4RA9A

Crystal structure of conjoint pyrococcus furiosus l-asparaginase with citrate
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
182
structure length
182
Chain Sequence
MKILLIGMGGTIASVKGENGYEASLSVKEVLDIAGIKDCEDCDFLDLKNVDSTLIQPEDWVDLAETLYKNVKKYDGIIVTHGTDTLAYTSSMISFMLRNPPIPIVFTGSMIPATEENSDAPLNLQTAIKFATSGIRGVYVAFNGKVMLGVRTSKVRTMSRDAFESINYPIIAELRGEDLVVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional insights into an archaeal L-asparaginase obtained through the linker-less assembly of constituent domains
doi rcsb
source organism Pyrococcus furiosus dsm 3638
molecule tags Hydrolase
molecule keywords L-asparaginase
total genus 58
structure length 182
sequence length 182
ec nomenclature ec 3.5.1.1: Asparaginase.
pdb deposition date 2014-09-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold L-asparaginase, N-terminal domain 4ra9A00
5F52A 1JSRA 5CBPA 3ECAA 1IHDA 1HFJA 3NTXA 2HIMA 1JJAA 1HG0A 2JK0A 1O7JA 4NJEA 5K45A 5K4GA 1NNSA 4PGAA 1WSAA 2GVNA 3NXKA 5K4HA 4R8LA 3PGA1 5I4BA 2P2NA 5I48A 1DJOA 1HG1A 5I3ZA 4R8KA 1JAZA 5K3OA 1JSLA 2WLTA 2P2DA 1DJPA 5DNCA 4Q0MA 2OCDA 4RA6A 1HFKA 4ECAA 2HLNA 1WLSA 5DNEA 1HFWA 2WT4A 4RA9A 2D6FA 1HO3A 1ZQ1A 1WNFA 1AGXA 1ZCFA 5DNDA 5HW0A
chains in the Genus database with same CATH superfamily
5JSKA 1CV2A 1NQAO 1V11B 1VSBA 2H9AA 1ATIA 2EFGA 4JLBA 5DM4A 5IH7A 2OHXA 2XSZA 4AY4A 1ZP6A 3CM0A 1QV6A 1HG0A 3PE6A 1N57A 1YA6A 1L4GA 2WR8A 3MT7A 4IFTA 1ISHA 2I2AA 3HZOA 3F98A 4HEA1 4F93B 2AE1A 2F55A 2JATA 1PEAA 1A9QA 1XDSA 2JIOA 1BHO1 1Y3FE 1S6YA 3ENZA 1RRCA 1F9AA 4MDHA 3W4IA 2FRVA 3PA6A 5JCXA 3V1TC 1ZD5A 2UXDB 4R1PA 4DT1A 3D2LA 4B3XA 3MRSA 2W8BA 1W36C 4Q6WA 2LGJA 3CH7A 2GB4A 1ECGA 2F1OA 3CSUA 4GT1A 4BV9A 4G8BA 1U0OC 3DE4X 2VQDA 3QBJA 1GKLA 1L4FA 2JFNA 4HJXA 2PV7A 3MOIA 3QLUC 2CC2A 4Q1EA 2WF6A 4E4YA 4O2BF 5BW5A 1M73E 3BIOA 3THWB 1H2XA 1ZONA 4X84A 1NNUA 5DF1A 4DABA 4ESHA 1K5GA 2HMUA 3C1UA 3GT4A 2OXIA 1EGMB 4AQYB 4K81B 2X77A 3F4BA 4OEHA 3AM5A 3LE8A 1YOBA 3KQMA 2J32A 4DMFA 2RDMA 5FV4A 3QLVC 4IZOA 5UKDA 4BNFA 1NR5A 3KK0A 4G4GA 3NWPA 2XMQA 2ZFUA 4DY4A 3V4VB 4CLOB 1J5PA 2ZSJA 4I1IA 3WRVA 4N5DA 3CWZA 4UASA 4ZMRA 5K20A 3IAFA 5BSKA 1SULA 3IEMA 2OK7A 4CNBA 1KEKA 2GKSA 2Y9PB 1ICIA 5FUXA 1PL0A 2CDNA 1N5MA 3IAAA 1QB8A 4WZAA 5DBHX 5G4KB 1TM3E 4MDEA 2H7VA 1B2RA 1QQTA 1T4CB 1Y1RA 3QE4A 4EBFA 1TOAA 3VOSA 2YIJA 1EQUA 5BV2P 3ROGA 5DRYA 1E3TA 2HSEA 2XUQA 3C7KA 1K4KA 4P35A 3G2HA 4UBMA 1X7WB 2P6OA 1DAPA 2XMCA 4I1OA 2RI0A 4Y2HA 5HDQA 4BN5A 3W5AA 3H2KA 3FCUB 4R2JA 2I22A 5CP8A 4W5HA 4BKMA 4IYJA 4RK4A 1YQQA 2YZ7A 1X1AA 3HYSA 4TKUB 4LOHA 4TYYA 3R77A 3LQRA 3VRHA 1KVQA 2N46A 4KQ1A 4UAGA 4YQEA 1ZVVA 4PM4A 4P9NA 1GCIA 221PA 3VH3A 5CVTA 1A96A 5KJFA 4IDPA 1X7GA 3OKCA 3R5TA 1GAWA 1U9IC 4ZVNA 2X42A 2ZRFA 3EDOA 1DHRA 3EA4A 1XO1A 3P94A 2E4ZA 3UF0A 4FXOA 1FSFA 1Q20A 3CZ4A 4MWCA 2PMBA 3I64A 4AG5A 4TM7A 1EFAA 2A0FA 1Z4JA 2X1HA 1J1IA 1U0GA 2RHDA 4LF7B 4KR6A 4AP9A 1AOXA 4DV3B 1V3QE 3ZE9A 1WL8A 1X1RA 4RTRA 4EENA 4WINA 5K0CA 1NZDA 2VH5R 4M9UA 3IYLW 2WVHA 4ND6A 4L51A 4OJYA 3QVXA 5GV8A 3UB2A 1XCPA 4TMYA 1TZKA 4MMYB 5FA5A 4B44A 2X6TA 3A58B 1U3CA 3PVSA 3NC1C 4RA6A 4XJTA 2YIDA 3SR4A 4PAQA 4E21A 4LX8A 2J3JA 3R6LA 1A8HA 2LIPA 4QXAA 3ESYA 4KPEC 3T1NA 3ZHYA 3A2NA 3D8TA 2ZJ0A 3WJ7A 4LZAA 4Z3KA 2RGYA 1N0WA 2O1EA 1ZGGA 4TKUA 4W8HA 3WLIA 3I58A 5D8DA 3C85A 4OJNA 3EUFA 2QRUA 1D4AA 2WM8A 3BJEA 3EGXB 1ZCBA 3E3OA 4PS0A 3M6FA 4GI2A 3COYA 1GM5A 3T3OA 2R8YA 3P0FA 3CLRC 1MG0A 4O4LA 3NP9A 4P2GA 4OGLA 5E2IA 2PZEA 3FLEA 1RRVA 4AZVA 3GVXA 1I10A 1RWXA 2FPWA 3OECA 1DT3A 4N18A 2O2XA 4XYGA 4BFWA 2JD0A 4AK9A 1J09A 3FY4A 1ZMRA 2C9MA 3MBKA 1KEPA 4JCCA 4JLOA 5FF9A 1MN6A 4J0QA 4WOKA 3T7EA 2CEAA 3OJOA 4MIYA 3EVAA 3VNRA 4YMVA 3IMCA 4I8DA 3E4DA 2XB8A 4HX9A 4MUGA 4I4NA 3H5IA 2VZ8A 3WKCA 4B5KA 3B7GA 3VTAA 4Q02A 3J81A 3ZXSA 1A7AA 1DE0A 2P9QA 5BSGA 1CQZA 1KI6A 4JYMA 1TYCA 1RQ7A 2KWIA 3RDPA 4UM9B 1MR3F 1SBNE 2YFYA 4K2HA 2H7XA 4PSKA 4ZCPA 1EK1A 3K0HA 3MRTA 4JX9A 5KSOA 4D8WA 1YMQA 2YXPX 4FE4A 5AVVA 3AQIA 1DIOB 2NQTA 4NH4A 1ZGCA 5D6OA 4JBIA 3GO4A 1E9SA 1XEFA 1I2ZA 3DXXA 2X8WA 2ID8A 4JJ6A 4BJ1A 5K09A 2J9RA 4R31A 2HWWA 1RWKA 3BZBA 3QKRB 2HT1A 6ADHA 4N3BA 4CT5A 1SCKA 3OLXA 5H4GA 5ESWA 4KYIB 1G5RA 1MEJA 1G3QA 2J9XB 1KI9A 4HH1A 5CM8B 5DBFA 2I4LA 3T1VA 1SU7A 3A6DA 5FH9A 5JJCA 2SICE 3I45A 4C3VA 1G18A 3U39A 1U3VA 2VPQA 1X13A 2IJGX 3EVFA 1FQOA 4PZPA 3T34A 4EO9A 1R64A 3NATA 2QXUA 5JIBA 1XXHB 3FCSB 4C0SA 3BIXA 1T3LA 3GF4A 5CPFA 2CL5A 2X0DA 2YN2A 4LXHA 3S1AB 4WCDA 5E6UA 1HDGO 4HGPA 1GRRA 2BUBA 4MHOA 5J3JA 1VKOA 1ONPA 2A4MA 2OUIA 3DL4A 3R24A 1L5LA 4DY6A 1I4LD 5EHNA 3MGCA 5A62A 3ZDCA 1VCHA 2Z09A 3FZNA 1BA2A 3T4PA 2I6SA 2MSNA 3GEEA 4FIZA 4G85A 4L27A 4R8MA 3VNSA 3VSAA 3AI2A 5IXYA 1EXDA 1KFJB 1NW9B 1TLLA 2OB2A 2RHJA 1EM8B 1WDLA 1IQRA 2V0CA 3EH1A 4NR0A 4BQNA 3LK6A 3ZJ4A 2HMTA 1L5YA 1FDTA 3JVUA 3GLIA 3T7SA 4ARIA 3QUTA 2XUPA 5JR3A 4J8PA 5JY1A 5AKXA 2V9CA 4EO7A 5JYBA 4FWTA 2VJMA 2XDQB 3FUWA 4C21A 3VNUA 2YQ5A 5EMNA 4RJKA 5D3KA 2HSZA 4BU0A 1U90A 1OXUA 1TVMA 1AK2A 1M0WA 3W0LB 2EKZA 3CVYA 2HB6A 3BEDA 2YWGA 4DPKA 4AZSA 1EFVB 1QYDA 1SOVA 4DCJA 3CF4A 4R7ZA 4N7MA 1K2WA 2IP4A 4HWKA 4EB8A 4LBWA 2GBGA 4DV0B 3CR7A 5FPQA 3SYTA 3U60B 1TZMA 5EPUA 4KE6A 3RS9A 1DGQA 2RHHA 2Y27A 3CT6A 4OI2A 4H15A 4GGPA 2D8AA 3TLAA 4RPJA 3CUTA 1J0EA 2IF2A 4MR9A 4TLAA 3UGKA 3U13A 4FU0A 1XDWA 3RSLA 4UHFA 1JG1A 2NUTB 4IZHA 3AB8A 2VTEA 3N87A 1JFFA 3IAHA 5G53C 4ASUA 4ETNA 5AIBA 2B5VA 1ORHA 1JQ3A 2XB9A 3DDCA 3LAWA 4MIOA 4YUXA 5IT4A 1PW5A 2FGKA 5A4AA 2ENUA 1JR6A 3UJ7A 4L4ZA 2CY0A 2XUZA 4M8SA 5EVCA 5EUBA 3FFBA 2FPUA 3T7CA 4YV7A 3CUYA 3NO4A 3D3WB 1XEXA 3HBNA 3REQB 1ELOA 1OVMA 2I3DA 2XSZD 4YRBA 1RBQA 1Q2UA 2D0PB 3F3YA 4B9EA 2UYOA 3MCWA 4IYRA 4UUPA 2HDOA 4HDRA 1ANKA 3JY6A 4C43A 2ZKLA 1QWOA 3IUEA 4AKIA 2PLWA 2BGTA 4QRIA 2BFAA 2CCKA 4PWZA 1U6KA 1XT6A 4EHFA 1BD3A 4K9NA 1RWWA 3EFHA 2B8EA 4B7CA 3UAWA 5JC1A 5F7OA 5CD1A 3PT5A 2H7CA 2P8JA 1KKLA 3BA1A 4NI5A 4HMPA 2H65A 3DUFA 1L1EA 4TV9B 5HWSA 5ALDA 4F85A 5KYYB 1GTL1 3KHUA 4BNXA 3KV1A 3BSWA 3N53A 1HE1C 4YT4A 1Z7BA 4HEJA 4MROA 5AW4A 3D7LA 2OKCA 5AM4A 2Z30A 5CJPA 1USUA 3LVBA 5EE0A 3SIPA 3KLPX 4H9GA 4PZYA 1H1TA 3R4VA 4S1TA 3R2JA 1KU6A 4R41A 3D02A 4BEWA 4Z49A 4TWBA 2II6A 2ZLBA 1EVYA 4RELA 1JQKA 1T36B 3I12A 1W9MA 4ZI3A 3KEOA 3ZWKA 3TD6A 1Y3AA 1IK4A 4NOMA 1QF6A 2ZJ7A 1F2TB 3OJEA 1IQPA 2GJAA 2H31A 3IUMA 4QNRA 1NC3A 2GF9A 2F17A 4PO9A 5AOCA 1ORIA 1VLHA 5K3DA 3UWMA 4KACA 2WQ7A 5TRTA 3QQPA 5K8IA 5LZ8A 4AKEA 3MINA 2FHSA 2ZYVX 5EI5A 2PCLA 1CEYA 5EJFA 3QOFA 4F4IA 3EULA 2HK7A 1UKCA 1AG9A 1T0IA 1MXHA 1U0SY 1JQJC 5DNEA 1U0EA 3GCZA 3E3MA 4FJ0A 2XD9A 2JFOA 2I03A 2H2GA 3B6JA 3S1SA 5GVRA 3NEJA 2IYTA 5ALHA 2YJGA 4RM3A 1U0BB 3AU8A 1PR3A 5DCUA 8ATCA 2ZCUA 1JA0A 2GTIA 3WBJA 4QU9A 4BTEA 1U4NA 1UBSB 4HN2A 3V4LA 3QLEA 3NKFA 2VR1A 1XTKA 4UMEA 2D3WA 2PQ0A 2DY0A 1PLLA 2H4FA 1P80A 2D59A 3LT4A 3O1JC 4JYCA 4O6VA 5EG5A 5JBIA 2GKGA 1RU3A 3PTLA 4PY2A 2ZI5A 3IJEB 3V6LA 3ZTWA 5MGBA 3FOFC 2G28A 1AKYA 4IEFB 4RHUA 1G66A 1YS9A 3MHTA 4B3RB 1MGPA 2I62A 1W7AA 3U49A 3IB6A 4O4IA 2XUKA 2HXGA 3ZV7A 5E8JA 3L7AA 3KKNA 5AW1A 4L78A 1YZNA 1O94A 4V0KA 1E0DA 5AKLA 3ZW9A 1WOYA 3K94A 4BPBA 2QN7A 2VJKA 3ETGA 4CM1A 5JMTA 3RYHA 2PS1A 5JJKA 3YASA 1GGJA 4GKJB 4DQLA 1HRDA 1QGZA 3I09A 4XCVA 4NWIA 3IEXA 2PFGA 4ENQA 3Q41A 4YQYA 2ZPTX 3K9HA 1SCQA 1POXA 1TIBA 1XPJA 2ZB7A 4B3MB 4Q19A 4B47A 1K89A 1R9MA 2FUCA 4QQNA 3KKLA 2GF2A 4KXNA 4R8KA 2PUGA 1TKCA 4AJ4A 2VAMA 3C5WP 5FRDA 4LGYA 2REXB 3UATA 1T8TA 4M83A 4F38A 2DEUA 4B4OA 3LSYA 1EA7A 4WBNA 3MTAA 2VJCA 2X3FA 3FLBA 4WE3A 2Q3EA 3KB6A 5HE8A 3IKVA 3RKSA 1MDFA 3BG5A 1D2RA 1Z06A 1LF0A 1UP7A 4L2IA 3SQWA 4P0PB 3HKDB 1TFRA 3T5TA 3B3GA 1A9XA 4HDCA 1W6RA 2FR8A 3AG5A 3AUYA 4LJLA 2REOA 5EIAA 4N6NA 1ZM7A 2CLSA 3OJXA 4UVIA 2XQFA 4B43A 1JAIA 4FQ8A 4BGUA 2F1KA 3H1PA 2CJYA 2MU1A 4G41A 4Q7JB 4EHIA 1PQPA 5C7YA 1UADA 4HL6A 3NVMB 5LJIA 1XA0A 5CK5A 2ECQA 1ZCAA 3HB7A 2ZUFA 1MC1A 2G9UA 4WWHA 2QYTA 3RSOA 4K0KB 1ZSYA 3EWSA 1QQAA 2EZTA 2AN4A 3HFJA 3EVTA 3OCYA 1E8NA 5HILA 2AXEA 3U7QA 2CDAA 4DCUA 3M6AA 3T61A 1RKUA 2EIHA 3AERA 5D3QA 1BNCA 3GRVA 4MS4B 5JVDF 4H59A 3VISA 3WIOA 1ZRSA 2YMMA 3IEUA 4A15A 5LU9A 1U2QA 4C2UA 4Y2XA 3N8IA 1K6IA 2A84A 1O95A 1GGEA 1F3OA 2CB0A 5A3JA 1E9VA 2PUJA 3GLGA 4M86A 2WM2A 4BQPA 1DPFA 3DO8A 5K0TA 2AWOA 4WOJA 4PNHA 4ZALA 3M2TA 3TD2A 1ZMTA 5HCUA 2EGHA 2RGCA 1E2JA 1PJLA 1FP4A 3NDIA 1KMCA 1FJ2A 5DEIA 3NHYA 5LP1A 1IONA 2FR1A 4EG5A 3U40A 1XYGA 1L7MA 1LQUA 1FRVA 3M4XA 2IOYA 4DL9A 4WDQA 4BUZA 3FZQA 3GFBA 1Q19A 4E5SA 3GDFA 4MGYR 4NYMR 1T29A 1YRYE 3DE0X 1Z0AA 3BFVA 2QNBA 1SU4A 1WR8A 3ADKA 3FPFA 3OZTA 4WVFA 4Y7CA 3UJPA 2B21A 4L7VA 3MCAA 1XTIA 3EQ6A 3GRRA 2VBIA 4IMIB 1JI0A 3MA0A 4KMMA 1Z4MA 4ZDKA 1MIOA 2WTNA 4FFDA 3TN7A 1IATA 1GUZA 4RPLA 5TMEA 2ZWMA 2X8LA 5DNUA 4J0FA 4X3CA 3FUXA 1NBMA 2J8ZA 1OLSB 4G0MA 1X70A 4JXJA 5CLIA 1QZ3A 2EYUA 2FF5A 2VJDA 1X7XB 3F96A 2VJOA 1JHVA 3EASA 2X86A 2VCHA 2ZUCA 3EBLA 2C77A 4O2LA 3TAHA 13PKA 2FV8A 4E6EA 1P1BA 4NESA 5B2FA 4QBTA 3U7RA 1A2QA 3OE5A 1D5WA 5AJHA 5IC6A 2FKNA 3U7IA 3UB3A 3NBXX 3ZH9B 3DO5A 3QEMB 3K0EA 2G40A 2ZS8A 1X19A 2QD1A 2VA9A 4D0LB 3P20A 3L8MA 2P4HX 1GL7A 4EI8A 3TSZA 1SQ5A 4OUKX 2CVFA 3K71B 4FEGA 2AN3A 2H3EA 4HVAA 4R7GA 5FO0A 1E4VA 1O6BA 3LXXA 5ALOA 4TXHA 4JELA 1S8AA 2F1HA 4DW8A 1I3CA 1UQTA 3W5DA 3I5AA 3FOEC 2L17A 1YC5A 5ALKA 3NVDA 4KLZA 3AUKA 2RG7A 2NUAB 4AYWA 5J4VA 2XAAA 1E1LA 3A11A 3G7SA 1PO7A 2MYNA 1RYHA 2VBFA 4MWDA 2WWFA 1S9HA 4FPXA 1Q0ZA 2VDOB 4MVJM 3LLCA 2FFRA 4MUBA 2IWRA 1TYZA 4B79A 2X2PA 3KV3O 3PITA 3WGLA 1JAYA 4RO0A 2XGJA 2BMFA 1AHNA 2Q3LA 1EZ4A 2HPHA 1R9NA 2A9KA 3EGXA 4GDMA 5C4GB 2UZ4A 3HNOA 3O2JA 2ZB3A 4YGXB 1B73A 2QM8A 1C9JA 2FW9A 1JPJA 1E1QD 1TB4A 3TLXA 5AUPB 3PQ8A 3MUFA 2EX0A 2OBBA 4R2KA 3AIOA 3OX3A 3QPCA 1DX6A 2V4MA 1OU0A 4JYPA 4YUYA 1XZIA 1FBTA 4E2YA 2B2XA 3FDJA 3Q2KA 4OIFA 2HIHA 1DRVA 4JODA 4PZ9A 3NTRA 3RBAA 4FCTA 1KU0A 1JXQA 5BO5A 4AUNA 4UE3S 3W90A 1XRPA 4QULA 4ZYZA 4MQMA 2WFAA 3GU3A 5HXAA 4NYMQ 2NO7A 4EBBA 3EIEA 5CIYA 4HWSA 4CMKA 5IN5A 4AS3A 3IELA 1H3FA 1USKA 3RF7A 5KSYA 1V26A 2CVOA 2GLTA 3LGAA 2NPOA 4DJFC 2F62A 5A02A 1DKUA 2B5WA 3OOWA 4UBLA 4DILA 5FLEX 1AY0A 4I2NA 3SJAA 4Y30A 4AICA 5FBLB 4HYYA 1G20E 4JQYA 1PJCA 4AJ1A 2R86A 1II8A 2W2KA 3PPWA 2PEZA 2GUWA 4JP3A 3VYVA 2HDWA 2ZR7A 1P2VA 2PZLA 4M49A 4EYGA 2ZM6B 3IIMA 2R60A 1V5IA 4LNHA 1U7DA 2A0WA 5DI3B 2NQ2C 4A0RA 5JHGB 1YQ9A 2IDKA 4UNSA 2IHUA 4A6EA 1P2DA 3R40A 4UE6A 1I4DD 1H9CA 3K15A 4RWEA 3I04M 5F9HA 3CUSA 1IYZA 1W1UA 1GA6A 2Y1FA 3DV2A 2FEAA 3HADA 2GUGA 3MWDA 3O4FA 2IV3A 4OK6A 3TCKA 3WMEA 1MPTA 1NHGA 3K1AA 4CODB 5INTA 1PE0A 4HAUA 1AK1A 1JG6A 1RLJA 2AH5A 3I2KA 4OJKA 3RNOA 3U56A 3RANA 4YUWA 3PBKA 1JKFA 4Q9IA 1TYAE 3N86A 1O6ZA 1Z2NX 1PGNA 4L85A 1LUAA 1UM9B 3QEOA 5EEGA 5TMDA 4PXYA 2B2NA 1L9KA 4LVOA 4AL4A 1JDVA 1ZK1A 4BO6A 4IWXA 2D6FA 2O5CA 4ND8B 2GK3A 4CHTA 1IY1A 1JN0A 2K4MA 3ETJA 2FP3A 3GCGA 5C2JB 3OQNA 4CEIA 2QX8A 2JAHA 2YY5A 1JR3D 4NBUA 5D00A 1C5KA 2JASA 3GFFA 3LRPA 3MFQA 1ZU5A 1FDIA 2V7PA 3E6AA 5F21A 3A1EA 1MO4A 3V80A 1TT5A 3W9UA 4E1VA 4XWKA 1RYYA 3BIJA 1GPH1 3QUBA 3WGOA 3ZHCA 1SXJA 3KAPA 5HIIA 4I5EA 3WDLA 4IW3B 1JXMA 2OP1A 1STOA 2QHXA 2UZ3A 2DUJA 5HKLA 3WAKA 1MMFB 5F1KA 3L9WA 2Q5OA 3OQPA 1CJSA 4G5XA 4Q37A 3PQCA 5JU6A 1NVBA 2ZYSA 3O4RA 3HUTA 4JJ8A 4PNZA 5THKA 3V4PB 1YB2A 4IG9A 3SAJA 2WWWA 2PZ8A 3TFWA 4F5EA 1B6TA 3N0XA 4N5LA 2QYSA 5CBPA 5JANA 1G0NA 4NICA 4UM5A 2G82A 2QR3A 2BBSA 1H6BA 1XAHA 3GUCA 3DEYX 1K8XB 3H8WA 4KDCA 5KNCH 1B6RA 2XNKA 1NW4A 4RPHA 2MOKA 2R00C 3G9XA 1SUFA 4I4IA 4OGKA 1Q7RA 1ZHFA 2W71A 4N65A 4TRNA 3RJ9A 2A58A 4PHHA 3QVSA 3H2JA 3SSAA 4ARZB 4EFMA 4NECA 2FPMA 3QG1A 2ZRKA 3PJDA 3W6PA 4HLCA 3CTPA 3RVRA 3PK0A 1EMDA 4KNWA 4AWXA 2XTMA 2L2QA 3L9XA 1W73A 2AFIE 4WFKA 4HV4A 4IJMA 3LUCA 2GRAA 1V6AA 3U4CA 4NCAA 4YJHB 4UFNA 1MF7A 2GD2A 1JU9A 5JAPA 121PA 3BOSA 4ENVA 4I66A 4O2AA 2Q0XA 4D4LA 5A4MS 2Q4EA 3G9ZA 2AEEA 2M6LA 3F5MA 4MRVA 4A8JC 4QQRA 1VA4A 3RAEC 3IR7A 5BYBA 2P8SA 1MFZA 1GXSB 2R6AA 3F8WA 2FFAA 3WWOA 2PSSA 5JAZA 3DGEC 4BB5A 1TEXA 2N47A 4TTPA 1WQ3A 4ONEA 5IVHA 2NO5A 4LISA 3LX5A 4ZI5A 3S2FA 1ECCA 5BXQC 3KQKA 1AGYA 3PHCA 1UZAA 4LDNA 2PT6A 2JLSA 3ZEAA 1O95D 1Z6PA 1G21E 3GUUA 3IKMB 4RFSA 3P9CA 4P0TA 2GERA 3HHEA 5FNVA 4EYOA 3CO5A 4NZ9A 4WZBE 5AICA 4B7UA 4C7XA 2XJ4A 1OZGA 1CJKC 2GCNA 2Y8EA 3HVIA 4QM6A 1Q0HA 1PR0A 3K30A 2UVQA 3MJHA 4LQLA 3CCBA 3KKQA 3PC7A 1G6OA 2XVMA 4O1IA 4ZEMA 3EPHA 3NHAA 3K09C 4XWWA 1UMCA 1CQIA 5I6DA 5HOEA 1KWKA 3HR7A 3M89A 1YBVA 3VC2A 1ZGZA 1HI9A 2I7DA 2ZYTX 1HTTA 3JX9A 2I2BA 2H48A 1D8TA 1ZOIA 5LQCA 1GV0A 2QGFA 2X3YA 2XUFA 3EQ8A 2GPYA 1F9EA 3TBFA 2P1ZA 4PSCA 4UVDA 1R0YA 1Y6QA 4TLEA 2OV2A 5FTJA 1N5IA 3MTQA 2IP1A 2OO7A 1VE3A 3MWFA 3O75A 4WLFA 4FVTA 4IDNA 1V95A 3B51X 3RJMA 3K70B 1GQOA 4KR9A 1NQXA 2P9TA 4YRSA 3UUEA 3DB1A 1BXGA 4K9LA 1LXCA 5FUYA 2OYSA 2IYLD 4GLJA 5B53A 3T3MB 3IQEA 2PLFA 2QLTA 2VOEA 4JLKA 3D4IA 3S44A 4G56A 3W5JA 1CKEA 3K09A 4PO3X 4NX2A 1TYDE 2XY4A 1A9XB 1WNTA 2GEVA 2PU5A 2Z2IA 3SKVA 5I48A 1Q0PA 3IALA 2QTFA 1T9KA 4O4HF 1TCBA 3JQGB 3L40A 1V25A 4OMUA 1TIPA 5AKJA 2WPNA 4ZJZA 4B3BA 4RZ2A 1R10A 1WULS 3WWZA 5KREA 4MI9A 5TQ2B 3P26A 4KGDA 4MNTA 4O29A 5L8VA 3OX2A 3EMKA 5HIKA 3D6JA 4K6FA 1E2PA 3RU3A 1T43A 3EC1A 2D8MA 3G8DA 3WNBA 1EUCB 1JILA 3H4TA 3N8NA 4G5YA 4W5JA 4ZPJA 3UK1A 3VHRA 2AUTA 3F5DA 3ON5A 4B9AA 1KO4A 2BM1A 3EXIB 3LY8A 3PX3A 4PRKA 4QHSA 4BXOB 1JDJA 2ODQA 3WOVA 2REQA 2W2PA 3WGUA 4EEZA 2ID4A 1GT91 1UPAA 2BTQA 5CR9A 1ZVQA 2JAOA 4REMA 4YUVA 4OXYA 5GM2A 5HKKA 3OIWA 3Q9SA 4NBSA 3MT0A 5KS2A 2AZXA 3BD6A 4I9GA 1JMVA 1AF4A 1A9RA 3AR2A 3JV7A 1E9AA 1VKRA 2MT9A 2YV1A 3OM9A 1C1YA 3A4NA 2HXYA 3OWOA 4BKPA 3PEWA 4G0UA 3WP0A 2JFPA 2WWTA 4F06A 3NTUA 4P3KA 4ZJUA 3PDJA 2VAPA 4G5FA 4UBOA 3VR5H 3SZ3A 5I7HA 4BFSA 1XU4A 8MHTA 3FI9A 5FKJA 4YHHB 3K0FA 2QBYB 4OJQA 3MCZA 3N70A 2PG3A 2WJJA 3LG2A 2XOKA 2DPXA 2IPLA 2ON6A 4RVSA 3ZHOA 1MA0A 2IBTA 2Y99A 4LJ8A 1XSEA 4BFLA 4RD3A 2C0PA 5K8TA 1KGSA 2IK8A 1EX1A 3ROMA 5IWAB 2JBAB 1KPHA 3F4KA 3HJBA 1L8OA 4J91A 4C78A 4D0SA 4FSHA 3GLSA 3SZLA 3C8ZA 3KZCA 1RBMA 1ZH6A 3MN1A 1U9ZA 2J46A 1G5TA 2NU7B 3RARA 4BNNA 3WK6A 4U39A 3H18A 4TRRA 1FNNA 2OLKA 4ZRDA 3VDXA 1LA2A 3DDHA 1LBQA 4KLRA 1GZUA 1X9GA 3H2HA 3FFTA 4RV4A 4LJ6A 1G63A 2VJNA 3ER9A 3IOBA 2RI1A 3R0IA 4C4RA 4XA8A 2PGAA 4XWTA 1ZK0A 2Q6IA 4TKZA 5KHLB 3QEBZ 4MHTA 2VHYA 1PTJC 1JF8A 5CFPA 1WD7A 1TK9A 3GLTA 1WVIA 5T57A 2NTJA 2A1UA 4ZYYA 2V45A 4LDQA 3QJYA 4JLDA 3EVZA 1GPMA 4I9UA 4MW1A 4DARA 5BVHA 1ES9A 2RHGB 4K9OA 3JWEA 4LTDA 2OQVA 3WHIA 3RM3A 2CJPA 1EQ2A 1NBEA 3GA7A 2FH5B 4IPTA 1YJ8A 4EG6A 4MW4A 4ZOCA 2J87A 1DKMA 2E5WA 3OE7A 2NU8B 3NBQA 2B98A 3IODA 3E1SA 2JJ1A 3M0EA 4MPDA 3NDBB 1DBSA 4DWWA 2IHNA 2ASVA 4U02A 4CF7A 2WE8A 1OLXB 1RXYA 4ZOLA 5L3RA 1E66A 3T9DA 2OHFA 3GFVA 4Y3UA 4C01A 1GPNA 2QNIA 4WA7A 5J5VA 1JFTA 1FYVA 4E11A 3TX6A 4C0KA 5CT9A 2DKOA 1BWQA 4FC7A 4FOSA 2VHUA 1OCEA 1ZAKA 1DOHA 2R9VA 3Q7QA 1JI3A 3ZY2A 3Q72A 1FEZA 1XALA 3KYCB 3LT1A 1E5XA 4KZPA 2BEWB 4MR8B 4KFUA 2HF9A 4A0GA 4HNGA 2W11A 4PPNA 1HT3A 1P0FA 2YFHA 1DJPA 3B85A 5ECWA 3G9TA 3TUIC 1GL3A 1KI8A 1DJQA 3COJA 1LDYA 2H1WA 5TMPA 4E12A 3CZ9A 3DH0A 4GXNA 3L4EA 1IG0A 1D7AA 1KY5A 1RKXA 2H4HA 1QYVA 2BKXA 1P7CA 1VP9A 2WAOA 5FAXA 5ABPA 2A5YB 5AKYA 1EFHA 2ACWA 3WA6A 4U7WA 3LUKA 4BVFA 2PUBA 1NBOA 4IJ5A 2X4DA 1FNCA 3QVLA 4M7PA 2WSLA 2Q4BA 3NGLA 1XNQB 3M82A 3O2QB 5D2CA 2JFQA 1OD6A 1M2EA 3L0DA 2O50A 3ONDA 4R1NA 5DOZA 4Q82A 3FPLA 4KXFB 3DBHB 2JJQA 4FNMA 4FT4A 4GL4A 2ZP1A 2YX1A 4KQFA 3OU2A 3GN2A 3GP3A 4K9DA 4D1YA 3KELA 5JAUA 3E8SA 3GUVA 1KMNA 2FFJA 3NBKA 2VHZA 4CJXA 1J6UA 3DBLA 4WFJA 5JSZB 2WFLB 1A1VA 2IYAA 1IM8A 2JGJA 1PL7A 4DMCA 2HA5A 2W48A 4PRYA 4Q3NA 4ZO6A 1J8FA 3DCJA 5A9SB 1ZJZA 8LDHA 3KP1A 2BGMA 4QXMA 4W5TA 3KM0A 4OHOA 4Q3BA 1ABFA 5HUQA 4N1AA 4FUQA 5E38A 2PIDA 3CEAA 2GCIA 4IDDA 3W2GA 2IH2A 1T1EA 1L7PA 2QLJA 1QOZA 3IUNA 3VPXA 1DKPA 3ICWA 2I1VB 1SKYE 1H05A 4QWWA 1DXQA 3PIRA 3VC3A 2C59A 4JI1B 1G0OA 2OEPA 2V97A 3ENKA 3I9NA 2ISQA 2ZPAA 4MMZB 4ZARA 4IRUB 1CUSA 1OXMA 1LB1B 2Q1SA 5IARA 1IQUA 4E0BA 1E0SA 2OFWA 2Y1DA 1JJBA 2NUBA 3IUSA 2OGZA 2PSEA 4TTVA 4EUKA 4X1IB 3LW7A 2XZOA 2GZ1A 9ABPA 5KOHA 1FDSA 1F51E 5ALMA 3FPCA 2JEYA 4M60A 1FDVA 3LHKA 2JBHA 4Z5XA 1NRWA 3ODPA 4B6PA 3VM6A 2P4EA 3PEVA 1N3IA 4ARVA 4FQ5A 4BQQA 1PNTA 2XJ9A 2PLRA 3K70D 1EFPA 3O95A 1F6DA 3QPWA 3TIFA 2BR5A 2HMYB 1N2CE 3OEED 4HZIA 5BMVA 4ZOEA 3ZKAA 1HE2A 3ZE8A 4FNOA 3HU2A 1MLDA 4FK8A 3KSAC 5EJ9A 2CVHA 2DQYA 4LWOA 3GT0A 3K0AA 4TN5A 1XU9A 4PFJA 3OIUA 5C18A 2PX6A 1T2NA 4C7OA 1E6CA 2H51A 2CLCX 1K4MA 3PGVA 4DCTA 1SUIA 5EIXA 3FYUC 4HRAA 2PR2A 4LZOA 3TQQA 2ZQYA 1RFLA 3RBZA 4MW9A 2PGLA 2ZG6A 3Q3CA 2JFFA 3WBBA 1NBIA 1WWKA 1M1XB 1ZLXA 2BKEA 2GILA 4YV0A 2XMGA 4MS3A 3WLPA 3W8NA 4RTJA 4EH1A 1WVMA 1XRLA 4MITA 4ZO7A 1N6NA 1UWCA 2CF5A 3SG0A 1RP1A 1TQ6A 2OM2A 2GAFA 2HH9A 5A71A 1MAHA 3ZV3A 4JI7B 1EJ0A 1T1JA 4X6YA 4BMZA 3EFEA 1QHEA 2CXPA 4J0GA 4OCZA 4Y1EA 1C7JA 1UOOA 5JZOA 4DNFA 2C3YA 1RT9A 3H0KA 4LHZA 3WHPA 2C7PA 3K0KA 5IU6A 1AB6A 3REOA 4IIJF 1FP7A 2FW6A 2H57A 4JSRA 4Q1CA 3INGA 4O3MA 3A05A 1GUDA 2QK4A 3W5SA 2WU3A 3PI7A 2VF5X 1ZDMA 3VO8A 1WTCA 1NG9A 4CI0B 4JJGA 1UQRA 5HSGA 4RLHA 1GTRA 1V7CA 2JGRA 1WMAA 4LI0A 4L9WA 2W58A 4DLXA 1T0UA 1E2LA 4P3NA 1YONA 3F97A 3NXKA 3TJZA 2Z5LA 1K66A 3JALB 1ISMA 4M9QA 4CCAA 1IL0A 2G83A 2N9UA 3V1MA 1DEKA 1MB0A 2I67A 3MOSA 5BNIA 1K3FA 3IERA 4MUKA 4M1WA 3H6HA 1LJLA 5AHWA 5IFKA 4ZCTA 1HYQA 1V9LA 2OECA 3CNNA 4IRMA 4QSMA 1N0UA 3JPWA 3OCVA 4LN1A 3ABRB 4I3FA 4EI7A 2C7OA 2PSDA 4R2HA 5P8WA 3C48A 3MLEA 2DPLA 3O8CA 4LXIA 1PF7E 4JBNA 4WY8A 2VN8A 3KKPA 1CJTC 4AJHA 1XKTA 1KE2A 2ID9A 3NV9A 1KVTA 2UUPA 4ZPXA 3A14A 3ROPA 5JTTA 4GU5A 4JLJA 3ECAA 3UT5B 3WISA 5CBKA 3ZGLA 5FLXA 4K3VA 3HKBB 1QQBA 3KXIA 4OOFA 3GLQA 1O57A 4AY5A 4CXMA 4YCAA 3GDWA 3L8FA 3S2GA 4BRSA 4D9JA 3OD5A 1E64A 4V03A 4EG1A 2NTVA 3ETLA 4LYYA 3WE7A 3CLRD 4LSGA 2HX1A 3M5CA 2L19A 3R3ZA 4HG2A 2Q5QA 1UF9A 4FKZA 4CUZA 5ELLA 2ZT8A 4XD2A 4B31A 4OAOA 3LWDA 2R6ZA 1FU7A 4W5NA 1DADA 2DE0X 3E7PA 3EFOA 3E05A 4XFJA 5EZ5A 5J4YA 1BFUA 1KE1A 4UNPA 1TZJA 1RQGA 5HF5A 2CNBA 2CN1A 5D87A 3PUHA 2Y77A 4NCXA 3KZVA 3QFFA 5G0SA 2JLQA 2IUFA 3I76A 3C2QA 2QUAA 4X62B 3H5NA 3HP4A 3FWYA 2O3TA 3EYWA 1T4MA 4DM7A 4IDQA 1GTG1 4IEEA 4MJXA 3UBMA 4AFNA 4GP9A 4XWOA 1O8BA 3TGPA 4GUDA 4E5YA 2D3TA 3KWMA 2FOIA 1ETUA 4OLJA 4Y2SA 1UPFA 1Y4AE 3OJFA 3EZFA 4HPJB 3WWEA 4CV3A 5I7WA 3AEUA 5M3BA 4LYGA 3IC5A 1PNOA 2JAUA 3DBRB 4G0QA 4G3XA 3ZBQA 4ZDJA 2JGIA 4Z9FA 4YV2A 4NYIR 4MZXA 3N2GA 4GYKA 1UBLS 2FK7A 1VSVA 1ZIXA 4LOJA 3ZDZB 1PX2A 5KPDA 4Y1GA 1FTNA 2VPXA 4IKEA 3NU1A 1QIIA 1SBQA 3G5AA 1SXJB 3AHJA 3UCXA 4CUKA 3DLTA 4AMYA 1K6EA 2DVMA 5CXQA 1DIRA 1GLNA 2ZRDA 4CV2A 3EGOA 5KJCA 4K8RB 3SSNA 1A5TA 3NIGB 6NULA 4G0XA 1DEHA 2JJ1D 4WESB 1GLGA 1INLA 1M6HA 6PFKA 1DC4A 2VP2A 1N3YA 4MLZA 4TXLA 5H7XA 5FUBA 1O96B 4PLYA 1AQYA 1U3GA 2CXOA 1A8PA 3UMVA 1FPMA 4ZVOA 5FTWA 4HDMB 2Q5FA 3K1YA 1R0KA 4X44A 5JQGF 3B9BA 1TTTA 3HN7A 3DBLB 2VUTA 3CBQA 4Q9DA 1BE6A 3B1JA 3KZOA 3W2HA 2Z2YA 3OO1A 5DX1A 1EDZA 2QKYA 5LOVF 4L3VA 1MZVA 3L46A 1QONA 5DEOA 2AXPA 2BZSA 3OCZA 3ZKWB 1SXJC 4URZR 3OLQA 4PPGA 1XMVA 4QRHA 5B64A 1AN9A 2OGWA 4MYUA 1XYVA 5IKMA 1JQLB 3UW1A 1DELA 1UWLA 3H2SA 3N76A 1QHIA 1ZY2A 4WHMA 1ZA1A 1HR0B 1MTZA 1L5HA 3QF4A 3E9NA 3GMSA 2B34A 4LCEA 2H00A 1I24A 1CRPA 3VMMA 4JJ7A 1KSHA 1AUPA 1PU2A 3TW6A 5C5DA 5EZYA 1X7YB 4DA9A 4D6PA 1JDPA 1US8B 1T0BA 1W6UA 2A9FA 5G3ZA 4E08A 2HDHA 1KY4A 2HFJA 2VP4A 4BV8A 1IOZA 3V8RA 1HH4A 3E9ZA 3H97A 3KSZO 1F12A 3QKSA 4Q34A 1I1QB 1MB2A 3AWDA 2B1RA 3KYJB 3ZCXA 3BE4A 4KIFA 3KDAA 4DUGD 3P9NA 2ZBEA 1FFEA 2DKFA 2V7QA 1O2DA 5CDHA 1LW6E 2AMLA 2ZXEA 3K8ZA 1G21B 4EJFA 3IXMA 1TD1A 2IYSA 3I9V1 4KMSA 3RPEA 3IQDB 3RUCA 4BVJA 4IWNA 4DADA 3EJWA 2Y05A 2FZLA 3FCEA 3VI3B 1J70A 3NANA 2FWNA 4QO7A 6AT1A 1GAQA 3JQFA 4CDRA 3EXIA 4GW3A 4N6OA 4PCLA 5GVSA 2OCPA 5AIAA 4A8JB 3QXCA 3DHNA 4NAVA 2VZLA 3HCDA 1P0PA 1QDEA 4QQ8A 2CUTA 3BRWA 3DLCA 3FF4A 3PEFA 4O2AB 2JCYA 3U48A 3HABA 2Y2VA 2XT9A 4GH5A 1ZOLA 3EPLA 4IM7A 1CE8B 1L7DA 2GXSA 4FQ7A 3ZDYB 1XI2A 1T2EA 3GNSA 1SXJD 1K5DA 4JR0A 3TXAA 5DTMA 3FGOA 5HDBB 1RCTE 2GX6A 3I3OA 1PV4A 3UAYA 1VDZA 3FGNA 5T3YA 1P60A 1TVCA 3O8RA 1PD1A 1ODJA 3FWPA 2FA9A 3GH1A 3L0BA 4B82A 5I9NA 1NI5A 4PGAA 5J58A 1MGOA 2NU9A 1K8YB 1TXGA 4WLOA 2TMKA 3RK1A 2GSWA 5CYPA 5FX2A 1SZPA 1Q21A 4CFSA 3AIIA 1R16A 2YN4A 3AG6A 4Q6BA 1TQ2A 3ROQA 2QTVA 2E3JA 2BFFA 4IG4A 3VV2A 3RVDA 1C1DB 1JZSA 2EEZA 5LFAA 3ZD6A 5I7VA 3CZPA 2IOFK 1YC2A 3F1LA 4AF6A 4IIEA 2QVXX 5HQJA 1UM9A 4MVWA 4RADA 2PKYX 1A9OA 3KQLA 2H63A 4P4LA 4Z7QB 3JWGA 1XZAA 3HI4A 1E98A 3NW9A 4HNRA 1YIAA 2GZHA 3CLUD 2BRUA 1SIOA 2GN0A 1P1HA 4NL4H 4XRGA 1M5TA 3DV0A 2VKQA 3IVMA 1JNXX 2BAGA 1TIKA 4QAQA 1NUQA 1JIUA 5JVDB 3QOYA 3OU7A 4EKIA 4PR0A 1WDKA 2HJWA 4DSAA 5EHQA 3J80A 3CIFA 5BWNA 2P6PA 1Z07A 1XOIA 2EL7A 1RYZA 4JBGA 4HP8A 2FF7A 4P4TA 2I4NA 1H2YA 2H29A 2IT1A 5ALJA 5EE5B 4ITUA 2CSUA 3FJ1A 1HDYA 3D8HA 3H5VA 3K31A 2A4KA 4J16C 4YA6A 4ML3A 4ZQHA 2VSQA 4HZGA 4I4LA 3ADOA 1Z6AA 2CFCA 1ZUWA 1W48A 5JXIA 2H2HA 2H1SA 1QKJA 3LO8A 2N75A 3N59A 5L95A 5AKEA 4HGRA 4N5HX 1SD2A 2HKIA 3GLHE 4RH1A 5KSZA 4FFPA 4YCDA 4G5SA 4GQIA 3R3JA 1G8MA 2ZI3A 4Y1RA 1JJVA 1RQXA 2IQ5A 1YMUA 2XTZA 3BRWD 2XLCA 3I9MA 4ZT3A 4CQLA 2FN4A 3OCXA 4AZ3A 2C1EA 2FEXA 2CK3A 5KNDD 2MSWA 4U0KA 2WEKA 5HKAA 1RYFA 2YZNA 3FDXA 3TSOA 2CVZA 8AT1A 3HR4A 2JZNA 4IV5A 3D9QX 1FVOA 4RJLA 3ZD8A 3E23A 3T12A 4IOMA 3CW9A 1OFUX 1T9BA 3LDAA 1WD5A 3BCHA 3K2BA 4L22A 3ZHUA 4QNNA 4DB4A 3PR3A 1TLTA 3R7AA 2F8SA 1Y8CA 3ABQB 2OD7A 1RIFA 1AZSC 4RCZA 4OXQA 4TYMA 4REQB 1C80A 4CFZA 4ETWA 2OV1A 1L3BA 1EUDA 3SFTA 4JT9A 3QMPA 1E2BA 1UUFA 2D1YA 4OHZA 4BWFB 1E4YA 3GL9A 2WUEA 3Q1KA 4I6JA 1YIOA 1QV9A 3EEOA 2JIRA 1HOXA 1SBIA 2BEVA 2J30A 2GH1A 5B6JA 3VTZA 1W5AA 3HCRA 4FEYA 3ILYA 5BUSA 2VNIA 1Z39A 4LOIA 5AXAA 1V1RB 2JLVA 2I87A 4Y0NA 4XFDA 2PH5A 1JU4A 4Y6QA 5EXDA 1YFLA 5EWMB 3WMRA 1C3XA 4TLCA 4AO8A 4OHRA 4DMKA 1K86A 2P68A 4D0GA 1WLSA 1N0IA 5JXGA 2ZU0C 1UWVA 4HDAA 4H7EA 4LYAA 3R7WB 1HDZA 4IH4A 1FSSA 2H3HA 3TB6A 3T95A 2CL6X 3W4JA 3AEUB 3L79A 4HADA 4EAAA 1M6NA 2CHEA 4CF4A 1GZ3A 5JWHA 1O95C 4P4SB 2RSLA 1EB9A 3EISA 5THXA 4L4XA 1I0IA 1IE3A 4O4LB 5T8KC 4UNQA 2GZDA 4I0WB 2GBLA 3KT0A 2NZWA 1M1YE 1EB8A 2ZAGA 1U94A 1OYOA 3BXEA 3EXFB 3MRVA 3P0IA 4FNGA 5H70A 5TGZA 4F7DA 1GTVA 4TYWA 1EXMA 2QSJA 3KXPA 4MTLA 2QAGB 2VEDA 2B2CA 4LY9A 5IBPA 4I4CA 4PYOA 5JE8A 4LF5B 5HRAA 2C20A 3LP6A 4G8JA 5JADA 2Q6KA 3RASA 1QFSA 2VPPA 3JQ8A 3JD1A 3LTNC 2FZGA 1L7VC 1VLQA 2GK7A 3ZJ5A 2A1TS 2R2GA 3Q3HA 1E8MA 3DF9A 3UC5A 3KQPA 3N6RA 5FA8A 1AS0A 3RLIA 5A4JA 3HB1A 3ND5A 4RS3A 4F60A 3PLRA 1C8BA 1HFJA 1OXXK 1C3LA 3FMPB 4ZAXA 5T67A 1K7YA 1OZAA 1PEKE 1VL8A 1GWNA 4Y0VA 3D6HA 1QRAA 5B7GA 1XVTA 3E9QA 2I91A 2O7QA 3LW8A 4E09A 2LPMA 2VIIA 2HU5A 3GDGA 5DU2A 1B8UA 5KVCA 5DN6D 1CULC 1N9ZA 4AWBA 2ZJBA 2Z4TA 2F3RA 4MS1A 3VHQA 3Q3GE 1J33A 1U65A 1OX5A 3LT2A 4IGAA 5D01A 2ZYAA 1ODSA 3TNYA 4PLFA 3UVEA 2QAJA 3MMZA 1LPMA 3QK7A 1E5LA 1U7XA 1XCBA 2NNLD 2WKPA 5E2AA 1TM7E 3M4YA 1ZUHA 3GROA 4QM7A 4ZT4A 2BZ0A 1E6MA 3Q3JB 1FLVA 4DA4A 4ABTA 3AEZA 3U4MA 2CXUA 3FWZA 3WDSA 4C7OB 1YU9A 3QY9A 1JV2B 1QHYA 2OHGA 4U3JA 5CVDA 3SM9A 5JS8A 1TL7C 4BFYA 4E51A 3HJAA 2BYTA 2IE8A 2IEAA 4L9RA 3ZDRA 2QM7A 1KOLA 5B4VA 4TTIA 1OXVA 2E85A 3K9NA 1IN4A 3PGKA 4U7GA 5H16A 2Y93A 4DREA 5B1EA 1U63A 1O5OA 2Z3WA 2IXBA 2XRFA 2I9PA 2VNJA 3AJEA 1S2GA 2GLUA 3CGWA 4ZCQA 3R7LA 2ODPA 3EVCA 3MSXA 3F2VA 3N2EA 3OLVA 2PLAA 1I30A 4WPGA 4RD0A 2OV3A 1YVEI 3X1XA 2ZBVA 1XDGA 2HJRA 6LDHA 3B12A 3W05A 2IYZA 1BO6A 4B09A 2SECE 2XZPA 5IJWA 2XMZA 3HCCA 3LQKA 1EK2A 1WUJS 1QO0A 1CS0A 2E4AA 1UBHS 2GCEA 2E4XA 1WXXA 1WLYA 1BGXT 2QRGA 2WSIA 4M1EA 4TTQA 5E4TA 1UBOS 1XL1A 4XWYA 5JASA 1OB2A 1KZ7B 1X3LA 4IQFA 3IQIX 1SU6A 1X1QA 4MPRA 5DRTA 4LMPA 3OE7D 4UCWA 4I36A 4MYRA 4KPYA 1XKXA 2LDBA 3FD8A 1A9PA 2OOKA 4BHTA 2OCAA 2ZUUA 4KZKA 3RFCA 3T5BA 4BCDA 4J1TA 3C3DA 3B9RA 4DSNA 3HCPA 4PTYA 1QG6A 4OPMA 1HTBA 1URPA 2HOQA 2X4GA 4DS3A 1LW7A 1IEWA 1P2FA 5A3VA 4FFRA 5BW8A 2ZT5A 2ZTHA 1QAQA 3AEXA 4L07A 4LY6A 1FFXA 1PW7A 1ULSA 3AILA 4LJ5A 1XZBA 5DYWA 4MKZA 3S70A 3IOCA 1HK7A 4DR1B 5HGJA 2O14A 3C14C 4Q3AA 4LHWA 2D5CA 3PJGA 1QM5A 5EKSA 2AFRA 1GFSA 1NN3A 1UAGA 1PBTA 2C83A 4TT3A 1Z2DA 3X2FA 4ND4A 2P5YA 1YJ5A 1Z5GA 3UAXA 1MXFA 4EJ0A 1D2EA 1UPBA 2AD1A 4KYUA 3BB1A 3FYUB 3VJLA 3E03A 4U7JA 2H17A 1EBFA 1XPOA 4H7DA 3DVQX 5ULLA 4YYZA 1THMA 3P45A 2OZPA 4I50F 1E3MA 2MSEB 3ZDXB 1N8KA 1E61A 1QZZA 3MWGA 4M9XA 4X64B 3STHA 4BNHA 2A33A 2QMHA 3A6ZA 4J2OA 2ZRBA 5EL0A 3B5EA 1MU0A 3RH0A 4F9GA 4YMUA 2IITA 3A6FA 5H68A 4MCJA 4D2IA 1OWOA 3B36A 4NFHA 2YYYA 3BMXA 3D4PA 3C4VA 4LSZA 4ZAVA 5KSWB 3CKKA 2ZTLA 1ST2A 3C8UA 1XJWA 1LDNA 3PGA1 1Z4LA 3DP7A 3PC4A 3BWYA 5ARBA 1RRGA 4O2BB 4YHBA 4AUEA 5HQ3A 2QDXA 2AK3A 1CY2A 4URHA 4UUQA 1JLRA 4KWIA 1H2ZA 5H9VA 3RI3A 3M1LA 1MD9A 1E9EA 1AC5A 1FFXB 1WW2A 3WRXC 3VUFA 3RG8A 1JG7A 3A1VA 4F92B 5L40A 1Y89A 3BBLA 3RC8A 2XDWA 5EQDA 3ELUA 1KMHA 1U31A 1TCCA 2GPTA 2QRLA 3DG9A 3DKPA 1P4JA 4ZHQF 3MMPA 2YDXA 1ODKA 1JJAA 1DWUA 3JATA 4GKAA 3MINB 4QPJC 4GHWA 4GE0A 1W9HA 4B4KA 4RJIA 1VHQA 4GS5A 3SX2A 1E96A 3T38A 1BFDA 3PXBA 3JU3A 2IOFA 4H6PA 3JTMA 1R0SA 3GFSA 4K40A 3ZHZA 1T9GR 5HS4A 5GJVC 4YREA 5AUOB 5ALYA 3HVHA 1BVRA 4Z0TA 1AQLA 4G84A 3W1WA 2SKEA 3VJRA 2GYUA 2VK1A 4YRLA 1LNSA 3WNCA 4RHYA 1QIKA 3VR6H 5BMVF 1YAHA 1QLHA 1E0AA 1DFHA 4MVJD 5CIWA 4JFAA 5AQEA 2D7JA 2OBXA 4TT8A 1I3OA 2NVUB 4HGYA 3VJKA 2WYHA 4GWGA 4GVXA 1U7WA 4PSAA 4M0DA 1NE7A 3E8MA 1UJ2A 1N6KA 1H4VB 1Z6TA 3AGPA 2XUGA 1OGYA 2Z8YM 3SC3A 4YAEA 1FA9A 1V9SA 2SCUB 4TYPA 4RANA 2Q3JA 3TZKA 2TYSB 4XQ0A 2XE8A 1LS1A 1RJ9A 1W30A 2L82A 3VPGA 4YV1A 1OA0A 3WGGA 1IB0A 4P58A 2BGUA 2XV1A 1SXGA 3HA7A 4J75A 2WD7A 1ZNZA 3BZWA 3EVEA 3WL8A 4URFA 3NOVA 4DLZA 1EFUA 2B36A 2GHQA 1Y7IA 3H6GA 3PXUA 4HXFB 4L6IA 2JGMA 4MP3A 1E6EA 1NFRA 5EGSA 1GG2A 1OHHD 1VG0B 1S7GA 2HJGA 4J90A 1WDTA 4U7FA 5ITSA 5A3RA 3FMFA 2ZK7A 4J49A 1Y3CE 1W0CA 1NV9A 5LQDA 1YBFA 3A4LA 3K9FC 1HBJA 1UK7A 3I2GA 1N8SA 4OB8A 1TM1E 1M2FA 4GRDA 1K6JA 3VHXA 4XIIA 4EA6A 3VYTB 2EIXA 2TMYA 3QKWA 1GLVA 2V0NA 1O94D 4ZTBA 4JA0A 1V8FA 4AU1A 1QF7A 3K6RA 3QBDA 4QJ4A 1GQRA 1IZZA 1HNWB 3L8ZA 5AJXA 4UEOA 4X8HA 1WP4A 1OI2A 2D4AA 2HTFA 5JMPA 1OZ0A 4XLZA 3GBVA 3ZXIA 3JTEA 3QKTA 1ATZA 1FP4B 2R7LA 3RREA 4Z0PA 1OBOA 3HRIA 3OCJA 3AHDA 3H11B 3PYMA 4YDSA 3U7FB 1QCZA 5F3WB 2A5FA 1RLOA 3N3BC 1DC7A 1Y3HA 4LZZA 1Q0SA 4ZYTA 3CKMA 1QJ4A 3QYAA 1DI0A 3UTDA 4MV0A 5CGZA 4GX0A 5FUVA 5J5AA 1XAGA 3ELYA 1DRJA 1X7DA 5E6SA 1YBHA 4PZLA 2HJ9A 1RC0A 1C30B 1FMJA 3I1YA 3NJ4A 4WK6A 3ZIUA 5B5SA 1SUDA 2VPZA 2RGNC 5LA6F 4F3YA 1VB5A 4ZK2A 1P7WA 2QXTA 1OH6A 4U2BA 1UDBA 1G64A 2K7FA 5EJGA 4C20A 3F71A 3F73A 3VYSB 2VFAA 4YPVA 3Q9NA 5B4TA 4FFSA 1I36A 1UJMA 3TXYA 1WMDA 5FHQA 1PK9A 2DCMA 3ITEA 3RK4A 4JQOA 2BFWA 2XVXA 2JFYA 3AYZB 3DT6A 3G7NA 1QRDA 2QGNA 5DNCA 4YQZA 4JKYA 2JGLA 2NYVA 4UFPA 5LSAA 4LQ4A 3EOAI 1ESEA 4G86A 4L74A 1A88A 3S99A 3G1WA 1QTNA 3K4QA 4OHBA 1OWLA 2A9QA 4DC0A 5A2GA 1GRNA 4FW8A 5K0SA 4OP3A 3MD0A 3NFYA 3AHCA 3RYFA 4G5QA 3FCXA 3WRYC 2GN6A 2IS4A 2BONA 4KEAA 4KXUA 3E1KA 3H11A 3JAKB 3UH0A 4BZXA 4ZV7A 5AK5A 1ZR2A 5JD5A 2C2HA 1IOWA 3CCFA 3H4VA 2JGDA 2W0MA 1HT1E 1GZ6A 4QDKA 3A4YA 4PBSA 1A04A 1SZJG 1WIWA 4ZOQI 3T1QA 3W9BA 2XIJA 4N48A 5K9ZA 4TV9A 4AJ2A 4BRUA 4J6FA 2P0AA 5L3QB 3WB0A 4IH9A 2DT5A 1X74A 2MJLA 2W4QA 3CS3A 2QMZA 3WMFA 3ZBPA 1JDBB 2PH7A 2R66A 3A9RA 4JU8A 1PJZA 3OT5A 1LDGA 1U81A 2K6GA 3NORA 1A2KC 3NETA 5IDWA 5KINB 2LWIA 4WFQA 4BP1A 3OPQA 1U9IA 3FNIA 4QLAA 4C7VA 1WV0A 1H22A 3V2IA 2YKGA 1HDOA 3ZWXA 4RABA 3A9TA 3GGPA 4BS9A 3MC1A 1KK2A 3GMTA 2DBVO 3R3YA 2VLIA 5C3UA 1UKZA 1W59A 3PNBA 3V55A 4AIRA 4EJSA 4Q4HA 4UOEA 5A1TA 4PGFA 1VKJA 3OTWA 1K2VN 3O9MA 4YRFA 2IE0A 2WB4A 3SC2A 4LYJA 4TMXA 4GM0A 5IXJA 1WHSA 1W0JD 3OM1A 3BMOB 3QW2A 4OYRA 1MA3A 2CBZA 4QRDA 4TOIA 3G5TA 4KAFA 2IU4A 3D7RA 2W2VA 3FLMA 5KYNA 1MT0A 5CXXA 1X1TA 3EVBA 4INZA 5FNZA 3DMPA 4O33A 1B1CA 4Z7OB 4ZCIA 4AN1A 2X9NA 5M7EA 4K6CA 4WKGA 5BYKA 5HR5A 5SZJA 1L5QA 1S2DA 1VJTA 4ER3A 1Q91A 2XKAA 1L1QA 4HNSA 3ETDA 4V1CA 1RWOA 2AG1A 3MVEA 4ID3A 1K8ZB 2FVYA 1PGJA 1ZRNA 4L73A 4M99A 4UHCA 1IH8A 1Z17A 3I8OA 1EINA 1KYTA 4ZQCB 1KHTA 2G5PA 1TYEB 1A7UA 2W00A 4N5MA 3UJ9A 3ER8A 3DBRA 4YK7A 5E9AA 2QUBA 3FTDA 5I7UA 3K8YA 1GPDG 2X5OA 3JYPA 1E1MA 1QNLA 2KB0A 3WLEA 1NFFA 4QUAA 4NMMA 3IVXA 4K9SA 2WE7A 3P9QA 3P52A 1JE0A 4I7EA 4ZJPA 2BFPA 1ECFA 2FAXA 4PIMA 3REFA 3UJNA 2CNWD 2HZBA 1E2IA 2ZB4A 4IJ6A 5B6IA 3UXYA 2WOJA 1A72A 2J5QA 1CP3A 5D5PA 1GA1A 2PKRA 2V5UA 4ZVMA 4EJSB 1D2HA 3ESCA 1NDQA 1G19A 3HXPA 4RLQA 3PWTA 5AI6A 5BUZA 3H7IA 3DFZA 4L0DA 1IQ0A 4JLUA 1E2GA 4PNPA 5LP6B 1EFLA 3RUDA 1YK0A 3BAFA 4BMPB 2G4CA 3JRWA 2D0DA 5BT8A 2C4KA 4GOOD 4DPMA 2RKOA 1LLUA 3RS3A 2QW0X 3TRFA 5K6TA 1DFIA 1B8PA 2VWHA 5DGHA 4I8IA 2CV1A 3EGVA 1SNYA 4KBGA 1SCIA 3RE1A 1U04A 4GI7A 4HK4A 4D3YA 3PV0A 4BFTA 3AZPA 3FOWA 5F7XA 3DT9A 1QB7A 1ZN2A 5REQA 2FYTA 5KTTA 1B2LA 1Z28A 3U4QB 3WLRA 1GHTA 4OXXA 1C81A 1KAMA 1JHDA 1QC5B 3UHOA 3G5MA 4ENSA 4XVQA 3OIVA 4XASA 4YLGA 5I9TA 5C1DA 4KKVA 2IS2A 1PKXA 3WGKA 3FSRA 4DRXA 2H52A 1X38A 3PEEA 4FHZA 4G24A 4W1PA 3QUQA 1LLQA 2J0UA 4RXTA 3VO2A 3GNLA 4ZO4A 3R3VA 4RC9A 4Z4HA 3GRZA 4EHLA 1AS3A 4PHCA 3QP9A 4DV2B 2GDJA 3L6OO 4IY1A 5EIOA 3K1TA 1EHCA 4NVRA 2Z5FA 4DV7B 2KE5A 4MP6A 2H18A 5ALXA 4ZAZA 1THGA 3FCOA 3AP3A 1CYDA 5ILQA 4MVJA 2NAPA 1E9RA 4IBOA 4Q7MB 4X24A 4DZTA 2DTEA 4LE0A 5B7NA 1YZGA 3S1LA 3U3OA 4KVGA 2F3QA 3ETEA 5I9MA 4BIIA 2WWXA 2F48A 3JWIA 5CFNA 1WZUA 1XA4A 1ENOA 1QV7A 4WGGA 2AX4A 4GPBA 4R40A 3KVNA 5AXBA 4M1OA 4Z4IA 2VLBA 2W6JA 5K7SA 3DAHA 1JHMA 1KFEB 3RABA 1HNNA 1B43A 3TOVA 3KD2A 2O5EA 2O4UX 5K5EA 4U9IS 5EMJA 1Y8RA 4HI0E 1LPPA 5TGDA 4DTIA 3HJHA 3B6MA 2GKOA 2XBLA 4FGJA 3RSSA 2Y66A 3RWOA 4UEWA 2VJPA 3TNLA 4FONA 2PD6A 2QL6A 3D3JA 2RGWA 3KFXA 4Z2YA 3WWPA 4D46A 5JJLA 4NFLA 3NBYC 4NABA 1L8AA 1GZSA 2WJAA 1YHNA 2JLCA 4K3UA 3GW8A 5LLSA 5I45A 2I55A 3GCXA 1CR6A 2UYYA 3CUWA 4HQLA 1GTZA 5TQJA 1UZLA 3JAWA 3FDFA 3KEMA 3T35A 1UJBA 4M21A 3TIXB 1S02A 4B83A 1A9TA 3L7NA 1HFWA 4MYCA 5ALPA 2Q0HA 3H1AA 5TDHA 1YR7A 3KUXA 1IEXA 3MYRA 5DH9A 5GONF 3ADCA 4LPSA 3H3XA 4CBVA 4IKOA 1PZMA 3B52X 5JSHA 2G7ZA 3K53A 4XB6B 3PRJA 3BPSA 2I66A 2R8EA 1P9OA 3FYUA 2IZZA 2W83A 5E1MA 3S5JA 3F8TA 4LJSA 5GV7A 1QGAA 1GFZA 1U28A 2NYAA 3EH2A 3UKJA 3A4VA 3L2OB 1XTTA 3H4IA 4L0MA 4QOIA 1MOZA 5TX7A 2P79A 5LB2A 4QC2A 1ZM3A 4QT0A 4KGVA 3CLSC 1C3EA 1A0OA 3DM9B 4YRTA 3TLGA 3S7ZA 4L0CA 1HUQA 1T6YA 2JI8A 3PRKE 4GX2A 4YDHB 5IBRA 3V7UA 1G2PA 1N1DA 1ORVA 3OVMA 4NK4A 1AT1A 2GZMA 4MJ3A 2P4SA 1SO8A 4FFBA 1AV7A 4BNTA 5C8ZA 1Y5MA 2EARA 3OLYA 4A6DA 2RCNA 2FOLA 4AY6A 5B2ZA 1SK9A 2N3ZA 1QG4A 1D0IA 2O8VA 4PIPA 3RYFB 2YXEA 3B3AA 3DZHA 4WBNB 3GPLA 3E4CA 5FBZA 3VU1A 1I1HA 4UU8A 3SMQA 3B3FA 5SY4A 1QTIA 2FW7A 1SGWA 1G8JA 2WYOA 1TUBB 4BX9A 3FRIA 4QYIB 5BOSB 2XD4A 2ILTA 2ZXFA 1T34A 2DCUA 3R5SA 2WIKA 3FVVA 3BE6A 1ODFA 4GSKA 2YVLA 4CF5A 2HSDA 4D02A 2QTNA 2OCIA 1I3LA 1JP7A 2BSXA 2CXRA 4M0CA 4DLVA 4X61A 4Z9BA 1DLJA 2YRWA 4AZTA 4GGOA 1ZCZA 1YKGA 4YP0A 4AZWA 1YZ3A 3UMYA 3IS3A 1TYBE 5EIEA 1CDOA 2G76A 5EJEA 5BSTA 4BO5A 1WB5A 2AKAB 1JAHA 1VIAA 1SVMA 2HGSA 4FWIB 4LV8B 3VNQA 4AO6A 4XPIB 5A6SB 1KDVA 1TQHA 2P35A 4KIUA 1Y7HA 4O4JB 2C54A 2HCBA 4R69A 5AXCA 4DXAA 1QHXA 2OXRA 1KZYC 4JBLA 4HAXA 5IMBA 2WLSA 4C06A 1QBGA 5CVJA 1VI6A 1RLIA 3EXG2 1JB1A 3IQGX 4P38A 5LXTB 4CMJA 1UKVY 4H77A 1UKEA 4YMGA 4M89A 4IGKA 3ESQA 3P2KA 4R5HA 3H83A 4RL4A 4EM6A 4UZEA 2OL4A 1OLUB 1VIVA 3CX7A 1M6VA 2P2SA 3IDOA 4OH1A 1JXOA 3SYNA 2BTEA 1LDEA 1H94A 1MIHA 1N2SA 3QVGA 4OREX 4PYLA 4TUYF 2PZGA 1E1QA 2BKUA 3QKIA 4FYVA 4LJKA 2D0IA 4ED9A 4DMUB 2A1TR 4J29A 4UTOA 4DR6B 4TQUS 3FYHA 2GR9A 2C3PA 4B80A 3N7TA 2AC2A 2XUDA 4INPA 5EWMA 4BNGA 2K87A 3ICPA 2WB2A 2HCRA 2AEJA 2E7ZA 3DMTC 3WL3A 1AURA 1H0SA 2BEUB 3H5WA 4FFNA 3LXUX 4FOOA 4B6SA 1RM5A 5TEVA 1KI7A 4EATA 3Q9UA 4MQEA 1JIXA 2IHZA 3VZCA 4CG2A 3T52A 1FXWA 2OOSA 2QY6A 1DDOA 1SQGA 5HIJA 4ZU3A 5DSXA 3SWWA 2H1OA 1E7RA 5FOQA 3F67A 2QSUA 1KBZA 4ASUD 2XEDA 2ZB8A 3RBVA 2OHOA 3P2EA 2GZAA 3FVQA 4P93A 5KX5F 1DAHA 2XXAA 4MRRA 3GELA 2ADOA 4X1KB 4BLUA 4ZI7A 2ZJ1A 1KJQA 1QGED 3MAJA 3U6KA 4FKBA 3T3NA 3KL4A 1MHTA 1W4RA 1TA9A 5HM8A 4IQ8A 5IYZF 1RJFA 3LNCA 2WTAA 5IS2A 1KWGA 1EI9A 3MUEA 4Z1MD 3NZEA 3DW1X 3EXFA 2J3IA 3EEBA 3HWSA 4MKGA 5GZ6A 1NIJA 1XMQB 3UJCA 1K8RA 2G08A 4PO8A 1WBBA 3E81A 2BMEA 4EEKA 4J9VA 1QQ7A 5E8RA 4DRZA 1YBAA 3K16A 5E0KB 5HRUA 4EL0A 5EXTA 4F45A 3VR1A 4BRZA 1NWHA 3I2FA 2J9ZB 3X1MA 3PNQA 1ODTC 1XEAA 2WIFA 3EGWA 5G0TA 4ALNA 2NGRA 3GB9A 1L4HA 1P9WA 3A6LA 4MR7A 5BNTA 4PG4A 1ZK4A 4FCCA 4GR4A 4JSTA 4MUHA 2A9VA 1MAWA 1N8TA 2WJVA 1WBDA 3OSZA 3DB2A 5G0WA 1KJZA 2AF3C 3RUIA 4DE5A 3CINA 3FHTA 1W19A 4N39A 4G4SO 4CM5A 3C6YA 3KB8A 2PMCA 1AKVA 5JMWA 4BNDA 3QXJA 5EFZA 2YHAA 4L8GA 1E9CA 4AXXA 2NVBA 3AXTA 4PW0A 1N2ZA 2J6IA 3EUWA 1F0KA 4C6HA 1NUAA 1JSCA 2CFIA 2OT3B 4Y2YA 3ICCA 2CWWA 4LC0A 4YS6A 1KTIA 3W04A 1R8XA 2CNOA 4JGIA 4RVFA 1RLTA 1RWVA 2M9MA 4G5GA 3E1GA 4N54A 3NIFB 3MF4A 7REQB 5CCBA 2AF4C 1AQUA 2QTCA 4HUJA 3DEIA 4R01A 2QRZA 5TPWB 1DVRA 5CH8A 1RJDA 1LNQA 4OI4A 3FUCA 3Q3IA 1SG6A 4HVTA 1B74A 1YDGA 2AG6A 2UVPA 3AMVA 2EP5A 4QOEA 4LEIA 1U99A 1KVRA 3KWFA 3MMNA 2AJDA 3WBFA 4D56A 3EBPA 4QXQA 3AVVA 4XVUA 1IDOA 3CZAA 3DO6A 3OZWA 3DW3X 2RH8A 5YASA 4BVBA 1NL3A 3OFND 2PANA 1G38A 4DR4B 1PSDA 3ZZUA 4RDHA 2O0JA 3ET4A 3RS8A 4BLPA 2O8NA 4I81A 2I4IA 1E58A 1OJ7A 4P4UA 2CFTA 4L28A 2VTVA 3GFGA 5DVZA 4LOAA 1M2OA 3ZU2A 4WK4B 1KRWA 1VL1A 2QSZA 5BW4A 1M2WA 3VYUB 2H6EA 4RSMA 3OSUA 2XUAA 5ALIA 2YFKA 1YJBA 2CDCA 2BW0A 4KE7A 5HM6A 3HLTA 3ZZ0A 4Q01A 3E8XA 4NQZA 4JROA 4CEIB 3HR8A 4RZSA 5FTNA 3TGWA 4QPZA 5HBRA 3BXFA 1W44A 5DLYA 5E4JA 4F21A 3BIWA 2PN1A 1DMSA 4OLFA 2J6HA 4CT0A 2O8DA 5AJYA 1VBFA 2C82A 2FSUA 4MRMB 2UDPA 3QX7A 1I2MA 4PZ0A 4EG3A 1OAOA 1N7GA 1OT5A 3QV1A 4GL2A 1I5EA 4MA4A 5TPWA 4WI1A 4KPFC 4LDPA 4YDQA 2REBA 1U5AA 1WX1A 2O48X 3GH3A 4IDOA 3RRZA 3RUHA 2E6UX 1BHSA 1UPTA 3C6ZA 4PZUA 1TPZA 1PJRA 3DEJA 3WRYA 1T4CA 3PRYA 2CHVA 4BC0A 1TKBA 1N2HA 4P84A 4C0HA 1T6NA 4O0LA 4D0RA 1XC7A 2Q4TA 5ESRA 3T3IA 1NOJA 5KTPA 3SOZA 2PT5A 3BBPA 5LB4A 4ISBA 4ZJYA 3QJGA 5JCOC 4WAUA 3PXEA 3M81A 1V5WA 1IWOA 2AYXA 4BLSA 1K7CA 2EKQA 3VNAA 4A0FA 2FWMX 2UZ1B 3D8NA 3FVWA 4ALJA 3OWXA 1EVKA 5HQTA 1L5HB 1TT5B 3O1IC 3U4DA 3FI0A 3IFSA 3TTXA 2ZRGA 5AJVB 5IULC 2DM6A 3D0KA 1NQUA 3S2SA 5FL7D 4XOIA 1KP2A 3UMGA 4EQZA 3GEGA 3H17A 1BJRE 1WPXA 3BF8A 5CVVA 5DIZA 4FMPA 1U2GA 3LKVA 1AGXA 4PG5A 2JIZD 2E1PA 1LVUA 1M54A 1NMEA 1NYTA 2CBGA 3VH2A 2WJIA 4I6EA 1E0KA 1ZD3A 1G3UA 3CPJB 3N5KA 1ZK2A 2P1DA 5TE9A 5CHEA 4S35A 1JWBB 4F0JA 3C16C 4A2WA 2F90A 1H2AS 2NIPA 3L0CA 2B0CA 3OFKA 3DXFA 2Y1CA 4CR6A 2FCAA 1P61B 1ZLYA 2HJVA 3U31A 4ENTA 1FX0A 1OHHA 4US2R 5HQ3B 1IBKB 3OKAA 4WZAE 3TEFA 3JSAA 3PU6A 5K2MA 2HSWA 3KOZA 3IR6A 2Z6UA 1T1IA 4EWLA 3WXBA 3IEPA 3GJYA 1KQPA 4IWYA 5EWLB 1DARA 5DHAA 4JJFA 4EYQA 4AJPA 1YOVB 4BV2A 2RK6A 2VDNB 2VTKA 2AXNA 2OTCA 1RRFA 3DQPA 2JA2A 4PONA 4Z4EA 2R97A 1OFHA 2A7XA 2ZJOA 1CZRA 3BRCA 3QM1A 4OFWA 3NGMA 2APJA 4J03A 4AJKA 1FYFA 3N8HA 4IVRA 5GIPE 3L7MA 3AEKB 1DAFA 5JCJD 2QS9A 1QVWA 1V3TA 1Y8QB 2JPDA 2R25B 3A1WA 3LQ1A 1N92A 1RI3A 1PVVA 2IYRA 2LUOA 4QDZA 3QWIA 4KRXA 1KYVA 2QQ5A 5HK8A 3TQTA 1Q0RA 3NT2A 3DHVA 3DE1X 3TZLA 3T9FA 2TMDA 4DZZA 2QJRA 2AFIB 3TTYA 8GPBA 3MJVA 3ZDBA 1GNSA 5IFLA 4BFUA 5KCMA 3SZRA 3RTEA 3RAFC 2H4JA 3SIWA 1N6PA 1PK8A 5MFPA 3COSA 1E9FA 4WDRA 2JFGA 1SXQA 1QYXA 3OJLA 1Z5VA 4PLVA 1Z26A 2P6NA 3ZGOA 1F20A 1P2BA 2W6QA 4HQNA 1Z5OA 4DA7A 5JNWA 4P92A 1FPQA 1NBMD 4E5DA 5T64A 1TAHA 2J4CA 2YCBA 3BHNA 3E5MA 3EZLA 4UNNA 3PDIA 2B4QA 2PWZA 4NMWA 4PLCA 3TTVA 3VNBA 3U9LA 1H1LB 1ECBA 2NTNA 4JD5A 1QZUA 4GPD1 5A06A 2DPYA 5EKUA 1T2FA 3FPAA 3AF6A 3LF2A 4QUGA 4MPPA 2YHSA 3PZBA 1GZ7A 3BORA 1XTUA 3BD7A 1MNAA 4Z9XA 3GLIE 4EUHA 1EX7A 3SX0A 4GI1A 3C5CA 3CUVA 4CI9A 4DR5B 4U6QA 1JYSA 2IEGA 1CJBA 3ND6A 2B8NA 3DTVB 1SIWA 1JX6A 2G07A 4NNJA 3UJ6A 5KU7A 1J2TA 1K0UA 4RF3A 3MEQA 3VR0A 1JHQA 2QAIA 4DVJA 2ZAYA 2HFKA 2P2ZA 3PDUA 4EFLA 4F4UA 1EGAA 4UTXA 3GY0A 1HE5A 4PC1A 1D6JA 1M8FA 1MAAA 2WUFA 4WN9A 4BO9A 3G0CA 4HRXA 5CVCA 1YO6A 5GWXA 3Q88A 4F11A 1YKSA 5ADUS 4OP2A 3GLHA 1KFBB 2UVDA 4DEXA 4TKVA 1VPDA 1JEYA 3PGXA 1T24A 2H0QA 3M4NA 1PZEA 3HDGA 4Z0NA 2EQ5A 4UBIA 4JP5A 1NP7A 3U3JA 2VZ0A 3CISA 5AKGA 1ZWKA 4PCAA 4D5GA 5HUJA 5IVKA 1EUZA 3HPQA 5HZGA 1WPGA 4HWRA 4YWJA 2ZJFA 2DBYA 4KR3A 2RCYA 2O19A 3ZWDA 3KUDA 3GA0A 5D3MA 1FFSA 1OC4A 2AI2A 2IYYA 4BPRA 2QDKA 2WICA 3OZEA 5E9QA 3BWMA 2X23A 3FXAA 4RHXA 3DLPX 4G81A 4HDKB 5FI3A 3ZIAD 1P7PA 1A76A 2P90A 3KZMA 4GBMA 4TZ0A 5AUNB 1DOZA 1N2GA 1UH5A 2Z95A 1MABA 4TL9A 1VP3A 2OC4A 4NIMA 3SSOA 5JAIA 3S2YA 3D6FA 1YJXA 4R9UC 4DYDA 4MCAA 3TGLA 3OEHA 1IHUA 3M6MD 1GOTA 1C29B 2V59A 2WVGA 3I61A 4MUNA 4MW2A 3SYMA 4I9NA 3P0RA 3CXUA 1HORA 2WBLC 1V4NA 2VL7A 2XYRA 4FYYA 1BCSB 5ENVA 1M6VB 3WB9A 1ODLA 3N2KA 1F1JA 2A94A 1UPXA 4HDMA 5CB4B 3GLFE 1HYEA 1F4LA 1I51A 2FB9A 4O2RA 2WWYA 3JAKA 5T4HA 2E2WA 3KTAA 3VGJA 4GC5A 4L8VA 4NBRA 2QUHA 4UDOA 5LR6A 3OLZA 3RBXA 2C8VA 4GRAA 4OQDA 4ENRA 2G06A 3USZA 3VAYA 1IZ9A 5JBNA 3GLHB 4IVPA 1G8FA 3UMBA 2OZLB 4I1VA 3HM2A 5ADHA 4QOJA 5ESDA 3ZLJA 2GHTA 2OHJA 2GBCA 1EXNA 3IIKA 3TI7A 1Z33A 2R1UA 2WSSD 4CM8A 4FC6A 3HU5A 3OFNA 1I33A 1R12A 3JCZA 3ICOA 3F49S 1G8PA 3MWEA 5FOWA 4GVLA 3D81A 1DC3A 3O92A 5FD8A 4KR7A 3M6UA 3LC0A 1M1NA 1T2DA 4B7ZA 1L4BA 1H9BA 1M6EX 1QKIA 1S9DA 2JHCA 3EW9A 3HB5X 4RVNA 4TVKA 2C5AA 3ZDQA 4U7DA 1GZ4A 1EDEA 4DYVA 3OT1B 5CD9A 2C8JA 3CX4A 1CY6A 4JY7A 1R0XA 4HMQA 1BIFA 1EYZA 4YMTA 1LJUA 3FHCB 4H6WA 4JN6B 4O3FA 5SV2A 1JR3A 1XLTC 2FFQA 1J90A 2PSHA 1IXZA 4G0ZA 1WXDA 2RAPA 2QE7D 2IHYA 5IG2A 2ILVA 3OQVA 4R1TA 2H5IA 2QRQA 4NYIQ 5CK4A 4BE9A 1H4TA 3DE6X 4AM8A 4KRYA 1EE1A 4LWQA 1WNFA 1B42A 3D5QA 4IIXA 3W2IA 4GOLD 2PS3A 4F2DA 5JZVA 1XHEA 2JAPA 1ZX1A 4KO8A 5E4YA 3TYXA 3OIGA 4EABA 4DIOA 3JQQA 4C87A 4JOQA 2HCTA 3SLGA 3OA2A 3FMIA 4ZI7F 3NUQA 3LWZA 5BN5A 2IH5A 1PDOA 1YA8A 2IIVA 1U11A 4CKBA 3BREA 3BMCA 1GQYA 4OA5A 2P2CA 5EYPA 1QCDA 1H3EA 5CW1A 1IBRA 2WP8J 1Q1EA 3GX1A 5DTJA 1CD5A 2BY4A 2G71A 2C94A 3AYXB 2ZAOA 3QLJA 4F4HA 1XMIA 1KL7A 2V7VA 3AL2A 4I6GA 4JWTA 4OU5A 3FTPA 4PEVA 5DI3A 3ZI7A 4EHNA 2BGKA 3DJFA 2CW5A 1X7YA 2ZSUA 3VPBA 4MUIA 2AOXA 2O9JA 3VPDA 4E14A 3VDMA 4I1YA 1J5XA 1A5AB 3JWPA 4FHFA 4BNJA 2Y0EA 5K8UA 2ZVDA 1UC5B 4EX7A 3G0OA 3L7YA 3H19A 4J3FA 3EA5A 4EKNB 3LPCA 5AHKA 5DI9A 2WD8A 1SAYA 2OLEA 4LVCA 3JQAB 3U5ZB 3KVRA 1W5BA 1XROA 3RG2A 3W79A 2FQQA 3DONA 4XARA 5DSZA 2XQIA 3IHWA 1UK8A 4B4DA 3SI7A 1A4UA 4JMPA 5JATA 5JVDA 1P62B 3PXGA 5ALWA 1C9EA 1V4VA 4HEHA 1KTVA 3CY6A 3WL4A 5KNBA 4GMGA 2WU1A 3FYTA 5CX1A 4C08A 3EIHA 2JHFA 2RIPA 3AOEC 3ANMA 3PI6A 4FN4A 3FCCA 4BASA 5BUCA 1G41A 3WL5A 2CHUA 1CQPA 1YL7A 2I7CA 3HN2A 4LCBA 4Y2QA 1O77A 5DFAA 3UO8B 3W2TA 2E37A 4REOA 4C1BA 2YXDA 2O05A 1UMKA 7MDHA 1R5BA 4R9NA 5CFMA 4JUIA 4CTNA 3FOAA 3Q0TA 1DIAA 4FTWA 4TS9A 2V3WA 4YJDA 3K9WA 2JFXA 3D2CA 3N0RA 1PWYE 4L7QA 4R8LA 3K0CC 4LJAA 1DKNA 5C51B 4GECA 3PC6A 1ZSVA 3PS9A 3DWGA 2XOXA 1KC3A 1PR5A 3D2AA 4EB3A 3I42A 5CFRA 1UBTS 3CO0S 4IGIA 4FOLA 1TEVA 3AVUA 2G4LA 4ARUA 3E3NA 3RJTA 2DBZA 2C1XA 1H1LA 1ZC4A 4R9VA 5KJ6A 1W29A 2AWNA 3FNQA 1N9KA 2PJUA 1KI1A 4JLMA 4ATNA 1JZTA 2B8WA 2IYOA 1EXVA 1E6UA 1N4AA 1R0ZA 3NTOA 1E94E 3UPDA 1XXLA 3B7PA 1RXUA 3FAZA 4GBGA 2B9EA 4HFNA 5FULA 5IEJA 1A69A 4HYQA 4QVGA 5J47A 1V0JA 4DIEA 4YLYA 7GPBA 1Z45A 1QIDA 1JQBA 1Z16A 5DGXA 3OE1A 1GIAA 2R8RA 4TRJA 3Q7SA 3JYQA 3F6BX 3E9MA 3GGSA 2CUZA 2ZJAA 4YJ2A 2XQGA 3IEKA 2O3RA 5F51A 4MV4A 3ZCVA 5LMZA 3TJMA 4EZBA 3FVTA 1EXWA 3DYBA 2GA8A 1H2RS 1M2VB 1ZICA 2HF7A 3AUAA 3QVWA 5AVXA 4X1KA 5ECYA 1MNQA 2JVKA 2X9QA 3UM9A 4HMOA 4TL6A 4N0DA 1GQFA 3PSAA 4LY3A 2H11A 5CTAA 5AVWA 5KJ1A 5FPKA 4QBIA 4US0R 1J39A 2IIQA 2Q3CA 1JEEA 4PGHA 4QVIA 2W2XA 4B3SB 4LFAB 1BG6A 2Q46A 3CW2A 1O9HA 4WMLA 3UJBA 3BCRA 1Z56C 5FHRA 1AKRA 3ROKA 3ZVNA 4H3KB 2WNSA 3E9CA 1JNYA 3BXXA 1FS5A 3MD9A 5DM2A 4QECA 3ACDA 2B20A 2WD7B 4F4DA 4L8LA 4FHCA 4X95A 5KAMA 3EQ9A 4HQFA 1T26A 4D79A 3NEAA 2DB3A 3UHAA 1JEQB 4DV4B 1TO2E 2KMLA 2DHRA 2ETVA 1G4HA 2NSHA 5JD3A 3KS9A 1YCGA 1VBMA 3AUFA 2EZUA 2AMYA 4A27A 2GPNA 7MHTA 2JFZA 4OP1A 1VRCA 4YTEA 2ABWA 1OB5A 1MOQA 3EDRA 4U2GA 3TEMA 5CDGA 1BU5A 2CXSA 3LO5A 2WHQA 3V7FA 4UOZA 4NV0A 3E9DA 1AGNA 1K88A 1UWKA 2BFOA 3TQHA 4C4TA 4UTNA 2GFIA 1PD0A 1DQRA 2FLVA 3IDQA 3EXAA 3WYBA 5T5QA 1EZZA 2BFCB 2FSSA 2QVYX 5FOUA 1T8RA 3C87A 3IDSA 1WZNA 3SBEA 1F2UA 5F76A 4WESA 3U7EB 5IJZA 2TMGA 2AFVA 3EZ2A 2OYCA 5CDUA 2YV4A 2RD2A 4NC9A 3W2FA 3EMBA 3PGMA 5CA0A 1YHZA 2NAFA 1NJ6A 1Q7EA 3HFSA 5BWMA 3A27A 5A1JA 1SMKA 2JD1A 3OTIA 1E89A 2BE9A 2OE2A 3MFYA 3DLAA 3VZPA 4ZVTA 4QOGA 1C8LA 1KR2A 1Y0BA 3L4BC 3NYQA 3THRA 5PNTA 2ZJ5A 4P31A 3VR3D 2RAFA 1CRZA 2PUFA 4RMIA 4LK3A 1OWPA 1A9SA 2NO9A 2ORYA 2NVWA 1FUYB 4LDRA 2Q49A 3UFXA 3I9FA 1ZNXA 2H2WA 4NTZA 4CKBB 1YZYA 3ZY6A 4XDYA 2BSQA 2FMKA 4HLNA 3BMNB 1B6GA 1NBHA 1WUHS 3SC4A 5FOSA 1TEZA 1S2MA 4F46A 3DHEA 1NU8A 1XJQA 1N3BA 4FIDA 2ZR8A 1F14A 3IMEA 4M8LA 1XQ1A 4D8UA 3EPRA 2HIGA 4CM4A 4BE7B 2FRXA 2IPOA 3AFHA 5AOBA 4F2WA 2BISA 5DHQA 4DDMA 5JRDS 1VPVA 1P7ZA 1T9GS 2VWQA 1NT2A 1VMEA 3S7TA 2WUVA 3V8NA 1GRQA 4AY2A 2FRDA 3I2YX 4F1JA 2XGSA 2X19A 3G8BA 5KYVA 5K0GA 3EBOA 1E4EA 4NBNA 4QGFA 5U4XA 4GP7A 5T3UA 1WZEA 2RC5A 4AZ0A 5L4SA 1QIJA 4IF4A 1WMSA 4ZQFA 2C2WA 4MQEB 3K3PA 4OOEA 2FK8A 4A10A 4PQEA 4ZHSA 1L7RA 1QIGA 2GCOB 3F5FA 4ZYVA 2XE6A 2RC6A 3WKAA 3IE1A 2GESA 2QMUA 3Q7IA 3PYLA 1QRTA 3OQ1A 3KJGA 2CT8A 1WKVA 1CPYA