3A1VA

Crystal structue of the cytosolic domain of t. maritima feob iron iransporter in apo form
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
254
structure length
252
Chain Sequence
HMVKVALAGCPNVGKTSLFNALTGTKQYVANWPGVTVEKKEGVFTYKGYTINLIDLPGTYSLGYSSIDEKIARDYLLKGDADLVILVADSVNPEQSLYLLLEILEMEKKVILAMTAIDEAKKTGMKIDRYELQKHLGIPVVFTSSVTGEGLEELKEKIVEYAQKNTHRMILDYGEKVESEIKKVENFLRDKKLRINPRYFALKYLSGDPEFYSEGVKLGLPELSEEERIGYRLLIAKRKREYVENVVKEAFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Iron(II) transport protein B
publication title Structural basis of novel interactions between the small-GTPase and GDI-like domains in prokaryotic FeoB iron transporter
pubmed doi rcsb
source organism Thermotoga maritima
total genus 87
structure length 252
sequence length 254
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02421 FeoB_N Ferrous iron transport protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3a1vA01
4MKGA 5AR1A 2ZE5A 3A1SA 4JLOA 2AL7A 2BVNA 2QE7D 3OEHD 2OCYC 1AZTA 2V9PA 1W1WA 3BB4A 3TSWA 4PQRA 4F4CA 2RKOA 1WXQA 2OO7A 1JAIA 1SVKA 3I8SA 2BJVA 3ZS8A 1US8A 5G3ZA 2W6JD 3PQCA 1H8HD 1Z28A 1JNYA 1RRPA 2FGKA 4NONA 4TSFD 2YWHA 2Z5FA 1QVRA 3E2IA 1G8FA 2HCBA 4EJSB 4AKGA 1LS6A 3BH6A 4NE2A 1W47A 3NWJA 2WJJA 4Q4HA 2V1UA 1E96A 1X1RA 2I4IA 4UNPA 4BFTA 5C4GB 2GJ8A 1N25A 1D8TA 1SVIA 3I72A 1CJTC 4IXNA 2HDNB 3RS3A 1VMAA 1TAGA 3TAUA 2MSCB 4JVMA 3KJEA 2ZS7A 1SQ5A 1XTJA 1G8HA 4P4SA 4YDSA 2ZI7A 2JJ8A 2PT5A 1E2GA 1MRSA 2D4HA 4F92B 3OHMA 3LVQE 2BMDA 1OFHA 4ZIRB 4PPGA 1P75A 2ZITA 2R6AA 3MWJA 4DZZA 1LY1A 2K5UA 3PR1A 4POAA 3UMSA 1NVVQ 1J2JA 2CNWA 1Z0JA 4U7DA 1AQYA 4RFSA 3JZMA 4DEXA 2BMEA 4AIIA 2WPDD 4HUTA 2HT6A 2ZI4A 1BO6A 2JASA 1KDTA 4C7OB 4KXFB 2GCPA 5EE3A 2ONJA 1DO0A 2FN4A 4PO9A 3QSYA 2DPXA 1E79A 1XTSA 1Z6YA 1KO8A 3IUYA 1OFTA 2LWIA 4PX9A 3BERA 1UDXA 3MWYW 1FNNA 4NCJA 5TDHA 1LS1A 4MRSA 2BCGY 4BUJA 3VR5A 4HB3A 521PA 4OHZA 3AF2A 5IK2D 2J46A 1Q12A 4EJSA 1UEJA 4RSGA 1U8YA 3B1YA 2ODBA 3MUFA 1M7BA 2J87A 3IDQA 2DYKA 1SULA 2B8TA 2LKDA 5EE5B 5DI3A 1HY3A 1FMJA 3PEVA 1WRBA 1YZNA 3QENA 2CLSA 2RGGA 5JI2E 3GJ3A 4GT1A 3MWKA 3RRMA 4DCTA 2NOAA 4C0SA 1OXVA 2O0HA 5FUWA 5TV2A 2IYZA 3VMFA 4YMTA 5FTJA 3L2OB 2ZYUX 3WMFA 1UKZA 4H1UA 2FFAA 4ZIRA 3TSOA 4ARZB 4G5RA 4D0NA 1E9CA 2AK2A 3CNOA 2RB4A 1E2JA 3WMGA 1IONA 4QM7A 2XZLA 3U6BA 1KSFX 1VIAA 2Z6VA 1DE0A 1G4UR 3CH4B 4KAXA 4OHYA 1OSNA 1TL7C 4PZYA 4WW0A 5BQ5A 1LB1B 2ZUBA 1NVXQ 1YHNA 2O52A 4KODA 4IVQA 3CPEA 4C7OA 3DMNA 4CZ2A 2PL3A 3B82A 2O8EB 5KSOA 2CHQA 1KDRA 4HATA 2MSEB 1CR2A 4P33A 3ZZTA 3U7GA 3LY5A 2RCNA 1GZSA 3BXZA 1RYHA 3OEED 3ZLJA 5H68A 2IXGA 1NRJB 2P0EA 2AFHE 1JXMA 1NG1A 2REOA 1RRCA 4ESHA 4C2TA 4DJTA 1G18A 4GMXA 3UWOA 1VPLA 1CF4A 2VLIA 3ICEA 4PHFA 2VP2A 5B30A 3OESA 3HYRA 1ZBDA 2R9VA 3AUYA 1KY2A 5LB2A 4D0GA 2C2HA 4A0HA 5KNDA 2ZE6A 3T1QA 1W0KA 2ZRJA 2QP4A 3DOEA 3GFOA 2GHIA 3F5FA 2F43A 2J45A 4IKEA 2GA8A 3GMTA 2WIAA 1D5CA 1DBSA 3WRXC 4U00A 1YZLA 4D4MA 2W0MA 2WMOB 3GLGA 2ZSFA 2D2EA 4ARZA 3WYAA 1KKMA 4OI2A 3C7KA 1OKKD 1UBEA 4TLCA 3NVAA 4NCIA 3WNDA 5KO2A 1XTQA 2GXUA 1OPXA 3CF6R 3EZ7A 2PH1A 2B21A 4QGAA 1Z47A 5TVKA 5K8UA 3PG5A 2ZSBA 1KMQA 4FMCF 3EXAA 4Q9KA 2AD1A 2RGAA 4JLKA 5JJLA 2QUZA 4Q1CA 1S4QA 4TMZA 3LFUA 2XNSA 4GNKA 1GNQA 4GOKA 4EAQA 1E2MA 4EQ6A 1Z0DA 4DRZA 4MYCA 1R5BA 2Z83A 5DNYB 4BFVA 3ZD7A 3Q85A 3NEYA 1BMFA 3W5JA 2Q9CA 1M8PA 2CL0X 2JLZA 4TMTA 5DHAA 1T3HA 2ZUDA 3P4YA 1JECA 4GZMA 3TR0A 4M1TA 2FV8A 4QXAA 4TTRA 2J0SA 2CCKA 2KI5A 1VHLA 1GFIA 1TF5A 2WSMA 4GRAA 4GZLA 2OHFA 3VU9B 1S9DA 1G3IA 1P60A 3TVDA 1XCGB 1MT0A 4JVSB 4BQSA 4N0EA 3EPLA 1L4YA 4FMDB 3VX4A 3FKSA 4LV5B 1IXZA 3OIVA 3AGPA 1DAEA 2IS2A 3EWAA 2WHXA 4JMPA 1ZIOA 4V0ME 1E9AA 4OQMA 4V0KA 2JDID 5G53C 3SBEA 4XSHA 3AVTA 1S3SA 5FFMA 1OFUX 2QPAA 1OV4A 3SJZA 2V8OA 1UEIA 1QRAA 2WKPA 1M34E 1FP7A 4US1R 1DEKA 1VTKA 1KYIA 1G20E 1N6LA 3VKWA 1QHSA 4FIDA 1XP8A 2WSSA 2ZRBA 4G0NA 2OBNA 5JRZA 1U8ZA 1HV8A 2QT0A 2BWJA 1B23P 3T34A 1I2MA 1K5DA 2VYFA 3QIAA 3B85A 1U98A 2XNDA 4G5QA 4GOXA 4HYYA 4PC1A 4TTPA 2FDCA 4ZI3A 3PEYA 4XOIA 1WF3A 2EQBA 3JVVA 4N0DA 4TYPA 4DDWA 3B1ZA 3UG7A 4LZZA 3BH7A 4QRHA 4D6PA 2O8FB 2EYUA 2NZJA 2IYSA 3WBKA 1T4GA 2ZRDA 1HQYE 2NMVA 4M53A 4IFEA 3ASYA 2QAGC 4JBXA 1N6OA 2DHRA 3VU9A 4NYIR 3BE4A 4WVFA 3PUWA 2YYZA 1UKYA 4IDOA 3VAAA 2VHTA 3FFAA 3K0CC 2G0NA 2W83A 1KAGA 3PCRB 4KSBA 4GI7A 2AWOA 5HE8A 3TSZA 2WWGA 4PC2A 3T1TA 3ADBA 3WY9A 4A0GA 1ZM3A 3RDPA 4MGYR 3KQKA 5L3RA 3W6PA 1WE2A 2GXSA 2OCBA 1WBBA 3LXRA 5HTKA 4K8OA 4DXAA 1CBUA 3H2YA 4OHWA 3HU1A 3QXCA 4EFLA 4HUQB 3EPHA 1ZU5A 2PT7A 3U3RA 4TMWA 1R5NA 4EPYA 4KVAA 3FYHA 1CJUC 1GRNA 4KYUA 2QP9X 3D7MA 4LBYA 4R71A 3A4LA 3BC1A 2WTUA 4LWZA 3LH5A 1JPJA 4LBZA 2CE2X 4RZXA 2IUSA 2LCFA 3K0FB 3REFA 3W6OA 4C3ZA 5JFGA 2G0TA 4HDCA 2C77A 5C4MA 4B47A 2P67A 3RHFA 3SQWA 4IOJA 1FOEB 1N5LA 2DFTA 3UIEA 5C18A 3BWDD 4ZCMA 1KZGB 1NLFA 3LXXA 4RD1A 5JECA 2RGNC 2O8FA 1G19A 3UXMA 3AVWA 3LO5A 4A0RA 1XNJA 2FH5B 1CTQA 3OZXA 1II9A 2NO7A 4KLZA 3T1OA 3EWSA 3DMDA 4I1UA 4IOLA 1IM2A 2B8WA 4LI0A 3SDZA 3HDTA 3AP2A 1TEVA 2WJYA 4QG7A 4XIGS 1HE8B 2OG2A 3IKJA 2GJKA 2B7CA 2V6IA 3C8UA 3R9XA 3AVYA 1Z83A 2JCSA 1IJFA 4XWOA 1XPOA 2ORIA 4FXPA 2NPIA 5KUTA 1CR4A 2ZIAA 2FNAA 1X8KA 2O0JA 4JSYA 4LX0A 3DKPA 5LD2B 2BBOA 1EFRA 2GZHA 3L82B 3GLFB 2OLKA 4ON9A 5K8TA 2QL6A 1F5NA 4LJ9A 5SZHB 4QC2A 3H4MA 3LW7A 4HSEA 1FFHA 1OE0A 3DM9B 1H8ED 3VR4A 4BEBA 2EFGA 4M9XA 4ZCIA 2PX3A 1Z2AA 3Q5EA 1D6JA 3TW4A 2HLDD 1P61B 5GJCA 1ZNXA 2IYQA 1QZXA 1PLKA 2ZQ5A 1R2QA 5JEEA 2OE2A 2F1RA 5AJWA 4IOKA 1YR9A 4W5WA 1C1YA 3C15C 5HCIA 3CRW1 4Q9JA 5DHFA 3A1TA 1E9FA 3DVLA 3EC1A 4KFSA 4HAUA 4JLMA 2AXPA 3W8NA 1ZIPA 3H86A 2J0VA 2Q9BA 1J7KA 4Q9LA 2GAOA 4O2RA 1S96A 3SYKA 1KMHB 2B6HA 5KNCA 3AVXA 4LGMA 4AD8A 5F2EA 1XMJA 1EESA 5ANRB 2H18A 1E9BA 3ASZA 6Q21A 3JVUA 1EWRA 1KI8A 2IF2A 1Z63A 3U61B 4CEJB 1IHUA 5KDDA 1DAIA 1II0A 1MRNA 3VHXA 4Q47A 1RRGA 1EGAA 3EARA 2JJ1D 4WIAA 3GLFA 3IIKA 3KL4A 3LBNA 1U8AA 4FMBB 4LDJA 4LV6A 3RS7A 5KPJA 1GTVA 3AUXA 1AM4D 2VBCA 1S1CA 2VHQA 2ZS9A 5FL7A 1KDPA 1ZC4A 3HPQA 1G8GA 2YVUA 3H0KA 3FFBA 5F9FA 5SZKB 5KPDA 1SVOA 2A5YB 2C9CA 4Q1FA 3QOFA 4MGZR 5FPTA 3Q5DA 5AJYA 4IDQA 4B43A 4CYMA 4LJAA 1V43A 2ZREA 2FEOA 4Z8YA 1GKUB 1OIVA 5J4HA 4OHXA 4ASUD 4V02A 3NBFA 4UNNA 4ZCLA 2R65A 1ZUHA 1OH8A 1W2HA 5B64A 3PXGA 1VG9B 4HI0E 4M9SA 4CDGA 1F6BA 1X86B 2QE7A 4HAZA 3OEHA 1TUEA 4XSGA 2OILA 2CE7A 3P4XA 4NHOA 1Z2CA 4OI4A 2ZPTX 2IS4A 1JI0A 1G3MA 2CVHA 3CZPA 2V55B 4UXJA 2WM9B 1NMYA 4A9AA 3TW8B 2W6JA 3QUSA 1NSTA 5AUQA 1MO5A 4CEJA 1COWD 2GVZC 3EIHA 4FMCB 4TSFA 1VDZA 4DUGD 1XD2A 2G6BA 1Z06A 2PJZA 3NDPA 4KO8A 4JJKA 1KO5A 1Q1ZA 1BYUA 2FPMA 3ZQJA 1JXOA 3HJNA 1IBRA 4MITA 2A5DA 3QG5A 4GP7A 1DAFA 1G3QA 4QKQA 4IOMA 2OCPA 2ZYTX 2FSGA 3WBJA 3LLMA 1MV5A 4E07A 2BV3A 4LC1A 4XTRA 4CGZA 4L15A 721PA 4MKHA 2CMKA 2AKYA 3FMPB 4EJSC 5FOSA 3T15A 1EG7A 5KHOC 1VHTA 2SHKA 2XSZD 1GWNA 2A5FA 1E2PA 4BLSA 4DSNA 2CJWB 3KJIA 1QG4A 1Z6GA 4KCGA 1XZPA 2C5LA 4WBSA 1BOFA 5DI9A 2WPDA 1T9HA 4M1WA 5FOTA 4JZKA 1U0HC 4H1VA 1M2OB 1OH7A 3F8TA 1BH2A 2FFQA 2P65A 4TYQA 421PA 1RZ3A 1KI6B 3E1SA 3I92A 3ZGXA 2ZE7A 3C14C 4ILEA 4L8GA 3N2EA 1JR6A 3THOA 2ZXUA 3LLUA 2XITA 2PZFA 4PAQA 3A58B 2E87A 2DWOA 2B92A 4KSCA 2G3YA 1JEDA 1R5OA 2JLYA 1W7AA 1XPRA 1XTKA 3HR7A 4LY6A 3VR6A 1N6NA 4ZKDA 1LF5A 1YR6A 1T0JB 1VKJA 4ITRC 5BW8A 3EPJA 1DO2A 4P32A 3RWMB 1OXUA 4MA4A 4UNRA 4NU0A 4BLOA 1YJ5A 2QN6A 4DCSA 1D9ZA 4B76A 1F2TB 3LQRA 4DT1A 4AKHA 1Q3HA 2ZETA 1XJQA 1ZJ6A 5DGXA 2JAQA 4BFSA 4C4PA 1LFDB 4KITB 2BEJA 2IYVA 3QKUA 3R9IA 3QI2A 3KQLA 2JLXA 3U7HB 4QHSA 3ZVRA 5J4VA 2IT1A 3Q7QA 4GPTA 4QHTA 1G5RA 2BOVA 2AXNA 2IYTA 4GBMA 2CJWA 1GL7A 4DHEA 1OFIA 4P4UA 1NP6A 2QY9A 1VCMA 2GETA 3DM5A 4G1UC 1W36D 2HYIC 2PJRA 1NMZA 4US0R 2OAQ1 2WJGA 5AJXA 3NC1C 4KI0A 2IUUA 1E2QA 2YJTD 5HCNA 3W34A 1UKEA 1KSHA 4CVNA 4DBLC 8OHMA 5H8WA 3OEEA 5FR1A 3FWYA 1IQPA 4HAXA 1E69A 1L4UA 1XCPA 4MRNA 1NLYA 1H65A 4B6FA 4MYTA 5J4LA 5FOUA 2JIZD 2WWXA 5FBRB 4BFYA 2ZUCA 3UATA 2ZI3A 3W3AA 5CJ2A 1NJFA 2QENA 5H1YA 3KB2A 3WRYC 2CEAA 3GLHE 4S35A 2YOFA 4XD7A 2I1QA 4DCVA 1F2UB 3ADKA 3O8BA 1F2TA 2KE5A 2F9LA 4NYMR 3VR2A 4KFTA 2ERYA 4EPWA 3QF4B 5KU1A 2GEUA 2J9RA 3QKRB 4HB4A 3ZQ6A 3MLEA 4B48A 5BYKA 3VKGA 1M6NA 1XMSA 5AJVB 1U94A 4LHWA 4DEYA 4ZDWA 5GVRA 1DAMA 4TT3D 3TAHA 3KUDA 3WP1B 3WXMA 1OKKA 2ZROA 3QG1A 2GXQA 2XJ4A 4M0LA 2QZ4A 4HB0A 4TYYA 3QVUA 4RD0A 3ZDQA 1JEEA 2V4ZA 4RVCA 4QBHA 1E3MA 2BM1A 1FPMA 4C2UA 2QRZA 4LUCA 4QOSA 4TL8A 1D2EA 1XJCA 1XMVA 2ZYVX 1NF3A 3V4FA 4TMVA 1E4VA 1TQ6A 3TUJC 4F91B 4PXAA 3Q8XB 2RH5A 1NG9A 1CU1A 5C46F 3BAFA 2F6RA 1BKDR 3WP0A 3RSOA 2BM0A 4HLCA 1AZSC 3T06B 3C5HA 2GJSA 3RC3A 5JJIA 4L16A 4M9ZA 5FPKA 1VG0B 1DELA 2RAPA 1AQUA 2IWHA 4URWR 1CJMA 1PLJA 1SVLA 5AUOB 5E95A 4DDUA 1ZCAA 3LBIA 4JVNA 1V5WA 1YRBA 3FTQA 1S3GA 5DYIA 1Y3AA 1F2UA 1AA9A 4MGIR 5TY0A 2JLSA 4G3XA 4NL4H 1NBME 4V0OA 3AVQA 2IEZA 1YZGA 2ZYWX 4JBWA 3QF4A 1QHGA 3QKRA 2F1IA 4M9QA 4B3CA 5D3QA 1G7RA 2FSIA 3SE0A 3RS0A 3GEHA 3AVVA 2QMHA 1ELOA 4IVPA 2IYXA 3EW9A 4Q21A 1P4SA 4XWKA 3BK7A 4QJ3A 5EXXA 3C5CA 3P26A 3IPYA 1TF2A 3VX3A 3KZ1E 2J7PA 4H9GA 2ZRFA 2DB3A 3GLIE 1TMKA 1CRQA 4KBFA 4MDFA 4HLDA 2H1LA 4M2LA 3AKCA 1SHZA 2ZRKA 3SN6A 4MYUA 5E7IA 4DLTA 4JLAA 1QF9A 3I32A 4F93B 1IY2A 1G6HA 1KSJA 4V03A 3EASA 1Q22A 3HR8A 4AC9A 1XEWX 5EE9A 2F1JA 4C0HA 1E1QD 1ODFA 4RCYA 2GK6A 3QEJA 3ZZ0A 4LHZA 3CONA 3KFXA 1KDOA 1MO4A 1XXHE 2GCOA 1HYQA 2ZR0A 4CT5A 4TTQA 1YZTA 4NYJQ 3VR3A 4C0QC 2CK3A 2CLDX 1W44A 4HB2A 1R0WA 4DB4A 4JLPA 2QMOA 2ZJAA 2ZJ5A 2O0KA 1RIFA 1NKTA 3U44B 1W49A 3HPRA 4O0MA 4AURA 5K8LA 4JLVA 3PUYA 3CX7A 5HR5A 1GKYA 4X8MA 4PQFA 2ORWA 2QG6A 1ETUA 3PJRA 1Z0AA 1O3YA 4A6XA 1Z07A 2VHUA 4KHZA 3QJYA 3IEUA 1RRFA 1YZQA 4A2QA 3AKDA 2NZ8A 3AB3A 3K70D 5E4FA 3TGPA 3U4QB 2KSQA 3LRPA 4QHYA 2ZSDA 4ERNA 1Z29A 4DVGA 3L43A 1XWIA 2X2EA 1G5TA 3RLFA 2VP5A 3SQXA 1MR3F 4JL6A 2IA5A 2R8RA 3G0HA 3CRVA 4KLNA 5CITA 2GDJA 2NTYC 3QXSA 4MQBA 5KSPA 2FZLA 1E0SA 1GSIA 1KK1A 1X1SA 3QXJA 2FG5A 5CLLA 3CM0A 5JRJA 1TPZA 2DFKB 4EPXA 2NO1A 1ZM4A 3A1WA 3SHFA 1KO1A 1G9XA 3ZD6A 4DSTA 2P6UA 1YE8A 3RABA 2CHVA 1EFUA 5CK4A 2V3CC 4PHGA 1YKSA 4LRWA 5CYOA 3H84A 1JQJC 3W8RA 2R6DA 1N6KA 3IQXA 1NBMD 4PFSA 1G21E 2BBWA 2W0SA 2IHYA 4Q1BA 1TU4A 1FZQA 3I4LA 3U44A 1JR3E 3HWSA 5AWFC 5KDOA 2ZU0C 3CRRA 3PFIA 4QNRA 4MUBA 3T5GA 3AP3A 2BMFA 5DO9A 2ZJBA 3DZDA 2QPOA 2YC2C 2ZSEA 4GOJA 3TIFA 2IX3A 2GJ9A 4OQNA 1CIPA 1P9NA 2D62A 3U6KA 2FU5C 3BS4A 1Z3IX 4QNMA 2PCLA 1KI4A 4CEIB 2GRJA 5JLJA 3U4QA 1SVSA 4X8HA 1KY3A 3ND9A 4JT2A 3NH9A 3W5IA 2B7BA 1E94E 5AUNB 1IY1A 5F3WB 1N6PA 4EPTA 2W00A 4DB2A 5EXTA 5P21A 3G82C 4OI0A 5EE1A 4QJ4A 2D2FA 4CT4B 1NN5A 1XD9A 2HLDA 3B1XA 2OV2A 5CK5A 3K9HA 1WP9A 3KB1A 2P3SA 1W0JD 4GP6A 3SBDA 5LD2C 1W4CA 1IAQA 4Q01A 1ZRHA 2EWWA 3CO5A 1MABB 2FFHA 3CNNA 4O25A 5EQTA 3X1ZA 1GM5A 2WKRA 2X77A 2R6FA 2FA9A 5KSYA 1L2TA 2AHOA 4W5JA 5FOWA 1JJ7A 3QKSB 4I99A 5IT5A 2OZEA 3SHWA 4NMMA 2OESA 3W9YA 4BZPA 4W5HA 4Q19A 4MKFA 4BASA 1XB2A 4NP6A 3RC8A 3GJ5A 4JKIA 5EP4A 1PLLA 2O8EA 1PV4A 1DS6A 2O8BB 3D31A 4PHHA 3GJ0A 4FI3C 5LB4A 3ZZUA 4FD2A 2ODWA 5GJBA 3QE0A 3PIRA 4R2IA 2A5GA 4PC6A 4IVRA 4WAUA 1FUUA 2BIFA 2JJ1A 2MSDB 3KKQA 4TLAA 3Q9LA 5BN4A 2IBMA 3NEJA 5DISB 2DWQA 1FQKA 3FDIA 3MCAA 4EFMA 5A0FA 2ORVA 3K53A 4A4DA 2GBLA 3SJBA 5EZ5A 2D06A 2YWFA 2LKCA 4HDQB 1R8QA 1NLZA 3A6PC 1UKVY 4HLQB 4B32A 1G16A 2QROA 4TYNA 1IN6A 4Z8XA 3PITA 4PR0A 1MABA 4Q03A 2HF9A 1XF9A 2RHDA 2AFIE 1Q1QA 1SXJE 1SGWA 2HT1A 2BCJQ 3NH6A 5HKKD 2EFDB 2G9NA 2AK3A 4AYWA 4R9UC 3TMKA 2CHGA 3V00A 3GJ4A 3QKSA 2JEOA 2XJ9A 4BE7B 1JR3D 2A30A 1VG1A 2E9SA 3AGQA 1SVMA 4HAVA 3UMFA 1HEIA 2XOKD 3QPWA 1W46A 1ZM7A 1DPFA 4OK6A 2QM8A 2O8BA 5FBLB 2A5JA 3NKVA 1COWA 3EZ2A 5L8VA 3EZFA 2QMEA 2D7DA 2ODNA 2Q3FA 2H16A 1OHHD 4ZDIA 4DLZA 1A5TA 4AKIA 1OH5A 4IDNA 4IHQA 3IHLA 1K6MA 2WJVA 2OFWA 3AQ4A 5CLQA 1W5TA 5L3QB 2UVQA 2ZRIA 3U2QA 1VCNA 1YR8A 4B71A 4DC9A 3K9LA 1EFTA 3KJGA 4L9WA 1MO6A 2HV8A 2R6GA 2V7QA 3KTAB 4S2EA 4ACBA 4GDFA 1T3LA 2QTFA 3AVOA 1JPNA 1OW3B 3BB1A 4Q7LA 3I73A 4Q18A 3QVVA 3GEIA 1G7SA 1NKSA 1NVVR 2ZRGA 1P3JA 1W48A 3GLGE 1W36B 2CNWD 1FMLA 1KAOA 3GQBA 2CL7X 2VP6A 4JJZA 2CL6X 1G6OA 4RD2A 3ZVLA 2QRNA 4DLSA 3DO6A 1DAKA 1CLUA 1T91A 2A7QA 3KXLA 1AN0A 1CJKC 3NTUA 1FW6A 3BD9A 4Y0VA 3NDBB 2QP3A 1GRRA 4Q1EA 1RVDA 5AUPB 2XTMA 4MDEA 2RGXA 4IEEA 5EP2A 5IF9A 5FUVA 3PUXA 1DOAA 2GJAA 4BFUA 3UK6A 2NO0A 2XGJA 2ZJOA 4QGFA 4PSKA 2ANBA 4Q00A 4Q4LA 2RGDA 3GD7A 2WWIA 2ZR9A 3U3KA 2VRWA 1A1VA 1N5JA 4AI6A 5JHGB 1G8YA 1C9KA 2IYWA 4URVR 4B2IA 5L3QA 1N6RA 3P1JA 4URYR 1SXJD 1WQ1R 2I1VB 3I8XA 3KTAA 3F3YA 4QFMA 1OH6A 2AWNA 3A1UA 2OFXA 1IN7A 2WMNB 4DDVA 2WWFA 3KKMA 4HUQA 4R2HA 3WHLA 2VTKA 3EIEA 2EYQA 1T0HB 3AM1A 4PPQA 1GILA 1MKYA 5DN6D 1XEXB 2GNOA 4C0KA 1CULC 3CRMA 5EZ6B 1HUQA 2NO6A 2ZU6A 4M1YA 2QPTA 3O8CA 4A92A 3K0FA 4P4TA 3BORA 4TQAA 2W6ID 2QAJA 4M21A 1VYTA 2F9MA 1HT2E 3IEVA 4F38A 3G5UA 1GVNB 2JIZA 4QBIA 2RMKA 1XD8A 1XTIA 2GEDA 2PEZA 4B33A 1YU9A 2IF0A 2P6NA 4PO8A 5JS7A 2C95A 3K8YA 5JSZB 1NY5A 4RY2A 4K46A 4KYIB 4OQXA 3FE2A 4LHVA 5JHHB 3WYFA 4XWAA 2VO1A 5TB5A 1SKYB 3BFKA 2EWVA 4OYHA 4YXWA 1DADA 1XU4A 3EX7C 1W0KD 1ZC3A 3TLXA 1HURA 4G5SA 2YZ2A 2ZJ2A 3CF0A 2PLFA 1S2MA 3NC0C 5CDFA 1TQ2A 4TT3A 3ZIAD 4NCKA 4GSYA 1WCV1 2O8DB 3Q7PA 3VKHA 5FTNA 5AJZA 3E70C 1IY0A 1ONBA 2PZEA 4TZ6A 3CR8A 3JZAA 4B3DA 4Q4JB 2DWPA 3SJAA 4LOAA 1R0ZA 1XEXA 3DDCA 3DEFA 4URXR 2FSHA 2ZJ8A 1E9RA 1W4AA 3A1VA 1UM8A 2QGNA 4I1VA 3KX2A 1GAJA 3L0IB 4NCNA 3X2SA 5BN3A 3ADDA 2HF8A 4DKXA 3ICQB 1Q21A 4F4IA 5G3YA 3IO3A 4TL7A 2A2ZA 1FUKA 1BMFD 1NSFA 2DFNA 5DYGA 3RRNA 1QHYA 4PHTA 2ZRMA 3THYB 1A2BA 1P2VA 5F98A 4XVQA 5JSZA 2HYDA 2ECKA 2PMKA 1E0AA 1UADA 2FSFA 2MMGA 3BFVA 2YHSA 5FUYA 2QNRA 1EX7A 2X2FA 2W2TA 1C4OA 1KMHA 1KI7A 3LDAA 4FW9A 2VSXA 1PUJA 2REBA 3CWZA 2J3EA 3EC2A 1GIAA 3NBYC 3W6NA 1GNRA 3TRFA 4DWJA 1E2LA 1S8FA 3KKPA 1N6HA 4D4LA 1PUIA 3J81k 1HTWA 4Z1MD 1H8HA 3K70B 2O8DA 3NHBA 3T12A 1RFLA 4JLNA 5A5GA 1W4RA 3LV8A 3ZVNA 4B3GA 2PZGA 3K09A 2VH5R 4QBGB 4UXIA 2R44A 2C9OA 3D6TB 2BKUA 4Q4JA 4V0LA 5B58C 1ESNA 5M04A 4Q7JB 3RSLA 2VF8A 4LJ5A 2HEIA 4URUR 2XEXA 4UNSA 3U60B 2FX3A 2ZSAA 2F3TA 2JLUA 2ATVA 1JQLB 1N5IA 2GEVA 3AF0A 4AG5A 3DZ8A 3TKLA 3OE7D 4YDHB 3T1VA 3THXB 4D82A 4GL2A 3W3ZB 2Q3HA 4M8NE 4YC7A 5A4JA 3THYA 4Q1AA 2IYYA 2Q0HA 1HA3A 2PMDA 1B0UA 4JSTA 4ZDKA 2ZJZA 4HZUB 4OI1A 3C41J 4DIEA 3ND8A 1N0UA 1KI3A 3PEUA 1Z08A 1G8PA 1UBCA 5J47A 3RYTC 4BLRA 2IW3A 3THWB 1MH1A 5SZIA 3UANA 4M1SA 3IGFA 3CX6A 2ZJYA 1KO7A 5FTLA 1GDDA 2HXYA 5EUQB 3CBQA 2GKSA 2WKQA 4ZV4A 4PAMA 1Q20A 2Z4RA 4N3NA 5BYJA 2NGRA 1E0JA 2FEMA 5IK2A 3L8ZA 1ZU4A 2X8AA 1IJEA 1Z0FA 5L3VA 1TU3A 4L5BA 5KYKA 3L0SA 3GLFE 1UDWA 2GTPA 2VF7A 2CXXA 2BBTA 3ZVMA 4NKRA 1HQCA 4IFBA 3OF5A 4G5OA 3A37A 3VTKA 2A9KA 4A82A 1HT1E 4C0JA 3OIWA 3P32A 4TQ9A 3LAWA 4C0AC 5EP1A 5E3HA 3RRYA 5FBVB 3PVSA 1S0UA 4ACAA 5FBWB 2GK7A 1RYFA 121PA 2UZ3A 1KO4A 4OL0A 1DTSA 3DKVA 3T35A 1SHKA 2Q21A 3GCGA 5LPNA 4HZUA 2Y8EA 3OAAD 1DG1G 3SS8A 3KQUA 2WBLC 1LW7A 1XDBA 1TQDA 1G64A 3FB4A 1J90A 2VIIA 3KXIA 3K9GA 3B7GA 3CIOA 3AEZA 3U7EB 5GJWC 5HZHA 2ZM5A 3THWA 2FWRA 1KI6A 5JWHA 5BXQC 4IDHA 1KZ7B 2NIPA 1Q1BA 2J41A 4DSOA 1F60A 3B1VA 2KB0A 2WOOA 4BEJA 1ZMXA 1UAAA 1JB1A 3LQQA 2W2VA 1ANKA 3PUZA 1E4YA 2QM7A 1EFRD 1E2KA 1UPTA 3EIQA 4UQOA 1KTVA 1WMSA 2ZEJA 2Z4SA 3OFND 1VIYA 4WXPA 3U3JA 4PPNA 5JBQA 1KSGA 3WNBA 4QJ5A 1G7CA 1NI3A 2XZOA 4UJ5A 2GF9A 4WZAE 1ZNWA 2P5TB 2DFLA 4Q4AB 2Q6TA 5FOXA 2YWGA 1OF1A 4OJQA 3A8TA 5TARA 2GZDA 3FKQA 4DIDA 4V0NA 4W9MC 1AS2A 2ATXA 1AS0A 2E1RA 3M1IA 1G1MA 1E1RD 1R6BX 4RZ2A 4HLUA 2OEPA 4AK9A 4NDZA 2DR3A 1FTSA 2BEKA 2GBLC 2NG1A 4FCWA 4MYHA 4QGGA 3MSXA 2JLQA 3PEWA 1E98A 4PSVA 1KJZA 2VA8A 3I1FA 2KWIA 1D2NA 1P2SA 4TWZA 3FHTA 4DLYA 5DSZA 3A36A 1DVRA 3MGCA 3S1AB 1PVOA 1IOZA 1SZPA 3K0EA 1IXRC 5DH9A 2R2AA 1KK0A 3MWLA 4OQFA 2J7KA 3BGWA 1GRQA 1US8B 3V4RA 2GCNA 1O87A 1N0WA 1UF9A 4LPKA 4BZXA 1Q3TA 1G7TA 2FE4A 1Z5ZA 2IYLD 1T8UA 1F3OA 1PJRA 1Z0KA 3OIYA 5SZJA 2C03A 3K9NA 1U81A 3TR5A 4Q4HB 2AD5A 4DDTA 1KI9A 1D2MA 5FL7D 5JWOA 3C4JA 1OB5A 4FCVA 4DLRA 4YMVA 1Z22A 3B2EA 3PUVA 5KOYA 4Q4AA 1T3SA 3VNUA 2YC4C 1MOZA 3QEOA 2CCJA 5JWRA 1I2DA 3I3SR 5E7MA 2JDIA 5J40A 3H1TA 3I62A 1CXZA 3L0PA 1M74A 5HKKA 3ZYCA 1QHHB 2QSYA 1KK2A 4UJ3A 4KVGA 621PA 4I4LA 4LHXA 3FHCB 4XTCS 3PENA 4BFWA 1L7VC 1NIPA 3Q3JB 2FF7A 3KJHA 2BMJA 4LYFA 3MMPA 2N46A 4EDHA 2QBYB 4G5GA 4Q9IA 1NNEA 2XOKA 1ZINA 3MG9A 4CW7A 5FTKA 2ZRPA 3S1AA 4CIDA 1GL9B 4HEJA 4GFDA 4ZKEA 3SJCA 3M4YA 2JA1A 2WICA 2IYUA 3IBGA 1NJGA 4UXHA 1OHHA 3TJZA 4DCUA 2GILA 5J5CA 3N2IA 4E22A 2D7CA 4A8JB 1P5ZB 5DLQC 3BB3A 4I1OA 1E2FA 4AWXA 3NBXX 1XEWY 1X3SA 2WAYA 1CEEA 4NYIQ 3FPAA 5DI3B 1Z8FA 1NVWQ 4EPVA 4JS0A 3DPUA 3TQCA 4P31A 1LF0A 4P0TA 3QQ5A 4B74A 821PA 5CB6A 3F0TA 4RD3A 3I61A 4EPRA 4PC7A 2ZRAA 4MUAA 1SXJB 4QGHA 1EFHA 1E9SA 2H7VA 3IPXA 4A36A 4WZ6A 2QI9C 5E7JA 5BN5A 4Q7MB 2P6RA 1QHHA 1DAGA 1G3UA 5ELXA 1E99A 2IXEA 4FINA 2JLRA 3CW2A 4KBGA 4LJ6A 3SEAA 4AYXA 1XZQA 4WOPA 5FPYA 3UPUA 4MH0R 3VQTA 1P72A 2ZS8A 3N70A 4M1MA 4PPFA 1N5KA 2VEDA 3KQNA 1ESMA 2G83A 2QBYA 1U9IA 4Q48A 4ABYA 5IDVA 1N2CE 1FL9A 3NBZC 2H8KA 3EZ9A 1KIMA 2G88A 2VP0A 1MO3A 2R62A 2EFEB 3SC3A 3TBKA 2N1BA 4C30A 5GVSA 4OK3A 1LTQA 1GG2A 4B6EA 4JVLA 1GP2A 2FPKA 1QHXA 3O8DA 3OIUA 1FX0B 1GNPA 1W36C 1II8B 1QDEA 4B2PA 2GESA 2UZIR 2VP9A 4OJKA 2IYRA 5FPSA 4LC0A 4NCHA 2ZAMA 4ZPXA 5CM9C 3TQFA 4A8JA 1ZP6A 1YZUA 4RFVA 4BLTA 4TZ0A 3MRSA 1ZD9A 1XPUA 1XJ0A 1P6XA 3D8BA 4A6PA 4U02A 4DCNA 2ZANA 3RS2A 3AVUA 2W58A 4FCTA 3ETLA 1NN3A 3AH8A 3O8RA 4LV8B 4PQYA 1Z6XA 3A4NA 4V0MA 2H5EA 1E9EA 2C96A 2J0QA 1SXJA 5JCPA 2F43B 2H17A 2GZAA 3AKYA 2J0UB 1E0KA 3QBTA 3GLGB 2GVDC 1ZD8A 4PSAA 3QNUA 1ZYUA 3HYTA 1RC8A 2VL7A 3EA5A 1G3RA 4B75A 4NZYA 5DN6A 1P73A 5BWMA 3U7FB 3CX8A 3QXXA 4IXMA 1H8EA 4AY2A 1TQ4A 2CDNA 4IJMA 1Z6TA 2FFBA 2W6IA 3D3QA 4B44A 4B3FX 4EQ6B 3E5HA 3MFYA 4KJZA 4MRPA 1RE0A 4TN1A 4KU4A 3TUIC 1FX0A 5CYPA 1II8A 1UJ2A 4P3YA 2F3RA 3R8CA 3SNHA 4TLBA 1G4AE 2GF0A 4YMWA 1NIJA 1QHIA 4XD7D 2YV5A 1XTRA 2A78A 4X8LA 5J4YA 1YRAA 2ZI9A 1ZW6A 4BFZA 1QBKC 1CJVC 1TUIA 1KNXA 2JJ2D 3IHWA 3R9WA 2ZRCA 3LD9A 2ONKA 1OIXA 2OUKA 5KSZA 2EVWX 5EXSA 2XTZA 3ZIAA 2J0UA 1E2DA 2IK8A 4D81A 4URZR 1BIFA 4BGDA 1X8LA 1AK2A 3K0AB 4O2LA 2J1LA 4CEIA 4D26A 4Z51A 1OJLA 3CUEF 1NN1A 4Q1DA 4R7ZA 2IUTA 3C16C 3UG6A 4LSGA 2IL1A 4AYTA 2QTHA 4LJ4A 1X8JA 4IW3B 1X6VA 4E5UA 3B78A 2OBMA 1XBTA 3EAQA 4M4SA 4JYCA 2EFHB 1SVWA 2YNMA 1WB9A 3CH5A 2BC9A 5AK0A 5KDLA 3K09C 3R7WB 1HH4A 4Z54A 2WIBA 2P2LA 1A7JA 2ZE8A 3REGA 1GOTA 1KI1A 2IS1A 2NO9A 4RD4A 4CRWB 1NVUQ 2BHRA 4PC3A 4LK2A 4ASUA 4F7WA 1YVDA 2RGBA 3ZJYA 1ZM2A 2ZAOA 5H70A 4WA7A 2QA5A 3P20A 4ZI2A 5G41A 3LBHA 4JL5A 1OLOA 4IEIA 4M22A 1T5IA 3UMRA 2MMCA 1ZNYA 5HPYB 3O47A 3CF2A 4Q66C 1XCMA 3LX8A 2Q3MA 4PZZA 2FOLA 4QL3A 2C04A 3X1WA 2OFOA 4LCBA 4Z1MA 1GUAA 2OAP1 1UFQA 3K0AA 4DUGA 4Y0AA 1L8QA 2J7PD 4E03A 1Z6AA 1EX6A 4C0BA 2BKEA 1KJWA 3IQWA 1KKLA 2DCUA 4QBFA 4OHVA 1OXTA 2HJGA 4JKYA 4D4KA 1FP6A 2IC5A 2C9YA 2WV9A 4J0QA 3HP1A 5JJKA 3NG1A 4XVRA 3NIBA 5EUMA 5GADl 3K70C 1Q0UA 2QORA 2IXFA 3U5ZB 1GKIA 5EP3A 3AV0B 3OE7A 4BLQA 2ZRNA 2XZPA 2YINC 3R7WA 4XVUA 1QG2A 4FWIB 4U5XA 1AS3A 2QEQA 4NYJR 2XSZA 3KKNA 2VHCA 4RKFA 1VG8A 1ZUNB 3QPVA 1OXSC 2FPLA 2QQ0A 3AKEA 2X19A 2CK3D 5CIQA 5F9HA 2XAUA 1A2KC 3ADCA 1TF7A 4N1AA 5HZKA 1CR0A 1VCIA 4TMXA 3R8FA 3GFPA 1NMXA 1VCOA 2EFCB 2XXAB 1PZNA 3B60A 4EFNA 3CKLA 2OCAA 2DBYA 3B8HA 1AKYA 2ZI6A 5JI3E 2JLVA 2ZRHA 2KJQA 4BZQA 1ZNZA 2H57A 1HE1C 4CEHB 3HU3A 3TUZC 3RVBA 3GPLA 4MRVA 1E79D 3VR1A 2C99A 4OK5A 3QBVA 2JATA 3SFZA 3CRQA 4LJYA 2RGCA 1E2IA 3MD0A 2OXRA 1CRPA 2J59A 1W4BA 1AKEA 4JLBA 1ZVQA 1KK3A 1OXXK 5CB8A 1NL3A 2GXAA 4D2IA 1K8RA 3AF3A 4D0LB 4KFRA 5FI0B 4NBSA 2WWWA 4LBVA 3SFVA 2G77B 3B13B 3UKDA 3QXHA 4PANA 1XRJA 1U90A 1WA5A 4A1FA 5CJPA 2A3RA 4RJLA 1U2RA 1J99A 4YLGA 4Q9HA 3N5CA 3BRWD 4XH9B 3Q72A 4DLWA 4ZDJA 3LVRE 1NN0A 5EJEA 3T5DA 1XFAA 1N3BA 3L0OA 3V9PA 1KHTA 2AN9A 2KBFA 3LW8A 3OAAA 3KDSE 2FGJA 2ASEA 2PEYA 5HE9A 2V1XA 4NH0A 4O3MA 1DAHA 2XXAA 1Q57A 2AR7A 1J70A 1YZKA 2JGNA 2NQ2C 3UWKA 5IHPA 4LHYA 1R0YA 5LDDC 4AKEA 4B35A 4CEHA 3IIJA 4HLUC 1ZUIA 1P62B 4YMSA 5JS8A 2C98A 2G1KA 5G40A 1WDTA 2RHMA 2WJIA 1JBKA 2L0XA 1N0VC 1AGPA 4A2WA 2BDTA 1OYYA 2W2XA 1LVGA 2HJVA 1RKBA 5KTYA 3WHKA 1M7HA 2HXSA 3OFNA 4B3XA 2H92A 5JMTA 2OSBA 5TMPA 4HDOB 4DLXA 1S9HA 4NYMQ 3TH5A 1E2NA 4EUNA 2WVJA 4JLJA 1P9RA 1OB2A 2EU8A 3FOZA 4TMKA 2REXB 2VQSA 3P27A 1FQJA 5FTMA 1J8MF 3RRZA 1E1RA 4BLPA 5LBIA 5B2ZA 1UBFA 4AG6A 2QSZA 2F1HA 1CP2A 3ZS9A 2TMKA 3BIFA 2IHBA 2UKDA 1U0LA 2YKGA 1P2UA 1RPZA 2CCGA 3M6AA 1VECA 4YONB 3WYGA 4LJ8A 2IS6A 1R8SA 4XJXA 4ZO4A 3MAAC 3QY0A 4LBWA 3PV0A 4WZBE 5EE0A 3GLHB 1XD2B 1T8TA 1J8YF 4JL8A 3AP1A 2XTNA 2R6CA 2D3WA 3FMFA 4BECA 4A0FA 3R20A 1R0XA 2VSOA 3DOFA 1CR1A 4LYJA 3ECCA 3L8YA 4PAOA 1E32A 1IXSB 2P5SA 3SYNA 3FKSD 5K8IA 2PLRA 3CZQA 3K1JA 4PO1A 3TK1A 1W5SA 4TL6A 4TYWA 5FOVA 1A4RA 2OM2A 2QMUA 3I5YA 3GJ6A 1OIWA 1VYVA 1OYWA 3EG5A 1T6NA 2FJUA 1K5GA 3EZ6A 2QU8A 1P2TA 2O5VA 4MKIA 3T61A 3NXSA 3GFTA 3B6EA 1TADA 1Q44A 4E09A 3BH0A 2XX3A 3LNCA 3X1YA 1XX6A 2WSSD 4D25A 3BFXA 4BFXA 3CNLA 3FGNA 4Q7KA 2V54A 2QAGB 2WJHA 4BRWA 4BRUA 2ANCA 2WOJA 1E1QA 4HAWA 2ZVPX 2ERXA 2XNDD 2QT1A 1AJEA 3SI7A 5FH9A 2F55A 3GLHA 1T5LA 1NY6A 3RAPR 1E9DA 1M1YE 1U9IC 2ZR7A 4OBEA 5UKDA 3GP8A 3HU2A 1Y63A 4CF7A 4L9SA 4UNQA 2D74A 2FZ4A 3RS4A 2OXCA 3TVTA 4EIWA 4TLEA 4DT1B 2EW1A 1AIPA 4L4UA 5JCZA 3VFDA 1OT3A 1IN5A 4B73A 3FHOA 4C9BA 3K0SA 2IWRA 5C1BA 2ZI5A 2XB2A 1KJYA 1U0JA 4A8JC 4JLDA 4KV9A 4EKDA 2V7QD 3SR0A 3B1WA 5KNBA 3GLIB 3LX5A 4TQUS 1A82A 3MJHA 4OKSA 5CDFE 1GL6A 1RJ9B 2Q9AA 5DIFA 3CR7A 2IEYA 1Q1EA 4M1OA 4WXRA 1ZD1A 1QHNA 3WNCA 3W90A 2HCJB 5FUXA 1TTTA 1ZM9A 2V6JA 1R7RA 1SXJC 1RW4A 5C2JB 3EA0A 4UKDA 3TNFA 4B2LA 3GEEA 1F48A 4DLVA 2VP4A 1P7CA 1R10A 3A4MA 2QAGA 4KFUA 2WWYA 1XXHB 1ZAKA 1KI2A 3GJ8A 4RD6A 2OBLA 4US2R 3VNVA 2CVFA 2BJWA 3X1XA 1GITA 3KUCA 1KNQA 1IN4A 3THXA 3CLVA 3K0CA 3ZH9B 5IRCD 4JIMA 4B34A 1W2GA 3BOSA 4OQLA 2HUPA 1NBMA 4RZUA 2PX0A 5D3MB 1XMIA 2GAAA 3B9PA 4YQFA 4FWTA 2QQEA 4YMUA 4JBYA 1XEFA 2C78A 3CPHA 3GJXC 4LYAA 3LWNA 1LNZA 1AGRA 4LPSA 4RCZA 3BBPA 1TEXA 2ZRLA 4Q5IA 3WMEA 3IBYA 3IIMA 1EK0A 1U99A 2F7SA 1IN8A 2WWHA 1SKYE 4DLUA 3NHAA 2GWHA 4IDPA 3KFVA 5EXPA 5JZVA 1EFCA 221PA 2VSFA 5TXGA 3GLIA 5B57C 1Z0IA 4JT4A 2CBZA 3VHLB 1N6IA 1D9XA 3KQHA 1CS4C 1RJ9A 4GMDA 2KBEA 3KKOA 4MGKR 2PBRA 4Q02A 4PTLA 4NPHA 4BPBA 2ODEA 2RGNA 4D80A 2G1JA 3QPUA 4R98A 2AX4A 2RGEA 1ZCBA 1YQTA 4ESVA 4W7SA 5FI1B 5J4KA 1LV7A 3AF1A 1XXHA 1W0JA 3GJ7A 1QVAA 3ONWA 3U3MA 4IRUB 3LA6A 2O8CB 2J5XA 1R4AA 2N42A 1G17A 3FMOB 4LJ7A 3RNLA 4FMDF 1M7GA 3DHWC 2WZQA 5GJVC 2Z43A 2ZVQX 1S1MA 1BYIA 3CWQA 1I4DD 3RWOA 4JYBA 1FTNA 2Z0MA 1TNDA 2VHJA 1G41A 4PZLA 4B3BA 3B5JA 5D3MA 4NTZA 5FPHA 2C8VA 5L3SB 2AKAB 1DARA 3IILA 2YWEA 2FMXA 2JJ2A 1CKEA 4G01B 4RZ3A 5FR2A 5CM8B 4YXWD 3QF7A 4M1KA 1E6CA 4RKEA 1KOFA 1E2EA 1JJVA 4LYHA 4II7A 3SOPA 3BJIC 1YR7A 1SKQA 1JALA 4I1SA 5FBQB 4D4JA 1EWQA 4DSUA 3I5XA 2I3BA 4K81B 4MRRA 2CLCX 4FN5A 4X8OA 3CPJB 1BS1A 1G291 3FVQA 4I81A 4C0LA 1P9WA 2YOGA 2WAXA 1DG3A 4HAYA 5JEDA 4QM6A 5FL3A 3DL0A 4TLDA 1I4TD 4TL9A 3QKTA 2DY1A 3MJRA 2ZTSA 4HZIA 1G5PA 3CB4A 4F4JA 3FMIA 5CIWA 1EXMA 3KXKA 2VPPA 1WBDA 3RS5A 1TX4B 1JAHA 3EPKA 4A15A 1I4LD 2O8CA 3AVPA 2XB4A 2GCOB 4P4SB 3IO5A 1E2HA 2PCJA 2NPFA 3X1DA 2OT3B 1FNMA 3SU8A 3TE6A 2QTVB 3AF4A 3SZRA 4A2PA 3M0EA 1KGDA 2X1VA 4RFSB 4BWYA 3SYLA 2YOHA 2JLWA 2BBSA 2OLJA 5L3SA 5DE3A 1JR3A 3U3OA 1VYUA 1UBGA 2QGZA 3B9QA 3RANA
chains in the Genus database with same CATH superfamily
3EGVA 3KQVA 3ICCA 3WGUA 4RVHA 4JLOA 4AJ4A 4QJBA 3QUCA 5C7LO 2HMTA 4KAAA 3OM9A 4GOOD 2V9PA 4X20B 5IYZB 2D1FA 3L0DA 4F4CA 1CQXA 4RS3A 2YV4A 2YJ5A 4KWTA 4FLEA 1IHYA 5K0TA 4I4IA 3I01M 1TK9A 4ZOAA 1RYBA 4ZQGA 4FGLA 3OCZA 1AKQA 3ZS8A 1US8A 2QVCA 1IJKA 1EWTA 3TZBA 4DA8A 2P1RA 2XXBA 4BAGA 1QANA 4X24A 4O4JA 1D2CA 5GINE 2P2NA 2FQWA 2BGUA 1RXYA 1LS6A 1WULS 2QQFA 3BH6A 4IIVA 4J4HA 1W47A 4X85A 4KBYA 3OOEA 1FSSA 1O9HA 2X9VA 4OD0A 5ALZA 4C6SA 2PFSA 3QUQA 2AE2A 2G1AA 3ABSB 3I01A 4UNPA 3LPDA 4B6JA 5LQMA 1N25A 3UCFA 4XLLA 5DM4A 1JKFA 2R8YA 5HQTA 1UBUS 4K6CA 3GV0A 3MWDB 1Y7PA 1VMAA 3RS3A 1V8DA 2PR7A 3TTUA 2VUUA 5CDHA 2P1DA 2IODA 5KTSA 4P4SA 2Q8QA 1KR5A 4BMOB 3GZTB 4FDVA 5MFZA 4O2BB 1TYAE 2EJTA 4PPGA 1P75A 1YFJA 1Q7TA 3WWZA 2G9QA 1V7CA 4KW7A 2QG9A 4O4IB 2CNWA 3TTYA 3O8OA 4DEXA 2H1OA 4LRTB 4AIIA 5FNVF 1O94D 1Z2DA 4NATA 1CEQA 1NFRA 4C7OB 3SG0A 1TO2E 5KVAA 2XE6A 1ISJA 2DR0A 4BVGA 4COKA 1QSGA 1UFVA 3D0OA 2Y6UA 3QSYA 4IM7A 3ADPA 4WUVA 4MS3B 3ZE2B 1FF9A 1Z6YA 2WAOA 3LYHA 3K70D 1CQIB 3IUYA 3BGSA 3MAJA 3MCUA 3CSSA 1L7PA 1SG9A 2K2WA 4MQEB 3UT6A 3BERA 3I2IA 5TDHA 1FNNA 4W6QA 1DUIA 2ZIFA 4ZU3A 4ZYWA 1FYWA 2DLDA 3O4IA 4YCDA 1KXJA 1YH3A 1JKXA 4MQ4A 1BX1A 4OHZA 2R1TB 2J46A 3TLKA 5IK2D 1UEJA 1ZH8A 2QR3A 4FSHA 1HSOA 1N1MA 2HK8A 3LP5A 2XUAA 2C88A 5LP6A 1SULA 3IXQA 3L8DA 4QDZA 1CDDA 4DLKA 5EE5B 3A10A 1QK4A 1I3CA 3F98A 3UWPA 3DDSA 1YZNA 3UA4A 1UMDB 3GJ3A 3MWKA 1R4NA 2PUGA 4ZZ1A 2WFAA 2BGGA 1OXVA 1N8TA 2ACEA 2O0HA 2IYZA 4CCSA 5FTJA 3DZHA 4MZDA 1BKYA 2FAXA 4ZIRA 2HU8A 1ZL2A 2M2IA 2XYGA 2NTEA 1DSSG 3CNOA 3N2NA 4GQBA 2PUJA 3KOZA 4CLRA 1E2JA 2A35A 3HVJA 1IONA 5E3JA 2IY9A 3WMGA 4QM7A 1T2EA 2Z6VA 3B52X 3CH4B 5DM60 1G5QA 4OHYA 1OSNA 1EHYA 3JWIA 5HUQA 2K7FA 2XRZA 1RXSA 3ND5A 1WSBA 3TPCA 1TMGE 2O52A 3AIOA 4KODA 4N48A 2NSDA 4C87A 3D59A 1GTG1 2AR9A 5KSOA 2MSEB 1CR2A 5MF6A 2ERCA 3F4BA 3UJ7A 2VCYA 3ZGYA 2C42A 1GZSA 3E7PA 3GAAA 3GPCA 4QRIA 4HPJB 2NUAA 2H1CA 5JDCC 3DSRA 5PNTA 3VC1A 3CSDA 3OPXA 1JTFA 3MERA 3DV9A 1M1NB 2DT5A 3TMAA 5KCZA 2Q6VA 4NFHA 2H1WA 2QTBA 2GUWA 4DJTA 4IIXA 1UDRA 1G18A 3MXOA 2XIJA 5C34B 3UWOA 4WA8A 4MUKA 5J1TB 5JSHA 4EELA 3ICEA 2QX4A 3TZHA 4M9UA 1YMVA 3AUYA 4IUBS 4D0GA 5HVNA 2C2HA 1X9IA 2YQ5A 3VR2D 1W93A 4WEOA 1GTL1 3M6UA 5CU7A 5BVHB 2Y1WA 3TD9A 3X1KA 5JZBA 7MHTA 1NMSA 2PE5A 1G63A 4XPIA 5KCMA 1ZDMA 5FJJA 2G7ZA 2PWYA 3CEPB 3BWEA 3PJFA 2B5WA 2GA8A 3HLYA 4LVUA 3S5JA 2H3EA 3RR2A 1YZLA 2OBBA 1ZVVA 1JFFA 4CKCA 2WMOB 5JPDA 3WYAA 5CA1A 3C7KA 1NOJA 1ITZA 1RLJA 1TU0A 5FFNA 4A8PA 3RF7A 1TI7A 3WNDA 1C7JA 3D5QA 4QGAA 2B21A 2IW1A 2CD9A 3DZBA 2AI1A 2ZSBA 1KMQA 4CMIB 3EXAA 1ABBA 4S1VA 2FMKA 2RGAA 2YJGA 4JLKA 5SYMA 5JH7A 1P4RA 1DCFA 4TMZA 1CQPA 4F12A 1GNQA 1KDYA 3K5PA 3V4VB 4EAQA 1QKJA 2FJ0A 4EQ6A 4CL3A 3BRSA 1Z0DA 2P75A 4G8DA 3NBKA 2HF7A 3AZQA 3UUEA 3ZD7A 4ZFNA 4PG8A 2CL0X 4I1YA 2JLZA 3C3YA 3RHSA 4DYVA 2DU8A 2XDYA 3VYVA 4AP6A 3H4IA 4MQ5A 4MW2A 1NYTA 2OK7A 1VB5A 3OX4A 2IVZA 4GZMA 3EBPA 4TTRA 3K9WA 1JF8A 2F1OA 3UT5A 2WSMA 3D5EA 3L7YA 4GRAA 4WMLA 5MFPA 2I2XB 2XWQA 3DBHB 3GDGA 3VZRA 3I30X 4EGQA 3AESB 1Z8DA 3TVDA 2C31A 2GH1A 3BSSA 2J3MA 3P19A 3R3VA 5DB4A 3QX3A 3VX4A 2RKWA 1IXZA 2GYUA 2QV0A 4DVJA 3EWAA 5AK4A 1YS7A 2FR8A 1ZIOA 2V0NA 4L3OA 3G59A 3OTHA 4V0ME 2IYNA 4JHLA 3GEPA 1QFXA 4AX8A 3FTFA 5CLFA 1Z7YA 3T5PA 1F14A 5EIBC 4J4TA 1NNI1 1OFUX 3SJZA 1JQEA 3SSNA 4CMGA 3PLNA 3SMVA 2CXOA 3WNVA 4BNUA 2WKPA 1SC3A 2W7TA 4MR8A 1YRYE 1B16A 3KU4A 4US1R 1O5OA 1G20E 4YDQA 3QSGA 1N6LA 1R9JA 3WYCA 2ZRBA 4LRSB 4EVIA 2GKOA 1KWGA 4ZOBA 4B85A 1KU0A 2WUGA 5CBPB 1B23P 1I2MA 2FPIB 1M0EA 3MBKA 3QIAA 4J0JA 4MVJM 4HYYA 4PC1A 4TTPA 1I7QB 2IOHA 4X1KA 3O0TA 4XOIA 2W6QA 5TQVA 5K3SA 3K1TA 4DDWA 3HVHA 1VJDA 2O8FB 4IZ6A 4BO9A 1J0EA 1D1SA 1R4ZA 1Z68A 1DIBA 1M2GA 1YR3A 2JHGA 4M53A 1CY6A 3ASYA 3TB6A 1OXMA 4JBXA 1N6OA 1G2IA 2VJMB 2DHRA 4ZO9A 2GLXA 3UYKA 4CMEC 3C5EA 2YWXA 5DKFA 5KKCA 2FPOA 5LYJF 4L3WA 3V34A 3PHIA 1UJ6A 2IBSA 4AQYB 2PS3A 1BS9A 2KQUA 3E7XA 4BQRA 1Q0SA 2VI5A 4U7FA 5LBTA 2PYDA 4CMKA 1MBZA 2VHTA 3QJ5A 4WK0B 5DWQA 4E33A 3TSZA 4QECA 4MJLA 3WY9A 3UMBA 4AQ7A 1O08A 4J0HA 2AMFA 5IJAA 4TN5A 4HGYA 3ANTA 1ODKA 4AMGA 4ARBA 4Z2AA 4BB5A 2E85A 2QLTA 4K8OA 1CBUA 3H2YA 3QXCA 2JH3A 1H5NA 4EFLA 3AJEA 3IAS6 3DOUA 3ILXA 3RIXA 1PTJA 4S1TA 3UYLA 3ACCA 2BZSA 1P0MA 3HVUA 1GRNA 3RSQA 1C1DA 1Z82A 2WTUA 2JW5A 3BC1A 1E18A 5I3CA 1R88A 1ZESA 2AB0A 1CV2A 1WU7A 3OBBA 4OGFA 5J2UB 4B6RA 3HY6A 2Y2UA 1H2YA 4FEEA 1KORA 1YVPA 2P67A 1UXHA 3L1UA 3M1AA 4IGFA 5EKDA 4RK0A 4ENPA 1J5EB 1DDGA 5C18A 1FNDA 2BFMA 3CG0A 5JZ9A 3PDWA 4WCDA 2C58A 5IKPA 3AVWA 4ZXPA 2BUCA 2R8OA 3LO5A 3OLYA 2XVAA 5C8VA 1FSPA 1MG0A 2W2KA 3EWSA 2IZ0A 4CIVA 3MXTA 5JTUA 3DMDA 4I1UA 2ZBPA 4A92A 3L1IA 2ATCA 2XUJA 3AP2A 1TO1E 2WU0A 2XGOA 4RHYA 6NULA 1F8YA 5AVRA 1GGVA 3EFOB 2YWCA 2AQ8A 4YAOA 5CVTA 2CJYA 3KEFA 5DN9A 4CKWA 1X1DA 3C7DB 4E21A 1NI4B 1Z83A 2JGAA 2WWRA 4YP5A 1IJFA 3TQRA 1O0BA 4TWBA 4JSRA 1ILWA 1CB0A 4IIJA 3V7UA 1LXCA 1V47A 4EABA 1C30B 4HEA1 2ZIAA 2FNAA 1EVYA 3QP9A 1X8KA 2O0JA 3ACBA 3HB1A 4IV8A 4OP3A 4LX0A 5TGTA 5KBYA 1HDYA 1YZVA 3GT3A 2OLKA 3A9VA 4RK6A 1CZNA 3MGAA 3MOGA 5EINA 4JJGA 2QL6A 4JFRA 5I7AA 5SZHB 3VZQA 3QVXA 1DEAA 3QVLA 5LMUB 1GZUA 1ILEA 3K5WA 2QU7A 3VR4A 5T64A 2PD6A 4BEBA 2PX3A 1Y7HA 3Q5EA 1D6JA 1PSDA 2IYQA 4ID3A 4QT0A 5M5BA 4JI8B 1HT0A 1IL0A 2TYSB 4HNTA 1K88A 1YC2A 2ZQ5A 5DVZA 3HA2A 4JWTA 5EYPA 2PTGA 5JEEA 2OE2A 4G4SO 5K3DA 1CZLA 3G17A 1C1YA 2CMFA 4EI9A 1XSEA 4FNGA 3B36A 1LD3A 1L3IA 4GC9A 4UMEA 5DHFA 2W42A 1GCOA 3Q6MA 4TYMA 3EC1A 3I2GA 2B8NA 5TF4A 2AXPA 3N3AC 3W8NA 2Q1XA 1ZIPA 4NZMA 2AH5A 2EKQA 2A0UA 5KQMA 5KQPA 1J7KA 2D5BA 4Q9LA 3J7TA 1MD9A 1ZA2A 2ZJ4A 2YFQA 2VBFA 4NFYA 2FZVA 5AM0A 4AD8A 4K9OA 3RVPA 1XMJA 1JH9A 4H6VA 2H18A 1LLQA 4ITUA 4DAEA 4W7IA 3ITDA 4UC0A 2ATEA 4CTKA 3JVUA 1NP3A 3ISVA 2CXQA 5ALHA 4HYQA 5HDQA 3TBHA 4DUYB 1SCUA 1I14A 1AKWA 1C1XA 1W52X 2GQ0A 3U61B 3EUAA 2DUUA 1I3OA 1IHUA 1U4OA 3MJ4A 1A8HA 3E2PA 2FCRA 3QOWA 3VHXA 5KDDA 1VLHA 4B7AA 1BJKA 4MLDA 2VDRB 1ONOA 3T41A 3IIKA 2OCGA 3LBNA 1U8AA 2WHPA 2YWRA 4LDJA 2WIKA 4ZOEA 5LCXA 4LOLA 3VR0A 4RULA 1O95A 4OG2A 3EIWA 3BWCA 1GLVA 1S1CA 1E58A 1PNRA 1D0VA 4DY4A 1H2XA 2RI1A 5AKIA 4DR1B 1NW7A 1KTIA 3N0WA 1G8GA 2YVUA 3C3BA 1DXYA 3FFBA 3Q88A 5F9FA 4G6ZA 4ZC1A 2COKA 3DP7A 2EF0A 3CXRA 2HIAA 1VL8A 2J32A 5FPTA 4S12A 1MLDA 5AJYA 3GA5A 5GP1A 3BRQA 1HNNA 4ZRDA 3UFXB 1NUSA 1OYVA 2FW0A 4OHFA 1OWLA 5LUAA 4C05A 2FEOA 1DFIA 1GKUB 4Z8YA 5J4HA 4ASUD 3DYBA 4ZWNA 2EZ8A 2QTRA 4ZCLA 1ZUHA 1DWQA 1HM5A 1Y6QA 1T25A 3AL0C 5FYDA 2I2WA 2QE7A 4GO1A 5CH8A 3NM5A 2Q0SA 5B3JA 4HO1X 4OKIA 1Q95A 4LGYA 1KFJB 2CVHA 3E53A 2V55B 4F6LA 2WM9B 3BDVA 3JAWB 4PLFA 4A9AA 2W6JA 2FQQA 4QU0A 1NSTA 1FSZA 5JJ5A 4HCJA 2R6HA 1MO5A 4BZWA 4I7EA 2C92A 1XMPA 1BEZA 1VDZA 4XDZA 1XD2A 1R6VA 1VFNA 1XQ1A 1Z06A 2G6BA 2R47A 3AFHA 1CK4A 3NDPA 3R3YA 5DW3A 5CFQA 3RTEA 4Q4CA 1F51E 3QG5A 4L50A 1DJOA 1YZFA 1JGTA 2G40A 1G3QA 4GP7A 4NE9A 5ERXA 3BULA 1FU4A 4WZAA 4IDBA 1AZWA 1QP8A 2Q2WA 2EW2A 2WYHA 2B0CA 3GAFA 4DV4B 1N3LA 4EGJA 1TW3A 4INJA 1SBCA 4L15A 4RGYA 3U49A 4OQYA 1X70A 2OHGA 2CMKA 4YIHA 2QX7A 1GXSA 2YS6A 3B3AA 3FMPB 5COBA 3RO7A 3VTFA 4EJSC 3T15A 3D3WB 2SHKA 4KFCA 4FSDA 3HBJA 4YAEA 2XSZD 3RV3A 1IATA 1NWCA 1IQRA 1UPXA 3ZE8A 3ZXUB 1E2PA 4WOCA 4CJXA 1O0CA 1CUGA 2WDPA 4IG4A 3GJYA 4ZHQA 3PDUA 5ESDA 3ZXIA 2OXEA 3F9IA 3NHKA 4RA9A 2C5LA 1DT5A 3ESDA 3H5AA 2NU6B 1C8BA 2QX8A 2R79A 2VATA 3IDSA 3NHSA 1AT1A 1TJ4A 1KFBB 1D4ZA 1U0HC 2Q4EA 4H1VA 1M2OB 3T9FA 3VSBA 1QLJA 1YZYA 2VAPA 1H6AA 1BH2A 1KJ9A 2AJDA 3AFOA 3BKXA 4WESB 4JLWA 2VPXA 5JO9A 3C6BA 3E1SA 1W85A 3O1JC 3TEFA 2GYWA 4QG3A 3LLUA 3BL8A 1J2EA 2PZFA 3DMHA 3PWKA 3A58B 4JGBA 4NABA 4PAQA 5K6AC 4KSCA 2G5CA 2G3YA 1JEDA 4RV4A 4WK2B 5DT9A 1SUIA 4JOQA 3VR6A 2PNFA 1N6NA 3GLQA 2H59A 3LUJA 3A9RA 4KO1S 1E5VA 4N41A 4ITRC 4LDAA 4E4YA 3EPJA 1DO2A 4G1EB 1OXUA 1U0BB 4NU0A 5B7GA 3AR7A 3L46A 4KXYA 4Q6BA 4ZVPA 3SM9A 4B76A 1F2TB 3ZI4A 1QYDA 3PGXA 4JXZA 3PWSA 1ZJ6A 1PR6A 1U9YA 2NU9A 1YQQA 3EQ7A 4XYBA 4YUWA 4KREA 1FFYA 1I80A 4RY8A 5ILGA 4FT2A 3QKUA 3IS3A 4ENUA 3H5TA 1RAEA 1R0SA 3KQLA 2JLXA 2BM8A 1L9XA 5TQ0B 2ZJ3A 5J4VA 4G2TA 1T9ZA 4GPTA 7REQB 2FHPA 3I42A 5L7WA 4UTOA 3JAKB 2APJA 3CT4A 3PDHA 4U2FA 1KPIA 2EJCA 2V45A 4QAQA 1OZAA 3TQIA 3MB8A 1OFIA 4P4UA 3RRBA 4I1RA 4IEFB 1VLMA 5CDYA 3VNQA 3LHFA 2HYIC 3ZU2A 1W36D 3IE2A 4CV2A 4O1HA 4EUHA 3BFPA 2O1XA 2WJGA 3DA8A 1E1CB 5IVPA 4KI0A 4X97A 4DL9A 3W34A 3GCWA 1E6LA 2FR1A 1UKEA 1GZVA 4OTZA 3AR8A 4TV9F 4CODB 1G2PA 1QCYA 1U0GA 3GMIA 4C4RA 4WSOA 4HWGA 1EDBA 1QTQA 1NLYA 3IB3A 3CUYA 5CG1A 5FOUA 1RHMA 3HS3A 5KTTA 5ALJA 1X9HA 3NAMA 4NI5A 4DV3B 5DXAA 1Q0ZA 3BK2A 4IY1A 4L72A 1RC0A 2ZI3A 3WC4A 3W3AA 4A5SA 2WF5A 4S35A 1JKIA 4HDAA 3Q8KA 5FWXB 5AXCA 5C8YF 1O6CA 2JZOA 5ALTA 1Z6QA 2PN1A 5F73A 1CY7A 4HX2A 1PHRA 1X38A 1TFRA 1H2HA 2BKAA 2Z2XA 3S44A 5AW6A 5AKHA 3LBAA 4EPWA 3ZOZA 2QJFA 3TFOA 2JVKA 5BYKA 1YRLA 3EXEA 5AJVB 1U94A 4DEYA 3BYZA 1MQ8B 4ZDWA 5GVRA 1DAMA 3TAHA 2QVZX 4G0PA 2VRCD 4BJ1A 4JLSA 4BMXA 4G0QA 3BZBA 4M83A 4YJ2F 5ICMA 3QVUA 1HTTA 4NY1A 1SC4A 1RPAA 1VLLA 2WFLA 3NV7A 3V32A 3UK2A 2V4ZA 4RVCA 4IH9A 1UL1X 4LUCA 2WLTA 4QOSA 4TL8A 3HC7A 1D2EA 3HDGA 1XMVA 2YHIA 1NF3A 1WG8A 1WKBA 2PBLA 1H4TA 3B3FA 4B87A 1K8QA 1XU9A 1YSCA 3A0RB 2ZIXA 4N65A 4QBKA 3H1AA 4F91B 3G2NA 1E62A 4DJFC 5C46F 1ZK1A 2YXEA 1CVRA 5E4YA 4B6PA 4HLCA 1VXRA 1CUVA 3ED1A 3BMNB 3RQSA 1AZSC 3H5NA 3RWBA 4F45A 4EMUA 4GLFA 3UOGA 4EJMA 2ESRA 3RV4A 5F4ZA 4B82A 5AM2A 4YO8A 2IWHA 3ZY2A 5LZ5A 3NHFA 3NT5A 3Q3IA 1CJMA 2CEKA 5AUOB 5E95A 5FBKA 4PAWA 3LBIA 4A03A 2RHWA 3EMVA 4TQGA 1AA9A 1Y1SA 1YAHA 3L8CA 4MGIR 4MVWA 2J9FA 4WHMA 2JB9A 5D6NA 4B83A 5U9CA 3HXQA 3U44A 3JVEA 4I19A 3V2UA 1JLHA 2ZYWX 1YZGA 3GEBA 3LO8A 4G9EA 3SQOA 3QF4A 1QHGA 3QKRA 4UARA 4IWXA 4U4AA 4JB3A 1Z45A 3DXFA 3SE0A 5A2QA 1FE8A 1H5UA 4LIPD 4NX2A 3IH5A 3GEHA 1VI5A 4NQZA 4WFQA 4ZYVA 3AVVA 3GUZA 4MK4A 1I7NA 2B99A 3FUUA 2VHZA 1P4SA 1R0CA 2FZCA 4LKRA 5JATA 2TMYA 1GCUA 4Y6RA 4FX5A 5AVTA 3IPYA 3KZXA 3Q7TA 5DTJA 3VX3A 2J7PA 1FVOA 2RGUA 4WZZA 2ZP1A 2PX4A 5HNKA 2IVFA 3GLIE 3JD2A 1F7UA 2DB3A 2Q7OE 2UVDA 3QLUC 3D81A 1RQXA 4M8IA 3AKCA 3TQCA 4DMHA 5LP1A 2ZRKA 3LC7O 3FOBA 4DLTA 4O2AA 3AFIA 1Y8CA 3I32A 4JLAA 4ES6A 3ZV4A 1M1XB 5IBRA 1T8WA 2Q50A 1AHNA 1G6HA 4MVJH 2JKVA 4EZEA 2P7IA 4WN9A 3SEZA 1UPAA 2RH8A 3FCUB 2WG2A 3GWGA 1Q22A 4HTFB 5JSQA 4IIEA 1KHHA 3A1EA 4YWJA 1ODFA 4DWVA 3IP3A 2E49A 2GK6A 3QEJA 4OQZA 4LHZA 2GBPA 3CONA 1KDOA 3KFXA 4QXPA 5CX1B 2LCQA 3OUUA 1U9ZA 4KQ9A 3SHQA 1TVEA 2HHCA 5L6LB 4TTQA 2RG7A 4NDAA 4RPIA 4C0QC 1XNRB 2CLDX 3FNQA 4QWMA 5JCJD 2UXBB 1WW8A 4Q34A 3HZHA 2FWPA 1AA6A 4MNTA 1WKVA 3GEGA 1JZQA 4EG0A 4DA9A 1N8KA 2V3VA 1FMCA 1RIFA 2P11A 2V3WA 4JU8A 4FDLA 5CVEA 1QTIA 4H7HA 3TTXA 1WETA 3BZUA 4J3JA 2XODA 4JLVA 4CF4A 5HR5A 3WICA 4X20A 5IYZA 4NJMB 1KP3A 1Z0AA 3C8HA 1O3YA 4M7OA 3MUEA 4JOCA 4N8DA 4KHZA 4KE7A 3QJYA 1RRFA 1QC5B 3RREA 1M34B 4A2QA 1Y89A 2V59A 3FHTA 3NYRA 4DGQA 2KSQA 4QHYA 2ZSDA 3ABRB 1SBYA 4FDUA 1JFRA 1QQ7A 3KAPA 3EY9A 4ZTUB 2OQVA 4QD3A 1XWIA 3GY0A 3LKVA 4JK3A 4P3OA 3F4LA 2MYPA 3MNFA 2IA5A 1BX0A 2R8RA 3CRVA 4H7FA 3DBOB 4QOJA 1WNTA 1XVTA 2A14A 3EW7A 5CD1A 5CITA 2NTYC 3QXSA 4FXOA 3U48A 4YRGA 5EERA 3BXXA 3W1WA 4MPJA 1XR3A 3MK31 1X1SA 1A2OA 1QZTA 3WJ1A 5JRJA 4DXHA 4EPXA 3LQ2A 4I5EA 3QV1A 3WTCA 3SHFA 3ZWYA 1KO1A 3EGEA 5CGQB 5AOAA 1F2VA 5JAUA 3KQWA 4YCMA 1J49A 4ZANA 4YJFB 3CMMA 3RABA 5EJ8A 4BCCA 2CHVA 4ZAFA 4AP9A 5A9SB 5CYOA 3H84A 4FFWA 2QZSA 1KEVA 2CMGA 1UPFA 1GAWA 1YS1X 3CW9A 1NBMD 2HNKA 1IY9A 2YXDA 3G7NA 4HDKB 2NAFA 4L07A 1E6MA 4JQZA 3IERA 3R44A 2FW7A 1TU4A 4X44A 1CUSA 3JQ9C 2JPDA 1JR3E 1JDNA 3DW1X 1U7WA 2NT4A 1DKUA 3GQVA 3CRRA 3MCZA 4UHKA 3WQRA 1GPBA 1USUA 3WKBA 1L5KA 2BMFA 3WGNA 4KR0A 4JNKA 1ZGJA 4LK3A 3ADOA 4NS4A 4RU1A 2XHZA 4GICA 4MS3A 3RIGA 4WERA 3W8EA 4BMPB 1Z3IX 4WOKA 2YVQA 5JG7A 1KI4A 1JMYA 4CEIB 2C2MA 2GRJA 5J43A 3OMWA 1SVSA 1G20A 4NMXB 3S7ZA 3U4QA 1FBTA 1FB5A 1YRQA 3QLTA 4NZZA 2QVXX 1E0DA 3OOJA 4I4NA 1Y9DA 2R1TA 3LZ6A 2QLBA 4EI7A 4ISBA 4EY4A 3IL2A 4DCCA 4EPTA 5EJMA 5CYFA 2W00A 4BQFA 5EJAA 5FQOA 3H9QA 1M8KA 5EE1A 5P21A 1PU2A 2NUTA 3TL3A 1L5OA 4DCOA 2D2FA 1RP1A 5AJTA 1AQNA 3ELYA 3JQFC 3U3DA 4QOIA 3K9HA 2Z8XA 3KB1A 1UMDA 1YACA 3D3NA 4GP6A 4QXRA 1J56A 2Q0QA 4NPCA 1XZLA 1IAQA 3MQ2A 1FYXA 3H1GA 3CO5A 3LQFA 2HSZA 2NMVA 2XKJE 4UAUA 4IR7A 4U9HS 1GM5A 3W9UA 4CF6A 3PPVA 2UUOA 2OY0A 3DL4A 1OREA 2I91A 1ZLXA 4RIGA 1T8PA 2XD4A 3TQTA 1YB1A 3CXUA 4ZVSA 1FJXA 4QU8A 2WB2A 2FPWA 4MKFA 3DAFA 1XB2A 3RC8A 5EP4A 3NXKA 5ALRA 4BUJA 1HDEA 2O1EA 2X7JA 2Z5VA 4YDRA 1PL0A 1EWYA 4NEGA 3UB2A 2C4UA 5KTKA 2I9PA 1YR1A 3FVRA 1L6IA 1QO9A 3D31A 3GJ0A 3KHKA 2I3ZA 5H81A 4FD2A 3QE0A 3UJPA 2Y1FA 1YDHA 1K63A 2A5GA 1H4SA 2VNHA 3JXEA 3N2LA 1PR3A 1GPDG 4WADA 1FUUA 2H4XA 2PUEA 1TIPA 1FXWF 1QYVA 1KQOA 4BFLA 3RGWS 3OZSA 2WM3A 4Y2GA 3WGHA 4ZYLA 4DPLA 5JAOA 3F3SA 3L3BA 3E9QA 3NEJA 2H5JA 4KMOA 1NXTA 4KZKA 1FQKA 1YE5A 3FDIA 5EPOA 3VHRA 5FT9A 3QYJA 4Z1OA 4QEDA 1N77A 3M6WA 4AQDA 1IWOA 3K53A 5DX0A 4L85A 3CUSA 3V8PA 4YAIA 4AZSA 3E1GA 1HORA 1EBUA 2BZGA 2YWFA 1RYYA 4B79A 5EJ9A 1R8QA 3K1ZA 1UKVY 2VHWA 4HLQB 5DHRA 4DPKA 3RSHA 3DKRA 4F1WA 1MABA 3FHJA 1MFPA 5BR4A 1XF9A 2CXPA 1MW8X 3O7MA 1SGWA 5KJEA 4C78A 4EYKA 1E9VA 5HKKD 4JR1A 5ALLA 2CFTA 3NONA 4ARVA 2XJ9A 2BGWA 2E4YA 1VKNA 4AECA 2A30A 3R7BA 1VG1A 1RD4A 1P7ZA 2C5BA 2OXTA 3NTQA 2OXIA 3AGQA 4KLCA 2FWJA 2IKQA 3HVKA 3LTNC 1RPJA 4HAVA 3MJCA 3QPWA 2NUBA 4Z2YA 1SQSA 3AR6A 4QTUB 1DPFA 3U4DA 3D4BA 2FZWA 2CFCA 3NHJA 1XUOA 2D1YA 4GU5A 4EB6B 4EFKA 1O94C 1G8KA 1NJ8A 2MU1A 2ODNA 2Q3FA 4G1VA 2FQ1A 1OHHD 2RAVA 3F74A 3K7EA 4MVJG 5U1PA 3MOIA 4RHFA 1NW4A 2NXNA 4UE6A 4HFNA 4X7BA 1T1IA 2XUHA 4XKJA 1B1CA 3L8HA 5K3FA 2FN9A 3FTPA 4KPEC 4DGSA 2FOIA 4EG5A 2ZWIA 3HN7A 4RH1A 3DBHA 3JSXA 1C0KA 1N3IA 2EKDA 3D64A 3AESA 4R5HA 4RPLA 5CHYA 3UMVA 3D8UA 3DGEC 3QLEA 1XZJA 1KFCB 1A76A 4X66B 1UBRS 5JMWA 2W2MA 2FEXA 3GNLA 4B71A 1BFUA 2R3SA 1B7GO 2X8BA 4OXRA 4L9WA 1BE0A 1JLKA 1MO6A 2FCAA 1DZ3A 2V7QA 3GFGA 3KTAB 3KS9A 4OM7A 3VI3B 1JPNA 4NU5A 1UXGA 1T10A 3LK6A 2W70A 3DL7A 1FRNA 1UBTS 4K6FA 3PD7A 3QVVA 5CEEA 4I5FA 5AXDA 5DP1A 2E4VA 3GLGE 1NKSA 1R6XA 3GGOA 5HG0A 2CNWD 2IPAB 2VK8A 1FMLA 3GP3A 3KDAA 2HRZA 3GQBA 2NM0A 13PKA 2A84A 3R5KA 3BEDA 3M3DA 1G6OA 1PFUA 2XBMA 1UKAA 4BNWA 4R2JA 3P2YA 3DO6A 4YQYA 3KXLA 1K97A 5JNWA 1CJKC 3HEAA 2C2YA 1SPBS 3WA7A 1FP2A 1RQ7A 3NDBB 1NJ5A 1RI2A 3DEYX 2FOXA 3H7AA 3MEQA 4O4HF 2X4GA 2E1PA 5AUPB 4J9UE 4MDEA 5IKOA 3EVBA 1EPUA 3STUA 3M5PA 4BFUA 2NO0A 4II2A 1ONPA 5B55A 1LWOA 4QGFA 2QLFA 4BV9A 2R66A 4A0SA 1KEEA 2YFYA 1D1QA 2RGDA 2H08A 4KR2A 2RHOA 4ZD6A 3U3KA 1A1VA 4OMCA 4QASA 2P6PA 3ZH2A 1G8YA 1C9KA 1HKHA 1YB6A 4D3DA 1N6RA 2XDAA 4J0IA 4IV5A 1ZAYA 1WQ1R 1O89A 4IRMA 4B45A 4CLOA 2EX1A 4NU8X 2ON6A 1SIWA 2FPPB 2AWNA 1TYCA 1PEDA 4WI1A 2SNIE 3U3ZA 2ZSKA 4G84A 4EAAA 5FAKA 1QAQA 2VCHA 1DWOA 2PX5A 2EYQA 1T0HB 2QW8A 1QFZA 5TS2A 3AM1A 3FZNA 2DVMA 5LZ8A 4N3CA 1DC5A 4BO8A 3TD2A 2ZIGA 3Q10A 2VHYA 3CRMA 4C0KA 3DZGA 3NR2A 5AVUA 3ZDDA 1P4GA 2NP7A 1D4FA 1RRMA 3ILVA 5EZ6B 2ZU6A 1QRTA 3RD5A 4JELA 1P1JA 5BORA 4CXMA 2W5UA 4AZ0A 3EMDA 1SHTX 4TQAA 5BSKA 2QAJA 3JQBA 4M8SA 1VYTA 4AROA 3AHGA 4F6RB 1UJCA 4WNCA 4F38A 3GFQA 1GVNB 3G5UA 2JIZA 4FFLA 1EFDN 1M1YA 3F6BX 3E3OA 3FJOA 3G0GA 3EIOA 1EYZA 2RMKA 2H06A 2X8WA 3I28A 4RADA 3AHJA 1U0NA 2IF0A 3WRVA 3Q15C 3SJ7A 1R66A 2IU3A 4KLRA 1JFSA 3DJFA 1RQ2A 4O08A 4IQ0A 1INLA 3MN1A 2XMSA 3KKZA 1P2BA 3FE2A 4LHVA 4OQXA 1WMAA 3E3MA 2BGKA 4QO7A 4LSWA 4XWAA 3U13A 2V7VA 3ZDFA 4B3BA 1V16B 5TPZA 4KPUA 4HT3B 2D00A 5AFSA 1LPOA 1REQA 4PYRA 3QXGA 3G8DA 3IDFA 4WT7A 3EFOA 5H3HA 4KL8S 1HURA 1SBIA 3CX3A 1C3OB 2YZ2A 1N4DA 5ICCA 3CTMA 3JYOA 2XUGA 1RWXA 4YP6A 5FV4A 2Q5LA 2XOEA 5JAIA 4GSYA 4NNJA 3VKHA 3MWEB 5FTNA 2I3AA 1ZOPA 1Z5VA 4EJ2A 1WQ3A 5C9ZA 3T1HB 1ONBA 4P3NA 1BJRE 3NP9A 4QUEA 2IP1A 2PZLA 4Q4JB 5E7QA 3DFMA 4LOAA 1R0ZA 1CQJB 1XEXA 3HCOA 4NE7A 5EWJA 3V46A 3WSWA 4ZVNA 2IIPA 4RH3A 1DC7A 4UTXA 4URXR 3I76A 3WJ2A 3U1BA 3F73A 1ECGA 1W4AA 1PR9A 3WYDA 2W2LA 3ETEA 1UM8A 3V3TA 1RAHA 4E4TA 4I1VA 5LXTA 4D57A 2XRYA 5I9LA 1FYEA 3CT6A 5DYNA 1U2DC 4QU9A 4TV8B 5FHQA 5G0WA 3MPOA 3R3UA 4UE3S 2XKKA 1D6SA 1DJQA 4BVKA 1FUKA 1NSFA 3G0OA 2IHNA 1RI4A 1QHYA 1MU0A 2C97A 4MAMA 1ZR4A 3THYB 1P2VA 4N3GA 5HHTA 2WUEA 2Z30A 2B1IA 4MO9A 1TYEB 3HRIA 5NLLA 2XBLA 1NU8A 3ZC3A 4BX2A 1Z4MA 2QNRA 2WDZA 1EX7A 1E1LA 4NRDA 3HXPA 3FPKA 3L18A 4FW9A 3DMPA 2REBA 4Y7DA 2CLHB 2J3EA 4CL0A 5CB4F 2AUNA 1GIAA 5TNXA 3W6NA 5FPKA 5HKOA 3CNEA 4Q3KA 1N6HA 4D4LA 4G0UA 1SM4A 4ZOLA 5DLDA 3SLKA 4Z1MD 3LUHA 2Z8ZA 3ZTTA 2PSEA 1I2CA 1KAEA 3GJQA 1YDWA 1RFLA 3DGFC 1M2EA 4G56A 4XWWA 3E9NA 4ZEWA 1W4RA 5F1PA 1GA4A 3K09A 1U3UA 2VH5R 5CT5A 2ZIUB 1UM9A 3COPA 3D4NA 4D98A 4H7PA 4ETWA 3E27A 4TKVA 2BTQB 3G88A 2YVAA 1ESNA 3OZUA 4ND7A 2WZCA 4HDMA 2VSNA 3VOBA 4LJ5A 1T0BA 3PXEA 2HEIA 4JT9A 4YJ3B 5KVVA 4CDNA 4PZAA 4DREA 1SKUA 3OZTA 4MW0A 3PFWO 2O19A 1YXMA 2JLUA 2QJWA 4P8RA 5DTQA 1K7XB 2P30A 3KM0A 3RRFA 3O4HA 5SV2A 2G5PA 1N5IA 2EIHA 2FSVA 2X23A 2GEVA 2X41A 3F6RA 3FFTA 1RE1A 4PHCA 4D9CA 5BQXA 2P40A 1PQWA 3JYNA 2G25A 1W9HA 1X15A 3F7TA 3OE7D 5I45A 2I80A 1LRKA 4D82A 4EQZA 4I5IA 3U0VA 2JFPA 3UFXA 3KEMA 2OGTA 2Z4TA 4DDKA 1POWA 1A4UA 1YCDA 4YS6A 1UFRA 1B0UA 1DWUA 2YYSA 3VR5H 4OI1A 3LVBA 2UZ0A 4JR0A 4XZ3A 3SP1A 1X87A 4MVJD 4DIEA 3GOHA 3NBAA 5CA1F 1KI3A 4X90A 1K4MA 1Z08A 1G8PA 1M1UA 2WHYA 3EIXA 2M6LA 5E9JA 3RYTC 1MTZA 1QH1B 4BLRA 4INPA 2IW3A 3O3CA 3BEOA 2J33A 3Q2IA 3UANA 3ZWBA 2ZJYA 1Z33A 4RKYA 1L8XA 1EG2A 1KRWA 3WGZA 2HQSA 3GRUA 1SELA 1Y1QA 3OU7A 2RJNA 5B2EA 2CWWA 3G2PA 5CYGA 2ZIEA 1SIOA 5ALYA 1E0JA 1X7DA 5JNRA 5LMZA 1YJBA 2Y77A 3F7OA 2PV0A 5MGBA 1XRNA 2QUAA 4L5BA 5KYKA 2O50A 3GLFE 1RQRA 1UDWA 2P2CA 1NLUA 4XX1A 2EGUA 1KH2A 2VF7A 3WXBA 4N76A 4NCBA 4NKRA 2Y9PB 1JLMA 4W4TA 5EHIA 1FYDA 3VTKA 2ID7A 2ZWMA 5LKRA 1U7UA 3O1LA 1PFWA 1CW2B 1QYIA 2QN7A 4OLHA 4D9BA 4BDTA 1S2GA 1QIIA 1UZAA 5F2OA 3SOZA 4L4ZA 3TDNA 4C0AC 1DKNA 1FDUA 3UZUA 1C0EA 3KB6A 4ACAA 2QNBA