALEA 5DV9A 4KRFA 4OAOA 3QSYA 1XXHE 4U9IS 3CO0S 5I7FA 4NBTA 3UQZA 1QP8A 2C1XA 2XUDA 4N7MA 1WPQA 5LU9A 1Y48E 4E2ZA 3NHKA 4AQDA 4OIMA 5CDTA 5C52B 3H5OA 4D0RA 4IDHA 5DI3B 2Z2YA 3SJCA 3LBHA 1HSOA 2F9FA 2QG9A 4TM8A 1U90A 2NPOA 2PMDA 3WYDA 1FVHA 2G71A 1ZM3A 1KSGA 3B3QA 1F2UB 3EDOA 3O94A 2AJBA 1TTHA 3D6MA 4RF3A 4C30A 1ZMOA 3AY3A 4J75A 3U3XA 3YASA 4CEJB 2MYNA 4YWJA 4TMZA 3T5GA 5EEHA 1D1PA 4Z9XA 4MWZA 3X2SA 4JYCA 2VPQA 4YXWA 4B4UA 4EKYA 3PQ6A 3FKJA 2OHHA 3HFJA 1IN1A 1N75A 1G5FA 1EA5A 2QUHA 4TXJA 3DZCA 2P65A 2EF1A 2PT7A 3WK5A 2GMWA 2CXOA 1VCHA 2YZ7A 4MDYA 2PKCA 2YBEA 2IS6A 1C7IA 1G9XA 5JPIA 3PP8A 4DC1A 1DQSA 3OOEA 1UBSB 2WMNB 4D74A 3DV2A 2QUKA 3DP9A 4HVCA 2FFHA 1I2AA 1O1YA 1QBKC 2H08A 3I04M 4G09A 5MGNA 1QG6A 2FEKA 3LV8A 1BMTA 2FFRA 1EVZA 2CZGA 4XTRA 4I6JA 5CAEA 4OMDA 2KYRA 4CCAA 3GPBA 3HUEA 3ELDA 3KYDB 4LMBA 2W7TA 2WKRA 3KKQA 4UM8B 3LBIA 5IKOA 3W4IA 4BQFA 1JEEA 1AS0A 3P9RA 2GEUA 4MNTA 5T4FA 4ESOA 4AY2A 1BE6A 1ETUA 4K1LA 1PJ4A 5AXBA 3PX2A 3UCEA 4D8TA 2X7HA 1ULAA 4MS4B 4BTLA 1TX4B 2BGTA 1BVYF 3KV1A 4X1IA 3FUWA 3GC6A 3AZPA 1PFGA 3H1FA 2C83A 4IEEA 3EFOA 2X5KO 1E89A 3PPWA 1R8JA 1NUUA 2JARA 2XUJA 1CKEA 4IJWA 1JEAA 1EAMA 3OLXA 4OYYA 3JATB 3VHQA 5LNK6 5A02A 1BDBA 1D2MA 3DE2X 2G09A 4B5KA 3JQRA 2WJJA 2JIOA 1PJQA 2EFDB 3AERB 1JFTA 1Y8ZA 1V37A 4D9GA 3JPWA 1QB8A 2MMCA 2O50A 1X7XA 3OP1A 2ZI7A 1DTEA 3P9QA 1YDHA 1M74A 2QUBA 4L74A 4RD2A 2W4IA 4Q3BA 3W34A 1N1MA 4JJ8A 2ID9A 3UB4A 4BCBA 3D6TB 4AECA 4OSOA 2DTXA 2FDXA 4XD7A 5J5VA 3E27A 4PYRA 1JG4A 1US8B 1TM3E 3EARA 5T8KC 3RT7A 1QOZA 3QYJA 3ES9A 3EXHB 4M1OA 1UBLS 2F64A 3BBLA 4CDRA 4DDTA 5HOQA 2RFLA 3MW8A 5F2KA 3IXQA 3CGGA 1ZH0A 1E8MA 1WCYA 1H2XA 3PD7A 3BCUA 4LIPD 2XE8A 3DTVA 5JEDA 2CUTA 3GW8A 4KMMA 3EGXB 4FHFA 5KJ6A 4H77A 4KWCA 2IYQA 1S2GA 2D3WA 3OCUA 3PG5A 4EITA 3AKZA 1CF4A 1FU4A 1KVRA 4JX8A 4L85A 4U63A 5E3JA 5FWNA 2H2WA 1FYDA 1RABA 5EUBA 1FEZA 5LQKA 1ESZA 1N2OA 4U9UA 4P53A 1HE4A 2XUGA 3EN0A 1A9RA 4I2VA 5CLQA 5E6SA 2NVUB 4P32A 5EWMB 3OQNA 3GLIE 2FMXA 3ENWA 5HILA 1TGYA 4LCBA 4IIVA 3REOA 4FC6A 4UBIA 3QXJA 1J07A 2BN4A 3G88A 3TIIA 4Q9IA 5L4LA 4ZD6A 5KYGA 3LBNA 4INAA 4EGFA 5I7HA 1QHHB 1GPLA 1YMVA 2P9BA 3CO5A 4Q24A 4Q93A 3UICA 4F4IA 5TPZA 4C03A 4EL0A 2XIJA 1FJXA 2IYPA 1FZQA 3K0SA 1L6RA 1EJBA 3QK7A 1DFHA 5J2UF 1NV8A 4KAXA 1FOEB 3KK0A 3MAAC 3QBDA 4PLZA 1E79A 2O0MA 4B6PA 5AHXA 1B8VA 2XTZA 1VG0B 5DHTA 4HB3A 1WQ1R 2CLSA 4G89A 5KCZA 3FXAA 2J7KA 3TX6A 2KE5A 3GAFA 1T2UA 1M2NA 1OR8A 4D4HA 4FOTA 1PWZA 4BV2A 1EDOA 4CL8A 1G0OA 3PT9A 3RC8A 3RGWS 2OORC 2OQIA 3A25A 3IOYA 3LZCA 5ANRB 1D4ZA 1JPVA 1JQ5A 4IZHA 5H83A 3CRRA 1R18A 2IHVA 2JLCA 5EJFA 3TLKA 2XAUA 1IBCA 4ND6A 1JDNA 1W52X 1SB9A 1T5DX 4URUR 3AVQA 5H02A 5IBQA 2R6ZA 4L8LA 3DOHA 3ROEA 2JJYA 3QVTA 2K5UA 2X0JA 3S2EA 4NEHB 4CCSA 4B0PA 3BWMA 1HBJA 3DE5X 3BGIA 3N3AC 3QEJA 4R2JA 3G0HA 2WKSA 2FFAA 2Z4RA 2IYWA 2RARA 2POCA 4X90A 1MH1A 2ZIXA 4ESVA 3OSUA 4LF9B 1ZM7A 3NC4A 3SQOA 4YRAA 4UCWA 1GNQA 3MBIA 4K3UA 3B60A 3EE6A 5AQ1A 1L4FA 1NJSA 1WW2A 2KLHA 4IAOA 1NWCA 5IC5A 3N59A 1XYGA 1XRRA 1NBIA 2QN7A 2I54A 3ND9A 2YICA 4GOLD 4KHZA 3D3JA 4CN9A 5JCZA 1C9KA 4IILA 4D3XA 4R8SA 4TTAA 3IURA 3U56A 1J2TA 3A8TA 2IEAA 2Q5EA 1U02A 3ESXA 3GJ7A 3IUMA 3K2QA 1W87A 4JGIA 4BB5A 1FYEA 1QRAA 5G4KA 4EHJA 5FI0B 4CKBA 4HQFA 5KOHB 3DW3X 1P8AA 4MJLA 3SZUA 1AV7A 3HGMA 4MULA 2ECKA 2P2LA 2VDNB 4WKBA 1Z35A 1JX6A 3H1GA 5CB4A 3EAQA 2QXTA 2RHRA 4MKIA 3ZEAA 4C4SA 2G25A 4KQHA 3PR3A 5DXFA 2BFAA 2X22A 1KYWA 3BHIA 1GA4A 1GQRA 4UOQA 4DZZA 1AB6A 5A2GA 2IEBA 3NWJA 2PKXA 1SU7A 4BLQA 1P0PA 2NXJA 3HE3A 4M1ZA 2HYDA 1A95A 3A6LA 3I6QA 4HDQB 1FX0B 1QG0A 4WV3A 3OMWA 2QENA 3PFWO 2CN1A 1RCUA 4NZOA 4X20B 4YJHA 4B84A 4WH0A 4E7OA 3I5MA 1OBVA 3HMKA 2ID7A 1JEYB 4QA9A 3H3XA 5TMDA 3KAJA 3TSWA 4MLPA 2CL7X 4K87A 1NW5A 3FPKA 4E1BA 2J3KA 2Z2XA 3BC1A 1E0AA 4FGUA 4XM0A 4DA4A 4WZAE 3GGJA 2P7IA 2AMJA 4NCJA 3PNMA 4ML3A 5K8TA 1E6KA 3PEUA 2C03A 2Q2WA 4MWTA 2GN8A 5HTKA 1MA3A 1VMKA 2Q2QA 4NAHA 1R0CA 4KVAA 1NULA 4HWOA 5D7NA 1S8OA 4F96A 3RABA 3ACBA 1YZUA 3EASA 3HL0A 4NMMA 4Y2UA 3H0KA 4QSHA 5AW7A 1F2TA 1WU7A 2HM7A 3F46A 4IX9A 2FE1A 1M67A 4HNAB 3TR5A 1DQRA 1YIDA 3JQEA 1KXZA 5DOVA 1QQBA 1RPJA 2EJBA 2J67A 3FM9A 1P1FA 5CA0F 1KZ1A 1VE5A 1U7XA 3FYHA 5DTIA 1MV8A 3SFTA 2GS9A 3TSYA 1BFDA 3O4GA 2FEOA 1KEKA 1BGWA 1E4EB 2V45A 1NL3A 1PSWA 2EJTA 1Y7HA 4F7DA 2RGAA 4Y2JA 3DKRA 1J1UA 2Y0PA 4J2TA 1ZSVA 2HTFA 3GUVA 4MJXA 3B1JA 4JB2A 1GNSA 5K7SA 5LMZA 3VAAA 4LF8B 1NBEA 3HG7A 3TPZA 1Z4KA 5F78A 3RYCA 1BQ3A 1YDMA 4FGSA 5C9ZA 2WA2A 4EAQA 1BWSA 5E7MA 5EPUA 2VF5X 3K1ZA 2OFXA 1KRXA 1GQ2A 2GD1O 2W42A 5C51B 2DLCX 3WLTA 1SBYA 1JEDA 3LX8A 3FMGA 5EZYB 5ESXA 1C4XA 1QHNA 3IERA 2FY8A 1F0PA 2W70A 3EQ6A 2Q9AA 3H9CA 2QTAA 1M6VB 3QNUA 4J03A 3VQTA 3CNBA 3EQ2A 4K28A 5CP8A 3VU1A 1RMTA 6AT1A 4CV3A 1I6LA 5GONB 5JWHA 4C5AA 1N2CB 4QBIA 1M1NB 5DLEA 1VQ1A 1YB5A 2CL5A 2Z95A 4FMBB 4UUNA 3UA3A 2NW6A 1T1EA 4WKPA 3HA2A 3LT2A 2QP9X 1FC0A 1OWMA 3Q7SA 3K4PA 1WNFA 4I99A 1UKZA 2BFPA 4X6UA 1LQUA 3C8UA 5DHSA 5SZJA 3GFOA 5AM3A 1YJAA 4CLRA 4HDKB 4CKYA 1NURA 3S29A 4IDBA 3OKPA 4RZQA 3QOXA 2QVXX 1KSJA 3QVXA 4O4LB 3TO5A 2Z3VA 4JB8A 1CHNA 4A10A 4QFCA 1P2SA 3PYMA 2GEKA 2DM6A 4QTUB 3NBFA 3F8TA 2VPTA 1VGRA 3A9SA 5JMTA 2JCVA 3N58A 3R9XA 1L7BA 4I4TF 3R0VA 4LHYA 3ETJA 4GZ5A 3IOEA 1WUKS 2VHEA 4PV7A 4BWFB 1OFHA 2A5JA 3FKQA 2PX8A 2XA2A 3N8HA 3BF7A 4RPCA 1XEXA 2BGKA 2UVPA 5FOSA 4F04A 3P2OA 2FN4A 4DF3A 1QRDA 3OCCA 4CM9A 3T7CA 4QYMA 4EI2A 1W5TA 3RVDA 2QN8A 3MM4A 1F3OA 3W5DA 4HBZA 1TUBB 1VKJA 1DXQA 1I4LD 2QIPA 1J1IA 4JC4A 1HUQA 2Z2IA 3H2BA 3LVBA 3RNLA 5JBNA 1U99A 1QQTA 3BICA 1A4XA 4M1EA 4UUMA 3ROGA 4C01A 3JQ9A 4MIOA 4H31A 3OEWA 3KTFA 3N6RA 4NV0A 3S2YA 4AJKA 5AYVA 1DNPA 4YDRA 2W43A 1KH1A 3CSSA 1FTNA 2PZEA 1UOEA 4BO6A 1ZMTA 1CFZA 4KFUA 2CMHA 4L5AA 5E3IA 3P9ZA 3KWJA 4BO9A 4M55A 1Z47A 3WBKA 1A9TA 3DFFA 4OHOA 3I64A 3IO5A 4H7KA 3EGWA 2BY4A 4UOEA 5EJ2A 4UU0A 5A4AA 1VHQA 5FP0A 1KDPA 2QU7A 2ZBUA 3BD6A 1D2AA 3BXFA 4MW4A 5GJBA 2PUVA 3BPSA 4HH0A 1DAMA 1VCNA 5TV2A 1TPYA