3A1VA

Crystal structue of the cytosolic domain of t. maritima feob iron iransporter in apo form
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
254
structure length
252
Chain Sequence
HMVKVALAGCPNVGKTSLFNALTGTKQYVANWPGVTVEKKEGVFTYKGYTINLIDLPGTYSLGYSSIDEKIARDYLLKGDADLVILVADSVNPEQSLYLLLEILEMEKKVILAMTAIDEAKKTGMKIDRYELQKHLGIPVVFTSSVTGEGLEELKEKIVEYAQKNTHRMILDYGEKVESEIKKVENFLRDKKLRINPRYFALKYLSGDPEFYSEGVKLGLPELSEEERIGYRLLIAKRKREYVENVVKEAFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Iron(II) transport protein B
publication title Structural basis of novel interactions between the small-GTPase and GDI-like domains in prokaryotic FeoB iron transporter
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transport protein
total genus 87
structure length 252
sequence length 254
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02421 FeoB_N Ferrous iron transport protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3a1vA01
2FFHA 4FIDA 4WXRA 4FCTA 4A6XA 2VYFA 2RGNA 5CK5A 4GP6A 4X8HA 1E1RD 4IRUB 3C15C 3U2QA 3FMPB 1YRBA 2PLFA 3I72A 5FUXA 4HUTA 2CHVA 1FNMA 2QU8A 1XZQA 4YDHB 3T1VA 4F7WA 2K5UA 2BHRA 3N2EA 4V0KA 4R71A 3SN6A 3BORA 3P4YA 4PX9A 2R44A 4L15A 2CVFA 3VR5A 1XMVA 1XP8A 4ON9A 1NBME 1SVSA 2GJKA 1AS3A 1NY5A 3AV0B 1T91A 2G88A 2D7DA 4PQYA 2QTVB 3AF0A 2N1BA 5BN5A 2YC4C 2J5XA 3LV8A 1OFUX 5TY0A 1D9ZA 2XZPA 2OM2A 3GFPA 3I4LA 3TKLA 5F3WB 1CJMA 1VG1A 2BKEA 4BFWA 5FH9A 4Q5IA 4JL5A 4MGZR 1L4YA 2EWVA 4QBIA 3GLGE 4BFVA 4AKIA 2QPOA 1KK1A 3FKQA 3TAUA 3B82A 1GM5A 5GADl 2F3TA 1UBGA 4PAMA 2J59A 2QT0A 1PLKA 3TSWA 2BBWA 1E9BA 4OBEA 2A3RA 2H8KA 4JKIA 4DT1B 2J0UB 4RD1A 1H65A 3T12A 3HDTA 4LHWA 2IW3A 4M1YA 5AJXA 1F6BA 4YMUA 5FPYA 4RD2A 1U94A 2ZUDA 5AUNB 2OFXA 5DNYB 4LJ9A 2C78A 4UNNA 3I3SR 5KHOC 1QDEA 4BLRA 1K8RA 5SZKB 1AKYA 2IYZA 2V6JA 2GJ9A 1A2KC 2C5LA 1CJVC 1P2UA 2DFTA 4NU0A 2JLZA 4EFMA 2PJZA 1NVVQ 4X8OA 1NLYA 2ORIA 4LBVA 1ZIOA 1UKYA 2ZIAA 4A6PA 1ZP6A 1CR1A 3REFA 2F1IA 1COWA 3VR2A 1D9XA 1UPTA 1P2SA 3LX8A 2J3EA 4US1R 2PEYA 5DHFA 5EXPA 3TQCA 4ZI3A 1ZC3A 3NVAA 4IDOA 1E9RA 4PPNA 4Q21A 1M6NA 2CL0X 2JLQA 1K5GA 2C2HA 1K5DA 4NYIR 4A15A 3B85A 3NHAA 4Q66C 4YLGA 4AWXA 1E0JA 1SKYE 3V00A 1FP6A 1PV4A 2WKQA 1E0SA 1OIWA 1VPLA 2GRJA 3RS0A 3TK1A 3HU1A 3DDCA 4Q18A 2ZI4A 1X8JA 1II8B 4G1UC 2JIZA 3K09A 3TRFA 4EAQA 2WSSD 4IOMA 2WV9A 2XX3A 4BE7B 2ZJOA 3K0SA 1XCPA 4Q7JB 4B3BA 4ZIRB 1KI6A 4IFBA 2B7BA 4JLAA 2OBLA 4F91B 1FMLA 5DYGA 4PTLA 2P6RA 3Q8XB 3D3QA 2R2AA 1Z6XA 1B23P 1KI4A 2GILA 1E9SA 1G5RA 2JGNA 2C9YA 5HPYB 2VSXA 3THYB 4NMMA 4RVCA 3W6PA 5CYOA 2WWHA 4NONA 5JSZB 2QPTA 1HEIA 4HAXA 4ARZA 2V3CC 3H1TA 4PSAA 2G6BA 1S0UA 3NBZC 4HDQB 4LJ5A 3BERA 1NBMA 4R98A 3R8CA 1NN0A 2ZI3A 4GMXA 4KSCA 1DAGA 2I3BA 2YV5A 2WOOA 2QMHA 2GWHA 3GEIA 2RGNC 1IQPA 3RSOA 2GCNA 1XPUA 2QMUA 4OQXA 4V0OA 3KB2A 3DOFA 3GLGA 1KIMA 2A5DA 1W0JA 1EG7A 3KQUA 2ZANA 1W2GA 4C7OA 2G0NA 1J2JA 3CF0A 2C03A 3AVUA 2GXAA 5FL7A 1E0AA 2CXXA 2WMOB 3OF5A 3WMFA 4M9SA 2CHQA 1XJCA 1Q1BA 1T3LA 2QQ0A 2VP4A 2ORWA 2G3YA 4JVMA 4PZZA 4Q48A 4C0JA 3VKWA 4GOKA 2J41A 1AQYA 1ZNYA 1S2MA 2CBZA 5FBRB 3K70B 2QY9A 1RRFA 1XJQA 3QI2A 3T34A 1U2RA 3DZ8A 1N6OA 4MYCA 1NVVR 3CPEA 3W6NA 4BFXA 1AGPA 2F9LA 3E2IA 5L3VA 3DM5A 3TVTA 5KNDA 3BXZA 1ZIPA 3SR0A 4DUGA 2A5GA 4EPYA 1ZM3A 2PEZA 2F1JA 1SGWA 2ZS7A 3VR6A 2LKCA 2RGBA 3BS4A 5KPJA 3BB4A 1CRPA 4NDZA 3MWJA 5ELXA 1N5IA 1KHTA 1Z3IX 4KVGA 4XH9B 2B8WA 4D0GA 4ZDWA 4N1AA 1LV7A 1II9A 3A36A 2GXQA 4DLTA 1OYWA 5EE1A 1ZMXA 4KU4A 2CJWA 3P4XA 2ONJA 2PBRA 1E9AA 3TMKA 1II0A 3NBYC 4LDJA 4ZCLA 2D62A 4HAUA 3U5ZB 1JEDA 4DB4A 3VKGA 2JJ2D 3ZYCA 1JB1A 2A7QA 1S9HA 3VU9A 4IDPA 4DCTA 2EWWA 1XD8A 1W48A 1E2NA 4US2R 4IOLA 2EQBA 4NCNA 2VF8A 2VP0A 1ETUA 1QHIA 4B3CA 4CDGA 1GWNA 1CULC 2ZJYA 1EXMA 3BAFA 2V6IA 3WMEA 2C9CA 1E2FA 2RB4A 3NXSA 2IUSA 1IY0A 3V4FA 3AVPA 3W5IA 3SFZA 2JASA 3OFND 2ZETA 3QSYA 4JBWA 4YQFA 2G1KA 1FX0A 1X3SA 3U3JA 4DXAA 2GESA 4TT3A 2VP6A 2FSIA 4LHZA 4BLTA 4HAVA 3K0FA 2WAXA 1MKYA 2CL7X 2OG2A 5AUPB 3PVSA 4BEJA 4Q9HA 4BZPA 1E98A 1R4AA 4PAOA 2VO1A 4EKDA 1A2BA 1E2QA 5BXQC 1CJUC 2XITA 3A4NA 1XTJA 5EUMA 4KJZA 4NE2A 4KYIB 1XPRA 3IUYA 4B3DA 3PG5A 1ZUIA 4CZ2A 2RKOA 3RABA 4BQSA 3K8YA 2XSZD 3ECCA 4LJ4A 2WZQA 2AWOA 4DCUA 1S1MA 4G5SA 5HE8A 3O8CA 2QORA 2EFCB 1N0WA 2XTZA 4Q9JA 4RKFA 4WZAE 1TX4B 1WP9A 2IF2A 4F38A 2OESA 3FOZA 2XTNA 1U9IA 2QP4A 4XD7D 1G3QA 1KMHB 3DO6A 2EFHB 1SXJD 4PC3A 2A78A 2BOVA 5EE3A 3GJ4A 2WWIA 2ZQ5A 3L0OA 4ASUA 3GJ3A 2PZFA 3GLIE 2QP3A 4D6PA 2I1VB 4ZKEA 1A5TA 3DOEA 1GRQA 3Q72A 1NNEA 3HYRA 5DSZA 2O0KA 4B44A 3ZVMA 1GNRA 1BOFA 1YZQA 3CZPA 2VBCA 3RNLA 2DPXA 4HEJA 3GLFE 2ZRNA 1DAMA 1VG9B 2FZLA 4M22A 4JBYA 1SVLA 2D4HA 3QF4B 2JATA 4LV6A 2VA8A 1KO8A 2FOLA 3PR1A 3C5CA 4CF7A 2RGAA 3SJAA 3ZQ6A 4GSYA 4W9MC 1NMXA 2ZYVX 3PFIA 3AGQA 5CJ2A 2OCPA 5CDFE 3QKUA 4C7OB 4EFNA 5GVSA 1UBCA 3QEOA 4XSGA 1MOZA 1NP6A 1XJ0A 4OQMA 1OLOA 2WM9B 4ACBA 4PSKA 1D2NA 1NI3A 4L4UA 5BWMA 5L8VA 1ONBA 1TMKA 1JJ7A 4GT1A 5JRZA 2ZM5A 4YXWD 1DTSA 4RSGA 2CNWD 2UZIR 4L5BA 4GP7A 1E0KA 4RFVA 1KJWA 2WJHA 1CKEA 2QROA 3CPHA 1I4TD 3KTAA 2CCJA 4A0HA 1UKEA 1HY3A 3CRRA 4C2TA 3HPQA 2XNDD 3N70A 4RY2A 2CK3A 2GCPA 3RSLA 4Q9IA 1H8HD 1HYQA 3IDQA 3MJRA 2J0QA 1W7AA 5FI1B 1DAIA 2DWOA 3FMFA 4D26A 2ORVA 5EXSA 5JZVA 1XBTA 2HF9A 1RRGA 1KK2A 3I32A 1U8AA 4UNQA 3X1ZA 1FQKA 1E9DA 2AKAB 1JXMA 3JZMA 4CEIB 1ODFA 2F43A 4L9WA 4P4SA 3VAAA 3DM9B 1SKYB 4FMCB 4JIMA 4GDFA 3KJGA 1T8TA 4JSTA 3BC1A 1ZW6A 5JCZA 4P31A 2QE7D 2OXRA 1M7BA 4TL7A 4JZKA 4URXR 2GJSA 4JLJA 5CK4A 4Q1CA 2FFBA 4HSEA 2JLSA 4KYUA 1XMSA 1U8ZA 1AN0A 4QNRA 4TQ9A 4WXPA 3AVVA 2DFLA 2ZRCA 3DHWC 4M8NE 4LYHA 3PENA 2IX3A 1X86B 4JT4A 1DAFA 2CCGA 3FE2A 3EA0A 4GPTA 1KNXA 3AP1A 1F2UA 2FWRA 2YWHA 4OQFA 3GLIA 4MRSA 2RHDA 4JS0A 1UBFA 1ZNZA 2JJ1D 2FFAA 1N0VC 5BQ5A 3C16C 4DDVA 4JLNA 2ERXA 2QP9X 4LJ7A 1FP7A 5G3YA 1RVDA 3TQFA 1TEXA 1G20E 1XXHE 2C04A 1BKDR 4CW7A 5JFGA 3RDPA 4D25A 5H68A 1SQ5A 1R0XA 3NH9A 3K0CA 5AK0A 1OH6A 5JRJA 1R2QA 3EG5A 4E5UA 5LBIA 4K81B 4DBLC 1RIFA 3MCAA 4LJAA 5JMTA 2PT7A 4P33A 4Z54A 4BECA 1BMFD 2O8CA 1WCV1 2O8EA 2QT1A 2QEQA 1K6MA 4QBHA 4PHGA 2ZUBA 3LH5A 5CDFA 1GNPA 3C5HA 3IPYA 3U60B 4JSYA 2B8TA 5DI3B 2J46A 2MMGA 2FV8A 4DJTA 1A7JA 1YR9A 3CR7A 3TNFA 1T3HA 4DB2A 1MT0A 3RS4A 1E9CA 4WBSA 1QZXA 3SC3A 1ZNWA 2VRWA 3ZVNA 2UZ3A 3GJ8A 1WB9A 2RGDA 3MUFA 1IN8A 3EASA 3OEHA 4C0AC 3SQWA 2WVJA 2ODWA 1Y3AA 1MRNA 5CJPA 4LC1A 2Z6VA 3AH8A 4H1UA 1XWIA 3KKNA 2XOKD 3KFVA 1EFRA 5GJBA 1L8QA 1P75A 4YMSA 1DBSA 1KI8A 4QG7A 3GMTA 3VHXA 4DSOA 1N6RA 4TMKA 2GCOA 3ONWA 3QJYA 4CIDA 3QIAA 4JLDA 3KB1A 2H92A 4F92B 3U7GA 3KFXA 2AD1A 4YDSA 4B33A 2XXAB 1AK2A 2O8FA 3WYAA 4JVLA 1GUAA 1LTQA 1P9NA 3K0AB 2D06A 4PPGA 2PL3A 3EARA 3Q5EA 3RS7A 1S1CA 5KUTA 4BRWA 4ERNA 1EGAA 3WNDA 1KI7A 3HU3A 3NEJA 5DLQC 1QHYA 2Q6TA 2W6JA 4TZ6A 1Z8FA 1J8YF 1HT2E 1BH2A 3KL4A 1GL7A 2FPMA 3X1XA 4DLRA 2JLXA 2FH5B 4G0NA 1NF3A 1QHNA 1FNNA 2HLDA 2IYVA 3L8ZA 2QAGC 2IS1A 4C3ZA 3U4QA 3LQQA 2D2FA 3D7MA 1CIPA 4GZMA 2WSMA 3IBGA 1YR7A 2ZYWX 4NPHA 2GTPA 2ZJZA 4A92A 4DRZA 1R0YA 1RC8A 4RD0A 5H8WA 1N0UA 4RD6A 4PR0A 4B3XA 4QKQA 4RD4A 3HJNA 3E1SA 2QSZA 4TN1A 1XXHA 2C96A 1ZCBA 4MRVA 5CIQA 3U3KA 1HURA 4EQ6A 3FPAA 2FEOA 4L9SA 3X1DA 3AVWA 4HAZA 4DDUA 5AUQA 4DHEA 1CLUA 1SKQA 4G5OA 4ILEA 2J0UA 2ASEA 3QXHA 4JKYA 3CNNA 4JL6A 4U00A 3ADKA 1AKEA 2F43B 4P4SB 1OB2A 3GJ7A 4AC9A 2IT1A 4NCJA 4BFYA 2GVZC 4ZKDA 1O87A 2R9VA 4OJKA 1G21E 1HT1E 2I4IA 3AKCA 1CS4C 1X1RA 2BDTA 1H8ED 1WQ1R 2OILA 4KFSA 3QY0A 3RHFA 4PZYA 3SJCA 1T3SA 1N2CE 3D31A 1JBKA 3OIYA 1L4UA 4XIGS 2DFNA 1OSNA 1ESNA 1OKKD 3SDZA 3ASZA 4TYNA 4PO8A 1G3RA 2XJ4A 3BWDD 4A2QA 1KY3A 1G3IA 1DPFA 1KKLA 1ANKA 1E2IA 4M9ZA 4OK6A 1IY2A 3CR8A 5E7IA 3AP2A 4OI0A 2VHJA 1LY1A 2KE5A 5JWOA 3P32A 3BK7A 3QUSA 2XTMA 5JLJA 3WNBA 2AFIE 4JJKA 4BFTA 2W00A 1KI2A 1VECA 3K0EA 5BN3A 3RLFA 3F5FA 3DEFA 4TYPA 4ABYA 1OFIA 1VMAA 3GEEA 3GJ6A 4OI2A 3PUWA 4GRAA 5HKKD 2A30A 5IK2A 2VHTA 2O52A 2Z43A 4Q7MB 4AG6A 4QM7A 4BFSA 4JVNA 3GLFB 3CUEF 1R5NA 1JR3D 1OFHA 4W5HA 3IO5A 5P21A 4PHFA 4YMTA 3FKSD 1QHHB 2Z4SA 5CYPA 1YHNA 2QRNA 4B6EA 5LD2C 5DO9A 3KQHA 4G5RA 3W8NA 2B92A 1LVGA 1YZLA 2PX0A 1KI3A 4IXNA 2WJIA 2J9RA 2DCUA 3B13B 1OXTA 4I81A 4F4CA 5J4HA 4KBGA 1UM8A 4OQLA 2QRZA 2NIPA 4K46A 5JI3E 4DDWA 5KNCA 4WZ6A 4M21A 4A8JC 3THXA 3SYKA 1EX7A 4IVQA 4MGKR 4GNKA 1J8MF 4TMTA 5FUWA 4Q1EA 1HV8A 4TLDA 2QUZA 5HCNA 3H4MA 5TDHA 3GFOA 3P1JA 2H1LA 3BH6A 4MUBA 5FTJA 2F3RA 4QHSA 4TYQA 3FMOB 4AKEA 3WHKA 4KAXA 5L3SA 3HR8A 3AKEA 2NO7A 3A4MA 1Z6GA 3D6TB 1PJRA 3V4RA 4JVSB 1AGRA 2B7CA 2GAOA 4BUJA 4V0ME 2GCOB 2ZUCA 3KKOA 2PLRA 4HDCA 4AK9A 3T15A 3WXMA 1RYFA 1DO2A 2WMNB 4MDEA 2O8FB 3EAQA 3HYTA 2DWQA 4HLUC 4P32A 2FJUA 5BYJA 1FUKA 2J7KA 4B3GA 3PQCA 1AZSC 5GJCA 3CF2A 3U7EB 2ZSAA 1W47A 3WRXC 4D82A 3ETLA 1KGDA 1E2DA 3C14C 1NIJA 4TMZA 2VEDA 4MKIA 3NC1C 3VR4A 3OAAA 1DEKA 1JPNA 4A1FA 4HDOB 3ZS8A 3SNHA 4QHYA 2ZS8A 4UQOA 3Q5DA 3U4QB 2X2FA 4O25A 4MRPA 3I1FA 5FOVA 3EWAA 2G77B 3ZLJA 4H1VA 3EZ6A 3PUXA 4U5XA 4TLAA 1Z47A 3MWLA 4HZUB 5E95A 1S4QA 2RGEA 1I2DA 2P2LA 1W5SA 1GIAA 2GBLA 5FOWA 1XXHB 1HQCA 4EQ6B 1SULA 2IF0A 2WPDA 4UXHA 4TLCA 4M1MA 3IEUA 1NJFA 3KX2A 3UATA 1N6NA 3WHLA 1S3SA 1Z2CA 4I99A 1OFTA 1Z0FA 2FU5C 4A36A 5G41A 3SHWA 3AVXA 3AVQA 4LOAA 1SHZA 3AF1A 2OCYC 5GJWC 1D8TA 2V8OA 3QBVA 4AIIA 2IYTA 2ZRJA 3PITA 5EZ5A 1FTSA 3LW7A 3BB1A 1E94E 2BMDA 1U0HC 2VL7A 1G19A 3KDSE 1Q22A 1GVNB 1ZAKA 2IXGA 3ADCA 3EIHA 3IKJA 3X1YA 2F9MA 4DUGD 4NYJR 1GILA 1W46A 1SVIA 1G17A 1Q1EA 1JNYA 2FSFA 2VIIA 3LAWA 2IL1A 4KSBA 4IW3B 4YMWA 4A0GA 3QG1A 1CRQA 3OEEA 2ZI7A 2O8BA 2A5YB 5TV2A 4Q00A 3IQWA 3QXXA 1YVDA 2Q9AA 2GJ8A 2Q9BA 5J4LA 3FFAA 1AJEA 4KFRA 4WIAA 2ZI6A 3A1VA 4TYYA 4UKDA 2LCFA 1T4GA 4QL3A 4CEHA 4V0MA 4DZZA 4J0QA 1NN5A 2RCNA 1PUIA 1RZ3A 2ZJBA 3QENA 4TWZA 3QXJA 4JJZA 2REBA 4GOXA 2V7QD 4JT2A 4P3YA 2KSQA 4FMBB 1KMHA 2ZAOA 1ZM4A 3Q7QA 4NP6A 4ITRC 4QGAA 2GK7A 1Z08A 2FGJA 2QPAA 1W4BA 3JZAA 1W49A 2X19A 1YZNA 3PXGA 4ACAA 1YU9A 1E4VA 3VKHA 3EPLA 1Z6TA 5B58C 1YJ5A 1I4LD 1F2TA 2ATVA 3AP3A 4WW0A 2YNMA 4IEIA 2NO0A 3UWOA 1G7SA 2HCBA 5KSYA 4RCYA 3TGPA 3QVUA 4D4JA 4F4JA 3B1WA 4KLNA 3RWMB 1NSFA 1XTRA 4HAWA 5SZJA 1LB1B 1XB2A 4B73A 2QGZA 1XTSA 3C7KA 2AN9A 1E1RA 5UKDA 1JI0A 2BVNA 3QF4A 3K70C 4KHZA 3NDPA 3F0TA 2DYKA 1M7HA 2XEXA 3KUDA 5L3SB 4EDHA 5FOUA 2JLWA 3DPUA 3SEAA 3BBPA 2CHGA 5FL3A 2NQ2C 1J70A 4WVFA 5A4JA 3VTKA 3EC1A 1OXSC 2VSFA 1A1VA 1Z29A 2CLDX 4XTCS 2P67A 5DN6D 2ODEA 1D2MA 1P4SA 3CH5A 2AXNA 2XAUA 2ZU0C 5DYIA 2OCBA 3ND8A 3GD7A 1KDTA 3AF2A 3UXMA 2G1JA 1WDTA 2GBLC 4URVR 2ODNA 5B2ZA 1BO6A 2IBMA 3DKVA 1IXSB 4XJXA 4E09A 1LF0A 2IYRA 3KXKA 3WMGA 4L16A 3LD9A 1P61B 3CH4B 2IK8A 2W0MA 3QKSB 4CYMA 3FHOA 3DZDA 3B6EA 2IWRA 1G8HA 1NSTA 4JBXA 3ZDQA 4EPTA 2G83A 4H9GA 4N0EA 1SHKA 2FF7A 3NBXX 4D0LB 3NHBA 4QFMA 4NHOA 2RAPA 3MFYA 1HQYE 4I1SA 3ICQB 4ESVA 2H5EA 1EFCA 4X8MA 1W5TA 2VPPA 3CX6A 4Q01A 1UDWA 4BLPA 4CEIA 2PCJA 1JALA 2ZJ5A 5CB6A 1G41A 3UWKA 4O3MA 4HUQA 5FTLA 2PMDA 3FTQA 2OT3B 4PHTA 2QBYA 1NRJB 5KNBA 4RFSB 5JECA 1TL7C 1CBUA 1IN5A 5JJLA 3BB3A 5JJIA 1VKJA 1MRSA 1NMYA 4FMDB 2NPIA 2KWIA 3R9WA 3AM1A 5IF9A 2C98A 3R9XA 2C95A 3EW9A 5JHGB 1YRAA 1W4CA 2C9OA 4LSGA 4ZDJA 3NG1A 3PV0A 3T1TA 4LYAA 3CRVA 4NZYA 1ZD8A 421PA 3C4JA 1R0ZA 4TTPA 2ZREA 2JA1A 1PVOA 5DGXA 2ZI5A 1U0LA 4PC6A 2BBSA 2WSSA 3EZ7A 3ZZTA 1TU4A 4IVPA 4ZV4A 3K09C 4LGMA 1UEIA 1G64A 1QHXA 1QBKC 1Q3TA 4JYCA 4OHVA 4QNMA 4R2HA 3R7WA 4C0BA 1Z5ZA 1TPZA 2GJAA 2ZROA 3M1IA 3NC0C 5JWRA 1W4RA 2O8BB 1KDOA 4FI3C 2IWHA 3RANA 2ZJAA 2A5FA 2WIAA 4FD2A 4L8GA 4CVNA 4TL9A 4B43A 4OI1A 4EUNA 1R0WA 2GEDA 1S8FA 1W1WA 4KI0A 4B34A 2FSGA 1G8GA 1Q0UA 2AD5A 3TJZA 3UMFA 1W36C 4DCNA 4MITA 3SJZA 2WJYA 1N3BA 4CEHB 1FMJA 3THWB 1N6HA 3K1JA 3W8RA 1HA3A 4MYTA 5DI3A 1XFAA 4JLMA 4CT4B 5FBVB 1XRJA 1T6NA 3L0PA 5FTNA 3LY5A 1LS6A 3UG6A 2JLUA 3OE7D 1L7VC 4TL8A 2HJVA 1UBEA 2W2XA 3VR1A 4TTRA 2WHXA 2BMEA 2AKYA 4PO9A 4FWIB 2HXSA 1F2TB 4P0TA 1VTKA 2E1RA 4OK5A 5EE0A 4TQAA 4KVAA 4RZ3A 2PX3A 4LJ6A 4I1VA 2W6ID 4TLEA 1RPZA 3PUYA 4CRWB 1E2EA 1FPMA 1JECA 2YWEA 4AYWA 1SXJE 2EW1A 3KKQA 1UFQA 4MKHA 1KK3A 1Q20A 3TW4A 2XXAA 3K0AA 1XNJA 3MG9A 4Q19A 1XTQA 4HB4A 2EYQA 4B75A 5IT5A 4C0KA 1KAGA 1G5TA 4AI6A 2ZJ8A 4V03A 4Z8XA 1E9FA 2R8RA 3E70C 1CXZA 1G291 2UKDA 3N5CA 1VYTA 3DL0A 4Z1MD 3ICEA 4TZ0A 4DLYA 2ZRIA 3ZD7A 3MWKA 3RYTC 4LRWA 4QBFA 1D5CA 5B64A 4EPRA 1IXRC 3PJRA 1C4OA 4KXFB 1WBBA 5L3QA 4B6FA 1OIVA 1G8FA 2H18A 3UMRA 4Z51A 2XB2A 3U7FB 1EWQA 4NCKA 2FE4A 1IN4A 1F3OA 2JJ2A 5AJZA 4LI0A 2GEUA 5KDOA 1CR4A 3W9YA 4HI0E 5C2JB 5FUVA 1KSJA 3TSZA 2BM0A 4KODA 4NL4H 1TAGA 5EXTA 2O8DB 2RGCA 1IY1A 3Q7PA 2V4ZA 5DI9A 4Q9LA 3CW2A 4YC7A 2HEIA 4W5JA 2YJTD 3AGPA 3O8BA 4LUCA 1JR6A 4O0MA 4DLSA 4GMDA 4Q4LA 3W34A 1Z63A 3CWZA 3OFNA 4HUQB 3ZIAD 4CGZA 3KKMA 2GNOA 2V9PA 3LO5A 5BN4A 2VHUA 5HZKA 1GRNA 1BIFA 5B57C 3TVDA 2J0VA 3BGWA 5DHAA 2QBYB 4BZXA 2CE2X 2BBOA 4QHTA 3VQTA 2WWGA 2JJ8A 1OB5A 1GOTA 5E7JA 3FMIA 3NKVA 4N3NA 4HLQB 1KMQA 4UNSA 5EJEA 2OE2A 3U44A 2HDNB 3OIVA 1NLFA 2YOHA 2OBMA 1S96A 3H86A 2GF9A 2W58A 3P26A 1I2MA 2J87A 1F48A 2XSZA 1E2GA 1TF2A 2X2EA 1Q3HA 4RZ2A 4WZBE 1HUQA 3TIFA 2AL7A 2FGKA 4R7ZA 2ZI9A 3LX5A 2ZRMA 5KPDA 4M1TA 1AQUA 1RYHA 3WBKA 4OJQA 1T9HA 4AYTA 5DH9A 1SVKA 1Z0DA 4XD7A 5C1BA 1SXJA 4KO8A 1U9IC 1GKIA 4LHXA 3H84A 5CLQA 1XCGB 3R7WB 3GLFA 3U6KA 4URWR 5JWHA 4MUAA 121PA 3FVQA 1E69A 4LK2A 4Q7LA 2WKRA 3VMFA 1Q1QA 2GXSA 2O0JA 3BJIC 2GZHA 1ZM7A 1QHHA 1YZKA 2ZSDA 1W0KD 2DWPA 4XWOA 2ECKA 2F1HA 4LX0A 3NIBA 3RS3A 1OH8A 1KTVA 1NN1A 2OUKA 1U90A 2A2ZA 3EPHA 3EWSA 4GOJA 3QKRA 1EK0A 1MABB 3TUIC 4NBSA 1CTQA 2H7VA 2J7PD 3I61A 5EP3A 2IUTA 2ZR0A 2ZS9A 4KLZA 2GK6A 4RZXA 1DE0A 2ZAMA 1TF7A 3L0IB 2CLSA 1Z6AA 4LYJA 3WY9A 2VH5R 1P7CA 4OHWA 1YZTA 2BCJQ 1G5PA 2KBEA 4FMDF 2REXB 1GP2A 3T61A 2VSOA 4NTZA 4QXAA 3IPXA 4Q1DA 4ESHA 1E2HA 2QL6A 2W2TA 4YXWA 3KJIA 3RWOA 4DSNA 2R6CA 4Q03A 1IN6A 2CNWA 2HYDA 2I1QA 1N25A 4LPKA 2L0XA 2BC9A 3CBQA 4G01B 1GDDA 3QG5A 3LFUA 2YOGA 1OE0A 2XNDA 3TSOA 1TTTA 1H8HA 4OK3A 1PLLA 4LBZA 4DDTA 1OHHD 2JCSA 4MH0R 1E79D 1XD2A 2B6HA 4ZDKA 4NCIA 3T1OA 4IFEA 2WKPA 4W7SA 1ELOA 2DR3A 1TNDA 3OESA 4HB3A 3CB4A 1EX6A 3PIRA 4URZR 2WOJA 1T8UA 2ZRKA 2N46A 4IOKA 4Q02A 1E1QD 5L3QB 3NTUA 3QBTA 1VYVA 3H2YA 4LHVA 4B2LA 3KKPA 3T1QA 3IEVA 2ZU6A 4II7A 3BFXA 4TSFD 4HZUA 4S35A 2QE7A 5JHHB 4M1KA 1OW3B 3SJBA 5CB8A 4OKSA 1PLJA 2PZEA 1KKMA 3AKDA 3QKTA 3A1UA 1FW6A 3W3AA 3BRWD 1DG3A 2IEYA 2JDID 4A0FA 3OZXA 3QPVA 2H57A 3TUJC 1KI1A 1GKUB 2R6AA 721PA 1P72A 2X77A 5C4MA 4M0LA 3UPUA 2JJ1A 4OL0A 1R8QA 1KDPA 2BMJA 3CRMA 1QHGA 4GI7A 3VHLB 3G5UA 3K70D 1P73A 3K9GA 4UJ5A 3L8YA 1UDXA 4N0DA 5LB4A 1YZUA 2ZE7A 1BYUA 1GFIA 1XEWX 2Z83A 4B35A 2E87A 1KZGB 5FI0B 1FTNA 4PC2A 1G16A 1R6BX 1MR3F 1SVMA 2OCAA 3K0CC 3KJEA 4HB0A 2N42A 1OXVA 2FPKA 3GFTA 3A1WA 3U44B 2IS4A 5JI2E 3EA5A 3S1AB 2V1UA 1BMFA 5ANRB 3EZ9A 3MSXA 3ZVLA 2FN4A 3W5JA 3LBHA 1E2KA 2QZ4A 4QBGB 5K8UA 3M0EA 4QM6A 2Y8EA 4HZIA 3TR5A 1PZNA 4DWJA 2AX4A 3AF4A 4KITB 4Q4HB 3THXB 3CX8A 4OHYA 1WA5A 1R10A 1ZINA 1P6XA 1JXOA 1IONA 1VHTA 3IILA 1LFDB 1ZBDA 2QG6A 3PEWA 3T5DA 2Q3HA 4BLQA 5HTKA 1KO5A 1SXJB 1ZJ6A 3VNUA 3EPKA 4PANA 2OAQ1 1JPJA 1OT3A 3ZVRA 1KI9A 5FBLB 3A1TA 1WRBA 4DEYA 3K9HA 1Z2AA 4QOSA 3PEUA 2IYLD 3T35A 4KFUA 4XWAA 1CR2A 1G3UA 2EU8A 4FN5A 2Q0HA 1AS2A 2QENA 1QG4A 4IVRA 1CU1A 2XOKA 1FUUA 3GEHA 4EJSB 2WWYA 1FQJA 1HE1C 2QMOA 3RVBA 1P60A 3QKRB 4JLKA 1JR3E 2ZJ2A 3I8SA 4DKXA 2P5SA 3RRZA 5SZIA 2QMEA 3U3OA 4FMCF 4KBFA 5FBWB 3VNVA 4BPBA 4JLOA 4MYUA 1Z83A 4TTQA 4XVQA 1C1YA 3LLMA 2PCLA 2R65A 2O5VA 1COWD 1P9RA 1TQDA 3B2EA 4HB2A 1VYUA 2KB0A 4MA4A 1P2VA 2ZITA 3P27A 1TEVA 1GG2A 1BYIA 1P62B 4I4LA 5L3RA 1MO5A 4XOIA 5BW8A 3ZJYA 5AWFC 1Z0IA 3IIMA 2YC2C 2GA8A 2FX3A 3SQXA 1ZU5A 4FXPA 4B2IA 1NVXQ 1T0HB 4RZUA 3TE6A 4O2RA 1IAQA 4DC9A 1WXQA 3PEYA 4Q7KA 1US8A 4E03A 3GPLA 2JIZD 3EPJA 2R6GA 1ZYUA 3T06B 4BWYA 1DAEA 2HJGA 2YINC 3B8HA 1GL6A 3AVOA 3LA6A 3N2IA 1QVAA 1U81A 3SS8A 3AKYA 4RD3A 2HXYA 5CIWA 3UANA 5EE9A 2HYIC 1KO7A 2CVHA 1W44A 4YONB 2AHOA 1B0UA 4XVUA 1X8KA 2OHFA 1XD2B 4EPVA 1ZD1A 2RGGA 1UKZA 1KAOA 1W36D 2F55A 1Z28A 1AZTA 1F5NA 5KYKA 3QKSA 4C0QC 2XB4A 3IGFA 4LBYA 4JLBA 4EPXA 3BFVA 2J45A 5DIFA 3LQRA 4JL8A 4PFSA 3QE0A 5CITA 3RRYA 1NBMD 2IYUA 3EIQA 5JEDA 5G3ZA 1ZCAA 1NY6A 4IKEA 3GJ0A 5F2EA 3AVYA 2VQSA 2FMXA 2RGXA 1H8EA 4S2EA 2OZEA 2V55B 3I5YA 5KU1A 1IN7A 4KCGA 3LXRA 1OKKA 3HWSA 1XD9A 5FTKA 1W0JD 4ZI2A 2ZSBA 1A82A 2J1LA 2YWFA 1JAIA 5FL7D 2WTUA 2QM7A 4HAYA 4RFSA 3GLHE 4PC1A 3B5JA 1KY2A 3AF3A 4UXIA 3WYFA 4AYXA 5KTYA 4MQBA 2F1RA 2ZVQX 621PA 5EP1A 5JEEA 5JS7A 4LJYA 4LV8B 3VX3A 1UEJA 3SBEA 4E07A 2EFGA 2IHBA 4LY6A 3K9LA 1G8YA 3DKPA 3B78A 1OV4A 5HKKA 2WJGA 2QM8A 1AM4D 5AR1A 4CEJA 3GQBA 3Q3JB 2OV2A 3D8BA 2HV8A 5EP4A 5FUYA 1Z0KA 1JR3A 1KDRA 1N6KA 2ZRAA 3O8DA 4PPQA 3DMNA 1UKVY 3WP0A 2NTYC 2PH1A 3PUVA 3FKSA 4OHXA 1UJ2A 2B21A 2CEAA 4DLXA 4DLVA 4AY2A 4DVGA 3ND9A 3SU8A 1LNZA 2CL6X 2OO7A 4URYR 2ZTSA 5J5CA 4X8LA 3ADBA 3BH7A 1YE8A 3KQLA 4ZDIA 1AS0A 5D3MB 2MSEB 1Q21A 3WRYC 1FOEB 3C41J 5D3QA 2ZYUX 5M04A 1SZPA 3THWA 5KDDA 2V54A 4Y0VA 3CRW1 2C77A 3CKLA 2BKUA 1QHSA 1R5BA 4NCHA 5EE5B 2C99A 2WWFA 2P65A 3HU2A 4AURA 5LPNA 5FOXA 3BFKA 1VIYA 2OAP1 3M4YA 1E96A 1OPXA 4PHHA 1OH5A 2ZRDA 3AQ4A 3O8RA 1X8LA 2IXEA 3I92A 3LNCA 2AR7A 2LWIA 3IO3A 3G82C 3OHMA 3CNOA 1MH1A 2XNSA 4M53A 1FFHA 2GAAA 3R9IA 2FZ4A 4A0RA 1Q12A 3LWNA 3CF6R 4US0R 5FOSA 4TT3D 3VR3A 2JLVA 3QQ5A 5LB2A 3RS2A 2H17A 4W5WA 1XEXA 2OSBA 3ZQJA 5DE3A 2GDJA 4UNRA 4Z8YA 2WWXA 4DSTA 5IRCD 3LVRE 4FWTA 1DAHA 5FR1A 5A5GA 2C8VA 4XWKA 4B71A 1O3YA 2KJQA 1NN3A 2W0SA 2YVUA 4A2PA 1P9WA 4FCWA 2QTFA 3K53A 1T5LA 3A6PC 4D4KA 3F3YA 1YR6A 1M74A 1US8B 5G40A 2ODBA 2PZGA 1U0JA 3GLHA 2D3WA 3BE4A 4RJLA 4Q4AA 1JJVA 3A1SA 2AK3A 3SYNA 2WWWA 1TADA 4LJ8A 4BZQA 5FR2A 2VTKA 4MKFA 3BOSA 4M1SA 1KYIA 4ASUD 3EIEA 2WBLC 1KO1A 2NOAA 1NVUQ 2BEKA 3FFBA 3MMPA 5EUQB 4A2WA 3ZS9A 1N5KA 2NMVA 1MO4A 5AJYA 3WYGA 2VHQA 4B74A 5FPTA 4PPFA 3PEVA 1N5LA 4DLUA 1JEEA 4B76A 1RW4A 3L82B 2O8DA 4V0LA 3FB4A 3GCGA 2ZR7A 1I4DD 2DFKB 2HT6A 2ZSFA 2YWGA 2WICA 4OHZA 2OLJA 4AKHA 4G5GA 3U61B 2AXPA 1Q44A 1AIPA 1ZNXA 5HZHA 2ZXUA 2PJRA 1P3JA 2YOFA 5FPHA 1VHLA 4ZPXA 5E4FA 2Q3MA 1U98A 4LC0A 1VDZA 3KXIA 4M9QA 2IYSA 3FWYA 1M34E 1XTKA 2BEJA 3T5GA 1W2HA 2NGRA 3A58B 3PUZA 1SVWA 2Q9CA 3UKDA 3LLUA 1XEWY 4K8OA 2IYXA 3QOFA 4G3XA 2YHSA 1RJ9A 1KJYA 2IYQA 3Q9LA 5FOTA 1P5ZB 3W6OA 2D7CA 4PAQA 1MO6A 4F93B 1DO0A 3NDBB 1ZUHA 3SZRA 1HE8B 3JVUA 4EFLA 4CEJB 2QGNA 2CK3D 1FL9A 3EZ2A 2AFHE 3GJXC 4IHQA 4LV5B 1OYYA 4MRNA 3TAHA 4DIEA 3U7HB 3KXLA 3QXCA 1EESA 2V7QA 4AD8A 1XCMA 3B9QA 1RRPA 1Z06A 3IIKA 3CO5A 1VCNA 4WOPA 4R9UC 4C9BA 4LHYA 4BLOA 1M8PA 1IHUA 4RKEA 2IHYA 4IEEA 2EVWX 5FFMA 2NZJA 2ZYTX 4KFTA 3TUZC 1WBDA 3KZ1E 4Q4JA 3I73A 1Z07A 2OXCA 5CLLA 4BLSA 2Z0MA 1N6LA 2ZR9A 4DEXA 1G4UR 3HPRA 2GF0A 4P4UA 3FDIA 2RH5A 3CPJB 1NIPA 3MWYW 4C0SA 2BJVA 4D80A 3CWQA 1OF1A 2FSHA 1L2TA 4PXAA 1E2LA 5JJKA 4AG5A 1DELA 5B30A 1QG2A 3QNUA 3A8TA 1MABA 1VIAA 1DG1G 3B1ZA 4B47A 1ZU4A 2EFEB 3MLEA 1ZD9A 1RKBA 3CIOA 1R7RA 2OFWA 2ZPTX 2HUPA 2FG5A 2Q21A 4IDHA 4POAA 4Q1AA 5KSPA 2IUUA 4D2IA 5J4YA 1U99A 4GL2A 1TF5A 2P6NA 1M1YE 5A0FA 5BYKA 4EPWA 5TB5A 1J90A 1QVRA 1CJTC 4QJ4A 5DN6A 1X6VA 4I1OA 3U3MA 3SOPA 5IDVA 3EX7C 1V5WA 4TMXA 1XEXB 1KI6B 2VP9A 3RC8A 1E2PA 2Z4RA 1OXXK 1XF9A 821PA 1DVRA 1CP2A 3TLXA 3HP1A 1GKYA 4BFUA 4HLCA 2YYZA 1W36B 4ARZB 521PA 4Q1BA 4UNPA 4C0LA 2P0EA 4DLWA 1E9EA 5HE9A 1N6PA 3IHLA 3MJHA 3SE0A 3GLHB 3TBKA 2O0HA 2AWNA 2H16A 2IYWA 1VG8A 2JEOA 3EXAA 3L43A 4A9AA 4Q4AB 8OHMA 1DADA 1E32A 1N5JA 4B2PA 5DISB 2ZRHA 1E3MA 5EQTA 4AKGA 2IXFA 3K9NA 2DBYA 4PO1A 3WNCA 3Q85A 2VF7A 4YMVA 2QTHA 3OEHD 3ZGXA 2ZVPX 1D6JA 1HH4A 4M9XA 1R5OA 3GLGB 2IA5A 4PC7A 3BD9A 1VCMA 3KUCA 5TXGA 2CDNA 4FINA 3QPWA 4G5QA 3L0SA 3R20A 3SHFA 2D74A 4A82A 3TR0A 1EFRD 4O2LA 4ZO4A 1R8SA 2NO1A 3FGNA 1DAKA 1IM2A 1DOAA 2MSDB 2GKSA 2KI5A 2OLKA 3MD0A 4MYHA 4QGFA 4DIDA 2ERYA 3TW8B 3NH6A 2JLYA 1GL9B 4RCZA 3H0KA 4R2IA 4PQFA 5FPSA 2REOA 2ZE6A 3ADDA 3IQXA 1J7KA 4HATA 1ZM9A 1Z0AA 5AJVB 2OEPA 5EXXA 4IDNA 1GAJA 1LW7A 2PMKA 3A4LA 4DLZA 5EP2A 1NKTA 2HCJB 4NKRA 4BRUA 1RE0A 1OJLA 5SZHB 3R8FA 1XPOA 2MMCA 2W6JD 5F98A 3UG7A 1NKSA 3SYLA 1NL3A 1G18A 3KQNA 4CT5A 2BMFA 1KSHA 1Z22A 4P4TA 3GJ5A 2QAGA 2HLDD 3ASYA 3AUXA 3B7GA 2NO9A 4Q47A 3S1AA 4BEBA 1RJ9B 4JLVA 1G7TA 4M1WA 1VCOA 4QRHA 5TARA 1IJEA 3NBFA 2ANCA 5CM8B 1A4RA 2CJWB 4GBMA 1WF3A 3LRPA 2R6FA 4Q4HA 2BV3A 2EFDB 4LWZA 2R62A 5G53C 4FCVA 5H70A 3VU9B 4NYMQ 2UVQA 3L2OB 1V43A 5TMPA 4WAUA 3BH0A 2JAQA 2R6DA 1T5IA 3KJHA 5J47A 3U3RA 3G0HA 1CEEA 2WIBA 2OFOA 2NG1A 2FNAA 1KNQA 3AUYA 1G7RA 3IBYA 1E99A 1T0JB 2W2VA 3OE7A 3QF7A 2GZDA 3CZQA 1GZSA 4TYWA 1BS1A 3THOA 4Q9KA 2F6RA 5HR5A 4Q4JB 3RS5A 3LBIA 1YR8A 3EC2A 1VCIA 3I8XA 4B3FX 2JLRA 1FX0B 3E5HA 3IHWA 3FHTA 4V02A 2W6IA 4JMPA 2IS6A 2BIFA 4JLPA 1D2EA 1OIXA 1YZGA 4EJSA 3GP8A 5JCPA 1XMJA 3SBDA 1KK0A 3K0FB 4IXMA 4URUR 1E2MA 1ZM2A 3B1VA 2GHIA 3SI7A 1X1SA 5C18A 3KQKA 1E6CA 3CNLA 4C30A 3B1XA 1UADA 5KSOA 4OYHA 2ZE8A 2XZLA 4MDFA 5AUOB 3TH5A 1DARA 4Q1FA 2EYUA 4BASA 2GVDC 1NJGA 2QQEA 5LDDC 5KSZA 5KO2A 1ZC4A 4Z1MA 1KSFX 2LKDA 3QXSA 5KDLA 1KJZA 1NG1A 4DSUA 4EIWA 2W83A 1VG0B 4I1UA 5IK2D 3DVLA 4E22A 4QC2A 4PQRA 3UMSA 1EWRA 4FW9A 1GRRA 3FHCB 4PZLA 4D81A 2DB3A 2HF8A 1OH7A 5GVRA 3LW8A 4LCBA 1CF4A 2GXUA 4KV9A 2FPLA 3CONA 3HR7A 5F9FA 1UAAA 3QEJA 3CRQA 2QAJA 1G3MA 2XJ9A 4PSVA 3B9PA 2QA5A 1LS1A 1YKSA 3M6AA 4UXJA 5K8IA 2CE7A 4IJMA 1Q1ZA 1IOZA 3NEYA 2FEMA 2BBTA 2G0TA 3JVVA 1XEFA 5HCIA 1JQLB 2ATXA 2ZRBA 4A8JA 2FFQA 1WE2A 3OIUA 4JYBA 4NH0A 1MO3A 5J4KA 3RRNA 5KOYA 2YKGA 2FDCA 1OXUA 2YZ2A 1EFHA 3UK6A 1TQ6A 3X1WA 1AA9A 1XX6A 4XSHA 1TUIA 3SFVA 4UJ3A 5FTMA 2ONKA 1RRCA 2AK2A 5K8TA 2E9SA 4NYMR 3A37A 5C4GB 4DCVA 1G6OA 2GETA 3ZIAA 1IXZA 3J81k 1TUEA 1E4YA 1CJKC 2NO6A 3BIFA 5E3HA 1NMZA 1GNQA 3P20A 1KSGA 1CR0A 3UIEA 1YQTA 1C9KA 4U02A 4MRRA 3MRSA 1E2JA 2WAYA 2IYYA 2CCKA 4TLBA 2J0SA 4U7DA 3V9PA 2VLIA 5AJWA 1NG9A 1KZ7B 2IS2A 2QNRA 2P5TB 2G9NA 4XVRA 2HT1A 2PT5A 1S9DA 4HLUA 2A5JA 3KTAB 3PCRB 2XGJA 3MAAC 4XTRA 3RRMA 2ZEJA 3VFDA 1HTWA 4BFZA 3QVVA 4TMVA 2DHRA 3F8TA 2VHCA 4IOJA 2IC5A 4D0NA 3B1YA 5EZ6B 1ZVQA 2F7SA 4D4LA 1MV5A 2WJVA 3OIWA 3OAAD 5TVKA 4TMWA 4HLDA 2A9KA 3RC3A 1LF5A 1SXJC 1ZRHA 3LVQE 4LPSA 1JQJC 2QAGB 3VX4A 1G8PA 4DT1A 4OQNA 3IIJA 4M2LA 1XTIA 1TQ2A 2RHMA 2Q3FA 2ZRFA 1W0KA 4M4SA 1IJFA 1WMSA 4LZZA 3AVTA 5GJVC 1NLZA 1QF9A 1PUJA 2MSCB 2P6UA 3REGA 4D4MA 1Z6YA 2V1XA 1IBRA 4MKGA 5IHPA 3LBNA 4QJ3A 4WA7A 1Y63A 1EFUA 2QN6A 2BCGY 3W90A 5D3MA 4EJSC 1KOFA 2WPDD 2D2EA 4QJ5A 3I62A 1P2TA 4M1OA 2RMKA 4MGIR 3U6BA 1TQ4A 4BGDA 3ZZUA 1TU3A 4ZCMA 2X8AA 1G1MA 2XZOA 2BM1A 4V0NA 4IDQA 5H1YA 2FA9A 1F2UB 2J7PA 3GLIB 1UF9A 1FZQA 3MGCA 1JAHA 4DCSA 5E7MA 1XZPA 1Z0JA 2TMKA 4HYYA 4C4PA 2ZSEA 1M2OB 3O47A 1G6HA 1DS6A 3ZH9B 1J99A 1S3GA 3AB3A 3LDAA 2NPFA 3NWJA 1ESMA 1XMIA 1EFTA 3RAPR 3QPUA 1M7GA 4QGGA 3I5XA 4MGYR 3ZZ0A 1II8A 1GSIA 1N6IA 4LYFA 2VP2A 3WP1B 3B60A 1U8YA 2O8CB 4ZIRA 4ZCIA 2O8EB 2QSYA 5F9HA 1GITA 4LBWA 2SHKA 3OEED 2GEVA 1G7CA 1OHHA 5JBQA 1E79A 3X2SA 1ZUNB 2P3SA 6Q21A 3THYA 3ZD6A 2QI9C 4QGHA 4Y0AA 1XDBA 4C0HA 4GFDA 4B48A 5JSZA 5J4VA 2IEZA 5FBQB 1RFLA 1KO4A 3WBJA 2ZRGA 3CM0A 2KBFA 1NVWQ 3CLVA 3C8UA 5FPKA 1E1QA 2CLCX 3EZFA 2ZE5A 5C46F 5K8LA 1XU4A 1G9XA 4NYJQ 1GTVA 1QRAA 4TL6A 4OI4A 4TQUS 4TSFA 3W3ZB 5CM9C 3AEZA 4A4DA 5LD2B 4GZLA 2NZ8A 4C2UA 1G4AE 1W4AA 2ANBA 5J40A 3DMDA 2GZAA 1F60A 2CMKA 2ZRLA 2ZRPA 3LXXA 221PA 2DY1A 4F4IA 2JDIA 2WJJA 4A8JB 4NYIQ 3CX7A 2BWJA 2BJWA 2Z5FA 2VP5A 5JS8A 4B32A 3FYHA 1Q57A 1SVOA 2X1VA 2OBNA
chains in the Genus database with same CATH superfamily
2OZPA 4G4GA 1GPBA 1ZK1A 2FFHA 2I2FA 3OPYB 4FIDA 3U9TA 4XOUA 4KP7A 2RGNA 5CK5A 5JPDA 1S8AA 2Q1UA 3KSUA 4X8HA 1E1RD 2HSJA 3DPIA 1SC9A 3GNSA 2E1PA 2AIRA 4J91A 2PLFA 1CERA 1YFKA 4KO1S 4HH1A 4FNGA 2QU8A 4HX5A 3V1LA 4F4HA 5IKEA 4CBVA 3N2EA 1P74A 4V0KA 3BORA 3P4YA 3HCRA 1M2JA 1ZITA 1NBME 4Y6GB 1O1YA 4N5NA 4PGMA 5L7WA 1SVSA 4MMXB 1AS3A 1A9QA 2IIVA 1NY5A 3AV0B 3NZEA 1OU4A 2G67A 1IBSA 5KJEA 3LV8A 1FDWA 2GD0A 3LOUA 5F3WB 1JA1A 1CUAA 3AOEC 3OH8A 2F90A 3Q7EA 4MUNA 5ER9A 3VAZA 3HGQA 3MRXA 3JQBC 4JL5A 4BB5A 1L4YA 4BFWA 3L18A 4O8ZA 4AKIA 1EUCA 1K2VN 5EIHA 5JC8A 3PI6A 3B82A 4JT9A 3A04A 4PAMA 1UBGA 3EUWA 2RI0A 4B83A 5JXHA 1PLKA 3GLUA 4KK4A 4ROTA 3SE7A 2A3RA 1J6UA 1HNNA 4JKIA 2NV2B 2I2XB 2OMKA 3K15A 1ZMOA 3IAM6 1EDZA 2Y1XA 3OVMA 4QICA 5FPYA 4QSHA 1NI4A 5IDQA 1D4FA 4TRRA 1AQLA 2CD7A 1PGNA 2C78A 2PA0A 3L07A 4UNNA 2B7LA 3DV0A 3ECSA 5LZ4A 1K8RA 4KLAA 3UJ3X 1QO0A 3KIPA 1TMGE 4ZARA 3EXIB 4HDNA 4CJXA 3GLQA 1KF0A 5CFQA 1P2UA 2DFTA 3L7JA 3QE3A 4MMYB 4B7ZA 2NVBA 3G79A 4HS9A 3FNBA 2H7YA 1NVVQ 3JD2A 4JR1A 4EG7A 3DD1A 4X8OA 3RROA 3EBPA 3ZKWB 1UKYA 2DC1A 4A6PA 1PDOA 1JDSA 1ZP6A 2H59A 3PPIA 4IV0A 4F56A 1C1XA 4FJ0A 4L51A 4XGQA 3KEMA 5FI3A 1P2SA 4Q3CA 5K3SA 1QRSA 3MJ4A 4MQFA 5DHFA 1Y6GA 1CB7A 1ZC3A 3NVAA 1PTJA 3G17A 1E9RA 2OXEA 1R9JA 4WY2A 3QUCA 4YEDA 4XRRA 3CUVA 3K7EA 1A9ZA 4JQYA 4XYMA 1YOVB 1Y8QA 2JK0A 1K5DA 2X13A 4RABA 3IAS6 3NHAA 4Q66C 5IAAA 1LGYA 4AWXA 1E0JA 5A5VA 3L41A 1FP6A 3ESQA 4GWKA 1PV4A 2QRLA 5E6RB 2I7CA 1IOWA 2A3NA 1QS0A 3C98A 4D56A 4G89A 5G0UA 4GVLA 4ID3A 1X8JA 2WA2A 3PUIA 3U09A 2WF7A 1RCUA 3IE0A 1V5FA 3VZBA 1TTQB 1M2HA 3IDSA 4DY6A 4BQRA 4X91A 1EWVA 5DNWA 3N2YA 1M66A 4YRFA 2HMUA 4ZIRB 5LYJA 2B7BA 2ODPA 4JLAA 4O4LA 5CCBA 5BOSB 4PTLA 5JDIA 2FP3A 1HE4A 1QYIA 1OX4B 1WY7A 1Z6XA 2PXAA 5DK6A 2GAJA 2X6QA 3FN4A 3W6PA 3OOHA 3A3YA 4RF3A 4HAXA 3OUUA 2VWHA 4LW8A 4PSAA 4DYHA 3AKZA 2OZKA 1S0UA 2HGSA 1NXTA 3AEUA 5DGIA 3HBLA 2VBGA 4W7IA 3SQDA 4BX3A 3R8CA 1NN0A 3EN0A 4GMXA 4CIAA 4G6ZA 4WESB 4YBRA 2YICA 4TRMA 5BN5B 5KTSA 2QMHA 3T9AA 2G1UA 5JAUA 3L0BA 4WXEA 2ZZMA 4HYEA 1ZCZA 2QMUA 3R24A 3QVMA 3I28A 3ZCQA 3JAKA 4KI7A 4C06A 4M0MA 2COEA 3DOFA 2RKBA 2HD4A 3EQ6A 5EJ9A 4R3UC 1J2JA 2ARKA 3CF0A 1B8VA 1ZGBA 3AVUA 3JWGA 5FL7A 4YWJA 1ODTC 2CXXA 3NASA 1LTKA 1RIIA 5D3KA 2CHQA 1NFQA 1Q1BA 1XJCA 1YACA 1YAJA 4P34A 5HCUA 2VP4A 1V4NA 2RHGB 1GGJA 4Q4DA 4PYJA 1BMTA 2ORWA 3ELUA 1BTOA 4JVMA 4PZZA 3SHVA 3UWPA 3W05A 4FILA 4C0JA 1I7LA 2POCA 4GOKA 5DTRA 1I3MA 3QVGA 3AY7A 1MOQA 4Z4QA 3TW8A 4FR2A 1TUBA 2FSVC 2QY9A 1XJQA 1I80A 3T34A 3R5KA 2HFKA 5FNZA 4F60A 2JBAB 4XIIA 5A4FS 3OZAA 1V71A 3OEYA 1BX1A 1IE3A 3E2IA 3GVIA 3MOGA 1UZUA 1ZIPA 4YMLA 5LXTA 4MV8A 4QVGA 4WADA 3WKCA 4YRSA 1OOEA 2R3SA 4EPYA 4GX0A 4X7MA 4BNKA 2PEZA 1BCSA 2GVNA 1QOZA 4BP8A 2GPAA 2I7TA 3QLVC 1O95D 1U5AA 5HIJA 2D13A 4YP5A 3BB4A 1CRPA 4NDZA 1N1MA 3AHFA 4WK0B 1C9MA 4S24A 3V4SA 2P3QA 5LVAA 1OASA 1X2BA 2XUIA 3GW8A 2PYIA 3BL6A 2CL5A 4Y6OA 3E3LA 2GBGA 4P6VF 5AYVA 4ZMSA 2LVBA 5EE1A 5AP9A 3MQFA 2ONJA 1SCDA 4LDJA 4MWSA 1JDBC 2O7QA 3NNDA 2IVFA 1I4OA 1UBRS 2C61A 3KVRA 3O8OA 5CGQB 1JB1A 2GASA 5LIRA 5LJIA 1COZA 1HDRA 4DCTA 2IXAA 4F84A 1W48A 4AULA 4E2WA 1JG1A 4GXTA 4EUEA 4QATA 2A4KA 2XECA 2W70A 4NCNA 4K6GA 4YJ2B 4YJDA 4WKBA 2O9JA 2VP0A 1QHIA 1YL7A 4CDGA 2ONCA 4B40A 3MK31 1NI4B 2P2DA 1J21A 1RD4A 5B3JA 2V6IA 3CLUD 2FAXA 3DV0B 3WMEA 3X1KA 3GCXA 4D98A 1N2ZA 2CSUA 4DV5B 2IELA 2P8SA 4WNYA 5I8ZA 3V4FA 5BT8A 3AVPA 2ACEA 1KMNA 5T4BA 4HDNB 6YASA 1E2UA 5GP1A 1V11A 3I0ZA 2Z9CA 1E59A 2ZQYA 3QSYA 2G1KA 3O84A 3WXBA 1K3UB 1Y1LA 4GG1A 2GESA 4CKXA 2Z58A 1O4VA 1J39A 1O89A 1V3QE 3H75A 4B4WA 3NBKA 2IDJA 1MKYA 4GEGA 2ECPA 2OG2A 1ZLXA 2W6PA 3PQ3A 1E98A 1R4AA 2I2BA 2WSLA 4MQFB 3PJRA 4L95C 1VLLA 3AILA 4N18A 4EKDA 1E2QA 3Q98A 3FVVA 1CJUC 1X7ZA 4RE5A 5EUMA 4KJZA 1XPRA 1Y8QB 4B3DA 1OR8A 2PT9A 3RFVA 5EJ8A 4CZ2A 2RKOA 5F7OA 2VDKB 1BE8A 1QFJA 2O8NA 2XSZD 3ECCA 5TPZD 5JFTA 1U9JA 1F8UA 2R4TA 5LZ5A 1VPVA 3O8CA 1QS0B 4DNOA 5BSHA 2EFCB 3DL7A 1FYEA 1NUHA 3GXBA 1RXYA 2JRLA 3ORHA 2HSEA 2VK8A 4RKFA 2YZGA 4Q9JA 5AOVA 5TC4A 3HY3A 2IF2A 3ZXUB 2IXDA 4BQNA 4F38A 2OESA 2FUG1 4G84A 4P36A 3DO6A 4CUKA 4PYOA 1GQ2A 1ADGA 1V96A 1X42A 2BOVA 1DRKA 2NT3A 3B6MA 3FXAA 3KYBA 2NZYA 2ZQ5A 3GJ4A 1C8VB 1QMGA 1AUXA 3L0OA 4L7QA 3VR4H 3BN3A 2CDRA 1KYTA 1XROA 3N74A 4K9NA 2QP3A 4M8KA 2FZ5A 4OM7A 1EUQA 5K0SA 4O5OA 3Q72A 4HGZA 5C5IA 1CUSA 1JG2A 3DMTC 3M6MD 4YO8A 5JVDA 1M9NA 2W6ZA 3O3OB 5JAQA 2RHHA 2OP0A 4NH4A 4RORA 3PNOA 3DOIA 3CSSA 4IQGA 2FG7C 3AEUB 1ZEJA 3RNLA 3PQ6A 4HEJA 1QGDA 2IPLA 3BE6A 3GLFE 2BM9A 4M22A 1YC5A 2EBUA 5ITVA 2O6LA 4B7AA 4C87A 5F5XA 2OHGA 2PE5A 4LV6A 2MDTA 4HBZA 4AW9A 1T1GA 2VKTA 4CF7A 2RGAA 4MR9B 4IQFA 4GSYA 5TGZA 1CZOA 3R3VA 3ZQ6A 1A5BB 3EVBA 3K5IA 3O4HA 3PFIA 4EELA 2OCPA 1RR6A 5B6IA 4CV3A 5JUWA 4UUOA 4XSGA 3QEOA 2EC5A 4LJKA 1NP6A 5AVZA 2PZ8A 4AN4A 4RVUA 4MIEA 1KJQA 1B74A 2FRVA 1AUQA 1GPLA 4IGAA 5EEHA 4OATA 3M70A 4HNSA 3KUXA 1LJLA 3RK1A 1U7OA 5KVSA 1HSZA 3A7EA 1T4CA 1GR0A 1KBOA 4FPXA 1QCZA 4FIZA 2X0NA 1R50A 5AKKA 4BE4A 1CUDA 1E3TA 3KCQA 4QDTA 3E4CA 4X6UA 4KQKA 3V46A 2WJHA 1I4TD 1P8AA 1BRMA 2IPXA 1S01A 4DR2B 2HOQA 3G0OA 1JH8A 1JFFA 3BILA 1LC0A 4G85A 4ZQHA 3CRRA 1EE1A 4G4SP 3FRJA 4C2TA 1RBYA 2XNDD 3JD3A 3N70A 3NT4A 5LXTB 1DLIA 1SCNE 3P9CA 1Q0SA 1I7PA 3IDQA 4IGIA 4OV6B 2VSYA 1RWBA 3FF4A 4TRJA 3LYLA 3VH2A 5FI1B 4OLJA 5BY2A 3IODA 4C6SA 3AJEA 5K4AA 2DWOA 3HBMA 4D26A 1QUFA 3OZBA 3LF1A 1GSHA 1RYEA 1RAHA 4Q0MA 1ORHA 3NX4A 5C4IA 3HZRA 1KK2A 1NW5A 2Z30A 3X1ZA 3KOMA 1SY7A 2VDMB 2E5WA 2ICAA 1P6QA 2R751 5DYTA 4B4DA 3JZMA 4MQLA 3BWXA 2FQ1A 2Z2XA 4DMHA 4OHMA 1SFRA 3FZEA 2ABWA 1MIOB 4N40A 1SKYB 3IDZA 5IARA 1XAIA 4JIMA 4EFKA 3I76A 1AY0A 1T8TA 3BC1A 2PPLA 4JSTA 3WHIA 1M7BA 3B9BA 2W2OA 4WK6A 3O8OB 5D1NA 1ADJA 3INRA 4JZKA 3EDYA 3GBPA 3RFCA 2JFHA 3QV2A 1O94D 5H3CA 4TWJA 4HNUA 1U8ZA 4WXPA 1FEZA 2E2WA 4QXRA 2Z2KA 3K8OE 5EPEA 2DFLA 3RLIA 1Z5VA 3DHWC 4M8NE 3W3AD 2IX3A 3JVIA 3Q7RA 4WCFA 5SYAA 3FE2A 4G5XA 4ZRMA 1N7JA 4CCYA 2IPMA 4GPTA 4F85A 2FWRA 4X1KA 2WG2A 1MN6A 5B7QA 2UYCA 4FONA 4MXDA 3WO1A 5EGSA 1Z7EA 2X7JA 1UBFA 1ZNZA 3BCHA 3TQSA 1VMIA 2PUJA 3N6RA 2PH5A 4DIKA 2YRFA 4CF6A 1U2TA 1V11B 3C16C 5BOVA 1W85B 3LL4A 2EGUA 3GI1A 4HNRA 1JHRA 4LJ7A 1RVDA 4RPKA 5ERYA 3MINA 3TQFA 4NQZA 4JZYA 2FSUA 3DBRB 3UUEA 3VPGA 4CW7A 5JFGA 4D25A 2XNJA 1RVV1 4MIYA 2X76A 3EW7A 1ULUA 3UPDA 1K92A 5JRJA 2ZZKA 3EG5A 4LGYA 1P2FA 2H9IA 2PO7A 3MCAA 3DDHA 3U4DA 4EW3A 1SCKA 1SBIA 3VC2A 2VNKA 4EJ0A 1AHIA 2GPTA 1YA4A 2M98A 5B53A 4KQ2A 1P18A 2ETXA 1IZ8A 5CDFA 2CHEA 1GNPA 3VPCA 3G2MA 2FMHA 5BMVB 2PGJA 4WI1A 1L5NA 1P4GA 3G1TA 2P0YA 4JSYA 2B4YA 3DL4A 2J46A 3LQ2A 4ZOLA 5L4NA 4D43A 1YR9A 3CR7A 4MW1A 2JEZA 2TMGA 2YZKA 4UHJA 3IMCA 1T3HA 1PL8A 1WD5A 3JQ7A 3MS2A 4JJAA 1OC2A 4DB2A 1E9CA 1QZXA 1Q7TA 1Q7GA 2F3SA 3SC3A 4Z5XA 1QTIA 1AF7A 2UZ3A 3GRCA 1Y34E 1DIOB 1NJ5A 3BTOA 1U31A 1S2DA 2AG8A 2PRJA 2WVJA 2ODWA 3ZWXA 1U3CA 2CXUA 4E94A 2A1TR 2YQZA 1CSEE 2CNKA 1EUYA 5JVDB 2JIOA 4H1UA 4MYSA 2LDBA 2QHXA 4RS3A 3RSCA 2C2BA 3ZUGA 1KFCB 2B2CA 1EFRA 2MINA 1P75A 1RYNA 4LOHA 3BJEA 3WGMA 4B82A 4QG7A 1P5HA 4DSOA 4II2A 3ZU6A 2GCOA 3ONWA 3P4UA 4P81A 3HKEB 3QJYA 1R6AA 4CIDA 4JI5B 4CMCA 4CLEA 4D8UA 2QR5A 3K35A 4JLDA 4JU9A 3BWBA 1A2QA 1UXKA 3ASUA 4YMHA 5B55A 3JYQA 1L8AA 4YDSA 1XMQB 2OR3A 3WYAA 1JHOA 1GAWA 1LTQA 2O2GA 3A9UA 3BBLA 5LMCA 2D06A 4TZTA 4EVSA 3LE8A 2W5UA 4JYAB 3Q5EA 3WWZA 1S1CA 1E7RA 2CZQA 2GN6A 2J3IA 1CUZA 3FOWA 3MTGA 3R0IA 5EPUA 1C8KA 3WNDA 4BRWA 1KEEA 4P5EA 4ENPA 3G68A 3HU3A 1QHYA 4GEKA 4F6RA 5I47A 4OLAA 2W6JA 4FYHA 2Q4RA 3V55A 4A73A 1K6XA 2FPMA 4DLRA 2JLXA 4G0NA 3VPAA 2QX6A 4DSZA 4R1PA 4ZXFA 2FEWB 2HLDA 1ZOIA 2DPGA 3L6RA 3Q11A 2R79A 3IQEA 4UCWA 5T8KC 3RYCB 1GTSA 2CMGA 3LQQA 4U3JA 1LPPA 2HSZA 2CXPA 5B1YA 2B35A 1NP3A 1UAGA 1JHPA 3IBGA 1YR7A 2ZYWX 4XGNA 1CZLA 2AC4A 3CZMA 4I08A 1UP7A 4A92A 3H9JA 4HRAA 1O7JA 5H8WA 1E8DA 1N0UA 4PR0A 4RD6A 4E5KA 3HJNA 4R8LA 3DEZA 4XWYA 3PBKA 1G20A 1JLLA 1H9AA 4FI3F 4KPGA 4HR7A 5A4IS 1ZCBA 2ZK7A 3R6LA 1FSGA 5CIQA 2JAUA 3PDHA 5LP1A 1Y4ZA 3X1DA 3FNHA 3ZD9A 4DDUA 2FMKA 3UJCA 2BYTA 5A4DA 1GEGA 2HPVA 4KW7A 3RVRA 3WK6A 3K20A 2QD3A 1P0CA 5FJJA 3QXHA 1YCDA 2ASEA 4F3NA 4JBNA 4U00A 2Q3EA 4CMEA 1U2QA 2CLOB 3HB0A 3WWDA 4PFQA 2IT1A 3DLIA 3T9BA 1M33A 2Z4TA 3N87A 3Q15C 2O57A 1VBNA 1GY8A 2Q07A 2R9VA 1SUEA 3QBEA 5IZCC 1HT1E 1QANA 2I4IA 2IOFK 4IIJF 3GA5A 4UZSA 2R1TA 1WQ1R 3SJCA 4DJJA 3LQ1A 3AEXA 1JBKA 1KERA 1CQXA 1H1DA 1YS2X 3HYSA 4KNWA 1ESNA 4IS2A 4QUDA 2HY7A 2JKZA 1G3RA 2PV7A 4LVOA 3BWDD 3L5KA 4C2BA 1PEDA 4BQPA 3P94A 4ODIA 1MC1A 2VPQA 3P9IA 5DF1A 5EHIA 1MX9A 5A9SB 4OI0A 1DLJA 1FVFA 1I9CA 1OXMA 1PWEA 1EGVB 2C9ZA 2PL5A 2VHJA 4H3VA 3KRTA 4MVJF 4X1KB 5JWOA 5K0CA 5HS6A 2ID9A 2ZSKA 2CV2A 2IBTA 3BK7A 5JLJA 1R15A 2W2QA 5CFPA 4L0QA 1AHPA 1A72A 3FLBA 5JS2A 1KI2A 1AXEA 1VI2A 2HQ1A 2UZ0A 3GJ6A 3RVPA 3QLUC 3EDCA 4IBOA 3NJ4A 4Q7MB 2Z43A 3ZG6A 5EINA 2JFZA 2F3QA 3GOHA 3V97A 4BFSA 3F7TA 1WL8A 3R7DA 5BPFA 4W5HA 2Q5JA 4OB7A 3NTOA 3CMCO 2F2TA 1OTXA 5IG2A 1QCCA 3A1DA 4YMTA 4FEEA 1L5ZA 3LPCA 4LY0A 1PYOA 5CYPA 3RFTA 1YHNA 2FPPB 2QRNA 3IPCA 1ISGA 5DIZA 4DEVA 3TJMA 2DCUA 1AO0A 2GPBA 1BXGB 2WVGA 5H5JA 3IQHX 3IC5A 4OQLA 1B3RA 2VI5A 4IXDA 3ZLVA 4EMTA 4K9KA 2NIPA 4K46A 1HMYA 4YJ3A 4RLHA 3R41A 4KMSA 1H6AA 4F3YA 5HNKA 3B12A 3C3KA 1MH9A 3JQ7B 3PUKA 4O2AB 2DY0A 3ZHYA 1DIHA 1A77A 4DY4A 5COBA 1GPMA 4TMTA 2OV6A 3AZQA 3Q6MA 1KEPA 4TLDA 1M72A 2VDPB 2QUZA 3MEQA 2DUWA 4PY2A 5B1DA 2FQQA 2ZVDA 3H4MA 1CV2A 3PT9A 1CETA 3D3NA 3GFOA 4FNAA 3PDIA 1RWQA 3DE0X 3TCNA 2HA2A 3BH6A 3INNA 4A91A 2CMHA 1E7QA 2Z5VA 1PX0A 2I6QA 2WUEA 3FMOB 4LZLA 4KAXA 5GIPE 5KZMB 1JG6A 4MKXA 3A4MA 1A76A 4W8OA 3URKA 3V4RA 1GPH1 1I13A 2XVMA 2HSWA 1L3CA 2GAOA 4BUJA 5MN4A 4DDMA 2GCOB 5KTTA 4YCAA 1DRWA 1XDUA 1XPJA 2PLRA 4AK9A 4OHRA 4C1NA 5IZ4A 3VPXA 3SEQA 3VGJA 2D0DA 2O1XA 2DWQA 4QDUA 4U7FA 2BM8A 1QTRA 4UM9B 2OB2A 4J07A 5GJCA 3U7EB 3BIXA 4XDGA 1VC2A 1SWVA 1KGDA 3VPDA 3WYNA 4UQLA 3KLBA 2BR5A 2YV1A 1RJEA 4MKIA 3PC4A 2XVYA 2I6SA 2GZ2A 1N2CA 3PXDA 3VR4A 3LP8A 3ZHXA 1Z2OX 4WLEA 5JADA 1IDN1 1N8TA 4ZO7A 1RDFA 3W06A 4LIPD 2YJ6A 3ACDA 1GA4A 2PBFA 4ZYZA 5KHLB 2P9YA 1JA0A 5K3FB 1DOHA 4TV9B 3WX0A 2GUGA 4WGGA 1JG4A 4P4LA 5FOVA 3EWAA 2YWXA 3IXLA 4Z99A 5TMBA 3FWNA 5G0WA 4YPOA 1ISHA 3MWLA 4Q34A 4UBMA 5KTKA 4M9UA 2VNJA 3V8NA 3BMQA 2RC6A 1GIAA 2GBLA 5FOWA 3EB9A 2Q27A 4O1HA 4KZKA 1GTL1 1YJAA 1WXFA 1Y5RA 1SULA 4UXHA 4TLCA 1VGQA 3IEUA 3AFMA 3WR5A 1JIVA 2Y6VA 4OH1A 1N6NA 3SM3A 4QZVA 2YYAA 1KY4A 1S3SA 2HK7A 4BRSA 4I99A 1PRYA 2RIPA 4C29A 1JKMA 1NZJA 2FU5C 2C7BA 2VPZA 3FPEA 5G41A 5HQ3A 4AKSA 5L45A 1Z16A 5LWHA 5EKTA 3WL5A 2DG2A 1SBYA 3TLJA 3PR2B 2V8OA 4KOAA 1HZJA 4DABA 4GC9A 4R8MA 5CDYA 3P9KA 2P8JA 4KTTE 3RVDA 3LW7A 4EGFA 2WZCA 2ZWIA 1ZOPA 2BMDA 2R1TB 3N5KA 2FK7A 3GD5A 1SC4A 4GQBA 4RHYA 5J2UB 1GNSA 3KDSE 4WCDA 3KJXA 4AJNA 3ADCA 3C3PA 2N3ZA 4ZZIA 3EIHA 3O73A 4DUGD 3IB6A 4NYJR 3QOXA 4Q3NA 4P9NA 3ST7A 2DH6A 5KQMA 4R1TA 2YWCA 1EGHA 4HH3C 5AH0A 1G17A 5C8YF 5JMWA 5C51B 1SXPA 2PMBA 2GSWA 2HJWA 2IL1A 4KSBA 4PGHA 4JUDX 4IW3B 4YMWA 3V7YA 3EDMA 1YDHA 4EY8A 4A0GA 1CRQA 1FJ2A 1CZRA 3A26A 3OEEA 5EKSA 3BGSA 2O8BA 2A5YB 2AYXA 2PX4A 3W8DA 1WP4A 4RDHA 1JIJA 2RH9B 3C4VA 1C3OB 3G2KA 3IQWA 3QXXA 4Q00A 2FKAA 3RBZA 4GYKA 5HUQA 4F1JA 5B37A 2Q9BA 3HV2A 4AVYA 2WR8A 5I3ZA 3FFAA 4OREX 2GK3A 4KFRA 3F5MA 2ZI6A 4TYYA 1OCEA 3L1KA 4UKDA 2V59A 5AOAA 1V4VA 1U6KA 2LCFA 4I5DA 1UMCB 4RJ2A 4DZZA 3DUFA 5LLTA 5CFNA 4JELA 4K3VA 1N2SA 4UUNA 1P1IA 2REBA 3N8IA 2PKXA 1WW2A 5KWJA 4ZP1A 4JYPA 2B0CA 1WZCA 3H1EA 2XH8A 4JNKA 3R0JA 1ZM4A 1FRFS 3N8KA 2D1RA 2H85A 2GK7A 2R85A 3COSA 4K9PA 4BVFA 4OXIA 3JZAA 3TJRA 1PFWA 4NARA 5ELLA 3BX1A 1H5QA 1I30A 4PGAA 4ACAA 1J2UA 1E4VA 2W4IA 5B58C 1HGXA 3HXMA 4TS3A 2ATVA 1D2HA 4YJ3B 1KS9A 1VE6A 3AP3A 1BRTA 2D1FA 4IEIA 1SOWA 2ZJ3A 1N2IA 3BZBA 5KSYA 4RCYA 1Z17A 5GMOA 5CB4F 3QVUA 4KO3S 4D4JA 3B1WA 1FUYB 1XTRA 4HAWA 3PYMA 4BKRA 2AN9A 3LVBA 1WS6A 5BR8B 2BVNA 3E35A 3EFEA 3ZIDA 4Y7CA 5A2GA 1N3LA 3C48A 1G8MA 1M73E 2CYCA 3GGOA 3HACA 4NECA 4TXLA 4EDHA 1N33B 3ZI4A 5FOUA 3WIVA 2DAPA 2VYND 3JQ9A 5KWEA 4XUCA 2JLWA 1QR2A 1PCXA 3SEAA 4DMGA 2E4WA 1J70A 2H00A 1A88A 2NQ2C 1XLVA 2QG9A 3CCCA 2XMBA 3DNPA 3I23A 1ECFA 3Q9UA 4U1RA 5CVUA 5FPQA 5AVYA 2F4VB 1WKCA 2A9PA 5K7SA 4ZOBA 3A6DA 4BCBA 5IUJC 2WG1A 1UQTA 2IYFA 4HQ6A 2XAUA 2Y71A 3M5DA 4PCVA 4JP1A 3ZJVA 2OCBA 2Z1MA 1AKQA 5L9AA 3G0DA 4RQTA 1V9SA 2XUQA 3GD7A 4FKBA 5ULLA 3STHA 3K1AB 1A9YA 2AUMA 2NM0A 1N2CB 2BUBA 3H3JA 4JI3B 4DA8A 3EQZA 4WOKA 5CT4A 2NUAA 2I7DA 4N54A 4N76A 1PZHA 2EZTA 2JAPA 4JLWA 1P61B 4C2AA 2IK8A 4YCCA 1QKIA 1XRSB 1P19A 2G4VA 3AYXB 4Q24A 4X20A 3P7MA 3PLAE 1LRLA 1WX1A 2ZFUA 4F5ZA 4BXOA 4JBXA 3RJMA 3MB8A 2G83A 2OO3A 4EPTA 1RXUA 2MCFA 1X7YA 1D04A 5K6AC 2FF7A 3E5MA 4C4AA 4D0LB 1U4NA 3NHBA 4QFMA 2VDLB 4I4NA 4YRAA 2G9VA 4I1SA 3WG9A 1PD0A 2H5EA 4YP0A 1EFCA 2F3UA 4X8MA 5CDUA 2Y1KA 1WXEA 4CEIA 1B7GO 1Z88A 3EAGA 2OCGA 3MJVA 2BEUB 5L40A 2FF5A 2EIXA 3HA3A 3ISTA 5FTLA 4XWGA 4OHUA 1C9NA 4E5NA 1XCJA 4NOKA 4RFSB 3EYWA 2EGGA 1HL7A 1CBUA 2PR2A 4JK3A 4XIYA 4CU5A 1PZMA 3KPVA 3BB3A 5TF0A 5JJIA 4JJ7A 4BMYA 3U80A 1FE8A 4UDOA 5KJFA 2DUMA 3IUPA 3QFCA 1TIBA 4ZQEA 2GN4A 4DWWA 2EX0A 3EFOA 1PFVA 1WMAA 3EOZA 5LP6F 1GCAA 3LT2A 5BSWA 4GOND 4ND4A 2K4MA 3HBFA 4EO4A 421PA 1HT3A 3GQBB 3C4JA 1J0XO 1GGKA 2RAVA 2PR7A 4TVSA 5LOVF 2BBSA 5HILA 3EZ7A 1F20A 3ZZTA 4P2GA 5IAGA 1I5EA 1KR2A 2NXJA 4HNAA 4IVPA 4RTRA 1AUVA 5E6UA 4AQ7A 3WLEA 1G64A 1NFFA 2HNKA 1Q3TA 3L06A 4MI9A 1ECLA 4R2HA 4YP6A 1Z5ZA 1WKVA 2ZROA 3HUUA 1P1BA 3IYLW 3NC0C 4X0EA 5JWRA 1ATIA 1MW8X 3J7AC 3RIGA 2H1CA 1MO2A 3HA5A 1TGYA 1Y6QA 2IWHA 3HCDA 4KR0A 5JDIC 5LN1A 2ZJAA 2WIAA 4FD2A 4CVNA 3A3OA 4KWTA 2OY0A 2HQOA 4MP3A 3KR9A 3OZFA 1W36C 2XTJA 2ZB7A 2RHWA 2FCAA 4W5QA 4MITA 3IP7A 1N3BA 1G8SA 1Q1NA 4I8DA 1NQAO 4Z4IA 5I5EA 3QMVA 5LBUA 3W8RA 4MWDA 3C3XA 5DI3A 1J07A 3I34X 1CVRA 3OKFA 3ABSB 2RG1A 4CT4B 3N28A 4JP2A 2E89A 3DB2A 2VR1A 2D00A 1XRJA 1NLUA 4AMUA 5THKA 4FYWA 3L0PA 5KTOA 3LY5A 4YACA 1J7JA 2KLBA 1CFJA 4MV9A 2K6GA 2WIJA 4FJ1A 2SCUA 3I6YA 5CEEA 2OWDA 1M5RA 1DEHA 2HJVA 4MUHA 4DARA 5NULA 2J5KA 2W2XA 3VR1A 2WHXA 4EKGA 3P9ZA 2PX6A 5AT1A 2Q1SA 4NZZA 4PO9A 3RG8A 2GEJA 3IOYA 4FWIB 4D3YA 1EBBA 4NFLA 2XWPA 5EE0A 5AW1A 3QVWA 4BQFA 2PX3A 1DAOA 2XA9A 4TLEA 4UATA 1XC7A 1XRMA 2FWIA 3PUYA 3AR5A 1YS9A 3MB5A 5FO1A 3HEMA 5J2TF 2I62A 4G2NA 1JEAA 4E51A 4MDYA 1UFQA 4LZOA 4RS4A 4BN0A 3I8OA 4QDXA 3RFXA 3RE1A 1ZN9A 1PIWA 2OYCA 2XXAA 1YB1A 5IEJA 2Q0QA 4AWAA 4BV3A 1P9OA 4L7VA 5IYZA 1QYCA 3WYBA 5IT5A 2R86A 4PS0A 1P0PA 4C0KA 1KAGA 4R9NA 3WLKX 4C4TA 3A6HA 3KZKA 2O3RA 2EJCA 3PFWO 5EMHA 1CXZA 5HDQA 1V7ZA 4Z1MD 3H05A 5LU8A 2XGSA 4PQGA 2I4TA 4PX5A 3HK2A 2P3LA 1KU0A 3BL8A 3MSCA 3P5SA 4WDQA 4LRWA 1X8XA 5B64A 1D5CA 1ZH4A 4Z49A 1S2GA 3JYOA 3MJSA 5DGDA 4JSRA 4Q37A 5IKPA 1C4OA 2J3LA 2C57A 4RZQA 3VC7A 1RZRA 5E4TA 3ENZA 1WBBA 1MZPA 1KDVA 2I4RA 3OM0A 5L3QA 2HBRA 3I2JA 4B6FA 4MCAA 1Y3CE 1SMKA 2H18A 5EHXA 2BGGA 2GYWA 2WVAA 4Z51A 4MWCA 5ICSA 3U7FB 2XB2A 4NCKA 1U2PA 1EBFA 1NZFA 3SZLA 1DL5A 3R5HA 2ZB3A 1IN4A 4ZQGA 2NUAB 3F7MA 1QQBA 5FAKA 4FGSA 2NWQA 1XVLA 4LI0A 3FNGA 2JFBA 4OMFG 4ITUA 1QAMA 3EEFA 1EVIA 4A8TA 3KPJA 2O3JA 4DA6A 3VJMA 3R3ZA 4BXOB 4OAOA 2BM0A 4NL4H 5DHSA 1XNQB 1K08A 5BV1A 5KQPA 1V2HE 3NALA 1A3CA 1RM3A 1E1DA 2V4ZA 1R9NA 4Q9LA 4EABA 4PONA 3CW2A 3EXFB 4G4IA 3USES 2BISA 1L8XA 2C2GA 4GVPA 2YJTD 4LUCA 1IEWA 1D4OA 3UA4A 5CW1A 4DLSA 1T9GR 1KH1A 1Z63A 3CWZA 3OFNA 3K8QA 4FUQA 4H3KB 4IIEA 1JTEA 1M0TA 1WVMA 1CUIA 2GNOA 5SYNA 3LO5A 4U8GA 3V8QA 4EF6A 4TS4A 4YLEA 1BIFA 4YT2A 4R5MA 5HZKA 2I87A 1J1IA 2WWGA 3PX3A 4JWTA 4E5MA 3PDJA 3K6RA 4KYTA 1GOTA 2PANA 3H7AA 3WE7A 4RAQA 3NKVA 4EM6A 1PWZA 4K28A 4B6OA 2VWQA 2OE2A 1DFGA 2IZ6A 1Y7TA 3GFVA 1O8CA 4P53A 3LXUX 3KG2A 4H6VA 3ZQ4A 1D03A 1NXWA 3H86A 3EFOB 2GF9A 4DBZA 3ZEAA 2J87A 2Y2UA 4YN3A 5F4ZA 5ALQA 4H59A 4ANFA 2ISSD 4H6XA 4LZWA 3KQTA 4HFJA 3ZWMA 2QTZA 4YUAA 4N5IX 1HUQA 2O5RA 4X90A 3THXA 5JU6A 2ZI9A 3LX5A 4B3RB 3L7MA 4G86A 3M1LA 3SG0A 1ZD2P 3WBKA 2QVLA 2H1OA 1SVKA 1BVRA 1ULSA 1VL1A 1X1EA 1Z0DA 2XEDA 4XD7A 3X43A 1SXJA 2CJFA 2O3SA 2O7NA 1JKXA 3D6HA 5L3ZA 3ZCUA 3GLFA 1PGJA 4PZPA 3U6KA 1UOQA 4BEWA 3FVQA 1V1MA 4YYEA 2HQRA 4LK2A 2GKOA 2WKRA 1TD9A 1MPTA 4O59O 3D4IA 1BGWA 4LVUA 1Q0QA 3VMFA 2O0JA 3B7PA 4LXUA 3AHIA 1V8BA 2GZHA 1YZKA 4LAFA 2DWPA 2PSEA 1UJBA 2F1HA 3KEOA 1HG1A 1OI7A 1A8SA 2OV8A 3L9XA 1KTVA 1VE9A 4L6CA 4YDQA 5IVIA 2A2ZA 1E63A 2DU8A 2OD9A 1EJBA 1NQTA 1XHEA 3NORA 4TLLB 1D1TA 1VIMA 1U9YA 3ZK7A 3IT2A 2IV3A 2ZYIA 2HRBA 3HZOA 1CQZA 1O97C 3JQAB 4J9UE 3OWHA 3TUIC 3KFLA 2EJBA 3PD0A 2GLXA 1QHFA 4NBSA 5AKEA 4ZAZA 4FC7A 3UBTA 1JU3A 2SCUB 3GJZA 1Q0HA 2EDAA 5K6RA 2QN8A 3IAFA 1JWLA 2M1ZA 3I61A 3IMFA 1U8TA 3LMKA 2F64A 2PZAA 5CLJA 2YH2A 2XNKA 1I6KA 2Y0PA 3N2KA 5DCWA 2X0FA 3WQSB 3C8MA 4MUGA 3E23A 4GQIA 1FNBA 2LW7A 1Y6RA 2REXB 3EH2A 3BSFA 4NTZA 2IYAA 2X40A 4Q1DA 4AY5A 2IOQA 3MBIA 4ESHA 2E4XA 1NW9B 3ZWOA 5DULA 4M46A 3ZWNA 1U2ZA 4BN4A 5GY7A 4N9QA 1BZYA 1E1KA 1RQXA 9ABPA 3QWBA 2XYQA 1XZIA 2CNWA 1ID1A 5AKLA 1Z68A 2YR0A 5D86A 3LGSA 5JXIA 1N25A 1WU7A 3QA3E 4LPKA 4QRDA 8AT1A 4EAAA 1GPUA 4E6PA 3PXAA 3OZRA 1L5KA 1GDDA 1RZVA 4I8XA 4J7CA 1I1QB 4G1EB 1T9BA 1V8PA 2J9ZB 1H8HA 2CBXA 2Y05A 3AY3A 3N07A 2UUOA 4J6FA 2WMDA 4LBZA 2JW5A 4DDTA 3AUSA 4WKNA 1R0CA 4ZDKA 1MAAA 2BGJA 4RPCA 4XR4A 1T5SA 3T1OA 3CSDA 2VSNA 4W7SA 1ELOA 4KDRA 2DF8A 2PVCA 3OESA 2E82A 4HB3A 4OP3A 1M67A 1EX6A 2P6MA 2RBEA 4TKUB 1HSOA 1RJDA 4BO8A 5JXGA 1T8UA 5B6JA 3HADA 3TIIA 2QRHA 5BQFA 5CDHA 5L3QB 4AO7A 2FEKA 3LM8A 3H2YA 4QYXA 2XBLA 4UC0A 4B6RA 1AZWA 4M8SA 4W1SA 4GR4A 2G70A 5LKRA 2ZUSA 2QE7A 4ZOAA 1LX7A 3GDFA 1KVSA 4REQA 1IATA 4LRUA 4FGKA 1PLJA 3KQPA 1TJ5A 2ID8A 3R5TA 3C5WP 1AB5A 1KKMA 3AKDA 4HCJA 3R8XA 3CZRA 1FW6A 1USVA 1KVRA 2IDKA 5LCXA 5IBRA 1FFXA 1EFVB 1TI7A 2OHVA 2RE8A 4WCFC 2W6CX 1S2LA 1QIKA 2H57A 3H97A 1KI1A 3LZ6A 1KJNA 3HVUA 4JUBA 3WK8A 2QIOA 5J63A 1PJQA 1RCTE 4QASA 4PINA 1T1SA 4GSLA 721PA 1J1UA