3A1VA

Crystal structue of the cytosolic domain of t. maritima feob iron iransporter in apo form
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
254
structure length
252
Chain Sequence
HMVKVALAGCPNVGKTSLFNALTGTKQYVANWPGVTVEKKEGVFTYKGYTINLIDLPGTYSLGYSSIDEKIARDYLLKGDADLVILVADSVNPEQSLYLLLEILEMEKKVILAMTAIDEAKKTGMKIDRYELQKHLGIPVVFTSSVTGEGLEELKEKIVEYAQKNTHRMILDYGEKVESEIKKVENFLRDKKLRINPRYFALKYLSGDPEFYSEGVKLGLPELSEEERIGYRLLIAKRKREYVENVVKEAFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of novel interactions between the small-GTPase and GDI-like domains in prokaryotic FeoB iron transporter
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transport protein
molecule keywords Iron(II) transport protein B
total genus 87
structure length 252
sequence length 254
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02421 FeoB_N Ferrous iron transport protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3a1vA01
1E2HA 1DAIA 1II8A 1E99A 3U7FB 2IYLD 3VHXA 4Q48A 1T5LA 5KNBA 1R5BA 2JIZD 4HB4A 3QPUA 1S1CA 2AXNA 4PHHA 1FMJA 1P2TA 2FNAA 1GNPA 4IEEA 1W2GA 2IL1A 3KL4A 5E7MA 5AJVB 2GJ9A 2J87A 3RS2A 3TJZA 4BFYA 1F6BA 1Z2CA 3ZS9A 4DDWA 5GADl 4JKIA 1SZPA 1XZPA 2QTHA 2PBRA 2E87A 2V9PA 1WE2A 1KHTA 1R2QA 3KKNA 2FEMA 3IUYA 3V4FA 2QMEA 4JYCA 1N5IA 2BKUA 1CR2A 2OCBA 4MYUA 2EFCB 3AF4A 4M9QA 3BERA 4HUQA 2PCJA 1GITA 1XWIA 3OIYA 1A1VA 1X8KA 1UM8A 2FE4A 3B82A 3GCGA 1P72A 4XOIA 2A5JA 3SI7A 1L2TA 2J7PD 1UEIA 4TTQA 1ZD1A 4FN5A 1QHYA 2JLSA 3VQTA 3FKQA 2ZSEA 1P60A 1P9NA 3U5ZB 1Z0JA 2F1HA 3DKVA 4EPTA 4C2UA 1G3RA 3S1AB 5FBWB 4JLPA 4MKIA 4CIDA 2PLFA 4KU4A 2OLJA 4WA7A 4C2TA 1P3JA 3L0SA 1SVMA 4D4MA 1B23P 1D2EA 1UBGA 1XXHA 1WRBA 2BDTA 2ZSFA 4OK5A 3WP0A 2P5SA 1KMQA 1KO8A 3OEED 4N3NA 1AGRA 5SZIA 2QBYB 2GCOA 2Z4SA 2RGGA 3GFOA 5CIWA 4N0EA 1CS4C 1SXJD 3CBQA 1JQJC 1JXMA 2WAXA 2BVNA 1W49A 3NDPA 4Q4HA 2NTYC 1XCMA 3BWDD 3GLFE 2ZI7A 5BQ5A 2CK3D 2XXAA 4AYWA 1G6OA 3CNNA 3RWOA 2OZEA 4LGMA 3SN6A 2GXUA 3M1IA 1ZJ6A 4LHXA 4TQ9A 3B13B 4LYFA 4JYBA 3GLGA 4MGZR 1Z63A 1MO4A 4URYR 3BFXA 5JJIA 4M0LA 3SJBA 1OB2A 3FHCB 4NYMR 1Y63A 3TR5A 1E1RA 2FSGA 2RHDA 1SVSA 3LVQE 1SULA 2VEDA 4URWR 4JLKA 3TK1A 1UJ2A 4OQXA 1DAKA 2XITA 5GJVC 1E2GA 3MWYW 2V4ZA 3KJHA 3QIAA 1Q20A 4UNRA 3I32A 4TL6A 2GHIA 3I5YA 3SE0A 4LY6A 3SZRA 2IYZA 4AKHA 4Z54A 1OIVA 3ZVMA 3ZS8A 4C4PA 2XZOA 5FOSA 4XVRA 2XNSA 5KU1A 2QMUA 4EFNA 1FQJA 1KNXA 4A8JC 1J8MF 3S1AA 2NPIA 2FFBA 2BC9A 4DEXA 3MRSA 1SVWA 2WJGA 4GSYA 4LJ7A 3RS5A 4KFSA 2BBSA 4E5UA 2VHUA 2CMKA 2ZSDA 1VG0B 1NVWQ 2ASEA 3QXCA 4HUQB 2FU5C 3OF5A 2XZLA 5KDLA 1F3OA 1H8ED 1TX4B 4QHSA 1DOAA 4GFDA 2WWXA 5AUNB 4P0TA 4W5WA 1PUJA 3K70C 3C4JA 2FEOA 5UKDA 2QMHA 2PL3A 4QGHA 1JECA 1YZQA 2ZYWX 3IO5A 4C0HA 2G77B 2EVWX 3FHOA 1U8AA 4NDZA 3RC8A 5CDFE 4ZDIA 3W90A 1MO3A 3ZDQA 3GLIA 3DEFA 4NCNA 1OT3A 1G9XA 3C15C 2AHOA 4ZPXA 6Q21A 3T1QA 1OJLA 1P6XA 5FUYA 1KTVA 1YR7A 4CDGA 1WBDA 1X6VA 5AK0A 4IEIA 4M8NE 2J0QA 2WOJA 1KKLA 2MMCA 3IPYA 2A2ZA 1QG2A 4JLMA 4OJKA 3U7EB 3B1ZA 3K0CA 5DHFA 1ZM2A 1E4YA 1TUEA 3OEEA 3VMFA 4P4SA 3AVWA 4Q1FA 2GK7A 3BS4A 3KQHA 3LAWA 1OH7A 1EFUA 2OBNA 3C5CA 5JLJA 1PUIA 4XJXA 4DT1A 3AVYA 1BMFD 1Q1BA 2HCBA 4BUJA 5AJWA 1TTTA 1XEFA 1BOFA 2YC4C 2HLDA 3A37A 3QUSA 3SU8A 2VLIA 3TW4A 3L0IB 1GAJA 5HCIA 4DCUA 1GOTA 4LJAA 3EWAA 1NY5A 4EPRA 3PIRA 3GD7A 4HAVA 1AS3A 2R2AA 4KFUA 1DO0A 1ZUNB 2Z83A 3DZ8A 2ZS7A 3RSLA 1P9WA 3UK6A 1I4DD 1E1RD 4GBMA 4NCHA 1OW3B 1M34E 5KDOA 4YMTA 2B6HA 1P9RA 2WKRA 1R7RA 3BXZA 3EIQA 3K70B 4G01B 1XEXB 1XTRA 1SKYB 4QBIA 1CJVC 1EESA 4PO1A 2HDNB 4D4LA 3WBJA 2ZU0C 5E4FA 4F38A 4HB2A 4PZYA 3TVDA 1KI6B 3LBHA 3IBGA 4Q4JB 4BFUA 4TZ6A 5JRJA 3DL0A 3CX6A 4EFMA 2B7BA 4B3DA 1C9KA 2Q6TA 3U3OA 1P75A 3QXXA 3QF7A 1EWQA 4TWZA 1YZLA 2C03A 4IVPA 1S3SA 2Z4RA 3MWLA 2ZRDA 3CRVA 3SEAA 4FMCB 4GPTA 2GETA 2BBWA 1X86B 4ZCMA 5K8IA 3ZLJA 1VG1A 4CT5A 2GXAA 1DBSA 3ZVNA 1S0UA 4B2PA 521PA 3LXXA 2LKCA 4N1AA 4Y0VA 5FPSA 3RYTC 5JCPA 4FINA 5JCZA 4DC9A 3TGPA 3V9PA 4WXPA 4A2WA 3AUXA 3EPLA 2PJZA 4Q9KA 3CR7A 4LJYA 1U8YA 3H84A 1JJ7A 1CU1A 3ZIAD 4BECA 4P4SB 4OKSA 1XMVA 1JAHA 2ZJZA 2J59A 1XBTA 1G291 4TYPA 4PC7A 2REXB 3AKYA 2VHQA 3B7GA 4LPKA 4RKFA 2ZROA 5EXPA 3LX8A 5TMPA 3TIFA 3CF6R 1UKEA 1UFQA 2GAAA 1V5WA 3MCAA 2FJUA 3U7HB 3LBNA 3LV8A 3QOFA 1KSGA 3BAFA 3NC0C 5CJPA 2C04A 1QDEA 1XMJA 4MYTA 3W5JA 4CGZA 1XDBA 3JZAA 5KUTA 5KPDA 2VP5A 4NMMA 1AN0A 2QM8A 2IXFA 3TW8B 2ZREA 3MJRA 4CZ2A 4JT4A 3KKMA 4E22A 2A7QA 3TSOA 1UAAA 4AI6A 4ZIRA 3NWJA 2WIAA 1QRAA 2JIZA 4RCYA 1E2QA 1N5JA 4CT4B 3QBTA 4QGFA 3ZD6A 3TUIC 4AWXA 1TPZA 4D82A 5AUQA 1GUAA 3QXJA 2W6JA 2UZ3A 1KO1A 1KDPA 3MFYA 3Q5EA 5BWMA 3UXMA 4WAUA 5F98A 2V6JA 2ZE7A 2WWIA 4CRWB 2P6RA 4IOKA 4M53A 1RW4A 5FOUA 3IGFA 1COWD 4MRVA 4LYJA 2DWPA 4OQMA 1EXMA 1Z83A 4KCGA 1NP6A 4MRSA 4XVQA 4CYMA 4OHWA 4AY2A 1XD2B 4KV9A 1KDOA 4K8OA 821PA 1NN3A 1J7KA 2ZS9A 3ND9A 4QBFA 1NN0A 1VYVA 1VHTA 1XEWX 1QHGA 3MAAC 3TRFA 1JNYA 5FTLA 5JS8A 4NCJA 3ZQJA 2ZRGA 2F1JA 4LV5B 1P2SA 1E2FA 1OPXA 2YOHA 5EUQB 4C0SA 1ZUHA 1IONA 1U90A 1ZVQA 1IN8A 1DPFA 2XAUA 5GJCA 2JEOA 1GWNA 3CLVA 4EQ6A 1K5GA 1J2JA 1R5NA 1BH2A 3GLIB 2OV2A 5EUMA 2QE7A 4EPYA 5J4VA 3GJ8A 1SHKA 1ZBDA 1UPTA 3VTKA 1FUKA 5KYKA 3TLXA 3IHWA 3QF4A 3FVQA 1KK1A 221PA 4KFRA 4L9SA 2F7SA 4PX9A 1BYIA 2P6NA 1VCIA 1NG1A 4D0NA 3Q85A 4GNKA 5LD2B 1XD9A 3VX4A 1NVVQ 4CVNA 1US8A 2WJYA 1VCNA 2DFKB 1BS1A 4TTRA 1A2BA 4GOJA 2CNWA 5CLQA 3CUEF 3QKSA 3BIFA 2GILA 3QPVA 5G3YA 1M2OB 1OFHA 2DPXA 1GG2A 2FGJA 2QSYA 3A1VA 2QGNA 2J46A 2UZIR 3FKSA 3PQCA 3L43A 4QJ4A 3U6KA 2VP2A 1QZXA 2J41A 2C77A 2VF7A 3T1OA 2QBYA 1DS6A 1E6CA 1AK2A 4TN1A 2WVJA 3QVUA 4OHXA 4DIDA 4Q9LA 2WPDD 3R20A 5EP3A 2DB3A 3ICQB 2OCPA 1Z06A 2YWFA 1E0JA 4HAXA 4U7DA 3LX5A 2GAOA 3UMSA 5IK2A 1G17A 1XP8A 3ZJYA 4YLGA 5KPJA 1KI4A 1RRGA 1E79D 4K81B 1LV7A 4PFSA 2QT1A 4XWKA 1N6KA 3NHBA 1IAQA 2UVQA 3Q7PA 4JSTA 1UKYA 5K8UA 1FQKA 2FPMA 3BFKA 5DI9A 2J7KA 1GDDA 2GF0A 2RGNC 4GOKA 5CM9C 1XCPA 2VP9A 4PC6A 3O8DA 1OH5A 2N1BA 5KNCA 1E9DA 3ICEA 4KBFA 1Z5ZA 2LCFA 4AG5A 2HJGA 3I62A 1ZM3A 5BXQC 5FL7A 1XJQA 1NVVR 1T6NA 4QRHA 4DRZA 4QG7A 1XMIA 1KAGA 3N2EA 3GLGB 1QHHB 1S9HA 5J4YA 2FDCA 3T1VA 3O47A 1HE8B 2ZU6A 3W9YA 2ZUDA 3UMRA 4KBGA 4M2LA 3VU9B 4DLWA 1U0JA 3FPAA 4JL6A 4MRRA 4RFVA 2W58A 3GQBA 2VBCA 4M4SA 5LD2C 2R9VA 1PLLA 2WMNB 3A8TA 3FMOB 4V0ME 2G6BA 2C9CA 2Q21A 3H1TA 4JZKA 3WNBA 1WA5A 3HU1A 4I4LA 2JLZA 1T3LA 2W0MA 1KK2A 4LC0A 3QQ5A 4ZKDA 3KB1A 4UNSA 1JQLB 1KJYA 3MWKA 2IYVA 2AKAB 1MR3F 2ANBA 4JLBA 2ZE6A 2ZYTX 1XXHB 4AURA 1Z6XA 1EG7A 3I61A 3THXB 1FTSA 2CVHA 3NH6A 1VYTA 2IYSA 1V43A 2ORWA 5KSOA 1G7RA 4Q03A 5DN6D 5C4MA 1S96A 2JDID 1RPZA 3ZGXA 1DARA 5DIFA 1ZUIA 1CTQA 5A5GA 1MT0A 2QP3A 3VX3A 5HKKA 4D2IA 3SJAA 3GLFA 4PR0A 3TUJC 4YMVA 4MGYR 1Q22A 3CX7A 1XX6A 4HATA 1DADA 3NC1C 3SHFA 4AYTA 1CR0A 4V0LA 4ZCIA 1TUIA 4TZ0A 4B75A 3SS8A 4EPVA 1BIFA 1VPLA 2JJ8A 4GI7A 2ZRFA 3K53A 2B8WA 1ZIOA 1N6IA 1CLUA 3CONA 2WWHA 3PUXA 4F4JA 5FPKA 1G8FA 3KJEA 3SQWA 3K9LA 2FFAA 2IK8A 2JA1A 2ZI3A 3CF0A 5FOTA 3U3KA 3LXRA 2FOLA 1T8UA 1JEDA 3H4MA 2Q0HA 1GVNB 2DCUA 1E32A 4AYXA 1HURA 4DLYA 1FW6A 1G8GA 5FL3A 2G0TA 3AUYA 3D6TB 4KI0A 2FV8A 3LWNA 4US1R 4PPGA 4UKDA 3F8TA 5JJKA 1KKMA 2QPTA 1QVRA 2XTZA 4BLTA 4Q1BA 2IWRA 3KXIA 3PUZA 3GFTA 4Q7JB 1KDRA 1SKYE 1HUQA 2FSIA 2IT1A 2XX3A 2ZRHA 3Q7QA 4Q9HA 3RAPR 4B32A 5DISB 1TU3A 1D9ZA 1TQ4A 1D6JA 3R7WA 2CCGA 1KI2A 2J3EA 2VH5R 3U7GA 3IPXA 1Q1ZA 2IEZA 1OKKD 3GEEA 4M1SA 3REFA 2PMDA 4JL5A 4NE2A 3D31A 5M04A 1KY3A 5EXSA 4XWAA 1N6NA 3QSYA 4KSBA 4BASA 2NZ8A 1TL7C 1W46A 2GZDA 3K1JA 3QKRA 4DCSA 1G3QA 4JSYA 1H65A 4EJSC 3K9GA 2FH5B 2NOAA 3KQKA 3L0OA 4P31A 3X1XA 3KB2A 3R9XA 2A5YB 2QI9C 4Q4JA 3ZD7A 4YQFA 4IOLA 1E3MA 4G5RA 1G5TA 1S2MA 2FGKA 3EZ2A 3KJIA 4EKDA 1NVUQ 1JEEA 2XJ9A 3C41J 4PC2A 3LO5A 3SDZA 3T15A 4FI3C 4PSVA 1W1WA 3RS0A 3UG7A 2X77A 4C0BA 1OXSC 4IOMA 4JBXA 3W5IA 1ZU4A 5AJXA 4CF7A 3BH7A 2VTKA 1Y3AA 3ETLA 2RGCA 4GP6A 3U4QA 1HV8A 4KODA 1YZKA 3L8ZA 2QENA 4P4TA 1AS2A 1MO5A 2WSSA 3A1SA 3U3RA 5J4HA 1M1YE 1EX6A 1GZSA 3FWYA 4G5GA 4LRWA 4BRUA 1IY0A 1FX0A 2NO7A 4DSUA 3CKLA 4NBSA 1E96A 1YR8A 4S35A 4MDEA 3ADDA 4FCTA 4ABYA 3HU2A 4JS0A 4AG6A 3GLGE 4MQBA 4GP7A 3EAQA 1HE1C 3KTAB 3SFZA 5IHPA 4FMDF 4ASUA 1R0ZA 1SXJC 5LBIA 1RRPA 2OCAA 5JWHA 2DWOA 5JMTA 5LPNA 3W6OA 1JB1A 4QGAA 2RKOA 3LQRA 4TL9A 1PVOA 2YJTD 1WB9A 1NF3A 2RGDA 3Q9LA 3ZYCA 3B1WA 3UIEA 3AVVA 1KZGB 1W4BA 3CRRA 1TF5A 1XJ0A 2ZJAA 2O8DA 3QXHA 2X1VA 2VA8A 2XOKD 2XGJA 2C9OA 1HT2E 5GVSA 4LYHA 4NYIR 4WOPA 2BMEA 2C96A 4M9ZA 3U44B 2AD1A 4BLSA 2KB0A 3FFAA 4NYJQ 3MMPA 4HUTA 3HPRA 2CL0X 2GVZC 2RGEA 4A6PA 2EFDB 2H1LA 5ANRB 5CLLA 3B9PA 2HXYA 3U3MA 4LHWA 4F4IA 1Z29A 4B3CA 5DI3B 1GNQA 2W0SA 2CJWA 2BV3A 4NH0A 4DSOA 1KJZA 1YRBA 3A36A 3AP1A 5CDFA 1KIMA 1S1MA 3PUVA 1EFRA 1U9IA 2RGBA 1W5SA 5DGXA 3KTAA 2V7QD 1WBBA 3RS7A 2DFNA 1AM4D 2HF9A 3GJXC 2QY9A 4JJZA 1CULC 1P5ZB 2ZJYA 1BMFA 1L8QA 5AUOB 2B21A 4BQSA 1S9DA 4IKEA 2CDNA 3SBEA 2F3TA 4ZDWA 4LHYA 5JWRA 3GLIE 1OH8A 2JJ1D 1U99A 3DOFA 4S2EA 2PJRA 3PCRB 1C1YA 3WHKA 5G3ZA 2ZRBA 3BFVA 3BH0A 3B5JA 4HYYA 5E7IA 2FA9A 2Z0MA 1LS1A 4RFSB 4F93B 4JVMA 4LWZA 1ZC3A 3QKUA 4HZIA 2O8EA 2ZRLA 4RY2A 3BC1A 1A5TA 2XSZD 5FUVA 4Z8YA 2TMKA 1B0UA 3DHWC 4MUAA 2HLDD 2ZR7A 2WWGA 3C7KA 2YVUA 4TQAA 2QPAA 5FTNA 2XOKA 1AQUA 2CLSA 1E2EA 1OFTA 4I1VA 1TADA 1DAEA 4POAA 3BOSA 2FX3A 1P2UA 1DO2A 4OI2A 2WSMA 1G4UR 1ZNYA 3LVRE 3RABA 4D80A 1FPMA 3C16C 1XTIA 3CRMA 5E95A 3EPHA 2QMOA 1ZAKA 1XTJA 3L0PA 3CNOA 4U00A 3CZQA 1KSJA 2O8BA 2CHGA 5FH9A 1G3UA 2WWWA 3QE0A 5EXTA 4CW7A 5H1YA 4DHEA 2EFHB 2H17A 4U5XA 4ASUD 3P4XA 4ESHA 1N0VC 3BB3A 4MA4A 3F3YA 1T8TA 1I2MA 4XWOA 1N5KA 1GRRA 1OXXK 4O25A 2ZANA 3PEUA 4FCVA 5C4GB 4M9SA 2WSSD 4A2QA 2V55B 1E94E 4LHZA 5F3WB 1CEEA 2NPFA 1KSFX 1G7SA 3EG5A 4FMDB 3K0AB 4DJTA 4M21A 1KI3A 3W3ZB 2EW1A 5KTYA 2QNRA 5L3RA 1KMHB 3RRNA 4GZLA 2Q9AA 2AK2A 4Q1AA 3VNUA 1WDTA 3PUYA 4OK3A 1E69A 3RWMB 4OHZA 3TAUA 3KDSE 2PMKA 3IIKA 5KSZA 1HEIA 4HLUC 1ZM4A 4WZ6A 1HYQA 3K0FB 2QA5A 1NSFA 3KFXA 5EE1A 5TARA 1K8RA 3C5HA 4PAMA 4BEJA 1W36B 4RD6A 4B2IA 4AC9A 3PXGA 3R7WB 5CYPA 3EX7C 1XNJA 1U98A 2GEVA 5EP4A 1Z6YA 4JLDA 4HAUA 3RLFA 1E9AA 2BM1A 2OE2A 5F9HA 2G1KA 4M1MA 1Q44A 2FG5A 2EYQA 1M8PA 1Q21A 1KMHA 2JLVA 3KXKA 4QHTA 2WKPA 4TMZA 4DLVA 4KLNA 4QNMA 2IA5A 3T34A 2WKQA 2QGZA 1TU4A 2ATVA 4LK2A 721PA 2B7CA 2J45A 4D6PA 2R8RA 4XD7A 3CB4A 3QKSB 4LZZA 2F6RA 4MYHA 4QL3A 1AJEA 5TB5A 4KLZA 1Z0AA 2WAYA 5FR1A 5LB4A 1G3IA 2XNDA 1GKYA 1WF3A 1KO4A 2L0XA 2ZE5A 1Q57A 4DLSA 4YONB 3LW8A 3EIHA 2R6CA 2J0UB 2F1RA 4FMBB 3B1YA 4OBEA 1P62B 1CR1A 1H8EA 1RZ3A 1NLZA 1T91A 2IYXA 3K09C 3A1UA 4KFTA 4MRNA 4OHVA 4OHYA 3BRWD 2CXXA 1N5LA 3T5DA 4MDFA 4IDHA 3CH4B 2CLCX 3BBPA 4MKGA 2EWVA 2VSFA 1ZYUA 2ZR9A 4ZI3A 5FUXA 4C0QC 2Y8EA 3B60A 3QJYA 2AX4A 2JGNA 1RJ9A 4D0GA 4JT2A 3U6BA 1TEVA 2W2XA 2CCKA 3CPEA 4DXAA 2W2TA 2V1XA 3DDCA 1N6OA 2OFXA 3M6AA 5TVKA 1MOZA 2OLKA 2PT5A 3FMIA 3M4YA 4PQFA 5EE0A 5BYJA 2C8VA 3VR1A 3I8SA 2HV8A 1W36C 3PEYA 4B3BA 2PEYA 2H92A 4HAZA 2JCSA 3EASA 2ZPTX 5A0FA 3RS3A 4A6XA 2BMDA 2O8EB 1VECA 3G5UA 3CPHA 5IRCD 2O0KA 2RGXA 4Z51A 4DDVA 1EX7A 4UJ5A 2QT0A 3PG5A 2ZJOA 1NIJA 3QY0A 2I3BA 3FKSD 5JHGB 3MJHA 2OSBA 4RCZA 3QG1A 2D4HA 1J99A 2RCNA 1G8YA 2VRWA 1MV5A 3EWSA 5L3VA 2Q3FA 2ZR0A 2JJ1A 3FOZA 2Q9CA 1PJRA 3F0TA 4MGIR 3ONWA 4ESVA 4L8GA 3WRYC 3ADCA 1CJMA 1US8B 1ZM7A 2ZJBA 2P67A 3NTUA 2CCJA 1E2PA 1N2CE 2GZHA 2R6FA 2ZYVX 3GLHE 1II0A 2JLYA 2CHVA 4QFMA 4M22A 4KXFB 4YMUA 1S4QA 4ZIRB 3AVUA 1NSTA 2REOA 1E9CA 1Z0DA 2ZAOA 5F2EA 1AQYA 5D3QA 2IXGA 2WZQA 3THWA 4ON9A 2WTUA 3CRQA 5FTJA 5P21A 5KO2A 2CLDX 4HDCA 3CO5A 2OFWA 4B73A 2MMGA 3K9HA 4GRAA 1AZTA 3PEVA 1X1RA 1KJWA 2ZI6A 3A4LA 3DMDA 1W0KD 5DNYB 5CB6A 3SYNA 4NYIQ 1F2UB 1W4CA 2YOFA 3AVOA 3NIBA 4TLBA 3WRXC 2IX3A 3GMTA 4V03A 3AH8A 3RVBA 1OXVA 3EZ7A 2ZAMA 4HLQB 4YMSA 3SBDA 1P4SA 2YC2C 3KKPA 4V0NA 1E2IA 3EPJA 1QHSA 2C78A 3KUDA 2YKGA 3TQFA 4IDNA 1TNDA 3B78A 2H57A 1JXOA 4TSFA 2BBOA 5TV2A 3O8RA 3A6PC 2ZSAA 5CJ2A 3KQLA 2MSCB 4LDJA 5JWOA 4PO9A 2GJSA 4JKYA 4A0GA 1TF7A 5KOYA 1NNEA 4V02A 5DH9A 2QG6A 1N6PA 2FFQA 2ZRCA 4Q4LA 5FPHA 3PVSA 2BJWA 5GVRA 5GJBA 1BO6A 1FTNA 2CE2X 2YZ2A 2WM9B 3QENA 4UXJA 3SC3A 2I1VB 1W5TA 1A4RA 4IVQA 4YDSA 3H86A 4ZV4A 3TSZA 4R98A 1H8HA 1NG9A 4DB2A 3NHAA 3FDIA 3CM0A 1Z6GA 1SKQA 5J47A 1A7JA 1JR3D 4RZXA 1EFCA 1Z47A 4O2RA 2OESA 3SJCA 3IO3A 1G21E 3U4QB 1TQDA 3QF4B 1GKUB 4QBHA 4B33A 5FPYA 3VKWA 1P7CA 4MUBA 1NRJB 2WJIA 1YZNA 3SYKA 2DY1A 3OAAD 2V7QA 2C9YA 3EIEA 4GT1A 1H8HD 1N6LA 1Q1QA 1YJ5A 2CJWB 3AF2A 1RKBA 1T3HA 5AWFC 2EFEB 5FOVA 3EC1A 2ZTSA 2JAQA 1KNQA 2JLQA 4ARZB 2OG2A 1G19A 4KJZA 4B44A 1KK0A 3U61B 1JR3E 1EGAA 1OYWA 4LBVA 5CK5A 4LX0A 2O5VA 4ILEA 3V4RA 2ZRMA 5FBLB 1KZ7B 3TAHA 3GPLA 1F2TB 2XZPA 1E0SA 3TE6A 4G3XA 1T0HB 3ZH9B 1FZQA 4DLRA 3TKLA 4BPBA 4AK9A 5JFGA 1G20E 1OXTA 2IUSA 4E03A 4CEIB 1RE0A 1Z08A 4IFEA 4AD8A 1DELA 4PO8A 3AB3A 2O8CB 4A8JB 2NZJA 1DG1G 1K6MA 1ZU5A 4NYJR 4QC2A 4DCTA 3ZZTA 1PLJA 2P0EA 5C1BA 4ACBA 4GMXA 2G9NA 1PZNA 3ZQ6A 2XJ4A 4NTZA 3NEJA 1NBMD 3X1YA 2VPPA 1YQTA 5JBQA 1CJKC 4FCWA 4XH9B 2IUUA 1Q1EA 1X8LA 1KI6A 4C30A 4RFSA 3NH9A 3LLUA 1FX0B 1GNRA 4LV6A 1KK3A 3LD9A 2RB4A 4Q1EA 2GBLA 5JSZA 3W6NA 4WIAA 4RZ2A 3T35A 3OE7D 1R6BX 2OXCA 4OL0A 1VCOA 4PHGA 2ZVQX 2QORA 1MH1A 2RGAA 4UXIA 1XEXA 3QNUA 1IY1A 1U94A 2FWRA 1D2MA 3DPUA 4TLAA 2VP6A 2YHSA 1LB1B 2VYFA 4QNRA 2VP4A 2YOGA 2VO1A 1K5DA 1G5RA 1QG4A 3CF2A 1Q0UA 4BZPA 2GWHA 3TH5A 4F7WA 2H8KA 4DDUA 2PCLA 1E2MA 3GLFB 4K46A 1LY1A 3CIOA 2IF2A 4RZ3A 1CP2A 2QQ0A 3P26A 5SZJA 2NO9A 3IBYA 4OQNA 4A1FA 2H16A 1Q3HA 2GNOA 4DBLC 4F92B 1E1QD 3ADBA 5G41A 621PA 4XSHA 2KWIA 4JMPA 4TMKA 3RNLA 2QZ4A 2BHRA 5C46F 2JDIA 3RC3A 3TSWA 2D06A 3GJ6A 4I1OA 3SHWA 4P4UA 5HZKA 1JPNA 1IOZA 3QXSA 4CEHA 1GRQA 1HH4A 1FP7A 4QJ3A 5TDHA 1IJEA 1LW7A 4J0QA 2X19A 4BFZA 1SXJA 3VKHA 4TQUS 5J4KA 5EXXA 4ARZA 4YDHB 5DYIA 5SZHB 3EZ6A 1Z6AA 2EYUA 1PV4A 3UATA 3ASZA 5JJLA 1DAFA 2BEKA 2NO6A 2N42A 3BORA 2QAJA 2VHTA 1WMSA 2D7CA 2IHBA 1XB2A 4R9UC 1NMXA 4M1OA 5HZHA 2HT6A 2A9KA 3THWB 4PXAA 3JVVA 3X1ZA 2GRJA 4DIEA 1SVIA 1HY3A 1KI9A 2Q3HA 5SZKB 2OBMA 3NVAA 4PQYA 3H2YA 3VU9A 4C7OB 1CRPA 1P2VA 4E09A 4TYQA 4Q18A 2ZIAA 2B92A 2OT3B 4EPXA 2J0SA 1FMLA 4DWJA 1OYYA 2AR7A 4YMWA 1CJUC 2ZI5A 5FI0B 4BZXA 2GZAA 3TUZC 2XB2A 1IQPA 1N25A 2ZE8A 2BBTA 1NKTA 4LJ5A 1U9IC 1T3SA 4H1UA 5H70A 4NZYA 1U0HC 3LDAA 2W6JD 1F48A 1A2KC 2HYIC 5FR2A 1WQ1R 4ITRC 1GL7A 3BB4A 4DLUA 1GM5A 2WJHA 2HJVA 1AA9A 1UEJA 3LW7A 1IXSB 4AIIA 2QM7A 5BW8A 4Q5IA 1ZNZA 3A1TA 5BN3A 1ZNXA 3Q5DA 5DN6A 2ZVPX 3HJNA 1X8JA 3SJZA 2BMFA 3KFVA 3OFND 3DKPA 1O87A 2P6UA 4BZQA 2SHKA 2ECKA 2Z43A 5EJEA 8OHMA 4FD2A 4D4KA 3RRZA 4XSGA 2CE7A 2K5UA 1AKEA 4TTPA 1JJVA 3AGPA 2GA8A 2G1JA 2J0VA 3LFUA 3N70A 4BE7B 4NCIA 3MSXA 2IW3A 1TF2A 2ZRJA 3LH5A 1Z28A 2JASA 5TY0A 3OEHD 3IKJA 3FE2A 5FBRB 3T12A 5DLQC 1OLOA 2F55A 2OEPA 1E9RA 1UDXA 3IDQA 4B35A 1HQCA 4BFSA 5BN5A 4RSGA 3DM5A 5EE5B 3OE7A 3QBVA 5DO9A 2RAPA 3OIWA 3VR5A 2IXEA 2R44A 4LYAA 3NEYA 4C0AC 3OIVA 1QHHA 1XU4A 2VF8A 1KI1A 4Q4HB 4RD1A 4HI0E 2VQSA 2XXAB 1JI0A 1G7CA 3LQQA 4Q21A 1P61B 4X8OA 3B1VA 4M1TA 3T06B 2QRNA 3CRW1 1EFRD 4TT3D 4LJ6A 3P4YA 4PTLA 1NLFA 2YWHA 5K8LA 1II8B 1Z22A 2ATXA 4DZZA 2GCOB 5FBVB 3CWZA 3NKVA 4EAQA 2CL7X 3SYLA 3EZ9A 4IDPA 1RYFA 1ELOA 1E98A 5IF9A 4B2LA 4IXNA 1AKYA 1YE8A 2EFGA 1XFAA 2QTVB 3I92A 3PV0A 4HSEA 4KO8A 4EJSA 5TXGA 1KY2A 1E0KA 1VKJA 4HZUB 2X2EA 5CK4A 2DR3A 2FMXA 2OHFA 4FWIB 2IF0A 1NN1A 1MKYA 4Q00A 1E79A 4D26A 1RJ9B 2YWEA 4TYYA 2C99A 2DFLA 3LBIA 3GEIA 1G41A 1RYHA 5J4LA 5FOWA 4NYMQ 5J40A 3ND8A 3C8UA 1NI3A 3THYB 4JBWA 1GFIA 3QKTA 4BLPA 3BGWA 1OF1A 4EPWA 2GJKA 4L16A 5LB2A 4CEJA 1XPUA 1GRNA 4BFWA 2J0UA 4BFXA 3T1TA 3AM1A 1XTKA 2KI5A 3K09A 4Q47A 4GDFA 2J9RA 4ZI2A 1LFDB 3K0AA 2J5XA 3ECCA 121PA 4HLDA 1VYUA 4OI0A 3BH6A 4EIWA 1JR3A 4WBSA 3LA6A 2AKYA 1UBEA 1YRAA 1N0WA 2GBLC 3OESA 2FZ4A 5JZVA 1WXQA 4LBWA 4Q9IA 4BLRA 4IDOA 1E9BA 1OFUX 3W8RA 2UKDA 1Z0FA 3F5FA 2Z6VA 1T4GA 2GJ8A 2VHCA 4FMCF 3GP8A 4Q9JA 3JZMA 1ZM9A 2ZJ5A 5CM8B 4YC7A 1J70A 2RMKA 1GTVA 1LF0A 4X8MA 4M9XA 2FPLA 5E7JA 5C2JB 1YVDA 1VTKA 3RRMA 3UWKA 4A4DA 2XTNA 3EA0A 1Z0IA 4B48A 2FSHA 3HR7A 3FYHA 1X1SA 3FMFA 2CL6X 3K8YA 4GZMA 2VIIA 2OAP1 4BLQA 3AP3A 1R0XA 3HYRA 1OKKA 3NBXX 4R2HA 1ZW6A 3EPKA 2BKEA 4F4CA 2JJ2D 2BJVA 3VR2A 3ZZUA 3UANA 1NIPA 1GL9B 2V8OA 4BRWA 4D81A 2QROA 2WMOB 3K0FA 1ZD9A 1I2DA 2ODBA 1NMZA 2F9MA 5HR5A 1VMAA 1CIPA 1LS6A 1ZMXA 4JBYA 1W4RA 4TMWA 3Q72A 3WBKA 1ZCBA 4UQOA 3WMGA 4B34A 2KE5A 3K0EA 5FPTA 3AKCA 5KHOC 5EQTA 3EC2A 4BLOA 3M0EA 2WHXA 1OIWA 3IQWA 4WZBE 2GESA 3B8HA 2PZFA 4C7OA 2ZS8A 1IBRA 1VIAA 1CKEA 3D7MA 2ZI4A 3E2IA 2O8FB 4KAXA 4PSAA 1UF9A 1LNZA 4GMDA 4URUR 4URXR 2W00A 3NG1A 2YYZA 3AF1A 3GEHA 4PC3A 5JHHB 1BYUA 5ELXA 2A78A 1XTSA 3KX2A 2B8TA 4H1VA 3RRYA 3O8CA 4HB3A 4EUNA 4Z8XA 2WICA 4IFBA 2EU8A 2OFOA 3U60B 1OSNA 1CJTC 3HP1A 1IJFA 1G1MA 3SFVA 2BEJA 4EQ6B 4HAWA 1CBUA 2W83A 3AQ4A 4WVFA 4ZCLA 4B43A 2ZJ2A 4B74A 2WWFA 2C98A 4TMTA 1N6HA 1KGDA 1QHIA 1R0YA 2A5DA 2KBEA 1RRCA 5AJZA 2G0NA 3K70D 1TQ6A 1YU9A 1KSHA 1J8YF 1HA3A 3P20A 1OHHD 1DG3A 1XXHE 3AGQA 2H18A 2O8DB 3CZPA 2ONJA 5B30A 3L2OB 4NU0A 4ERNA 1WP9A 1HQYE 2FSFA 3VHLB 4LBZA 1RC8A 2ZYUX 1CRQA 1MRSA 3WY9A 3X1WA 2JLWA 5KSPA 3I1FA 4KITB 2ERYA 4C9BA 1GILA 5A4JA 2F43A 1QHXA 2F9LA 3PUWA 1L4YA 2PEZA 1FP6A 3PEWA 1NL3A 1GSIA 3GJ7A 1RRFA 4IXMA 2ONKA 3FB4A 421PA 3ADKA 4DDTA 1G5PA 2CBZA 1XD8A 2FZLA 2XNDD 3EXAA 4JLVA 1NBME 4UNPA 4ACAA 4JVSB 2ZI9A 4OYHA 4A36A 1SXJE 5EP2A 4Q1DA 1G3MA 2QEQA 3OIUA 4OQLA 3BE4A 4QKQA 2Q3MA 2BCGY 3AVQA 3LRPA 1ZNWA 3UMFA 4TL7A 4HDOB 3THOA 2JATA 4OI4A 1J90A 3MD0A 2W2VA 1W0KA 2F1IA 1EK0A 1TMKA 1BKDR 2AWNA 5DI3A 1FNNA 5FL7D 4LJ8A 3CWQA 3T5GA 1AGPA 3EARA 2YINC 1HTWA 3CR8A 4IJMA 2GK6A 4JLJA 2ZRAA 2FF7A 5AUPB 4XIGS 1G64A 4WW0A 2CNWD 2BMJA 5L8VA 3PR1A 1IN4A 4PANA 1O3YA 4R71A 2BOVA 3N5CA 4DT1B 3I3SR 4I1SA 4KSCA 1LTQA 2QAGC 3VKGA 4LBYA 4WXRA 4O3MA 4DSTA 4Q1CA 2C2HA 2VP0A 1XRJA 4LOAA 1U81A 2PLRA 4H9GA 4QM6A 2HUPA 3BK7A 4C0LA 2A3RA 2OO7A 1DEKA 3LLMA 2IC5A 1R8QA 2H7VA 1IM2A 2ZRKA 4KVGA 2P3SA 1M7GA 5HPYB 4DUGA 4B47A 3FGNA 5JEEA 5DYGA 2PH1A 4O2LA 1AS0A 1ANKA 4PZLA 3GLHB 5FOXA 3DM9B 5G53C 3SQXA 3AKEA 3ZIAA 4XTCS 4A9AA 2N46A 4O0MA 2PZEA 2P65A 5B64A 5LDDC 3IQXA 2ZUCA 3B85A 3OHMA 3U2QA 2JJ2A 4LJ9A 5L3SB 1EFTA 4I1UA 4NL4H 2JLXA 2HCJB 2IYTA 1E2DA 1E4VA 3SR0A 3D3QA 4JJKA 4US0R 2QN6A 2BCJQ 3MGCA 5FTMA 4Z1MA 3RANA 3VR6A 2GVDC 2QE7D 3FHTA 5EP1A 2XEXA 4PHFA 4TMXA 4Q7LA 3SNHA 1M7BA 1NLYA 5CYOA 3CW2A 4DLZA 4LV8B 1IHUA 3JVUA 2VSXA 3T61A 3C14C 4W7SA 4C0KA 4RVCA 4B6EA 3FFBA 1GL6A 1W0JD 4LUCA 4ZO4A 4YXWA 3ZZ0A 1QVAA 2C5LA 4TT3A 1XJCA 3REGA 1DE0A 4U02A 4G5SA 3KKOA 1OFIA 4Q4AA 2V3CC 2QPOA 2WJJA 1XPRA 2IS4A 4Q02A 3G82C 4II7A 2AFHE 4LPSA 4DEYA 4IVRA 1YZUA 1Z2AA 2PZGA 3E1SA 1W44A 2NQ2C 2R6GA 3HYTA 3I4LA 3R8FA 1R5OA 1OB5A 2QAGB 4Q7MB 2OXRA 3IILA 2P2LA 1G8HA 1U8ZA 1D9XA 3A1WA 3GFPA 3PFIA 1T5IA 3A58B 4PAOA 1F2UA 5FFMA 4HDQB 5IK2D 4RD2A 1XZQA 1Q12A 3E5HA 4DCVA 4EDHA 3QI2A 1N6RA 4BEBA 5JS7A 4B3FX 4LSGA 1UADA 2Z5FA 3OEHA 2YV5A 3O8BA 1JR6A 1SHZA 1ZIPA 1ZCAA 4MKFA 2GF9A 3WMFA 4ZDJA 4BWYA 2QTFA 1XPOA 4DUGD 5EE3A 2QSZA 3QEJA 1E9FA 3VR4A 4QOSA 1G16A 2AK3A 1ETUA 1XEWY 3FTQA 1VG8A 4RKEA 2HXSA 4W9MC 4RJLA 5DE3A 2REBA 3CPJB 5B57C 5KNDA 2AN9A 3KQUA 2O0HA 3B2EA 4A15A 4GL2A 4C3ZA 4B3XA 1QF9A 1YR9A 5FI1B 2ZETA 1E0AA 2CK3A 2O8FA 1MABB 3QG5A 5FUWA 2DYKA 2AXPA 5IDVA 3IIMA 4A0FA 2QP4A 2ZITA 3FMPB 4JIMA 3B9QA 2KBFA 2W6ID 1D2NA 3CX8A 3Q3JB 3WHLA 1N0UA 4D25A 4URZR 1RVDA 4MITA 4AKGA 3B6EA 4QHYA 1KI8A 1I4LD 1UDWA 1ZINA 2LKDA 5EZ6B 2QUZA 3MWJA 2AFIE 4JL8A 5B58C 4IDQA 2A30A 4GOXA 1G6HA 4M1YA 5L3QB 3LY5A 3WP1B 4JLOA 2ODEA 1VG9B 2I1QA 3R8CA 1CF4A 2YWGA 1ZRHA 3BD9A 4UNNA 4D4JA 3TMKA 5B2ZA 2QAGA 5L3QA 1SVOA 4IW3B 4ZKEA 4R2IA 5EE9A 4IOJA 1ESNA 4HZUA 3W8NA 5G40A 4EJSB 3G0HA 1OIXA 4FXPA 3THXA 3I73A 5H68A 1P73A 2WV9A 4Q7KA 2ODNA 3KZ1E 4Q4AB 1TQ2A 2WWYA 4HAYA 3AP2A 3KQNA 1F5NA 4PZZA 1DAGA 2VL7A 4PC1A 4EFLA 2RH5A 4B3GA 2BM0A 4V0MA 4TYNA 2D3WA 4PPQA 5JI2E 1VCMA 2R6DA 4A92A 3WYGA 2V1UA 2HEIA 2NG1A 4Q19A 3W3AA 3GJ3A 2R62A 1KYIA 2NO1A 2D62A 4TYWA 1NJFA 1DAMA 4RZUA 4D0LB 1Z07A 4NCKA 1M74A 1YHNA 2ORIA 1Z0KA 3I5XA 3WYAA 4L5BA 4QXAA 3DZDA 3P1JA 4G1UC 4OK6A 2XSZA 4M1KA 3AVXA 1CR4A 2HF8A 3HPQA 1SXJB 4V0KA 4JVLA 2V6IA 4DVGA 4CEJB 2HYDA 4L4UA 5KDDA 4JLAA 1ZC4A 1II9A 4NONA 2O8BB 4BGDA 1E2JA 1R0WA 3P27A 1S8FA 3UG6A 4MRPA 2KSQA 4US2R 2VHJA 3ASYA 4KYUA 2R65A 1N3BA 1OH6A 1YR6A 4A2PA 4DLXA 3OZXA 1U2RA 2QL6A 4JVNA 3RS4A 3K9NA 5BYKA 2GEDA 3OFNA 2D7DA 2GCPA 5FBQB 3KUCA 4RD0A 1XMSA 1F60A 1UKZA 5DHAA 4MKHA 2LWIA 3E70C 4G5QA 5AR1A 2DWQA 1ODFA 2I4IA 3PJRA 5C18A 4QGGA 1JPJA 3EZFA 2A5GA 3A4NA 3VR3A 5JI3E 1E9SA 4LCBA 1W0JA 1QHNA 4M1WA 4YXWD 2G83A 2GTPA 2JLRA 1KDTA 1GIAA 1L7VC 4FIDA 1NBMA 4NHOA 3UKDA 5IT5A 1D5CA 3ZVRA 1X3SA 1OE0A 2DHRA 1E2NA 1VHLA 1W4AA 4FW9A 1MABA 4P32A 2ZSBA 4PHTA 1VIYA 1OXUA 3WYFA 2D74A 2P5TB 3DVLA 1W48A 4X8HA 4ZDKA 3SOPA 4Z1MD 2H5EA 5J5CA 3AVPA 3L82B 2HT1A 3TVTA 1MRNA 4PSKA 1ZD8A 1W2HA 5DSZA 5JSZB 4QJ5A 1WCV1 5CITA 2GXSA 2O8CA 2IYWA 2D2EA 1IXZA 1IXRC 1NVXQ 4NP6A 5JECA 4B76A 4OJQA 3KXLA 2CEAA 2NMVA 2IEYA 4V0OA 1E1QA 3EA5A 1COWA 4RD4A 2IS2A 1FUUA 4P3YA 2ZJ8A 1IN5A 1C4OA 4Y0AA 2E1RA 1NN5A 3AV0B 1OV4A 3TBKA 5AJYA 4UJ3A 2G88A 1G7TA 4WZAE 5D3MB 1DAHA 2IYRA 4R7ZA 2J7PA 3GLHA 3J81k 2XTMA 4G0NA 4DCNA 2AL7A 3IEUA 3UWOA 2DFTA 2GJAA 4B71A 3HR8A 4A82A 1CXZA 2ZQ5A 5H8WA 2W6IA 2GEUA 1ZP6A 2RGNA 1PLKA 3IEVA 2V54A 3H0KA 4BFTA 4CEIA 2OAQ1 2ZRNA 3DMNA 2X2FA 2PX0A 3P32A 4KHZA 1M7HA 2NGRA 1JBKA 4UNQA 3DOEA 1XD2A 2DBYA 3VNVA 3MUFA 1TEXA 1FFHA 3CH5A 4TL8A 1HT1E 1F2TA 2O52A 1MO6A 2G3YA 2R6AA 5EZ5A 1RIFA 3GJ0A 2ZEJA 1UBCA 1KI7A 2WIBA 3RDPA 4F91B 4URVR 2WPDA 4DLTA 2ORVA 3AF0A 3QVVA 2IWHA 4I99A 2ZRIA 2IBMA 2OILA 4Q01A 5JRZA 4QM7A 1EWRA 3L8YA 2QU8A 1UBFA 3KKQA 4XVUA 4XTRA 1NKSA 3Q8XB 3GJ4A 3NXSA 4L9WA 1AIPA 2F3RA 5CB8A 2OBLA 2WOOA 1TAGA 1Z6TA 3IHLA 4W5JA 3VAAA 1ONBA 1R4AA 3KJGA 4E07A 3NBZC 4OI1A 5GJWC 5L3SA 4PPNA 2MSDB 1DTSA 2KJQA 5HCNA 1G18A 4TSFD 1S3GA 3X1DA 1DVRA 1U0LA 3NDBB 3U3JA 3TR0A 4XD7D 1W36D 1E2KA 4I81A 3GJ5A 3WMEA 1KAOA 3W6PA 2CHQA 4KYIB 2FFHA 2IHYA 1GKIA 4MH0R 1G8PA 2ZUBA 1VDZA 2F43B 3MLEA 4HEJA 5HE8A 2XB4A 1NJGA 4IRUB 4A0RA 1I4TD 4G5OA 1LF5A 1NY6A 4QBGB 2E9SA 3DO6A 3I72A 3AEZA 4MYCA 3U44A 2ODWA 1KO5A 3QEOA 2ZM5A 2GDJA 5HKKD 3R9IA 2BIFA 1Q3TA 2IS6A 3MG9A 2IUTA 4Q66C 2MSEB 2ZRPA 4PQRA 4CEHB 4X8LA 4KVAA 1OHHA 3RHFA 4BFVA 4LC1A 5HE9A 3TNFA 2JLUA 4MGKR 1XTQA 2FN4A 4C0JA 5KSYA 3HDTA 5HTKA 2O0JA 3AVTA 1R8SA 3CNLA 2A5FA 4NKRA 4DB4A 4AKEA 3EW9A 1LVGA 2OM2A 3V00A 4TLEA 1XF9A 3NBFA 1A82A 3R9WA 5D3MA 3HWSA 2OCYC 2EWWA 1YZGA 1NMYA 3D8BA 1L4UA 3WXMA 4LHVA 3B1XA 3X2SA 4UXHA 3AF3A 3BB1A 1IN6A 1XCGB 3W34A 3PITA 4HB0A 1E2LA 1Z3IX 4TLCA 3QPWA 4N0DA 3OAAA 1M6NA 5E3HA 4P33A 3VFDA 2RHMA 2ZXUA 2AWOA 1R10A 5FTKA 2GXQA 3A4MA 2NIPA 2J1LA 2IYQA 1JAIA 1SQ5A 3PENA 1IY2A 1E9EA 2IYUA 1W7AA 2EQBA 1T0JB 3ZVLA 2BWJA 1IN7A 1UKVY 2IYYA 2X8AA 4FWTA 2GKSA 4JLNA 2AD5A 3UPUA 1GP2A 2WJVA 4PPFA 1T9HA 2QRZA 3BJIC 2IS1A 1SGWA 1G4AE 1FL9A 2ANCA 3IIJA 4PAQA 1FNMA 2PT7A 1FOEB 2YNMA 3QKRB 3THYA 2VSOA 3RSOA 5JEDA 3AKDA 2ERXA 4HLCA 4LJ4A 2GCNA 4A0HA 1KOFA 2QQEA 1JALA 4L15A 3K0SA 2WBLC 2PX3A 4A8JA 1ESMA 2Q9BA 3HU3A 4W5HA 2FPKA 4DKXA 1YKSA 1D8TA 2QP9X 4HLUA 2CVFA 4NPHA 5CIQA 1EFHA 4OQFA 3I8XA 4IHQA 4B6FA 4AKIA 1W47A 1Z8FA 3LNCA 4TLDA 3N2IA 1RFLA 2OUKA 3WNCA 5F9FA 2D2FA 4LI0A 1KO7A 1YZTA 4DSNA 1QBKC 1SVLA 5BN4A 2NO0A 4RD3A 1AZSC 5K8TA 3K0CC 2C95A 3NBYC 3TQCA 1SVKA 4TMVA 3WNDA
chains in the Genus database with same CATH superfamily
1N9KA 1E2HA 1XK7A 3PCXA 2PA0A 5BT8A 2IYLD 4PFQA 1J0BA 2P1DA 4Q48A 1T5LA 4C4AA 1R5BA 5EKSA 4KN9S 3LPCA 3OLYA 4QASA 3D7KA 3QPUA 2AXNA 1ZZEA 4HDKB 3ZWCA 2YRXA 4G0QA 1QGYA 4IEEA 2V96A 3L01A 2GJ9A 3KZVA 4ZZ1A 3OPYI 4MVJA 5KC8A 1JH9A 4OX9Y 1F4LA 1BQ3A 2GHQA 4WBNB 1MJGM 3WKEA 1EA7A 1RC0A 4NBNA 4WGFA 4RPCA 4Y9DA 5LUBA 4YQYA 5I7AA 3GMIA 3V1NA 4A2CA 2I2AA 5GADl 2E87A 2QTHA 2V9PA 3G9QA 1WE2A 4KYTA 3V4FA 5CYFA 4V1CA 3TLMA 4JYCA 2BKUA 3ORRA 1LLCA 4MYUA 1ZI6A 2M6KA 3BMOA 3P0FA 1L5ZA 4QWMA 5KMGB 4K1LA 3WSVA 1FP4B 3OIYA 4G0UA 3AYXB 5IVPA 3GCGA 3H5VA 4DREA 2PUWA 3GU3A 3WK8A 1FDUA 3PC7A 3EMBA 1JG3A 2D5IA 4P7JA 3MB8A 3D5TA 4M8LA 3UPTA 4RIFA 1Y33E 1Z6PA 5T4HA 3PDIA 4FHZA 4CBVA 1XN4A 1YIAA 2H54A 4CN8A 3PFHA 2OB2A 3E81A 4EUEA 3SOZA 3NUGA 4C2UA 4JLPA 1YKGA 1X3LA 1VLQA 2Y1CA 2PIAA 4WA7A 1EWTA 1RI1A 4LZWA 1GRCA 2X1HA 4MV7A 3JU3A 2W6ZA 3A9WA 4TTSA 1WRBA 3WP0A 4BMOB 2WNHA 3DMRA 2P5SA 4B17A 1LX6A 3NORA 2XRZA 1Q7CA 2IZ0A 3M2PA 4YCNA 1BE0A 5U4QA 4O4LF 2GCOA 2CWWA 2IYEA 4CV0A 4KR7A 1HDEA 3GFOA 4WK6A 5J5VA 2VH2A 4BQNA 1QTIA 3T9BA 1GJRA 4M7OA 3A6ZA 1YZFA 1T5SA 4TWRA 4B5KA 1C9YA 4LXTA 4OXQA 2JBAA 4ZU1X 4O29A 1B15A 3DBVO 3QVSA 5LLSA 5AVZA 3JS5A 3RSQA 1QRUA 1KXZA 1N33B 1XCMA 1KJ8A 1JDPA 3BWDD 2ZI7A 1TT5A 1EDZA 5KVQA 4F3KA 4J16C 3AWDA 3AO0B 4HWGA 3WWDA 1YB7A 1WSDA 4GLJA 2QNBA 4C76A 1XDUA 3BEOA 2ASVA 4UASA 2GXUA 1EX1A 4KXQA 3QHQA 2EBFX 3OCCA 5E7QA 2IXAA 4G07A 4DRYA 3GLGA 2H1IA 3HB4X 1MO4A 5JJIA 1NAHA 4M0LA 4AMUA 2P9JA 1Z5PA 2YMMA 3BXFA 3DGEC 2NM0A 4NYMR 1Y63A 2CDBA 1JB9A 2P6OA 2QZZA 2ZSIA 3LA8A 5LBUA 2C4MA 3VAZA 3OQNA 4FZRA 3DV0A 3V7FA 3ZHOA 5ETJA 1UPXA 2VHXA 1JEYA 4B79A 4YY3B 2ZJ6A 4J8PA 3WL3A 4OQXA 4X5OA 1KEEB 2QVZX 5GJVC 4F3TA 1P5FA 3SX4A 3P2KA 3EYAA 2PRJA 2V4ZA 5HFAA 4ZEXA 3E03A 2W2KA 1TCVA 3BZWA 3BG5A 1B2RA 1U5AA 2GHIA 3SP1A 2CJPA 3NX4A 3SE0A 3ROZA 4LY6A 5FNVB 3BM5A 3QIVA 4L8LA 2HO4A 2J3QA 1MFPA 3E22A 3ZVMA 3ZS8A 2QTVA 5D7BA 2QG4A 2P62A 3RUDA 5FOSA 4AO7A 1SCBA 2F4VB 2DUMA 2O3TA 4TZTA 4HDMA 3LUHA 4WA8A 4R2KA 2AMJA 4D43A 4IKPA 4MAFA 1J8MF 2FFBA 5KNBD 1K2WA 5D5HA 2XDWA 2GQ0A 2W5UA 2RGYA 3KU1A 1SVWA 5IMSA 4RIGA 3NXKA 1K0FA 4KFSA 5TLSA 2LIPA 3HL0A 1I1NA 1ILWA 2VHUA 4N54A 4RVUA 3VSDA 1HPLA 2CMKA 2GD6A 1G5HA 3GT3A 1DEOA 5JE8A 1LKZA 4X61A 4YJ3A 3U7QB 4OHFA 4YI3A 1VG0B 1NVWQ 2ASEA 3BMOB 3QXCA 5K3FA 1I1QB 2FU5C 2AN1A 5ALQA 3ERCA 3OF5A 2YTZA 2XZLA 2ZBUA 3G0OA 1WKBA 3NIDB 5F33A 1FTWA 2PMEA 2GH1A 1XVAA 2GK4A 3ZR4B 1CNMA 2G4VA 1VRCA 2K2WA 3VR0A 5AUNB 1N2JA 4P0TA 4W5WA 2FPIA 1HMPA 3DD5A 3DHEA 2Q1WA 3BMXA 1SIBE 1KARA 3GVXA 1K7FB 4A36A 1YZQA 3B9BA 2ZYWX 3K9FC 1F1JA 3GY0A 4MR8A 4FYYA 1U8AA 2O3JA 4JQSA 3SZUA 1CLEA 2F48A 4HJRA 4MW7A 3GYBA 3VO2A 4ALJA 3GLIA 4NCNA 1OT3A 1V3UA 2JZCA 2C0CA 3NPMA 2HUNA 2UYQA 1OJLA 1P6XA 4IIHA 3D6AA 4MJXA 4G1MB 4HYQA 4EW1A 3OWHA 5AK0A 1GPNA 2IXDA 3DDHA 4N6NA 4BKPA 3IUSA 4JLMA 2A2ZA 1DTEA 3K0CA 4XVCA 1B42A 2IOYA 4I7EA 5GM2A 4GR4A 1Z62A 1PT7A 2OZLA 1TUEA 3CZCA 3OEEA 4V1CI 1T2UA 2FMIA 3HBNA 4TV8A 3UV3A 4MV6A 3VR6D 1B6RA 3S8MA 3BS4A 3VMMA 2AFHA 5KOHB 5IM4F 4KDEA 4HK4A 3EG9B 1PUIA 4UUAA 3KV1A 2VT6A 4DT1A 2ETXA 3WADA 3ROKA 2BDUA 4Q3AA 4PZAA 3VOTA 4D57A 2ZZMA 2JGJA 1BOFA 4J7AA 3W9BA 4BBZA 1GCOA 2QVXX 3IR7A 1LLFA 4PHCA 5ED0A 3PHCA 3TW4A 5L40A 4I8XA 3VZQA 1QV6A 1D7OA 1XOIA 2II6A 1Q0SA 3ESQA 1EWKA 3FTPA 1AXGA 4LXXA 4WNYA 5K4HA 2R8PA 1Y8QA 1WY7A 1ZJJA 2ZXEA 1FJXA 1PZGA 1PEDA 2BMWA 2HQOA 3P9PA 4GKAA 4L9AA 4OIFA 3QLUA 4EPRA 3OFVA 4YV1A 2PUBA 2VZ0A 2HJSA 5AVRA 2R2AA 3N8HA 1PFVA 4MRAA 1DO0A 2Z83A 3B48A 3DZ8A 3VGPA 1WW8A 5TIIA 4M6WB 2X8LA 1P9WA 3T52A 3UK6A 3ZZMA 4NCHA 1OW3B 4M38A 4C6RA 4YMTA 5PNTA 3ORFA 2WKRA 2A92A 4FTWA 3GG2A 4UM7A 1NYRA 4DG9A 2WVGA 1RI3A 1TUBB 5M7EA 5HP4A 1U63A 3EULA 4G01B 3ER6A 4LY9A 4FGLA 4AY4A 1XTRA 3TLGB 1NQOA 1U04A 1SN7A 3QMPA 4ZAFA 1XQ6A 4F86A 3H13A 1X9IA 3KSUA 3DTNA 2WE7A 4D4LA 3PP8A 1T0PA 2ZU0C 1I2ZA 1XZEA 5LBTA 4KX3A 4QYIB 2IZ5A 4PZYA 3WO0A 1RU3A 1R18A 2R4TA 1XQ9A 1URPA 2Z57A 3CNEA 3K0BA 4M76B 3C3CA 4WI1A 3RTBA 3BWBA 4ZYVA 3T3NA 3DE3X 4MVJP 4KNYA 1N0HA 2W2MA 3CX6A 4NJEB 4PGFA 5B3KA 1N4DA 1K6EA 3EEQA 3OPNA 1V8OA 4DUPA 3C4QA 4J1TC 3ZIDA 3G5TA 1YC5A 2MJLA 3BRWA 1UC8A 2R4UA 1YZLA 2EZTA 3MWLA 4IVPA 5BPHA 1C8VB 2AFIA 3WB0A 2GETA 4PBTA 3UWPA 3TG2A 3PIDA 4WK4B 1FDTA 1X86B 3LGXA 1X7ZA 1VG1A 3HCPA 4O3FA 5H4HA 4ZCMA 1DBSA 3LKVA 2B8NA 2XKAA 4C3VA 3ACBA 1OVMA 3R6DA 4Y0VA 2X9VA 3FOWA 1TO2E 2AFIB 2VYNA 1MN6A 2IW1A 3FSJX 5EHQA 5FPSA 2DBVO 4BZWA 4DC9A 1W30A 4WXPA 3AKZA 1H2XA 1KXJA 4NXMB 4DQXA 1DIOB 2O2XA 4LZPA 4K28A 3JYHA 1XXLA 3ZIAD 5HOEA 5EIBD 1GZVA 1O1YA 1VPEA 3DEHA 5EIXA 4TKVB 2OSVA 3GRUA 4OKSA 1JAHA 5AICA 2J59A 2PAFA 4KVFA 1G291 4LYYA 4TYPA 4UUMA 2REXB 2RG1A 3AKYA 4YUWA 4RKFA 1FU4A 1WX1A 2RARA 1SCNE 1YBVA 2JGEA 4EZIA 2G09A 4CM9D 5CBPA 3O82A 5EGSA 3TIFA 1GGMA 2BFPA 4DA0A 1UKEA 4Z7NB 1UFQA 4DSAA 5B1DA 2Y6VA 4KQWA 1VL8A 3IX7A 5CXQA 2HNKA 4AT1A 3HYNA 2JVIA 5CJPA 4R83A 5ITZA 3O3CA 2OYCA 1XMJA 1XDBA 4E11A 4MUFA 5AVSA 2GOYA 2VP5A 2QM8A 3LRTA 2P9YA 2C3OA 4WXEA 4X45A 1LBSA 1TYDE 4Y30A 3TSOA 4WY2A 3FUUA 1UAAA 3L7AA 2QTRA 2VSQA 1E2QA 2FPIB 4LFCB 2C00A 2BFCB 2VDPB 4OYRA 4QGFA 4RK7A 3PUIA 3G02A 2RHBA 1OJ7A 3A3NA 3QU2A 4DZRA 1RQRA 3GLVA 3MIIA 1QO0D 2X8WA 3JD4A 4MKZA 4RTMA 2W6JA 1KH1A 2R6R1 2UZ3A 3CGWA 4WT7A 1KO1A 2V65A 3FY4A 4NE7A 1YTUA 1WPGA 2PXAA 4GXQA 1PNVA 2YY6A 3C7AA 3GN1A 3R41A 2POCA 1R88A 5GIOE 2V6JA 5A5DA 1P9OA 1RAEA 2WWIA 2C7QA 3R0QA 5T3UA 1T4MA 2OGTA 5KI6A 1HNXB 1G9TA 4DA7A 4OQMA 4RTRA 5DXJA 1EXMA 1PE0A 1CETA 4G5HA 2HCRA 4FFLA 4J9UE 3U9TA 1GUBA 3IV6A 3ZJ4A 5BURA 4XVQA 1ZH2A 4CYMA 5D86A 4BC1A 1KDOA 1FEZA 1ESCA 2DPGA 3UFXB 3D7NA 4QBFA 3MT0A 2P9GA 1J0DA 2V0NA 2I76A 2YL2A 5LLDA 1XEWX 3FZEA 3PGMA 3ZWKA 4QQ8A 2NZXA 5FTLA 3URKA 5JS8A 2YJ5A 4IIYA 1EHIA 2F1JA 3BYZA 4LV5B 4L76A 3AUSA 4U2EA 4PLWA 2WZBA 1K75A 1IN8A 2JEOA 2WFZA 1V3VA 3AONB 1WTAA 1XDWA 3VZDA 3TJMA 5HIKA 5JNUA 3EPRA 3ANLA 5IC5A 5G0WA 1XNHA 5CNIA 2OV2A 5J4VA 2KMLA 4L3VA 3UB2A 1AQLA 2K4MA 3PC2A 1NNLA 4ER5A 1Y37A 1UPTA 1AUXA 5COQA 3VTKA 4U0KA 3IHWA 3TLXA 3QF4A 4MA5A 3U1BA 4TLLB 3FPCA 1USUA 1I0LA 1BYIA 5AKKA 2J6CA 5A3SA 1OC4A 1VCIA 3D1JA 2BR4A 4J4BA 4UBOA 4D0NA 2D0PB 3EGXA 5BR1A 1L4NA 1H0SA 1US8A 1A7UA 1CUUA 1NI4B 1Q2UA 1VJ0A 4GOJA 4IWNA 4R1TA 1QX4A 3CUEF 5CG1A 3B12A 4G0WA 2GILA 5JT1A 4YPFA 2G7MC 4MQMA 1OFHA 2DPXA 2B35A 1V1RA 4DA8A 4BYGA 4CHTA 2QGNA 2UZIR 1Z82A 3FKSA 3HEBA 4AB1A 1DO8A 1QZXA 2FZGA 3D43A 2I2XB 2C77A 5I3ZA 2QBYA 1E3QA 3GG9A 1AK2A 4OATA 1ZEJA 2D5LA 3R7DA 2WPDD 4N01A 4HQRA 1JT2A 2V74B 3STVA 3ISJA 4HAXA 5CH3A 1U80A 4RULA 2C0PA 2VT7A 2WF9A 1E79D 5IJXA 4PFSA 2OXIA 3OUTA 1NVDA 2QT1A 2QZSA 1N6KA 3FIJA 1IAQA 2AR0A 2UVQA 3S68A 4JSTA 4ARAA 2WTEA 2XLCA 3NQ41 4B31A 3DOJA 3PL5A 1HDGO 2HQBA 5DI9A 1U1CA 2IH5A 3E1GA 2RGNC 3EBOA 2ZBGA 2VP9A 3ZCSA 3AOEC 3D8HA 3LDHA 4J3NA 3WJAA 3R5HA 5CR9A 5K0TA 5HF9A 5KNCA 1CVIA 5MGBA 3VGJA 4R7TA 4BJ3A 4QUJA 4X0EA 5JRDS 3THSA 2DBZA 1QZTA 4AWAA 4BO5A 5BXQC 2I78A 1R0RE 1IH8A 1T6NA 3AEUB 1QK4A 4J7XA 4H6VA 1SHTX 4XAQA 1Z4JA 4DRZA 3NKFA 1H3EA 3IUMA 4F6RB 2ZRQA 5AI8A 3GLGB 1P1KA 3SXUA 2XE4A 4RABA 1L5GB 1B00A 4KWCA 1BOOA 3ZGZA 5I01A 1Q14A 4RL6A 4YEDA 3CUTA 4X1YA 2IXTA 2ZUDA 1X77A 1EJ6A 4JQCA 4M2LA 4ZVKA 5LFAA 1LQTA 1UBRS 2AF4C 1H85A 1MW9X 3GBVA 3MYYA 3RUCA 4RFVA 5TRTA 4FT4A 4EUKA 3D3KA 3GQBA 2VBCA 2R9VA 2PU7A 4NCAA 4XFJA 1SEPA 3G2IA 4QXMA 1ISIA 2WF8A 1J7JA 2MR5A 2HHHB 3HBFA 3H83A 4JZKA 3WNBA 2WWRA 4FYJA 1NXTA 2NVBA 3BWEA 4M3NA 4UCXA 1WA5A 4I4LA 5JVDA 4G0OA 2JLZA 1J0CA 5JNLA 4LC0A 1E4EB 1ZOPA 3CTPA 3QQ5A 3KB1A 3FUWA 2DUJA 3BXEA 1QDUA 1NXWA 4CQJA 1G20A 3MOSA 1TTHA 1W34A 3EQ6A 3EXEA 4A6DA 2MYTA 5THXA 1MR3F 4WBXC 1SPXA 3TWOA 1XXHB 5JJBA 1D1SA 3SSNA 1QC5B 4LCEA 3CVOA 1TM2A 3ZLBA 3THXB 2CVHA 1TT7A 1YS2X 5SY9A 1D0IA 4UTOA 1EJ2A 3TI9A 5EKDA 2ORWA 4J1NA 4WFQA 1M66A 1JPVA 2I6SA 2P35A 3UBMA 5DBGA 5C4MA 1MZPA 2IYPA 7MHTA 5DGCA 1RPZA 3ZGXA 2OD2A 5IVDA 3SC6A 3ET4A 4OQPA 1PHPA 4WWHA 4NSNA 4ALMA 3ZDCA 3P5SA 5A5GA 2P79A 4JP3A 1NT4A 3BX1A 4R3NA 4MQEB 4RDHA 3BJRA 4Y2QA 5HKKA 1UQTA 3WFZA 4LI3X 1G9SA 4C3OB 3JASA 4NZZA 3JWJA 4MGYR 1RCUA 1NPTO 2R97A 2FX5A 4HATA 3SHFA 4H27A 4EB0A 4V1CB 4ZCIA 1ILEA 1PK7A 4YRMA 1N3IA 2XA2A 2WYHA 1X13A 1BIFA 4C1NA 1M9NA 3FA2A 2CLIB 2D2VA 1ZIOA 1A4IA 1I4WA 1PN3A 1CLUA 1BCRA 3ODGA 4HNAA 1CUWA 3K9LA 4YRKA 2JA1A 2ZI3A 3CF0A 3LXRA 3Q3VA 1T9AA 2D1YA 1L6IA 1WS6A 1DXQA 4P86A 1Y1SA 2GUGA 4I8IA 2Q0HA 1CFZA 3TBFA 1HURA 3U26A 4BB6A 2FLKA 1FS5A 1E1YA 5ECGC 3RUIA 4OLAA 1QV9A 2HJ9A 2O4CA 2Q50A 2WJPA 1TEHA 3LWNA 4X3CA 2BGTA 5U9CA 3F8TA 4WKOA 5JJKA 4I08A 4DJDC 2XTZA 2LZ0A 4Q1BA 4CFSA 1T26A 1AK1A 1D0SA 2WHYA 4PWYA 3L84A 3OFJA 3Q7QA 3GAMA 5E6UB 3RG8A 3WJ7A 3CVJA 3RAPR 4CTMA 3IKLA 4RWEA 5DISB 4MUHA 3F49S 1TOAA 1TU3A 2W2QA 3GO4A 2GARA 4QSHA 1G59A 4ZMRA 3QJ5A 4FGJA 3GEPA 3I83A 1S02A 1PJAA 1USGA 2AG8A 2VH5R 3DDUA 3LXUX 1Q1ZA 3TXXA 3IP1A 4DYHA 2FWAA 3GEEA 3NAGA 3EQ2A 3NEPX 5B3JA 4EG5A 3ZLTA 4JXZA 1KY3A 2AYYA 1SB8A 5EXSA 2JHAA 3PQ2A 1QRTA 5ALVA 4BASA 1EP2B 2AG6A 1RWMA 2ILVA 2NZ8A 3QKRA 5KKNB 4TSKA 2EZ9A 1H65A 2WJAA 3LZCA 2BFNA 2QVYX 4G5FA 4EJSC 4JK3A 2FH5B 3DNMA 1XJWA 3L0OA 4F3NA 3KQKA 3UK7A 3OIDA 3R9XA 3MRTA 4GC5A 4NQZA 2A5YB 2Q7OE 5JXWA 5M2QA 2VJAA 3JWEA 5C0OE 4I14A 4RL4A 3WGZA 1S2MA 3EZ2A 1PW7A 4F96A 1W52X 3ILYA 3AHHA 3Q15C 4PC2A 4GDMA 4FI3C 4C0BA 4YQFA 4CMJA 4D6XA 2RDMA 5AW4A 1N2GA 2AG1A 3C3KA 4IOMA 3RJTA 3UV6A 4ARIA 2R7KA 4ARUA 6ADHA 3BH7A 3AJRA 1Y3AA 1YRHA 3GFVA 4XJTA 1YZKA 1P1JA 2BZ1A 2DFDA 2UZAA 2YZ7A 3L8ZA 2PGIA 3UYLA 1MJGA 1M1YE 3TTWA 4G5GA 4KEAA 4BRUA 4W5OA 1FX0A 2NO7A 1E96A 1YR8A 4ND5A 4YASA 4ABTA 2PUVA 4MDEA 9ATCA 4LE1A 2A9QA 1XMXA 1BA2A 1HE1C 1YCDA 1Z13A 3MWEB 1QIMA 1FBTA 1ICIA 1OC2A 2YIMA 4J0EA 4JHLA 1SXJC 1T1GA 4HDAA 3STHA 2PUHA 1M2EA 2H1VA 2YXBA 3EVBA 2CF5A 1ID8A 2R87A 3F97A 4EFKA 5JMTA 4GQAA 1EVKA 3QVXA 3EBPA 2ZSKA 4EL5A 5AQ1A 1QYDA 2EEPA 3F78A 5DCLA 4ZAYA 2RKOA 3TCKA 3F73A 4TL9A 5JLAA 5DX0A 3W2TA 1WB9A 2WM8A 2JGDB 1P18A 3WLMA 3J80A 1LDYA 2AZ4A 3I0NA 4UPVA 3K5WA 3FOEC 4E32A 2VUUA 1XNGA 3HXOA 4H7HA 3B3FA 3CRRA 2XADA 2BKVA 1JHVA 2DHCA 2H51A 2O8DA 3VJKA 2XOKD 3DAPA 5CU7A 1BU8A 1HT2E 1JYFA 2C9OA 4IR7A 1ICEA 3DAOA 4N40A 4RKQA 5IBRA 1AMUA 4NYIR 1LC3A 4M9ZA 4WOPA 4HXGA 2D0IA 3DE4X 4BLSA 2KB0A 4HUTA 3HPRA 3ZN2A 2I7DA 2Z3ZA 3TRIA 4HS4A 5BQ3A 3FSRA 1Z2DA 1MGPA 3T8YA 4EYQA 1IZYA 2ZB7A 3S2EA 1KEKA 4RAOA 2VRCA 3U3MA 5CLIA 4UE3S 5DI3B 4UHEA 4N76A 3H9JA 1KORA 1ZMBA 1FXWF 1YRBA 3A36A 3RQSA 3TPFA 1KIMA 3G0GA 1J8DA 1WMAA 4CTOA 4GPAA 3OX4A 2PNFA 4MXDA 1K68A 4WXYB 4AMGA 1UBKS 1W5SA 1K97A 5DGXA 3PGA1 3OKFA 3UKOA 1ZGJA 2W6MA 4DQUA 1NVMB 3RTCA 5BV1A 5EPOA 3WLPA 3E3MA 3LCMA 1ZH4A 3HWRA 5A2QA 2PKYX 3DVQX 3DT8A 3BMQA 4W7IA 1BTOA 2J33A 3IQEA 1BSVA 4HV4A 4LKRA 4MDHA 3GFRA 1QBGA 1XDSA 2ZJYA 1L8QA 3FVWA 5AUOB 3GGDA 3MLAA 1D4OA 3GNTA 4IKEA 1H69A 4ZDWA 3GLIE 2MSKA 1GDTA 1X7WA 3DOFA 4LF7B 1UBUS 3WHKA 4MKRA 4WDQA 1VBNA 3BFVA 3C6QA 1HZZA 3B5JA 3FZQA 2J9YB 4KAAA 2DFPA 4RVOA 2GEFA 4ND1A 5E7IA 1ZBQA 4QELA 2BI7A 2VAPA 3O4VA 4NH4A 5JAIA 3HC7A 3H4IA 4JVMA 4CIVA 4QQFA 4HZIA 4E2FA 1TKAA 3G7NA 4GC9A 4CKZA 1YVEI 2GO1A 2B5WA 3BC1A 1OBFO 3FMVA 5FBKA 4CQNA 3MUNA 1X74A 3IJPA 3AG6A 2TMKA 1U5BA 3HDYA 4FGUA 4Z8YA 1WDMA 1CHNA 3FWPA 2V3WA 3C98A 3NVDA 4MUAA 1NNI1 2HLDD 4MKXA 2ZR7A 2WWGA 3F9RA 4R9RA 1TM7E 3D6JA 3SM3A 4BO1A 4XYBA 4E2ZA 4ML3A 1ZMTA 1LPNA 4J6EA 1E2EA 2RK3A 1BQEA 1G2QA 1TKRA 4POAA 4X6XA 2QYHA 3BOSA 2FX3A 3W5CA 1OAKA 1YJQA 4FDLA 1DO2A 3NDJA 5CPFA 4UVIA 1CUCA 3PXBA 4ENRA 4LDQA 5ALKA 4Z6KA 4M36A 4XOUA 3HE3A 2FWIA 3VPGA 1NGSA 3KQQA 3RABA 3IPCA 4D80A 3C16C 1QKKA 4LZJA 1E8NA 1V7PC 3VH2A 4BE9A 4QDJA 5LMNB 3EPHA 3K5HA 4HGOA 2O6LA 1U8FO 2L2QA 2WF7A 5ELMA 2WWWA 1DUSA 2G4CA 1K3UB 4HXYA 5H1YA 3ILSA 1K8YB 4HMOA 2X0DA 4NE9A 4G1EB 2J3DA 4GQBA 3P4XA 1I2AA 2PSJA 3BB3A 3VSBA 4RLHA 2E85A 4K9SA 4E21A 3V6LA 3F3YA 3GD5A 3ASUA 1I2MA 2HRDA 2O57A 1GRRA 2FCRA 2B2CA 1PWEA 1MG0A 2OMEA 4D02A 4CG0A 1DQNA 3DL4A 4EF4A 1ZI9A 1AH2A 1KMIY 3TGWA 1NQXA 1NVTA 1VPVA 2I4TA 5JD3A 3LQ1A 3P2YA 3PKJA 1SY7A 5BWOA 1KSFX 4P4GA 4Y98A 2OXFA 4FMDB 1ZD2P 2WLTA 3ZHYA 2W42A 1SMKA 2HQRA 2X15A 2NSHA 3MERA 3ECSA 4PYMA 4DJTA 1X1AA 3W3ZB 3AVVA 1SOUA 2C59A 2C58A 1VL5A 3GW8A 4C20A 5ICSA 5KTYA 4GKBA 5LSAA 1HT0A 1TYCA 3JQAB 4XGQA 1LUAA 4P80A 3QH4A 3C1AA 4PLHA 4CQLA 3SYMA 4IIJA 3DTTA 2O2HA 2PX5A 2Q9AA 3LFTA 3SLRA 5KSWB 1WDTA 2I1WA 2Q1SA 3HBJA 2EV9A 3KDSE 2HPZA 1PJCA 5IEJA 4BXOB 4QRDA 1ZMOA 2ZIWB 4C4OA 1PZMA 3L0DA 5BSEA 4G9EA 3NDRA 3WJ1A 4UPDA 1E5QA 4X20A 3LRXA 5D85A 1WVMA 4UU8A 4LG1A 1YHYA 2QJTA 4KQEA 3U4IA 2O2ZA 4OAQA 2VJCA 2G8LA 4FFVA 5A4IS 4RD6A 4B2IA 4K2AA 2HI0A 4X20B 2AW3A 2ZWPA 2J4CA 4JLDA 1FXSA 4FS3A 5CCDA 3RLFA 4UTXA 4PINA 2X4IA 1NDQA 1SU7A 3GL9A 3OTHA 1FS4A 2V6GA 3LOUA 4ZHQA 1Q44A 3HYCA 2B5OA 3H87A 1YE3A 2HMTA 1PVDA 2VA9A 1V5EA 4CQLB 3A3YA 2VYVD 1U7ZA 1YBFA 2OCDA 2MINB 2Z8ZA 4WCFA 2EHJA 3FJ1A 1L5LA 2YCBA 3O26A 3TD9A 1Q0LA 3R0JA 3ZHCA 1Y6ZA 2DX7A 1TU4A 4QPDA 1PR6A 2ATVA 721PA 2B3TA 1Z7EA 2B7CA 1VE5A 1XI2A 3EVDA 2X6RA 1C1DB 4MYHA 4KN8A 4PSDA 4QL3A 3T7AA 3QFTA 5TB5A 4RPLA 1N5MA 1TK2A 1TCUA 3A4YA 4BVJA 1BWSA 1GTZA 3KKKA 5SY4A 1G3IA 1Y0BA 1GKYA 2L0XA 3B3AA 4FR5A 4YONB 1S2NA 4E7PA 3EIHA 4FDAA 1V4BA 1JDBC 2J0UB 4GNRA 4WNAA 5L6LB 1CC1S 1U02A 4YRGA 3DEJA 2Q4BA 3A1UA 4O1HA 3WLHA 1YRWA 4OHYA 3BRWD 4WZAA 1KEPA 3T5DA 4FKMA 3H8JA 1VA4A 4LY0A 1OWNA 3RVPA 1ZR4A 3L06A 3M4NA 4XE5A 5ALFA 1Z25A 3RT1A 2QRKA 5KNCD 4ZI3A 2N3ZA 3KZMA 1HE3A 5FUXA 2G9ZA 5A6VA 5AW6A 2H63A 4DM4A 2Y8EA 3QJYA 3PDHA 5C3MA 1V6CA 1YUBA 3DFUA 4L4YA 5J1TB 1CRZA 3PX2A 4AUKA 4B8ZA 1UXKA 3RKRA 3L4JA 4ALNA 2YV3A 1RVV1 3M6AA 2E4YA 2QTLA 2PT5A 5DBFA 3VR1A 3IPAA 3RBAA 2XVYA 4XD2A 1VI6A 2C8VA 4BLUA 5BNIA 1I7SB 5GIPE 3KNZA 2XB6A 4I36A 4JC8A 4B3BA 3Q40A 5KQRA 4W7HA 4P34A 3EASA 4ZK6A 3AILA 3RS3A 5JXGA 2BMDA 3Q9NA 4J0DA 4O63O 3ZWVA 3NBAA 2CLKB 4BX9A 2CBXA 1SU6A 4NABA 1GPMA 3PBKA 4J91A 4ZT7A 2JAWA 2JCXA 1ACMA 3FNEA 4J03A 3PG5A 1MW8X 2AQIA 2ZJOA 3TLCA 1C7JA 3HCFA 5J5AA 3OJEA 4GVXA 2OSBA 3GJZA 3CV3A 4FR0A 4CM8A 1MV5A 1PL7A 2JJ1A 3HZHA 2Q9CA 4WZAB 1GPWB 3FOZA 3ONWA 4YCDA 1C9NA 5GGXA 3TAUA 2Q45A 3G5LA 3NRCA 1QORA 1N2CE 2R60A 2HRQA 2EJVA 2ZYVX 2YRWA 1BWPA 1U7HA 1PO7A 2CHVA 4M22A 2JFVA 3G8DA 1JAXA 3HFRA 3AVUA 4TS9A 2ADMA 3NONA 4MB6A 3T1YB 3NI2A 1EVQA 3S2FA 4C43A 5I48A 1BMDA 1Q0HA 4Z3KA 2IXGA 4HC4A 3NHPA 4EZBA 1PRYA 4NCXA 3DVSX 2IHUA 2NTNA 1P0FA 3CZ9A 5KO2A 2CLDX 2EG9A 4RK0A 3DLPX 2OFWA 1YT5A 2QR5A 1H0RA 1PEAA 3MBKA 4E5KA 3CLRC 5IAAA 2OORA 3QVKA 1AZTA 4PLYA 3JQ6A 2CZGA 4L2IA 5DNYB 1Y1RA 1W0KD 1QRRA 1QO9A 5H3LA 4NYIQ 4WCFB 3SYNA 5EZYB 5CB6A 1W4CA 4TLBA 3IODA 4OQYA 2IX3A 1N2EA 4F9FA 3KOWA 1U0NA 1UWLA 3PNLA 3AH8A 4AFNA 1EXWA 4YMSA 5AK5A 1L5HB 3KKPA 3B52X 1CUVA 4V0NA 1BG6A 1TIPA 1AF4A 3I30X 3L0BA 1E2IA 4IMRA 4NFLA 2C78A 3F3SA 1PJBA 3TQFA 1GO2A 1TNDA 1U5BB 3EFOA 3LVFO 1E66A 3A6PC 1NMSA 1RWVA 1E3EA 3RKSA 4QU5A 5DXAA 2VTVA 4KOEC 1XKLA 3QU7A 2GJSA 5EKUA 1QGDA 2PWZA 3HDJA 1Q7GA 3KR2A 3NNNA 2QG6A 1W5AA 5KWEA 4IJVA 2I54A 5GVRA 2BJWA 1CF9A 2XDQB 1MT3A 1TQ8A 1HKHA 2OO5C 2R8EA 2JA2A 1HETA 2YZ2A 3L7JA 1K7YA 2ZBFA 1YB4A 3MTGA 2VXBA 5GY7A 4YREA 5IXJA 3QENA 2VH1A 4UXJA 1G66A 5DTRA 5ABPA 1WVGA 3D4OA 3DFFA 1T0BA 3USES 1PX2A 4YO7A 1R6UA 3WDMA 1BXGA 1W35A 2QJOA 1J2TA 1NNSA 3D6FA 3H86A 3ZGOA 1PSDA 3PE3A 3G9ZA 2OZVA 3WGUA 1NG9A 3VH4A 2AI3A 3EXHC 3FJOA 5AFSA 1EP9A 4HT3B 2J3JA 3CY6A 3C3EA 1JR3D 2YRFA 3DZGA 4RZXA 1T43A 2GSWA 1DQPA 3IO3A 1IHOA 4X44A 1TQDA 3PLRA 1V8FA 4F1WA 2NSYA 1YAJA 3VKWA 1E1CA 4LYGA 4W82A 1ZEMA 5CDHA 1PDOA 5KNDD 4DIUA 1DIBA 2DY1A 1L8LA 2I80A 2JNWA 3KYCB 1XSEA 2XT0A 3N3AC 4QT4A 2EL9A 3TG8A 1A9QA 3AF2A 3VYVA 4DCCA 1RADA 1T3HA 3BUSA 5LM3A 3DPIA 5CBPB 1KNQA 5ADUS 3KL2A 2W6CX 1G19A 3OX1A 1EFVB 4KJZA 2R3SA 4C1BA 3TZCA 3COJA 4NV1A 1JR3E 4Y1GA 1Y6JA 1EGAA 4JB2A 3FVTA 4P2BA 3OZSA 1STOA 4LBVA 4YH1A 5IARA 5KYTA 1ZJWA 1KZ7B 2I03A 1F2TB 3RVOA 3DYVA 3NALA 3PD0A 4P7KA 3K2IA 1E0SA 3UFXA 2OYRA 2B0CA 4DLRA 4MGHA 4LMBA 2G5TA 3TKLA 4UHCA 3ZHZA 1IPFA 3G7UA 2GBPA 3GT4A 1F8YA 4TOIA 4LRSB 4QDUA 1FU8A 4PYIA 2BKXA 2DUUA 3IULA 4E03A 5H5JA 3C3YA 4DCPA 1U1EA 3AB3A 1BMTA 3HUTA 4HNGA 4BJ6A 4IF6A 3RU3A 2NZJA 2R6HA 4HFJA 1DG1G 1K6MA 1JQBA 1ZU5A 2OYSA 3EH2A 3P96A 4NYJR 3V1TC 5FBZA 4LE0A 3FM9A 5I8ZA 4LF6B 3ICPA 3EFEA 4FGZA 1E7QA 2ZIVB 1U2ZA 3R7SA 2IUFA 3ZYZA 4BQOA 4LXHA 5IHXA 1QQBA 2Q2VA 1RYYA 1OX4A 1SB9A 3ZQ6A 1HDOA 3GH1A 2BL4A 1NBMD 3NEJA 2VPPA 3OZAA 4LA4A 4ZO6A 3UHAA 3X1YA 5HUJA 5JBQA 4ZI7F 2ZSHA 2G82A 3GGJA 3KOOA 3L0ZA 1ML4A 3FCCA 1RM4A 2X4GA 1FX0B 1GNRA 3NH9A 4LS3A 4PLFA 5DWDA 1Y8RB 3FPFA 3KYDA 2R2GA 3OI7A 2FKNA 3E5NA 2VDUE 4PLGA 4XCVA 3ASVA 2M1ZA 4XIJA 1FXWA 4Y2XA 5IDQA 3W6NA 4WIAA 5ALZA 4HNVA 9LDTA 3JQGB 5FQOA 4PVCA 4REOA 4IVNA 4KNWA 2VJKA 3EMVA 3VKVA 4R51A 3LLSA 4ZO8A 3PUKA 3LSTA 2MDTA 3WTCA 5F2OA 1U8TA 4TXMA 3ND5A 2CY0A 3U4HA 3R3SA 2PX6A 4R2LA 4ZVQA 5FXMA 2XMPA 2YHSA 1QYCA 5KQLA 3UUWA 1JQDA 1KYTA 1UBMS 3CF2A 5DIZA 3VU3A 3GNQA 1SWVA 5C7YA 4CIYA 1R15A 2AC2A 1SBNE 2P77A 3GLFB 3NOQA 1Y48E 2IF2A 4MP8A 5F7XA 2DWUA 1EVIA 5E1OA 3A70A 2C7BA 5AM3A 4UHHA 3IBYA 5K5EA 3R7NA 3EMDA 3K05A 4UMVA 5FO0A 3U7IA 3L6EA 1DHRA 1Q3HA 4QD3A 2DFVA 2NXCA 3UHPA 4F92B 5LKAA 1E1QD 1ZK1A 4YJHB 1R00A 3ADBA 4XSHA 1C0PA 2KWIA 5HZGA 2ZK7A 3RTGA 2AG0A 3P0HA 1I6LA 1B7GO 2JDIA 3TSWA 2D06A 4I1OA 3TQHA 4KPGA 1X9HA 3ZBQA 4I1RA 3R3JA 1A8SA 2WA2A 3ZE1B 2DF8A 3HKBB 3LYUA 2PRKA 3NT5A 1YDMA 1HH4A 1FP7A 4HN9A 1LLDA 5TDHA 2X9GA 3PFWO 2YBDA 3UEOA 3R76A 1OBCA 4K6KA 2H65A 1G20B 2X19A 4IWYA 5JY1A 1SXJA 2QB5A 3UCFA 4FHCA 3IBFA 3ZW8A 5J4KA 3QX3A 4ARZA 5IKXA 5DYIA 3IT2A 1AE1A 4U7PB 1DAFA 2BEKA 2NO6A 2VAVA 4MVJE 5JO9A 2ZOSA 4J07A 2RGUA 3BORA 2B25A 3HH8A 4WRRA 1WMSA 2IHBA 2YV2A 1B1AA 2NZVG 2OD7A 3ENNA 3EQZA 1J23A 1WNTA 1JFSA 3JVVA 3NCHA 4WFJA 2GRJA 5DLPA 4DAOA 1SVIA 3GMSA 1HY3A 4MMZB 3ZDXB 3L0CA 3NVAA 4JI7B 4ZAXA 4O4IB 1MUUA 2DLCX 5DGIA 5HSGA 2CWDA 4E09A 5K0EA 3DEYX 3I6BA 3BIWA 4Q18A 3DR3A 2B92A 5M34A 3H1FA 1BE6A 3HV0A 3TX6A