4RA9A

Crystal structure of conjoint pyrococcus furiosus l-asparaginase with citrate
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
182
structure length
182
Chain Sequence
MKILLIGMGGTIASVKGENGYEASLSVKEVLDIAGIKDCEDCDFLDLKNVDSTLIQPEDWVDLAETLYKNVKKYDGIIVTHGTDTLAYTSSMISFMLRNPPIPIVFTGSMIPATEENSDAPLNLQTAIKFATSGIRGVYVAFNGKVMLGVRTSKVRTMSRDAFESINYPIIAELRGEDLVVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional insights into an archaeal L-asparaginase obtained through the linker-less assembly of constituent domains
doi rcsb
source organism Pyrococcus furiosus dsm 3638
molecule tags Hydrolase
molecule keywords L-asparaginase
total genus 58
structure length 182
sequence length 182
ec nomenclature ec 3.5.1.1: Asparaginase.
pdb deposition date 2014-09-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold L-asparaginase, N-terminal domain 4ra9A00
5K3OA 1HFKA 5DNCA 5K45A 4R8KA 5HW0A 1WNFA 1WSAA 3NTXA 5DNEA 1ZQ1A 5K4GA 3PGA1 2P2NA 1HFJA 1HG1A 5DNDA 2P2DA 1O7JA 3ECAA 2GVNA 1JSRA 1DJPA 5F52A 5I3ZA 5CBPA 1JSLA 4Q0MA 3NXKA 1JJAA 1HO3A 1HG0A 4ECAA 5I48A 1HFWA 4R8LA 1WLSA 1ZCFA 2OCDA 4PGAA 1AGXA 5K4HA 2WLTA 4RA6A 2D6FA 1NNSA 5I4BA 4RA9A 1DJOA 1IHDA 2WT4A 1JAZA 4NJEA 2HLNA 2HIMA 2JK0A
chains in the Genus database with same CATH superfamily
4HQ6A 3LY9A 5SY6A 2ZSDA 1JR3D 2TMKA 3MQ2A 1ZK3A 1BGXT 4L27A 4RKEA 3EWNA 3HKBA 4E1VA 5CYOA 3UWMA 3GG9A 1KAEA 3BH7A 4TPKA 3V8BA 2W2TA 5A5VA 4J43A 1DB3A 4GWGA 3AILA 4IIJF 5IC6A 5J23A 3ZWCA 5BQFA 1S2LA 1FRQA 3ZX4A 1U3UA 2PD4A 2JZOA 3JQBA 1OFUA 3NDIA 2QUKA 2IYTA 2GCEA 4L5IA 3WDMA 3I64A 1EK2A 1YVUA 2W22A 3GARA 2QPAA 1QIJA 2E4UA 1RWPA 1WKBA 5DEOA 3WKBA 4DY6A 4OQQA 2DE0X 1L4YA 4AU1A 1IU9A 3WNCA 1MO5A 2Q9CA 3U09A 1P2VA 2UZAA 1W4LA 5DHAA 3A31A 5I9SA 1ZSVA 2VAWA 2XXJA 5HK8A 4W5WA 3STXA 4A2QA 4DCCA 4E5DA 4B3MB 4YNBA 5FTLA 2LIVA 2QN7A 1SOUA 1UUFA 4UFPA 1UBNA 1FSZA 2J9ZB 5AW6A 4ZOCA 3Q5GA 5A4DA 2G76A 4IUBS 1FU8A 3W6ZA 4URZR 1HE4A 2Y1CA 2ZJZA 2XZPA 4MWSA 1LLQA 1N7IA 3TUJC 1WW3A 2B8JA 4Z9BA 4QX6A 1IYZA 1X1TA 2PMEA 4MVYA 4B40A 4JLPA 4F2HA 1WABA 1UBJS 3PNMA 2WPNA 5E0KB 3L7LA 4IGIA 1QH0A 2PMBA 4RAOA 1SHLA 3C4VA 4RL4A 1XLWA 4U0KA 1P3DA 1TZ2A 3BJIC 3FFBA 5JSUA 1IWPB 2C2ZA 4Q15A 1RI1A 1UBMS 1Z18A 4REOA 1Z7YA 3BRQA 3VHRA 2H1LA 3PBKA 1SGWA 2YYYA 5G1NA 4ENSA 4YUWA 5IHXA 5JWOA 1ZVJA 2KLHA 4JELA 3EAQA 4MRSA 1G3RA 3VR3D 5A5GA 1K4MA 4PRZA 4AIIA 5TVKA 1JIUA 1BWQA 3L06A 3MFQA 1BX1A 4NLLA 4YT8A 2ZUBA 1W76A 4O1HA 5KYKA 4NZYA 2QKYA 3QPCA 4JKIA 4PSDA 4WCFA 4W7IA 1XCLA 2JH3A 2B35A 4BBPA 4XYEA 5AJUA 2YWGA 2CWWA 3V8MA 1U9IA 3ZCUA 3AUYA 1NQUA 2TMGA 2W93A 2GD2A 4OMCA 4HXYA 3ENQA 3DE7X 5E2BA 2WAAA 1R00A 1XTIA 1QUFA 4IEEA 4RHCA 3QJYA 3U17A 2HREA 3T8YA 4BNGA 3HLKA 1R8SA 3JQRA 2C5BA 3KAQA 2WZCA 1YIDA 2CVQA 4F3NA 4RE6A 2C7VA 1IB6A 4FE3A 1IC6A 1T8TA 4ETMA 3L01A 5JFTA 1IQUA 4PZDA 3T1QA 1U11A 3A1WA 2C4NA 1E5VA 2B4QA 1H2RS 3ENZA 3GPBA 4IX1A 1Z8NA 3CBGA 4UNPA 5FJIA 4LFCB 3SYKA 3QYFA 5T57A 2EWWA 4ECAA 1U5CA 4KXMA 2IBSA 1E7QA 3O8DA 2E2WA 3C3EA 1Q3KA 3S1LA 3WYDA 2G9UA 5FUWA 4OHUA 4S24A 1O95C 1I2MA 3JAKA 1ARZA 4HB0A 3ICCA 4BNMA 1VPVA 2HLNA 3PP8A 5I9BA 4D3SA 3EC1A 3ESXA 4BN0A 3ZZ0A 5IM4A 2FW0A 1PEAA 4F45A 1GA6A 4B76A 4CR7A 2ZSUA 3OJEA 1DKOA 2D7JA 3GP5A 5LMNB 1B26A 1R8XA 4E13A 4LVNA 1JKMA 2JVJA 1HXHA 1PFUA 3FM9A 3QYPA 1WCIB 2AX4A 2GYWA 2J1LA 3CMMA 4KE7A 4UBJA 2E5LB 3GFQA 4IDDA 4MINA 3WLLA 2HAEA 3FETA 2X1HA 1VJGA 1MO6A 4D9CA 3IA2A 2BFDB 4BVEA 5JALA 1CY8A 3AI1A 2J5RA 4D7AA 3PTAA 3PCRB 2LD4A 5CFMA 1WXIA 2OBXA 2SKCA 2WWIA 3S99A 3SZUA 4ENVA 1MJ5A 5H3HA 1WW8A 1HRKA 3UFXB 1GAWA 2PMDA 4YASA 3U13A 4XYGA 2VSFA 3C7DB 3CCCA 2W2XA 2H2IA 3K70B 1FNMA 4Z2AA 1AF4A 4O1IA 3H65A 4Q9NA 4M4SA 1GKUB 3VU9A 2HPHA 4PX5A 2OXRA 2IXAA 3LHFA 3IT2A 4O2BA 3UUFA 1HTBA 2GZHA 2C8KA 3D0KA 3TVTA 4AX8A 3GDOA 5TMEA 1SUAA 2F1RA 5DYIA 3CVVA 3ECCA 1R4ZA 5JCJD 3H5OA 4KLCA 4ZI7B 4XVUA 4MR8A 5FRDA 1VI6A 1YFKA 1FTSA 1TK3A 3DLCA 3VTAA 1GG2A 1J99A 3KUDA 1Y9AA 1ZMRA 2IZ5A 2PYZA 4B48A 4CFYA 2VUUA 1XTBA 5IK2D 5IXJA 4YAOA 3KKPA 3F8WA 3I2KA 3NMUF 3GRFA 1HX7A 1O6GA 1NL3A 1ONNA 4QYIB 3AIKA 3EYAA 4HGQA 1M1NB 1TLLA 3MK31 4BLVA 4BO7A 3CWQA 4PWZA 4ZEMA 1Q21A 1ZGZA 2IUYA 3DZCA 2A5JA 2H2GA 1HDCA 1M2FA 5AO9A 4GECA 3PFNA 1EP3B 2J09A 1P45A 3EH2A 3DF7A 4HVTA 2FPGB 1VGQA 2JH9A 2FEOA 4AN1A 2YHAA 4EJSB 4ZTUB 4LMPA 5NULA 1BXZA 3FWPA 4X66B 2PM8A 1MD9A 1ZN8A 4PLYA 3ZXXA 1K7XB 4F4HA 1JFTA 4QPNA 1OLOA 2D1RA 3EIOA 2GQ0A 4R8RA 4MQUA 1W47A 3LPAA 4WXEA 1XWWA 2WMOB 3DVRX 2XWSA 4KQCA 5KTRA 4P4GA 5BSFA 4GOND 2IYXA 4LWQA 2BYTA 1MRSA 2D3TA 3QA9A 4PPQA 4R3NA 4WKNA 4FR2A 4LX0A 5LZ7A 3AP2A 4GXRA 4CTOA 1M7GA 4V0QA 5BV8A 4GI5A 4KR6A 1JL3A 5TQ2A 4MGHA 2ZTVA 4WA8A 1QBGA 1W1IA 4Y2HA 1N6OA 1Z8FA 2GEFA 2I7DA 3FYUC 3NHFA 4FKMA 4AURA 5JNRA 4UAJA 5EXEA 4EY4A 4BZWA 2HCBA 2JJ1D 1BXGB 1K7EB 1SQGA 3BGDA 2XA2A 4JDPA 3PXAA 1R50A 2GTPA 4LDJA 4XSHA 3D8NA 3LC7O 3V4LA 5JZSA 4KBFA 2ODTX 3MYYA 3PFBA 4KWHA 2W2OA 5BSGA 5EZQA 4LF6B 2NXCA 1FP4B 4GPD1 5L7TA 1N2SA 3G0GA 5I47A 4TTVA 1VLVA 4GFDA 1XNQB 3E0QA 4MUBA 4W1QA 3D0RA 3DEIA 5D6NA 3F73A 3WQQA 2JARA 1XDDA 5TGDA 3B2EA 2ZYHA 1NMQA 3BQ9A 4ESVA 4FN4A 4J0GA 1XNRB 3SR0A 2QVCA 1SURA 1FP6A 4JI5B 3AYXB 1UPUA 3NZEA 3O3MB 2B69A 2Y1WA 4O2BB 4Q3KA 3UY4A 4X64B 2N3ZA 3G17A 1Z73A 4X6XA 1ETHA 5HPYB 3AUXA 1J5EB 1Q22A 2E55A 1JQ5A 3DNMA 2JFFA 1KK2A 5LYYA 3P0FA 2PUJA 2OB1A 5AMXA 3QEKA 4YWHA 1EVZA 1THGA 1VA5A 3TQIA 5BNFA 1WX1A 2XMCA 3QF4A 4PYLA 5TRTA 3QVXA 4CCAA 4JITA 3E7FA 1PAUA 3UJDA 2HXGA 5GZ3A 2FZKA 4NE2A 4BFVA 3BRWD 2I6FA 2ZIXA 3AJDA 5C5CA 1S2DA 3UMFA 1QZXA 2DY1A 4LYJA 1JFVA 3VJKA 5LFAA 5EIXA 3MCAA 4ZWNA 2M9MA 3PNOA 1A8UA 4IXMA 1VIYA 4XWYA 1T3ZA 1ORRA 3S1AB 2JH8A 3CW9A 5U1PA 2HU8A 3H9GA 1YC2A 3CR8A 2HCJB 1H85A 1ODCA 2PHZA 2QNBA 2X8JB 4OJNA 3LCMA 4TV8A 2WT4A 1ZD4A 2YWRA 1XZCA 2QTLA 3P97A 4KGVA 2C9ZA 1MRNA 3GLHA 2R1ZA 1XZIA 4XJTA 1I7DA 3E82A 2RH5A 3K9HA 4A2PA 1EFKA 1KQFA 4Z4HA 1E1MA 4NEQA 5GMOA 4M55A 3KVNA 1A04A 1SOAA 4BWFB 2P3OA 1II8B 4WE3A 4C4OA 1UXJA 5KOHB 5EJ5A 4PY2A 4UNNA 5CT8A 3ZN2A 2ETXA 4EHNA 1NN0A 2PX8A 4NCHA 4LJ4A 1L1QA 4M7WA 2ECPA 2P5UA 2CUNA 3NBAA 2XCSB 3O1IC 3UMYA 5JAQA 1TAUA 3KJFA 2D7DA 2FF5A 4MA0A 4ICIA 1RC0A 1XGKA 3GFOA 3O4FA 1L1FA 4BGDA 1NVXQ 4H3KB 1HNXB 5A0TA 2GN9A 4FDTA 4GG1A 2JFHA 4MIYA 5JFOA 1R0ZA 2PSJA 1Z12A 2FV8A 4FMCB 4K6FA 4QPZA 1RI2A 2PL9A 1TTTA 3DNFA 4W5HA 5K99A 4DIUA 1UC5B 4F1KA 4HNGA 1B23P 4X54A 4RTPA 3EE6A 3STVA 2VYNA 3L8DA 4GMDA 1T0PA 1YQ9A 4O4IB 4AECA 3GOHA 4ZT2A 2DF8A 5KC9A 4OA8A 1MOZA 3T38A 1LK7A 4J3FA 3GJXC 3QVVA 3QWHA 2F9FA 2R8BA 2C9MA 1NJ2A 3OIDA 4DBVO 4TL9A 1NX9A 4YJGA 4A8JA 2PV0A 3DW1X 4ON9A 4FCVA 2ZANA 2SHKA 1AGYA 2ON6A 5JSHA 4UM7A 3TX6A 1B6TA 1RWQA 1XCBA 5EHZA 3K70D 2A5YB 3EGWA 4YAFA 1INLA 3UC5A 3OY7A 1VPTA 4Z3OA 4L22A 2R6ZA 1A8SA 2HFJA 1G6Q1 1Z34A 2NV6A 2RK3A 5FLKA 4D9KA 3PUKA 2HMUA 4Z8YA 3FN4A 1EK5A 4MS1A 3MRXA 4GYKA 3CISA 4RD1A 3PXEA 4V03A 4S2UA 4LJ9A 1H8HD 4HNSA 3ST7A 1I4EB 3RPEA 1T35A 2EWVA 1C4XA 2OM6A 3DBLB 1BAPA 4AS3A 3G2IA 1ZIPA 2VH1A 5IBPA 1W36C 1NR5A 3N6XA 2C7QA 4HR7A 10MHA 4P5PA 3N0TA 3N7AA 4LRQA 4O3MA 5LZ5A 4UM9D 1S0UA 1PR5A 3SHVA 4F5DA 5B55A 2WIGA 3V6LA 4H59A 3X0DA 1JWLA 1IY0A 3M9WA 1XN1A 1QG4A 2NO6A 1V7ZA 5FO0A 4KOEC 3P7MA 3EVCA 1PTJC 1CIVA 1C1DA 1AKNA 4UTNA 3WGNA 3L6DA 3IOMA 1LB1B 3ULKA 2Q3HA 3PC7A 4Q82A 4R8MA 4NPAA 2G5TA 1OVMA 2ZRKA 1Z0IA 4CLHA 1A1SA 2RHTA 5B64A 5BNTA 3IAAA 4OB7A 1NRXA 4O4LA 3QXGA 4YDHB 1VDZA 4RZHA 4MV6A 1II0A 1ZD2P 3DXYA 5ALUA 5J4VA 5C3MA 1VKZA 3UAYA 4IIJA 1W4AA 4OCZA 4PRKA 2BH9A 1DBQA 3PZRA 4C87A 3VH3A 1FIUA 2AXNA 1AOXA 4ZOAA 3C2QA 2ERCA 3OEEA 2QV7A 3JAWB 4ZT7A 2FFAA 1UC8A 1H23A 1EWQA 1OC2A 4I55B 2C5GA 3VNVA 4HNRA 4FIDA 2VUIB 4KYUA 4DLUA 1ZDMA 4YALA 4S05A 4OHOA 3CIFA 2WQZA 2R4QA 1BMQA 3A4TA 4K6KA 3I6BA 3RTEA 2BBTA 2VPTA 1G5IA 3DZFA 5PNTA 6ADHA 3GAZA 1T4BA 3IAM6 3Q9UA 4G4SP 1O2DA 4XB1A 1QYCA 1YR1A 3HYLA 2ZBDA 4CG3A 3ZU2A 4KV9A 3C3AA 4BO0A 3LDAA 5IJWA 3RVSA 3UW1A 4B7UA 2LCQA 4RK0A 2JDID 1KEVA 1E1QA 4O08A 2WYHA 4F3YA 1GFIA 3FPKA 1PTKA 5LQAA 1PD1A 3HCCA 1G20E 1W35A 3DZKA 3KFXA 4CDRA 4E5MA 1OH8A 1Z4JA 1QVRA 2Q62A 2D2VA 2VS1A 1A5ZA 2B30A 3AKYA 3N76A 1J1UA 1PV4A 1GHTA 4H7EA 3QM1A 1KJWA 1JEYB 4OQPA 3PL5A 4A9AA 4N0PA 1N2GA 5IRCD 1CD5A 4CKZA 1ZCAA 3FJOA 4HX5A 3CLUD 2O0HA 1TCBA 4QULA 4ZKDA 4PS1A 4TWIA 2V45A 1XEWY 4TLDA 3H8VA 3TLYA 3UT5A 3T9EA 5KMGB 2DTEA 4Z4IA 2CWDA 4W4TA 4YRJA 4C0HA 2WV7A 1J2YA 1X19A 2RH8A 3BFPA 4HYQA 1ZA1A 3TMYA 5JTUA 4WGFA 1EGAA 2P2DA 3IOEA 1R15A 4DRZA 1NVEA 5EKDA 2XOKD 3WYFA 1PWZA 3AUUA 2KM1A 3WP1B 3OOSA 3E9NA 3F9IA 2OLJA 2JCVA 3HCWA 1IG3A 3EH1A 5E4YA 4TS3A 3WGLA 1F14A 2VHWA 2YHUA 4MRPA 2QVXX 3CO0S 1D2CA 1CDOA 3UK0A 3OZRA 3ORQA 2JKZA 3AK4A 6ABPA 1NPDA 2FOLA 2H7YA 3A7EA 3KQNA 3OX1A 3Q7PA 1KJ9A 1UT8A 5DSZA 1QIKA 2IP2A 1RI3A 4M76B 4RZ3A 1E9BA 4TN5A 5TR9A 3OEED 4QBIA 1RWWA 4ZU3A 4Q4CA 3R24A 4INZA 3RFXA 2FZ4A 1AKWA 4MI9A 1AS2A 5FPQA 1W7AA 2XXAB 3HRKA 1RP7A 4XOIA 3U4CA 2HYIC 3WL8A 2GZSA 1EFRD 2R751 4PQFA 3J81A 4OQLA 1AS3A 3K2BA 5FB3A 1YQUA 4NBRA 5DBIA 1SC9A 1M1YA 4NABA 2BCEA 4YQEA 2WZBA 3PXUA 3IR7A 5IJ9B 3AU9A 5IP5A 3OJWA 4KITB 4H1UA 3TZLA 1K8RA 3K9NA 1ZYUA 1V4BA 1YZYA 3USES 4PHGA 4H27A 3OF5A 3LW8A 3H7IA 5ERYA 2ZT8A 2ZRIA 2EL7A 3E23A 5TVGA 5B57C 3HCRA 3QLEA 3RVNA 3PYLA 2QYHA 4TQUS 5JXJA 4G8BA 5K0LA 1B8NA 2OGUA 1FFDA 3MWEB 4BVKA 4CPDA 4EMTA 3BBLA 1FJGB 1GUFA 4D99A 3HB9A 4TL7A 2VSYA 5E7QA 1XHEA 3I2HA 3KBOA 3G5TA 4E1BA 1O8CA 1O54A 1YDFA 1B15A 2Y76A 3FAZA 4MV3A 4TQ9A 3RVLA 4C6SA 4RU1A 1P2GA 4CKYA 2QU7A 4OQXA 4W6QA 4YV2A 3GMDA 3GZJA 3AG5A 1H4QA 4A4DA 5DXFA 1H2HA 3EXFB 3ROTA 3OTOB 4IG9A 4K3VA 5BSHA 1D8TA 3G7UA 3KPVA 1E60A 5AD1A 1NV8A 5JSFA 4KGXA 1CR6A 4OUKX 5CR9A 5IT9A 3GEHA 2VNSA 1M2OA 2DBZA 2P1DA 4QNNA 3ZEIA 1T1JA 4MZXA 3ZXUB 4WVFA 5DSTA 3WLKX 5IT5A 3DT8A 1DIBA 3TUIC 1SXJC 4V0ME 1M6NA 2YJTD 3GJTA 4ITUA 4R7ZA 4PPNA 3A9UA 1UDRA 2PIAA 3G8AA 3IQXA 1F2UA 2HRZA 3GN2A 4W8GA 3E9ZA 4X1IB 1QTIA 4RC9A 1RYFA 3HG7A 3WKAA 4G1MB 4DC0A 1ISSA 1XCPA 4EYGA 5AVTA 2IE0A 3PNSA 4H3HB 1FPMA 4CQMA 4QARA 5B1EA 1GAQA 3WIOA 3VAZA 1QFMA 1K06A 3MWKA 3IYLW 2J5KA 3L1KA 1PJ4A 2JBHA 2QV0A 1QJ4A 2OHHA 4RPCA 1Z2NX 4EHBA 3SJUA 4X1KA 1UEJA 3LF1A 4FYJA 5HQTA 4IIDA 1H5QA 1Z2DA 4K6MA 2W0MA 1ZINA 3DMTC 3O1JC 4PXYA 2OCPA 3ZWKA 4BTLA 1ND6A 1SVMA 3LDFA 3CIOA 1KH3A 3JQAB 2DLNA 1H2FA 2WJPA 1EU1A 3ZGVA 1HYGA 4JEUA 1RLOA 2WEKA 4BMDA 2HC9A 1SQ5A 3E2PA 2YWDA 4G9EA 4X6UA 5E9JA 3QF7A 4RIGA 5EKXA 4BVGA 1OH7A 3WB1A 3BXEA 2FPSA 2YXBA 1ISHA 5FOUA 3G2NA 2GLTA 2ZAGA 5D1HA 4BE7B 5AUPB 1C3XA 1QF7A 3OTGA 3SVZA 3HKEB 3A9CA 3FUWA 2JBWA 2FHSA 3ZHBA 16PKA 3D8TA 1ZNZA 4YA6A 2VO1A 3EFOB 4J2TA 1CC1S 1UXOA 4HFNA 1I7QB 1W6RA 3RHFA 3LA8A 2M1ZA 3ZWVA 3KC2A 1LRJA 1ZIDA 4MKFA 3SSOA 1SK9A 1ECCA 3EK2A 2KQUA 3A6ZA 3OICA 4RADA 1U8YA 1CUDA 5H81A 1XA3A 2H4ZA 1ZU5A 3H9EO 4TL8A 4G37A 2HJRA 4NE9A 3TBFA 3IMGA 5D00A 4C9BA 2PPLA 4JOQA 5CFPA 1JNYA 2BL4A 3LE8A 5ESRA 2J6IA 3BIXA 3M9XA 4BO2A 1C8VB 1L1EA 4R54A 2XUAA 3TW8A 3W5DA 4QDTA 3KWLA 4H7JA 1R6VA 3EZYA 3L18A 5I8WA 2HOQA 1BDMA 4L16A 3MINB 4OP2A 4X7BA 4DQDA 4BNXA 1DKMA 3D5QA 3KDSE 3AB8A 3E9EA 4X1YA 2EZ8A 1AKMA 4EGQA 4LCEA 4PO1A 4QXAA 3QUSA 2QS9A 2GZDA 2FZLA 4IXTA 3W6UA 4K9OA 4Q1VA 3SYNA 4WXHA 5TJHA 4PGMA 1ZMOA 3PI6A 4IHAA 1KFJB 2LE0A 4JC8A 4OI2A 4FJ1A 1C2TA 1YTLA 3T9FA 3ILSA 4V2UA 3ZBUA 1DJLA 3M7IA 1P1FA 1ZGCA 4HH4A 5FULA 4IQFA 3BIJA 3A1UA 2QA5A 3GLRA 3ZQKA 4DTCA 1B3BA 4I6JA 1C9JA 1PUXA 1FYFA 3BFVA 3KLBA 4IKEA 5LR6A 3D8RA 1RQ7A 3IAUA 4PW0A 3T3NA 1E1QD 3T5PA 4OXIA 5EP1A 2VCYA 4L75A 3LCUA 1V1MA 5JD3A 3TOVA 1F1BA 3LYUA 4Y67A 5EKTA 3V2UA 5SY9A 1JHUA 2GN2A 4YCSA 3A3OA 3ZH2A 1OLSA 1Q83A 5LQKA 2ZZNA 1TOAA 1J6UA 4ZT6A 5IT4A 3WWYA 1U3CA 1YK0A 2BLNA 1WMDA 2OV4A 4GX2A 5JU6A 3PVSA 2QM8A 1LLUA 2FZCA 3NWJA 4HY3A 4Z9AA 2XYHA 1HQKA 3QXCA 3VNBA 3B3JA 3LRTA 4NKRA 1NNLA 2G28A 1RAHA 4C21A 5G40A 3PHBE 1GTMA 2BGGA 2XT6A 1Y8QA 5EYPA 1JJIA 2G9VA 2WFLA 4KQ9A 2FFHA 4LXTA 2VJQA 1M33A 3A9VA 4NDZA 2A1TS 4KR9A 4PYKA 5BSMA 1HYBA 3Q3HA 2QTVA 4LV6A 3U5TA 4C7OA 1B6GA 2O8CB 3OM9A 2VAMA 1IEWA 4UUQA 2WSBA 3NIBA 2QOEA 3L8EA 1XROA 1SBHA 1X7YA 3MAJA 4UXIA 1G17A 4HOYA 5JLAA 3C7CB 3SR3A 3V48A 1R5OA 3RTDA 3T4PA 2PH3A 5MN5A 2RHRA 4FZRA 4RKFA 1OXMA 2HL6A 1NJ1A 3H18A 4WY8A 3FBWA 1Y8AA 3R9IA 4AS1A 3IDZA 2PJRA 1SCJA 4UAVA 4UM5A 1XYVA 2WFAA 3NBZC 2CLSA 4FX5A 4TT8A 2JA2A 1Z47A 4HKTA 2RGCA 2VP2A 1URPA 3AUTA 4ZCTA 4RFLA 4JB3A 3LZDA 1QDEA 2E21A 1CG6A 2ZAYA 3IJPA 3K16A 1BOOA 3NONA 4JT4A 1JLRA 1JWBB 1YB5A 3FMIA 3PU6A 4PYOA 2B8WA 2H1CA 5EIWA 4B6SA 2MT9A 3N2YA 4O4HA 4BP3A 1EG2A 2P9EA 4FLEA 4HTAA 2H1RA 2VA8A 3A2MA 3E3LA 1WXWA 3EZNA 3NEYA 4MWTA 4WACA 4CUZA 1Y5NA 3PHGA 3FNFA 1P2BA 1RYHA 2A5LA 2XHEA 3M9LA 3R0IA 5DNEA 3PC6A 3QE0A 4CLEA 1PFGA 1YHZA 1QRRA 1Q1BA 2PT7A 3LUJA 5D3QA 4AC9A 5KOHA 4BMOB 3FUVA 3QG1A 2QDXA 3F8TA 2O7NA 2CN1A 5AUQA 2XD9A 1FYEA 1EAMA 1GKLA 4LE0A 3H16A 1OXSC 5DI3B 3PPXA 3MZ0A 1D6MA 2Y9PB 4C4XA 1I6MA 1TZKA 1Q7CA 2CNBA 4MHOA 1GV0A 1PT9A 3AHHA 3CJQA 1JF8A 4RKYA 1QFZA 4XQ0A 3SS7X 3U7FB 5ADHA 2FSSA 3A11A 1K9SA 2I1QA 3D02A 3T12A 4D4MA 1KI7A 4OLFA 4XSGA 2VG8A 4QDUA 2DVMA 1ILWA 3JYHA 2J48A 2RB4A 3JZDA 5DWQA 3BRCA 4B17A 2D8AA 1GL6A 5F2OA 3FZEA 4CM7A 1ZI6A 4YBRA 3HN7A 4BFWA 3AR4A 4JEMA 1USUA 2O0JA 3A27A 1KHHA 4MHSA 1OKKD 1NOIA 1EXWA 2EF1A 4HAOA 1WLSA 2JD1A 4GPIB 4AZ3B 4YAUA 1OBFO 1OSNA 3W9BA 1KI3A 1GOTA 2OHOA 3IBGA 1M5RA 1WPXA 5JO9A 5JIBA 2JFQA 1UZAA 2GZ1A 4MV9A 4M83A 4URHA 1UANA 4BFSA 4RHUA 3T1YB 4G4JA 1Z7BA 1VYVA 2ZATA 5T64A 2I22A 3O47A 4C20A 1HZZC 4TZKA 5K9ZA 1ZITA 1UBCA 2W43A 4L73A 4WCFC 1SVWA 2NQ2C 2WKPA 3PLNA 3I72A 4MIOA 5EJ7A 5H5JA 2ZIZA 1EHYA 1JIJA 2BHSA 2HNKA 1HTTA 2FZEA 3KYCA 4INPA 5SYMA 4AJ9A 5A6VA 4QG3A 4CIWA 4LX8A 4DR4B 1OB2A 2FQXA 2VHJA 1P17A 1OT3A 3LT1A 4J75A 2OMEA 4Q3LA 1XMQB 1WUHS 3R3YA 1KRXA 2AEEA 3NOOA 3AXTA 3CJRA 3HBMA 4TKVB 3D7MA 4Z53A 2OESA 4KPYA 3HY4A 3G9UA 2YZ2A 1GCOA 2HIMA 1HY3A 3TF5A 1QK3A 1T9ZA 3CLRD 5AUNB 5LKRA 2P9FA 2DYKA 4GOXA 2HZBA 2OFWA 5CCXA 2HF9A 4JJIA 4NBSA 3JALA 1OC4A 1YQWA 3AGPA 2BM9A 2F1KA 3TINA 3UXEA 3WYCA 3ZD8A 5JCPA 3SC6A 2JAOA 1ZGBA 2YX1A 3OT4A 3Q3VA 4OXNA 3WS7A 3ZHOA 2Q5LA 1M34B 1FRFS 3BK7A 3GLQA 4F4JA 1F17A 1MCZA 4JP8A 3MQ4A 5LL6P 1TD9A 4DIOA 1DIRA 4INOA 1P75A 1XRJA 1T25A 1NATA 5ITWA 2CK3D 4I7EA 4C29A 3SHTA 1GYQA 3QVWA 3NIDB 5CA1A 2AUNA 1P4RA 3RM3A 3L7IA 1MFPA 1WHTA 3K4QA 2I4IA 3U37A 1C0IA 1KRHA 1GRQA 2GUWA 1PJLA 2Y1FA 4EUSA 3U6BA 4H3VA 4QLOA 4R9SA 1QU2A 1E3MA 1P9NA 1BH2A 1F9AA 2ZU6A 3N7UA 1H6DA 5EWJA 2PNJA 3TQOA 5JZ9A 2HHHB 2D59A 4IM7A 4MQBA 2WWFA 4HDMB 5D5PA 3TD6A 3MLBA 3AOEA 2X9GA 1BDJA 2VQDA 3PD1A 1QRTA 1N34B 1GD1O 5K51A 1UKYA 1PR3A 2BV3A 1S3GA 2WU0A 5D5HA 1QH8A 1FQWA 3COWA 1UWVA 2Y92A 3EISA 1PGJA 4DZTA 3WLMA 5F23A 2ABWA 3C48A 2CUZA 5FD8A 3EQ2A 3EBPA 1Z37A 3R9KA 3GLVA 2Q49A 3DZBA 4EL0A 1E6UA 3IEIA 1E7YA 1EHCA 2FEAA 2JI9A 2IITA 2Y68A 2ECKA 3D4BA 4PV7A 1B2RA 1OIXA 3QPDA 4ZZ2A 3L79A 4DUYB 4JSYA 4NMXB 5AI5A 5KHAA 3B6KA 3F3KA 2WUFA 1J8QA 1TAGA 4UHEA 1R0YA 5A2GA 1UAYA 2Q1XA 4AMBA 5A02A 3UG6A 4GICA 2YC2C 4MAFA 2V8OA 3P2KA 2VTBB 2P78A 3CKMA 3EZ9A 1T9BA 3AFOA 1XB2A 2IXFA 3OLZA 1ESNA 4QQRA 2CXQA 1ZXXA 4L5CA 2MR6A 4ZQBA 3JWIA 2D13A 1TA0A 1GJRA 4C3OB 2J0VA 2BGNA 1DC6A 3WFJA 4D0RA 2HQ1A 1E2LA 1T6YA 3OOYA 3GT7A 4G9BA 4L8YA 4A2CA 2GM4A 1AH2A 1BE8A 1NUQA 4EEKA 3CCFA 2FW8A 5BOSB 1PV2A 1K6EA 1D4AA 2PBLA 3QX8A 3IP7A 3HHEA 3RRZA 4DREA 1AMUA 2JLWA 1UEXC 1NJGA 3KLPX 3WYNA 3ZI4A 5AQEA 3R40A 5EZYF 3TXAA 1P72A 1JR4A 2WDPA 4OYRA 2F9MA 1XXHA 3PWZA 4X20B 2QR2A 1Z5VA 1W4RA 4D44A 5KINB 4GX1A 4Q4DA 1IATA 4IGEA 3S0JA 4EUKA 3D6NB 1DC8A 1TQ6A 3LQYA 1LJ8A 3G5MA 3MXOA 1DC5A 4Q9HA 4A91A 4PGGA 3ZD6A 2OKCA 4Y0VA 1L5GB 3KPUA 1VL1A 4DA0A 1Z9BA 5KMGA 3ZHZA 1QG0A 2OZKA 3EG9A 4W7SA 1BHJA 4L28A 4RJJA 3ZCXA 1VMIA 2XB6A 2RHBA 3RVQA 5IYZB 3UBTA 4M7RA 5AOAA 2WLTA 3QEMB 3CNOA 4OB6A 2QT9A 2HUPA 3CY6A 4EG0A 2JI4A 2J3MA 2LGJA 1XZAA 2BR4A 5B5SA 2JAHA 3JD1A 5HFNA 2ZIVB 3SM3A 2OHJA 3N2GA 3VU0A 1YHNA 2QX7A 2QTCA 4J0CA 1ZIYA 4RMJA 5AFSA 1EYZA 3MGKA 1JDZA 4AXBA 4WKBA 2A92A 1XU7A 1VB3A 2ZRBA 1IEXA 2ZVPX 4URFA 3OJ0A 3PHIA 4IMIB 3UC9A 3DEAA 4JBXA 4PBTA 3ORSA 4HL6A 1JXQA 4P33A 1MX3A 4FDVA 1L5NA 2DM6A 3EXAA 1G3UA 2ZB3A 3QOFA 2CF5A 3RS8A 4UAUA 4KQFA 4Z0PA 3V7FA 3HK2A 4TWRA 1BX0A 3LGSA 1GQQA 1VIVA 2WF5A 2WWTA 4Y6SA 3SC3A 4ISBA 5FWDA 1X9IA 1L8QA 1Y81A 1RW4A 3BFXA 4C01A 2QZPA 3DTNA 1IZZA 2FKAA 4F56A 1O0BA 1GZVA 2OZVA 3QBEA 3QSGA 3AEQB 2Z3ZA 2CMHA 4IDEA 2DULA 3OO0A 1KWGA 5CG2A 3UN1A 2P3SA 5L3QB 4L15A 3FMVA 1DJNA 4H3SA 4D6PA 4FINA 3FLAA 1H8ED 1P77A 1PVVA 4MGZR 3VV3A 3VYVA 1V11B 4JNKA 3JTMA 4W5RA 1BYUA 1E2UA 1H69A 1PWEA 2IBMA 2OO7A 3DKRA 3EVTA 4UTOA 1PCXA 3WBKA 2FAXA 1JHAA 3K0HA 3GRYA 1XD9A 2H00A 3JVUA 1QH8B 4M9UA 1Z0JA 4H1HA 3C87A 3RF7A 1KMHA 4WOKA 2G71A 3CEHA 3A6EA 4EPVA 4F2DA 3ZDAA 4QEDA 1D9ZA 1X1EA 4FUTA 4YJGB 4U7HA 1AY0A 2NU8A 3LGAA 2XNJA 5GGYA 1T5OA 3OE4A 4N5HX 1RRKA 3B60A 3GAFA 5JY6A 2Q2QA 2JFUA 3V4FA 1DGQA 1VZ2A 1XTUA 2R1TB 2CUTA 1G2PA 2D5LA 1X7ZB 4UXHA 4K46A 4HEJA 1ENZA 1ATZA 4R84A 1G59A 3ZDCA 1QLHA 4C4ZA 2AWNA 4LZOA 1P7CA 4H15A 1Q84A 1ZICA 2DHCA 4P3XA 3UK6A 3OZGA 5FDFA 5JJLA 3VVBA 2AR9A 3E9MA 1P1KA 3DGEC 2QL9A 4GXQA 4BXOA 4L4SA 4C43A 1JG1A 1KARA 1ZGAA 5T4BA 4MJ7A 3D7SA 4F9GA 5KOIA 1LQTA 2RIRA 4ZV9A 3RUEA 4TV8F 1BDHA 4EMUA 1C50A 4XGKA 1R6UA 3HA5A 5HMMA 1U2ZA 4G0MA 4YO7A 2PJUA 3TXYA 3D0QA 4YR7A 2QP4A 5HA5A 4I2NA 5JPCA 3IEXA 2Q07A 2WR8A 2O2ZA 2BFPA 3GFSA 1V35A 3KUKA 1FMLA 2JJQA 1A8IA 1YFJA 4WBNB 1R4MA 3AR7A 3SIRA 3T7DA 1N5IA 1BIFA 2JRLA 3TO5A 3HB5X 4CFSA 4NYMQ 4B3FX 3SQWA 1S9HA 1P44A 1O3YA 2YFYA 3HCBA 3U49A 2VJOA 1Z74A 4FYXA 3R8XA 1M0WA 1FTNA 1PJQA 1X6VA 2HMVA 3DO5A 1FJXA 5ENDA 1P62B 3CSUA 3K0BA 3A7DA 5KZMB 3E4CA 1G9XA 2VNAA 4L6CA 4A0RA 2KBEA 4BJ6A 3ZWNA 4B85A 2XGSA 4MS3A 4U9UA 4UDYX 5T3UA 2XYRA 5EY5B 4HVAA 3L41A 2X0EA 3WWPA 4X7RA 3WWZA 2BUCA 1H22A 4J94A 4Z8XA 1O57A 5FNVF 4D46A 3NM5A 3OM1A 3E6AA 3E0XA 4JL8A 4YC7A 2IZZA 3ZDEA 5EIHA 3WGZA 1NC3A 4PX9A 1DJQA 2Y1EA 3CSSA 1QXSA 4TZ6A 3AB3A 4LJ5A 3MPUA 4XKJA 3PFWO 1V3VA 3O9MA 1AGRA 4BFZA 1MDBA 4PG4A 4NF2A 1J9GA 1DAHA 1JLMA 2GSDA 1Z5WA 3KSZO 1YQXA 1MB2A 3FPEA 5IAKA 1TJ5A 3RRNA 3E70C 4X3CA 5HM8A 2C96A 2R6R1 3QTTA 3TLMA 4AKHA 3FPSA 2OG1A 2JAUA 2UKDA 3VAAA 3OCCA 5D3KA 5F21A 3UMJA 5BUSA 1X9HA 2HPAA 2PX3A 1L5HB 3DB2A 1JR3A 4B0PA 4PRYA 5K8IA 1RP1A 1REQB 3C74A 2HT6A 3N8GA 3BM5A 1N2ZA 1Y6ZA 3QEOA 4XCVA 1NIPA 2GK7A 4QECA 4C1NA 3TSAA 2JC3A 3FCYA 3SQMA 2Q6TA 3PFCA 4ZICA 4M1SA 3O92A 4F2WA 4BY9E 5AXCA 4OL9A 3LX5A 4QFMA 5F9HA 2AZTA 2BN4A 1E2PA 3BSSA 4O4JB 4UHFA 4HZGA 4EYOA 3P2EA 3VBEA 2R6CA 2NU8B 4NCAA 1T8YA 1YJBA 2DHDA 3EXG1 3URKA 5CFNA 2XCLA 1EFPA 2NZVG 4Z0TA 2XEXA 1CU1A 3HWRA 3UT5B 2F59A 4DNPA 1KVQA 3T94A 4OUDA 1GGNA 2X5JO 2YWJA 4OAQA 4AM8A 4EYEA 2JLSA 4QOSA 5CFOA 4MWOA 2ZQ5A 3HVKA 4WKGA 5ALSA 8OHMA 5HJ5A 4B3TB 1JEDA 3H0CA 3HJBA 2XE8A 3EQ7A 1UCFA 4TKLA 2XR1A 2VP6A 4F12A 5JAUA 2FG5A 5EXXA 3DT6A 1EP9A 2NO1A 4OQEA 4JUBA 3O1HB 4TXNA 4XPZA 2DCMA 4D0LB 5IZ4A 2FWAA 1SCNE 1M1YE 4NPHA 2ZPTX 2IFTA 3BMQB 5F52A 5FA5A 2WKWA 2C8VA 4TLBA 1GTJ1 4COKA 5CB0A 2G0NA 3LBIA 1TMGE 1U2SA 4GR5A 4HUQB 5K6AC 1A5AB 3D7KA 3WLSA 1Z0ZA 2LBPA 1FXWA 1NDQA 2AC7A 4BNJA 4DSTA 3M6VA 2P5SA 4D74A 1SVKA 3IVGA 4XPIB 4EUHA 2VF2A 1XEAA 4MDEA 3O8OB 5EIBD 3OIYA 2PCLA 4JI0B 3V2IA 5K2MA 4MAAA 1E9FA 3EUWA 4DA9A 4Z7JA 3RLFA 1AQIA 2OFPA 3LVBA 4MWBA 2R62A 3ZNNA 3CNBA 4WOJA 3UWOA 4B09A 2MDTA 3AKEA 2AMLA 4EQZA 1PJ3A 1N33B 1ND5A 4E2YA 1WCIA 5IDYA 3S5JA 1T4CB 3OF2A 3TIIA 1E1DA 4HMOA 4AG5A 2D5CA 1Z75A 2NYVA 3DONA 1NMXA 3KT6A 1MTOA 1V16B 3V42A 4H4DA 4DCJA 5JNLA 3I5AA 2BKUA 4BZQA 5KQRA 4LG1A 4ARIA 3JAKB 3VR4A 4TTAA 1YASA 3FKSA 5CRIA 1TD1A 3VYSB 4UOZA 3HCDA 1TO6A 1YK1A 4ZANA 2ZAIA 1F8YA 1ZONA 1VSQA 2ZAOA 3FBGA 4IPTA 5AM2A 4QFCA 1G3QA 1V41E 2CJFA 1X7XA 1CZRA 1XQWA 1LSUA 2QMQA 3DTTA 3LT4A 4UBMA 1B43A 3RG2A 5IAAA 1UBFA 5JT1A 1ZN2A 2A9OA 1OMOA 4IY1A 3UANA 4ZK2A 4WNAB 3PDCA 4EW6A 1BC5A 4H4EA 4PAQA 2Z6UA 1QF6A 5ALFA 1I94B 5DGCA 2B0CA 4DARA 2PD6A 3NBQA 1RKBA 2YQ4A 1O6CA 2Q0SA 2JIQA 4NAUA 2P2YA 3FMGA 1ZM9A 1E3JA 2EKLA 3DVQX 2XUFA 4D4HA 3WNBA 1UKCA 1W93A 2FVYA 3NHMA 4QHYA 3RE1A 3RFCA 1ZD5A 1S7CA 3LP5A 4DCUA 3OHPA 1T0BA 3ITDA 4V1CB 3K35A 1EDBA 1EI9A 4D4KA 1OHHD 3OWXA 4KR0A 2JJ2A 4IJ5A 4LE2A 4P0TA 3RC1A 3U7GA 2BMAA 3BFKA 4D9EA 2VIIA 4JBLA 3BBPA 4K3UA 5GM2A 2PUBA 1V6AA 3KO8A 4CT0A 4KQIA 3ELYA 3NXKA 4MKGA 3AWDA 4CCYA 1GWNA 3CVJA 3O4JA 4MMXB 4X3OA 4RTSA 2ZJ1A 2HYDA 3S2EA 2UZ1A 1VE1A 3MF4A 1GDHA 3MYRA 1D9XA 1AXRA 1EDZA 1GZ6A 4BNHA 4D97A 5CM9C 2OZLB 2E5FA 2GOYA 4XW2A 1NVVQ 4UDXX 3IS3A 1PR4A 2C5HA 3RVJA 2E5WA 4FI3F 1ZD9A 1UP7A 3OMLA 4OVKA 3WFZA 4FVTA 3EJ6A 3IPXA 1A69A 1KVSA 3IDSA 4TKZA 1PK7A 4WSOA 3WJAA 1Y37A 2DWQA 5SZKB 1D2AA 3LA6A 3NR2A 1RQPA 1P0CA 4HRVA 3W78A 2CFOA 1NXVA 4X94A 3KAJA 3RHTA 1O5IA 4DFDA 1ZHOA 4DB2A 3JZIA 2ZUTA 1YGPA 3U7HB 3MT0A 2FY8A 1N1MA 5KHLB 5FJJA 1TQHA 2YRFA 1NBIA 2I7XA 4LZNA 4KX3A 1VKHA 3DAPA 1GL9B 5LD2B 4G67A 1QYDA 4FSHA 2DB3A 2E4WA 2YHIA 4YUXA 4YXWD 1IPHA 1E2HA 3UKJA 5A5EA 4U2KA 5E2AA 4IS2A 3X1JA 5BMVB 3FTNA 3R5TA 2Z2IA 2F3SA 3ZOZA 1WMFA 3M6LA 4O6VA 4ZIRB 2GLXA 4D9NA 1YS1X 4WN9B 4DMGA 2FG7C 2EIHA 4L0MA 1GGHA 2W2LA 3IE2A 4GRAA 4QREA 5F7JA 2Z2KA 4QBTA 1W0JA 4FMPA 3SMVA 3TNFA 4S12A 5FXMA 2CV0A 4YMSA 1X92A 2EFEB 3HTXA 2A3RA 5JVDA 1D7AA 3OIGA 1ORTA 4EP1A 3UOWA 1NVUQ 2FRVA 1G20B 4FDUA 2RBKA 5EA2A 5B6JA 4C4TA 4EHHA 4BECA 1T2EA 2HGSA 4LUCA 5DI9A 2LZ0A 4DGQA 1Q1QA 3VSEA 4YP1A 2F55A 2V7WA 3NG1A 3QU4A 2NXEA 1PZNA 2I29A 3A6GA 3EQ6A 1K92A 4JHLA 1U7XA 3IUSA 3WJ1A 5A03A 3FYHA 1MB4A 4YFVA 3WWCA 4KRFA 2FTKE 3AO0B 3M1IA 5TXGA 4Y2YA 1G4AE 3NWBA 2IH2A 4KIWA 4ZMSA 2V7UA 1ISFA 3ESBA 1XUOA 3QTLA 4JMLA 1SB9A 2QLTA 3BUSA 5KCMA 4E5VA 1DWOA 2OBYA 1R5JA 4R4JA 2ZYIA 2X0NA 3RANA 5ISMA 1BFUA 4G5OA 5TS2A 3V2HA 2Z6AA 4OBXA 2PDAA 1WHTB 1X1CA 1C4WA 2FCRA 1GA4A 1I2ZA 5GVRA 1VCIA 2Y2VA 2M6KA 3WB2A 2NP7A 3UGQA 4OO3A 3AJ9A 3NHYA 1IOWA 4MQ5A 5KYUA 2VJBA 2YWCA 3DZHA 1RIIA 2IYNA 3HV0A 4KG7A 3H7AA 5K3OA 2V74B 3A8TA 5JCOC 4ZOLB 2WJ3A 2Y1LA 4ZT4A 3E5HA 2H85A 4Q3NA 1HE3A 4WJZA 5K8CA 3SS8A 3WGYA 5LQDA 1XHFA 1XT6A 1NXXA 4ZALA 4GRDA 4QBKA 3RK4A 4UU1A 4I4LA 3P96A 3ZVLA 4Z1OA 5I7SA 4BMNA 1P4SA 4GMGA 5BURA 2GI4A 4JXKA 4CV1A 3ZW9A 4DDKA 3IDFA 2ZTHA 5IKOA 1QRUA 5JDCC 4ZOQI 3ZX5A 3WLEA 4EPRA 2WM9B 3LXUX 1E2IA 4QOIA 2G67A 3NOXA 5BMVA 1HR0B 4D2IA 4JLBA 2F90A 1DS6A 1DTWA 2OAEA 2ZR0A 1JQLB 1PN3A 1TQ8A 4RPHA 3UT6A 1VIAA 1C4OA 2P8JA 4J0DA 5KYWA 4L57A 2N47A 3K70C 1IN8A 4G0WA 2I6XA 2UZ1B 3GLIE 3A2LA 3L8GA 1QRSA 3PVZA 4FZVA 3HADA 3EMBA 2QUBA 2VTBA 4JBIA 2YOHA 3ZW7A 3M2PA 1KMNA 1XR3A 1DZIA 5G0UA 2O8FB 1L8LA 1N2CB 1VXRA 2DHRA 2HRDA 3T0GA 6YASA 3IKVA 2YINC 5EKSA 4R0MA 5EIAA 2Y8EA 3U44A 1WPRA 4IHJF 4TRMA 1JSLA 2IV2X 4I1PA 3GH3A 4LPKA 1DQPA 2GZ2A 2XODA 2OTCA 1DKRA 1YRQA 3HM9A 1AKVA 3KS9A 2RGDA 5TS3A 1JEJA 3H4MA 2RGRA 1OI3A 1PFQA 3OFVA 2WPDD 4GBGA 1XFDA 1G9TA 1ZZEA 2V7EA 1BFKA 4TKUA 5JZVA 1OXUA 4OAPA 5ED0A 5FL7A 3SQXA 2N46A 4KUHA 4LJLA 1UMCB 1RHMA 3K8YA 1PEKE 2B2XA 1XJ5A 2IEIA 3NHUA 3PENA 4MVCA 4X93A 1B14A 4BU0A 5A4FS 1XPOA 3REFA 4JWTA 1XEWX 4LZLA 1BCRA 1F9EA 1O89A 1UXKA 1KJJA 2CKMA 3Q7TA 4KODA 4N3NA 5BO5A 2GAFA 1KJ8A 3KAPA 4ZAYA 3GHYA 3S28A 4CMIB 1ADJA 1TUIA 1TIBA 2OCYC 3BILA 3NAZA 4Q1AA 2HJSA 3R7NA 2V6BA 1Q20A 5LLDA 1A5BB 1YUNA 2KW5A 3H5IA 3KWFA 2CLKB 4FU0A 4NV1A 1HO3A 4IJUA 1P19A 2JGRA 2ZLBA 3FWYA 3X2SA 4UVEA 3GFFA 3QEMA 5JYCA 3LCRA 1M34E 2ZIEA 1G5TA 2YMMA 3IO5A 3Q15C 1WQ3A 2GETA 3ZCTA 1JDNA 5ALLA 1PV1A 3FZNA 4TXLA 5CTAA 1DAGA 4RL6A 1EWKA 3WICA 4OOFA 2CL0X 2DKNA 3NBUA 1QO0A 4QLAA 3SP1A 3HUUA 4EGFA 2ZE5A 1N3BA 4QAQA 3OG9A 4TL6A 1H3NA 3NNSA 3RWOA 3IUMA 3L05A 1KDYA 4G85A 2QLFA 4JVLA 1JYFA 1GTL1 2WHQA 2OHIA 2NTJA 3EY9A 4M8SA 1QIFA 5JMPA 4BUZA 3IAS6 1FS6A 1PJRA 3DLPX 4M0UA 4HF7A 4XRGA 5ICCA 5J43A 1DLIA 3HXOA 3H84A 1Y8ZA 4JMPA 5CUQA 5BW6B 2LXNA 4BQEA 3KOXA 4WOBA 1KKMA 5FF9A 1QVAA 1SXIA 3E5NA 3DXFA 2R3SA 3GN1A 3SBXA 3HWWA 1FX0A 2CXXA 3BE5A 4UHHA 4UVDA 4F71A 5FH9A 1ZHHA 1C1DB 1QV7A 1BWRA 2PSEA 1O0SA 1YA4A 1JDJA 3K92A 5CJPA 4A0HA 4GC9A 2WF9A 3E15A 4UU0A 2P8SA 4B46A 4TSFD 2JLVA 3HDYA 5LMZA 1XF1A 1FUUA 3KZCA 3PGVA 1G7SA 4O63O 3LXXA 2I71A 5SYAA 4BHTA 3U1TA 2PO7A 3OIVA 3STTA 5I6DA 5DGIA 4LF9B 5K2OA 3T95A 5KTKA 2JASA 2DFKB 4CF3A 4KMMA 3CRMA 5KI6A 4A8TA 1KEPA 4RF4A 5I4IA 2HBZA 4I1UA 4G1EB 1NDHA 2X0RA 2H4JA 5HRAA 3TRKA 3JYLA 4N03A 4EHKA 2Z5LA 4BZXA 1SKMA 4QHTA 4BVAA 5IC4A 4LZWA 2H5LA 1FQKA 1X0VA 2II6A 3CZ4A 1UQUA 1G5PA 5LQRA 4Q6WA 1ZGGA 2OHFA 3HY6A 1UPTA 2ID8A 3DV9A 4M0LA 1GPNA 5G0VA 3WSWA 1E1CA 3ZLBA 1QKKA 3TAHA 5BW8A 3I05A 5LSAA 1DTWB 2J0SA 3CH7A 4TMYA 3U3ZA 1E8NA 1IBLB 2E0IA 1FMJA 1KEUA 2FPGA 3NVDA 5JANA 1LNSA 4IIHA 1FZTA 3VPXA 2ORIA 3F0TA 3BKWA 2IIVA 1ZOPA 4WLUA 3K8QA 3ONVA 3PPYA 3W9YA 3ONFA 2FP3A 5AESA 1RRFA 3WNQA 3PRJA 4FW8A 2OHVA 2UAGA 4NMHA 4ZI5A 2VHTA 2D0IA 2VXBA 4FEGA 2KHZA 1GILA 4JQYA 2GH1A 3O90A 1HNNA 2PSSA 4NFHA 1LNZA 4GBED 5AIAA 3AJ8A 1VMKA 1TQ4A 1FDSA 4V3CA 3AM5A 2YN2A 3OUTA 3TTWA 1RJFA 5A5DA 2ZRLA 2C78A 3RVMA 4QVKA 3LKBA 3W2TA 5LYJB 1Z26A 1TVKA 2JLBA 1ULZA 1ZAYA 1EFVA 1P39A 1QG6A 1UM8A 2IGBA 2RAVA 2VC2B 1QS0B 2VH5R 2X8WA 3AHDA 1UP6A 3SNKA 3SBDA 2VOEA 3CRZA 3NVKI 5HKOA 3CLSD 2YTZA 1TGYA 5AI4A 4DYVA 3DDHA 2PU7A 1E92A 1R66A 2AOUB 2BEUA 2GVNA 4D80A 1VL5A 2VJNA 5IH3A 3N6VA 4Z0HO 1A72A 4IHJA 3RCBA 3O4IA 3ZQUA 1XLTC 4AJJA 5DISB 5KNDH 2M1XA 2MINA 3CG0A 1MXHA 1SC6A 3WRXA 1U8CB 2ZSBA 3OKAA 3HB1A 5IKXA 1ETUA 2WE8A 3CXUA 3DD5A 4B4DA 1BU8A 3ER6A 5CFZA 4JX8A 1M2VA 4ZYXA 3FOZA 3DDCA 1ES9A 1JTVA 2XECA 2P4HX 1ZJZA 3C5HA 5DE3A 1KP2A 4Q12A 4UDNA 5KWJA 2NX2A 1L7NA 2WIKA 4ZQEA 4DILA 5FYDA 5GINE 1RU3A 4XX0B 3TOXA 4EUNA 1GPUA 2AR0A 4KR7A 5JCJA 2NVUB 3L5KA 3X1YA 3QUCA 1AO3A 5BNWA 4GEGA 2ZAMA 4KK4A 5DHFA 4MICA 4ZHQB 1LX6A 4AJ1A 5C5DA 4JJFA 5EEHA 3SG0A 4MYCA 1JSZA 4TZ0A 2JHGA 5ICEA 4PM4A 3DEJA 3IJ5A 5B58T 2CDRA 2IRWA 2X1MA 3GJQA 3EVNA 1UR5A 3OT1B 3BXZA 3ZIAD 5IJ9A 1C30B 3ZEAA 3MWFA 5AVSA 1I2CA 3IBCA 3I53A 4M0FA 4RIFA 1OAKA 4TV9B 4KXYA 4JJ7A 2I5PO 1VE6A 2PA3A 3CLVA 4KLAA 1Q2UA 4TVBA 1WJGA 3GFBA 4JYPA 5C4IA 1WQ4A 1ECGA 2C4TA 2K4MA 3NEPX 4NTZA 5FHRA 1E2EA 4GUDA 3BAZA 2V96A 3VI4B 1NONA 2NUTB 3DMHA 4P9NA 1QQBA 3P9NA 2FX3A 4EPWA 1Y5MA 2GMWA 4FGLA 2PUVA 3ORRA 4NONA 5AW8A 4LJYA 3BVPA 4FZ3A 3THOA 3VPAA 4XCQA 4J0FA 3VU9B 3CEMA 4WUTA 5JJCA 1BE1A 4I46A 3T7TA 3TIFA 1DXOA 5EEGA 3VJRA 4AJOA 1ZNWA 3KSRA 2WTXA 3S2SA 1K97A 4CCWA 1WBJB 2BBWA 2Q5EA 1Q7EA 2YHBA 4KC0A 3HKCA 2ZXFA 1L5QA 1LNQA 1YJ8A 3ASZA 3DBIA 3MJEA 5FL7D 2BGTA 1A9XB 3K6RA 4JYMA 2ZKLA 3RYIA 4E7PA 1TCAA 4YS6A 3OSUA 3V7NA 2L17A 4C0XA 3SZOA 2P77A 3EDYA 1VLJA 4PC6A 4PYNA 4HX9A 4R2HA 1F1JA 4ID3A 3VVLA 1FVXA 5GZ1A 5K0CA 4E15A 2EX1A 4D3FA 2N1MA 5EWLA 1PYOA 2ADMA 4G0PA 3RYHB 1EE9A 3JD4A 2YVQA 3B9PA 4PICA 4CKWB 1SQSA 4BBJA 2Y67A 2VWGA 4XQ9A 5DM0A 4YREA 2AZMA 3OY2A 5F7ZA 1DHRA 5EJIA 1TZBA 5ARDA 2OV8A 5CPBA 2HSGA 1WAMA 1IXSB 1NTOA 3IA7A 2MU1A 4HTFA 4BFXA 3LY5A 2NUPB 3NATA 3HSKA 5LP1A 2R7NA 4YMWA 1OJLA 2Q2OA 1UBOS 1YR9A 3CN7A 2H0QA 4HPWA 4A8JB 4F0JA 1N6RA 1TZMA 1B16A 3FOEC 1K7CA 1MV5A 2W2MA 2M32A 4IDHA 3A0RB 4MW7A 4WN3A 4CCSA 4F4DA 3GLFA 1MDFA 1TAQA 2ZYGA 4X95A 1I3LA 5EUCA 2RE8A 1WZIA 2QIOA 1KY5A 2V65A 3PGJA 1T1IA 1U2DA 3CX3A 1JFFA 2H4YA 1U28C 2X5KO 3KPJA 3LC0A 4QO8A 2P6UA 4F4FA 4YLEA 1IN1A 4WLEA 1C1XB 3O2SB 4LYHA 1NJ8A 2YQ5A 3LQ2A 1L7PA 1UMBB 4WZ6A 3UPDA 4ZYTA 3MTQA 3AHEA 5KNCA 4ZREA 5G0WA 3L4SO 3RU3A 4I1IA 2CHVA 4GP9A 4OL0A 3GQBA 3Q2IA 3UJ7A 2XCRB 4BV2A 3QKUA 1RD4A 2G09A 3IAHA 4DEVA 1JW9B 1ONSA 3WK4A 4BB9A 5K8UA 1GL7A 1XD2A 2V6MA 1BZYA 4GSKA 4D4IA 5FTNA 4DLWA 4IDPA 5KQPA 1G5FA 4CM1A 3BXFA 2X7JA 2B4YA 4G5RA 3EIQA 2O06A 2NTNA 3Q3EA 2Q99A 2IEAA 1QKIA 5JMTA 2JBAA 1LA2A 4GS5A 3BA1A 2ZI4A 3D1JA 1U6IA 3LK6A 3H2ZA 4XX0A 2ZBFA 4JJKA 5D84A 1QAQA 2HLPA 1GTVA 2HRQA 2LKDA 1FB5A 2R96A 2OSBA 2XY4A 4C5CA 2PVSA 3ACDA 3W5VA 1Q2XA 3EUEA 4AJEA 1BMDA 4EVIA 2IU3A 1LVHA 2C2GA 1GTG1 1Z5OA 4N4AA 3HKEA 3QE4A 1L7EA 4QOJA 3GNLA 4EI9A 5BSKA 1NVFA 4RX1A 1EA7A 3NYRA 3C4QA 3GIDA 4G89A 3ZIUA 4KQKA 4IXWA 3HJHA 4YO8A 3K1JA 4A6DA 3M6MD 4YIHA 1Z7WA 3IPLA 4RJKA 1W36B 1M1ZA 3Q3IA 1XJWA 3BD9A 2HTEA 4GOJA 3GYGA 9ATCA 3F5SA 1ODKA 1KPGA 2XPCA 2XB8A 1P81A 3EGDA 4Z4GA 2XMZA 4RO0A 3HV2A 1QVZA 3ORFA 1U31A 3W6OA 2FNAA 1UDAA 3D81A 4FYPA 4G8CA 3RS4A 3N74A 3UEOA 1IJBA 5E9WA 2UU9B 2GILA 1V6SA 2IZOA 3A1SA 3FGZA 3R0XA 4LISA 1I5OA 3WMXA 1EFHA 2OEPA 3O0TA 4DNQA 4R98A 2FW7A 3F7OA 3KKQA 1KP9A 4YXWA 1QU3A 4OHMA 5DTQA 1ZM4A 1N25A 4HDKA 3S8YA 2VJYA 4W7HA 4YAWA 1M8KA 3WAJA 1ZMBA 2WIFA 4MZDA 4AAYA 2FK8A 3ZBTA 1H2AS 4OQFA 3JQCA 4F3RA 3WADA 4Q9KA 2VAPA 2JKVA 1FE8A 4Y9RA 4D82A 3C98A 4PX3A 1DV1A 4ZQIA 3TX2A 1QP0A 5GWXA 1NAIA 1HMYA 4MJ3A 2OXTA 3M6XA 1M6WA 3O8RA 1VMDA 3ZZMA 3PUJA 1TJPB 2WBLC 3QA3E 4XIJA 1JE1A 1GADO 4MW5A 4HYTA 5DHSA 1EK6A 1W19A 1V1MB 1CRWG 1PKEA 2XSZD 2H1HA 1F6WA 2BFCB 3PDIB 4ECEA 1U90A 2NT3A 1QIHA 3P32A 4D45A 4NE7A 2RGGA 4TSRA 1SD1A 1SY7A 1U0OC 3GG2A 4GGOA 5LIPA 3MRSA 2I33A 2I87A 4V0OA 3WMEA 2C0PA 1WCWA 3MBOA 3WLRA 1BWPA 4IX9A 5JAMA 1B8UA 2XA9A 3U7IA 4CM8B 3VXKA 3C5VA 1Y3CE 5CT4A 3Q9LA 2PIDA 4JGBA 5E1DA 5FFNA 4QU8A 3WZMA 4MS4A 4O3FA 2Q1WA 3T5CA 4KGDA 5KSPA 4HPXB 4DLLA 4D02A 4E08A 1AX9A 1PW7A 2F6RA 1WUIS 1DC4A 3KJIA 5FLEX 5GZ6A 1HYEA 1XVLA 2XUZA 3G0IA 2ZPUA 3KPYA 4JBGA 4N0MA 2Q2WA 4ATNA 1IAVA 2FFQA 3AIMA 4I1OA 3NWPA 3R3ZA 3ZZ1A 1VSUA 1N8NA 2AXPA 2AXQA 2UYOA 3IQGX 3QP9A 1U81A 3ADOA 2ZXEA 4GE3A 4N3GA 3WGOA 4AUKA 1XG5A 4LQCA 1GSOA 1NC1A 1QMPA 3OLXA 1B2LA 2PGDA 3IIJA 4Y2UA 1WMAA 3CR3C 2O8BA 1F6BA 3PLAE 2ZBPA 5FUQA 4XWGA 5JDIC 3OJLA 4MVJF 1I3CA 1E2MA 1TW3A 1ZJ5A 2XKBA 4UZFA 3ENKA 5G0SA 3TJMA 4B81A 4EF5A 5IVPA 1KDRA 1YE3A 1QSGA 2ZI7A 3LU1A 5D87A 1U3VA 3RODA 1J1IA 5DK4A 1MW9X 1DHTA 1YNOA 5HKLA 2RK4A 3KQPA 3PHLA 5JNSA 5L6MB 1JA1A 2CEAA 1IK4A 1AKRA 4P0PB 4HDSA 1OU0A 1TUBA 1FDOA 1G98A 1QTNA 3KJGA 4KNVA 3FUCA 5IABA 4P98A 4C6HA 3HNRA 3EDRA 1K8XB 3D4OA 2P5YA 1H05A 3VR4D 1E89A 3AOGA 1ISIA 2WIDA 4CU5A 3IQZA 5HIKA 3QTBA 3I5YA 3G82C 3BZUA 4ZFNA 2VNHA 4NBTA 3DOCA 3FYUA 1DTSA 2XE6A 4L8VA 2QXUA 4UVGA 2XQIA 3X1WA 1IJFA 5KTTA 4LJSA 1GQFA 5DKFA 3AG6A 4CMIA 1OAOC 1WQ1R 1JT2A 1LX7A 1QVWA 1P9OA 221PA 5CIWA 5EQJB 5AI0A 3ODGA 3G0BA 4ITRC 2X86A 3VDNB 5KKNB 1NJ6A 3IVCA 2PS9A 3UBMA 3LXMA 4HGNA 4Q7LA 5A3RA 2GBLC 2AV6A 5FBKA 1FBNA 1P9WA 3PJFA 3SGLA 4AN4A 2JI6A 3BGVA 4NL4H 3WK7A 1T9HA 1LRLA 1XN4A 1CFJA 3VGPA 3DBRA 1OASA 5KQLA 4NFLA 2J4DA 1MA3A 4OY3A 1WSAA 2HHCA 2QM7A 3H17A 5KVSA 5I7EA 4AWXA 2QNRA 4FYYA 4L0QA 4MGIR 4QTXA 4QLBA 1HQDA 4FJ0A 1F0NA 4N7BA 4PZ9A 5IUNC 5B6PA 5AW1A 4AY6A 3QHAA 3DZIA 4W1RA 1VL8A 4LHVA 4EHFA 2CE7A 2XE7A 4JLNA 4PHFA 5EIBC 5ALGA 3MPOA 4RK5A 3EIXA 1CUZA 4RD4A 2I4OA 1IN6A 4R2XA 4OYHA 5FUXA 4ETWA 3M2TA 4BCBA 1OI7A 2VP3A 3GIWA 4IQ8A 4PANA 2VBFA 3L2OB 3LHDA 2WZQA 5HFJA 4K8RB 4H31A 2YRWA 4KWTA 5JDCA 5DZSA 5KNDD 2GN1A 5GV8A 4YHBA 1KFCB 5AHKA 3VR5A 4DADA 1DQSA 1UQRA 1VCHA 2H7XA 4IVRA 4C7XA 1ZL2A 3K9CA 4BPRA 1MHPA 1Z5ZA 2FEWB 3L92A 1AN0A 1E5XA 4JOSA 4XEHA 5B3JA 3CN9A 2HCTA 4KBYA 3L6RA 2H59A 2PGOA 1USGA 4JI6B 4JNCA 1TCCA 1I51A 2Q27A 2VTDA 3R4CA 5T8KA 4A03A 4B3DA 3DCYA 4CDMA 4QKQA 1JQKA 4YJDA 4LBWA 4F92B 2GPNA 5DX1A 5EWJB 4PSAA 4AP6A 3OIUA 1EQ2A 4TTRA 3WV4A 1WZ2A 1VTKA 3WNZA 3T1OA 3TE7A 5IANA 4DOMA 3VZCA 3QITA 1REQA 4RLQA 3FF4A 2V9CA 3EFOA 2OBLA 4RF5A 1DP4A 1D6NA 3EA0A 4YRMA 2OK8A 4L74A 4EB3A 4N1AA 1XKTA 2H1IA 2I78A 4TLLB 5CA1B 2FUG6 4X00A 1W1UA 3N5CA 4WW0A 3RTAA 1GYPA 4QA9A 3MB8A 3TW0A 3E8XA 4ARBA 1E2NA 5IVHA 2UVQA 1LWNA 3OPMA 2ZB7A 2XLCA 3PVCA 4X60A 3OE5A 1XLVA 1XHLA 1JA9A 1E32A 2AFHB 2VHEA 2NZ8A 1WLYA 2P1ZA 3EN0A 2RH9B 4XR9A 4IZIA 2JIRA 1O7JA 3FDIA 1BE0A 2QLNA 4HFJA 1L8XA 4UUPA 4C03A 1M5UA 3PUXA 2PRJA 4HWTA 2Y77A 3E05A 2CYBA 2G8NA 2QAGA 2B8NA 3AZQA 3EXEA 4ND3A 5IAGA 1QO7A 5CDFA 5B36A 2AJLI 2ILVA 2GR9A 4MRMA 4X1YB 5L95A 1V2GA 3BGIA 5LBIA 2DXIA 2R44A 3MA0A 1XV5A 2V4UA 3OZVA 5ELMA 3WA6A 2QUHA 2LV8A 4JZKA 2W6JA 3T7RA 1C1HA 3H9JA 3HI6A 1ADFA 3MD9A 5BQPA 1JLKA 3RKRA 4DSOA 3LDHA 1MB9A 2C1ZA 1DKQA 4LXIA 5F7OA 4WEOA 4CEJB 2X13A 2WB4A 1S1MA 1L4UA 3QFCA 4AZSA 2WYOA 4R6XA 3UTDA 3VX4A 1E9DA 4Z49A 3ROEA 1GR1A 1P5ZB 1THMA 1U2EA 3G2MA 3DDUA 2PVCA 4FGJA 4C88A 3ISTA 3I8XA 2K87A 2TYSB 2VJCA 2IKQA 3HYTA 1YZLA 3GFPA 4NXMB 4ZC8A 1DRWA 4YRPA 1LCIA 1CQJA 3KJZA 3KL2A 3EGDB 3NFYA 2QW0X 4X97A 1H2YA 4ADSG 4TMVA 4BLUA 3LYLA 3MIZA 2HD4A 3JX9A 3TEJA 4TSKA 3OJFA 1T3SA 3QV1A 1Z4OA 3G5AA 3ZV5A 2G0AA 1MX5A 5MGBA 4ASUA 1ZY2A 2JATA 1NDUA 3T0IA 1EUQA 1T4GA 3AEXA 2C9BA 1ML4A 2DH5A 3IP5A 3JWHA 1P9RA 1PG2A 2JK0A 3ZVMA 4OLBA 4BN5A 1TLTA 5KYYB 1CP3A 2JEOA 4RQTA 3KKOA 1BWSA 3HBNA 2VEOA 3QLJA 2PQ6A 1NW8A 4GKVA 4GT1A 3RS3A 4ZO4A 4LRWA 3A05A 3OKCA 1FVFA 3OFND 4Q9LA 1AURA 3PC3A 4GKAA 4UNQA 1HLGA 3FOFC 3D3WA 3NCHA 1A7AA 1T2DA 3DL4A 1V2HE 1KPHA 1SQFA 1XL1A 1KK1A 4BQQA 5CVJA 3AV3A 3V3TA 5KQMA 2FX2A 2PMWB 5DULA 5ALEA 2F2TA 2WUGA 3K3PA 2FPMA 4CM9D 1C8LA 4W1PA 4QT0A 1WDWB 2XXBA 3UWDA 1CCWA 2IDJA 4GDFA 2YS6A 2GK4A 3H9BA 2RHHA 1U7HA 1F2UB 3GQVA 5CDUA 4F85A 1Q19A 3U39A 4QDJA 3A70A 3P2IA 4GVXA 4I8DA 4TYQA 3TRHA 3A10A 1TT5B 2I6QA 4WA7A 1CVIA 2BELA 4LPSA 4XWTA 4ARAA 4EA8A 4ZVOA 4YV7A 3QK7A 4A1OA 4YLYA 7MDHA 2XUDA 3WLOA 3VU8A 5JQGB 4JR1A 4B31A 1Z5GA 2ZRMA 4EX6A 1ZESA 1U0NA 3QE3A 5F3RA 4EKYA 4O2AA 1E2JA 4ES6A 1O95D 4G0QA 2R00A 4XUCA 2Q4EA 2BKLA 2HCRA 5I9NA 4NQRA 1XP5A 3ASUA 4N0EA 4OREX 3EG9B 3FGPA 2YMLA 5U4QA 1JTFA 1I5EA 1JALA 1SIWA 1OE0A 3I9NA 3OU6A 4RZQA 4DWJA 4IIUA 3SS9X 2PBRA 3MB5A 5KO2A 3VKGA 4GLBA 3EGXA 2NVBA 2ZYSA 1Q7TA 4GZMA 3UAGA 4ZZ3A 2WG0A 1RAFA 2WJJA 4A8HA 3SICE 1OH6A 3F4LA 4A16A 1B74A 3USZA 4F3CA 4ZU6X 3NKFA 2Q45A 4ZO9A 3Q6MA 4B6OA 3I9OA 3G8YA 2V7XA 2QG9A 3QFSA 3EY4A 3UK1A 1TO1E 2ZIAA 4RZUA 1JG4A 4BASA 5HDQA 5M2QA 2BFFA 1TZCA 1NQTA 5IEBA 1E5DA 3NHAA 2VKQA 3P2YA 3GUHA 1ZUWA 4KN9S 4AJ4A 3ZLUA 1XRNA 3KCQA 4QGFA 1P91A 2A4MA 1IJEA 3V46A 4IUDS 3EF0A 1MJGM 4KFSA 4Y18A 5IX8A 1RFLA 2R97A 3CKLA 1TM7E 4RSRA 5GY7A 1S01A 2DKFA 1NVGA 4WXMA 2QN6A 2I6GA 3WK8A 1QPGA 1F5SA 4NBNA 4XD7D 3ZHTA 4RK1A 1J21A 4TVSA 3OQ6A 1KORA 2FWNA 5K03A 1A2OA 5B2ZA 2P35A 1BQ3A 5C5IA 1VLMA 3TAUA 2QTMA 4RCZA 3GLGE 1AKQA 5CAEB 1QFXA 3ZCPA 3PR2B 2W9XA 4MI6A 3KLMX 3VR2D 3ZHRA 4DLNA 1MABA 1BKSB 4F9FA 1KVTA 4M6WB 3JQDA 1W49A 2QT0A 4HWPA 4RGQA 5BY2A 1HYHA 2HJWA 3SQLA 1X7WA 1XTVA 1Z0SA 4MITA 4AP9A 4E88A 4U6NA 4REQA 5JVDF 5LD2C 3UYKA 5BMVF 3ROKA 1LH0A 1UKBA 3CNQS 3KOZA 3K94A 5BXYA 3GFTA 3PDWA 4M37A 4OLHA 5TT0A 5C1DA 1Z0KA 4J16A 1BA2A 3NTXA 2FPRA 3OE7A 5J63A 4HLQB 5C5EA 4NU6A 4D0SA 5K09A 2FFJA 2VZ9A 5MN6A 3BT7A 3SAJA 1KH1A 1AE1A 3K30A 5CLHA 1KSGA 1XKQA 5J4KA 2RONA 5AKIA 4FBLA 4P2BA 3NO4A 1ODSA 3EVZA 4KQ6A 5CXQA 1PR6A 2W98A 3LLMA 5J2UB 1OZ0A 2CVHA 3HXLA 4F5WA 2JFBA 1BVRA 4LOJA 3VSCA 4PFKA 3WRWA 3N7TA 2J5QA 3LUCA 4RD6A 3N39C 4BYGA 3CVYA 2P90A 3T5TA 4O5OA 4I4CA 4LCJA 4MS3B 5DN6D 2XQKA 4K1XA 4OM7A 4JOCA 2ZDHA 2R6JA 4HN4B 4BS9A 1UDWA 1EFCA 1FUKA 1NUTA 3H8WA 1L7DA 1N57A 3O38A 3PR3A 3QVGB 4OHWA 4QHSA 4ZGWA 1Z0DA 4K0RA 4L9SA 3U0BA 1F6DA 2C04A 3H2HA 4UBOA 4Z99A 3M4ZA 4EGCB 1XA0A 1U2GC 4WBNA 2RGEA 3JY6A 2KWIA 2FUKA 2QJWA 4LIPD 4RTQA 2QE6A 4B87A 5HF9A 1WSBA 4FDAA 2IEGA 3G0CA 1KI9A 4TV9F 1FFCA 1KZ9A 3MM4A 5ADVA 4AL4A 4PYJA 1EXDA 3DMTA 3IBSA 2IUTA 1RJ9A 2UYGA 3BJZA 3I9V1 4LZAA 2CUKA 2XWPA 4WKPA 4BYMA 3TG2A 1ORHA 4PPFA 1TRKA 4AROA 3T7SA 1TFRA 5HVNA 4X92A 1MX1A 1W75A 3IKMB 4JIGA 4Y7DA 5ESDA 5K0FA 4ERNA 5FR1A 5C8YA 5ITZA 3QQ5A 1FLDA 2ZRHA 5FORA 2AH5A 4MH0R 2NUAB 3ZCQA 1LPPA 3NHZA 2ZWIA 4L6AA 4N7MA 4U39A 1NXTA 1E66A 3WBJA 3ZE6A 4PN3A 1RLIA 3T99A 4M1TA 1SD5A 4UEWA 1GCIA 1MA0A 1P1BA 5EHQA 3UWKA 3SLRA 2WLSA 3OZXA 2Z9DA 1HH4A 3BMNB 3KQYA 4PC2A 5GP1A 5L3RA 1KOJA 1NUAA 1FXSA 2ODBA 2WKQA 3OX2A 3OZUA 5TLSA 3EVDA 3GLFB 1G9SA 5KJCA 1T0UA 2DY0A 4FTWA 3JZMA 2ZTSA 1VG0B 3C3YA 1G21E 3PJEA 1AKEA 4TMWA 1M7HA 3W7AA 4RXUA 1YR3A 3EASA 1WV1A 5KQSA 2OLEA 2HR1A 3IP1A 3NCTA 4E07A 1W94A 4HAZA 3KJQA 1DAEA 2PMFA 5HF6A 5TARA 3PE6A 4NYJR 3GZTB 1A4UA 3ZGYA 9LDBA 2PH1A 1EBFA 4QBHA 3KEFA 2OOSA 4BZZA 1V3TA 1D2EA 1J8VA 3DMPA 3PNQA 1X38A 3VOAA 4GMHA 1CUGA 1YMQA 1GAJA 3SZMA 1Y1SA 4W99A 2NU9B 1WHSB 4IOJA 3FOWA 3ORYA 1D04A 1NSYA 1E5LA 2J3LA 1KRWA 1RXVA 5AW4A 5CH8A 2B5OA 1ZIXA 2C83A 2P2LA 3KX2A 1P29A 2QW8A 4W9NA 5BWBA 4QRHA 3NEJA 4WDRA 3G3EA 2FMXA 2QE7A 3UIEA 1D6SA 4A0QA 4QIHA 4E4YA 4NXNB 2AFHE 5FLXA 3P9PA 2ZWAA 2AFIE 3MJCA 2QSYA 3CVWA 4LSGA 3WKEA 4C5BA 4DUGA 4NHEA 2BFWA 3UB4A 3TLEA 2OXCA 5CDSA 1OBCA 3A2NA 4UBLA 2D5IA 4XD2A 3VFDA 3VR6H 3PNVA 3FPAA 1RJGA 5LXTB 2VUSA 1T3LA 3IQDB 3N8KA 4B5LA 2JAPA 3AM3A 2Z95A 2WKRA 5EP3A 3L0BA 1DIOB 2GO1A 5L45A 4O0MA 4QNRA 5C1IA 3TLBA 3FSRA 1DRKA 3DFFA 4JT8A 4KXUA 5LA6B 3GGJA 1VGRA 3BXPA 3GROA 1G6HA 2JFPA 1NPTO 4RJIA 1RWVA 3FXAA 5K0EA 1JV2B 1PT7A 4Y9TA 1E59A 5FWYB 2BHNA 2G3YA 2VXCA 4EG3A 5KNDA 1KIFA 4KVGA 4S3MA 3WLJA 3WQBA 4AF6A 3TPZA 2B98A 5CLGA 3W06A 2J85A 1RJ9B 4KPFC 2ZS7A 5CX1A 2GD0A 4MS4B 2J32A 4OKNA 2VL7A 1ZN7A 4GPEA 2ZW9A 3VYUB 1Z45A 4UEOA 3WO0A 2JLRA 4MOWA 5HCIA 1ZBQA 2JGKA 1GNQA 1QZUA 5I7VA 3CM0A 2ZM5A 4HDNB 1WNTA 3NHJA 3DDNA 2RBGA 4FJ2A 4IEFB 4X8MA 1OJ7A 4ACAA 4BAGA 4L3OA 1B0AA 4DMHA 4Q01A 4A10A 4ZI7A 1V5WA 1Z6ZA 3KVVA 2GNAA 4NV0A 4DDMA 3GDHA 3LOPA 3C6MA 5JJBA 3H05A 4YJ3F 4IDFA 3E58A 2EW2A 2F62A 3DWGA 1R0BA 3EIUA 4BP9A 1IDOA 1QLJA 3RT1A 5AM3A 2RI0A 4QUJA 2D1SA 3P2MA 1MVNA 2GYVA 1OX4A 2ZBUA 4EZEA 3HU2A 1Q6YA 3IIIA 4YPFA 2X3FA 5KKAA 5ILOA 3EPLA 2Q7XA 4UQPA 3LJKA 1WMSA 2Y1OA 4IHQA 1QF9A 1H6AA 4XJSA 4CM4A 4CMJA 4OX9Y 4FE4A 3ICPA 3JRXA 3BL8A 3KCNA 2GHRA 3C85A 2DWCA 1PLKA 3W90A 2XUGA 5BW4A 1AK1A 1Z06A 4NULA 4FZ5A 3NALA 1KNXA 4TYMA 2WUVA 5FBRB 3B1WA 2GF9A 4NIMA 2ES4A 1TX4B 3CUYA 4EH1A 2WWXA 3QNWA 1PE0A 4RS3A 4GAEA 4YDRA 4CBVA 4LXUA 5I4BA 2QRPA 4WCVA 2BHTA 5IMBA 5J58A 3A6PC 4C04A 4D57A 5KJ1A 1TA9A 4HV4A 2BKAA 3P0EA 5BR7A 1NJSA 3EODA 5CEFA 5JBNA 2OO5A 3U7RA 1JWAB 1RI5A 2IH5A 1LDEA 1IY9A 2PH7A 3N6RA 2Q5HA 5KTSA 3PRYA 5C18A 5JS7A 2WMNB 1NW4A 4FILA 2P9ZA 3HZRA 1PJ8A 1ZGHA 1XAIA 3KYBA 1PK8A 4J1TC 4P32A 1D03A 1NI4B 1TVEA 1HM5A 1FRZA 4OXYA 1J9ZA 3IV7A 3EC7A 1Q91A 1M66A 4B33A 4E2WA 1MEOA 2WTNA 1FTYA 3JR3A 2G9ZA 3PQCA 4P54A 5K6TA 3R5SA 2VDNB 2P0YA 4G0ZA 2OB2A 1ZA2A 4OFBA 2O19A 1FXWF 1UBLS 1QP7A 1S02A 1GR0A 5AH0A 1FMFA 2RCNA 1OD6A 1POXA 4XJVA 4FXOA 1TECE 2GBPA 2HM7A 3BFJA 4O4IF 4ROTA 3RSHA 3KTOA 3TDKA 4BQRA 1NVDA 3CUWA 4IHJB 4MV7A 5L4NA 5C7IO 1QAOA 2ZWPA 4ODIA 1BA3A 3ADPA 3VJLA 1OCEA 2ZUDA 1Z4IA 3O7WA 2QRVB 4Y2TA 5EJFA 4QDOA 2OYRA 4MQMA 4JAVC 1GUZA 3G85A 3OCXA 4LDNA 3KUXA 1HZZA 5LU9A 3N75A 4OOEA 2XB9A 3I45A 1XZBA 4G0XA 1KAMA 2VLBA 3HYCA 2W2KA 3COVA 2ATCA 2ZRGA 1I0IA 2XT9A 3VU1A 4Z4EA 5HCNA 4MGKR 5DM1A 4AKSA 3UCEA 3DOOA 3HGTA 3LRPA 4RZIA 3WHIA 4BX8A 2CNWA 3IT0A 4LDRA 2OM2A 3NWEA 4YR9A 1X1RA 1QHYA 4LNUA 1CUSA 3EEIA 1NQAO 4HDAA 4LEIA 3DUWA 5FWAA 3S2YA 5CLJA 3C41J 4KZPA 3RSZA 1CJSA 4GNKA 1JZQA 2FPUA 4H6XA 1I1QB 4KLNA 3L7NA 4YDQA 3PI7A 2REQA 1TADA 4TTJA 4UCXA 1WP4A 3PDUA 5J2UF 4DKXA 1QHSA 4QT4A 9LDTA 4PLGA 1N8KA 5BN5B 3U3KA 1NZFA 1PX0A 4PINA 3N8HA 3UXHA 4B6PA 2XTJA 2XV1A 2EARA 3I1JA 5H9WA 1CEYA 2QN9A 1CF2O 3OQIA 3TAXA 2C98A 3ZBPA 1I6KA 2NV0A 5FFMA 5LXTF 4FQ7A 2HMTA 2G63A 1ICEA 1AGNA 4UNRA 2ESRA 3E3MA 3DP9A 4BQFA 2EYUA 1UWCA 1GNLA 4XD7A 4CTJA 4LQDA 3ZQ6A 2NPIA 3AI7A 4FR5A 3TMAA 3KR1A 4L3WA 4PN7A 3GH1A 5K01A 1A9ZA 3A36A 5FPPA 4LZJA 3UB2A 4ZVPA 4CEHB 4B2PA 2O8EB 4GM0A 1XMSA 3DO8A 4AZ3A 4URUR 1EVYA 4M22A 5CHEA 3R8FA 4LK2A 3DULA 3AR5A 1RE0A 1XRSB 5A4KA 2PUDA 2NPOA 1LTKA 5TDHA 3H9QA 3BIFA 3WGQA 5JSZA 1WEKA 1RRPA 2R6GA 4GI7A 1VLHA 4C4RA 5CA0F 1K6JA 1T4MA 4W5OA 4F97A 2B2CA 1PS8A 1M9NA 1W0KD 1P1CA 2OQ2A 521PA 3RK0A 5FI0B 3GXOA 3UTCA 4CKEB 1FJHA 1EX7A 4PHCA 2XKAA 3GELA 4CEJA 2O3JA 3ETNA 3ER8A 4YUYA 3MWYW 1L5RA 5EWMA 1LS1A 4CL2A 4MYHA 2QTFA 5KYWB 3GJZA 2G5GX 2RHOA 3CG4A 2F4VB 2ZIFA 4BO9A 3WV5A 5JD4A 4WFJA 2EQAA 1RMQA 3K8ZA 3W7BA 4TKUB 3R4VA 1DAPA 2CNKA 5A1JA 4OFZA 2ASVA 4I4IA 2E3JA 2KX7A 2PAAA 3FRHA 3W8FA 5DOVA 1ZVQA 1OA1A 1DEAA 2E82A 1W87A 1OV4A 4F2PA 5IBQA 4CF7A 3FHTA 1XZMA 4X8OA 2AMJA 3G2LA 1M6VB 1UJBA 2J3JA 2RKWA 2JL1A 4KZKA 3LC2O 5G3ZA 4EARA 5HNKA 2FRDC 3EFBA 5E8RA 2FPIA 2O7VA 2VXOA 4QOGA 5COAA 5AI9A 3NIGB 1OLUB 5LNK6 2MYNA 2ZVDA 3C5WP 3K05A 5IM5A 5L53A 4QUEA 1AXEA 1RLTA 1WOYA 2V98A 3PS9A 4KWIA 4M1EA 5E9QA 3KKMA 3EEYA 3LVRE 4G81A 1DPGA 2Z9BA 2X23A 4AUMA 4FFNA 2XVYA 4Z86A 4ZRMA 2RGUA 5J9FA 1T9GS 5JS2A 5KNCD 3ZK9A 4QYTA 5DMXA 3RWBA 2MHCA 3TW4A 3BX1A 1TL7C 3BRSA 1ZKDA 4HSEA 1NQVA 4POAA 4XWAA 1YD7A 3IXMA 4DM7A 2Q1SA 2F67A 4OQDA 4KYTA 4IUYA 4WBSA 1NT4A 2WF8A 3OPXA 1SB8A 3G5LA 3LPDA 4A36A 5B4VA 3TR6A 2AKYA 1OF1A 2BFEB 2O2JA 2BVNA 2OCXA 1E0KA 3VMMA 2JPDA 3LPMA 3WK5A 1IDN1 1QOZA 1R4NB 3I01A 4RDXA 2ZEJA 1XNJA 3WGIA 4RHFA 2HO4A 4LWOA 4S0ZA 3K09C 3OP4A 4DR6B 1HSOA 2YVAA 5DTIA 4UMFA 3B78A 3T4UA 2VT7A 4I9NA 5FYQA 1V6CA 3RT7A 3RFFA 4MVJH 4P3NA 4WCDA 4W63A 1TA4A 1K86A 1UXIA 1Y6FA 4MTLA 2V8BA 5J1TB 1GRCA 5B7GA 5A6SB 3RLIA 4FKBA 2XNHA 2C31A 5LQCA 4U3JA 3WYEA 3R0JA 4PSVA 3THWB 1OGIA 1WXQA 3RBZA 5MGNA 1T8PA 3TOCA 5LBTA 2XCUA 3RR2A 1EFRA 3WGVA 4CMEC 4ZCPA 1E94E 3CZ9A 3TDNA 3MS7A 1C8BA 1JB1A 5I9IA 1IHYA 5JS1A 3BIOA 3I2FA 1Y3BE 2P30A 3JATB 5K5EA 4EKGA 3EQ8A 5DCLA 2GZAA 3E84A 5CVTA 1BKYA 3EEFA 4DEXA 3WB9A 4BJHB 4HLNA 4RCYA 1AJEA 4JJGA 4P22A 2QM0A 3OLQA 3BZBA 5C3UA 5KNLA 5AT1A 1I3OA 4R9RA 4PC7A 3EXHA 2NACA 1G18A 4MEBA 3ZY4A 4BX9A 5EWMB 3ILYA 2YY6A 4LECA 2AYZA 5DDIP 1HK7A 1OWOA 2DPLA 2RIPA 3AUSA 3U9SA 4ALJA 3U2QA 3BDIA 4OYYA 1PT5A 1JI3A 1YZHA 4QELA 2EJUA 2XOKA 4IJQA 4RLFA 3LMKA 3OQNA 2PXXA