4RA9A

Crystal structure of conjoint pyrococcus furiosus l-asparaginase with citrate
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
182
structure length
182
Chain Sequence
MKILLIGMGGTIASVKGENGYEASLSVKEVLDIAGIKDCEDCDFLDLKNVDSTLIQPEDWVDLAETLYKNVKKYDGIIVTHGTDTLAYTSSMISFMLRNPPIPIVFTGSMIPATEENSDAPLNLQTAIKFATSGIRGVYVAFNGKVMLGVRTSKVRTMSRDAFESINYPIIAELRGEDLVVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional insights into an archaeal L-asparaginase obtained through the linker-less assembly of constituent domains
doi rcsb
source organism Pyrococcus furiosus dsm 3638
molecule tags Hydrolase
molecule keywords L-asparaginase
total genus 58
structure length 182
sequence length 182
ec nomenclature ec 3.5.1.1: Asparaginase.
pdb deposition date 2014-09-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold L-asparaginase, N-terminal domain 4ra9A00
1HO3A 2WT4A 5DNEA 5HW0A 5I4BA 5DNDA 3NXKA 5I48A 1JSRA 4RA9A 5K3OA 4RA6A 2P2DA 1JSLA 3NTXA 3ECAA 2OCDA 5K4GA 1ZQ1A 1WLSA 1O7JA 5CBPA 1HFKA 1JAZA 1DJOA 4NJEA 1ZCFA 1HG0A 2P2NA 4PGAA 1JJAA 5K45A 5K4HA 2D6FA 5I3ZA 3PGA1 1WSAA 2JK0A 1HFJA 2WLTA 1AGXA 1HG1A 4R8KA 2HLNA 1DJPA 5F52A 2GVNA 4Q0MA 1IHDA 1HFWA 1WNFA 4R8LA 4ECAA 5DNCA 2HIMA 1NNSA
chains in the Genus database with same CATH superfamily
3OOHA 4MDEA 1XZKA 1P18A 5FCDA 1LA2A 2Q8PA 1RNLA 1WU7A 4TN1A 3BT7A 1P4HA 2REOA 4D44A 1Q95A 3MCZA 1E8NA 1HE1C 1ESEA 1EXDA 4LK2A 4K6KA 1X2EA 4EEKA 2GXQA 1EX1A 2QTVA 4JT4A 1T1EA 1FPMA 3OPYI 3V4FA 4DMGA 2P4HX 5KREA 5KBYA 3QLVC 3TNDA 1GG9A 1B8PA 3LUHA 1ZI8A 5HJ7A 2WIGA 1V8FA 1SK8A 2A4MA 2ZWIA 3AJEA 4RJIA 5EXXA 2OCIA 3H87A 2C00A 4QYIB 1J8QA 2XDAA 3FYDA 5GIPE 1FSFA 4GUDA 3ZUPA 4LWZA 5K20A 4RH0A 4R8LA 3UYLA 2B4TO 2FP3A 3B70A 4JJ4A 1HQDA 4V0RA 1DTWA 5EAIA 1GUDA 4RD6A 4BMPB 5EJ5A 3GP8A 2OD2A 4NR0A 3QE4A 4Q7QA 1G60A 3HDTA 1ULTA 3OP4A 5BQPA 3KLOA 3GLIB 5G4LA 1M2EA 4RZ2A 4P83A 4MRMB 4YUVA 3FWPA 2R3SA 2BUAA 2YVQA 3SEQA 3SR4A 1BXGB 3FTNA 2Y2UA 4QT4A 4MR9A 4GLJA 5TR9A 421PA 3OJLA 3E9CA 4N47A 3HZRA 2OXEA 3DDHA 4XIIA 3WKCA 4N7MA 3WLFA 2WTNA 2AN4A 1M2FA 3C74A 2RHWA 3LKZA 1ZW1A 3R3JA 4KVZA 5BR1A 2ADFA 2W0SA 3V80A 4O0LA 2DHCA 4QE3A 4MW2A 2NO6A 4MMYB 5EYPB 2D3TA 2HA0A 3IUNA 2IHYA 4UXJA 2YJ5A 3FSGD 5BSRA 1QYRA 1V8ZA 3I05A 3GY0A 3GRVA 4IVPA 4PTLA 5DGIA 1M2VA 3VR6H 1R4ZA 1J2UA 2QD2A 3WC4A 2NT4A 2Y68A 1EVYA 4MUYA 2QKYA 2VJOA 3EXIB 3U4CA 5DASA 3C5EA 4D9BA 4QZVA 3H5NA 2QM0A 3LZCA 1IN1A 4EB6A 2ZIXA 1XZGA 2B83A 2C1XA 3WBKA 4F2HA 2L2QA 3GOHA 4BWGA 4NWIA 1RWWA 4FINA 5KI6A 2RGUA 3SI7A 3MGBA 2OO5C 1YR2A 2WF6A 1I6KA 2G04A 2P9ZA 4FR2A 4INJA 2KLHA 1QX4A 4TWIA 5AJHA 5H1YA 1GP2A 4ZDKA 5C8YB 1XTVA 1ATZA 3AW9A 4QUBA 5HOQA 1GAEO 4FMCF 2I4LA 4FFBB 4UJ5A 2GXUA 2B4AA 5REQA 4IKOA 2ZW9A 1ZIDA 1JG1A 1U0HC 3IEXA 4KAJA 3TW4A 3QF4A 4B43A 4MB0A 1YI0A 3OA2A 4DSOA 1JDBC 4RVUA 4TMFA 2HA2A 1V96A 2O2YA 4CODB 1E1YA 1XZAA 1JRLA 1XN4A 2QMYA 4EA9A 2B5WA 3O9ZA 4RLFA 4J3JA 1P5FA 1MPXA 2NPFA 2GUWA 1Y6FA 3N59A 1G1MA 5BUSA 1MO5A 3MWYW 4PSUA 4LF6B 3JCZA 5JQWA 1AMNA 1IEQA 3JSXA 4NMXB 4FU0A 3THWB 1IPFA 1Z4PX 2IYNA 4UMDA 5DU2A 3NWEA 3OG9A 5E0KB 1MDFA 1EUDA 4HVTA 4DYDA 4H77A 3HCEA 2RAPA 4HH3C 5FQNA 4DAOA 3HBJA 1F0KA 3P9YA 1CR6A 2AXEA 2KW5A 4XDZA 2PEYA 3PC2A 3VM6A 4MQFB 1PR6A 2EEZA 1EJBA 4TMXA 3QPWA 5EZYF 1DUSA 1X7WB 3TD2A 3V42A 5HQ3A 3KFVA 4JFAA 1NVDA 1NM5C 1ZRHA 2NO1A 1FBNA 4YQFA 1UEXC 2J32A 4Q34A 1DAPA 4QQKA 1AKMA 1UDBA 1H3NA 1VMIA 2C2HA 4WK0B 3AVOA 3BE5A 2UZ0A 1RC0A 3GQBA 1KK3A 2QZZA 4WZAE 5BUZA 5IN4A 1CW2B 2VYND 3VZPA 3ZK7A 2PIDA 5AIBA 5DK6A 3O1LA 4I99A 2QU8A 5FOWA 2I4NA 5HILA 1QH8B 1T8SA 4YJHB 1JFRA 1XPRA 5A4JA 1U4OA 3HSKA 4R84A 2Y1KA 2AK2A 2CE7A 3D8NA 1K06A 3R20A 4R9NA 4TZKA 4ZVQA 1GN8A 1II8A 2PIAA 3WMEA 1JL3A 1KIAA 3GZTB 5K0SA 2IHNA 3Q3CA 3V8VA 3SM9A 4ABYA 3GUVA 3K2BA 3TKLA 3PJRA 1E2QA 2Y67A 3BHJA 4LC9A 1NUHA 4U6NA 1OXMA 2X41A 4IHJA 3SC2B 3V2IA 1AMUA 2UUCB 5HIAA 4IF6A 1YC2A 4U7PB 3W06A 4JL8A 4X20A 3OCUA 3A06A 4QQRA 3V8RA 3IA2A 3W5UA 1NTOA 3ZDRA 2FEMA 3MWKA 1YUBA 4KQFA 3UUWA 4L5YA 3HA5A 3NHBA 4EABA 2MCFA 3Q3JB 1PQUA 2RGNA 3U5ZB 3KKKA 4ER3A 1NE7A 1BZYA 1M6HA 3UUGA 1V8PA 4N41A 3LPNA 3ZCSA 2QLNA 2ZJOA 3L0PA 3RC3A 1ZJZA 2PEZA 1L5WA 3HA7A 1GPKA 1JX6A 3O83A 4D8UA 5B55A 1GO2A 3E61A 3CO5A 1RIFA 2K7ZA 5KNDD 4NYJQ 1QOPB 3UHOA 2GEUA 1S01A 3DAPA 3LO5A 3BTUA 3LRTA 2BGJA 5FPKA 2OHFA 2XUGA 4N39A 2OXTA 3UFXA 4YCMA 4COKA 3JAKB 1GFZA 4MV4A 4KWEA 3ND7A 4CIDA 1ZMXA 3V4PB 4NK4A 3IBFA 3LX8A 4RWEA 4BPRA 3WRXC 4W4TA 1DAIA 4EL5A 1GUYA 5EP2A 3BFVA 1NVFA 3BRSA 3IP9A 4PGHA 5E1BA 4MUKA 5ADWA 1RABA 3U48A 3FCEA 1M73E 1KOJA 1CJCA 4O33A 4X1IB 4FLEA 2H4JA 4EUEA 1XYVA 2G82A 3LHIA 1YR7A 4KLAA 1SXJC 2GESA 3SBDA 4WZAB 2QJTA 3MB5A 3WLRA 3BWCA 1G5PA 2I5PO 5EHGA 3OFKA 1B8OA 3MTDA 3T3MB 1TZCA 3PZBA 2IS2A 1J7JA 1G5HA 1LC3A 3DFKA 2UU9B 3FAZA 4MQMA 6AT1A 2NO4A 3QPBA 4B0PA 3BYZA 4H3SA 5KTMA 4DMKA 1ZNWA 2OLEA 2ZPAA 3ZVKA 4R8VA 3UAZA 3KB6A 3TOCA 5JNSA 4Y2QA 1YQGA 3EGDB 4Q4LA 2QVBA 3ICPA 3EG9B 4MK4A 4WZ6A 3ZW8A 3UHPA 4LIPD 5ALRA 3WDMA 3RE1A 5LOVA 5K7SA 2Q46A 4GPEA 2XMQA 3B6ZA 4FE7A 5BVGB 2MT9A 4EFDA 2ZRPA 4AD8A 2IEGA 5JFTA 5KU1A 2RH4A 5JLAA 4N4AA 1ENZA 1SIWA 2FK7A 4B4DA 2DMRA 1NUUA 3PXCX 4Y6QA 2WAOA 3G0GA 4OHWA 2OGWA 5IT0A 4YREA 3RTBA 5AKLA 1W46A 3FFTA 4WECA 4D9CA 3CZ4A 1KI6B 1Y3AA 5LKAA 2GT1A 2AHRA 4DCNA 1EAMA 6ADHA 4IZOA 4WLEA 4R05A 5LZ7A 3AJAA 4CM6A 1HH4A 1ORDA 3OZCA 2RG1A 2HK6A 1W0JA 3EULA 4I46A 5HMMA 2PK3A 3OJCA 1L5FA 3AR2A 2HLPA 2VJMB 1QVZA 5K3FA 3RYIA 4LMRA 4LJSA 1AKVA 2IL1A 4KQEA 3AHCA 2AFVA 3OU7A 4PZAA 3N39C 4J76A 3ZNPA 4D4GA 5HIJA 2FFHA 5K0EA 2BFWA 4LGMA 3ZD6A 2A84A 3T0GA 3HWX1 3GJTA 5AW3A 2C5FA 2O59A 1E1QA 2BHTA 3IQZA 5KYWB 4YQYA 2X0IA 4UREA 1YGYA 2JK1A 3O3CA 2IYAA 3NEYA 4L8LA 2BKVA 4R1TA 3OWXA 4TTJA 3DA8A 4UM9B 5CB0A 5FDFA 1TIBA 3RTCA 1UK8A 2EF0A 2ZWMA 3GFPA 2FNAA 4FSDA 2WTUA 2FQWA 2Z8YM 4MQ5A 5FPHA 2D4HA 2QB5A 4QYTA 1QB7A 5AJXA 4RLSA 3ZTWA 1UFOA 4I1IA 4KZKA 1FVOA 4Q18A 4AWBA 4ZN6A 2HGZA 3QMMA 4URFA 3O8QA 3MK31 4ZEWA 2IYTA 2F1KA 3ED5A 1HDXA 4QWMA 4YH1A 4BRWA 5EIXA 2B1JA 1SHJA 1S9DA 2A8YA 3DCIA 4RE5A 2CV2A 2AOVA 4TQUS 2GPWA 1IM8A 4Z7JA 1IULA 2IXDA 1OXSC 1YASA 3GZNA 5EUCA 1RTTA 4G0OA 1M6EX 2IXAA 2WM2A 4AECA 4FB5A 3HXTA 5MFPA 5ALFA 2BR5A 3ETLA 1LI4A 2VK2A 2JHFA 5EMKA 2JFBA 5EJ8A 4YONB 3KX2A 2B9VA 3KZ1E 1F9EA 1PFGA 2GDJA 3HADA 3PQ8A 2OORA 3A9WA 1RBQA 3DUFA 5EOVA 3O2JA 4QUAA 4PFKA 1PUXA 1NVBA 2B2XA 2VHYA 2Y05A 3PDCA 4URYR 5TPZA 1FUIA 3IQGX 4BJ3A 2FWJA 2WOJA 3H0EA 5HCIA 5EWLB 4JVNA 3U3JA 3S68A 3GC6A 4CIXA 5TS2A 4DPLA 1WSDA 2QZ9A 4LBZA 4RL4A 2O4UX 5B53A 3IERA 2POCA 2IC5A 2XIQA 4ZI7B 2AC2A 2GRJA 2GERA 2R4TA 3FTPA 3KOMA 5ITSA 6YASA 4Y2TA 3W1EA 3T7SA 3OIWA 3V1KA 4NF2A 4TN5A 1P17A 3GRRA 2ROQA 3W5JA 1TEZA 5IMSA 1P1IA 3ACCA 4HRXA 1MJGM 2I29A 4XM1A 3QWIA 4Q1DA 4DDTA 1LZLA 1KOLA 1P75A 1BJTA 2ZTHA 4URVR 1S3SA 3L6EA 3W04A 1JDTA 1MX5A 3C6ZA 2J3EA 1VGRA 3T3DA 1QNFA 4I6JA 3UGTA 1Z5OA 4N03A 4DC0A 1QIMA 1GNTA 2JKVA 2HMAA 5SICE 1WPXA 1M1UA 1EPUA 1ZCZA 4UDYX 1B26A 2IZ5A 3HB9A 1X8JA 3IUPA 3C8ZA 5EWJA 4G01B 4TGLA 2X8LA 1TCAA 4EPYA 3J80A 2Q2VA 3BD9A 1JAXA 1JIJA 5DH9A 4XJVA 5AI0A 5DSZA 2UVPB 4LBVA 3GGCA 3N0WA 2PRIA 3R1IA 3HH8A 4DEYA 4O5OA 4EPTA 1I7SB 4WK4B 3I8OA 4N5LA 2XTMA 5IBRA 4HNHA 3AHFA 3K1YA 4INZA 5FOTA 1JAHA 3PT5A 3IP7A 2R1ZA 5D3KA 2OCBA 1CY4A 5C46F 1J8DA 5KS2A 2LIPA 1R0KA 1SCDA 2O57A 3C16C 3C3XA 3QVSA 4K3UA 2JLSA 4EG7A 4D9KA 5KOYA 4Q93A 3TTVA 4MQBA 1O9HA 4HSEA 3G0BA 1N1DA 2DHRA 4RQBA 4JJAA 4OIFA 3F4LA 4JEIA 4F6RB 4B48A 5IHXA 1PHPA 1XE3A 2M2IA 5F9MA 5B57C 2W7TA 3H1AA 5I7RA 4MINA 5CD1A 3GLHE 1PS9A 3DKIA 1Z36A 2BTQA 1QGUA 2RDMA 1BIFA 2ZWVA 2V6GA 4X8MA 3W8FA 3F7OA 4FC6A 4R2WA 4AKHA 4XJSA 2PGIA 3WWOA 1KTVA 1VHJA 2G17A 1Z5ZA 5IDYA 3UK0A 5AM1A 5JWOA 5HFNA 2HM7A 4FGUA 4M8IA 4KR2A 1FLAA 4MVXA 2F3RA 1PL6A 2Z95A 1GCUA 2WABA 4NIMA 1HDZA 4URXR 4HWTA 2ZRQA 4HNQA 4EY7A 1Z83A 1G2OA 4YRKA 3QE0A 1HDYA 3MM4A 1WD7A 3UBTA 4H3KB 1OLXA 1A9QA 5GONB 1DAMA 3FCAA 2C0QA 3B20A 4N6NA 3ZI4A 2E18A 3GGDA 4NJMB 2VL7A 3NBQA 4O4IA 3X1WA 3ZE7A 3QLUC 1NGSA 3VXKA 1JJ7A 1T91A 1ENPA 2JIDA 3DZ8A 3JWEA 2P9YA 1IJBA 4NY1A 3SEZA 3GWGA 5CBPB 3MTJA 5JSHA 2FDRA 3CXRA 4QHTA 1OLUB 5CX1A 4PHHA 2SKCA 1DKLA 4I3GA 1WF6A 1HNNA 1U1IA 2FEXA 3E7WA 3WS7A 4PN7A 1ML3A 1CD5A 2Q7OE 1G8JA 1SVIA 4CBVA 3V34A 3FZNA 1SVSA 5M04A 4BY9E 2P4SA 5BNWA 4G65A 4G5RA 2FWIA 1E7YA 2W6OA 4NCBA 3TE7A 1RPTA 2HU2A 1UZMA 4HYQA 1OJLA 2C97A 2L19A 5LZ5A 2VQEB 1TO2E 1A3CA 2ZE7A 3H5VA 4AURA 4RQTA 1CJVC 2N0SA 2XE7A 3DS8A 3N2KA 2IELA 3N7UA 4KUGA 4ZAVA 1KZHA 2PUVA 1UK6A 2ONKA 2CHGA 5CB4A 3T3HA 1S2LA 4YCNA 3W77A 3KTOA 2IOQA 5JCJD 3T9DA 3JD3A 1AQIA 4MCJA 3WISA 1DTEA 2Q9BA 4XVRA 1AKUA 1FC0A 4HI0E 5ICSA 4ETMA 1CR1A 5FH9A 2EV9A 2H0QA 1Z68A 4LXXA 4B6OA 2P4EA 3SR0A 5G2OA 4XIJA 2QE7A 2FPUA 2JJ2A 3CZQA 1ISHA 1QMPA 5BXYA 3HR7A 5BMVA 1XDBA 2WJVA 4AQ7A 3I2FA 5FEUA 1NVVQ 1W96A 2B69A 2PH3A 3ABOB 3GLHB 1BVRA 4PWZA 4HGQA 1XXHA 4B45A 1W36C 5BMVF 1DIAA 1QHIA 1YBFA 3B1VA 3DLPX 5FYDA 5IK2A 1YRLA 2MMGA 3NOQA 1CUHA 1ZNZA 1BOFA 2VPZA 4XGRA 3RB8A 3V7WA 3WYCA 2QUHA 2GKOA 1DIOB 3A1NA 4WOCA 3P0IA 4YRZA 5KTPA 4CTJA 3RRNA 4CDNA 5CA0B 1RJWA 3DTVD 3W2IA 1QHXA 4QXRA 2OKGA 1HYEA 3NGLA 3OZAA 4LISA 4EGAA 3V7UA 4EJMA 1E6LA 3U6BA 3UMMA 5KTRA 1N2EA 2E9SA 4N8DA 4DY4A 4E5DA 4EG8A 2QP4A 2XYQA 2M9MA 5BPHA 1XA4A 1JHZA 4LXQA 5B7GA 5COBA 1ND6A 2H17A 2J5KA 2PX8A 3RBVA 4F72A 5HGXA 2AOUB 3STHA 5B1YA 4U2GA 2FJPA 2QXTA 3PRHA 2LIVA 1VKHA 4UASA 3RK4A 4BJ1A 2VK4A 1I7NA 1EK0A 4GR9A 1I7PA 1NBME 4LTDA 1DJQA 3VO8A 5EKDA 4R2LA 3H99A 4EELA 2QLFA 2G9ZA 5A7HA 5HDBB 1RWPA 1YE8A 1T3TA 1RZRD 3NI2A 1U1GA 3IAHA 2A0XA 4BTLA 3N2GB 3WICA 3NJ8A 5TGTA 3WE7A 4W5NA 4MWEA 1ADFA 4R8MA 1MZPA 3CSDA 3BDAA 1MN6A 1Z2PX 3ZS8A 4C6SA 4RTKA 1LFDB 3CLSC 3ROMA 1XXHE 2BTQB 4KZPA 1JSLA 2HSDA 3V2GA 1ZM7A 1DQSA 3QKTA 5CFLA 3Q3GE 3FVWA 3MS4A 1M6WA 5CEFA 4L9SA 1E3SA 2JCVA 5B3JA 3EYAA 3Q9UA 2ZT5A 5BXQC 2CXHA 2HTFA 3KAPA 3MMXA 1N8NA 3JWHA 4UE6A 1T3LA 1ZJ4A 3KOXA 2QVLA 2Z56A 5DM60 4ZVUA 4R7GA 2SKDA 3ZWNA 1Q7TA 5F51A 5HCNA 1N2GA 2V3VA 1WB9A 3QFRA 3L1VA 4DLKA 2FQYA 4M36A 1CUXA 4HFRA 3BIXA 4MYHA 3H4TA 1ONOA 3UC5A 5AVQA 1CRWG 1WW3A 3MYRA 4MRMA 1E32A 3IMKA 1J9GA 3HHPA 4C20A 4YXWD 4CIBA 1NP3A 1MFPA 2B1GA 3PNPA 1ZD8A 1NULA 1ZHHA 3T94A 4AZ0A 3OZDA 4URZR 5LD2C 1A8PA 1LV8A 1Y48E 5EWJB 5D2CA 2O0HA 1UPCA 1W0KA 4D79A 5B36A 3GNLA 3KTAA 5LCXA 3QV1A 5LMZA 1CJKC 2C2ZA 2NTJA 3WO0A 2EBWA 4RXMA 3WRYA 3N05A 1B6TA 1P4SA 2CNKA 1XMXA 2GCIA 1TYZA 1AV7A 2IA5A 3KWJA 3L8ZA 4RNCA 4LDJA 1PVDA 3PJFA 3PR3A 4PZCA 3ZZNA 5C4MA 2XGGA 1XMJA 1QTNA 2O7QA 1JEQB 1Q0UA 3OZBA 1BN6A 3VR4A 4JVLA 3W5DA 3NYQA 1YS2X 3VO2A 5ALPA 2ZRGA 2GNAA 2COEA 2LP4Y 2ZUCA 3GFBA 3K92A 3NBUA 4IGAA 1N6HA 1I2AA 4IDNA 2XYPA 1WKCA 3AESB 4OL9A 5JS6A 3M1YA 4N01A 4MUGA 4O1MA 5CA0F 5DNYB 4JC5A 1KI9A 2DP4E 3K1JA 3DUWA 5A2GA 1JPNA 3HFGA 1MAWA 2RONA 3JYNA 3NHRA 4YCBA 3RYFA 3VJMA 3VR2D 3C14C 3I01M 5CA0A 4QRIA 1GQOA 1NC3A 2FSFA 4WFQA 1RQGA 4CM9D 3KQPA 5C5IA 1AV6A 3FMFA 5K51A 3WX0A 1AZLA 2AXQA 2BV3A 3FWKA 2X7HA 1JVNA 4LRSB 4X8OA 4XWGA 4CMKA 4DEVA 1Y8ZA 5IJ9B 1QJCA 2X3UA 1WUIS 3QBVA 1QHEA 3PWKA 2O2JA 1Q44A 4I1SA 5ETJA 4KIGA 4EGSA 1Q21A 4B73A 1NX6A 4E09A 1IG3A 4X0EA 4CVNA 4QU5A 2PMBA 5FTLA 2C58A 1WULS 3A25A 4PINA 621PA 1FQKA 1SHUX 1ZX1A 2YBEA 2FPOA 3AKCA 3ZHTA 3FOEC 3C3PA 1UL1X 3GXBA 2ZVDA 3PXEA 1KQ3A 2JJ1A 3PHBE 1GJRA 1H8ED 2QN1A 3GZ4A 3V1TC 3QFFA 2O3SA 1P7YA 1TUBA 3P4UA 4R1MA 3NNDA 1EFVA 4NBVA 4PU0A 3SPXA 5BSMA 3ORQA 4B47A 1PI3A 1WQ4A 2C95A 2Z8ZA 3JW8A 1I6WA 4HGZA 2VJAA 3AXTA 1UH5A 1QFZA 3QUQA 5JBQA 3EVEA 5FBHA 4TTTS 4B4WA 1JXOA 2XUFA 3DXZA 4BKUA 1ODJA 1ULHA 1B15A 1ZK2A 2KMLA 4IVNA 3UMJA 4POOA 4PFSA 1LQUA 3GHHA 3KJHA 4D25A 4INOA 3C7KA 3EFHA 4RLHA 3REOA 3ZQKA 3LQFA 4QRDA 5K9ZA 4P7JA 1VL0A 2WZQA 3N2IA 2A0KA 3G8DA 4YDRA 4TXNA 3HKDA 5JNWA 2CXNA 4GT1A 2DT5A 2PGJA 4BFVA 4BTEA 3TLAA 5I45A 3N2GA 1YQUA 5FTKA 4CTOA 3MGKA 2DG2A 3MMSA 2JLCA 4JFRA 4KSCA 1AA9A 2N75A 4EJSC 4KO1S 2OYCA 2BFBB 2LR0A 3HBAA 2PX6A 5KVCA 1IXYA 2WRZA 3ZZTA 2X76A 1LPNA 3EBPA 1CXZA 3DWGA 4I5EA 1M5UA 4E5SA 2D1FA 2HCBA 1JUDA 2EZ8A 3HS3A 4TTIA 1OH8A 1HYQA 1E7SA 1H0RA 2R8ZA 4ZVNA 1GLVA 4AZTA 2BFFA 4RK4A 2BFAA 4BQIA 1MFZA 5CEJA 2PBFA 3WLTA 2WLTA 4ZI2A 2RJ3A 1IY9A 2DB3A 1EK1A 2DFLA 4YP7A 1BCSA 2VHEA 4YJKA 5G0VA 2PD4A 4IMJB 2AYZA 2C2MA 4OKNA 1JR2A 3TJZA 5EKUA 1P0PA 4UAGA 5GP1A 4U8HA 1KAEA 5PGMA 5SZHB 1EXVA 4KIWA 4NS4A 2XNHA 2BEWB 3IAAA 4P1ZA 5EMJA 1T4MA 4AVYA 4FFRA 2M32A 3CUKA 2IHTA 3FGNA 3ONFA 4L95C 4DIOA 2JAHA 4A0HA 3CX7A 1XQ6A 3VHRA 2CJXA 1VKZA 4JI4B 4HDOB 4LGCA 2GARA 2ZJYA 4FMPA 2HK9A 5A04A 3DLAA 4EJSB 2WJZB 4QYSA 1SKAA 4GVXA 4F3KA 3WL6A 1U1EA 2I3AA 2UYYA 3E22B 1ECPA 3BDVA 3HJCA 3OLZA 4U7HA 2QE6A 2YBDA 1VP3A 3LVRE 4RQAA 1QP8A 3BWXA 1MOZA 3CLSD 1FTSA 4MX8A 4X1KB 5GY7A 5JUWA 1W36B 1D0IA 2TYSB 5AQ1A 2J3QA 2FFJA 4ZO6A 1WSWA 4ZQGA 1GL7A 3IQDB 3ZVLA 5JXGA 4RFLA 4CM3A 2DR0A 1HMYA 1QYIA 4FNAA 1DKPA 2VVTA 2ZIGA 4A10A 5A0FA 4DV1B 1X7YA 4Y0AA 1DRVA 1W85B 2MU1A 4QOEA 4R83A 4X7MA 3TAUA 3KSUA 1D6MA 3KNZA 2UZAA 3PSAA 3QLUA 3KU1A 4IIXA 3VO1A 4ZK6A 5LYJB 1N9ZA 3LY7A 3DNPA 3GJSA 4YK7A 1KF0A 5JALA 4A73A 1ZM3A 4PYOA 4BKQA 1VE3A 2YHIB 4LXIA 4GI2A 5IEJA 1LSUA 1GZ6A 3LUFA 1T5LA 4LJ5A 3W4JA 1QFJA 3Q8WA 2ZB4A 3F8SA 2EQAA 4HO1X 4QRHA 3EQ6A 3GLVA 1KC1A 3B5IA 5FEMA 3GPCA 3AKZA 3VJLA 4BVBA 2R7MA 1V26A 1WHTB 3N0RA 3DGFC 4XR4A 4LFAB 1ODLA 1E3QA 2IS6A 3GA0A 3U7FB 5D7BA 3TW8B 3IC5A 4FQ8A 1E89A 2IPMA 4KXQA 4P3NA 4LJAA 3SZGA 4DR2B 1JWLA 3FKJA 1GPUA 4Q03A 4F4CA 2XV1A 4XEUA 3S7ZA 1Z6AA 4PAQA 3QUBA 2GBCA 2JBAA 1HYBA 4RH1A 2IHUA 2AJTA 4AP6A 1E7MA 3BGWA 3KG2A 2A1UA 2FG6C 3D81A 3P4XA 4CWAA 4KL8S 3B9BA 5AI5A 2J9FB 4O2AA 3PITA 1ADYA 2YN0A 3RJ9A 3FRHA 4HGYA 1I36A 1M6YA 2GOYA 3GCZA 1ZRNA 4ZDWA 2JH8A 1RKBA 1RCTE 2TS1A 3T1OA 2DBRA 4IH9A 4QTZA 1A72A 4OP1A 3HYTA 4PPNA 1F2DA 1K0FA 4OA8A 3NT2A 1K6MA 4F6RA 3Q5EA 3QVXA 3DE0X 3EW7A 4Z2YA 1BMQA 2Q6TA 4WZZA 5REQB 4HXYA 1SCBA 3R6TA 1U9CA 2FN4A 2YWXA 5EJEA 4BCBA 3ID6C 1OYWA 2BGUA 4CFSA 5K03A 2AKEA 1QM5A 1SZDA 1B14A 1ODKA 3BGDA 3MWDB 3FLMA 2QRUA 5EXTA 2JEOA 5DHFA 3KETA 5FI0B 2HLDD 4L0MA 1BKDR 1UJBA 2ZJAA 2FEPA 2C4NA 3M1LA 4UFPA 2WP0A 2H2WA 4C30A 1NNUA 1YV9A 1QB8A 1Y4SA 1O95A 4Z4HA 1OA0A 2HJHA 8ADHA 1LBEA 3EZLA 1SCQA 3G02A 4U0JA 4ER7A 2NO7A 2QVYX 4JLUA 1UJ6A 5BYBA 1W30A 3RKRA 4DPMA 4E5NA 1CUBA 4GPZA 5IUNC 5LU9A 1FTYA 3FJ1A 1A9YA 1C7FA 4NE7A 3IPCA 1XJWA 2X8JA 4PZYA 1RBYA 3FUUA 4Z4GA 4O8CA 3GEMA 1NUQA 4XQ9A 3NV7A 4Q82A 3EUEA 1UXIA 1QOZA 2EBFX 1KPIA 1XRRA 2H1FA 2H8KA 4O8ZA 3UK7A 3PX7A 1L2TA 5IP5A 3SXUB 1S8NA 3OFVA 3TMKA 1VCNA 3P9RA 4QOHA 5EN4A 1HDEA 4BB0A 4FN5A 4J0HA 1Q0LA 2RGRA 3S8YA 3H3XA 4ZA2A 2VF5X 4OXQA 1N2ZA 4TS3A 5CDFA 3VDQA 4QGAA 1PYGA 2BFCB 3ERCA 2VWGA 3GOQA 5J23A 4WQMA 3TZEA 3UHFA 5BV8A 4HOYA 4P58A 4YRQA 4LYFA 3N8IA 4JOSA 5F5XA 2PZAA 1OAOC 1O5TA 1W8DA 2G07A 4YRJA 1XHFA 4JBGA 4BFCA 2G83A 2X0EA 1M1ZA 4PS1A 4LOJA 2O5EA 2C8VA 1T9ZA 1BTOA 3MAGA 3PEYA 1JFSA 4HG2A 1PBTA 2BKAA 3TQIA 1P0CA 3L4JA 3CT6A 3CN7A 4OI2A 3Q41A 3ZV6A 2VUSA 4EUSA 2ZRCA 1M83A 3RHFA 3RUAA 3K70C 2J6HA 3WIOA 3HKBB 1BAPA 4ARZB 1EUCA 1J06A 4M6WA 5FWNA 3FOWA 2ZKLA 4PPGA 4HDCA 4IJ6A 4M21A 2PZLA 4YMHA 4TVSA 1XLUA 4CG2A 1L7BA 1LBIA 5THKA 1MNAA 1H93A 2CLKB 1RI4A 1FP7A 4Y6GB 2RJOA 1P72A 4RCYA 4RYDA 2GTPA 4R2HA 1BE8A 2NNLD 2FSVA 3UJDA 3QVJA 4QDUA 5B3KA 1X38A 2QX6A 1O96B 3A28A 3PFKA 4ZICA 4ZQIA 4BO8A 5A9TA 4CI9A 2ZREA 4G4GA 2H51A 3OIUA 4Y0NA 5E9WA 3VZRA 2IVZA 5H7XA 2ZYTX 1OXXK 3RK1A 3W3ZB 5KHLB 1KERA 4BO0A 4D46A 3DDNA 4TWRA 1MUUA 3GJRA 4FDVA 4MR7B 2DWCA 1E2UA 1SC1A 1L7RA 1ZDMA 2QQ5A 4MZXA 1G4AE 2P40A 3GRKA 1V9CA 4MVCA 3ZWAA 2E4ZA 3KQSA 4U00A 4EQ6B 3UCXA 1SKUA 3HCNA 4ZRNA 1RQXA 1OHHD 2AXPA 3U4DA 2BGRA 5DP2A 2G1PA 5FFFA 4GKJB 3TX6A 3R75A 4C4SA 1VJDA 3DHEA 2KS6A 4RABA 5DYYA 3SVTA 1MH9A 4BJ5A 3JARB 1UDXA 2BHRA 2HV8A 3MT8A 4YMWA 1N6KA 2REQA 3UAYA 2WJYA 4UHFA 4YDQA 1FRQA 3ZTTA 3ZR4B 1AGRA 1NXPA 3UT6A 4BEBA 4MH0R 2X9GA 4QOJA 1G8GA 2Y1DA 2BFNA 3RVDA 4F92B 3CY6A 4DJFC 3F97A 4EZBA 4YMTA 5KYYB 1PSDA 3WK6A 5LD2B 1HFEL 2Q1SA 3NTVA 4J0JA 2NV6A 4IRMA 1W5BA 3O74A 4ZFNA 4W9RA 3BQNB 2AR7A 5BR8B 1XVIA 3EOBI 5EIWA 4DRXA 2HN9A 4MI6A 1H2ZA 2Q4OA 1Y6JA 1CUEA 1EP1B 4E7OA 5LUAA 4I19A 2BGKA 3K8YA 1VE9A 1G17A 2V9CA 3PJDA 3AINA 4CT4B 1CR2A 1F6DA 1Y37A 5JBIA 1ZNYA 2QSUA 2W2NA 3EF0A 1WG8A 3PB3A 1R0RE 1GZ4A 1WLSA 3I2HA 1A71A 3MOGA 1OAKA 4R3UC 2QX7A 4BRUA 4D9MA 2K87A 4GKBA 3SQDA 3JZMA 1SH7A 1X0VA 4JQZA 4YRMA 2EBUA 5FX2A 1H85A 2UYCA 3NTUA 1RW4A 1Q3KA 1XMPA 3HDYA 3K0BA 1E9BA 3HKDB 4OXIA 2DC1A 4ME6A 4XLZA 3A6JA 5EA2A 2H0RA 4I4CA 5EWLA 5TXGA 3PTAA 1HLPA 5CH5A 4GSYA 3AMVA 2FHSA 4KQJA 3PICA 5AW5A 3T8YA 3L7NA 5ALHA 2W6CX 2XW6A 4F4DA 2WDPA 4M49A 4YJ3A 2HADA 1XP5A 4Q4AB 4JXJA 1VG9B 4D9GA 2F1HA 4IXWA 4MPJA 5JIBA 2BE7A 4RVDA 5IH3A 4DXDA 1NOJA 1GRRA 2YVUA 5JD3A 3EWSA 3OOJA 3QU7A 1WCYA 2Z58A 3FSRA 3A10A 4HQKA 4TTQA 1KI4A 1TO1E 2JI7A 1VHWA 1HYHA 4MYDA 4AJNA 1GVNB 2R44A 1E9CA 4FNMA 3Q10A 5I9SA 5L7WA 2FWMX 4ALLA 4B6FA 3IP8A 3WQHA 3R9XB 1YULA 3RC1A 4D6YA 4WCFA 1Z17A 2VPWA 4BLRA 3RSHA 4Z2AA 1M34E 2I6XA 2PV7A 3EEQA 1W0JD 2IYPA 3NANA 4QXPA 4RIEA 1IBRA 2QPOA 3K9FC 2CT8A 1SUDA 2YZKA 2C99A 3CLUD 7YASA 1G0OA 1ISRA 2BDUA 3KR2A 4B2IA 2ZCUA 3A04A 1NVMB 1XDSA 4KLCA 4OFXA 3MUEA 3AEKA 4TXHA 3UXEA 3SDSA 5ICMA 5JAOA 5J3JA 1QPZA 3ZS9A 4EKIA 2HBRA 1ABEA 1KRWA 3N1UA 3T4XA 1XR3A 2AD1A 4XARA 2IEIA 1M2HA 2GPSA 2G4CA 2XB9A 4OHRA 1OB5A 1Q15A 3PEUA 4MJXA 3AK4A 3L8MA 3SXPA 3Q7IA 1GGHA 3LDUA 4FK8A 2PSHA 1CUDA 3T3IA 3HPRA 3UOAB 2Q0HA 1XCPA 4I66A 1Q3TA 4L8FA 3EZGA 2I2FA 4JI1B 4B3XA 2BL4A 2FWNA 4E7PA 1KDRA 1U2PA 2COUA 5LZ9A 4DR1B 3S2SA 1NSTA 5FPQA 1CIJA 2JFXA 4FHGA 2GM5A 3LL7A 1U8TA 1KRHA 3EGEA 3HL0A 2GHQA 2IP4A 1W1UA 3RV4A 1RHMA 4F1KA 1X77A 2XADA 4EKNB 1KO4A 2YHBA 4OQXA 1X2BA 3JATB 4WOJA 5DTMA 1OU4A 4U2FA 4DDVA 3MHTA 3ZOZA 1HXHA 4NULA 1J1ZA 1NW4A 4QXQA 5KYGA 3WSVA 1SA0B 5J4KA 1RWBA 3FROA 5FP0A 1DL5A 1RWNA 3EG5A 2YINC 4IXMA 1TQ4A 3ZHSA 2IHBA 4EAQA 2Q6VA 3RTEA 5F52A 4LG1A 5FLYA 4AJ1A 4BQNA 1E0JA 3T1NA 2IVFA 5TGDA 3VPAA 2DE0X 3QVVA 4PAOA 3T5CA 3CMCO 2XT6A 3P94A 5L3VA 4J29A 1JG2A 2C83A 2YH2A 2JHCA 1PIWA 2Y9MB 3WP1B 1P5HA 1PDVA 1XVAA 1YQ9A 2P2CA 3S2IA 4FHCA 1QKIA 1Q0HA 4I08A 4JELA 2QJOA 1RU3A 3NCHA 4F4JA 1CQIA 3GMTA 2I1LA 4YAKA 4GBJA 2IUTA 3MWLA 4GZ3A 2V65A 5BWNA 2OL4A 2IIPA 1PWYE 3IS3A 3T1VA 4YUZA 2PLAA 1R4NA 3I58A 4KSBA 3I72A 1JXAA 3EMBA 3R7WA 4B3BA 2D1SA 3NASA 3FAKA 2UXCB 4EY5A 1Y34E 2G1UA 1LDMA 5GGXA 2RGGA 1BS2A 3E9QA 3H9EO 1EXNA 1AHNA 1Y3HA 2I80A 1JFVA 4TYWA 3W3AA 1JPJA 3OQIB 1I51A 1PW5A 2GZHA 4FDMA 1XZIA 4MKXA 5A71A 5BSWA 1G8HA 4WERA 5FUBA 1T2NA 4AU1A 4IIYA 3MWGA 3CLKA 2JIOA 1X1SA 5A7FA 3MG9A 2HRCA 2C5HA 5DSTA 1UAAA 3IBTA 3BQMB 2Z1NA 4BO4A 2EU8A 3PL5A 1ZGAA 1UZLA 1K68A 1TF2A 1P2UA 2CEKA 1UXGA 3KZMA 4XWAA 2VDRB 2CFTA 4EYGA 3C15C 4CUKA 3PQ6A 1OHHA 3A0RB 5JWHA 3L4EA 3MLBA 2OBLA 4DS3A 4QU8A 4GMKA 4JSYA 4TZTA 3UJ9A 3E15A 4OYYA 4POAA 4C06A 2FSVC 2GGSA 2UZ4A 5JASA 1NNEA 3AKDA 3CWZA 5IZCA 4EKYA 3H1GA 3I62A 2ZBDA 3FWYA 2ABWA 3DV0A 4HB4A 1YQXA 1J8MF 2ZBPA 4JUBA 4MS1A 4BZWA 3LBIA 1PFYA 1CUFA 2R79A 5H59A 2IFTA 3BF8A 3P96A 4I0WB 4OQFA 3SHVA 4DGQA 4F91B 3CRQA 4K9RA 4B2LA 1GZVA 2ZI3A 1WZIA 3Q8MA 5H3LA 4ENWA 1BEUB 3WNDA 2V74B 2VZ0A 2Y71A 3L1HA 4QJBA 1ZR4A 2RH8A 5C32A 3OM9A 3QWFA 1C0KA 5F12A 2H59A 2ISQA 3E2PA 4PR0A 2W11A 1FQWA 3A1WA 3EQ9A 1H5NA 4TSKA 2J0SA 2PRKA 2WHXA 1JQBA 2PSJA 3FIJA 5GJCA 4HMPA 1I7LA 1YFZA 2QTBA 4P22A 3JAMA 4ATNA 4RM3A 3T3GA 1XRLA 4ZIRB 2H85A 2HCFA 3QPAA 1PO7A 4O25A 1FU7A 4RAQA 4E2WA 1NZFA 3W90A 1PJAA 1CDOA 1RRMA 4DYVA 5FNZA 1TCVA 3GYBA 1EFTA 3RSSA 1CZHA 2C3MA 3R3WA 2ETVA 4IOJA 2I1WA 1VECA 1XRMA 3L4SO 5J1SB 3P1JA 4E5PA 3E9DA 4MI9A 3GLIE 1ECFA 4OFBA 3KVNA 3V8BA 4GR4A 4KW7A 2K2QB 2LKDA 1YJ8A 2YYAA 3H1TA 2J9RA 4N6GA 3U7QB 3WGLA 1KFKB 3JARA 3V48A 4FE4A 1NJ8A 4RTOA 5LPNA 3A2MA 1X7GA 3G8AA 2V7BA 4V0NA 1IHXA 3T4EA 4KXNA 3QHQA 1QPBA 4HQNA 3L8GA 3VYTB 2VTBB 1OLSB 1KY5A 1XYYA 2IPNA 3IUJA 4QUDA 2EKDA 3W2TA 4JI2B 1XTTA 3R9WA 2BMFA 1PD1A 2HMUA 4N49A 3OETA 4KWCA 3KQMA 4OI4A 4W1RA 2HYIC 1RADA 2Q50A 3IV7A 3PFHA 4C0WA 1QO7A 1UMBB 3ANMA 5J58A 4TS4A 1PWXA 3G9TA 1OKKA 5DHRA 4GYKA 3OMWA 3REQB 3L79A 2O20A 3EJ6A 3FYUA 4QX6A 4UFOA 4E4YA 4YRNA 3RC7A 2Z2KA 4YEDA 4MVJF 3WLIA 4ZAYA 2R6R1 2JHPA 4M9ZA 4FFLA 2YJZA 1E2NA 1KJ8A 1L4MA 2XMDA 3DDCA 4LPKA 2GN4A 3RQSA 2WJGA 3TKAA 2NO9A 3RVSA 4BBJA 5A1TA 2QLBA 4RK0A 1TQDA 1T25A 1Z38A 3I2GA 4MVJM 3GGOA 4PPQA 3IBSA 4PC7A 2YW2A 4NX2A 2WZCA 2VWPA 2ATIA 1MB3A 3HZZA 2I2CA 2OHVA 3ZXXA 4YWJA 5A1JA 2LWIA 3ET4A 4ZCIA 1PT5A 5KPDA 2QBYA 4DNXA 3KAJA 1BN7A 3ESAA 3DBVO 1SXGA 2YFKA 1OFHA 2Q1UA 3IMCA 1ULSA 4K2AA 1NJ6A 2VHVA 4BKPA 2UUOA 5LJIA 3BMOA 5BVHB 2HK8A 4FNOA 1NU8A 3TRJA 4RJTA 4OYRA 1VI6A 3F4BA 3G89A 2OK7A 2WF9A 4MJ3A 1EIWA 2BCEA 4B8ZA 2H7XA 3B7WA 4TLLB 4P4LA 4V39A 3TWOA 3WGOA 4IUDS 4JBXA 4ZARA 1TMGE 2DWOA 1WUJS 1IY2A 2Q8NA 2WG2A 3T3PB 2ZU6A 4AO6A 1V95A 2BTEA 2X2OA 4DUPA 2V3WA 1T5BA 3TG8A 2H1WA 2J31A 4FEEA 2PFKA 3NHZA 4XLLA 2QXUA 4LKOA 4YNBA 2ESRA 1XZBA 5DTJA 5EIBC 5H3HA 1C30B 3ZJ4A 2QTNA 3TVYA 4Y3UA 1TKRA 2P90A 3UAWA 3EPPA 721PA 1IZ0A 4TMWA 1V5IA 3ZVRA 1L4NA 3SC3A 1BWPA 2HIGA 1D9XA 2RGWA 2O8DB 5TJHA 1J0DA 4L75A 1MD9A 2HQOA 1E2GA 1MG5A 1UPTA 4Q66C 2GHIA 3BSFA 3OJ0A 4TV8F 2J46A 3DUFB 4NH4A 3CR3C 1K08A 1CJMA 1RLUA 3E35A 3PYXA 1S3FA 1YZGA 4PAGA 4PYQA 1V1JA 3ZU2A 1QGZA 3K6SB 3M33A 1W8IA 5LNK6 5C53B 1U8ZA 1GZ7A 4JK3A 4L50A 1S6YA 3JQEA 1DAGA 1HK7A 3HR4A 2GD0A 4FYJA 3JSAA 3CVYA 1ECGA 4WUTA 1XTQA 4NONA 5SY9A 2GSWA 2HWYA 1P6XA 2W8BB 3QXJA 4MKZA 5BSTA 4BNJA 1ZN2A 4IW3B 1P6QA 1W5TA 1N57A 2VSOA 3DKKA 4LN1A 1C1HA 3F5MA 1OV4A 4KP7A 4CMCA 2MYPA 1JDVA 1QDLB 4GXTA 3RGWS 2D1TA 4A1OA 5JARA 3K1AA 2VOEA 1PZXA 3OE1A 1Z2DA 1JLHA 2I4OA 1QORA 3ND5A 5BT9A 1FY2A 4DYHA 3NFYA 4JLMA 3Q40A 5AJYA 4C4AA 4ROTA 3MF4A 2UUBB 1VMDA 2O0KA 3ZH2A 1AXRA 3S40A 3I32A 1RPZA 2GVDC 4L8GA 3SYRA 2NMVA 1JIXA 5GOZA 3C3MA 4CUJA 4CE6A 2Q5OA 1RYFA 2EC5A 1UDAA 4U7JA 3ZN2A 5JR3A 2IP1A 3CKLA 1OXVA 5DRTA 4JLWA 1XKTA 2XZPA 1TZKA 3LBHA 3T7DA 4EECA 2Y0PA 4EA8A 2O1SA 3INNA 3PP8A 1Z6ZA 2PKCA 4HDRB 4BVKA 4NMHA 4PG4A 1NRWA 3WVNA 3OIDA 4RMIA 1EHYA 4YRGA 3WA6A 1QYCA 3ZWMA 5DM0A 1H3FA 3ZDDA 3HJHA 2UDPA 1BC5A 2WWWA 4MGYR 1K7FB 1YGPA 1W6UA 5MDHA 1V1RA 4K6MA 2CFOA 4G5YA 4IUBS 3TL6A 3G5LA 1WZNA 1A69A 1NOIA 2VI5A 4M1MA 2PH5A 4U2EA 1W44A 1OILA 2FB9A 1M54A 2CBXA 4P3KA 1AQ6A 4DLYA 1H65A 1KI2A 3IEPA 1GG2A 3DC2A 4L3VA 3M89A 2C03A 4XSHA 2JG3A 2WF7A 2XKKA 3K0KA 1U1FA 5ALYA 3W2HA 4ACAA 1QYVA 2ECKA 1PJBA 3TS1A 1DC3A 5FPYA 4ARVA 1BEEA 3UJ6A 2RHJA 4GMGA 4BLVA 3O31A 3CH5A 1XTZA 2GZSA 4OJYA 3LFHA 4D9IA 1DAKA 2QSZA 3KC2A 4WBNF 2ZBEA 3QP9A 2BKLA 1R0BA 1WKVA 2IUYA 2KPOA 4HZIA 5LMCA 2X2FA 4RS3A 4XQ0A 4FI3F 3WG9A 2ZPTX 1UK7A 2EG9A 2OYRA 3RVMA 1H5UA 2ZJ4A 5HUQA 2ZQZA 2O54A 1D2RA 4P81A 2MYNA 2RHTA 3IUQA 5F3RA 3IP6A 3ESYA 4ER0A 3ELDA 2I0FA 3H1EA 1FDSA 4DANA 3T12A 4CLHA 3F6SA 1ORHA 2C94A 4JUDX 4G26A 5EXPA 1EFRA 2Y9PB 4V0KA 5AW9A 1A7JA 2GETA 5F7XA 4WZAA 4EY4A 1YFJA 3H3JA 5EZ5A 1TZMA 7MDHA 5LN1A 4PC6A 2A9QA 3H42B 4R9VA 4OHYA 3TLXA 1TPYA 1VCIA 4O08A 2VA9A 3U3KA 2JIQA 1XDZA 3JV7A 5KYNA 1NQWA 2PGOA 1T35A 1AHHA 4PONA 2C07A 4X61A 5D3QA 1VLLA 1RS0A 4DOMA 3UAVA 3WQRA 4JITA 4M1KA 2HJRA 4GXNA 2DOKA 4FWBA 2WHEA 1JU9A 3K5WA 5ELMA 5JAUA 5J5AA 2AZXA 5LA6A 5THXA 4G0ZA 3RTDA 1Q6ZA 1ZK3A 5TNXA 1YKFA 1QK3A 2OR3A 1DBWA 3DD5A 4LRWA 4EO4A 2HH9A 4CN9A 2RIRA 3KFLA 2KE5A 4DT1A 3KLNA 4MPTA 4R40A 4QGGA 3GN1A 1FL9A 1NZJA 4ZRMA 4QELA 1HE5A 1W5FA 3COPA 3VR4D 4L74A 2PL3A 4EG0A 1JPUA 1UP7A 1IXSB 4HNTA 2HSJA 2I71A 2JFPA 1ECJA 3I0NA 4M89A 3DLCA 1KNXA 1WMFA 1ZOIA 4B46A 4XDYA 4PQEA 3D64A 3L7IA 4DCCA 2DERA 1HBJA 1Q7EA 3EA4A 3QKSB 1WHSA 4NJOA 4XCQA 5TEVA 3S2UA 1H9AA 3I23A 4FCTA 4BGVA 4DKJA 1EM6A 3ZBUA 4B74A 3PEEA 4K6GA 2BGWA 3MQ4A 5EE9A 3ET5A 4OAOA 1LBSA 1TZ2A 1ZQ1A 1F8XA 2XKJE 3ZQ6A 4LF8B 1XPUA 1A5SB 2PH1A 4OXNA 4N7RA 4DAEA 4DA7A 3SZOA 4H1TA 1MU0A 3F2VA 4BASA 1KGDA 3QKUA 3R44A 1XP8A 2EZTA 2Q9UA 2MR5A 4ZVVA 1YJCA 5DYIA 3M1AA 3DDOA 5C35A 3BGIA 3QPDA 4QGSA 3KEMA 5KYWA 5ICFA 1F2UB 2NUTB 2FAXA 3UENA 1V4BA 2MIIA 4BCCA 2PWPA 4KOAA 2I99A 2OSBA 5ALXA 5FV4A 3GRCA 1KJYA 2KBEA 2YIJA 4MUNA 4MYUA 4UBJA 5DO9A 3L9WA 2NSDA 5T57A 3P2KA 3E3OA 4B7UA 1NN1A 3OEHA 4M22A 4Q3OA 4FFOA 4Q3CA 2K6GA 3DAHA 3QXGA 1Z2EA 4KE6A 4OREX 5TF4A 3THXB 4M76B 1MNQA 1QDUA 1A8UA 1OVMA 3A1CA 3JQAB 3OPMA 4HYYA 3TBHA 1V1MB 1VM6A 2FSSA 3TDNA 4Q3EA 3RUFA 3EPHA 4UBKA 4HNVA 1VMEA 3PNMA 5GTDA 1G38A 1WB5A 2H63A 5FF9A 2OMKA 2PL1A 4YS6A 4L5JA 4BNZA 5KVQA 1EX9A 3DE5X 4IRUB 4ZGBA 7ABPA 3Q8KA 1RC8A 4C7OB 3K8QA 2B20A 3P0HA 2MINB 2R1VB 2RI0A 3AZPA 2NM0A 3M9WA 1LQ2A 3OU6A 3ZWOA 5LIRA 3BWEA 3SQOA 2IS1A 1EUDB 2XVXA 3FF4A 1OY1A 1TTTA 4KLRA 1FRFS 4PNPA 3RFVA 1T5HX 3SQXA 1GNRA 3USES 3I2YX 3TM4A 5CITA 3WWZA 1L5OA 1SCIA 3TGPA 2GBIA 3H5RA 2BBSA 5EKTA 1FSPA 1NRXA 4GI5A 3T38A 2AG5A 2VZLA 2VXYA 4QDJA 1MXFA 2PZEA 2TMGA 2H4ZA 3RFXA 2OV6A 3DTYA 3ESQA 3T41A 1VCOA 1XKQA 4LTMA 4NJEA 4C4TA 4EFMA 3TLEA 1FTWA 3JVVA 4F4HA 3T1TA 3G9UA 1ZVVA 3AL3A 3EMVA 2WTXA 2W6MA 2VWHA 1G8KA 3L8FA 2BMVA 3PPYA 1RRKA 4KPUA 1QHNA 3Q87B 5EZSA 2Q1WA 1R50A 2YXLA 2YWHA 3PDUA 2W0MA 4FCCA 3LXMA 1IBKB 3W9SA 2Y4OA 1F48A 5AKHA 2CLLB 1DJNA 1BGVA 2OILA 2PKXA 3SXJA 3R2JA 4KGZA 4EBFA 5JD4A 4LJLA 1WETA 4MP6A 5SZJA 5FUMA 1G3MA 2EKLA 3O8DA 2ZSIA 4FOSA 4XX0B 4OSEA 2NAPA 3FPJA 1W76A 3I37X 3U17A 4E15A 5SY6A 5BYKA 3OT1A 1DJMA 4Q48A 5J4LA 5HF6A 2IH2A 5DHSA 4BB6A 4I8DA 3DCNA 4P53A 1MKYA 1C3JA 3PDIA 4JCCA 2X7XA 5BNZA 5B6PA 4EHLA 4QLAA 3V32A 4GOKA 2FYTA 3IMFA 5J4HA 3X1ZA 4Z53A 1XTBA 2F3SA 1M75A 4XFDA 5FO1A 1TEVA 2BGTA 2WVJA 4ZQBA 3RHZA 1UT6A 2JGIA 4Q6WA 3ZI7A 4EJSA 4ZK2A 2IJGX 1O4WA 3ILSA 1AKYA 3WI7A 4S0ZA 3DVAA 5HTKA 5K99A 1JHVA 3DKVA 3DO8A 4II7A 3W3AH 2PX5A 3ZGLA 4YTEA 3NX4A 3HB0A 1E9RA 4RTRA 1M8FA 5A62A 3N5CA 3JD2A 4LSZA 5CYGA 4PLCA 2ZRAA 3BJZA 2APJA 1B23P 2QZSA 3D1JA 4NBWA 1ZCFA 5CAEA 2VDOB 4QXOA 1GRCA 5BUQA 3E3MA 1FSSA 5HQJA 2V6JA 3ZJTA 4QJ3A 4Q7MB 1NC1A 1RLIA 4C6TB 4U3JA 1LDNA 2PT9A 5GINE 4DR3B 3PA6A 1S2DA 1Z12A 2Q3EA 3E0QA 4P31A 1D4ZA 4M7RA 4UHBA 2YCLA 2PM8A 5LDHA 1N5MA 1N8KA 4GOXA 4WLUA 4K9LA 1C1DA 2NZJA 2WK1A 1PLJA 1Y7TA 1FVFA 3RU9A 2HPZA 3IB3A 4KIJA 3OZXA 1NQVA 1UOOA 1IH8A 3I9LA 2O2GA 1PS8A 2P6MA 1QQ7A 3GH3A 4Y9SA 5KDLA 5JY1A 1ZZGA 5HZMA 3KALA 5T67A 4U1RA 4BJHB 1E4EB 1J21A 2AX3A 4URWR 1UXKA 1QGDA 2P75A 1YVRA 4RZUA 1IJFA 5E6UA 2I6QA 2W48A 1IVNA 3EGVA 4K2HA 4NMLA 4HAXA 2HF8A 4TVOA 4EJ2A 1E79D 2I9PA 2RHLA 2ONYA 4JODA 3GR6A 4Q3AA 1ZFNA 2UYOA 1U99A 2KQUA 2AZ4A 4LY6A 1Z33A 3OOWA 3H3FA 2PSFA 1FYFA 4RD4A 1P1HA 1YR3A 3OSZA 5CYFA 1P45A 4X8HA 1SOVA 3IFSA 1D3AA 1NKVA 2QJFA 5CDSA 2OCDA 2O8BB 2GCEA 1VSBA 3G0OA 1RI5A 1IOLA 5A6SA 2JH9A 4BE9A 2A0FA 3EFOB 2R0QC 2ZSEA 2A3RA 1UP6A 4LOIA 1DQRA 3PD1A 5DEIA 2H9AA 3WGHA 4B79A 2VQFB 3VH1A 3CT4A 1NBWB 1YK1A 2WA2A 4KU4A 5FI1B 1QCCA 3ABZA 3BHNA 3P45A 1BVUA 1NQUA 4HDNB 1F06A 5F3DA 1RXWA 2WYVA 6LDHA 4XB2A 4RPIA 5JXHA 3STYA 1NTRA 3KKNA 1Y8QB 4IAOA 4Q6BA 3IUBA 5I7FA 3FTCA 1EINA 1GRVA 2DHQA 5TT1A 5FNVB 3LWNA 3W6OA 2Z8XA 5F9FA 1DDGA 2VK8A 1VHQA 3FR8A 4MQEA 4O4LF 3AV0B 3AHDA 10MHA 3KJNA 3QBDA 4MRAA 3CRNA 2HRRA 1AZTA 3OKCA 5CMLA 1THTA 1SBQA 1UJMA 4PGAA 3IO5A 4U2DA 3I9FA 4ALJA 3JVDA 4V38A 3LTEA 1BG6A 1QRDA 2V6FA 2Y0BA 3OX3A 3PWSA 3Q5GA 4P33A 4DHEA 4EO7A 1Z2AA 2PS9A 4FW9A 3IOYA 4OQNA 5FJIA 5JAQA 4F6LA 2Y1EA 5BSFA 3U60B 1N6IA 3OFND 1QGUB 3TQCA 3FNFA 5EHIA 2J3DA 1LKZA 4IIJA 2NGRA 3ZY5A 3U4AA 4GGOA 1IB6A 4HDQB 3DHNA 1L8OA 3H18A 1FDRA 2X6TA 3L6UA 1JXQA 3PC6A 4M9QA 1TJ3A 1XRSB 1YTUA 2EFDB 1F60A 4QA9A 2A9FA 3GI1A 3TW8A 4ZOCA 3IAEA 5J2UF 5KSOA 3RJTA 1DADA 3MJDA 5IVIA 4ZJYA 5D1HA 3C70A 1KY3A 3F1KA 3S2YA 4E12A 1LBTA 2XCOA 4QU9A 3H17A 1K5GA 3IURA 2LCFA 2WFLA 4JR1A 4P7GA 1ZMRA 1C3VA 2I3BA 4YJFB 5DP1A 4BN4A 4UD6A 5AYVA 3VR3D 1E4VA 1YCFA 2B0JA 2HEIA 3VNUA 1T5IA 3V1UA 4BMCA 4CL3A 4FJ2A 2JAXA 1QP7A 4KVFA 5FOSA 1J8FA 2P91A 2R8OA 2XJ9A 1OFUA 1BEZA 5LBTA 4FHEA 1Y9AA 4C0BA 5ICEA 1VLQA 4MKGA 4XIFA 5EXSA 5TQ2A 4BLPA 2VTDA 4MLZA 4UNSA 4EKDA 4LNAA 3CRW1 3JALA 2YXDA 5AI4A 1V3QE 1PGJA 3UK1A 3KVYA 2JI9A 3KPJA 4GW3A 4ENVA 4UEKA 4UVIA 4O0MA 3QOFA 1LUAA 3O2QB 1UBTS 5KQSA 2H1VA 5UKDA 3HXOA 3IAM1 1M1YA 1FP1D 3QGMA 4CCYB 1C7RA 4RVFA 5ELXA 2ZJBA 1E60A 1TNDA 2C98A 3D43A 3JTEA 4NZNA 3ST7A 4FSXA 1G8SA 1I13A 1KNQA 2QRZA 5KNLA 4BX3A 2HAEA 3SLKA 1C7IA 1GA4A 3EIOA 3OLQA 4DA8A 3MILA 1C1XA 2GBLC 1RMTA 2I33A 2VCEA 3CKKA 1KJ9A 5KX5A 3O95A 4Y2SA 3ZHUA 2CL6X 5M3BA 4PLYA 2A88A 4WLVA 4D8YA 3DAOA 3QBTA 4RPHA 2W6IA 1QBKC 4LCEA 3NHWA 4XH9B 1VPTA 4FTWA 3HXQA 1ATIA 4KRXA 2DBVO 2QX9A 4R2KA 3U62A 3IE1A 4FFWA 3B82A 4Z8XA 5CT5A 4ZGGA 1W35A 4XSVA 1R3UA 5FL7A 4YLEA 3A36A 2NTYC 1KIMA 1GQSA 2B4QA 3D4BA 5NLLA 5KTNA 1JHMA 1YJBA 3G8BA 1HZZC 3RUCA 4YXFA 4I1OA 4LI0A 1H8EA 2HY7A 4L7QA 1GTJ1 2GPTA 5DN9A 2UYQA 1DSSG 3R3UA 3JQ7A 1PJQA 3NHSA 4OATA 1F7VA 4YCDA 4BO3A 1G5FA 2H3EA 3LT5A 4I6GA 3CXUA 5L3QA 4LE1A 3N28A 3BGOS 1T9GS 2BEVB 4JHXA 2XWQA 4IM7A 3T95A 3JR7A 4JH0A 5LQNA 3VPHA 5ALQA 4LE0A 3PCXA 5KTOA 1Z5GA 2G0TA 3L7YA 1ZCBA 5LLTA 1IONA 1X8KA 1XD2A 5M5BA 4NZYA 1VYTA 1GZSA 3AEYA 2I6FA 4UZFA 2G63A 3CM0A 3MT9A 3QLJA 2ARKA 2X86A 2B98A 5L3RA 1UBKS 2O2SA 3OQMA 3IDOA 5KYXB 1MAUA 3DMYA 2VLBA 1DO8A 1DXQA 2JI6A 3C6XA 2P0YA 4JUCA 4NCKA 2OXRA 1G3UA 2VFAA 1CS0B 3UA4A 4KQIA 4FFNA 1G20E 5JQGB 3EQZA 4J9VA 4Z7NB 4IIVA 1E2JA 1MIHA 2AV6A 1SBCA 4KMSA 3SHTA 1TUGA 2C9OA 2OHJA 3A1VA 4M9UA 4FM9A 3UV7A 4ZO7A 1IY1A 4FHDA 5EMLA 3P8ZA 4YQZA 2P3OA 3SJ7A 3K2IA 3IP3A 1BSVA 3ZE2B 2BEUA 1U9ZA 3E0XA 4N3AA 1C4OA 2YJ3A 1NVKA 5JROA 3LAWA 2GVNA 1AHPA 1CUIA 4RULA 3K73O 4MQUA 1P9NA 3U80A 1EP2B 4DF3A 1U6JA 1U5CA 1UM9B 2JD2A 1T9CA 3EPRA 4QPCA 4R8RA 4JZYA 5DK4A 5F7JA 1AKWA 1I33A 2FZCA 2AKYA 3H1FA 1T3HA 2C9YA 1OC4A 3W4IA 1LRKA 4ZWNA 5DNUA 1YO6A 1TTHA 4K88A 3Q9NA 2ZI5A 1E2LA 3EGWA 3ROPA 2ERCA 3VPDA 2RFLA 1XVLA 3KKZA 1OGIA 3SM3A 3RS5A 5I7VA 1Y1QA 4KRFA 3WQBA 4GPTA 2WMYA 3FSEA 1PJTA 2ODNA 4Z4CA 4KR3A 1AUXA 2MMCA 3M6LA 2B6NA 4UATA 4XPIA 3MAJA 3C8HA 4LF9B 3G49A 4AIRA 3E1SA 3IOCA 1D2AA 3F7NA 3PF9A 2W2MA 2C8KA 4MRNA 3BX1A 3VC3A 2BMAA 2GI4A 4DUYB 2VYVD 4TV8A 3O4HA 4YROA 1I0LA 4OK6A 5BWMA 3IYLW 3R3HA 4RIHA 3F6RA 4PSCA 1E5QA 4FCVA 2DLCX 4MRSA 2XLCA 3TPZA 2VP3A 2VDVE 16PKA 2QORA 4WI1A 4B4KA 4J4TA 1D1QA 2O8NA 1KVRA 4S05A 3GLGB 3FPGA 3LCCA 4B17A 1JLLA 3W5AA 1XL1A 1H23A 1R8QA 1ZD2P 4NBNA 4RHUA 1MV8A 1TQ8A 4P4TA 3H16A 2CF5A 4E22A 3Q0IA 4ARUA 4GD3Q 1ND5A 1YI1A 1CUUA 5A3JA 4HAYA 2GYUA 5J5VA 3PHLA 2B8WA 4UVDA 3V7YA 3VR0A 2F8TA 3A4NA 4F5DA 1RYHA 4R0MA 4JA2A 2PZBA 4ZPJA 1E62A 1L4EA 4HEHA 3ZU6A 3C8DA 4ES6A 1VFNA 4LRXA 2O23A 3TD9A 1ISSA 4J90A 4NPAA 1ICEA 5FI3A 2OT3B 4MS4A 4DR5B 1M67A 2P1DA 5J59A 4E32A 1SEVA 1YB7A 3GUHA 5IZCC 3ETGA 4PV7A 4A4DA 1MABA 1MJFA 2NZ2A 2XE4A 1CR0A 5HJEA 4RA6B 2DPXA 1TC2A 2BHLA 1NW5A 2C04A 1NNI1 1N3IA 2IGBA 3JVIA 3RODA 3ZWBA 1YB2A 4P84A 2ODEA 2CHUA 1E2PA 4NBTA 1G8PA 3PFBA 4OB6A 1TJ4A 2Y99A 1JBQA 3NLLA 3OKPA 4NC9A 3HDVA 3F7TA 4BX2A 2XUQA 2GN2A 5H16A 1WBBA 1S8FA 1YHYA 2CDBA 2MWMA 3VFDA 5C37A 3BWYA 4D82A 5DM1A 2BOVA 2WR8A 3AP3A 2FOXA 1NUSA 3C7DB 5KWJA 3DXFA 1NUPA 4M8KA 4WXYB 2Z4SA 3AUFA 3O3OB 3BXZA 1MT3A 4CKWA 1C14A 6REQB 3OPNA 1HE8B 3HJRA 3T5MA 5B5SA 3BZBA 3QOYA 1OI2A 4Y1RB 5AVUA 3FWNA 1KMNA 4KQ1A 5CM8B 5K5EA 3S2GA 1XZCA 4BPBA 3BB4A 4AP5A 3DEFA 3T3OA 2SCUA 3Q85A 3UBMA 5JWRA 1IBSA 1GPDG 1L4HA 3INTA 3LH5A 5GONF 1RJEA 3CV3A 1JMVA 1PYOA 2HZ7A 2X42A 1V4VA 1MA0A 2Z04A 4ZT3A 3ZNQA 2WY2D 5JQGA 4XGQA 5JYDA 2E5FA 1SVMA 2PH7A 3GNTA 5FJJA 1SXJB 2Q41A 4IX1A 1GGEA 2O8FB 3ND8A 1DRWA 3U61B 4C43A 3OI7A 5CG2A 4KHZA 4HJRA 4C76A 1DG9A 2QZJA 3FDZB 2BM0A 3C3DA 3MTIA 4JC8A 1YDHA 2QF7A 4ZZIA 1LS6A 4HH1A 4H1VA 2RK6A 4C0LA 4AX8A 4PC3A 2YZNA 4MAMA 3LYLA 5FPSA 3CIOA 3G59A 1VZ2A 3ZLUA 3FYSA 2BD0A 4G85A 2I6TA 4DB2A 2X1VA 3DBHA 3EQ8A 4CDGA 3P9ZA 3FTFA 2G06A 3RYIB 4FOPA 2XCSB 4Q24A 4J94A 5AK0A 3PRJA 1Z5NA 4WT7A 1JDUA 1OWPA 4O02B 3QLVA 1XYGA 4RK6A 4RS4A 3IKTA 2QN8A 3UM9A 4PX3A 1ZHFA 4RDHA 4Z9YA 3IIIA 1QH0A 1A77A 3FGPA 2YWFA 1YS1X 3R76A 1M2KA 5JBNA 5LQCA 3TLMA 1JFFA 2A30A 3OX4A 2FW6A 1T5TA 3QFCA 3AB8A 4HV4A 3SQLA 4DM7A 1D7OA 4IILA 3G9XA 3PQ2A 4M0LA 1FDOA 5DV9A 3C5VA 4F2WA 3G2NA 2BVNA 1SNYA 3CLRC 4MWSA 2V6IA 3GRPA 3LP6A 1XZMA 5E7JA 5AKEA 2G5GX 2Q5LA 4GMDA 4P5EA 4U02A 3VHLB 3TTUA 5IT4A 4LWPA 3RVLA 4JEUA 5K3EA 1LPMA 1P0QA 1JHYA 1X1RA 3B1XA 4WVFA 3R5SA 5T6MA 1L5LA 1TT5B 3V6LA 1PP4A 1IBMB 5B2ZA 5CT9A 3ZWXA 1XNQB 4PLHA 4IDDA 3TGLA 2PUCA 3FNRA 2XT0A 1S7GA 2HUNA 4UHKA 2HF7A 5I8ZA 1EFCA 5IABA 1Q2UA 1QPGA 4O4HF 3E70C 3I3OA 4DV6B 3OIGA 4IP0A 4JT9A 1JIIA 1FYEA 1UOPA 4ZCSA 5BSUA 3I9V6 3TPFA 1RLMA 2LCIA 5D3MB 3H5OA 3L8CA 4GM1A 5F4BA 2WV9A 4BWFB 4E1AA 5AKKA 1QMGA 3TI7A 2Q8QA 2R60A 2MSNA 5BYJA 2J6CA 2ZJ7A 3ZI0A 3GARA 2WJ6A 4ETNA 1LW7A 4JC4A 3VTAA 4PRYA 1L1RA 2A1IA 2BMDA 4G0XA 4OJTA 1HE4A 1ZJ5A 3P9SA 1K8XB 1FTGA 4ZOAA 2MSDB 1BROA 4HL6A 5EMHA 3WK8A 1CUYA 5LBIA 4K46A 5CURA 4OJNA 1QVAA 1IE3A 3RU2A 4G0MA 5BORA 2X14A 3M6WA 4NCJA 1E7QA 3CVVA 5IMBA 3MJFA 1KAHA 4FN4A 1JIQA 2QTRA 1JHPA 2A3NA 2CLSA 3DMHA 4K28A 4QPDA 1J25A 2WQ7A 1P2VA 3LI2A 5EY5B 3E03A 3SYMA 1GQQA 1B6RA 2JJ8A 1I3MA 4ZOLA 4CGYA 1O5IA 4JIMA 1CQJA 2H8GA 3KOWA 3QHAA 3FZYA 4HATA 4PG8A 1K3TA 3R5KA 4OHBA 3T5AA 2AOTA 5G3YA 1HQCA 1PGQA 1W25A 3AJRA 2RHGB 3C6KA 4K9PA 4BQQA 4MYRA 5L8VA 2XVZA 2WC1A 4H9GA 3JQAA 3K9HA 1J39A 2W9XA 2F3PA 3Q5DA 3AY0A 5A03A 1DQYA 2QTVB 4BAZA 4C04A 1RKXA 3DO6A 5LJLA 1MO4A 3FE2A 3RF6A 1ZGZA 4OXRA 1IZYA 3IR7A 4TXLA 1NYLA 2CLHB 2AUTA 1U8XX 2FP4B 3GLSA 2EFEB 1S8OA 1WMSA 3ANLA 1NVWQ 4L02A 4LVOA 3CPEA 4QPZA 4S35A 4UULA 4QSHA 4E1BA 2I6GA 3D7NA 1RWMA 3V5NA 3LWBA 1ZC4A 5K8LA 3UT5B 1N2XA 1USKA 4IGEA 1OXKB 2PUGA 2CFSA 2JPDA 4KFUA 3NTRA 1E0DA 4TKVB 5AKXA 1ZD5A 4W5OA 1WY5A 1Z35A 1XL0A 4FOTA 1IHUA 3LF2A 2PTGA 4ZVTA 2OSVA 4IV5A 1YFKA 3M5DA 4DDUA 1VRCA 5DGXA 3KDSE 5DE3A 3GU3A 3OLVA 1JV2B 3TH5A 3QW4B 4OG2A 3GVXA 5CHYA 4LJ6A 2P4QA 1LSOA 3HLYA 1GYRA 3K8OE 4NZZA 5KDOA 5L40A 4I4IA 4KWIA 3DWIA 3VV3A 1NMEA 3CEAA 3VKVA 1EFVB 5D6NA 1EGMB 4C7JA 4PX9A 2GBGA 4MWCA 2FZEA 3RVQA 3ZY3A 2PU7A 1JE0A 1TYCA 3COVA 2V1XA 4ZOEA 4ZMSA 3CR7A 4ZODA 3FVTA 3RHTA 3STTA 2R6DA 4IGKA 5GOTA 2V7UA 1PT6A 3TLYA 2QNRA 1Y5NA 4Y2HA 3HTXA 1TVMA 4D97A 4G81A 4JOBA 4ZI3A 1N7GA 1TA9A 2C78A 5C9ZA 1YR1A 3HNRA 3PR2B 4E1VA 3RASA 1CVLA 3G13A 1NVUQ 4RENA 2N46A 4NH0A 1BHO1 2FSGA 2ZSKA 4FPXA 2CFRA 1NAHA 4IDHA 2FW8A 2F8MA 3JYHA 1UJ2A 1L5NA 3PHIA 5EHQA 1YJAA 2XMPA 3A1UA 3WAGA 2J9ZB 1DQPA 1W47A 4YV1A 3CRVA 1XFAA 2IYYA 5F2OA 4BMNA 3KSZO 4DBLC 4P4UA 1WCWA 5LOVB 1YZKA 2IH4A 2C3YA 1QHHB 3VOAA 2AR0A 2BZ1A 3I6QA 5EE1A 2B36A 4GUAA 3RUHA 4HUTA 4EAAA 1Y3DE 1PS0A 3U39A 1N7HA 3ADCA 5JFOA 1QRSA 1O0BA 3MUFA 2GZ1A 1JHOA 2BI7A 2FFBA 2YY5A 2OQRA 1CWUA 2J85A 4IJVA 2OCYC 5IULC 3RG2A 4I3FA 3HJFA 4GKVA 3PFNA 2QBYB 1HKUA 5CFMA 3ZCPA 3ZY2A 4JKOA 1XXLA 2L82A 2H1SA 2OA0A 2RKWA 3I0ZA 1ZP6A 2XNKA 1TQ6A 5KOJB 1F51E 1KETA 5DLPA 1NF9A 1OFUX 3RHSA 1GGVA 3PHCA 1TM3E 3IVXA 2Q5FA 4PGMA 2JJYA 1OB2A 2NZUG 2HHHB 3GJ8A 2GM3A 3KK0A 3NHMA 2H1RA 2VP4A 3CQ9A 5IVPA 1G9TA 2L0XA 3PQ3A 4BVEA 4YR7A 3F49S 1GADO 1SOMA 1JSCA 2ZB2A 1NP7A 2RK3A 3KAQA 1FB5A 4J16C 1E5LA 1XB2A 4IO0A 3BKWA 3SK0A 4AKTA 4ZHQB 4UHCA 1A8IA 3I8XA 1LC0A 3WKBA 3D6TB 4YRDA 2AEMA 1Z7WA 1R9JA 1KYTA 1OW3B 1T1IA 4C22A 2QUJA 2ZKIA 2QTFA 3E9RA 3MJRA 3ISJA 3FYCA 1RXYA 2BR3A 2GILA 2NXNA 3BULA 4L15A 4N12A 5K6AA 1L7XA 1R1DA 4YRRA 1EDEA 2J5XA 3D4LA 1OH7A 3CRMA 3KVOA 3J7AC 3EVNA 3DFZA 4NPHA 5A06A 4CG0A 4HNAB 4KGDA 5E8JA 2O48X 2XB8A 3N8DA 1HLFA 3KJIA 4BFUA 5CCEA 3LECA 3OZWA 4EARA 3B9PA 3LIPA 4X24A 4F3CA 4I55B 1P1BA 1SCKA 1YUMA 5AKJA 5JCOC 1NY6A 4GH5A 3EGCA 4KWTA 1DWPA 3K1AB 4LDAA 4L7VA 2QEQA 3B6KA 4MUAA 4X91A 4PE5B 1FP6A 4P36A 4PO8A 4B8WA 1H9CA 1GYPA 3HRIA 5D5QA 3T34A 5ECGC 3PG5A 4WXMA 2BY4A 3JQRA 2FN7A 1R27A 4BNUA 1EIZA 2VYFA 3AF2A 4FD3A 4HNGA 2WZBA 3AWIA 2V59A 3R5TA 1ECCA 1SUSA 3PGA1 1LX7A 1XQVA 3MN1A 4J3FA 4N65A 4NZOA 4X6UA 3KR1A 4DR7B 1FRNA 1PJSA 4MHOA 3WMFA 4L8VA 3IIEA 4MPRA 1XA0A 2IXFA 4ALIA 3ONVA 3CISA 5JVDF 4D8XA 3HZOA 1Z6XA 1FYDA 3QG1A 2BM8A 1KYIA 2FPSA 1CUGA 4LSGA 4JQYA 1N8SA 5DNDA 2OYSA 3RVOA 1Q92A 2X3FA 3G2LA 4WDQA 3AR9A 3KD2A 5AOVA 3RIGA 3A32A 3AEQB 4Z3KA 2VNKA 3AIIA 1SKYB 4RSHA 4LOHA 4LYHA 4ZP1A 4BQFA 3SC2A 1SUPA 3AI2A 5JFGA 5DCUA 4NU6A 5KYKA 3ZTYA 2AEEA 1U1CA 2DGDA 4R0VA 2GJSA 3KEFA 4L3WA 2OCLA 1LSJA 1N3BA 2XUJA 4X94A 1PN3A 2W00A 3TLKA 3NNSA 4DIKA 4DBLE 2EP8A 1N33B 3P0RA 3ZWYA 1SVOA 4Z54A 4MITA 3F46A 1GU1A 4RDIA 4DIBA 1OH5A 4TPKA 2XJ4A 1QH8A 4YJHA 5H70A 4I4NA 4IOKA 2VHTA 2VAPA 4PPFA 1FFXA 3OIVA 1I32A 2SCUB 3Q4GA 4MW5A 3ZJ5A 1MORA 1NHWA 1OFVA 1RTKA 2HRBA 5CA1B 3SBXA 2JFFA 1FX0B 1SQ0A 4JWKA 3I01A 1ISJA 1JKJB 2FOLA 2HV9A 4JUFA 4ZHSA 4UZEA 3HB5X 1LXCA 2VXOA 1D0VA 1XEAA 1PGOA 3CVOA 2Z2IA 5TC4A 1SVUA 3GGSA 4EB8A 3MD0A 3BTOA 3TFWA 4KITB 1ONPA 4DNFA 4PBRA 4JZKA 2V9ZA 1RIIA 2ORIA 3O3MB 4RIIA 3A6DA 5CDFE 1H9BA 1CY6A 2D54A 2WYUA 1SBTA 2F7SA 3WWCA 3WZMA 1J1IA 4B80A 3ZJUA 3FNGA 1SD2A 3LVFO 5MGBA 1P5JA 1T2EA 2OORC 3NKFA 3Q8XB 3DLIA 3RRFA 3HVJA 2FEKA 2HNKA 1C8BA 4WZBA 2ZANA 1OE0A 4V3BA 5EUMA 4IWYA 3M8KA 3O7MA 3WGUA 1K7SN 4YAUA 1R3DA 2FVXA 2HD4A 5E0OA 5KX5F 2HT1A 3NBFA 3DMTC 4NAUA 1V5GA 2N47A 2JATA 2AN3A 4PO1A 3PSHA 2GAIA 4R69A 4TLMB 5CX4A 1SXHA 3I2JA 3ITKA 4X1YB 3BEOA 3QE3A 1WHTA 4GM0A 2XMCA 4P7KA 4RSRA 2GS9A 4GKKB 5ENDA 4MICA 1SJ9A 3JALB 4EG5A 2FR0A 4ZHQA 1H1LB 3BTSA 1U6KA 2H06A 2I6UA 2WILA 1X1BA 4JYCA 4FMDF 4NBRA 3CGGA 1XLTA 3A4IA 4RX1A 5KQLA 4AS1A 3PEFA 3AVUA 3VU1A 2ZS9A 4NVRA 5LYJA 4JJIA 1IMJA 2B7LA 2QNIA 2ZBUA 3UWKA 4RKEA 1K4MA 1DEOA 1DTWB 2QTTA 3IEUA 4ZVRA 3V6MA 4EB0A 2VHQA 4ZCRA 1EWKA 1TF7A 5JT1A 1B0ZA 1CVRA 1RQNA 2EYUA 3C0KA 1H2YA 3HRHA 3LVQE 1ZWKA 2V98A 1C0EA 1T5OA 1ZSVA 2WWXA 3K53A 3LK6A 4X1IA 1SCUA 1V41E 1MHPA 5DZSA 4MHTA 1J0XO 3TOXA 1D03A 3E7XA 4Z0PA 3S1AB 3BZWA 4Q19A 3SEFA 3R7LA 1MO2A 1QG4A 1XWFA 4IUCS 3KWLA 1U8YA 3AQ4A 4BP9A 3AUAA 2RGCA 4P86A 3NWJA 4B75A 3HYCA 3KLPX 4KRGA 3NPMA 4HX5A 3L8HA 5D1NA 4S2EA 4L85A 2BHSA 1IYZA 3JQGA 4NDZA 1YCGA 2M1XA 4LK3A 1B4DA 1F7UA 4CQMB 4P0QB 4MS3A 1ZVQA 3KKPA 4ASUA 4KE9A 5E6SB 4EY8A 2P9EA 5LP6F 1NJSA 2I7DA 2G4LA 3UATA 2NVOA 4N0PA 4RVSA 5CG1A 3TQOA 2Q6OA 4A6XA 1VPWA 1KDOA 1R6AA 3NJ4A 3ETDA 1CUJA 2BEUB 2ZLBA 3AQIA 3DPIA 3IDQA 3O6VA 3QA3E 1NLUA 4GQIA 4KDEA 4M1SA 1PK8A 1ISMA 5CDHA 1SBZA 5D7NA 5TJ9A 1MRSA 1SCJA 3ORRA 1GUBA 3WKEA 3HJNA 3R9XA 1QCYA 3JZIA 2FMHA 2FUKA 2J08A 5ESRA 4EJFA 1IL0A 4X54A 4ISBA 3KD3A 4IKEA 1O97D 4I9NA 3PQDA 1IQ0A 3OHMA 4C9BA 1BXZA 1IY0A 2V97A 1GLGA 3D6JA 4ZVSA 4LYEA 4DMLA 3A6LA 4LDQA 3ZZ1A 3ZHOA 2Y66A 4J4HA 3VVLA 3L6BA 3OKAA 3ZE8A 5C1BA 2GKSA 3PNOA 3BMXA 1Z34A 2ZBGA 3OOSA 3U9LA 4CL2A 5HX7A 4HGPA 2R8EA 4WW0A 1GCOA 4HEA6 4B6QA 1U11A 4TV9A 4WOKA 1GGKA 5ICCA 3L7DA 1CQXA 3WY9A 4G1FA 3DL4A 1N78A 2HA3A 5C3MA 2HDHA 3O4VA 4FKBA 5LZ8A 3VU3A 5L4LA 2Z4TA 2GZMA 1J97A 1RI3A 3HACA 5AIAA 1X8XA 3I8SA 5FHRA 5ARBA 5DMXA 3TVDA 3U7GA 3OQ1A 2NZYA 3FKQA 1FS5A 1D2EA 3OE7A 5FBLB 4D3DA 1X7WA 1PV4A 2R6JA 1EHIA 1WL8A 3HA2A 4IJQA 2OV3A 2FPXA 1JA1A 1N3YA 4OM7A 4AF6A 1SBYA 2EERA 3GFTA 1XV5A 3QF4B 1J9EA 1G20B 2R5FA 2VRWA 1P9WA 1W1WA 2WPNA 1RPJA 5DTIA 2HQSA 2P3LA 2Q4EA 2IU4A 2VF7A 3KYDA 3M9LA 3SMQA 4Z86A 5EC8A 1SUAA 2OQIA 3RSZA 1P6UA 3LFUA 2VPIA 3DZFA 3EC2A 3LPCA 2J0QA 4Z99A 4FBGA 3JYPA 3NG1A 3D54D 3LDAA 3OE5A 1SKBA 1BYUA 5TF0A 1SRRA 2XA2A 3H9JA 2J7PA 3IPAA 3PUHA 5JZOA 1JLSA 2R97A 4F5WA 2IHZA 2HIMA 4WFJA 1PHRA 5HM8A 1QO9A 4M9RA 2Z4RA 3CFYA 1Z4KA 5THQA 5LMUB 1XQYA 2RCYA 3PJGA 5HWSA 2AI1A 3F9RA 3NTXA 4RD1A 3UMRA 1SU8A 1OREA 4LQ4A 2VNJA 3E58A 4OUDA 4QJ4A 1ZKMA 2AEJA 4D4JA 4OJQA 2ZSFA 3HK2A 4FX5A 4RANA 2NU6A 5HRAA 3WB2A 1GKIA 1RT9A 5HZGA 2PLRA 4GHWA 3LLSA 3G0HA 4CTMA 1H4TA 2QTZA 1X3LA 1NY5A 4FS8A 3TTXA 3V9AA 1EE9A 2QJWA 3ABQB 3CINA 5DCYA 4XGNA 1ZVJA 3ON5A 5ALNA 1MEEA 4QEDA 3UWMA 3BD8A 2XZOA 3DB2A 2PR7A 3CIFA 3EVZA 2V4MA 3TZ6A 4KH0A 1QBGA 4DR4B 4QBKA 1YQDA 4W7SA 3PEWA 1KVTA 2IWRA 3U0VA 2WTAA 1WXDA 5A5EA 1WXWA 5C52B 2QR5A 4ECEA 1GFIA 4YCAA 3JVEA 3PQ4A 5ALKA 4XTRA 2J59A 4QLOA 3STUA 2ZETA 3G8CA 4B33A 2G09A 3B38A 4R0NA 5MN4A 1DFIA 1GNLA 2OZVA 5IS2A 1BDBA 1U7ZA 2O06A 2HNBA 1O0SA 4V2UA 1BQ4A 3ESZA 3A37A 3D7MA 3NIWA 4HAVA 4KXFB 1GSIA 2PSDA 2PVCA 3TLZA 4ZYTA 3FDJA 4JI8B 3PCRB 1RFGE 5AESA 1GL9B 2RAFA 3AR3A 1XT6A 1M2WA 3G0IA 1Y8RB 4JB8A 4RQUA 1R4AA 5AKZA 3U4QB 4ZYVA 4M0UA 3NOVA 4RC9A 1BH2A 1KH3A 2Y2VA 1MDBA 3CTPA 4Y2RA 4QKQA 2ILVA 1XBTA 1ZJWA 1Z06A 5DSXA 2W2PA 1C3LA 4M99A 5BN5B 4CETA 1ZESA 1K5DA 4RO0A 2TECE 4WINA 2QW8A 5JCOA 1ULBA 1I01A 3H6GA 4FDTA 4WY5A 3EZXA 4ZKDA 1KYXA 4BFSA 4OHPA 3R7BA 3NC0C 1L5VA 4PBSA 3IAXA 3O84A 4H7KA 4R1QA 2O8BA 1WOMA 1N0VC 2DFNA 5JW6A 1VMKA 4K7JA 4KGVA 3TIVA 4EF4A 2W6NA 3FDXA 4MARA 3LV8A 1G98A 3MJ4A 4KJZA 3ROKA 3P97A 3QI7A 2OLKA 1EEHA 2D8MA 5AI6A 3CLUC 4YVFA 2JCBA 3HYLA 5I48A 2VUTA 3KKEA 3NC4A 5HRUA 4Z6KA 2O8CB 3KZCA 1FX0A 1VYUA 4PTYA 2P5YA 1TM1E 4TKLA 4MGEA 1CUWA 1P0IA 1PJ4A 1U4SA 3ES9A 3G68A 5FADA 4IXTA 3WV5A 1BFUA 2B8JA 5FL7D 3LX5A 4OSOA 3RUPA 4C0KA 3LT2A 4TL8A 4Y67A 5B58C 1WQ1R 3VRHA 5DLYA 2P2ZA 2VWQA 3NHPA 3EVAA 4GZLA 4ZC1A 4FEGA 1QUEA 2HDWA 3TL2A 3DOJA 5L6LB 2WHQA 3Q88A 1YAJA 2Z8YA 4MV3A 1JDSA 5ITZA 4X3OA 4CV3A 2XUDA 3FIUA 1G8MA 4GXQA 4B5LA 3SCZA 4AT1A 4L73A 5BURA 1NQOA 4LMBA 2W71A 1JPVA 3MFQA 3E18A 2W22A 1JECA 2EFGA 1FMTA 1HLGA 4FR5A 2GO1A 2WJPA 1PR3A 5AH0A 3X44A 1NRIA 3GL9A 2GAOA 5JEEA 3FHTA 3SF8A 2Z6VA 3JQ8A 1TX4B 1H42A 3U3OA 1RYDA 1KL7A 3PCTA 2R7LA 4U7GA 1KFEB 2X0DA 3OTIA 4TYMA 5FAXA 3HN2A 5H3CA 1T6NA