4RA9A

Crystal structure of conjoint pyrococcus furiosus l-asparaginase with citrate
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
182
structure length
182
Chain Sequence
MKILLIGMGGTIASVKGENGYEASLSVKEVLDIAGIKDCEDCDFLDLKNVDSTLIQPEDWVDLAETLYKNVKKYDGIIVTHGTDTLAYTSSMISFMLRNPPIPIVFTGSMIPATEENSDAPLNLQTAIKFATSGIRGVYVAFNGKVMLGVRTSKVRTMSRDAFESINYPIIAELRGEDLVVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-asparaginase
publication title Structural and functional insights into an archaeal L-asparaginase obtained through the linker-less assembly of constituent domains
doi rcsb
source organism Pyrococcus furiosus dsm 3638
molecule tags Hydrolase
total genus 58
structure length 182
sequence length 182
ec nomenclature ec 3.5.1.1: Asparaginase.
pdb deposition date 2014-09-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold L-asparaginase, N-terminal domain 4ra9A00
3ECAA 1JJAA 1HO3A 1WLSA 2P2DA 4PGAA 5DNDA 5K4GA 2HLNA 5DNEA 2P2NA 1HFJA 4RA9A 1ZQ1A 1HG0A 1NNSA 5I3ZA 2WLTA 5HW0A 2GVNA 5CBPA 5K3OA 3PGA1 2OCDA 4Q0MA 4R8KA 5I4BA 3NXKA 5DNCA 5I48A 5K45A 2HIMA 1O7JA 1JAZA 1HFKA 1IHDA 1ZCFA 2JK0A 1DJOA 1WNFA 1HFWA 4NJEA 2WT4A 1JSRA 1JSLA 5F52A 4ECAA 3NTXA 1DJPA 4RA6A 2D6FA 1AGXA 5K4HA 1HG1A 1WSAA 4R8LA
chains in the Genus database with same CATH superfamily
2R84A 4X8MA 3MTGA 2WJWA 1F8XA 5DYTA 1QPBA 4F4HA 2I3ZA 4LNUB 1VPEA 1VJDA 3L0ZA 3ZGNA 3CIOA 1SCUB 3IXMA 1JFSA 2HD4A 2C7GA 1MJGM 5HUJA 1GGKA 3LY9A 4OATA 5LP6B 2J46A 4MKZA 1XCLA 3F3KA 5LLDA 2XJ9A 1WHSA 4QJ4A 1UBUS 3EUWA 1CJUC 1EHIA 2XMSA 3K70D 3DMDA 1ZD1A 1K3FA 4DNPA 2GI4A 2V03A 2VTDA 3R5FA 1OLUA 3RKRA 2OHHA 2W6ID 1XPUA 4GMGA 2EJCA 4F21A 7YASA 1T26A 1QM5A 4RVCA 4V1CA 4IQ4A 4JXZA 4WCDA 3VR4D 1GRNA 5KNDA 4Z53A 2VCYA 2ANBA 3AI7A 3KQQA 5HMMA 3V4RA 5AKLA 1Z62A 3MCVA 1U8YA 3HN6A 2AJ8A 3F5QA 4TWIA 3W4IA 4A2CA 5IZ4A 1HRKA 3DMPA 4XZ3A 3HB4X 3OPYA 2GEFA 4X1IB 4EKYA 5AIBA 3SYMA 3LUKA 2XE8A 4B4KA 2GJ4A 4CUZA 3HCDA 3DEIA 5DM2A 3O7MA 3PGA1 1AKTA 3PLNA 4KDCA 4MWSA 3ZH2A 4HH3C 3KQWA 1V2HE 1KYYA 5D85A 1P44A 5AP9A 1KXJA 2FQYA 2P4UA 1VMAA 3MGKA 2IPLA 3DE0X 4WK0B 1O94A 4YALA 3FZQA 3ICOA 5E7MA 2WUGA 3I5UA 5D00A 5IULC 1NXVA 2DBYA 3CNNA 5FWYB 4D9MA 1Z22A 2RK3A 4OXXA 4CFZA 4B6FA 3DEJA 3KZCA 4YJDA 4AJEA 5JALA 5A9RA 1OWPA 5GIOE 2DQ4A 1YWGO 4PFKA 5EAIA 3CKLA 3DP7A 2W5UA 5K8IA 3IBFA 5K8VA 2FPXA 5REQA 1QFZA 1UOEA 1GZ6A 5B64A 2RGEA 5AW6A 1KR2A 3G2KA 4DZTA 5CUQA 3B5JA 2OLKA 3CLTC 2CF6A 3WRWA 5K20A 3QTTA 4MW0A 1NG9A 4YP5A 4KI0A 1A27A 4IO0A 5IXYA 4ZT5A 4FQ7A 5JR3A 3V1MA 2UVQA 2SCUB 3I6MA 2QTVB 2PT7A 1ISFA 5JD3A 3FUUA 2ZYSA 5BUZA 1NJGA 2ZIXA 2R97A 3G5MA 4CUKA 2HJRA 4LJRA 4XW2A 1HDIA 4GBJA 5AI8A 4ARAA 5KTOA 3S2UA 4WASA 1GCIA 5FA6A 4EENA 3LQ4A 3H75A 1LW6E 1Y5MA 4GI3A 3LQRA 3EZ6A 1XTPA 3OIUA 3NHZA 4MWDA 4RQAA 4BJHB 1FBNA 1FRVA 1GZVA 4UD2A 1MAAA 3B1VA 3SEQA 3WSVA 3OWOA 4N47A 1ZH2A 2DECA 2Y2UA 2XCSB 3VZCA 2RGCA 1SPXA 3VC7A 5IT9A 4AKHA 4UVDA 3THWB 3DHNA 4Z9YA 4HWGA 5F9HA 1QHHB 4YT8A 4WLEA 3W6PA 1NQ5A 4PYOA 4TOIA 3RS9A 4GM1A 1SG6A 1SCIA 3I83A 2JCXA 4EGSA 4BQRA 2F1KA 3R74A 2VRWA 5JASA 5DBIA 3ZWQA 1CR0A 1VBMA 1T15A 2FRVA 4Y2JA 5GQSA 2YIJA 1D0IA 1QAOA 3Q5DA 4YUXA 3W0LB 1V1JA 1Z88A 2FMTA 1Z08A 3A6ZA 4W6ZA 3PJDA 3PI6A 2YHBA 4X64B 1BWPA 2UZIR 3TX6A 1LBQA 5HA5A 4AZ3A 4EY6A 3RVSA 4G5QA 5AW7A 1WJGA 5IVHA 1GPKA 2LVBA 3G0BA 1H4TA 3QBJA 2P3QA 4ZPXA 4TVKA 3K70B 4N39A 1MR3F 2IX9A 2ZRKA 2ZCVA 1YBMA 2FZEA 5L7WA 4GC5A 1E2NA 2Q3HA 5AKXA 1WKVA 2RI6A 1JQJC 3V4SA 2Z83A 3GNSA 5I9BA 1CETA 3V4OA 5BWNA 2GF0A 2GHRA 3D6AA 3E1GA 4HC4A 5H3HA 5L3VA 4M87A 3LWDA 4HP8A 4RY0A 2JIDA 4AXBA 2VDJA 3JW8A 3RYHB 2J87A 3VHRA 1YXMA 5K7SA 2W90A 2DWCA 1KORA 4RQTA 1ZC4A 3HJAA 1D2HA 2GUWA 3EEQA 1COWD 2Z8ZA 4B3SB 4JBGA 3AV3A 3UMJA 4G5YA 3KXPA 1OV4A 4I8IA 1AKVA 4BUJA 2BGRA 6YASA 3MFYA 1GYQA 1LK7A 2P9EA 1RS0A 2CCGA 3LW8A 1VQ1A 1EB8A 4U8GA 4C0SA 3R0IA 1DWPA 2AOUB 5K0JA 1ZDMA 2F9FA 2JLYA 2X1LA 1VI6A 5DX8A 1GPWB 3IVGA 4MUAA 2NM0A 2P2YA 5CLQA 4BQOA 4FP9A 1I3KA 1KPHA 2IOFA 3GVPA 2H0QA 3OQIA 5ELLA 3VO2A 2O1SA 4NBTA 1EX9A 1XMQB 2RGRA 2IIQA 4W7IA 3ZCTA 1QAMA 8LDHA 2AYZA 3NBAA 3GELA 1QG0A 3C6MA 2PV7A 3ITKA 5LBTA 3RT9A 2FQ1A 4UZFA 3VHQA 4IZOA 2AKEA 3FNQA 2X7JA 1Z28A 1TTQB 5BSKA 3IDFA 2X3UA 4II3A 2BF7A 1KZ1A 1OLSB 2P5UA 3QOWA 2IYYA 2UKDA 4YCJA 1EJBA 2Q0XA 4RQBA 1IB0A 2F1IA 3Q3EA 1KYQA 4BMCA 4E12A 2HUNA 2ZI7A 3MCAA 4LZAA 3ORRA 4FWIB 1AX9A 3RYCA 4EGFA 4W5NA 4BFUA 4R71A 5I7AA 5TB5A 4EBFA 2B35A 5MGNA 1UMBA 3FHOA 4LRTB 1R9MA 4YRQA 2JVKA 4NXNB 1T1JA 4M9XA 2XUJA 3MMXA 1FX1A 1XL0A 3TUIC 1HGXA 4UVHA 2XF2A 2ORED 4WINA 4ZO9A 3RSCA 2C88A 5LP6F 1E8DA 1EAMA 2FMKA 2PO5A 3H7AA 5F51A 2LD4A 2WIJA 4QM6A 1KYVA 5HE8A 4A73A 2JA1A 4DYDA 4JXJA 2EIXA 5JMPA 1FF9A 2A9PA 2PS1A 2WSYB 3Q8LA 1I5RA 1XEWX 4WFIA 5J5VA 2HU7A 1E1RA 3EC2A 4GMKA 4BN5A 4F3NA 1H0HA 2GD0A 4ND3A 3I04A 4OHUA 4FOOA 4G4SP 1AKUA 1LC3A 4ZZ2A 1CB0A 4JLKA 4MR7B 4N0MA 4YACA 4ZCPA 2C4TA 2RFLA 4OLBA 3DG9A 2J30A 5J2UA 3MJVA 2I33A 4M88A 3HWRA 3IQGX 4MGZR 4BP3A 4L1KA 2E0IA 4MEBA 5IT5A 3DL2A 1OB5A 3CO0S 4QOHA 3OESA 4B3XA 1FLDA 1P0FA 3TAHA 3EBPA 4FNMA 3CX3A 4IIXA 2VXOA 4CF3A 4EY8A 1QV7A 2UZ1A 4E2XA 1YS1X 1CJTC 2KWIA 1KSHA 2QHXA 2I80A 2JGAA 3ET4A 3P9YA 3O4JA 3QA3E 4YJKA 2QAJA 2X5KO 3ZQUA 4MW2A 2EW8A 4MINA 4FDAA 5IDWA 5KX5A 3GHHA 3H05A 3KAJA 4DQUA 4KFRA 3O8QA 4EFLA 1O4VA 2F9LA 4AJNA 1X7WB 1YAHA 1BU5A 1ZN9A 4HAUA 1GLGA 1LRLA 2NNLD 1UM8A 4N5NA 5HP4A 1ZR4A 3SQWA 1JYEA 2NVBA 3O8DA 3BA1A 1DXYA 2ZQZA 5AW3A 1Y1TA 3I9MA 3GDWA 1NUAA 1OVMA 3R3UA 2R6ZA 4FDUA 1VYUA 4RK4A 2VDUE 3MBOA 4C04A 5FWXB 4X3PA 4Z0NA 2AXNA 2ZIGA 1HSOA 1SKUA 1KF0A 3OU2A 3A3KA 4O02B 5E6RA 1O95C 4D8UA 3ZHZA 4A8JB 2OBNA 1HX7A 1P60A 3ZPXA 2ZVPX 1W88B 1ZC3A 1A50B 3P2MA 2XI4A 1RLMA 3GLHE 4BMVA 4S12A 1XZFA 4DR2B 3LUJA 1F3OA 4PNHA 4AICA 1Z5ZA 3DYVA 4FC6A 4J3FA 4Q47A 4AG5A 5LNK6 2FXIA 1E4OA 1MT3A 3U3KA 2CB9A 4LJ4A 4LJSA 3HSSA 2ZCJA 4BGDA 3IO3A 3NOQA 4DV5B 3U09A 2VYFA 3TTWA 2NP7A 2XTNA 3V7YA 1XPOA 5C9ZA 4JA0A 2CJWB 2IKSA 2JC3A 4GLJA 3W05A 3ZWWA 2HCBA 4R1SA 5IT4A 1I2ZA 4KQMA 2C78A 2YASA 1YQUA 3KQSA 4YWHA 1PKEA 4BV3A 4ZOQI 4PGFA 5B3KA 1X7GA 1HOTA 1ZH8A 1BRTA 2FZGA 1AB6A 3E1SA 1PLLA 3WO0A 4EYOA 2R86A 1G7SA 1LCIA 2B2NA 2V5VA 3QIAA 3SOZA 1FUUA 2ACEA 1YK0A 4WK2B 5CAEB 1N6NA 3TBKA 4EVQA 4Q4HB 3A1TA 3DV0B 4I5GA 1QK5A 3UIEA 2Z5GA 3IPXA 4W9NC 3A7DA 1ELOA 3MOGA 1K7XB 5CVVA 4DMGA 2ETXA 3SHQA 2VZ9A 1U3CA 5GTDA 3VAAA 2ID7A 4DLSA 3N2KA 2VUSA 4ZHQA 5JBNA 4KYVA 2LW7A 1HE3A 4YRGA 1H2ZA 1WG8A 1RACA 1YBHA 1WWKA 1VA4A 3FPEA 3MJ4A 1H1LB 4R3NA 3HYTA 1FBTA 3ASYA 4LDJA 1MU0A 1EM8B 3C5CA 1MG5A 2P3SA 4X3OA 1BNCA 1VE7A 2OZVA 5EZQA 2HK7A 2O9JA 2R79A 3HDJA 5BQ3A 1D6JA 3WLQA 2P30A 2CVQA 3FLAA 2Y2VA 3FYCA 1RM4A 3AEXA 2X0KA 1UJBA 2FPKA 4D8YA 2C92A 4GPBA 2WUVA 4NIMA 3HXKA 3Q0EA 4TXLA 4UEKA 3DLTA 3ROEA 1UC9A 2HJHA 5T41A 1B15A 1ZM4A 2BFCB 2W2LA 1WUHS 3OZTA 4Y2QA 2HDNB 4ZC1A 1UFQA 4E2YA 5AW0A 4E0BA 1EFVB 1GL9B 1EK2A 1CPYA 1T2NA 4REOA 4UKDA 4AJJA 2YNMD 2QTRA 4EKDA 2XUQA 1YTUA 1VMIA 2ODEA 1OXXK 5TF0A 4ZN6A 1PLKA 1ABBA 3PCXA 1MKYA 4C3ZA 1KH2A 4L8VA 3V9PA 5CVJA 1M7BA 5TMBA 3UOGA 4BWYA 3L2OB 1Y4SA 3KD3A 3KPWA 4PWZA 1O9GA 3UA4A 4UU0A 3VZBA 5KCZA 1WXGA 1GPH1 1W8IA 2LRHA 3CTMA 4FYPA 1L9XA 5EIOA 3HUFA 4CU5A 3H0KA 1D4OA 1VMEA 1UPCA 5I8WA 3OIDA 5F7OA 3LVFO 3FLMA 4MR9B 1KH3A 3B9RA 2OXRA 2PKYX 5DX1A 1X1BA 5F7ZA 3ZGXA 3G8CA 4WZBA 4CKWB 2IYRA 2H9YA 2P6PA 2OZLB 2CXSA 4N5IX 3GUHA 3Q5GA 2VF4X 3QEMB 5AK3A 1J00A 2BOVA 4YEDA 3ECCA 4QOJA 2AFHE 1RWOA 3VDQA 2CUNA 2Q4BA 4QHYA 2Q6LA 3DH0A 4NU5A 4ERXA 1DKMA 1NR7A 1V9LA 1XYYA 3DDHA 4MVJI 4H3HB 2WM8A 4ZVSA 1BFUA 1GQSA 3CY6A 3VSDA 5AW5A 3VH4A 2INGX 1SOMA 5KTSA 1D2NA 4IJ6A 4IY1A 4MVXA 4ZQGA 3WGJA 5CBPB 5BV7A 4YI5A 1ZFNA 4C3VA 3BFJA 1SBIA 2PG3A 2BZGA 4MGHA 4R9UC 4BLQA 4BNGA 4V2IA 1IXKA 4ZO4A 1M10A 3GA0A 4BFLA 2VT6A 4RMNA 3HPRA 2HK6A 3DVSX 2BZSA 1U7UA 5C4GB 3HVRA 3RS8A 4YH1A 3IEVA 4K9QA 1T8YA 3TRIA 1TEZA 2WHYA 3A0UA 3I6IA 4BYGA 5KU1A 3F3SA 2V65A 4U1RA 3OY2A 4C4RA 1TMYA 1OJLA 1QX4A 2VXBA 2O8CA 1H8HD 1SXJC 3U81A 3EGDA 4OQEA 4UNPA 1PG0A 2RHWA 3S68A 2F00A 5F77A 4MMYB 2OGSA 4UM5A 5HKKA 4LOJA 3I12A 1NQWA 3NVMB 2AFIB 1I9CA 4UFOA 2DFLA 2W6QA 2FHPA 1GGJA 2NGRA 3QLUA 3EXG1 1X1AA 2WF7A 4P82A 4TLBA 5I4BA 3OFSA 2R11A 3BL5A 4BQIA 1BQEA 2PXCA 2CLFB 1SPBS 2P1RA 3E05A 4YECA 2MSNA 3EC1A 3QFTA 3PQEA 2DWUA 4CQLA 4CEJA 4BVBA 4OFXA 3R3VA 2ZIWB 2R8XA 3I5MA 2G4CA 4DNOA 3A4IA 4HNHA 5AJUA 4ZV7A 1OXUA 4K9LA 3A04A 4BX2A 4F92B 4W5RA 3ZZNA 3GU3A 1S2DA 1BKDR 3K0EA 5D87A 3NTLA 3TIFA 1L5GB 4FS3A 1HEIA 2NTNA 5AVUA 3G7NA 2DEUA 4LGMA 1CDOA 3ZWAA 5JJCA 2X15A 1ZCBA 4BJ1A 4WXEA 5LUBA 2E6UX 4EPTA 3D8HA 1GUYA 3K0BA 1RQ7A 2OORA 1U4OA 4C7OB 1ZW1A 4WKNA 3OLCX 4E5YA 2ZR8A 2J9FB 3QE2A 3ZHYA 4ZANA 1TB4A 3Q15C 4S0XA 1BMFD 3O4GA 3ZCPA 2YYAA 3MUFA 2B1RA 3ZLVA 4CLDA 3A10A 2QG9A 2QT9A 4YNBA 2N47A 3HDYA 1C8VB 2NQ2C 2R8RA 3N2LA 1HH4A 2A0XA 4LDZA 4BMNA 2EWWA 3JX9A 3HEMA 4CQMA 2ZB3A 4ZVRA 1U5CA 4DJTA 3SE7A 1O5TA 3JATA 3NGMA 3KHSA 4MSUA 4B46A 1VHTA 3EUFA 5DNAA 4IGEA 1E89A 5I5GA 2O0KA 1KQFA 3ESZA 1B76A 1OX4A 1T9GR 2QJRA 1CE8B 2X8JB 3C14C 3IIEA 3R6GA 3HA3A 1Y8QA 2QGZA 2V0NA 3F97A 1GHTA 4I5EA 1Y6JA 3N6VA 4L6CA 3EXHC 4OXKA 2VEDA 3B51X 4PYMA 3HNPA 2WDPA 4GWGA 4B9EA 2PKXA 4HGYA 1PR1A 5DJ5A 4DIFA 3CISA 5EIWA 4XGNA 5HQ3A 1P7CA 3O0DA 2VTBA 3DKVA 3VR2A 1YB6A 5F73A 4HS9A 2AE1A 2O3SA 4QFMA 4YYEA 2BCEA 4Z6KA 4XUGB 4BNTA 1TA4A 2PKCA 1N2ZA 1REQA 1U7HA 3NU1A 4J6FA 4LXYA 4RS4A 4D98A 1VJ1A 3RE1A 2OB1A 1LK5A 1N5JA 4GSKA 1ZVJA 2O8BB 1DJPA 3KZ1E 4HMOA 4R68A 3HC7A 4YMSA 1FVHA 1XL1A 2ZI5A 3SBEA 1AE1A 3RHSA 1Q1BA 4KKXB 3C2QA 2IYAA 2V7WA 4Q48A 1HO3A 3PI7A 2OUIA 3HJBA 4EL0A 4MUYA 2EFDB 5A9TA 1GCAA 5DLYA 5K3SA 3WWYA 3S99A 2ADFA 3TLGB 4ZZIA 2QD3A 4RV5A 2GXQA 1DG9A 1JMVA 2BHSA 3K0HA 2GDZA 2WU1A 3NT4A 2WUWE 3P5BA 1QONA 4LVCA 4TROA 4RH1A 3FGNA 1UC5B 2HI0A 2IF0A 1CUDA 1DBSA 3WWEA 4AY5A 4IM7A 1JSRA 1NUHA 2B1QA 2BHNA 1Z68A 2HPVA 5JQGB 4C4XA 3HK2A 1CUJA 1AKRA 5I5EA 2CNWA 1JKJA 3SEFA 5HXAA 4N01A 1U8XX 2GBPA 1CD5A 2QW1A 3K05A 3D6VA 1I7DA 4PIVA 3H11A 3ZGYA 3WGTA 5BSUA 3LC0A 5A5EA 1DJQA 4OYRA 4PZLA 3EXG2 4NMLA 2Q6TA 3Q7EA 3ZEIA 1I33A 4BJ5A 2EJWA 1E98A 4MRVA 1UP7A 2UUOA 3DM5A 3T3HA 1UAAA 2QLMA 3AHHA 2PZMA 3FNEA 3LQQA 2CFCA 4ARCA 1EK1A 1ZMRA 4P4SA 3WL8A 2QUZA 4FMCF 1RRKA 1GNQA 3X3HA 2WNSA 4BVKA 1U2GA 3SX0A 2HLDD 2JJ2D 3TI7A 4IHJB 2WU3A 4NS1A 1UC8A 4DMLA 4WL0A 1DXHA 2Q9CA 2XTAA 2H17A 3ODGA 5DBOA 1IRIA 2WW8A 4AT1A 3NYIA 4QHSA 5ARBA 1XMSA 4KPUA 1KI8A 5FI3A 1J42A 3JQBC 2BC9A 3EGEA 3DMHA 2YV4A 3GLKA 5CR9A 4ID3A 3URKA 5FUXA 2OLJA 1UZLA 1CUBA 1N2OA 4QNMA 5EMHA 3VHXA 1WOMA 2EV9A 5EP4A 1NVTA 2H4WA 3UH1A 1JUDA 4FZ3A 4R83A 2NO6A 4UMFA 5JWRA 5EEHA 1EVJA 4CL3A 4B6PA 1LX7A 3GX1A 4G1FA 4TTAA 1HLPA 4AY4A 3B8HA 3KKQA 2CL0X 2B8TA 2NU9A 5C8YA 4MV6A 1XTSA 4IKOA 3RFCA 3IELA 5K8LA 5CW1A 3KTAB 4FN5A 3DE3X 3P7MA 1YL7A 3L1JA 1PLJA 3JALB 4ZCIA 2UYCA 1P81A 4L95C 4YRCA 1B41A 3DZIA 4EJ2A 5KBYA 5LDGA 1UBFA 1F7VA 1RE1A 3W6UA 4R5MA 3LUGA 1NT2A 5KTMA 2EVWX 4DC9A 2EF0A 2VDRB 4P81A 3GY0A 1Q1ZA 3HMQA 2ZDQA 3ZKWB 1SVUA 2EZ9A 2BEUA 1KQOA 3AIOA 3D6NB 3R5KA 2YWBA 1GR1A 1LDBA 3W4KA 4MCJA 2IKQA 2IHTA 5SYAA 3EAGA 4HKTA 4NJMA 5TJ9A 2FN9A 4B3IA 4MB0A 4QYTA 4DG8A 3KL2A 3P0IA 1YFKA 1NPTO 2GEVA 2GK3A 1SKYE 3GEDA 3T34A 1I2CA 1JHQA 4JD5A 1YCDA 4PXYA 4WFKA 5JG7A 2HMWA 1RZ3A 2WU8A 5CVDA 3K0AA 3PXDA 4I19A 4LY9A 5TGZA 1UDCA 4DJEC 4YUAA 7AT1A 3ZDQA 1V5IA 2G09A 1H1TA 3IOCA 5EIXA 1UOQA 1WY7A 3I8OA 3PUVA 4MGEA 3FHLA 1M1YA 2CNOA 2GJSA 1KAEA 3F67A 3A1NA 1ZJ6A 1BOOA 5JAOA 1L7MA 3PNOA 3HKEA 3NHBA 3R6TA 4LJLA 3JSAA 4JLOA 3GLFA 2CT8A 5DTRA 1J2EA 1NQOA 2H9AA 3ZCUA 1JHAA 5CEEA 2PN1A 3IUBA 4XVQA 2JFPA 1PS9A 1UKYA 3ZBUA 3KUUA 5B4TA 5EMMA 4UUMA 3QKRB 4YP6A 2HNAA 2BFDA 1Z7BA 2RH4A 4UEOA 5AQEA 3WADA 4UVGA 1QPGA 5H0IA 2GMWA 1QYDA 3O2NA 1H2HA 2YUIA 4LBVA 3RAJA 2O5EA 1EFRD 3V4FA 3CUUA 1LI7A 3U56A 2GBGA 1FP1D 1W30A 3IE2A 3K9HA 1P6UA 3N0RA 4QEZA 1KVUA 1DELA 5DSTA 1L1QA 4GYKA 5EJ2A 3WWCA 3IPRA 5B30A 3G8AA 1WSDA 2LTAA 4AZSA 5T3UA 1R15A 5JXJA 1YSCA 5KYGA 5AVYA 1W44A 4WIAA 3ZHSA 5CCEA 1GKIA 2HMAA 4TWBA 1F8UA 4LC9A 4K1LA 4YMLA 4JJ6A 3DOOA 4NNJA 4OREX 2CVFA 4MA4A 3F96A 1E0KA 3P2YA 1UDAA 3AXTA 2HHCA 3CPHA 4JEMA 4OSEA 3U3MA 4LTNA 1WUYA 4YMHA 5KTTA 3FBWA 1MEEA 2ORYA 1TZBA 5JXIA 3J81k 2BE7A 3HV2A 3CRQA 3KKMA 3C3PA 4FKMA 1XKLA 1F4LA 4HQFA 4UEQA 3R4CA 5CA1A 2ZT6A 1I1HA 2O0HA 5GVRA 4NMXB 4F4JA 2DUUA 3OI7A 2BKUA 3TI9A 2OHGA 5DNUA 3C3CA 4UBJA 2ET6A 3RSOA 1MZVA 1ETUA 3ZV3A 3R0QA 2ZCUA 3O74A 5G3YA 3HJGA 3GFTA 2AVDA 2D5IA 1ZL0A 3IAS6 3LA8A 2JFZA 3IGFA 2YJZA 3A2KA 2HZBA 2QBYB 2PWZA 3I52A 3OHPA 5HBRA 3UT5A 5C4IA 1CRWG 3QQ5A 1H2XA 3WTCA 2YWJA 3DFUA 1UFRA 3LOUA 3GLVA 4P83A 4AF8A 3WMFA 1AZSC 3OG9A 4KO2S 3G5AA 2FUKA 1QO9A 4Q12A 1UQTA 3WWDA 1P73A 3IP9A 3SLKA 4JLNA 3R8CA 2P5SA 2ZSKA 3MCUA 2ZB2A 4G26A 4L8LA 4PG8A 4MKHA 2ZYHA 3UB2A 2Y1WA 4DANA 1E5XA 1HBJA 3FZNA 2QRHA 4MV1A 2MSCB 3LVBA 4HHEA 2ZR0A 2QLTA 4XX1A 5SZKB 1USGA 2FPMA 3QELB 5TSDA 3A9SA 4Y1RA 4D44A 3K0KA 4MITA 1XNJA 4J1NA 5TVKA 1RW4A 2PXXA 1NSYA 3AESB 3RRNA 2B36A 5T67A 3IS3A 4EDFA 1RZRD 4D3DA 1P39A 5ITZB 3GMDA 1OROA 5A3JA 2E49A 4G5HA 5DEOA 1HDEA 4HNTA 3AR2A 3ZJYA 2EX0A 1U8FO 4JK3A 1JFFA 1O8CA 2HIGA 4IDPA 4IIGA 4NCNA 4BNLA 5CCBA 1YR3A 4K6OA 1FP6A 2W8BA 5IP5A 5BSVA 2FY8A 1W36D 2BI7A 1MLDA 1KHTA 1NKVA 2OV2A 4N0QA 4AJ1A 3IT3A 2FEWB 5A4KA 4Q82A 4PYJA 5KJ6A 1P74A 4WEQA 4DCVA 3PD1A 4PV7A 5L6MB 1QWOA 3EIWA 2DPHA 3Q9SA 1YR1A 3OWXA 3K9LA 3PSAA 1KTIA 3EVEA 4QE3A 2W6NA 3B5IA 4ND1A 5IHXA 2H18A 2XOKD 4IHJF 1ZK3A 1QKKA 2IEZA 2N75A 3NRCA 3Q2IA 3TJMA 1K0FA 4LZLA 2QEQA 2QA5A 3LCJA 1ZN8A 3B7GA 1KO7A 2ESRA 2XYHA 3NM4A 3GG2A 3IQXA 3OTGA 4OUDA 4PO1A 5CIQA 1R4MA 1U5BB 1C7FA 1L7EA 1ZAKA 5HKBA 2ZZMA 2DR0A 3R8FA 3VNBA 1ODFA 1NLMA 3IPAA 4L0QA 3QVTA 3GP8A 5B1IA 3RQSA 4KR7A 4RXUA 4CIBA 1NF3A 4MAMA 3FIJA 3NIFB 2BGUA 4AM8A 1K8YB 1NQTA 1RYBA 3IAXA 3MOIA 2FW1A 2WI8A 1FTSA 2FPUA 3EVZA 4X8HA 3Q6MA 2BP7B 5L40A 5CT5A 2FXVA 3IKJA 3KR0A 4H6PA 2OC4A 9MHTA 1YRYE 1GKLA 1NYTA 3C74A 1G5HA 3AY6A 2C57A 2ILTA 3NFYA 1UK8A 4FCWA 4FQ8A 5CXUA 1IXYA 2BTEA 4S2EA 1X39A 3MERA 1RPZA 4V0QA 2UUAB 3DE2X 1HOXA 3U39A 1QYCA 1VKOA 3ENKA 3BCHA 1Y81A 3ES9A 3QVGA 4KL8S 5LQSA 2ZSAA 2H1OA 3GYGA 3TDMA 3V46A 3M33A 2DFNA 3T5GA 1T0JB 2QZPA 4Q03A 2GN0A 4XQ9A 4B80A 2EJBA 3PX2A 4KQ9A 4E70A 1T3TA 3L8ZA 2R7NA 3DMYA 3WZ2A 3X2EA 3TLXA 1SWVA 2JJ8A 4C6SA 2IYUA 2QQGA 2X19A 1HA3A 5ALNA 2HH9A 4PN3A 3L82B 4IILA 1KAGA 1XQXA 1STOA 5ER9A 1FW6A 2O3JA 2WU4A 1IJFA 3R7NA 1VM6A 3HMKA 3DOCA 4J03A 4NFLA 2PSEA 1W29A 1MOQA 1XRJA 2X9QA 3D64A 2V45A 3HR8A 1PQ4A 4XQCA 5F1YA 3HN7A 3AEUB 3PXEA 4P31A 5BYBA 4MVJH 1E66A 4NZMA 2P9TA 2XQKA 3LQKA 1LQUA 4BWGA 3N2GA 3OE1A 3U7GA 4DIKA 3EWAA 1U8TA 2AOTB 1TEHA 5CD1A 1FTGA 3I1JA 1XD8A 2C0CA 2FR1A 3ETJA 3HO8A 4XWOA 4CF7A 1I24A 2BF4A 3L92A 2G71A 5JHHB 1OA1A 4G65A 1ENYA 1QKIA 1R0CA 4NESA 1NIJA 3DWFA 2OGWA 2I8CA 1XCPA 3FUCA 1NY6A 2F3RA 2QDKA 1FFCA 4YGXB 5DASA 2AS0A 2YYZA 3EFHA 5C8DA 4JLBA 4HEJA 2JHFA 5EJ6A 3CUSA 1TUBA 3RODA 3G8DA 1XU4A 1MNQA 4QT4A 3SQDA 1RLOA 2YZ2A 1SVKA 2EKLA 3MNFA 4O5OA 1MO2A 3DXYA 1I2DA 3NBZC 2H06A 3S70A 3P19A 4CF5A 4CIYA 5CJPA 1ZJJA 4MRSA 2ZU6A 5JWHA 1LVGA 1S3IA 4ZU1X 2XA1A 1XD2B 4P5DA 4ZTZB 2ODAA 4Z9BA 3N28A 3SXPA 3W9BA 3ZWKA 3HWX1 3C5HA 4EAAA 5CG2A 2RHGB 2CLLB 1OWLA 1SNYA 3KT3A 4CIWA 1EFLA 5A4DA 4ZT3A 1W36B 2AK3A 4LGVA 4XSHA 4DIEA 2ZBFA 4BNKA 5IWCA 4RFSB 4XAQA 3B60A 2B4AA 1X1RA 3VFDA 2HF7A 1RXYA 2WTAA 1VMDA 2C5HA 3AERA 3R2JA 2I3AA 3MGBA 4C4OA 4A0FA 2NZ2A 3JPYA 4YRZA 2P6OA 3UM9A 2UVDA 2JFQA 5K03A 2G5PA 1KMQA 3D8UA 2ZTVA 3V2IA 4AQDA 2OOSA 4WBNA 4ZYXA 4EFKA 1LGYA 2H48A 3STXA 4HN9A 1GYPA 2NTVA 3HUDA 4DHEA 4DR3B 2YJ6A 2DXIA 2HCFA 4LNUA 3M5DA 5L3ZA 5AJWA 4RK6A 1ULUA 2G8LA 3K9CA 4HPWA 4A7PA 4EEZA 4J0EA 4JENA 2FX5A 3MTIA 2E4UA 3H3XA 4MQ6A 1TAHA 5JSZA 4GR9A 1T6YA 4YASA 5DNEA 1NUQA 2Z30A 4KWHA 1ZJYA 3JQ9A 3X2SA 5B3LA 4GI5A 3S1SA 2PLWA 3RS4A 2QX4A 4IH9A 3BIOA 4QBIA 3FBGA 1LDEA 4JVLA 2FSUA 3R3SA 4RK7A 3RVJA 1E1CB 1TC1A 2COKA 4R1NA 4FINA 3LOPA 1N9GB 4KE9A 3C6ZA 1JIUA 2ATIA 2X8LA 3WJ1A 1E8MA 4H35A 3QXHA 9ATCA 2NVOA 4FYYA 2ZSBA 1RHQA 3OHMA 4LK3A 1XZ8A 3VR6A 1EM6A 5HDBB 3VYTB 1VP9A 3WL3A 4WUVA 2O6HA 5ITWA 3NUQA 5FTJA 5HSGA 3N5CA 1X7XB 2WWRA 3TO5A 2DCUA 4MPDA 4UE6A 2A58A 4GPIB 3IVAA 4BFSA 3QX3A 1ZD2P 1AA6A 5A05A 3EULA 4PLVA 3QYJA 1LPNA 3EHEA 3RBZA 4ALJA 5DM0A 3DTVA 2W70A 4DOMA 4GLBA 4J0CA 5FPPA 5EYPB 1SUEA 4RJKA 1PL7A 4Z9XA 3S3TA 1A69A 3CLUC 3U4CA 4BKRA 1HYEA 1NJ2A 1PT6A 3V9AA 4FM9A 4X8LA 3P2EA 1O6CA 4FGWA 1C8LA 1AB5A 1PJ4A 3EA4A 3NVDA 2H5LA 2AQIA 5MHTA 2C1ZA 5K3DA 4IBOA 3RHZA 4PYQA 2GN9A 2AWNA 2VHQA 3P9CA 1FFGA 1W4LA 3NHSA 3SYLA 3NLLA 4QVKA 4YXWD 1V3UA 2FWNA 2RIRA 2R8OA 4GOXA 2C96A 4H3KB 1CZLA 4RPGA 2QUHA 3DZBA 5JVDF 1LX6A 1U2SA 1Q7BA 4NBNA 5JDCA 4E5DA 2YJGA 3A7EA 5F3DA 3S7ZA 3W7VA 4GMXA 1Q11A 4MJ3A 4AMYA 4K6MA 4BVEA 4DILA 2OBMA 4EVSA 3OU6A 1E99A 1DTWB 1KKLA 3B7WA 1TJ3A 3MYRA 3EF0A 4JX8A 3ZX4A 3ZE2B 3HGQA 3EF1A 3E1KA 4DG9A 4GKAA 1G8SA 1WD5A 1SRRA 3C4QA 3DHVA 3O47A 3PC3A 3QYAA 1KWKA 3MGCA 2QRZA 5AKZA 1RKQA 3QE3A 1VA5A 2HF9A 4TKVA 1ZYUA 1GAJA 3SHWA 3ADCA 3KYBA 2NVUA 1A0OA 2X6QA 5BW6B 4QU5A 1W47A 2V98A 3H6KA 2CZCA 3H8JA 1ONSA 4GGMX 2BONA 4QASA 5CM2Z 3VH2A 2Q46A 2ZSUA 4FOTA 5K05A 1AMOA 2AZTA 1Q0PA 4ZICA 2ZE8A 4E51A 5KYYB 1UWCA 4PVDA 2GS9A 1RYFA 3DO5A 3MJTA 2ZRMA 3I0MA 4NFHA 5KC9A 1F8GA 3W3AH 4FFBB 2F3UA 4M8NE 1RZUA 3UJPA 3ZYZA 5CEFA 1YFZA 1IVSA 4KE8A 2DR2A 1SXPA 1XRMA 3SZRA 4JJ7A 4BEWA 2YBDA 3K1YA 5IT0A 4AMGA 5L8VA 2IU0A 2WZCA 4P4TA 4RCYA 1Z7EA 1LF0A 3WMWA 1GPUA 5JE8A 2V6MA 2Z57A 3K0CC 1DQRA 4OJKA 3IAM1 1SD5A 4Y1EA 1WX1A 4ZOBA 1WXQA 4LGCA 1JAHA 2PU5A 4BHTA 1D9ZA 2OT3B 1QBKC 3CUEF 4TZ0A 3U3XA 4GUDA 2PZJA 4MW9A 4Q3DA 2VAPA 5SZHB 4GZ3A 5B1EA 3TBFA 4MYCA 3UKJA 3U7IA 3U4QB 2FI1A 1Q0LA 3BXOA 3OEHD 2CNBA 1DEKA 1Z0DA 3BF8A 1J1IA 3O9ZA 4LE0A 3Q41A 2G80A 2D5AA 4GBMA 2WYIA 1T9HA 10MHA 2RGYA 2VRBA 3U40A 1NP6A 2CLSA 2VA8A 2W6IA 3MD9A 3RIGA 4OI0A 1YDFA 4JHXA 3TOCA 5FPTA 2E5LB 5F3WB 4J2HA 4LYGA 1GL6A 5F78A 3TGWA 4I1PA 4HZUB 1XF1A 3L6EA 4KNYA 5IDQA 3QKIA 4OAOA 1NVEA 3D6JA 3N3AC 2HDOA 1IBMB 3L8GA 3I6QA 4P80A 4RZSA 3HA2A 1KI6A 3GAZA 3NO4A 4RF4A 4AUEA 4J8PA 1CKEA 3WR5A 5IJ0B 2Q50A 2NTJA 2COUA 1AQIA 1Y9ZA 1YR6A 2QN3A 2KB0A 3IJ5A 3JQAD 3NHUA 3OJXA 4H7EA 4HFMA 3U0BA 2CMDA 4KX3A 3KB8A 1YULA 4BQSA 2H29A 3WVNA 1II8B 3KALA 1IM8A 3MWEB 7GPBA 3UHFA 3L6CA 1JQ5A 2NMVA 1R5JA 3WL4A 4YT5A 1P1BA 3T95A 2VG8A 5CB4F 2POQX 1QP0A 3NDBB 4ERNA 5FV7A 3FWZA 4LCEA 3DGFC 5HE9A 3BD7A 4OKSA 1CQJA 3L77A 1JE1A 4PNPA 2IOFK 4PCUA 2ZYAA 1P5FA 3EOBI 4OIFA 1IPHA 2BBTA 9LDTA 1NN3A 4N41A 1V39A 4EB3A 3V1TC 4R84A 3BTUA 5KTNA 1J6UA 3BMOA 4MB6A 4WUTA 5B7QA 3DT9A 4Q1BA 1HYGA 2EFGA 5C35A 4B3RB 3HJCA 3I01M 3T5DA 5B36A 2IHUA 4EJSC 3EJ6A 3NONA 1MQSA 2RGNC 4UTXA 4BBPA 1PO7A 2OMEA 1JNYA 3M5PA 3HJRA 5EWJA 3U19A 3AJ8A 4KJXA 4ASUD 5H5JA 4K3VA 4NPAA 3UQYS 2RGDA 3CF4G 4U39A 1UKBA 1O95D 3EDCA 1JEQB 2XNDA 3B5EA 3OZRA 5AXBA 2O52A 3RLFA 2AZMA 5K8UA 3GOQA 5FRDA 1IXSB 1ZD4A 5DNYB 4X3CA 3WIDA 3LK6A 4QUJA 3WE7A 4E2WA 1Z5NA 4F91B 1JZTA 3WB1A 2WG1A 1WPGA 1OYOA 3GV0A 2WQ6A 4RD1A 3E9RA 1X1EA 4J7CA 1QF7A 4DWVA 1IUPA 1HK7A 3GQVA 2WAMA 2P1ZA 2HGSA 3BF7A 3DKIA 5HJ5A 1XNQB 3SAJA 5FAXA 1RXEA 3VNRA 1TFUA 2JAHA 3EDRA 4O8CA 4TL9A 4TKUA 1QFXA 4QWWA 3CZ5A 3CZPA 1NG1A 2F8LA 1IY1A 4KE7A 1PT7A 3GBVA 1KO8A 1SU7A 5FHRA 3EPKA 5FB3A 2FLWA 1TJNA 2WNHA 5CX4A 2NUPB 2Y77A 4TVSA 4Q16A 4KWEA 4FE4A 4QUBA 2WD9A 4P84A 2V9PA 2FW7A 3U16A 4CF6A 5DISB 4PLTA 1ADCA 1ZJ4A 5DHPA 3COVA 5EHGA 1Z6GA 3NTVA 5JCXA 3H3JA 3GRPA 3I6BA 4FNAA 1HLGA 4E46A 1JWAB 5J4KA 1W96A 1DMSA 3WJ2A 2X2FA 4KIUA 1HWYA 2VUIB 1KFCB 3JWGA 4FGSA 2X9VA 1CR4A 2YWXA 3OCUA 3WLRA 3CRRA 4URUR 1DINA 4RW0A 5AHOA 3D4NA 2R8EA 5E1BA 4F06A 3CX8A 2PMDA 3ML1A 5I3CA 1EVZA 3H18A 4KIGA 2JFXA 3BOSA 4WY8A 1LLQA 1Z6ZA 1M2GA 5HUHA 1ZK1A 2B37A 4Y9RA 3U61B 2FRXA 1N6LA 4LOKA 3QA9A 4IPTA 1AQNA 2MINB 8OHMA 3KJHA 1G0NA 1E6WA 4EGCB 5BN3B 3HCFA 4XGKA 2OHJA 3ONDA 1KYZA 2QUJA 1O5OA 1CQXA 2X41A 5FWXA 1EUCB 3FPJA 1KFEB 2XZTA 2G70A 2Q1XA 4MRAA 4O2AF 3SXJA 4D4IA 1ZU4A 2RHHA 1SIWA 2PFKA 2BKAA 4WD3A 4WQMA 4MI9A 5C4MA 2XD4A 1KC3A 4E4RA 3A3NA 3LKDA 5A3SA 4BXOA 4GNKA 2GH1A 4R0VA 4IJWA 1FLAA 2NZUG 4M4SA 3TQRA 4YX9A 3JQAB 4FGZA 4GZ6A 3SWWA 4FYVA 4BMSA 1COWA 2VQEB 2B6HA 4O63O 4JI6B 1O0BA 2MU1A 2QI9C 3K7EA 2WNIA 2PKQO 3BRWD 3GRAA 4W1QA 3H4TA 2FVYA 2IUFA 5K0EA 3B20A 3CZ9A 3ZDCA 4GIBA 3WRYC 1LJ8A 4RKFA 3TK1A 2IHZA 3T3IA 5KQRA 2PPLA 1N5RA 2ZU0C 4YCSA 1ZEJA 2Q27A 3D0KA 3H9UA 3CZ4A 3HSYA 2QJTA 3ZXUB 4G1CA 1YR2A 1TZKA 3OIFA 1VJTA 2GR9A 3DFZA 2OYSA 4MQLA 2QTLA 4MZXA 4WFQA 3C3XA 4TUYA 3CN9A 3BKXA 1SQFA 4AMZA 1X7YA 2QTHA 3WNBA 4N9WA 1UUFA 4D9IA 3E9DA 3GH1A 3PJEA 3T5PA 3MTDA 4E22A 4HVTA 1E96A 3L4SO 4GZMA 1NMQA 4I4IA 4X9XA 3R7WA 4HLUA 5CAEA 2WWTA 1UOPA 4HTFA 2BMDA 3WBFA 2XHEA 3WA7A 1N0VC 1NFQA 1W4AA 5DBEX 3TSWA 1M34A 3W6ZA 2A94A 4HAZA 1JQBA 3HU3A 2QAIA 3MT7A 4JYMA 1GTZA 1YZ3A 2DFDA 4PVCA 5DGIA 1QTQA 5EXTA 4LF8B 3H2HA 2C58A 2C4WA 3G68A 1FX0A 2HSZA 3H2JA 3I76A 1Z12A 2YJ4A 4MS4A 4R3UC 4TYQA 4B35A 3ZVNA 5MDHA 2Q8QA 1KP3A 3RROA 1TZMA 2HX1A 1H6AA 3DLIA 2IPNA 3E9QA 3KKEA 3NNSA 1NAHA 2DPMA 3Q3CA 4JB2A 1GPLA 2LIPA 4OHBA 4OL9A 1BSVA 1YOBA 1NNEA 1PTJA 1H1DA 2QRGA 2TS1A 2C3YA 1BS2A 2DR3A 2VHEA 4UMEA 4XDYA 4IJ5A 2N3ZA 5BRAA 4EA8A 3UCEA 3IQIX 1OH7A 5BWMA 4YCDA 5KYWB 1DE0A 2RONA 3JWIA 3SYTA 3BCUA 1JIIA 4FHFA 5F76A 3TECE 4AK9A 1W6RA 2PD6A 3OP4A 4PRYA 4PLPA 3ULKA 1SXJD 2HKIA 1JBEA 4C4SA 5IG2A 4F46A 4KRXA 2OD7A 4CM5A 3MINA 1BYIA 2COEA 3H87A 3IEPA 1ZCFA 3IV7A 4LBYA 4LJKA 1L1FA 3RBXA 1THTA 1PYOA 4X20A 2EBWA 1EFVA 1E9AA 2IZ5A 1EJ0A 2O3UA 2R1UA 5IAKA 4HNUA 4XASA 4GT1A 5EG5A 1E58A 3LBFA 1Z8HA 3HZOA 3L1VA 4M1YA 4KNWA 2K4MA 2EFEB 4KUGA 5HFNA 2GRUA 2J1LA 4DIDA 4F9EA 5G4KB 1O54A 1K2WA 4PG7A 1TO1E 2JFFA 2BR4A 1VLQA 3ZWVA 1E2KA 5CDUA 5HMLA 4G85A 1X1TA 1XC7A 1CK4A 1J1ZA 3CR8A 1JHOA 5GGYA 1JRLA 5JNSA 4HX9A 1MEOA 1P4JA 1KHHA 3CYFA 5IF3A 3L8DA 4ZK6A 3IIMA 4MWTA 4ZJUA 3GVXA 1HDYA 1DCFA 1PWXA 1CUZA 4ND2A 5IAEA 4PHTA 3GRYA 5GAJA 2NSHA 2RBGA 5EHNA 1GAWA 2EL7A 5TC4A 1E20A 1FFDA 3TIIA 1NQVA 4M1OA 1J20A 1G5RA 4W4TA 1T1SA 1P33A 2WAOA 4DA6A 5IAGA 1W4BA 2AYYA 1WUTA 4MYTA 4X93A 3FMFA 3QH4A 1EBBA 2D2XA 4E5SA 1J70A 1QWSA 1O77A 1F06A 1SM4A 4JI7B 3KSAC 4Y6PA 4WN9B 5FNVF 1QQTA 5CFZA 2QW0X 4BVAA 3NIWA 3RWBA 3L18A 1JXMA 2E4YA 3KKZA 3DDCA 2H2DA 4QUGA 5FEMA 1OW3B 1QZ3A 1INLA 3HN2A 3JD2A 3ENVA 2V8BA 4MR8B 5A6SA 1RCTE 3FM9A 5CVCA 1Z17A 1SHZA 1RRVA 2GB4A 1VSBA 5AO9A 1H94A 5IJAA 4ABYA 4IDDA 3TLAA 1WF3A 2X5JO 1B3RA 1PHRA 2BR5A 3HA5A 3MMSA 3OM9A 4KG7A 4OFBA 4A26A 3D1VA 3AKCA 1YAJA 2MSLA 4FZJA 3VYVA 1ZCZA 4NBSA 3IBCA 2R6R1 3ZHRA 1ACLA 1TK9A 1J39A 1A3CA 1ZUWA 4WE3A 3WS7A 1XBTA 2HTEA 1N36B 4B3CA 1RKBA 2AQHA 4FR2A 4J07A 5C31A 1LU9A 3DWEX 4KVZA 1C4OA 1E7SA 3TQSA 5CDFA 3D5EA 4P4UA 3PKIA 1H93A 2I4MA 2QPOA 3IFSA 1AQYA 4HY3A 4Y0NA 3WZLA 4BLSA 4CKXA 4D4JA 1T4BA 1YNOA 2XCLA 1XTUA 4ILEA 3AI1A 1R9JA 4EO7A 2FN4A 2ZBRA 4NYIR 1UPTA 2CWDA 2PX6A 5ED4A 3EIHA 3DV9A 3HJFA 4U3JB 3T7RA 1A1SA 3R9XA 3IUSA 3DPIA 4ND4A 5IBPA 1HETA 3HM9A 4QG3A 3FVTA 2WM2A 1TDJA 3DBIA 3U1VA 3WNCA 1P2VA 2JH8A 3COPA 1H6CA 1NDUA 4LWQA 4TZTA 1GPMA 3V2UA 4PBTA 2B6NA 2HBQA 4HXYA 4IYRA 2KLHA 2C2MA 1F2DA 1XLVA 2WSBA 3PPVA 3CEJA 5EVCA 1QCYA 2OUKA 4GPD1 3UHPA 3SQNA 3HS3A 1Z74A 2H63A 2CLOB 4EHFA 2AC4A 2FSFA 3OFVA 1M2HA 4OI4A 2O5RA 1M54A 4EJ6A 3FFBA 1Z6XA 3ICPA 3DVAB 1HF3A 1Y7PA 1PD1A 1ORVA 4D82A 2G06A 2I78A 4CF4A 2F1OA 4W1SA 1U0NA 2D1TA 4CM8A 1U9JA 5K8CA 2NACA 2OKGA 3FDZB 3TKLA 3ZWOA 5IVPA 3FHJA 2XUFA 4WNIA 1KJNA 2WP0A 4N65A 4NG5A 2VDQB 3TKYA 1PFUA 5FUMA 4DKXA 1FXWA 1U28C 2BSAA 2NQ8A 4EX7A 1FLVA 3QKSA 4O2RA 1OFIA 1OILA 2A6PA 4KXNA 3GAAA 1DC7A 3DYIA 2XCUA 1L8QA 1XLTA 4TMVA 2YNMA 4O1HA 4CMEC 4F8YA 1ECCA 2OB2A 2OE2A 4TYMA 4F5WA 3A6KA 1NP7A 2AMYA 5BT8A 1FL9A 4KFSA 2J3JA 3OZWA 1SEPA 4QODA 4B6EA 4K9KA 5J5CA 3ZE8A 1XRQA 1RWPA 4MW4A 4NXMB 3IDSA 2PL5A 3MRVA 4M6WB 1TUIA 1GQ2A 4NG4A 4ZOCA 3ZLBA 1VJ0A 3OU7A 3LT4A 1QHIA 2VXYA 4Q1AA 3S8YA 2PFSA 3QTLA 1GJRA 2I2DA 1BRMA 4IKPA 2HSWA 4HB0A 2IHKA 1ZJ5A 2IZ1A 2OPBA 3QMWA 1BCSA 5ALUA 1PDOA 2D5BA 4EKGA 3FYUA 1RAFA 2WA2A 1NMEA 4C7JA 4OK3A 3KVRA 3O4IA 5AJZA 3ZWDA 1F6WA 1WCIA 2GTIA 1DQYA 3OPXA 1P0QA 2ZYTX 4EPVA 5BSFA 1RNLA 2BEVA 2G5CA 2V4ZA 3C6QA 4BNZA 1CJCA 3K96A 3NP7A 2YY7A 3DCYA 4J90A 5CT8A 2XRZA 3A2LA 1DKUA 2YIMA 3ZHBA 1T24A 1XFDA 2GD1O 3AOGA 3EG5A 1H2BA 4K9DA 3WGGA 2Q1WA 3L0BA 4PPYA 5CT4A 4UBLA 3D2BA 3NMUF 2RCNA 4I4CA 3IR7A 4FJ1A 5E7QA 3UJDA 1RWBA 1Z73A 5GV8A 1DKRA 1YB1A 2WD8A 2P2LA 3ESYA 3P0HA 4H6WA 3TNDA 3VKVA 1KAMA 4R1PA 3CF6R 1U7ZA 5KNBH 1NATA 2P27A 4F97A 1R0BA 2PL3A 2QRKA 4PU0A 1ORRA 4C89A 3AVVA 1LV7A 1U0OC 2GPTA 2H92A 1AUQA 4U5QA 1WKBA 3KT0A 3ACBA 4EQ6A 3GPLA 3FWKA 1GM5A 1CERA 1H8HA 5CVUA 4GG1A 4EKIA 3GJ7A 5EXPA 3CCBA 3PHHA 4BNHA 1KI4A 4PXAA 1ZAYA 5EFZA 1O5IA 2D00A 3ZU2A 1H9AA 1XEAA 4EY3A 4Z1MD 4OMDA 4N0DA 1BFDA 1B43A 3ZOZA 3L6DA 3TZKA 2C2ZA 1Q44A 3AHFA 3B3GA 4NHEA 2OQVA 5L4NA 2WTXA 3RUFA 4MJXA 4EI7A 1TIKA 3PITA 3I28A 3R76A 4YRIA 2IXGA 4NBUA 4K9SA 5L45A 4C03A 2WQZA 1WMDA 3L04A 5AI5A 5LVAA 1LLCA 1ISIA 1LI5A 2YWRA 3TOZA 3UY4A 2PLRA 3MW8A 2ZB7A 4A0RA 4HGOA 4M9RA 4BV8A 1ZONA 4RJJA 1VL6A 2HWYA 1Y7LA 4TN1A 3TZHA 2TRSB 3AFOA 1PBNA 3NHWA 4M2LA 1XVVA 1QQ5A 4WN3A 3AR8A 3FSGD 4LMRA 3QWAA 4ZO8A 4ZV9A 3UB4A 3BMCA 4UMVA 3C85A 4XVRA 2IEGA 4FLEA 5H8WA 1FCJA 1VHQA 1CYDA 5CXSA 4D9BA 2CJFA 5LWQA 3M82A 5SZIA 4UDOA 3ZVMA 1H3FA 2GVNA 2QXTA 1LBTA 1XU7A 2IW3A 3UOWA 3LZCA 1BWSA 3DBRA 3RW9A 1ADGA 3P9ZA 4AROA 2ODNA 1SKQA 3VOTA 5U1PA 5GIPE 3WNQA 3DL4A 4DLZA 3ENZA 3E6AA 3MGGA 1DL5A 5LYJA 3VR3A 3PL5A 4NBKA 4ITRC 4YJ2A 2YIVX 4M9QA 1UBJS 3T4PA 4IIUA 4UC0A 1Q6ZA 5KB3A 4Y9SA 2QIPA 3VUFA 2HRRA 2I54A 2ORIA 3JTMA 4PAGA 3QP9A 2VP2A 1EX1A 4GM0A 3LXXA 3TQCA 2VH2A 1OPXA 1QJCA 4MYRA 3RKSA 5E3HA 3LYAA 4POAA 3FYHA 2QRMA 5AKYA 4MJLA 1JLLB 3NIDB 2AEMA 3H8VA 2B78A 1NBEA 3OOSA 4MW5A 1BOFA 2BDUA 1R10A 1Y8RB 3N2EA 4LK2A 1A5TA 2WA1A 3VKWA 1G3UA 3V1LA 1PEAA 3UUGA 2FP4B 4PGMA 4PLYA 4P36A 3R3YA 4NOKA 4FR5A 1CNEA 2JAOA 2HRCA 3CPSA 2XNKA 2EX4A 1WA5A 1W8DA 2B3DA 2ZJ6A 2YMQA 1V1RA 5LMNB 2CSXA 5JRDS 5JHGB 3BJIC 5E8JA 3BXPA 1XI2A 5FXMA 3SR3A 3ZK7A 5KSZA 4DKJA 1K97A 1CUYA 4YQFA 1CB7A 2WYUA 3NH9A 2NV2B 1F9EA 1UK6A 3UK0A 1YNSA 1KYXA 4S1WA 1TQDA 3DAFA 4MS1B 4Z4IA 3GGGA 1DIBA 5JI2E 3W79A 4F4UA 1FVOA 3GJ5A 3QKRA 1ZH6A 1NM5C 2AI2A 4B75A 1OTYA 4F04A 4YCLA 5TPWB 4AJ4A 3EEBA 3ADDA 3JD1A 4WEOA 4GC9A 5IJ9A 4BAUA 2D6FA 3QU4A 2QN9A 1EFPB 4TVBA 5EUQB 3VJRA 3AUXA 5JZVA 4I50B 1GTVA 4M8SA 4JFAA 1T3ZA 4CDNA 4M8IA 3HDTA 1O6BA 3C8DA 4UU8A 3UC5A 5C34B 3GLFE 2OVBA 3ZWCA 3LYUA 4KR9A 1CEQA 1K0UA 2FU5C 3GC6A 2OZPA 3GJZA 3LBNA 3LL4A 3P2KA 3GPIA 3UHJA 2Q2OA 2KBEA 3IP3A 4RKYA 3DBLB 4M60A 4E5MA 2J8ZA 4E6PA 5KQMA 1R4NA 4FDTA 4Y67A 3ST7A 4ES6A 2ENWA 1JJBA 3ZUPA 1Y5LA 4A03A 4FT2A 4DC0A 3OJ0A 3WNZA 3E22A 3H2SA 3NAGA 3T8YA 3K0SA 4BX9A 1F6DA 1UJNA 3JS5A 3LX8A 4IWYA 4WDRA 2IUUA 4DYVA 4HVCA 3BDVA 3EA0A 1T36A 1XEFA 1PFQA 1W1IA 1DKQA 3GJ6A 4GOJA 4Q9NA 4L57A 2BMVA 5HGXA 1LBHA 4BTEA 3BTOA 4JJGA 3EVGA 4I1IA 5T57A 4BNDA 1DBWA 2RGAA 3IO5A 4RKQA 3V2HA 3ND5A 1PJAA 1EPUA 3TGPA 4WAUA 4PSAA 4Q1VA 1MC5A 5K9ZA 2HJSA 4BQFA 1HV8A 1QCCA 1XDWA 4GF5A 1P0IA 2IH2A 3HUUA 1IM2A 3JAKA 1UBSB 1UQUA 3VYRB 4DGSA 1QO0D 2HA2A 2PLNA 3AV0B 2VKTA 1TQ4A 2IYOA 3UMBA 1FQKA 5DTMA 3UXYA 3NBKA 3UKDA 2CDCA 2Q6OA 1G8PA 2GLXA 3CURA 4F11A 3W8EA 2WPDD 4FN4A 2FDCA 3E2PA 2O8FB 4L76A 4JI8B 3FUWA 8ADHA 4DIBA 2C77A 3JVEA 2Y1EA 3IB6A 3D7MA 2L17A 4DBVO 2Q28A 1FYWA 3R09A 4F8JA 1ECPA 4TPKA 1E59A 1KJJA 1YZGA 8ABPA 4JQCA 5AOVA 2NX2A 4BVFA 4FILA 2ZS7A 4GECA 5K1ZA 5BORA 4QEKA 5AVTA 1I14A 3KYDA 5AESA 4X54A 1J7JA 3H0CA 2ZT7A 1NW7A 4LQLA 1R3UA 3F9IA 4N3NA 3N8NA 1OVGA 3TS1A 2JIZD 1N57A 3WP0A 2VQDA 4JNKA 3IEKA 4PO3X 4Y0VA 3UT0A 4A2QA 1R8YA 5JDIC 3ACDA 2PJDA 4JXXA 3VISA 5C46F 1KR5A 2OM2A 4YP7A 4RD3A 1YZTA 4JP5A 1TGVA 1TQHA 2D3WA 2JAUA 3QF7A 3SYNA 3M9XA 4ZI7B 4R05A 1A7UA 2O4UX 1KDTA 1NMSA 5EP2A 1P0MA 2C8JA 2FQQA 2G9QA 2PHZA 4Q4JB 4A6DA 4HEA6 3PG5A 1W2GA 2PGXA 2ZBVA 4ITVA 5IU6A 5JJIA 2VUTA 2IK8A 1RP1A 3DZHA 4N82A 3TDKA 3GLHB 5P21A 1KQPA 3W4JA 3RIXA 3K20A 2ZG6A 3GNLA 3ZU6A 3SJAA 1DT3A 1RP7A 2V7UA 1LVHA 1Y1QA 5AHKA 4ZRNA 5FEUA 1TTHA 1MPTA 1VB3A 3QUAA 3NEYA 1EFRA 1UK9A 3TZ6A 1ZN2A 2ZJ7A 1OBOA 3EGWA 3LC2O 2NU6B 3V8VA 5FI1B 2HT6A 3OTOB 1KFJB 2PCJA 3KZXA 4L5CA 2GM5A 1JSXA 1TF7A 4Q4LA 3ROXA 5JAIA 3SCZA 3GVCA 2RHTA 1LNQA 1F60A 3IERA 1YK1A 2AR7A 3GDOA 2VAVA 5CXXA 3AM1A 5KVAA 4KWCA 2ZSFA 1RLTA 3VBCA 1XNRB 1TZJA 1P6XA 1WXXA 3EYWA 3QMVA 4G0NA 4URXR 3E03A 2C94A 2RGXA 4FS8A 5DLEA 3ZQ4A 3Q5EA 3VU9B 5G53C 1JDVA 2WVAA 3GMTA 3EIXA 2Z5LA 4PZ9A 3GFOA 4DA0A 2WB2A 4JLJA 4RTSA 1JG6A 1U11A 4NH4A 2R8YA 3WLJA 1Y6ZA 2I2AA 3C39A 3L8MA 4L8YA 3I5XA 2HZ7A 2RDMA 3TPFA 4BASA 4EABA 1APBA 3WK9A 2AZ4A 5IKXA 1KYIA 5D8DA 3ETCA 3L7KA 3VMMA 1WMAA 2PH5A 1JT2A 1A9XB 1QQAA 1CF9A 4MI1A 1YBFA 1UEIA 2YY5A 2PUJA 5HCUA 2B2CA 2BGIA 2I71A 5K2MA 3L0OA 4MUIA 5LKAA 2QUBA 3ELWA 5HZKA 3FGZA 4FB5A 5IYZA 3LUFA 4GYJA 1CF2O 2GN8A 1IXZA 3TR6A 4EPYA 5DMHA 1MN6A 3NHYA 5LMZA 4DWJA 1RXWA 1FP4B 2YVAA 2HMSA 1WEHA 3CFYA 3F7MA 4LSZA 4NJEB 1YL6A 1XZLA 2Q6IA 4V02A 1Y80A 3TZBA 4CLRB 1IJBA 2CXRA 4JJAA 2HR1A 1MB0A 3IV9A 4US0R 3DFMA 1GCGA 3BH0A 1SZPA 4EJ0A 1EEHA 4RF3A 5L3RA 2IXDA 2YS6A 3C7DB 4M83A 1J0BA 3SQLA 1XFAA 2OCLA 1OCEA 4ZU3A 3WQRA 1QR2A 1MAUA 2QVXX 1VIAA 1BGVA 2CXQA 1UJCA 4IHKA 1SUDA 2BYTA 3ONWA 5A04A 4ZALA 4CCYB 1RZRA 1JR3D 3Q7QA 3QBEA 1R66A 2ZJ2A 4KYUA 1B0ZA 2LPMA 3FPAA 1TJ5A 3PJGA 1ABEA 1E2JA 4LXXA 4MIOA 4P6VF 2NYUA 1E3MA 1NXTA 3CU5A 3FPBA 4ZZ1A 1NU8A 1C7JA 1J97A 3BAZA 2WYOA 3CLUD 4D9FA 2XT9A 4WESA 4M8LA 3WDLA 1TM5E 2OECA 2GKSA 2EJVA 3GK3A 1O2DA 1N6KA 2PMCA 5ALJA 4GWLA 3ZVLA 4CEHB 4HNGA 1DUIA 5JV5A 4OQDA 5HX7A 3MS2A 2ASVA 3RVNA 3OD5A 1DTSA 4XM1A 2P6NA 2JHGA 2O2GA 3E7WA 3HKCB 3EXFA 3T6KA 4S1TA 1L4GA 1Y89A 3F6YA 2QE7D 3SC2B 5KOHA 2GHQA 4KEAA 3FUXA 3JVDA 4FUQA 2PT9A 1K06A 2GPNA 4F5YA 4RFVA 3OX1A 1PVVA 2AK2A 2C7PA 2W2MA 4ECAA 5B7GA 4CLHA 4RSRA 2OESA 1P0CA 1X0VA 2DWQA 3EF3A 4CKYA 1YJAA 2YN4A 1CZRA 3W5AA 5EIAA 1FRFS 2A92A 5TS2A 4UULA 2XCQA 2GEDA 3G2MA 3KAQA 2QX7A 4OOEA 4DB4A 4D7AA 1FDVA 1WE2A 1I4LD 2XVZA 5JUWA 4JYZA 3N1UA 1GSAA 1T2DA 1KS2A 4V0LA 3W3AD 5KJ1A 1N2XA 1T8TA 4INJA 4FJ2A 1VBFA 3KRTA 4JLSA 5LLSA 4MDYA 1P62B 3H0EA 4J0HA 1UZUA 2XTZA 1OWNA 3OLWA 4ALMA 1NR1A 3BVPA 5F3RA 1XKTA 1TMKA 3IRUA 1M5TA 3C8UA 1U31A 1L4MA 5AVWA 1FTNA 5DFAA 521PA 2DSTA 1E6EA 1T9GS 4JJIA 5I9SA 1WMFA 1KOFA 4CXMA 3HV0A 5A4JA 3INTA 4K9RA 3P9KA 2CUKA 1Z39A 2Q0SA 2F55A 4FI3F 1XAJA 2BELA 3QI2A 3AEQB 2O50A 2BUBA 2HFJA 4ZK2A 4XWKA 5ALKA 3TOSA 1NV8A 5LZ7A 3H1BA 5TEVA 4OHWA 3A28A 2OQIA 3QNWA 2R6JA 4LYFA 3UK7A 1NBWB 2L0XA 4EH1A 1JA0A 2SNIE 4A23A 4H6VA 1YVEI 1PHPA 1YD7A 3O2JA 4P3KA 2R5NA 1N1EA 4S24A 1S2OA 5JTUA 2P3LA 1X1QA 2IPMA 2DAPA 4H1WA 4UOQA 1C1DB 3WLMA 4EDHA 4IUDS 1AY0A 1LS1A 1U7PA 4G1UC 2PPVA 4MP3A 1BS9A 2NNWB 4OUKX 1NLFA 4EA9A 4EG7A 2CHUA 4YAOA 2GF2A 2WSMA 4CGZA 1V3TA 5DHUA 3CXUA 4GP7A 4GKBA 2OM6A 5TGDA 4IQFA 1DBRA 1PL0A 1UBCA 1Q17A 2IZ6A 2E6KA 4WI1A 4AJ9A 3VUEA 2Q45A 5B7PA 4JEUA 4B8ZA 2H3EA 2J5QA 2X0JA 2FUCA 5K3FB 3B1FA 4CL8A 1AO3A 3QFHA 4PG6A 1UZMA 4JC0A 3R3JA 2AFVA 4I66A 3AEZA 3VGPA 4UAUA 3ESQA 3RANA 4MA0A 1EUQA 3RAPR 2RAUA 4DEYA 3I92A 3R44A 2VDNB 3T0FA 2YQZA 4CR7A 3NBMA 3ZY3A 5F7JA 1MJFA 2V97A 1K6IA 1AV7A 1K8QA 4ENRA 2YV2A 3PNVA 1OIVA 4HEHA 4AN1A 3AR3A 1DSSG 1GPAA 3IP6A 3RFVA 4EW3A 4HMQA 3QBDA 1QYRA 5AVSA 2AD5A 4KMOA 5HQJA 5DHSA 1Q0HA 4F7DA 2XUPA 3AK4A 1L7RA 2Z6UA 1QH8A 2ZIZA 4CN9A 1IZ0A 4MLDA 2IFTA 1FLNA 2IGBA 2YQ5A 2HF2A 2VHUA 5CMLA 4KXFB 2NZWA 5ECGC 1C0IA 4P35A 1Z5UA 4WBXC 5TLSA 4ZEOA 1W34A 3LWBA 3C5EA 4QU9A 2F7SA 4ZP1A 2O19A 5A03A 1EX6A 1X1SA 4XWTA 4PBRA 3V3KA 1CIJA 3DUWA 4QFBA 5HKLA 2W48A 3ZBTA 4PY2A 1RM0A 3FWNA 1I1OA 1EVLA 1LV8A 2HRBA 3GRUA 4II2A 1L8LA 3QLEA 1XQVA 4PM4A 1AQJA 4JB3A 3WBJA 4AKEA 5HCNA 4IIHA 1H4VB 1VKZA 3OQ6A 4X97A 3WLTA 1GG9A 1T8WA 1RU3A 4OBBA 5FAKA 1Y8ZA 1JG4A 4IXDA 2XUIA 3IT1A 4XJVA 5DW3A 4ZI3A 4JJ4A 1QGZA 4MKGA 4C2BA 3LUAA 4G9EA 1OHHD 3G88A 1CX9B 2E21A 1E92A 2GVZC 1HE4A 3FCOA 3PZBA 2IQIA 4R98A 3RUDA 4LXQA 2IEYA 4ARZA 5K0BA 3G85A 1M1ZA 2BD0A 4GLOA 4MYSA 1WQ3A 3HJNA 3SMVA 1OYVA 5CTJA 1VJCA 1B4DA 2I6QA 3H5TA 4QTYA 1F8FA 2X86A 3PD7A 3RABA 3D3QA 3UW3A 1SK9A 1BXGB 2PEYA 1B74A 2OVFA 3G5LA 2BR3A 3UV6A 4LYDA 3OTQA 1ZBDA 4Q7QA 4ESHA 3T1OA 4UDXX 2VPPA 3IA2A 1GXSB 4L7VA 3FMOB 3FROA 1IM5A 1MDBA 2FX2A 4PX5A 1II8A 4AZ0A 4I3GA 4DLVA 4W5OA 2HV8A 2PUWA 4G81A 5CB6A 1Z2AA 4O25A 3IIJA 2V3VA 4L2IA 1U80A 4PC6A 2W6OA 4PHFA 2HPHA 2C5AA 3L1IA 4UPVA 3V97A 3WYGA 1ZUD1 3BX1A 3K4QA 5B6IA 3Q6NA 5HHTA 4Q9KA 2H7VA 4JKYA 1CZNA 3PU6A 3ZZUA 5JD4A 1M0SA 1LI4A 2F43B 1XZCA 4PLFA 4DCJA 1Z82A 4HH0A 4PHGA 2UVPB 2J7PD 2OY0A 3MWFA 1ZNZA 2WWXA 5SZJA 3HXQA 4JROA 1IG3A 4Q7LA 1AKQA 1DUSA 1F5NA 1R6TA 5DN9A 1XF9A 3F2VA 3I9NA 1PEDA 2RJNA 4G3XA 2XB2A 2G9ZA 3NC1C 3MFQA 1YBVA 1CQIA 3SLRA 4IFIA 3ERCA 1BAPA 2X13A 4H7JA 5B58C 2CNDA 3EOAI 3P5SA 4OGFA 3PUJA 4QQKA 4RY2A 4X00A 4CM4A 5KOJA 1K5HA 7REQA 3U3DA 3NYWA 5IM4F 2WYVA 5ENDA 2VWHA 3TW0A 4NFYA 1SUFA 3SSMA 4DR6B 2CCKA 2HHJA 3DT8A 4FZ5A 5ULLA 5BVGB 2QM0A 4GZLA 2VK8A 1IUNA 3T4UA 3TOVA 3X43A 1F7UA 1GGNA 3NALA 5E95A 2X4DA 3Q72A 1J23A 3CZQA 4CZ2A 2Q2WA 3PF8A 4ZYWA 1Q7RA 2WJAA 3S1AB 1E6LA 3W04A 1NC1A 1XDBA 4TRJA 4ZRDA 3DOEA 3UPDA 5KWVA 3A6FA 4X60A 3SSNA 1V95A 1JJIA 4XUDA 5KZMB 4PQFA 4RHEA 3WLKX 3QKUA 2AOXA 1ZUHA 2QRVB 2XKAA 1ZITA 4CLOB 1X9HA 1LQ2A 1ZL2A 2FWIA 5FPHA 3FPLA 3IHWA 4DSOA 2XGMA 4PO8A 3RDPA 2Z2KA 5DYIA 1YVDA 5UKDA 3VO9A 2DCMA 3AR9A 1QO7A 1WETA 1SAYA 4LYHA 1J2YA 3KXIA 3HJTA 3JYPA 2CL5A 2BVNA 3LUDA 3NZEA 1CW2B 1V26A 4ESOA 1GDHA 4C2UA 2DT8A 4XGRA 1SZJG 3V48A 3DE1X 1ZWKA 2PE5A 4NMWA 3NOOA 2JIBA 1Z4NA 2H5EA 4QBKA 3AZOA 4LGYA 4BNXA 4O6VA 4OB8A 2FN8A 3ANXA 2C7QA 1UMDA 3Q7RA 2C42A 1SUAA 2VPQA 3AIIA 4G5GA 4Y6LA 5HF6A 4D3SA 1EH5A 3OEHA 5BT9A 2VCEA 2EGGA 4NV3A 1UC4B 2CNKA 1W1UA 2BEWB 2XCOA 3BJMA 1KQ3A 1KKMA 4IDOA 1XCBA 1OI7A 1ZW6A 4M0CA 3TJRA 1QP4A 5EZYB 4AO7A 2HADA 4B2YA 5K0FA 5D5PA 1CZOA 5K51A 2BFAA 1FXUA 1A9QA 1C7IA 5EWLA 1GUBA 3CWQA 4L08A 2UZ4A 3IH5A 2RHOA 3M3PA 3P71T 3DMFA 2D13A 4MQUA 2WE7A 1Z36A 4MHSA 5AIAA 5ALMA 4EF4A 5FDFA 1KNQA 1KRXA 1DT5A 2D06A 1RAIA 4JL5A 1G6HA 4Q3CA 4QXQA 1T91A 3HGTA 3JQAA 3IT2A 1PT5A 4WNCA 1OXKB 1UBLS 1L4UA 1D3AA 3C1AA 1NW5A 1IEXA 4IV5A 4F6LA 1OBVA 2QZ9A 1NFFA 3O1IC 1BDHA 2PGAA 2VJBA 2OV3A 4KDRA 4LFBB 3LYLA 3Q0IA 3B1YA 1S2NA 3QXSA 1QGYA 1RJGA 4Z2YA 5IKOA 2KJQA 1CDDA 1SQ5A 5JSQA 5KIAA 1JHYA 5THKA 1MEJA 1Q0ZA 1AZWA 1V3VA 3KYCB 4KO1S 5HIMA 3I3SR 4F1KA 1NN0A 3SSAA 2A7QA 4ZT6A 1A7AA 1XXHA 4C0LA 3T5TA 3QENA 4FE7A 2FLVA 1U90A 3SXUA 4H7KA 2WG0A 3BZUA 4XLTA 1SVNA 5D6OA 4JL8A 4I8DA 4BAZA 1SCAA 3L6UA 1VSTA 1GRQA 4ASUA 3DXXA 3QEAZ 1RAHA 4K1XA 4EZBA 1MB4A 1U7WA 1VJGA 1P61B 3I9V6 2QR5A 1O95A 4LHXA 3VZQA 3PRHA 4P4GA 3DHYA 3QE4A 4QU0A 4FW8A 4NEQA 4YCAA 5IMBA 5KNCD 3E7FA 2A14A 2HW8A 4R8SA 1AURA 4Z86A 1YKSA 3S2ZA 4FFNA 1HDGO 4MWEA 1F12A 3A4YA 5IUKC 1KSGA 4CI0B 3KDSE 3DAGA 3OSZA 1HFKA 1QQ7A 3F1LA 2GO7A 1R6DA 4XLLA 4YQYA 5TXGA 3RC7A 1MP0A 4R8MA 3THSA 1VCMA 1LBIA 2QSYA 1KAHA 4TVOA 3T9CA 1CR1A 3ELUA 4BLPA 4RSGA 4CMIB 1YQEA 3AKDA 3ET5A 3MWYW 4GMDA 5I9IA 4K9OA 1CUHA 1ZCJA 2QF7A 4X8OA 3H1TA 2XEXA 5D7NA 3OQ1A 5KYWA 4OHZA 5GPBA 1ISSA 1QRTA 1LWNA 1M34E 2ZUEA 4QYIB 5JJLA 4MPPA 3GL9A 1JEAA 1BVRA 4WLUA 4OU5A 1JN0A 1CY2A 1OZ0A 2I6TA 4RTMA 4KRFA 2IEAA 3AU9A 3TR0A 5EIBD 3DDZX 4CV3A 1A1VA 2LR0A 2FPIB 1UKAA 2CLDX 3RYFB 1U99A 3O75A 4X91A 5HCIA 4D9JA 4R2KA 5D86A 1FS6A 1XOIA 1VHJA 4ACAA 4O4LB 1OXMA 3F7NA 2A78A 1C4WA 2AG0A 4WWHA 3WYBA 2RHLA 3MZ0A 5I7WA 1TTTA 2IS1A 5DNVA 2RH5A 1ESNA 2E37A 4W9NA 1C8KA 4CI9A 3FOZA 1ZCAA 3U6KA 4TQ9A 1FU8A 5JYBA 1O3YA 3R7FA 2NTEA 2MCFA 5IABA 3T7DA 3AI3A 4MGKR 4D9CA 2I1VB 3EDQA 4JBXA 5KYTA 1EQUA 3DULA 1J21A 2GPAA 1ODIA 2VVTA 4M46A 4PIMA 3LE8A 4U6SA 2WJVA 2FUNB 4LXGA 4OQXA 2CJPA 1E9FA 2QU8A 1VHDA 3DCIA 1T0UA 4KK3A 4NV1A 3MRTA 4U6QA 4N18A 3KQLA 3MWDB 4JNCA 1ACJA 3S2SA 5D3MA 4RO0A 2JJ1A 3T3DA 1FRZA 4GI1A 3GPCA 3Q8WA 4M7RA 4DFDA 5F1KA 4WN9A 3HFRA 1I1QB 1V7QA 4GGPA 3KTOA 1YACA 4MUMA 4PWYA 5JBQA 1O1YA 5FUWA 2C61A 4G24A 1B6RA 4XWWA 3X1WA 3O3MB 1JI3A 1R6BX 4UARA 5GY7A 1E4EB 4LYEA 1KE2A 3RTCA 4BFVA 4XIIA 1Y6FA 2CJYA 1BW9B 2EAUA 4A82A 1IOZA 3ESBA 1V8OA 3Q85A 3L8FA 5LQAA 3LSYA 1CEXA 3PCTA 4EY7A 1M2EA 2NYRA 3USES 1GZ5A 4GKKB 3JQGB 1K68A 3FWYA 2DFKB 1E2QA 2H2WA 2C59A 3S81A 1CS0A 1Z25A 4ZU6X 4ZEVA 4LY0A 3NKFA 1QC5B 4MRRA 4JEHA 2B7CA 2L19A 4BFZA 4O08A 2QQFA 3SZOA 1DDGA 1TADA 1Z37A 2A5YB 1DP4A 5E1MA 1UBHS 5GADl 2G28A 3A31A 3CF0A 3EXEB 1VC2A 4H1UA 3DYBA 3IMCA 4KBYA 3TRJA 3WISA 2AN9A 3R3XA 4BP1A 4JOBA 1KGSA 4BE7B 4R16A 4TQAA 1YZHA 1Y3FE 2GJKA 2YRFA 4YAWA 2Y1OA 5EPOA 4EUFA 2A1TS 1ZZEA 1KY2A 4BRWA 1IATA 3T7SA 3THXA 1MD9A 1QHSA 4RULA 5AJTA 4D0SA 4QO7A 2G1UA 4IQGA 3KU4A 5E6SB 4FPXA 3ZGZA 4YWJA 4MIEA 5LBUA 1N2CA 4YAFA 3BSSA 3ZJVA 1YB4A 2MYPA 2WIDA 5CBKA 4P0QB 1O94D 1I3LA 2ZDGA 4XR9A 2PJRA 5NLLA 3QPUA 5FOUA 3VZSA 2O7VA 1PFGA 1V0JA 4AZWA 3CNHA 2AFIE 4HDKA 1SQSA 3OPYI 2UU9B 1NA5A 2EC5A 2G04A 4C08A 1SJ9A 5EZYF 1NUTA 2PK3A 3ROMA 4HUQA 5AJXA 3UGTA 3E4DA 2QX6A 3R8XA 3TCXB 4XRGA 4DCNA 1HEYA 1RI5A 1RJ9B 1SXJA 3BE5A 4CQNA 4DM4A 2CKMA 4OJQA 1XK7A 1X2EA 3AG6A 5BSWA 4P08A 2QVLA 5I9LA 2X7XA 5L4SA 4BIMA 5FPSA 4U9IS 2NXWA 4Y7CA 3GEEA 1A97A 2PZ8A 4H2DA 1CUSA 1P1RA 5EUCA 5EMJA 1HE8B 2Q49A 4REQB 4I4NA 4OD0A 5FR1A 3SE0A 5CYFA 2Q5EA 3ZWYA 4DWOA 3G1WA 4NHOA 1P2UA 5E3IA 1J8FA 5DPMA 1T3GA 2P8JA 5AVVA 3W06A 2BUAA 4QTXA 1HL7A 4URVR 4RHFA 4XLZA 5YASA 3H2KA 4RY8A 2QTNA 3MIIA 4KZPA 4NK5A 4B6OA 3R3WA 4M6WA 4DQLA 5J2TB 1Z4OA 3DLHA 1ILWA 2XXAB 4HG2A 1YJBA 4KJZA 3KE8A 4BFTA 1PGOA 3JZFA 5CFOA 5CFMA 1M76A 1HG0A 4Y2SA 4O4IA 4R3WA 4L4RA 5CURA 3U3JA 1YR8A 4JJZA 4B83A 9ABPA 2EBHX 1PJQA 4C4YA 3UMMA 4Q9DA 2A3RA 4K0RA 4BNFA 1JEJA 2OO3A 2E82A 2I6XA 4R69A 4CVNA 3DDSA 3UGJA 2BGNA 4Z9FA 2Z9BA 1VYHA 2AF4C 2EHJA 1UDRA 3PE6A 3RNLA 3IMEA 1FOEB 4CCAA 1QGAA 2WMOB 4X41A 3RUIA 3DMRA 3S5UA 3UUWA 4Z7JA 2AF3C 1R6XA 1JLHA 3IODA 1GD1O 2Q5QA 5C1DA 2P90A 1T5DX 3TDNA 4DSTA 1B8OA 1DTEA 1NHWA 3B6ZA 4UBNA 3VZPA 1PR2A 2N1BA 3PR2B 1JKXA 1U3GA 4P54A 2I4TA 2J9YB 4MQ5A 4PPFA 3M6WA 3UMRA 4EFMA 1JWLA 2Q4DA 3KV1A 1UBNA 3DE7X 3EXHA 1J2TA 4JMPA 4NDAA 3BXFA 5ILGA 3E9YA 4Y2XA 3RJMA 4YPVA 3PQ6A 1KDVA 2FWRA 1KZ6A 1WHSB 1PT8A 1N0WA 3UMSA 1UANA 2XLCA 3GJTA 2GCNA 5AM0A 5ERGB 5DK4A 1VIDA 4EA6A 2EBFX 3BSYA 3KSZO 3X1KA 3L8YA 1OLUB 1WS6A 2GEUA 3ETLA 4YLGA 1VPLA 3A6DA 1N1MA 2JHCA 3EEYA 3B1ZA 4RDHA 4V1CB 1WXDA 1C9DB 3FCSB 4U00A 3IAAA 4E08A 2HXSA 2DY1A 2BY4A 3QJ5A 3E27A 2DHRA 1C9EA 4UXHA 4EGAA 4JA2A 3LCVB 1RTTA 3ZG6A 3P9IA 2NPOA 5C37A 3DAPA 3NAMA 1USVA 2TMYA 1W1WA 4NYJQ 3BRSA 1MB2A 3OOYA 3B2NA 5DW0A 1T0PA 4U9HS 4WXHA 2PVSA 2GJ8A 2W6ZA 1GQOA 3F90A 4O4LF 1EK0A 3RRFA 1I7QB 1H0SA 3NOXA 1YHZA 3WMXA 1DAOA 3E4CA 3HUEA 2ISSD 4YO8A 1RBYA 4R8KA 3VPHA 2ZIUB 3UFBA 5TVGA 2ZBQA 4BVHA 2O7QA 4WXYB 3D3JA 3F8WA 4JUBA 3K8ZA 4NATA 5IH3A 3HL4A 3QI7A 4LRYA 4LDAA 2VYVD 2XVYA 3O03A 5C0OE 5HKOA 4B6JA 1L5OA 3ETHA 1XNGA 2IEDA 1TJYA 3D7KA 3F2IA 5FBRB 3VOBA 4MHTA 3EMVA 3UMVA 4RC9A 3PR3A 1TKRA 2OZKA 2EOAA 4GGOA 4QDJA 4G6ZA 2EP8A 2AG5A 4OHMA 1RWXA 5HYVA 3EQZA 5FQNA 5LB4A 3ADKA 3CUTA 4JP3A 2HY7A 5REQB 1Z2PX 4IQ0A 1X77A 1JTEA 1U8UA 1IY0A 2XPCA 3GUZA 4MVJM 5IM5A 2C83A 2I6FA 3C1UA 5HS6A 4TRMA 2DBRA 1ISGA 1IHDA 3SHVA 3OCYA 2H51A 1MH1A 4XJSA 3HO6A 3KL4A 1QU3A 4GX0A 2D4AA 3ILYA 4BB9A 2ZIXB 1XG5A 5ELXA 1GT6A 1MOZA 4FBLA 4FGKA 5E9WA 3L8HA 5TQ2A 3ETEA 3F4KA 3VZRA 3AFHA 4Q1DA 5C1BA 1LB1B 1ZSNA 4YXFA 2CD7A 4GOOD 4DVGA 4F3TA 1CUGA 1FQOA 2H07A 4JH0A 5TARA 5FTLA 1KIAA 1USKA 1M1NA 1X70A 2IYFA 4M0EA 5DEIA 4PCVA 1G59A 1Y8RA 3EODA 1E1RD 3KEMA 3L7AA 3E3OA 3AG5A 3JQBA 3PEEA 2XQGA 3ABSB 5FHQA 4B34A 3FB4A 1CIPA 4KGDA 1M8GA 3FKQA 2G82A 4J1SA 1NN1A 2P9BA 1P7ZA 5G1OA 1YR7A 4QZVA 3ZYCA 4E30A 4JUFA 1E9RA 4EG5A 4LZZA 2HA3A 5BSGA 5BQXA 1AA9A 1C2YA 1VL1A 2DX7A 4ZDJA 4AJKA 2OFXA 5JATA 5JT1A 1ZHHA 1OQAA 1WSAA 1DAEA 1S96A 1AOXA 3LRXA 4OYHA 4V0OA 5BPHA 3NHJA 3JQEA 2C9DA 3L84A 4IJMA 5KQSA 1LWOA 2HMUA 2JCVA 3PA8A 1EESA 2W71A 2VAMA 2QV0A 5E4JA 2E55A 4B87A 4HAXA 3AGPA 4WY5A 1QDLB 2GPBA 1G19A 2I6GA 4Q21A 2WJHA 4UM8B 4AZ3B 4URHA 4QKQA 2XVXA 1D5WA 1RHUA 2JD2A 1SC4A 4LEIA 4GU5A 1ADYA 2AG8A 2UUPA 2FSSA 1PJCA 3C7TA 2H8KA 1CJBA 3O93A 4NEGA 1BMTA 4OM8A 2VJYA 3WYCA 1BH6A 3YASA 4L8FA 3LU1A 3RIEA 4WNAA 2CE2X 4DCMA 1IIRA 4KHPB 3AVUA 1IZZA 1VYVA 5CNJA 4AIRA 3I0ZA 1P2TA 1E62A 3GRZA 2EFHB 3ZQ6A 4AVYA 5IUNC 4R2JA 1N5KA 2XUDA 4EY4A 4DF3A 1M5UA 1UBRS 4G89A 3MT0A 5CJ2A 4UPDA 2Z56A 3QV1A 2W0MA 1YE8A 1ICIA 1C7ZA 3CJTA 4Z1MA 3K09C 1U2EA 3HHPA 2NSYA 5TDHA 3P0FA 3PHBE 2OXEA 2XRFA 5F2NA 5JC8A 2PIAA 3NDIA 4EHAA 4CM3A 2A8YA 5IANA 1U2RA 3PPYA 4KMMA 5IF9A 5H59A 5B4VA 4Q1FA 3L41A 3TL3A 1WV0A 5J2TF 3PC7A 1G21A 4EO4A 2LBPA 1U1FA 5TR9A 4CKCA 1DC5A 3HR4A 3ZDRA 4TSKA 1UXIA 2IBMA 3EASA 3FSGA 2JH9A 1G4AE 3OQIB 4I9GA 2VZ8A 3OM0A 4QRIA 4X7RA 4KAJA 2V9CA 3HCWA 1JDSA 2ZRQA 3AUJB 3GLGA 4JR2A 2H1HA 4JSYA 4Z0HO 3VDRA 3VJLA 3AVQA 1G8HA 2O8EA 2J4FA 5DXJA 2PUAA 2LE0A 2IYPA 1D1QA 1EJ2A 1X92A 3ZGOA 2D3TA 3SJ7A 1DB3A 2L18A 1SHTX 2BE9A 2GFQA 3L7IA 2DQZA 3A6EA 2D0PB 3QXGA 3UGQA 5C3UA 4E4YA 4R9RA 1R0YA 3A1WA 2IUYA 3GNQA 4TN5A 3RYCB 4CRWB 1RD4A 3K15A 3PIRA 3LBAA 4Z8YA 3K8YA 4WH0A 4ZI2A 5I6DA 2O8FA 1UMBB 1CVIA 4PAMA 3PFBA 3V7WA 4F2GA 2ZB8A 5FBZA 1J8MF 1UWKA 3OIGA 2JKVA 5JFOA 5CD9A 3QE0A 5LDDC 2D5LA 2ZYVX