4RA9A

Crystal structure of conjoint pyrococcus furiosus l-asparaginase with citrate
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
182
structure length
182
Chain Sequence
b'MKILLIGMGGTIASVKGENGYEASLSVKEVLDIAGIKDCEDCDFLDLKNVDSTLIQPEDWVDLAETLYKNVKKYDGIIVTHGTDTLAYTSSMISFMLRNPPIPIVFTGSMIPATEENSDAPLNLQTAIKFATSGIRGVYVAFNGKVMLGVRTSKVRTMSRDAFESINYPIIAELRGEDLVVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-asparaginase
publication title Structural and functional insights into an archaeal L-asparaginase obtained through the linker-less assembly of constituent domains
doi rcsb
source organism Pyrococcus furiosus dsm 3638
molecule tags Hydrolase
total genus 58
structure length 182
sequence length 182
ec nomenclature ec 3.5.1.1: Asparaginase.
pdb deposition date 2014-09-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold L-asparaginase, N-terminal domain 4ra9A00
1DJPA 1HO3A 1AGXA 2HIMA 2WLTA 3ECAA 4R8LA 1DJOA 5I3ZA 5I48A 4R8KA 2D6FA 1WLSA 4RA9A 5F52A 5K4GA 1ZCFA 1JSRA 1O7JA 1JSLA 2WT4A 5DNCA 1WSAA 2HLNA 5DNDA 1HFKA 5K3OA 1HFWA 5K45A 4ECAA 3PGA1 1IHDA 1HG0A 2JK0A 5HW0A 1NNSA 1HFJA 1ZQ1A 2OCDA 3NXKA 5CBPA 2GVNA 5DNEA 1HG1A 3NTXA 4PGAA 1JAZA 5I4BA 1JJAA 1WNFA 4Q0MA 4RA6A 2P2DA 2P2NA 4NJEA 5K4HA
chains in the Genus database with same CATH superfamily
3AIOA 4UOEA 4LF9B 1BQEA 2BOVA 2BN4A 3NBXX 3RW9A 3OFND 3RSHA 1NHWA 5L3VA 1K0FA 3BL8A 1Y34E 2HNAA 2BAGA 3DHEA 2FPMA 2MHCA 5A3SA 3TLMA 4YCDA 3UT0A 1OXUA 2FZ5A 2LDBA 1MZPA 3BFXA 2OO7A 1QFMA 4P3OA 3GPCA 3Q11A 3AY3A 5FWNA 4WCFC 2FLWA 2A1TS 3GCDA 5BV1A 1W7AA 1T0UA 4MV3A 2H4XA 3BSSA 2NUAA 4Y7CA 1W96A 2P8JA 1HWYA 2DLCX 621PA 1OE0A 3COYA 3MMNA 1R6DA 3OPYA 2RGYA 5AOVA 4MJXA 5CP8A 1NKTA 2WWIA 1MENA 3H9BA 2ZTUA 3VPHA 3LKZA 1K7CA 4HLNA 2FPUA 2HYDA 5HIJA 3K0SA 3LECA 5BN5B 5FB3A 3WGJA 3PNYA 3S4YA 1TRHA 4NV1A 1RHQA 3C3JA 3G7SA 4GYWA 3UG6A 3RUDA 4ZCIA 3L7DA 4LE2A 2XCTB 3H84A 2IHUA 4DBVO 2JFZA 2M6SA 3KVOA 4ID3A 4NX2A 4BP3A 4E14A 2BFMA 4ARIA 4YCLA 3M4JA 3EEFA 1AC5A 4UHDA 1O7JA 1U1EA 2VVTA 3GVXA 3ESYA 1SUAA 2XNDA 3MBOA 4OQLA 1K3FA 3EZYA 4Y9RA 5CTAA 5D7BA 5FOVA 3UMJA 4FHFA 5FDFA 4JCCA 3GARA 2BM1A 3SHOA 3LHIA 1H3EA 1E6LA 1UAAA 1YSCA 4YRJA 1Z5UA 1REQB 4MUNA 3ACBA 4HWOA 4ZC1A 4J1SA 5IHPA 1K2VN 4BRZA 1IXYA 1X42A 4XDHA 2FHSA 4D57A 2R8PA 2NU9B 3S7TA 4N1AA 4F11A 3PF9A 3PXCX 1TCAA 2Z2XA 4CIAA 1Z0DA 3D3WB 3R3JA 3QX8A 1W1IA 4MVXA 1ZMBA 5E1BA 1Z22A 1SKYB 4ZFNA 4G81A 2YWFA 1ZCAA 1GGHA 1Q2XA 2J6HA 2RAVA 3MT0A 3V4OA 2J6IA 1N5DA 3GIDA 2BTQB 1F2UA 2A86A 2Q2QA 1GLVA 1BU8A 1JG1A 4JLVA 1O4VA 2MYTA 2IOYA 3CVJA 3GRAA 4FZVA 4JLDA 3WK9A 4ZO6A 3GD7A 5BY2A 2G06A 5KSYA 3ZHZA 4C4PA 4B4VA 1EEXB 5HQ3B 5A2GA 2DQ4A 3EJWA 3PUKA 4MPJA 4U1RA 4PZPA 3MB8A 2P6MA 4UW9A 3HCPA 2W22A 1QGUB 4EF4A 1HH4A 5I7OA 1XMVA 2HQRA 4M49A 4NMXB 4ZICA 3Q6MA 4UCWA 3R4VA 5CA0F 1DZIA 1ZXBA 4NJMA 2C5SA 1JIXA 3I6ZA 2RKOA 1A4IA 3ECSA 3FF4A 1GZ5A 2JI4A 3ZHTA 4TLCA 3O1IC 3ZTWA 4MCIA 4PNZA 2ZJYA 3OM9A 4FOOA 3BREA 5D3ZA 3IEMA 3ORRA 4IS3A 1M1YE 1N6OA 2P77A 2YV4A 2P2CA 1OHHD 3QKTA 4D97A 1GFSA 1KSGA 1E5QA 2ZBQA 3WADA 3ZGOA 1P60A 2QORA 4IDEA 3ORQA 2MCFA 1KERA 1XCJA 1YI8A 2OM2A 4K3UA 2B6HA 3ZCTA 5A6VA 2A6PA 2QG9A 3FCEA 5CMLA 5IKMA 3IAM1 1J2TA 2V7GA 3P2OA 3RS2A 4ECEA 1KEEA 3PJRA 3RU2A 1PJ2A 3UWSA 4XQGA 3PS9A 3MJCA 5ALPA 4CIWA 2BUAA 2LPMA 2OXRA 4OPMA 4GAEA 3UV6A 1LI5A 4YQYA 2IELA 3C3YA 4P34A 4QQNA 4R7TA 3TLYA 5H3LA 3UCEA 4D0SA 2Y77A 4R6WA 4QNMA 4KR7A 2H4JA 5ABPA 2FOIA 3JQEA 1JJFA 1XNGA 3JD3A 3PWZA 5NULA 4OMCA 3PEWA 3IBYA 4RPIA 2BJHA 1PO7A 4QO7A 2J6BA 1ADBA 3TI7A 4A8JA 1GCUA 3II6X 2ONJA 1WSBA 4JJ7A 4XRGA 1AB5A 2X14A 2ZBUA 3FYUA 2RHMA 4BJHB 3JPWA 1DRKA 2RGNC 4P4TA 1GG2A 2V65A 3K70D 1YKGA 3L0OA 2PO7A 1MAWA 4ZRDA 4CHTA 2JKYA 1VJTA 3LZDA 5CLFA 1PL6A 4JX9A 3ZHCA 1OV4A 1G60A 5K3FB 3SCZA 5LQUA 3VVBA 1RJEA 3RBVA 5U4XA 1JX6A 3O95A 1MC1A 2R66A 4JDUA 1GOTA 3HR7A 2BI8A 1R6TA 5TY0A 4DGSA 4KHZA 3CC8A 4OXRA 5K5EA 1ZCZA 2OLEA 3U4HA 4CYMA 2RH8A 2ZAYA 4KPUB 5TR9A 5C4MA 2HK6A 3JATB 3FUVA 5IZ4A 3U2QA 3CJTA 3R3WA 1DC6A 3U48A 1U31A 1XDDA 2CXUA 5ES3A 2DBRA 2PD3A 1VG9B 3CLTD 4L5JA 1U90A 3I72A 3ZU4A 4AP9A 4ZRNA 3KQUA 4OBBA 4PLVA 1EK1A 4KKVA 3H2KA 2L2QA 3PE6A 4GKJB 1NVVQ 2ZJ8A 3ZY2A 4BUZA 4YYZA 5FCDA 4BVKA 5MN5A 1WQ1R 5FA6A 3BWBA 4FE4A 1OJLA 4C01A 3HR8A 4ZRMA 4B76A 1X9HA 1ZCJA 3U4GA 2ADFA 3BIXA 1OGYA 3D0KA 3FD8A 1N5JA 2X0EA 3LA8A 1NV9A 1TPYA 2PKCA 3JR3A 5LQSA 3C3XA 2ASEA 5IWAB 4XEUA 5H59A 1Q21A 1SIBE 1DU4A 2WP8J 4ZT2A 2WIAA 1U94A 2QZJA 2I7XA 3M4XA 2F3PA 5JE8A 3GJ4A 4JVMA 4NNJA 5JNVA 3HCRA 1NATA 5K8TA 1PWYE 3TTWA 1MABB 4B5LA 2CSXA 1DG3A 5JSZB 1SU6A 1YJAA 4QTXA 3ZDEA 4ENPA 1J49A 5LXTF 2OV2A 2ZIGA 2I55A 4W5RA 2IYQA 4P2GA 2BV3A 1VJRA 3IVMA 4H15A 4AO8A 2GYVA 4UFPA 2FJUA 1YZHA 2P2LA 1FB5A 4I7EA 2BRUC 4IZHA 4J1TA 5CNKA 1AN9A 2CYCA 4RIHA 3P97A 5AKLA 4F1KA 1GRVA 3HZOA 5B1DA 3PT9A 4KXFB 3HWSA 3V1NA 2A5GA 3RQSA 3TAUA 3UK2A 5FJIA 3U5TA 4XYEA 2YW9A 4E2XA 5FPSA 4BCDA 1K86A 4LPSA 1N2BA 3VKWA 4Q3NA 4BTEA 1JXQA 4JR0A 3RIEA 5KOHA 1ZRMA 1YC5A 4A6DA 4NV3A 4D6XA 5HUJA 3WL8A 4FFVA 1KIAA 4OLBA 3K9GA 2BEKA 3QOFA 1O2DA 2QX6A 2ZIZA 4ZDKA 1J23A 2D1TA 3ZJ5A 2QVZX 3H87A 1H2HA 2Z57A 1SZCA 4EVQA 1MB2A 4AKEA 2KPOA 1QXSA 3OE5A 2AHRA 1E3TA 4J49A 2BMFA 2W4IA 1E1CA 1D2RA 2FUG6 2P9JA 4ZYTA 2C4MA 3GXOA 1L4HA 1MOPA 3GJTA 3UJ6A 2X4GA 3MQFA 4YRMA 3EVCA 4Y9TA 4BUCA 4MV6A 3PENA 2ZI9A 2C5BA 3F4LA 3FPFA 3I73A 3O90A 3AHJA 3CH4B 4NULA 3TO5A 1WUJS 5TXGA 1KYWA 4FFSA 2PFGA 4WSOA 1RIFA 4EHFA 5BQXA 1PTJC 4JYAB 5TEWA 3O4JA 1U1DA 5C8ZA 3C6KA 3KKMA 5EXSA 2QMOA 1KTVA 4L5YA 2P8SA 1FVFA 2EWWA 3QLVC 4TMVA 3DLAA 3EGCA 1N2CE 2CVOA 3BAZA 4YRPA 5BQOA 1BE0A 1PT6A 5ADHA 1GU0A 1RFGE 3CLUD 3EHEA 3MERA 1Q0LA 2C4HA 1OSNA 3FGPA 4RGQA 2ZI5A 2HIGA 4GP7A 4CUZA 1DLIA 3TQSA 5FO1A 3RLFA 3FA2A 1JEAA 1EFPB 2ORWA 2H1LA 4FGLA 1FUUA 2AJCA 1HK7A 2SICE 4QXPA 1D6JA 3D4NA 4FP9A 4GOKA 2YWDA 4ZYXA 1I3OA 3ZZ0A 2BF4A 4Z1MD 1Y8RB 2H5EA 3V3TA 4BVLA 2EDCA 5KTOA 3DWFA 3GJYA 3T5TA 5HS6A 5FBKA 5L7WA 2XMQA 3TGPA 5JSHA 3ZHBA 3Q0IA 4DA8A 4FI3C 3TLZA 2G76A 4WD3A 3THRA 1O9HA 1B0AA 1MB0A 2CKDA 2YIJA 3QVGB 2X0DA 5JXGA 2AN5A 2AOWA 4L8GA 4L6IA 2NPOA 3TFQA 3PC8A 4HGRA 1UBRS 3H2ZA 4KXUA 3R9KA 1ZD1A 2B37A 2WQ6A 4D3FA 3K0FA 1XIVA 1CEQA 2OILA 5CT6A 2XVZA 1WXFA 4BX0A 2E21A 1YAHA 1YQGA 4G65A 4LJSA 4OJYA 1UBNA 2AZ4A 2FR8C 2AOUA 4L27A 3RIYA 1HEUA 3AEQB 2ZXUA 4UC0A 4C3UA 4JSTA 1IPEA 1QCYA 2WMYA 4FEGA 4MUKA 2QV7A 3S55A 5A5EA 1UT6A 2NT3A 1JSCA 1UXOA 1W5EA 4J1NA 4KRYA 1YVRA 4W1QA 3MD9A 4Z0HO 4CM8B 4MDFA 3WYBA 1JA1A 4R9SA 4TS9A 1AGNA 1T6ZA 3WJ2A 4EL0A 5IT4A 3IAAA 5LQRA 2HEIA 1I7SB 4X62B 2Q6KA 1GSAA 5ECYA 1BXGB 4UVHA 2WSLA 3BMNB 4C2BA 2IEDA 2OC4A 4JFAA 1T26A 3A1UA 1HLGA 4ERXA 5FL7D 4L5CA 3IODA 2P2NA 4K40A 5EWJA 3C8UA 1PJ8A 1NX6A 1R5NA 4NOMA 2E4UA 3IP7A 1W85A 4QDOA 4QBGB 3NUQA 1CIPA 3CEPB 2QS9A 1EE9A 2E4ZA 3FJYA 3M6AA 4YVFA 5K0LA 3RSQA 4N01A 3A0RB 5HMMA 3T5CA 4YREA 3TRJA 4XYLA 2IZ1A 2ONKA 1NF2A 2G88A 1Y8AA 3JALB 4Y3UA 3RC3A 3T3IA 3EIUA 5SV2A 4DIEA 1N0IA 4HEA1 4D0GA 4NH0A 1FJXA 5LOVF 4ZV4A 1GAXA 5JMTA 1Y7LA 4TMXA 1CUJA 3I3SR 4YROA 3IKTA 2DJ5A 2GPNA 2DQSA 3C0KA 3OQIA 3QOYA 3FN4A 4MTCA 2GHTA 2QR3A 3T7RA 4F6RA 3LWNA 3SM3A 5C7IO 1ABBA 3QSYA 2Z2IA 2A14A 4L0QA 4XOUA 4Y67A 1F1BA 3LLMA 3BPSA 4UKDA 3WGMA 13PKA 1J07A 1U3CA 2P5SA 3GDFA 1FMLA 2IXFA 5L4LA 1EJ0A 1KK3A 4PGHA 4XM2A 1XQVA 2C58A 5JQGB 4B80A 1IAVA 4U7JA 1TEHA 3ZE7A 3VAYA 3AERA 3KLBA 1KIFA 1SQGA 1Y4UA 2G17A 4AMVA 3ZCSA 4BO0A 4QUEA 2UZAA 3HL0A 1M66A 2DTDA 1WG8A 3KEQA 4IFEA 1QJCA 1HBJA 2WF6A 4MQEA 3ETNA 3AV3A 1RRGA 4G9EA 3UJNA 1MPXA 1PQUA 1XYGA 3DUWA 3SKYA 2WJYA 5AI9A 4BN4A 2A3RA 4JI4B 1VJCA 3OJCA 2N42A 2NAFA 4LOKA 1LI7A 4BDSA 4MP8A 3RAEC 3S68A 4DUGD 4QJ5A 3SY8A 1R27A 2G5PA 2OZKA 4X6XA 3T1VA 3EAFA 2Q5EA 1HI9A 2WD7B 3ORSA 4PQGA 2AD5A 3FDIA 2IHJA 1EM8A 3G9UA 3LDHA 4RYLA 3K09A 4CQLB 3ROZA 5JAOA 3OX3A 1LC0A 3QELB 5BRJA 1IWPB 1NM5A 3BIOA 4K6CA 1FY2A 1YOBA 2ZB2A 3D1LA 1NDHA 3DE2X 2WR8A 2C61A 3OIGA 1L5SA 1NJ5A 4QRIA 4EA7A 3I42A 5TPZA 1X8XA 4ETMA 1HE5A 3IB6A 2ODEA 3N70A 4J4BA 4OBEA 3TD9A 5CA1B 3D31A 1F8YA 1JHOA 2HC9A 1XT6A 2DT5A 3CX8A 5YASA 5AVUA 3MK31 4Q18A 4FYYA 4OXNA 4YAWA 3GOHA 3W9YA 5IVIA 1XZJA 2IS2A 2D2VA 4OI0A 5T57A 2BKEA 2OD9A 2OYSA 3PNKA 5DF1A 2IIVA 2Z5VA 4UD2A 4JU9A 5AUNB 1VZ3A 3DMTA 1SHLA 2OORC 2RHDA 121PA 4GXQA 1JBQA 4Z2YA 2VWGA 2A84A 4PO1A 1YV9A 3F6CA 4LFCB 1IL0A 4AMGA 3RIXA 4B3DA 4XIYA 1RJGA 1PGOA 3CW2A 3P2JA 3PJGA 1JJIA 3R5SA 5IZCC 5JC8A 2MWMA 3V1UA 1SIOA 3DD1A 3IB3A 4NZPA 1OUMA 3AW9A 4NOKA 2PDAA 4EUHA 3WJ1A 5CJJA 4CCYA 1J99A 4X3PA 2EBFX 3NORA 4G0ZA 2AN3A 3PL5A 4UVEA 5BVGA 4NDZA 1PW7A 2E37A 3WGHA 5CVTA 2V4UA 3FNIA 3K6KA 1RABA 2V6IA 4R9UC 1V8ZA 3OOJA 3VOBA 3PICA 3NTOA 4DABA 2UXCB 2FSVA 3DOIA 2YHBA 4D25A 5TQJA 2RJNA 4EUEA 1Y4AE 4HDRA 5KYTA 1ZQ9A 1WMFA 4HN2A 3QKWA 2J5KA 4N8SA 3ONNA 4WADA 2C7VA 5CFQA 2CLOB 5EKTA 3CF4A 5D8DA 4UTXA 4CMEC 4JJEA 3DE1X 2XCQA 2ZTMA 5JFOA 5G02A 1HE4A 2QX9A 5MN4A 1UKEA 5FA5A 2XMPA 4G26A 4F46A 4JT4A 5ALSA 4LS3A 3T7JA 5BN3A 1E61A 5BNIA 3Q1KA 1MH9A 5HRCA 1VJ5A 2RHTA 4HUJA 1GZDA 2X19A 3DFZA 4R0MA 3DYBA 3DCNA 2GMWA 1IN4A 3FZYA 4X63A 1U7ZA 3SQWA 1B74A 1WUYA 3K8ZA 4E51A 3LUAA 4I1PA 3D0OA 1PT8A 1CJVC 2GJSA 2JCGA 3BBLA 4E5NA 1S2IA 3A1WA 4HEJA 5HILA 3KWMA 5T3YA 4ZO4A 4G36A 5GAJA 2HNBA 3IPAA 4YP5A 1ZFNA 2XB2A 1KAHA 2VSXA 2Y0BA 4NH4A 1VXRA 2I3ZA 4ZVPA 4WQMA 1JW9B 2ZUCA 3W5IA 1OYYA 3AX6A 1IBRA 2AR9A 3FGOA 3N0RA 4L1KA 1FA9A 4Q02A 4WKNA 2GXUA 2Z2JA 3PVCA 1YT5A 2Y92A 4GMKA 4HZGA 1U2ZA 4O0MA 1FFBA 1KY5A 3IP1A 4ZREA 1TLTA 1ZLXA 4FOLA 3BGSA 2EW8A 1P4RA 5TS3A 4H7HA 3USCS 2WVAA 3KUKA 4R01A 2QF7A 1MEJA 2MYPA 4GLFA 3K16A 4RF3A 3V80A 3JQFA 1K88A 2ZROA 3RC1A 1WHSB 1ZVKA 1I4TD 2DKOA 2PXHA 4I50B 3OQ6A 1DOAA 1VP3A 1BD3A 3AKCA 4R1MA 1JG2A 3K5IA 4ONEA 5BUQA 1HDXA 3WLEA 5LFAA 4QD3A 3E3AA 3H3JA 3LBHA 3V00A 1QBGA 1NC3A 4KAJA 4ISBA 1XTTA 4RAQA 4K0RA 4B4DA 2NO9A 1CCWA 2UVPA 3PYMA 1PZEA 5BUCA 2VPZA 2EJBA 2XGSA 3R6WA 2EU8A 4OIFA 3CKLA 1PVVA 2WSIA 1JR3D 1HDRA 2ERXA 2CMDA 2VEOA 3GLRA 3PPXA 3QWIA 4HUTA 5KQGA 5LP6A 1QIGA 1WZUA 2IYPA 4Z9FA 1BEZA 2XCLA 3UAZA 3R7DA 3U5ZB 2E55A 4GUDA 2HCBA 1ZH0A 2BISA 4XB6B 4QOIA 1MHPA 2HXGA 5T6MA 1U80A 2CYBA 2ZW9A 2PUBA 2JIMA 1GGEA 5H9WA 1R5OA 3P1JA 3DLHA 1ZMOA 2W2QA 2VYNA 2Q6TA 5EHIA 4F9EA 5E2BA 4PS1A 4XGQA 3L0ZA 3DVLA 1V9LA 3P0RA 5EZYA 1XEWX 1L7RA 1W88A 5DNUA 1XNQB 3EAQA 1H2ZA 4HAXA 4V0NA 5EXEA 3VJLA 5GZ3A 4FJ0A 3CTMA 4YJHB 4OFZA 3P2YA 4O1HA 3R77A 4RJIA 2MT9A 2BEVA 4UNPA 4S05A 3E9NA 1CP2A 1SHJA 1MIOB 1CY1A 1NW6A 1WX1A 2HD4A 5CCDA 5B4VA 1Z75A 3RYHB 4GR5A 3EVFA 5ARCA 1Z62A 2V9CA 3T3MB 2COKA 3CRVA 1V45E 2Y2VA 5EUBA 2XWPA 3X1WA 4AYTA 2CFTA 4DSTA 4BFCA 4WX2B 2GBPA 3V46A 3OTOB 4TQGA 1E5LA 5TARA 5F2NA 4LI3X 4JIMA 2PS1A 2FQYA 2W0SA 3TSAA 4AJJA 1P17A 2RGWA 3QJGA 1I94B 5BYKA 4NY1A 2LW7A 1RYFA 3T3EA 4LVNA 3GLKA 4RZ3A 5AJZA 3AF2A 2XW6A 1CEEA 4GF5A 3KOZA 4M38A 2WWVD 2CK3A 3ADKA 1S8FA 1X13A 3Q7EA 5FNVF 2EJVA 2G08A 3IQFA 3JWPA 4KXYA 5LWQA 3UWOA 1T9DA 2WU3A 1N77A 1JDSA 1X7DA 2PQMA 3AU9A 4HQFA 4S1WA 4ZI7F 3BERA 2DHQA 3IR7A 4KI0A 4HNTA 3AVUA 1XJQA 1VYUA 1XUOA 3DMHA 5DK4A 2HUNA 5BN5A 5CB4F 1SVLA 5AI8A 2V45A 3F90A 1QQAA 4F85A 4UHEA 1ADCA 4QIHA 3SAJA 4TQUS 3UAGA 5T8KA 1ZMXA 4HRYA 3FNHA 4IX1A 4YT8A 5IVPA 4PCAA 1WJGA 1XLVA 1UJ4A 3OTIA 1W73A 4A0GA 5FOTA 2QQFA 3P9IA 2ODNA 3QVVA 1IEQA 1REQA 2EKQA 1N92A 3G1WA 1FP2A 4RPHA 4P80A 2R6ZA 3PQDA 3BCHA 3GT0A 2NU9A 4KQ9A 3VSEA 1PV2A 3UK1A 2JFXA 1FZTA 4Z4IA 3PNSA 4H4DA 1CV2A 4DMHA 4OHCA 3WLSA 1G3IA 1U04A 2Y6UA 3O8NA 4CL2A 1AQ6A 2Q5OA 2QTAA 3D3WA 2FFAA 2XV1A 4W7HA 2CWWA 2X6QA 5DP1A 3T0IA 1MVOA 4ZTZB 3PNPA 3QVLA 3UMBA 5B57C 1CRWG 2ZTLA 1GT6A 2BTQA 2XEDA 4UHHA 1UFVA 1ESDA 1LWNA 2ZJFA 4BKMA 3S1SA 1I2BA 2PX0A 1VIMA 3ZDDA 4XFDA 3MWDB 5AFSA 1U7XA 1YHZA 5TF0A 5KWJA 4GOOD 5HQ3A 3B51X 3OCUA 4NYMQ 3WGTA 3MT8A 1CUHA 3U4AA 5A0TA 1SBTA 5IN5A 4KO4S 3UT5B 4B48A 2C4VA 2ZRCA 5L9AA 1AQIA 1O97D 1QGUA 3GF4A 3JV7A 2FP3A 2JLSA 3PDJA 3X44A 4L4XA 1YU9A 5H7XA 2RC6A 3PFIA 3VZPA 1LX7A 1NDQA 1O5IA 4UEOA 5CK4A 4MP6A 4QICA 5FTMA 3QEAZ 3HDGA 3CRNA 4GYYA 4ZGWA 4XWAA 3BK1A 2I4LA 5DN6D 4KDEA 4TQAA 3OJXA 4CMIB 4RL4A 4EW3A 4O2BB 2DKFA 2PUDA 3GAFA 2M1XA 1DCKA 1XTIA 3HKEB 1DRUA 4Q03A 3UM9A 5HJ5A 1G5TA 2CLLB 3KZCA 3TAHA 3ZCPA 2EEZA 2VR1A 1NL3A 3PJEA 2GUGA 3EN0A 2HK9A 3GA7A 2D74A 3UFXB 4AXBA 1SFRA 2FUG1 3QKRB 4AM8A 4LXGA 1PDVA 1RU3A 1SQ5A 4FXOA 3JYOA 2C03A 3KJFA 3TBHA 1JG4A 1PUXA 1H2BA 3LSYA 5CW2A 1T8RA 4R8KA 5DYIA 4KO8A 1U2EA 1SRRA 3WLHA 3IIEA 3PWSA 5C34B 5KNCA 1L6IA 1FSPA 4G0MA 3N5KA 1BFUA 3QFCA 4FWIB 5FUWA 2IHBA 3A4YA 3ORFA 2F9FA 1NBMD 4K03A 2ZJ0A 2WFLB 4LOIA 1JN0A 1I6WA 1NVEA 2Q3BA 4N3AA 4OGGA 3LCUA 1DIHA 3MQ2A 5TEVA 3MMSA 1NOIA 3QFHA 2XNHA 3VR4H 5FA8A 4LZZA 5CLQA 4Z9YA 1XTRA 2QM3A 3GIWA 4IFIA 2DBZA 1EESA 4IJVA 4QOJA 2XX3A 3B3QA 2A9VA 3BA6A 1PLKA 1CUZA 2J09A 3VI3B 4YMGA 1KJ9A 5JCZA 1PR2A 5IH3A 2GAIA 4BCCA 1BOOA 2O4UX 1L7AA 1C1HA 2ZSJA 4KFRA 1DAKA 2A5JA 3A9VA 3CSSA 4MRVA 4QTUB 1A9YA 3DOOA 2PUEA 3KWJA 1FMJA 4WKOA 5CG1A 3ITKA 2QIOA 3NBAA 4DHEA 1VJ1A 2QA5A 1SD5A 1VKJA 2OBYA 4PLGA 1H05A 5K3FA 3AB3A 4C0SA 4EB3A 3KEMA 4ZEVA 3THYB 4QNNA 4FW8A 4F0JA 4Q1AA 1AHPA 4CUKA 4MEJA 3ESBA 3IT0A 1JG7A 1XRJA 3CLSD 4CETA 5KREA 4KVZA 4B0PA 1K4MA 1Q1BA 3EUWA 3IXQA 1SRQA 4OHMA 3DVSX 3WKDA 3QU2A 4G4JA 3JQ8B 4ZVTA 3V4LA 4KPUA 5ADUS 1F60A 2O7QA 5IK2D 3M6XA 3JATA 4KV9A 4BUJA 3BEOA 4GMFA 4RZSA 2I8CA 1EFUA 4HRVA 5F64A 2SKEA 3S81A 1Z5VA 2D5BA 4LVCA 2NPIA 4IY1A 1CDDA 1RXWA 5D01A 2B83A 2R7NA 1IXKA 2AYXA 2ISQA 4E22A 2WQZA 4Y2QA 1TUBB 1Y6QA 2WPDA 3WAKA 1SVWA 3HU1A 2A0YA 4EJFA 3UJDA 1IXSB 3I05A 3GLIE 4DOMA 5DM0A 1K9VF 2QP4A 3WNQA 1DKOA 1N1GA 4TVBA 1YBMA 3TZQA 2Z98A 1AOXA 4HDQB 2ZBPA 1B6TA 2BZGA 3HDVA 5JUWA 2VJMB 1RLOA 1FIUA 1A77A 1MAAA 3OZRA 2PMCA 1VMIA 2WPNA 4JB8A 4YWJA 5A0FA 3EG9B 4XSGA 3SXUB 5GJCA 4EJ2A 1XMIA 2E5WA 2H5IA 3VYSB 3RSGA 1D4ZA 2R6CA 1YIAA 1MABA 3QYAA 1TJYA 3L04A 4BFTA 5J4KA 1I6MA 5JSZA 1W76A 3MGKA 2VNHA 4EFDA 4R3WA 4U4AA 5IVKA 1I6KA 2WBLC 3GRZA 3IDSA 1G7CA 4DWOA 4RTLA 2GLUA 4RNDB 4NCIA 3JAWB 2WAYA 2XCRB 1II0A 2XTNA 3PFKA 2C78A 1E5DA 4JLUA 4Q16A 4YAOA 5DOZA 3TOSA 3WWYA 2X6RA 3EQZA 4AROA 4CDGA 4L3VA 5JSKA 3O26A 4FHEA 2JA2A 4C43A 1M2OB 5JJIA 5BSFA 3UK0A 3GNQA 3GFQA 2QSZA 4J3JA 1XPUA 3PXUA 4DJ5X 1SHKA 5MHTA 5CDTA 2VA8A 2YWJA 4F93B 3AR2A 1B6RA 2JJ2A 5AM5A 1DAEA 2C0PA 4RDXA 5KYUB 5J2TB 2NP7A 1HOTA 1YONA 4PO3X 1KBZA 4BNTA 4DN6A 5HKAA 2H48A 4U5XA 1CVRA 3BWCA 4MWDA 4MRRA 4H1VA 1Y81A 3MOIA 4Q05A 5M3BA 5FI3A 2GZ3A 4KFUA 3TLCA 2C5LA 1RI2A 3Q2IA 1VYTA 1DC5A 4X3OA 3AWIA 2X76A 5C4GB 3A9CA 4HYQA 5JSQA 3WLPA 3O2SB 3Q3CA 3T61A 4INOA 4B81A 4L4ZA 1N2EA 2Q8NA 1AF7A 3TTTA 4KH0A 3U40A 3DXYA 5FPTA 3EWIA 1XMOB 4LYDA 2W9XA 1YDWA 6CHYA 4FDMA 3AFNA 4KQXA 4EKIA 1QTNA 1ODJA 7YASA 5JHGB 4MDYA 2FK8A 5ALOA 3DEIA 2MINB 3DZGA 3W2EA 4W9NA 3I45A 2AGVA 2NZUG 2WD8A 3SS8A 2H2DA 5EJAA 1U3UA 3FE2A 3OZ7A 2UUPA 3I1IA 2PNJA 1IVSA 2Q45A 4L4SA 2IVFA 4RM2A 3W7VA 3IP3A 1H9BA 4RQAA 4X60A 1YB2A 4AP5A 2I1QA 3WB1A 3G2QA 3R5FA 3OA0A 1U9YA 4PE5B 1Z6ZA 4RANA 3PNMA 5IAKA 3W9SA 2R79A 2NXWA 4L76A 4Q3OA 3SYNA 3L0PA 5CDSA 4WCFA 3AR3A 1EFPA 3SBDA 2R47A 2VTBA 4GC9A 1MNAA 1UK8A 1NLYA 3WXBA 4LKOA 1Y8RA 5E6RB 4YAGA 2XMZA 1SXJE 3E3OA 3CZAA 3CH5A 2VQDA 4Q6BA 4ZI2A 1H4VB 4ZIRB 1PL8A 2VP5A 4EENA 1U2SA 1V2HE 5FPPA 4R7ZA 1WB6A 1USUA 2BGRA 3EZLA 3H1EA 1Y1PA 3HZZA 3QVGA 2EP8A 3OECA 5IXYA 4WA8A 4WLUA 3USES 4YV1A 1A8IA 1Q1AA 2JIQA 2D7CA 3A9UA 1T0PA 3BXPA 4RU1A 4POAA 1ZVQA 3OQMA 4FMCB 3V8RA 4YCBA 4DIMA 4QNRA 1GCOA 3VHQA 5EE9A 3T5BA 2J3HA 3TR5A 4G23A 1P1BA 1N36B 1XZPA 1Z56C 1KQ3A 3AEQA 2UV8A 2PXCA 5KI6A 5K3BA 3B38A 5JALA 4YP7A 1KY2A 1UT5A 4N9WA 3DL4A 4ETNA 5EPEA 3WYNA 1XMJA 4CM8A 5KWVA 3WLTA 3SMVA 5JI3E 1EUDB 4E4YA 3JAKA 1GAQA 1FYXA 3UFBA 4QT0A 4H1WA 3LYLA 5I7FA 3V8QA 4MR9B 4KB5A 3JD4A 5EE1A 1BNCA 1BXGA 2EHJA 1YJXA 3BMNA 3W5CA 2RB4A 2D1SA 2VF7A 4DSUA 4K2AA 4RAOA 3LQRA 4I55B 1COWD 1T24A 3NDJA 4L0CA 4OSPA 3OLCX 3ZBUA 2TMYA 4G1BA 4F8YA 3FMGA 1Z5GA 4K9OA 3I2GA 5JJLA 5KHLB 3ZE8A 2QL9A 1EA7A 3H7IA 3JALA 2B1QA 1AK2A 1UFOA 3TSCA 1IQPA 1MJFA 2XKAA 3WP0A 2HMYB 3V7FA 4CMCA 3IBFA 2BZ0A 3V33A 5BYBA 4C0AC 1NKSA 2N0SA 1G18A 2G1JA 1TYBE 2H0RA 2GXQA 2IV3A 4C0WA 4LY6A 4MLZA 1XAGA 1DBSA 1NA5A 3O7MA 1IH8A 4MUEA 2DT8A 5B2EA 3TPCA 1XQ6A 4E3WA 2XYPA 5F1YA 4Q1FA 4GLOA 4BNIA 2FKAA 1XU7A 4IQ8A 1CZNA 3A6KA 1Z2OX 2JJMA 2QJRA 4TOIA 5TDHA 2R6AA 3G9XA 1V71A 3TW8B 5JQGA 2E5FA 2GD2A 2J9RA 3PVSA 2RK6A 3KFXA 3NXKA 4FCCA 3HJHA 4B2LA 4NXNB 1L3BA 1M10A 3P7MA 4AK9A 1KFCB 1NC1A 2CF6A 2YN2A 1WMDA 4D6YA 4YC7A 2XT0A 4FDAA 1HPLA 4FR5A 5JCXA 1AJEA 3EZGA 4IRXA 4ALJA 3CVXA 4EZIA 4QDUA 1ORRA 1ZVJA 2H17A 1N8NA 2JATA 5J58A 1PLLA 3KPWA 4WK0B 2FWNA 3N28A 2EF0A 4WGGA 5BN4B 5AD1A 1E2JA 4D4LA 1YR7A 3BOSA 3DLIA 2IXEA 3BB1A 2A9RA 4F7WA 3A06A 1T0IA 3HA5A 5G4KB 3V1MA 3GVPA 4A82A 4DIUA 3LS2A 2ZWPA 4EYQA 4EKYA 1ZK4A 2WD7A 1R4ZA 3JU3A 3ZOKA 4CQLA 1DS6A 3P52A 4OG2A 2RGNA 4XX1A 2PS3A 3QELA 4LDZA 2G09A 1C9YA 2DR0A 1ECBA 5DH9A 2WU4A 5ALXA 1VIVA 4MUGA 5KJFA 4C7XA 3SIXA 4XWKA 2NNWB 2Z6AA 1H0KA 1HO3A 1ZXLA 5KAPA 3PGVA 4B33A 1Y33E 1Q14A 4ADSG 3EG5A 2W2TA 1FNBA 5CA1A 5JS7A 2O2DA 1PS0A 4ITRC 4ZOAA 3N2IA 2JZCA 3QBVA 3WK5A 3WMEA 4DLVA 4RK6A 3X1JA 3EZXA 2ORYA 1CIVA 1KYYA 2WDPA 2XYGA 3L41A 8MHTA 4DLYA 2XSZA 5CHEA 4COKA 1HGXA 2JGNA 1M0TA 2AJTA 3SQNA 4WNAB 4OHVA 4Z86A 3FPSA 2B7CA 3VR0A 2VHQA 5KIAA 2ZUFA 4UHBA 4GU5A 4DB4A 3I9V6 4IHJB 1KK0A 3OI7A 4JCOA 2IRWA 2V7BA 1H85A 4M1KA 4MQ4A 5AI5A 5DTMA 4KQJA 4BNWA 1OI7A 1SXJC 4JP5A 5K8IA 3K1TA 3ENNA 4YJFB 1A5TA 4BO4A 1RZRD 3F3YA 1QX4A 2C3OA 4WUTA 3ND5A 3ZD9A 1O3YA 1ZCFA 4J0HA 5C18A 3C3WA 5DHRA 4CL8A 4XM1A 3RHTA 5JS8A 3ESCA 3LX5A 4K6FA 3VR3D 3ZWAA 3A05A 4OA8A 2I2XB 3FLMA 3Q2OA 2WHEA 1FFEA 1FUEA 3C7TA 5K05A 3MGBA 1UPTA 3HRHA 3RHZA 3QVJA 4KQCA 1B7GO 2OCPA 3WGYA 3DZKA 4XD7D 4D3SA 2Z8XA 4P32A 2IYWA 2VXYA 3P2EA 3ZHQA 2ZRLA 2G5TA 2UUBB 1WAMA 5TMDA 1JR2A 2BRUA 4JMLA 1MNQA 4RIIA 2PGAA 2VBFA 3A6ZA 4Q3KA 3LOQA 2VTVA 4NESA 1RXIA 3AOEC 4DAEA 1BWRA 2PH7A 3KCNA 4F04A 4P7JA 4PO9A 4RQBA 2NZ8A 1T3GA 1RNLA 4F6CA 1A4UA 2Z2ZA 2ESRA 4JC0A 1A5ZA 4JITA 2BHLA 4ZMSA 2I9PA 4RZIA 1JDVA 4Z4HA 1EBBA 1WDKA 1VCNA 1KQOA 2KBFA 5F23A 2C7RA 1E4EB 1F5NA 5IDVA 1U8CB 3ENVA 5TPWB 3CNHA 1A1VA 1IBCA 2QY6A 2EYUA 2JCYA 2Z1NA 4GVPA 1EDBA 1YZLA 4XIGS 5EUMA 1BXRB 5HJ7A 3RASA 2ZT7A 4RY9A 5IXSA 1ZGGA 4CEJB 1V25A 1YQ9A 3GG9A 3ZBTA 1KYVA 1XZNA 4HAIA 4FCTA 2YICA 4NCXA 1GG5A 3AY7A 3LO8A 3I34X 4BWFB 2BE7A 2YMPA 1H6AA 1E3LA 2E4VA 4PPFA 1RMQA 5ES4B 1G3RA 2Q5JA 1LSSA 1Y4SA 2PZBA 3A8TA 3HPRA 2RBEA 4PYKA 4R54A 2IX3A 1T0BA 5LLDA 1R0SA 1RHMA 2AW3A 2I76A 3FHLA 3HE3A 1FX0B 4HAVA 1W581 3HCAA 2ANBA 3OPMA 5CVEA 1CG6A 1WHSA 2A35A 2QN6A 2Y1LA 3ILHA 4I50A 2AMLA 3SOZA 3VR6A 5KTMA 1HETA 2I7VA 2IODA 2QVBA 4PBSA 4ED9A 3VVCA 5HG0A 3KAQA 1X94A 3QLVA 1QK4A 1Q84A 4LRXA 3C48A 3DMYA 3E2IA 4QOEA 4X66B 2HM7A 2J08A 1O89A 1QRTA 2ET6A 3M8KA 4MV1A 1AUVA 4U7HA 1K6IA 2OBMA 3IJPA 3KKZA 5CYPA 3RODA 3CA8A 3QV1A 4TMWA 5ALLA 1N4AA 1ZGBA 4ML3A 4CMJA 4PG8A 4IIDA 4EUNA 4Z4FA 2FLKA 3V8PA 4AICA 3NDBB 3DZ8A 2GBCA 3ZDAA 3GMDA 4ASUD 5HGXA 2Q7OE 2JGAA 1IUPA 3L1IA 2J3KA 2PH1A 1YS2X 3OZXA 3CVOA 1VG0B 3R0QA 5MN6A 4WKPA 2EFJA 4UDOA 2XQGA 1BWPA 4X41A 4C78A 1UOQA 4BQIA 1A95A 1WB9A 2QRQA 1C9DB 5T64A 1GADO 5J5VA 3K92A 1S01A 1WPGA 1HE3A 2GERA 3HYTA 3S40A 2PSHA 1QU2A 2ZOSA 3AVVA 4LI0A 1JF8A 3C70A 2FCRA 2QTRA 3HB4X 3R6TA 4I8IA 4IXMA 4OA5A 5K3CA 3PUJA 3QKSB 4BY9E 3KPUA 1DWPA 1PG0A 2FR8A 4M99A 3LVQE 3AFMA 4P4SB 4TSRA 4YJHA 3W77A 3DEKA 4LWOA 3CR7A 3LU1A 4B2IA 3HY3A 1MIOA 4C7VA 4INAA 2EXXA 4B8ZA 5FEUA 5JJBA 1J8VA 1AY0A 4U39A 3L0SA 1E9VA 4KX3A 2QVLA 3RYHA 1VSUA 2QROA 3EMDA 3LA6A 3B8EA 2ZKLA 5AHRA 3WL7A 5DXFA 4U8HA 4DSAA 2JAUA 1X74A 2BELA 4OHYA 4NE2A 3E9YA 3WNBA 1B6GA 1F06A 2A9QA 3L4SO 5HMLA 4PLWA 2F8TA 4Q5IA 1GTVA 5J1SB 4MV8A 3RFUA 1QKJA 3NPMA 2DSNA 3GLIB 5AM1A 3EASA 4JGBA 5JAHA 3VR1A 5CX1B 2ZDGA 1IHUA 2I6FA 5J1TB 5DB4A 1E5XA 1SCKA 1NXSA 2XUPA 3KPYA 1F38A 4L6AA 5ELXA 1XBTA 3QF7A 1OB5A 2IY7A 2WWTA 4A2CA 4PZZA 3TDNA 4YUWA 2YMLA 1NVVR 3K9QO 2POQX 3M6WA 3NT4A 2GPBA 3KJZA 4NF2A 3ZQ4A 4AJKA 1NXQA 1EBFA 1W1UA 3D7MA 5M5BA 2IYVA 1VSQA 4JLAA 3WZ2A 1KDVA 2P69A 5CTJA 1PD1A 3ICEA 4HLDA 3ABOB 2OAP1 3NHAA 3GV0A 3GFBA 3SLRA 1Y4ZA 5DNVA 2WHPB 1FJ2A 4CKBB 2EL7A 4C0XA 2DF8A 3IMFA 2HJWA 4PAWA 3LXUX 3QVXA 4KBYA 2FPGB 3O8BA 4N65A 1E98A 1ZNQO 1Z5NA 4LSWA 4FD3A 2HB6A 4MAAA 3TNYA 3VH4A 2AJBA 2XPCA 1K8RA 1YQDA 3Q4GA 3H5OA 3SS7X 3VUEA 1DAPA 4FEEA 1W52X 1G20E 3NJRA 4XYMA 3ZWQA 3PR3A 2W2LD 3VOAA 3EC1A 5CB0A 4LC9A 1BAPA 1FL9A 3PD7A 3JZMA 2R8XA 1YTUA 3LUJA 1YQTA 4BTVA 4YAUA 1V8PA 5C1PA 3FM9A 1UEIA 1E3MA 2DUWA 4Z9BA 3DVAB 1P6XA 2OBXA 1RPJA 3O3MB 1GGKA 2OAEA 4C88A 1DJOA 3UF0A 2JIRA 1QKKA 4ZDIA 5B7QA 1SQ6A 5EHXA 4FDVA 3W5HA 5EJIA 1ZN7A 4F4HA 4XIFA 2VA9A 1E63A 5C3UA 4YP9A 3T5GA 4DIDA 4V0ME 5EERA 1EJ6A 3DP9A 4N5MA 5DGDA 1Y4DE 3MWDA 5IG2A 2W98A 4X5OA 3ZU2A 2NV6A 2WZBA 3QUSA 3KQLA 4Q39A 3UBTA 4FZRA 5FPQA 1ZGZA 1YRLA 4MO9A 2PT7A 3KKEA 5ESWA 3UT5A 3SLKA 3RYFB 3UT6A 3TCXB 4AY2A 4UHKA 3STXA 1ARZA 2BLNA 2REQB 3ESRA 4AX4A 1E18A 3C41J 2O14A 3BTSA 2H9IA 1EE2A 1BE1A 1YI0A 2QGNA 2QUJA 3QUQA 5EJGA 2N9UA 3BZWA 3NDRA 5H4HA 3PA8A 1OXMA 4CMIA 1E1DA 1A5BB 1SCDA 1VMEA 1IZZA 4O2BA 1AG9A 2K7ZA 4JJFA 1XLTC 3HKEA 4M0DA 1Q1NA 1SG0A 3G0DA 3HBNA 4HZUB 3VX4A 3EA4A 2OORA 4GR4A 2AEJA 3RAGA 3N05A 3UFXA 3OPQA 4DLBA 4AJEA 2P41A 1AM4D 3QKRA 4DDMA 1TADA 5IZCA 5JH7B 2DMRA 3VPXA 2XT9A 3QVSA 1M8KA 4BP8A 1G8MA 3I6YA 4MVJE 3WRWA 1RAAA 1NWHA 3F3KA 3OU7A 5CUQA 3WGQA 4KEAA 2RB5A 1WXIA 2VUIB 4UASA 1QH8B 2IHVA 2ENUA 1QDEA 3CZMA 5CDFA 1AKUA 3ZYCA 4X97A 4CZ2A 5BSEA 3OFVA 3VXKA 4IEFB 1ZJYA 7ABPA 2FEOA 1FRNA 2P40A 2WFLA 2PLNA 1QHHB 3L4BC 1J0AA 3TL3A 3LQ1A 4YO8A 4F3CA 1V1RB 1JFLA 3BGIA 3KSDO 5F76A 5K4AA 2Q2WA 3ET5A 2VC2B 4UM5A 4CMEA 3DGEC 2GNAA 1CUDA 1IQ0A 2W4MA 1NWCA 1OTHA 1RFLA 2X86A 3AINA 4KRGA 1GQRA 4QUGA 1G9TA 1W19A 2IEZA 2QQGA 5ALFA 3VC3A 3QPWA 4KPGA 5MDHA 1EQ2A 1XTJA 3DZIA 5G53C 2B2NA 5HRUA 3D3EA 4HPXB 4YJKA 5IM5A 1YZQA 4XOIA 5GM2A 2CNDA 4IUCS 1ZN8A 4Q9DA 4YUZA 3HUTA 4RJ2A 4Y7DA 3THYA 2AX3A 3IVGA 3FCSB 5ED0A 3H5RA 5IARA 2H1RA 1P44A 3CF2A 4IIFA 1HLFA 2H18A 2AKYA 3AJDA 4PFKA 2HJHA 1VMAA 1QH1B 2FPIB 4IIGA 3MJFA 4MA5A 2PBZA 2OFPA 2ZEJA 2GJ8A 2VH2A 3JQ8A 3OUUA 3HLKA 4DUPA 2HRDA 1L1QA 1VRWA 4OQEA 4BU0A 4CIVA 4CGZA 3UBMA 2BCJQ 2GAOA 3KTFA 4JUDX 4P35A 1GQOA 5DK6A 1U0RA 5GIOE 3RYIB 1FTQA 4X6YA 4OHPA 5B1HA 4K2HA 3N8IA 2Y4NA 1JAYA 1GKYA 1QZUA 5EESA 1TUBA 3PFHA 2ZZMA 2FPRA 4DZRA 1GL3A 1ZM3A 3Q15C 2CLKB 2OZLB 4QBHA 1YRYE 4R2HA 4YPFA 4C4AA 2OMEA 4RMHA 4E30A 5IFLA 4Q7EA 1N1DA 4FB4A 1UKYA 2B5WA 2XODA 2HRZA 5FWYB 3UHFA 2ZJ5A 3EUEA 5LP6F 2B61A 4J2OA 4PWYA 4O3FA 1ZR4A 2KBEA 3HXKA 5FBWB 2VJMA 5CVJA 3TFOA 3CUWA 1PL7A 3UKJA 4FU0A 4BLRA 3EG9A 4OQDA 3FMIA 4JLMA 4O02B 4Y30A 3S99A 2FW6A 4EF6A 1K5PA 5BURA 2Y1KA 5M04A 4KLAA 3UZUA 1EXVA 3WGZA 4EHAA 4BATA 2F4NA 2GM9A 3K5WA 3VU1A 1A8PA 2CVFA 2ORED 2FPKA 2C4WA 2PL3A 2WTAA 5CK5A 5EUQB 5FIUA 3WQHA 1KOJA 4JUIA 1OF1A 5EZYF 2FPSA 3BIFA 3VTKA 4PU0A 4QUJA 3I52A 4KK3A 3TQHA 3M9WA 3IVCA 2VUUA 5AO9A 5LA6B 3WNVA 3GUVA 1Y6ZA 4WBXC 1QTQA 1BXZA 2VRBA 4AQ7A 1QO0D 2FFJA 4MUIA 5AP9A 4B74A 4D9NA 4EUSA 5BOSB 3L79A 1IYZA 4F38A 3E0XA 2NU7B 3G0GA 4BRUA 2CLEB 3LBYA 4H35A 5JFGA 1FVOA 1NFRA 1TUEA 4HN4B 4O4IB 4UEQA 5ETJA 3W6NA 1QP7A 4GC5A 1J4AA 5KYUA 1OY1A 1VBFA 3VHXB 3TKYA 5DO9A 5C5EA 5J2TA 4K6HA 2IEYA 1EB8A 3R41A 4RPJA 1ZUHA 5H4GA 2V3WA 3OQBA 4W5HA 1J2JA 5HW0A 2AQHA 1NI4B 4MUHA 4QJIA 4F9GA 1NVMB 2I2BA 1P5RA 3NAZA 4HVTA 2BL4A 3RU3A 4CIDA 4KGVA 4MVJM 4RGYA 1ZINA 2AC4A 4H6VA 3IOMA 5L3QB 4M1TA 1FCJA 3FAKA 1SUWA 4BFVA 3B6JA 4BNYA 2GKSA 4YIKA 1G8JA 1JECA 1TA0A 2RAPA 1BJTA 3B9QA 1UFKA 2QXUA 3R0ZA 4GXRA 1O8BA 1QVVA 3G79A 1KE2A 3GWGA 1GZ6A 4JXKA 3TBKA 6NULA 4FN5A 5K3DA 5JMOA 5KVVA 5LIRA 1RHUA 2JBAB 4B17A 4PXAA 2WWFA 2ZB4A 3K6SB 4MRNA 3HFJA 3DZFA 3N2GB 5HJ2A 3HUDA 3DE4X 3FRIA 4OP2A 4BO8A 2MINA 4XX0B 3A25A 4LNHA 4CTOA 4ZT3A 3IHKA 3R4CA 1L4BA 4WZ6A 2HSDA 3AM5A 1TE2A 3R76A 3BK2A 3U39A 3KTDA 4BZXA 4ZVMA 1OVGA 2K87A 2JFHA 4PGMA 1L7VC 5GJBA 2B92A 1GFWA 1D5WA 2F3TA 3KEOA 4X1YA 5EZ6B 1YUNA 4FBGA 4C7OB 1A88A 2J31A 2ZXFA 3BB3A 4P4UA 5ESRA 4CM9D 2QT1A 4TL6A 3ZDCA 4F7DA 1HRDA 1AKRA 2XOKD 4FFLA 3RM3A 4YCCA 1UPBA 5E6RA 1GSIA 2JLBA 2YVKA 3HJAA 4TM7A 5AKGA 1IQRA 4DXDA 3HXOA 2JEYA 4TTTS 4KU4A 1KEWA 1E9BA 4GX0A 4ZIRA 3T54A 4MYSA 3I9V1 2W6JD 1D1PA 4H6XA 2C96A 4RHCA 4XFJA 1L7NA 3EQ8A 3L1VA 4U2KA 5DBEX 5GVRA 4ALNA 2B36A 2Q6LA 5DMXA 5A9SB 1FQWA 3FFTA 1VJDA 1KO1A 1I6LA 1LV7A 4AJIA 4KZPA 1CQIB 1QV9A 1WNFA 1GZUA 2OSVA 5EIBD 2X77A 1NF9A 3AT1A 2J3EA 3K4HA 1GWNA 3F96A 4YFYA 4FR0A 1OLXB 4F96A 1DG1G 3KZMA 4DLPA 1YDEA 1NFQA 2J41A 3KJEA 1C8LA 1EP9A 1H3NA 3PXGA 2IL1A 1FFYA 4RPLA 1V4NA 2O2XA 1CS0B 4O29A 2EWMA 3H83A 4QPZA 1ZAYA 3EF1A 4G0VA 1V6AA 3OPVA 3C3CA 2V0CA 3DEHA 5IDWA 3KG2A 2ONZA 5EY5B 1VKNA 1QP4A 4DB2A 3IDQA 2A8YA 3C3AA 4BNZA 2WUFA 5P21A 1MGPA 3N76A 1BMDA 5BT9A 1TVKB 1E7SA 2D0DA 3AB8A 3GJ5A 1ENYA 1EUDA 2AWOA 3OP4A 3ZZMA 3L40A 1U11A 3SX4A 1V5EA 1XI2A 4N47A 1U6JA 1PQWA 2AH5A 5TGTA 5DZSA 2GAJA 2QYSA 4KR2A 4LKRA 3QHPA 4GPZA 1XZCA 2GEUA 4MR9A 4DC9A 2Y99A 4F6LA 4QTZA 2VRCA 4OGLA 1JE1A 3GEEA 1VIDA 1JFRA 3E7PA 1Z0ZA 1DFIA 4NXMB 1OTXA 1IOWA 1OXVA 4I55A 5LB2A 1BN6A 5LPNA 3RUPA 2XUFA 1A50B 8GPBA 1TM1E 3EEOA 1NMXA 4NMLA 3BEDA 5TC4A 4GO1A 3AETB 2YY5A 3F6PA 4ZA2A 2FPWA 2VH5R 2Z83A 2GN8A 3H2SA 4YP1A 1WXDA 1T3ZA 1RC0A 1XXHB 1BHO1 3AJ9A 1A97A 1E7WA 2NTNA 4HNUA 4BXOB 3H8VA 2C3MA 2CL6X 3HI6A 3UMGA 4DV0B 1G7SA 4FYXA 2IP1A 2NO6A 3SC2B 1N5OX 2C94A 1Z7WA 5E9QA 2L18A 3BXZA 4KNWA 2YCBA 3RRBA 4ARVA 1I0LA 6PFKA 3KDSE 4MW5A 5E3JA 2GEDA 2ADOA 2ZE6A 1OAOC 1QRRA 3DFUA 4TYQA 5KC9A 3TW8A 4IDBA 1KVRA 3NAQA 2CFCA 3LK6A 1LH0A 5JT1A 1RYMA 2A1IA 3IGFA 3MWGA 4MUFA 1P2TA 4M53A 5CGQB 4CEHB 4XCQA 1LVGA 4BO1A 4C0KA 3D7SA 2PR7A 4K9MA 2IS1A 2AV6A 2OWEA 1GV1A 1V47A 1YJCA 2POCA 3ONEA 4J0GA 1JB1A 2R1UA 1L5GB 4B6RA 4I1SA 2QP9X 1HDZA 5JJ5A 1DPFA 4YJ3B 3V8EA 4EG3A 3V3KA 1E58A 4HWGA 4JROA 1A72A 1L4UA 4AWXA 2QJFA 3D3QA 4HYTA 4B3TB 4RHYA 4H18A 3PDHA 1ST2A 3GLFA 2QUKA 2QW8A 2GM5A 4LRWA 1MDFA 3EZ7A 5EAIA 3RT9A 1CUIA 2B7BA 2WVGA 5BN4A 1EFLA 2H4YA 2A9PA 4BEWA 3KB6A 1UPFA 3RG2A 2ZS8A 3BH6A 5F35A 5G4KA 2X0RA 4E09A 2NZYA 3FXAA 3JQ6A 2EV9A 3CLTC 3LIPA 1MQ9A 1GZSA 1S3IA 3S2GA 2AFHE 1N6PA 4YJGB 3OP1A 3TEJA 4UHCA 2G71A 2R00C 4TV8B 1I3KA 4K8OA 1Z5ZA 4JUFA 2GR9A 3TOXA 5IS2A 3IKJA 4UM7A 1SURA 4Q7JB 3TJMA 5JTTA 1I14A 1VYHA 2R1ZA 3G49A 3G5MA 5JTUA 1YA8A 4XDYA 4RPGA 3U9LA 4KJXA 4DY6A 3CX6A 3PC3A 1J2UA 1B8NA 2IEGA 4ZVRA 3UPTA 1H9CA 3MUOA 1NUUA 3JQCA 1K8QA 1YRQA 1MB3A 2GQ0A 2I65A 2HU8A 5K0ZA 3GRPA 1QV6A 3DH0A 3GJ3A 1T8WA 2NYUA 2WJVA 3BRWD 4JOCA 4Q21A 4ZODA 3SFZA 2PKQP 3U7JA 3DAHA 3V7NA 3IYLW 4XB2A 1RW4A 1OH7A 2J3LA 1Y3CE 1SELA 2C7GA 3FI0A 5AW3A 1II9A 1SUCA 4HGPA 4BVGA 3BZBA 4IHJA 1GYPA 3C85A 3W78A 3VHRA 3BCUA 5AICA 2FEKA 4G5RA 4AUMA 2Q8QA 3L0CA 1NJ1A 3HYCA 3M81A 2IPLA 2H07A 1N7GA 3RV4A 3RIGA 1A9ZA 4YJFA 2JC3A 4ZYZA 5IC6A 1K89A 4GYJA 4PZYA 3NYIA 3IVAA 1P2UA 4G56A 3T1NA 1DO2A 3UJ8A 2X9VA 3KLOA 5CFMA 1OLUB 3OE7A 4FQ5A 1S4QA 3W1WA 3I8SA 1ENPA 1V96A 2DKNA 3M6UA 1U8YA 5JDCC 1JILA 1YDMA 4G5QA 4C4SA 1C7IA 1F6BA 4PYNA 4BNJA 1HMYA 2OO5A 2IDZA 4TSFD 4UBMA 4B7XA 4D8TA 3VPGA 1OIXA 1Z2DA 1G20B 1GQSA 3H1AA 3UUEA 4ABYA 3DEZA 4NU5A 4CT4B 4G2NA 5ADWA 1KDTA 4JQZA 1NOJA 2BGTA 4TZTA 1XZAA 4G5YA 1QIHA 1K1EA 1TJ5A 3ABSB 5JCJA 5KVSA 2PO5A 1R5JA 3W3ZB 2JPDA 3ILSA 2G25A 4ZPXA 1OI4A 1UQTA 1YGPA 5C53B 2I2CA 5AMXA 1RQLA 3KQMA 1AZTA 3IT2A 5KBYA 2VJLA 1N2SA 4WEQA 1AE1A 2A58A 4AZ0B 1G8KA 1K08A 2OV3A 2EGGA 2GK6A 2PGOA 3MJHA 4KFTA 3R8CA 3UAOA 1DZ3A 4ATNA 4JY7A 1ONNA 3AEKB 2IUEA 2NTYC 1KI7A 1JLLB 2PUCA 1WCYA 1ZH2A 4LXXA 3Q9NA 5BXQC 1E4EA 4IH9A 3P0HA 2PX5A 4O8CA 2QTZA 1NI5A 5TT0A 1IDN1 2AT1A 2C59A 2VQ6A 5TPWA 4AX8A 4MHTA 2C54A 4RTRA 1F0YA 3U3XA 2I33A 2XTZA 4JK3A 1BXRA 3VI4B 4MRSA 1I36A 1M7GA 3A26A 3G7UA 3CLUC 3NDIA 4MGKR 4CEJA 2E7ZA 3HDQA 2JLVA 2H7XA 4GMGA 4N82A 2XF2A 1WZIA 4D3DA 3NAGA 3GPDG 1AZLA 1MO2A 2V7UA 2WHXA 4KLNA 2WJ4A 1RR6A 2AWNA 4TKMA 2C7PA 5FUBA 3L1KA 4NYMR 2PGXA 3ZWBA 1SVKA 1O58A 5F7XA 2JD0A 2WM9B 4G24A 4ESEA 5EWLB 3IUPA 1EP3B 2A4MA 2E3JA 1FX0A 4M9XA 2IEAA 1A04A 3STWA 5KJ1A 3ETGA 5BYJA 3AHFA 3I01M 3Q85A 4RIGA 4DCNA 3RVMA 4O25A 2JCXA 4B3JA 5EQFA 4G4GA 3K2EA 1D6SA 2QU7A 2CD7A 4MWSA 3W8NA 4BBZA 3VNSA 1THGA 3F4BA 4AKTA 1KZ6A 4TWAA 2YZNA 2FMXA 3PQ6A 1R8SA 3PLAE 4A36A 3KXLA 1CUFA 4L3WA 2Y0DA 4MUJA 3FWNA 4EYEA 3ZJVA 1FDSA 1GFZA 3DHWC 2XA9A 1F5SA 3PKZA 4FYKA 1U7UA 3UAXA 2BYTA 3I2FA 3U62A 4EY4A 1Z0AA 1OKKA 2P9ZA 1ONSA 4OHXA 3VKVA 3PZBA 1TFUA 2IYZA 3ZWKA 3ICQB 1ONPA 1OZAA 4AO7A 4JBYA 1E64A 3Q98A 1VCIA 1UBGA 5BWOA 2JFBA 4IXDA 3MHTA 1XRPA 3K0CC 1ORDA 1ULZA 1Y9JA 3AUSA 3ZD8A 2PZAA 1DIGA 4JLJA 1KJZA 5DLDA 3U4IA 4Q9LA 5FLEX 1KS9A 1Q15A 2NUBA 5IHXA 4E94A 3L7BA 5AI0A 1A98A 3HB7A 4GI5A 1KKMA 2Y4OA 3QKSA 1RWNA 1NIJA 4I4LA 3NPAA 4JN6B 1NNUA 5IT5A 1OREA 4DR1B 1UK6A 3W8DA 4P4SA 2IYUA 2IW3A 1ABEA 5DWDA 3ZV3A 1U2RA 4D4KA 2NXJA 5BSHA 4I08A 5JSUA 2BSQA 1J1UA 1DKQA 3I1FA 1JHAA 1QV7A 3S8YA 1YD7A 4HTFB 4F4IA 2EKLA 1HX7A 2H1SA 1ECGA 1DJNA 2VJYA 4KRXA 4E0BA 1AZWA 4NKRA 4RZ2A 5C80A 5JPDA 3R0JA 4RSMA 4P9NA 1C30B 3HKDB 4I6EA 4MDEA 3GLIA 1JVBA 2QM7A 2OCDA 3RJZA 2IHZA 1LY1A 3TCKA 2QTGA 4K8RB 5JQGF 4WOBA 3SOPA 2EJWA 1TK3A 2UZ1B 5CX1A 2FVXA 1EAYA 1P7YA 3H9CA 4FHGA 1N3YA 4JJIA 4W1SA 1TK9A 2XQJA 1FW6A 1LZLA 2XJ9A 4H60A 4PZ9A 1ML4A 2G6BA 5JROA 4Z9AA 3NHLA 4ZEXA 1RACA 1J0XO 4BVFA 4CODB 5A4MS 1EHCA 3AMVA 1QFSA 1CJBA 3IXMA 5AKIA 4CKXA 2F8MA 2WT4A 1TMYA 1M5TA 4Y98A 3V42A 1GTG1 4C5AA 1F8GA 1JDJA 3O8OB 4X7BA 4C0BA 1ZHFA 4D56A 3EVAA 5K45A 3LH5A 2VSYA 1XWIA 1DO8A 1ZZEA 4H7JA 3RSLA 3RK1A 1IC6A 4G0PA 3COWA 1JR3E 2AR7A 3NC1C 4MV5A 2WHPA 4X45A 4L0DA 4CKBA 1SUPA 3J81A 3U56A 4FYMA 2PMFA 4B71A 3TZEA 3BWEA 3TIFA 2ODAA 1D2AA 2FPGA 1P0QA 1L7MA 1R0YA 3G0BA 1WMAA 1OU4A 4J07A 5DX1A 3VV3A 5AM2A 4NU6A 4MYCA 2PV0A 3ZWWA 4BGEA 4GKAA 2B8NA 5IMBA 4ZGBA 2W6IA 1I32A 2ZYIA 2R44A 2AL7A 1Z6TA 1XX6A 1XTUA 1AKYA 4LN1A 5BSTA 2GPYA 2GYWA 3R7BA 2CYAA 2OM6A 3ANMA 3B9BA 4AKSA 2EIXA 1DXYA 2FZGA 4MUAA 5KQLA 4A6EA 4DTCA 3TAXA 5HRAA 5CA1F 4UAGA 5A4AA 3Q5EA 2OHOA 2AQ8A 5FP0A 1SN7A 4L4YA 3GFTA 3DVAA 1UBKS 3D7NA 4F06A 2JJYA 3AIKA 2BR5A 3RVDA 2BMWA 4CKWB 4PF1A 1RLTA 5BVHB 1IHOA 4S1OA 2C2OA 2OZPA 3P4UA 3GROA 1EYZA 2X41A 1RMTA 3A6JA 4RULA 4I4TB 4HQKA 3CN7A 3AR9A 4CMGA 1ZJ6A 1RE1A 4PONA 1W5AA 5T4FA 2FB9A 3VBCA 1OC2A 1E5TA 4HAUA 2HLDA 1NMQA 1HE2A 3DOFA 3JD0A 4QOFA 3RHFA 2IDMA 3MB5A 1R9NA 2Q99A 2MTBA 3NXSA 4TUYB 1YB5A 3U1TA 1AQYA 1W0JA 3AF0A 1V7ZA 3OIDA 1JTVA 4FFWA 5ECWA 1QO7A 1CXZA 4PHGA 3TLXA 3HXLA 3OHMA 3QWAA 5AKJA 1E6EA 3GEHA 3RYFA 1C9NA 4BNLA 2AZDA 3FWKA 1QRSA 2WKPA 3VR2D 2REQA 1WDWB 1RCTE 1Y7TA 5H0IA 1J42A 2O54A 5BSWA 3WRYC 4EA8A 5B1YA 5IX8A 5F5LA 3DDNA 1GQFA 4QGFA 4RTOA 3FG9A 4UTVA 3DC7A 4QKQA 4PC2A 2GYUA 1VGQA 2FGKA 2FEMA 1O94C 4JMPA 5GP1A 5LSAA 4KXVA 1KIMA 2ZU0C 5JO9A 4HZUA 2HTEA 5BR4A 1AKEA 1YE3A 2GCGA 3K9HA 4GD3Q 2FQXA 1RXVA 2V9PA 4LNUB 3OFKA 1NXXA 2GEVA 4E07A 2OK8A 4A2WA 1D2NA 3FDXA 2V7QA 4Q4CA 2QSJA 4GOXA 5JH7A 1W4RA 3DC2A 4RHXA 4OKIA 3D2AA 4I5IA 3OY7A 5M7EA 5D86A 5DM2A 1SWWA 2PTHA 2IXGA 5KAMA 1IN1A 3JSAA 1Z3CA 4RGVA 3QMWA 1XU4A 5INTA 4QDKA 1HDGO 4XA8A 1QH8A 2HU2A 4IOKA 4BBPA 5IF3A 5DXJA 1V1JA 5TB5A 4ZHQB 1ACMA 2FEPA 3K6JA 4CFSA 1ESMA 2IYXA 1W2GA 2YWEA 1KS2A 1RHKA 2X0NA 1MC5A 3AI3A 4JJGA 2Y2UA 4J94A 3RF7A 1NVKA 3O8CA 1V1RA 2VJQA 4ZZIA 3AP2A 4X8HA 1KXZA 2EDAA 1B2LA 2HIMA 2P1DA 4N8EA 4BZQA 4RACA 2EKPA 3IIKA 2ZSDA 3HU5A 4X00A 4X8OA 1P29A 4EYKA 2IXTA 3UGJA 1RKXA 3ACDA 5BNZA 3DF9A 1YFJA 2HA6A 3KOXA 3KAKA 2OWDA 4YXWA 3V6LA 4CI9A 2YHUA 4LOJA 4G09A 2ZATA 1FFDA 2ZRFA 4QJBA 4YAEA 3AOEA 1ND6A 5DHFA 1DDGA 2JAXA 2C9OA 4E31A 3ZIAA 3DJYA 1QO9A 2GRAA 2C98A 2O2CA 4TXMA 2CXSA 2RARA 2GBLC 3OPXA 1QH1A 3I30X 2YIDA 3KVYA 1EH5A 1SG9A 3W04A 3FX2A 4OHRA 4I50F 1NW3A 4AY5A 4US2R 2ATEA 5K4HA 2GB4A 3IHLA 2GUWA 1ZPDA 1CZRA 1WDLA 5B3JC 2YHAA 1S8OA 1OAAA 5EEGA 3RYIA 1VECA 4HX5A 2ZGVA 4MP3A 4YRCA 1PV1A 3COVA 4OMFG 5C46F 2YHIB 2FEWB 2J87A 1LDEA 3PEUA 4FDTA 3WGVA 1YRWA 5I7RA 2OC9A 5LUAA 2OZLA 2ETVA 2JFFA 3V4ZA 1CNMA 3WDLA 5KTNA 5ISMA 3AGPA 4ZVLA 4NNPA 1PJZA 5AXBA 1WV0A 4EPXA 2I5PO 2O0HA 1LNSA 1BX0A 2DYKA 4WXHA 3ELUA 5FWYA 2C88A 4QC2A 2PVCA 4I1IA 3Q7PA 3NHZA 3V2GA 4E6EA 4P86A 2G8NA 1DHRA 3DBHB 4JB3A 5C37A 5F3WB 5KSZA 3D8UA 1FC0A 3G02A 5HDBB 3FHCB 4FI3F 4WT7A 2MSEB 5FORA 3ANTA 2FX5A 4UCFA 1TTPB 2PS9A 4M8KA 5DX0A 2R9VA 3WLFA 4DR6B 1K06A 3DTNA 5D00A 4BNVA 4PRZA 1UPXA 1G4UR 3IMGA 1QDUA 2D00A 3D4IA 4JYZA 1C1DB 2IYAA 4MKIA 1J06A 2Q5FA 1Z07A 2HSJA 3ILYA 1L1RA 1Q7BA 5L3SB 2HEGA 4FE3A 1C9JA 4OGKA 1SNYA 1Y3HA 2INGX 1VL2A 2YJ4A 2YZGA 4JODA 4L2IB 4PNPA 1OBHA 1TCVA 2PSEA 2FE1A 5LA6A 1JEQB 3EWAA 2XGOA 5E0KB 3E5MA 3AJRA 5BOSA 3ZY4A 2GD1O 4ZZ1A 3GPLA 3IDOA 4F5WA 1YL5A 4Z54A 1XPOA 2NU7A 2BFFB 5K8LA 2P9FA 4O4IA 2W37A 4Q1BA 4A9AA 1K8XB 2Y8EA 3MINB 4HXEB 3FYDA 5D6NA 4KGDA 4FFMA 3Q3IA 5AVTA 3VHXA 1DXQA 2ZQ5A 1KO7A 1TF7A 5EKDA 3RC9A 1SVSA 1OX5A 1QIJA 3SKVA 5IEBA 1NI4A 4QYMA 1ONBA 1UANA 2BHSA 3UWDA 2B8EA 3EIOA 4P92A 1SKBA 1L4MA 5J63A 2YQ4A 3DAPA 3M34A 4C4RA 5L3QA 5EL0A 1FLVA 2COEA 4WOJA 2Y1GA 1Y1RA 1J97A 1OVMA 3ZWMA 1PR5A 2C0CA 1BQ3A 3D6TB 1LD3A 4WA7A 4M8SA 4S0ZA 2CXXA 3ZGZA 4BOYA 5CM8B 1DE0A 2JBAA 3DVRX 3CO0S 2WT8A 2H59A 2ZBVA 4Z7JA 3K6SA 3N2GA 4DBLE 1XRLA 3KR9A 3AR6A 4XX0A 1GRNA 4MMYB 4Q3BA 4BO2A 2WF5A 3WIBA 3NIWA 4RSRA 5JNWA 5CB8A 1K7EB 1ZD9A 4PW0A 4RA6B 3I1JA 3HACA 1P74A 4IS2A 4RBNA 3NBYC 4XWGA 5BV7A 5HTOA 3CVVA 1MQ8B 3I39X 4FS8A 4U2EA 2O2IA 2WHQA 5FTLA 3AUUA 1V5FA 3AFOA 4OEHA 2H85A 4K28A 3AVOA 5THKA 2IDJA 3CV3A 5CXXA 2NNLD 3MS7A 1C9KA 1G6HA 3NBQA 3SBXA 4C7OA 3ZWXA 1V7CA 3I9JA 4MI9A 1UDWA 1RI4A 3BD8A 5DXAA 5AH0A 4ZVUA 5DTIA 1DBQA 2O2ZA 5C31A 5KWEA 4IAOA 3DO5A 1JBEA 4IHAA 1Z26A 2MMGA 3IUNA 1TYAE 4FW9A 4MCJA 1S2GA 3MT7A 3U44B 4UEKA 4N76A 1QGAA 2B8WA 3B1VA 4HDCA 2PZMA 4PZAA 4EHLA 1BO6A 1O95D 1NW9B 2WNSA 4OU4A 3WI7A 5HKOA 2C8KA 2Z4TA 1KI1A 3EEBA 3HJTA 1C7ZA 1SEVA 2FLVA 1EEHA 2HY7A 3LHKA 1GA1A 3E27A 4TKVB 3I9LA 1AV6A 2EZ4A 2PVSA 2QVYX 4NCNA 1CQIA 4HGYA 4XPZA 1HA3A 4LXHA 3U3DA 1BN7A 2L82A 2BUBA 1B41A 2R2GA 3BCSA 3VYUB 4V38A 4Y1RB 4AJPA 5A4JA 5KTTA 3HCOA 1KZ7B 4MQMA 2YVAA 3L3BA 5D1NA 3R3SA 1U3VA 1Q6YA 4LRUA 1IWBB 4A5OA 1CS0A 2ZYTX 5I7HA 3INYA 2YS7A 4Q0MA 3QYJA 5KNBD 1O97C 1T9ZA 3AP1A 3CUEF 2FSSA 1BQ4A 3QWBA 2GN9A 2OYCA 5B64A 5FX2A 4WBSA 1PG2A 1TVKA 2ZLBA 1BROA 1B43A 4KVAA 2VKTA 3RVSA 5C1DA 1Z0IA 3IDAA 2C2MA 1NVUQ 3HVIA 4O2BF 4B43A 3W6OA 1PX2A 2DUMA 3IKMB 5FLYA 2NQ2C 3RRNA 3WRXC 4MB0A 2P4SA 5I5EA 3J7AC 5IDYA 3VVLA 1I7LA 3QE9Y 3C15C 5F1OA 2HCRA 1KZ4A 4YCNA 1WD7A 1Z13A 2JFQA 4CIXA 3BRCA 2PH3A 1E3JA 3KYBA 3NASA 5JI2E 1OA0A 3QP9A 3GPIA 3AETA 4CEIB 2WJAA 4KYUA 3X2SA 2WJIA 4NQZA 2OV4A 3IO5A 4B7UA 4YMHA 2F59A 4MQFB 1NQVA 4N3NA 4NBKA 1Y1LA 1XXHA 3T5AA 1NVFA 2C9ZA 1J33A 3C7KA 1SHZA 3DV9A 4BXOA 2EX0A 2FFHA 3FMVA 3ONFA 3H0CA 4HDKB 1M0EA 1T2NA 1ZGCA 4E2YA 3ND8A 4JAVC 3CBGA 4K6GA 4PLHA 1RI1A 2X2PA 3SC2A 1WU8A 2TRSB 2W93A 4D8WA 4JP2A 2NOAA 3EX7C 2PU5A 3GT3A 3CUVA 3Q5GA 4EUFA 1LNQA 1WDTA 4BLQA 1GNPA 1E9CA 5JEEA 2HDWA 3OG9A 1QK3A 3D43A 1L5QA 4KREA 1UJ2A 3WLAA 2ZIWB 4CEHA 2QD5A 3VNQA 5D5PA 2FUCA 4H3HB 4IYJA 4HSEA 5EGSA 4UE3S 1S2LA 3SZLA 3HGQA 4W9MC 1JDPA 1SZDA 1FNMA 1VHWA 3KD3A 2ZPUA 4AIIA 3IKVA 4K0KB 2N1MA 3L7MA 4YJ3A 2FWBA 5L3RA 2Q4TA 5F12A 2FW1A 1X86B 5SZHB 4EFLA 5FR1A 3R3HA 2WNHA 3QG1A 5AUOB 3DB1A 3CLSC 3LF1A 2YRXA 3OOSA 2XMDA 1T9BA 1J24A 1D3AA 2FF5A 3HO8A 1Z6GA 4HWSA 3H2YA 3KV3O 1E1RD 2HQ1A 2PPVA 3L4BA 2IT1A 1R6BX 2B35A 1QQ7A 1RM0A 2G4LA 2PWPA 2C7QA 3HKCB 1TQ8A 1M34E 4O2AB 2XAUA 3A0UA 1LSOA 2P3OA 4ZAGA 3D3JA 2UXBB 3KP1A 3QU4A 2XZTA 1CY7A 4K9KA 3F1KA 2ZDQA 3M5DA 2P27A 2V74B 4IQFA 3ILVA 2ERYA 1P5ZB 1Z28A 4YJGA 2C97A 4LQDA 1C2YA 1ODCA 4TV8A 3X1YA 5CGZA 3L06A 4LQ4A 1VHQA 4CU5A 4B3GA 4UUOA 3A6EA 1XZGA 2QN2A 4H08A 3D1VA 4OREX 3KUCA 2OZVA 4D9MA 1TVMA 2HJVA 2XQVA 4MW0A 2G1AA 4PQYA 2WOOA 4LHSA 1K75A 4QOGA 5IXJA 2G04A 4BB0A 1RQNA 3CKMA 2RI1A 4CCSA 1MMFB 2AZTA 4CIBA 3DZHA 3BAFA 3DMDA 3N5CA 5JAPA 2DGDA 3K30A 3NRBA 4KMOA 4NAVA 2CMFA 1GYRA 2YOFA 4QPJC 3EC2A 2OXIA 1IY1A 4E5UA 3GRCA 2M6LA 3B6IA 4ZAYA 4BLOA 1M2KA 4F9FA 3JD2A 3NBUA 3FGNA 1CUYA 4MTLA 1ZITA 1PYGA 3NRJA 2VDVE 4EG5A 4YDRA 5TV2A 1EFVB 4LDAA 1EB9A 3ITNA 4LVUA 3SZ3A 4CKEA 4B4KA 2C77A 3H6GA 4RKQA 5DLYA 2R6DA 1XMPA 1FQOA 1FMTA 1GTRA 2VT3A 1WB5A 2WSMA 4OHWA 4ZU1X 1ZVVA 2QNIA 1OLUA 1XZQA 1KOFA 5TJHA 2ZUBA 5HIKA 1YBHA 3U7QB 1QG4A 2A9FA 2H7CA 2PT5A 4G0QA 3HY4A 1A3CA 4JOBA 4AG5A 4F1WA 2EJCA 5J2TF 1I9GA 3BQNB 1OYVA 1PN3A 1Q7GA 4JKIA 4FYPA 3AF3A 1UPAA 1F6DA 3GX1A 3EDQA 1IIRA 2DUJA 1DAFA 3EMVA 4AD8A 1G20A 2HIAA 3GEDA 4G84A 4EYSA 3L0IB 3ROFA 1ZS9A 4BAGA 2LGJA 1ZJ4A 3HVRA 3WKBA 5A2QA 2J7KA 2EFHB 3NT5A 3LQYA 4MPTA 1LB1B 3VAAA 1KO8A 2ZR0A 1AQUA 2JGKA 4DNFA 5C32A 4Y1FA 2JIBA 2EF1A 5KC8A 1RRKA 4WERA 1WWKA 1U0EA 1O1YA 3ETDA 3PJFA 1RJFA 2OHFA 3U7IA 1FSGA 4RMNA 2VPXA 4OMDA 4B84A 2ZJ4A 3ZLTA 2QRPA 1P7CA 4NFHA 4BLTA 2X15A 4FFPA 1GPBA 4JBGA 4WOCA 4D7AA 2DWCA 1HURA 4AZ0A 3K9CA 5G0UA 3W5JA 1VIAA 3PE4A 1EFAA 4R0VA 4D9EA 2WE7A 3MRXA 4M7OA 4E4TA 1ETHA 3AEKA 1PEAA 4LDJA 1T9HA 1JLLA 5JCOA 1E4YA 2YN0A 1CUWA 2VEDA 3DDSA 1ESZA 1GUZA 3MLAA 2BKXA 4M8LA 1NW8A 4WESB 1SM4A 4JD5A 3F2IA 3QFFA 1PG5A 2ECFA 1YL6A 4ZVSA 3U09A 1JKFA 1S6YA 4F3KA 3OFNA 3BUSA 4Z1OA 3DPSA 1E3DA 5EKSA 4R84A 5A3RA 4TPKA 1FUIA 2AMYA 2QAIA 2OCXA 4D9JA 1W8DA 3ZGYA 2QAGC 4HKTA 1T5HX 3PPVA 4Y2XA 4ZQEA 2GI4A 1USGA 4YH1A 2X13A 3UXMA 2AEFA 5B37A 4O59O 4QWWA 5B5SA 2FFRA 3CRW1 2GCOA 1NMEA 4I2VA 4YDSA 4EI9A 1XEAA 4BNFA 1JA0A 4UEJA 1MRSA 2QI9C 4IL5A 1C2TA 1J0CA 2AMFA 5EWLA 4IUYA 1UAGA 4IHKA 1USWA 3RTEA 4IRUB 3TL6A 3UKDA 2O1WA 3PHBE 3TB6A 4LHEA 1RT9A 2YJ3A 2DCUA 1E6CA 3LZCA 2WJGA 5CU7A 3UHPA 4YRNA 2PKXA 1J8FA 3KM0A 2AJLI 4MOWA 1TPZA 3SE7A 2NUTA 3VQTA 3ZXIA 2O8CB 2XR1A 1UBFA 3ETHA 2KLHA 3C3BA 3NETA 4FMCF 4MS4B 4OXYA 5GJVC 1KSHA 1XVUA 3EW9A 3AM3A 4CT0A 3L5OA 3G88A 3CIOA 4IR7A 4JQYA 5GV8A 3ND7A 5WRFA 2HSWA 3VJKA 1VBKA 4Y0NA 2CHUA 3FW1A 5GJWC 2X23A 2DHDA 2Q2NA 3CZRA 5FWDA 1O5OA 3AU8A 1YGYA 2W2KB 4R2WA 4N48A 2B78A 4YQEA 1JB9A 3JSXA 3JTMA 5MFZA 4YIHA 3FCYA 1UH5A 3L6RA 3IL2A 2P9GA 4H1HA 3KKKA 4S12A 3PUHA 4GX2A 2GEBA 4DADA 2CZGA 4YXWD 4Q3DA 3L7NA 4CKCB 4I55F 4M0UA 1DEOA 4R4JA 2RH5A 2V55B 2VAVA 3SZOA 1P31A 3OZBA 4M1MA 1U28C 1AUPA 4WFJA 5HCUA 2SNIE 3PQFA 3ROPA 1CUXA 5DI9A 4CQJA 2H4HA 2PRJA 3IX7A 1JGTA 2HHJA 4B1FA 2H2GA 3E5RA 4WH0A 2UU9B 3A4TA 2PA0A 1ISHA 2R1VB 4H7FA 5SYAA 4B9EA 1DEAA 1W4BA 2CB0A 3S28A 1IFXA 2ZYUX 2CY0A 2QL5A 3A4NA 3QU9A 1N8TA 1EJBA 1V7PC 1P2BA 2X4IA 4HK4A 4HTFA 1UP4A 4KW7A 4TWZA 1E6WA 2BSAA 3AB7A 5K1ZA 3V4RA 3U4QB 3C6XA 1VPLA 4QUIA 3GU3A 1YULA 4MPDA 4P5EA 3U81A 5ALHA 1TD1A 1G59A 2YVUA 3WJ7A 4P4GA 1C30A 1T8SA 1AUOA 3HKDA 1NT4A 3I0NA 3UC5A 2QR2A 3ANNA 3LD9A 3EXHB 3CJQA 2FG6C 1OHHA 2H11A 3IAS6 4F56A 2R60A 2UZ1A 2G9ZA 4P22A 5BQ3A 4BGIA 3AL0C 3GT4A 4V3CA 2QPAA 1QTIA 1ST3A 2YXDA 1NUAA 4CI0B 1FTNA 1FF9A 2WAXA 1V95A 4O63O 2I6GA 3FTDA 1EDOA 4V2UA 2YJNA 4WXRA 1OTYA 3DZJA 1VMKA 3RWBA 4JP8A 4BYMA 4EY3A 4YQFA 1UIMA 1SBZA 2QRGA 3FKSD 2ZYRA 3FRJA 4H2DA 3A4IA 1TUIA 4IZIA 4C6SA 2P0AA 2E6KA 2DX7A 1SQSA 1T5IA 2PUJA 3GRYA 3O8OA 4YQZA 4S1VA 3HY6A 3MGAA 3LDFA 2XQFA 1R6AA 3NHSA 4RVUA 1Z4NA 4BVEA 4OQQA 4DIFA 1JG6A 1MJGA 1Y6RA 1PL0A 2IY8A 4X93A 4BN0A 4XWTA 2JD2A 2Z3WA 4U3JB 3H65A 4FX2A 3I9OA 5TNXA 3NYRA 3KETA 5HKLA 2RGAA 1Z0FA 1Y80A 3FTPA 1J8QA 2O8BB 4EPWA 2TECE 1QZ3A 2RHGB 4JFRA 3EBLA 3KKPA 4F4JA 4DKJA 1M2NA 1FDOA 4HXFB 2WFZA 3PHJA 1U8AA 3BXHA 5CVCA 1LTQA 2V7XA 3Q72A 1PLJA 3SIRA 3UW3A 2IX9A 3GLVA 2TSYB 2NXEA 4JENA 4IO0A 1RKUA 4QYIA 2JGMA 1R9JA 2ADMA 1KBQA 4TGLA 2HWYA 3UOAB 1BCSB 1ZX1A 2W2OA 4J4HA 2H2IA 4DC1A 4B34A 4DZZA 5EHNA 1MF7A 3KJNA 2YNMD 3MRSA 2B1IA 3HWRA 1RZUA 3HBAA 4JXJA 3SP1A 4CKWA 1N5LA 1U2QA 1EXMA 5LQJA 3W3AD 5BVHA 2XMGA 2X9NA 4WKGA 5J5AA 4UQPA 1TJPB 4I4TA 2CD9A 3BF7A 4Q3AA 4W6ZA 5FBQB 1RCFA 4DV1B 4CM5A 4I9HA 4GOJA 1Q91A 3TLGB 1PHPA 2PUTA 3NEAA 2R00A 4OYLA 4OHOA 3LOUA 4QECA 4TUYA 3OZEA 2OGWA 2WMDA 1RM5A 3F6SA 2HJRA 3P94A 2QQ5A 1RWKA 2KQUA 3COPA 3FPAA 3WRVA 2AOXA 3PNBA 1N6LA 4CV2A 5ILOA 4HP8A 4R8LA 3OLVA 5TQVA 5EA2A 4LA4A 1X7ZB 3UJ7A 2B7LA 1AXGA 3VYTB 2DU8A 2X7XA 1JT9A 3NONA 3VPAA 2XIJA 5DNWA 2ZBRA 3HUEA 1VQ1A 4O33A 1TM2A 3VPSA 1A5SB 4LNUA 3IRVA 4U02A 3I4LA 3GOQA 4MS1B 3H5NA 2WTMA 1DJQA 1CYEA 4W6QA 4XZ3A 2I78A 1I3MA 4R6XA 3SFVA 2GKGA 1VSTA 3P2IA 5JAQA 3TH5A 5JNTA 3K0HA 3AEUB 4KQIA 1VZ2A 3KVRA 5KTYA 4E21A 1XL0A 2XXAB 4MV4A 3UICA 4ZZ2A 3STTA 3VH1A 3ZWVA 5LQMA 3GH1A 1R4NB 3FYTA 4JI5B 3ETJA 4IDDA 1BIFA 4MI6A 3JWEA 3R7FA 3RSFA 4QYWA 1KNQA 4ZHQA 5P8WA 2N75A 5JDCA 1D8AA 2AFIE 2UYOA 3QKIA 4MEAA 4JJ6A 1N9ZA 3SYLA 3SYRA 3W9UA 4CM1A 3L8MA 4AS1A 1UDBA 1WSWA 1Z9BA 2J4CA 3LXXA 3PB3A 4CM6A 2L0XA 4PG4A 4IIUA 3DV0B 4BDTA 1XKQA 3BTVA 4PFJA 1FQJA 1ZM9A 1BCRB 2P78A 2XZDA 3RREA 4BN5A 3OURA 1RJDA 5C81A 1YR8A 3WLRA 3C4QA 3KL2A 1FXWA 1G5IA 3E18A 3HN6A 4HGOA 4R05A 4D79A 4M9UA 4ZCRA 1NDUA 1OZFA 2CB9A 5CM2Z 3SG0A 1V35A 4HC4A 3LWDA 4CE6A 1MW9X 2FOXA 1P0MA 4Y6SA 3C5VA 2O50A 1YS4A 3LPDA 5I7VA 5BR8B 2VL7A 1NUTA 3CLKA 1L9KA 2ECOA 3GLTA 2O5RA 4TS3A 4TX1A 4FHZA 2WIJA 2JB9A 3JZAA 4I0WB 4BPBA 2I3GA 5EFZA 1CY6A 1XRRA 1O6CA 4ZC8A 2EFGA 3KB1A 3L05A 2WE8A 3B52X 4O4HB 5CXSA 2YW2A 3V8MA 4BTLA 1VFPA 2DFLA 3SJBA 4X64B 3HBLA 3RVJA 1T29A 2A9OA 3ABRB 1NP7A 1QNFA 5IC4A 4L15A 3RGGA 2O8FB 4B6OA 1O0CA 4YHHB 3G6WA 5EMJA