3A1VA

Crystal structue of the cytosolic domain of t. maritima feob iron iransporter in apo form
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
254
structure length
252
Chain Sequence
HMVKVALAGCPNVGKTSLFNALTGTKQYVANWPGVTVEKKEGVFTYKGYTINLIDLPGTYSLGYSSIDEKIARDYLLKGDADLVILVADSVNPEQSLYLLLEILEMEKKVILAMTAIDEAKKTGMKIDRYELQKHLGIPVVFTSSVTGEGLEELKEKIVEYAQKNTHRMILDYGEKVESEIKKVENFLRDKKLRINPRYFALKYLSGDPEFYSEGVKLGLPELSEEERIGYRLLIAKRKREYVENVVKEAFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Iron(II) transport protein B
publication title Structural basis of novel interactions between the small-GTPase and GDI-like domains in prokaryotic FeoB iron transporter
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transport protein
total genus 87
structure length 252
sequence length 254
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02421 FeoB_N Ferrous iron transport protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3a1vA01
2QRNA 1X1RA 3D8BA 3CLVA 1XEFA 4GRAA 3WBKA 2A9KA 2CJWB 4LPSA 4BWYA 4I1SA 5FOUA 1US8A 5JWOA 3IGFA 2FEOA 2ZYVX 4M22A 4TQ9A 2WWHA 4HAUA 2BKUA 1JI0A 3OHMA 3HU3A 2EFGA 2GWHA 3OZXA 2DYKA 4A0GA 5JWRA 3ASZA 5DH9A 1R8QA 4DLUA 1NIPA 3VKHA 4Q9IA 4TL6A 3SDZA 5CB8A 2RHDA 1XPUA 1UEJA 4M4SA 1IN7A 1S4QA 2FOLA 2QZ4A 3ZS8A 1WXQA 4C7OA 4EPVA 2WM9B 2VL7A 4LHXA 2GJ8A 4CEHB 1XMJA 2V8OA 2Z5FA 3OIYA 2RB4A 2MSDB 2F43B 4PHTA 3LV8A 2PX0A 4TLBA 1XPRA 4CEIB 1G5RA 3LX5A 3R8CA 1Z6TA 1S9DA 2WSSA 3JZMA 2VHCA 4IFEA 4V0OA 1ZIOA 1DAKA 2QMEA 1G291 1EFRD 1WRBA 3A4NA 3K70C 1G6HA 2V9PA 3GEEA 4C0KA 1MKYA 1XD8A 1SVMA 2KBEA 3A36A 4NCIA 1J2JA 1EFHA 1GDDA 4L16A 2GBLA 3A58B 3FHOA 4QXAA 3PIRA 4D4LA 2BM1A 1GZSA 4I81A 3PV0A 1BKDR 4KBFA 2D2FA 1P4SA 1QZXA 4HB4A 4Q47A 1RRCA 5FBWB 3FKSA 3EPHA 1W0KA 1ZC3A 2VHUA 4XD7D 4JVLA 4LZZA 5CK4A 3GJ8A 4ACAA 2G3YA 1EWRA 2WSMA 2V1UA 3FMPB 5EE0A 5E7MA 3SOPA 1AS3A 2VF8A 2IYZA 1S9HA 2AD1A 2J7PD 2FPLA 4V02A 1X3SA 1AK2A 4ZCIA 4NZYA 3SYKA 1F2UB 3W9YA 1U0JA 1LS1A 2DWOA 2HEIA 2N42A 2RGXA 4LOAA 3KQHA 2JJ1D 3X1ZA 2EWWA 3WNCA 1IHUA 2GK6A 4POAA 3V4FA 4LYHA 3AQ4A 3MD0A 1W0JA 3PUYA 1N0UA 2WJHA 4B73A 1NBMD 1XDBA 2QMHA 3I8SA 4BLTA 3QF7A 3WRYC 2CHQA 2W2XA 1HV8A 3E70C 1DARA 1U98A 2XB2A 5C18A 1Z07A 4NE2A 4W5WA 4Z8YA 4BPBA 4LJ9A 3GLIA 3SQWA 2GEUA 4DVGA 2MMCA 3PVSA 1J99A 1KO8A 3V9PA 2CE2X 1VYTA 4Q19A 1UPTA 4K46A 5DYGA 1G3UA 4KJZA 4B35A 1U8AA 3NC0C 2O5VA 2ANBA 4A4DA 1YZNA 4M9XA 3VQTA 3NBFA 1IY1A 2A5DA 2XAUA 3VFDA 2NZ8A 2QNRA 4JLBA 1Z6GA 4M9ZA 1XBTA 2C9YA 3IUYA 1H8ED 3T5DA 3ADBA 3CBQA 3DHWC 1DAFA 2F9LA 1NJFA 3H1TA 1RFLA 1L4UA 3QKTA 5LPNA 4P33A 2IW3A 4Q02A 3AKCA 3PXGA 2EFCB 2OXRA 2D4HA 2DFNA 3KJHA 4PPQA 4E03A 1SVSA 4C0JA 2QE7D 1E2EA 1MABA 3HYTA 3A6PC 1CP2A 3KKNA 3LAWA 4G5GA 4RSGA 1TQ4A 2DCUA 2GF9A 3CPHA 4NCNA 4G5OA 5B64A 2FFAA 2WTUA 1KZGB 3KFVA 3ZS9A 1GILA 1EGAA 2DPXA 1GIAA 3QKSB 5EP1A 1X8KA 2YYZA 3IPYA 1HT1E 3C7KA 3BH0A 3CPJB 3IQWA 3N70A 3BB1A 4D80A 4PPFA 5DYIA 3F0TA 2EQBA 5FOXA 4GZMA 5KDLA 4A8JC 1ZU5A 1F2TB 1W5TA 2E87A 2NIPA 4EPTA 2XZPA 4TWZA 2DFLA 1Q20A 2CXXA 3UG7A 4DLXA 4KFSA 4NKRA 2P5TB 4PAQA 4W9MC 2GZAA 4CEJA 3THOA 1XFAA 2G83A 2Q9BA 3A37A 2V3CC 4ZDIA 2WJGA 4US0R 2O8BB 2CL0X 1GKIA 5L3RA 4UXJA 1RZ3A 4A8JB 4RZXA 1G21E 4O2RA 1BYUA 1VCMA 4HLUC 4EIWA 4P4TA 4C0SA 5DIFA 2A5JA 5ELXA 4JT4A 4NYIR 3P27A 3VR6A 2QPOA 2JLVA 4C2TA 4Q4LA 1Z8FA 2REOA 4RFSA 4TMKA 1R0ZA 1ZIPA 3A1UA 1AGPA 4A6PA 2FSIA 4LRWA 4MRSA 5JS7A 3TIFA 2GCNA 2O8EB 2XOKA 4MDFA 1ZAKA 4DLYA 3MUFA 3SR0A 4B2LA 4M2LA 3ZIAA 2D62A 3LVQE 3RS0A 1WF3A 2GEVA 3R9WA 4KSCA 4WIAA 4YMUA 1D9ZA 4I1OA 4BFVA 1KHTA 5SZIA 1US8B 3OAAD 3PJRA 2JDID 4EAQA 2W83A 1W4RA 4LGMA 1VG0B 5H68A 4CYMA 1CTQA 1E9CA 3A4LA 3DM9B 4XOIA 4OBEA 2IS1A 2IHBA 2OE2A 4URUR 1O3YA 2ZM5A 2FPMA 3AKYA 4YDSA 3NVAA 1QHNA 1U81A 2ZEJA 5AR1A 2XJ9A 2ZR0A 4KO8A 1KMQA 3K0AB 3OIUA 3RRMA 1T0HB 2FDCA 1ZCAA 2PCLA 1GNRA 5FOWA 4AYTA 4C7OB 3K9LA 4C30A 2GBLC 1XP8A 2V1XA 2VP2A 1JEEA 4X8MA 2CCJA 3HYRA 5KNBA 4RD0A 3UMFA 1AS2A 2QM7A 4QC2A 3SBEA 4LHWA 1F48A 4QBFA 2GJSA 3NXSA 1UKYA 1OJLA 3CWZA 2NO7A 3GJ5A 3T34A 2AFHE 3QNUA 5DO9A 1G20E 2OM2A 3B13B 1ZUHA 1RVDA 2DWPA 3F8TA 1D5CA 1Q57A 1KDRA 4PAOA 3CO5A 3KFXA 1JXOA 2CL6X 2D2EA 4YDHB 1KSFX 2A5YB 1SHKA 3BK7A 1ZD1A 3DVLA 4OQXA 3EX7C 5IT5A 4UNPA 4MDEA 1PLLA 2PCJA 1KSGA 4A0RA 3QF4B 3LXRA 1IONA 1QDEA 1RRFA 1Z0JA 1UM8A 3TGPA 1GVNB 1UKVY 1OFHA 1QG2A 4AK9A 5TARA 4RD3A 1ZC4A 1G3MA 2ZTSA 2X19A 4A1FA 2FMXA 4PZZA 2TMKA 2D74A 3M6AA 4B43A 4C0QC 2FSFA 3CH5A 4IVRA 4JJZA 3TSZA 4YMSA 3ZLJA 4HSEA 2B7CA 1HE8B 3LX8A 4B2PA 1IXSB 2JGNA 4MUAA 1SZPA 3U6KA 4XWOA 4K81B 5EP3A 1KNQA 4XTRA 5JSZA 4UNSA 5J47A 3IBGA 4O0MA 5J4YA 5E7IA 3E5HA 1IN6A 4QBHA 1XMSA 4HEJA 4KVAA 3JVUA 3RABA 4IDQA 2PLFA 2ORWA 1TF7A 2VHTA 2D06A 1QHYA 1G41A 3KJIA 2HLDD 2GTPA 2PZFA 5GJWC 3RSLA 1DPFA 2RAPA 3IILA 5FR2A 3BBPA 4TYWA 1EK0A 1A1VA 3HJNA 1Z22A 3D7MA 4A2PA 4KITB 1YR6A 1KZ7B 1GNPA 4TYQA 3ZZTA 5D3MA 1E96A 3VKGA 5F9HA 3PUZA 1YQTA 1Z28A 2AWNA 4EPYA 3VU9A 3ZVMA 4R9UC 1OW3B 3QKRA 4Z1MA 5J4HA 2J7KA 4TQAA 1KI6A 5JJIA 4Q66C 2BDTA 3EZ2A 4OHXA 3K70D 2Q6TA 1N5KA 5H70A 3VTKA 3WYFA 4B33A 821PA 1VKJA 3B9QA 2A5FA 3FTQA 4LJ6A 2XNDA 4W5HA 1CU1A 1MABB 3B85A 4FMCB 4D26A 1NNEA 1W48A 2P2LA 2QAGA 4P0TA 2P67A 3AF2A 3RAPR 4ZO4A 2CDNA 3LXXA 4LHVA 4C9BA 3KXLA 4TZ0A 5BN3A 1NSFA 5CM8B 3HP1A 3WMEA 3FMOB 4HYYA 2Y8EA 3AVYA 2OZEA 3ZD7A 1EX6A 4UNNA 4JBXA 4TSFD 3AF1A 1G8PA 1P2VA 3QXHA 3RANA 2FX3A 2ZSDA 1Q12A 3AVVA 4QFMA 4A36A 5FBQB 3THXA 4CEJB 2ORVA 5JLJA 2BJWA 4RD4A 1YRAA 4KYIB 3TVDA 2NQ2C 5BN4A 4FIDA 5EE5B 5IK2A 1SVOA 4ZPXA 2JIZA 1NIJA 1AN0A 4DB4A 1DO2A 3CF6R 1XTRA 1U8YA 4TMTA 2B92A 1KY2A 4C4PA 4F93B 3NG1A 1ZYUA 1TEXA 4Q9KA 1VYUA 2ZSFA 4BZXA 2HF9A 5G3ZA 2JAQA 2HUPA 2W2VA 4B3GA 5CIQA 3B82A 3NBXX 3EPKA 1E94E 1OXXK 1FPMA 2RKOA 2EVWX 4JT2A 5B58C 2QP9X 4KV9A 3R7WB 5J4VA 4H9GA 4P4UA 2IBMA 2NPIA 2WMNB 1E1RD 3P4XA 4TYPA 2FFBA 1QHIA 5CLQA 2G1KA 4OQFA 5GJBA 3FDIA 1OXUA 1KDTA 2IYLD 2R6AA 4NONA 1VCNA 2ZITA 1P6XA 4RZ2A 1F6BA 4P32A 1YZKA 1GUAA 3AP1A 3MFYA 2IF0A 3EZ9A 3QBTA 2BEKA 5TY0A 4HLCA 1OHHD 3DOFA 5EQTA 1KI4A 4G5SA 4BFWA 1J8YF 4OHYA 4G3XA 1JQLB 1C1YA 1CULC 2VO1A 3IHWA 1T6NA 2CEAA 3PEWA 3Q7PA 5HCNA 1H8HD 5JEDA 1KI3A 2AL7A 1U0HC 3KX2A 4F4IA 1XEXA 1CBUA 4XWAA 2KB0A 1U90A 4D0GA 2OILA 1GRRA 1OF1A 2X77A 3NTUA 1PLKA 3O8RA 3PCRB 1SXJD 3AVXA 4EPXA 5AJVB 2G9NA 4BE7B 2VSOA 1W49A 2E9SA 4RY2A 1N6NA 1DTSA 4BFTA 5JJKA 4KODA 3W5JA 1ZW6A 2XB4A 2BBSA 4Q9HA 2IX3A 2Q9CA 1JR6A 1BIFA 4XTCS 1IJEA 3VNVA 2C77A 4FCVA 1Q44A 1FMLA 2IA5A 3Q7QA 3PEYA 4AKIA 2B6HA 1W4AA 2Z6VA 3Q9LA 3H86A 1E1QA 2R2AA 2H92A 3JZAA 4I1UA 5TB5A 4BZQA 1E32A 1AS0A 4PC1A 4E07A 4TLAA 3CNNA 3QJYA 4DZZA 1YRBA 2BHRA 1X6VA 1GITA 4NH0A 4G1UC 3AB3A 4B2IA 3ICEA 4OQLA 1TX4B 3CWQA 5JHHB 3OEED 1R4AA 2KBFA 1T5LA 2GNOA 3CB4A 1EFTA 4AKGA 1IJFA 2GCOA 3SE0A 1NL3A 4AYWA 2VP9A 2Z4RA 1OIWA 2AD5A 2Z83A 5JHGB 1N6HA 4B3FX 3TQFA 2OFWA 2P6NA 2W6JA 3L8ZA 1FP6A 4LBZA 1RYHA 1XZPA 2GDJA 3C16C 4KLNA 4GNKA 4HZUA 4HAVA 3CX7A 5EJEA 2QN6A 3EARA 4OI2A 4JMPA 3PENA 2IXGA 2GETA 3ADDA 2DFTA 2O0JA 3Q3JB 4HAWA 2FWRA 2CBZA 4IHQA 4O25A 3WMFA 4QJ3A 4ZDKA 2YKGA 4LV5B 2O0HA 1Z6XA 3GD7A 4CVNA 3RWMB 2IF2A 5JSZB 5FL3A 5EUQB 1KO5A 3SJAA 5J5CA 1G3QA 2QP4A 5CIWA 4LV6A 1ZMXA 2UKDA 3ONWA 3B60A 2KI5A 4HAXA 1HE1C 3OIWA 5CJPA 1Y3AA 4G0NA 2XSZD 3A4MA 3NC1C 2UZ3A 4Z51A 1DAGA 2DR3A 2EFEB 2QRZA 2J46A 3GJ6A 3QEOA 2C9CA 3I62A 2IS6A 4AI6A 1CJUC 4BFYA 4LCBA 4ZCMA 3B78A 4FI3C 4PO9A 5FUWA 2OUKA 2R6CA 3L8YA 621PA 3LBNA 3AGPA 4AD8A 2YOHA 2BBTA 4BECA 4WW0A 3EWAA 1SULA 3G0HA 3VU9B 4ZDJA 1I4TD 1OXSC 1ZINA 4QJ4A 4F4CA 3KZ1E 3QKRB 4Q48A 4D4KA 2QAGC 1VHLA 1KI6B 4BLQA 1Z6AA 3QKSA 1VIYA 2ZRCA 3SN6A 3I72A 4NCKA 2BV3A 1CLUA 1P60A 2QM8A 4B32A 3DDCA 1VG9B 1G9XA 4IDOA 1XMIA 1YJ5A 4DEYA 3RRYA 1RJ9B 3P26A 2HF8A 3KQKA 2ZUCA 1WDTA 1T3LA 1F2TA 3VX4A 2QAGB 4FWTA 3AVTA 2BBWA 3EPJA 2GXAA 3IIMA 5FUYA 2QI9C 2FU5C 3FB4A 4NYJQ 4ILEA 5HKKA 4N0EA 2ZANA 4XVRA 5SZKB 1EXMA 2VRWA 3CX6A 2FFHA 1OKKA 3A1SA 1A2BA 3BWDD 4EPRA 5DNYB 4Q1EA 3AF3A 2JJ2A 3MWLA 4Q4AA 5FTLA 2ZE5A 4PC2A 1VYVA 3MAAC 1NJGA 1TAGA 2J9RA 3THWB 1PVOA 3S1AA 5CLLA 1SVKA 4ZI2A 2V7QA 1GM5A 2GHIA 2QMUA 2VH5R 3TUJC 1XZQA 4S35A 3SI7A 2ZVQX 4B6FA 4M0LA 1T0JB 4M1SA 2AWOA 4DSTA 5KDDA 1OH6A 4US1R 1JALA 3IHLA 3FFAA 4MUBA 2ZRPA 1W1WA 4D0LB 1OIVA 2JATA 3RSOA 2HT6A 4JLMA 1G8YA 3GJ3A 3MJRA 1AM4D 4Q7KA 4DDTA 3ZH9B 2VP5A 4MYHA 3VR4A 1KJWA 4R2IA 1NN0A 1OV4A 2YWHA 4UXIA 2BVNA 3KDSE 3CNOA 3K0AA 1G3RA 1KNXA 2F1HA 2FGKA 3W8NA 4JSYA 1E2NA 1KIMA 1ZD8A 2C99A 3K53A 4V0ME 5CDFE 4QHTA 4PQYA 4BRUA 5L3SA 4BRWA 3NBYC 1BYIA 1N5IA 1P7CA 1VG8A 2PT7A 4YONB 1CXZA 1KJZA 2PZGA 2OCAA 2Q3FA 2QGNA 4JLPA 3RYTC 4AWXA 1M7BA 4Q1AA 2YC4C 4PZYA 4KFUA 4DIDA 1KI7A 1Z29A 4MA4A 5KNDA 2VYFA 4H1VA 3BB4A 2IYYA 2MSCB 2ZYUX 5HE8A 5FPYA 1XEXB 1KSHA 1T3HA 2J59A 2Q9AA 1XF9A 3KKMA 5DISB 1Q1ZA 1AJEA 2AN9A 1E79D 4OKSA 1NBME 2EFHB 4DRZA 2QL6A 2I1QA 1GL9B 2GF0A 3EIEA 1KDOA 3D31A 2G0NA 3Q85A 1EX7A 1XJQA 5LB4A 3QF4A 3J81k 2VQSA 3T5GA 4XVUA 3AF0A 1NMYA 2ERXA 2GXSA 5K8TA 2GVZC 2ZSBA 4WZAE 3FPAA 4X8HA 1G7SA 1UKZA 1UFQA 2ERYA 2R44A 5AJWA 3NWJA 5ANRB 1ZU4A 5KSPA 1P5ZB 4EFMA 1MH1A 1NP6A 5M04A 2OO7A 1QBKC 4B34A 1XJ0A 1DAMA 2BMJA 5F9FA 4BFUA 2XOKD 1GAJA 2WWIA 3U44A 1ZM2A 3PG5A 3BJIC 1FTSA 1D2EA 1RRPA 1Z0FA 2GCOB 2QROA 2BM0A 4IKEA 2ONKA 3ZIAD 2P6UA 4DUGA 4UJ5A 4BFZA 3FHTA 3VX3A 3K0FA 2IUTA 4BZPA 1XCGB 4BLOA 4U7DA 2AKAB 3IIKA 2XTNA 1TPZA 4RD2A 5TXGA 1N6OA 2KJQA 4HZUB 3W6OA 4HB0A 1XTKA 4OJKA 2H17A 2WAYA 4WZBE 1QVRA 2ECKA 2C5LA 1NN5A 3QPVA 4F4JA 2WJYA 2DB3A 1HQCA 5HE9A 1P73A 4B3DA 2PT5A 4JLKA 1LV7A 3HWSA 3M4YA 1ZNXA 1H65A 4LYFA 4DCSA 3TKLA 3LBIA 5KSZA 1R5NA 2HCJB 1NMZA 2FEMA 2ZI7A 1KMHA 3MG9A 3SNHA 3FOZA 1KO1A 2CLDX 2PH1A 4FMBB 1Q3HA 1NLYA 1CJMA 4QBIA 2BCGY 1XMVA 1MOZA 2XXAA 5IDVA 3K0SA 1LF0A 4FW9A 4JYCA 5DHAA 4GP7A 4QGGA 2OHFA 3NHAA 3NDPA 1TQ2A 8OHMA 2W00A 4NP6A 4NHOA 4DDVA 4QHSA 1R8SA 4OL0A 3SFZA 2OBLA 2RGNA 3KQLA 3IO5A 2RGEA 3LLUA 1UDXA 1E0AA 4IEIA 4EUNA 4F91B 4L9WA 1IN4A 2RH5A 3IO3A 3AKDA 3U7FB 1ZCBA 1XTQA 1G7RA 3QKUA 5JJLA 1W44A 2BMEA 4LSGA 3UK6A 4LYAA 1HT2E 4DXAA 4Q01A 2AHOA 3GFOA 4ESVA 4GZLA 2EWVA 3B1XA 4URWR 2NO1A 2H16A 2OCPA 3CW2A 5HPYB 3AVWA 5FL7D 2P65A 4P31A 4CRWB 4B75A 3DZ8A 2JLWA 3IEUA 1W4BA 4AKEA 1FUKA 1QRAA 1W4CA 3LD9A 5FBRB 1NN1A 1DAHA 2NG1A 5JECA 4DB2A 3GFTA 1N6IA 2ZSAA 1JBKA 3O8BA 5CK5A 1QHGA 3D6TB 4YMTA 1RKBA 4GPTA 3GFPA 4L4UA 4MYTA 1XX6A 5EE3A 5KDOA 1DADA 1OXTA 3SEAA 4Q4AB 5G3YA 2LKDA 3T15A 3I32A 4R7ZA 4KI0A 4RJLA 2I4IA 4A82A 1N6KA 3PEVA 1FOEB 4IJMA 4XD7A 3S1AB 2WJIA 3OFNA 3BAFA 5FTKA 4B48A 1HQYE 1SQ5A 4IOLA 4V0MA 5CDFA 2ANCA 1R5OA 3R7WA 1TL7C 1SHZA 2W6ID 5JCZA 4OYHA 3TK1A 4DDWA 2LWIA 3LBHA 4Q00A 4WVFA 1Q1QA 2YINC 2L0XA 3RHFA 1G8FA 2OCBA 1M1YE 3L82B 4JLNA 4MGIR 4A15A 2JJ1A 4JVSB 4JLOA 5EZ5A 3M0EA 4YLGA 3X1XA 4TMWA 3LRPA 2H1LA 4AYXA 3WNBA 4V0KA 2W0SA 4V0NA 1NBMA 1X86B 4LBYA 4NYIQ 3MJHA 2ZRAA 5EXXA 2WJJA 2CNWD 1YZUA 3EW9A 3ND8A 1ZP6A 4DHEA 2EU8A 2ZIAA 3EASA 1OIXA 2EFDB 4LJAA 3TUZC 1MRNA 2ZS9A 4JL6A 3W3ZB 1MRSA 4J0QA 5L3SB 1FFHA 2HYDA 3QPWA 3OEHA 2CK3D 2YWFA 2JASA 1NY5A 2IYVA 2ZI4A 3CX8A 4C0HA 1ETUA 2W2TA 4A6XA 3DOEA 3EZ7A 1WCV1 3BFXA 4JLDA 4QNRA 1N5JA 3C41J 3QENA 1G7CA 4I4LA 2GEDA 2IEZA 3P32A 3UATA 5KPDA 4TLCA 2IXFA 1F5NA 3MGCA 4RKEA 2FG5A 1IM2A 2GJAA 5LB2A 3R9XA 2VLIA 5L8VA 3N2IA 2ZRGA 3KJGA 4QOSA 521PA 5C4GB 3CRQA 2WKQA 1NVWQ 2RMKA 2ZRFA 4URVR 3BS4A 1II8B 4PQFA 3RRZA 1N3BA 5FOTA 1KI2A 2GCPA 1UBCA 2Z4SA 3EPLA 1G4AE 1E0SA 5E4FA 1ZNYA 4FN5A 721PA 3HR7A 2FSHA 4Q7LA 2IYSA 3Q8XB 4DC9A 3GEIA 3CF0A 4LC1A 2GESA 2ODWA 1A82A 3SHFA 5KSOA 3MCAA 4M9QA 1GTVA 421PA 3SU8A 5EUMA 1KTVA 2J0UA 4MKIA 4NL4H 3W34A 5E95A 1Z6YA 3ZQJA 3U44B 3QOFA 3MWYW 2QTFA 1XB2A 4RVCA 2WVJA 2J41A 1E9DA 1NVVR 3AVUA 2PMKA 1KOFA 3T06B 3KQUA 1G7TA 3K8YA 4PR0A 2ZRBA 3K0FB 3ETLA 1AIPA 1HH4A 4MGZR 1S2MA 2ZU6A 4ACBA 4KLZA 2Q21A 3KQNA 2J0QA 1IXZA 5EP4A 2YWEA 2IHYA 3ZZUA 1G16A 4KYUA 3UWOA 4PZLA 2WAXA 2ZE6A 4OHWA 2NO0A 2PZEA 2ZAOA 5DI9A 4ARZA 2R6GA 3U7EB 3RC8A 2HXSA 4BLSA 2JLZA 3H2YA 4M1TA 4UNRA 1OFIA 2QA5A 4LJ5A 3C5CA 2FPKA 3K0EA 3F3YA 4PSKA 1LNZA 3IDQA 3W8RA 3SYLA 3BRWD 4KVGA 1M6NA 2R6DA 5B57C 1ZBDA 1T3SA 4TTQA 3KUCA 1XCPA 3DM5A 1KMHB 3EWSA 4A2QA 1PV4A 1N2CE 2O52A 2GXQA 4KFRA 2VSFA 2WPDA 1NVVQ 3C4JA 5CYPA 3TSWA 5DLQC 3RWOA 2J3EA 2RGNC 3CRMA 4C3ZA 1CF4A 2XXAB 4M8NE 5C46F 1NSTA 4YXWD 2XNSA 2ZS7A 1FQKA 3CKLA 3TH5A 3TMKA 4DEXA 3VR2A 1E2HA 5C4MA 5KTYA 1RJ9A 4ASUA 4BGDA 1QVAA 4I1VA 4D25A 4MYCA 4N3NA 2OXCA 3WRXC 1F3OA 3KKOA 3OAAA 4MQBA 2JDIA 1FX0B 2J5XA 4HB3A 2BJVA 2F1RA 1RIFA 3VR1A 2ODBA 1E1QD 3I73A 1KYIA 4HB2A 3OEEA 1ZNZA 3NEYA 3WYAA 2X2FA 3EZFA 3O47A 3TJZA 3UMRA 2IYRA 1K5GA 2YNMA 3AVQA 3E1SA 3UWKA 4L5BA 1NVUQ 2IUUA 2WJVA 4DKXA 3LA6A 5JI3E 2JCSA 1E4VA 2Q0HA 2QTHA 1S3GA 2HJGA 4F38A 1BMFD 5HTKA 1XEWX 1XPOA 3GLGA 1OYYA 5J4LA 2RGAA 4GMXA 2IK8A 5JWHA 4ABYA 2W6JD 2F1IA 3EZ6A 3THWA 1G1MA 2ZUBA 2BEJA 3TR5A 1KAGA 1QG4A 5DGXA 3REFA 4ZCLA 1COWD 3IKJA 3MLEA 3MWKA 1B23P 3W5IA 4HUQA 1E2DA 2NMVA 3T1OA 3IEVA 3ZQ6A 1KK3A 2ZR9A 3BH7A 1OLOA 3HPRA 4MRVA 1CR4A 1DO0A 2MMGA 2N46A 4R71A 2RGCA 5GJCA 1JAHA 1KI9A 3ADKA 2DWQA 2QQ0A 2B21A 3LQQA 4E09A 5TMPA 4ERNA 2CVHA 2XX3A 5CM9C 3DKVA 4ESHA 2IS2A 1NMXA 1HEIA 1JJ7A 5JZVA 3KUDA 3ASYA 4GOJA 4PPNA 2WOOA 1P2TA 1XD9A 1GRQA 2C9OA 2IYXA 2YWGA 1D9XA 1KK1A 3EC1A 3TW8B 1M7GA 1WQ1R 4QBGB 1SGWA 1E0KA 3HR8A 5EE9A 4RZUA 1E2MA 2QPTA 4DLWA 2CVFA 3EC2A 1WE2A 2IYWA 4DDUA 2JLRA 1OPXA 5BQ5A 4TL9A 3IBYA 1JNYA 4HLQB 1P2UA 3VHXA 1PLJA 2AXNA 2OESA 4BFSA 1N25A 1FTNA 2HJVA 1R7RA 1J7KA 2JLUA 2CLCX 4K8OA 5FI0B 1IQPA 3DMNA 2C2HA 4PC6A 2WHXA 2F3TA 3V4RA 3EXAA 2IYUA 3U3KA 5K8IA 1FZQA 1K5DA 2HCBA 3F5FA 4B47A 5BWMA 2O8DA 2HLDA 5DN6D 3A1TA 1AA9A 3KB2A 1QHXA 1MT0A 3BORA 5HKKD 3R20A 5CB6A 1TUIA 4TMVA 5AJYA 3I5XA 2NOAA 3GJ0A 4O3MA 2C98A 1EFUA 1E9BA 3AGQA 3PUXA 4MKGA 4M1MA 4A0FA 1WBDA 2WWXA 4IDNA 3Q5DA 3B9PA 5DI3A 4Q7MB 1CS4C 3U6BA 1E0JA 1TMKA 1VECA 2BBOA 2JJ8A 2OT3B 3I1FA 3I61A 5EXPA 1ZNWA 1XXHB 1AZTA 3OF5A 1DS6A 1Q21A 4S2EA 2IEYA 2J87A 1KKMA 3KXIA 1U0LA 4LX0A 4PC3A 4HDQB 2WBLC 4LHZA 1S96A 4HATA 1XCMA 1E2LA 4Q4JA 4GP6A 2OSBA 3KB1A 2OCYC 3QXCA 1Z0KA 4D81A 1OH7A 4OJQA 3UXMA 4BFXA 3ZD6A 1ZUIA 2I1VB 3B5JA 1ZD9A 4TN1A 1YR7A 2LCFA 3BFKA 3K0CA 3EIQA 1M74A 1GL6A 5A0FA 1TEVA 3UMSA 3P20A 2J0UB 3LDAA 5BYKA 4B3BA 2DHRA 3IPXA 1W36C 2VSXA 4DLVA 5DE3A 4G5QA 4MKHA 2R9VA 2VHJA 1IXRC 5JBQA 2V54A 5J40A 4DLRA 4TSFA 3WMGA 3L43A 3LO5A 3H84A 4X8OA 2HT1A 2IYTA 3RS7A 1DVRA 1XTJA 4OQNA 2ASEA 3AVPA 2QTVB 1S1MA 1DELA 2IT1A 2C95A 2REXB 1R5BA 3E2IA 1L7VC 1VDZA 1W36B 2R8RA 3LH5A 2WSSD 3W3AA 4V0LA 2K5UA 1R0WA 1M7HA 4ARZB 1JR3E 3DZDA 2E1RA 2QBYA 1QF9A 2ZE7A 1RYFA 1LY1A 3GJXC 3PITA 1VTKA 1YE8A 2Q3HA 3BD9A 4JZKA 5K8UA 3AH8A 3OE7A 4Q7JB 3TRFA 1AQUA 1N0WA 4W7SA 4C2UA 3SHWA 1ANKA 1L8QA 1OE0A 3U7GA 5AUNB 3FVQA 5JEEA 1O87A 5EP2A 3FKSD 1LS6A 1W0KD 4PPGA 1N5LA 4IDPA 3DKPA 6Q21A 5AUQA 4CZ2A 1J90A 2ZUDA 5L3VA 1Z2CA 3WHKA 4IOJA 4D4MA 2QT1A 3AKEA 4TTPA 1N6RA 4IOKA 3B8HA 3P4YA 4RD1A 4EJSA 3GEHA 5HZHA 2PJZA 1HTWA 2D7CA 3A8TA 5JRZA 4JYBA 3B1ZA 3LLMA 1A4RA 2F9MA 2GJ9A 4JVNA 4CF7A 2AKYA 1NF3A 3K09A 3K9HA 1OHHA 3LY5A 1OB5A 3V00A 3AF4A 3U3OA 2ZI9A 4ON9A 4B3XA 1E2JA 1TU4A 3GLHE 3LVRE 4DIEA 2H5EA 1G4UR 1NRJB 1W0JD 2NO9A 3OIVA 4WXRA 3TE6A 4TMXA 1S8FA 3FMFA 1G5PA 2PX3A 3L0IB 4JL8A 1H8HA 4Q03A 3VNUA 2WWYA 1L4YA 3I4LA 2B8WA 4F7WA 4MRNA 3GLGB 4JLAA 1KO4A 4M9SA 1KDPA 1P3JA 2JLYA 4QGAA 4FCTA 2BC9A 5LDDC 1SXJA 2Z43A 4D2IA 5BN5A 3C15C 4Q5IA 3WXMA 1Q1EA 5FH9A 4OK3A 1Z47A 1V43A 4PFSA 4KCGA 2IWRA 3K9NA 2J0VA 3N5CA 4NMMA 1SKYB 4L9SA 4HUQB 4DCTA 2QP3A 4FMDF 4PSAA 1NY6A 2YOFA 5LD2B 1OFTA 1N6LA 4PANA 2FA9A 1E2KA 5DSZA 1U94A 4PHFA 4CIDA 1E2PA 4KXFB 4TQUS 5SZJA 3TQCA 1GFIA 1MV5A 1TNDA 2ZJZA 3G82C 4UKDA 1G8HA 3K9GA 4OQMA 4NPHA 3N2EA 3QG1A 4QKQA 2FZ4A 2F3RA 3U7HB 3CF2A 2WIAA 4OI0A 2X1VA 2H57A 1ONBA 2XITA 2ZRDA 2ZVPX 4XIGS 4CGZA 5FR1A 4TLEA 2O8FA 2FSGA 3ZZ0A 4IW3B 1Z2AA 2XTZA 5A4JA 4LHYA 1WP9A 3HDTA 4B3CA 2YJTD 2PJRA 2GK7A 1M2OB 1II9A 4LDJA 1X8LA 2PEZA 4LWZA 4Z8XA 4JBYA 1TF5A 2QPAA 5KU1A 4EDHA 4BLPA 1Z08A 5K8LA 2VP0A 4ZI3A 4R2HA 5AJXA 2XSZA 3TBKA 1OSNA 5AUPB 4DLZA 1IN5A 2VHQA 1KKLA 5F98A 5EZ6B 3RS2A 4AURA 2O8DB 4NDZA 5L3QA 2BWJA 4LPKA 2FFQA 2GZHA 5FBVB 4C0BA 2WWWA 1G19A 2FZLA 3DMDA 2NPFA 4YQFA 1II8A 2VF7A 3Q72A 2V6JA 1UAAA 1KSJA 5DI3B 4JBWA 4TT3A 3MWJA 3AUYA 3SJBA 4KFTA 1BS1A 1TQDA 2CE7A 1ESNA 4FD2A 5E3HA 3SS8A 1YKSA 4ZV4A 2ZSEA 2GZDA 3K70B 3K0CC 1S0UA 4LK2A 1GNQA 3OFND 1FQJA 1EFCA 5GADl 2H8KA 2G77B 3WNDA 1KJYA 4Q4HB 2C96A 4Y0VA 1W7AA 2ZI5A 1Z63A 1U9IA 4Q4JB 1W47A 2YC2C 2C8VA 2FV8A 1RE0A 1UBGA 1JR3A 1XXHE 1DBSA 2ZJ8A 3MMPA 4NYMR 1Z5ZA 1JPJA 4GBMA 4BASA 4B76A 3WBJA 4A92A 3CR7A 3QVVA 4PHHA 5CYOA 4CT5A 3MSXA 4UXHA 4DLTA 1I4LD 2DFKB 5HZKA 4Q18A 2ZI6A 1TF2A 3QY0A 4A9AA 5KUTA 3LWNA 2CLSA 5JI2E 1VCIA 1TTTA 3H4MA 3AVOA 2RCNA 4Y0AA 4M1YA 1S3SA 3TNFA 3SZRA 5EXSA 3QVUA 1N0VC 5IHPA 2ZJBA 5FOSA 2OLKA 3NH9A 1WA5A 3QXJA 4DBLC 4MKFA 5BW8A 2QEQA 4B74A 4EFLA 3OEHD 4JJKA 1K6MA 4TMZA 1SVWA 2WV9A 2ZQ5A 4H1UA 4IDHA 2QBYB 4NYMQ 3P1JA 3PR1A 3RRNA 3X1YA 3ZVRA 1Z0IA 1F60A 2C03A 3U4QA 5JFGA 2CMKA 2RGGA 1D2NA 3I92A 4LJ8A 5JCPA 2QQEA 3BE4A 2OEPA 2IUSA 3GLHA 3T12A 4EJSC 2CHVA 4M53A 4DCVA 1FX0A 4LBVA 3VAAA 4JVMA 3B6EA 1JJVA 3W6PA 4QM7A 4PXAA 2Q3MA 5AK0A 3GLFB 3U3MA 3FE2A 1ESMA 1E69A 1MO3A 3WP0A 1JPNA 2WKRA 3FHCB 3K09C 4LC0A 3RS3A 1DG3A 4IRUB 3QXXA 5IF9A 3AP3A 4B71A 1FMJA 1QHHB 1CRQA 1Z06A 4EJSB 3DEFA 2UVQA 4NCJA 1WB9A 2PBRA 2KWIA 2RHMA 1IY0A 1R2QA 3ZVLA 1JECA 3NDBB 1N6PA 1LTQA 1UBEA 2ZROA 3U3JA 3UANA 4BQSA 2A30A 3B1VA 1D2MA 5GJVC 3M1IA 1G3IA 2BMDA 3TAHA 2ZRMA 3PUVA 3NBZC 4JS0A 1P2SA 4IXMA 4MRRA 1EFRA 1SXJC 2C78A 1MO5A 3HPQA 2EYQA 3RLFA 2A5GA 3R8FA 2IS4A 1BH2A 2V6IA 1EG7A 4QG7A 2ONJA 3WY9A 2DBYA 1NG9A 4BEJA 2OFXA 2I3BA 2ZYTX 1II0A 4IXNA 2MSEB 2ZJ5A 1NG1A 1OXVA 4PO1A 1KI1A 3REGA 4QL3A 5C2JB 1B0UA 1E79A 2QUZA 3X1WA 1XJCA 5JMTA 2LKCA 1WMSA 1YZLA 1SXJB 2GKSA 4II7A 121PA 4ZKEA 1MO6A 1UEIA 1W36D 5D3QA 3TUIC 3W90A 2D7DA 3L0PA 2A78A 1GKUB 3ND9A 3EA5A 4XJXA 4IOMA 5J4KA 3GLGE 4CT4B 3SBDA 3NHBA 3WP1B 1DAEA 1XRJA 2J7PA 2ZS8A 4KU4A 4WZ6A 4YMWA 1X1SA 4M21A 4GMDA 2HYIC 3ECCA 2NZJA 1RW4A 4GL2A 1A2KC 3IIJA 1U2RA 4JLJA 3RS4A 5KOYA 4TL8A 3CONA 4Z1MD 3THYA 4TZ6A 2XJ4A 1SKYE 1IN8A 2DY1A 5CITA 1E98A 3CZPA 3QE0A 4IVQA 4JSTA 5F2EA 2WPDD 2R62A 2ZREA 1WBBA 4D4JA 3G5UA 3GJ7A 1RPZA 1E2IA 2VA8A 5KNCA 4C0AC 3GQBA 1KK2A 4N1AA 4C0LA 1FW6A 2AK3A 1U99A 4UJ3A 2OFOA 2XNDD 4ASUD 3QEJA 1ZRHA 4D6PA 2V4ZA 3LNCA 3CRVA 1K8RA 2XTMA 2QENA 4LI0A 1KO7A 3ZVNA 1VCOA 2H7VA 2V55B 1G8GA 3QI2A 4FWIB 3QSYA 1CJKC 4IVPA 2O8FB 1NVXQ 2GRJA 3KJEA 3ZYCA 2F7SA 2PL3A 1ZVQA 3CNLA 4GDFA 3A1VA 2KE5A 2H18A 1I4DD 3TSOA 3BB3A 4WBSA 4Z54A 1PUIA 1FNNA 3SFVA 1T4GA 1MR3F 2XZLA 1NLFA 4ZIRA 3HU2A 2ZJOA 1GP2A 4XWKA 3U61B 1H8EA 1KI8A 2QAJA 3MRSA 3QQ5A 4KSBA 4QJ5A 1ZM9A 3FGNA 2GILA 4LBWA 4W5JA 2B7BA 4P4SA 3KTAA 1XXHA 5FPSA 3A1WA 5L3QB 3R9IA 2B8TA 2FF7A 2ZR7A 5GVSA 2AXPA 2NO6A 5C1BA 1E2GA 4DLSA 5TV2A 4AKHA 5IK2D 3TLXA 2QE7A 2JIZD 1T91A 3FKQA 3L0OA 4O2LA 5BXQC 2ZU0C 4NTZA 3I5YA 1Y63A 3UKDA 2ATVA 4B44A 1OT3A 1U9IC 1TQ6A 3AP2A 4EFNA 3B1YA 1OB2A 1EESA 3SJZA 2ODNA 3BH6A 1DAIA 4LJYA 5IRCD 2FH5B 3BGWA 2QT0A 1GG2A 5GVRA 3I3SR 5AJZA 4QGHA 5KYKA 1E2QA 1XD2A 1SVLA 4LJ7A 1P9RA 1CR1A 1NI3A 1YR8A 3I8XA 1P75A 1A5TA 1VG1A 2R6FA 5CJ2A 4OK5A 5SZHB 2BIFA 1LFDB 3GP8A 4FINA 1XTSA 2A2ZA 1HUQA 2N1BA 5E7JA 2HDNB 4HAYA 4PTLA 3SC3A 3ZGXA 2OAP1 1AQYA 2P0EA 2QSYA 1BO6A 1Z0AA 3CRRA 3IQXA 2AX4A 5FL7A 3ZJYA 1A7JA 4XVQA 4MYUA 5TDHA 5FFMA 4QM6A 1BOFA 5FUXA 1UBFA 2D3WA 3U2QA 2O8CA 2GVDC 4RD6A 3LW7A 2GXUA 4JIMA 4URZR 2SHKA 1W2HA 4EPWA 5B2ZA 3DL0A 3VMFA 3BERA 221PA 2QG6A 2ZRIA 4HZIA 1IBRA 2CHGA 2P6RA 3GLIB 3CUEF 4QNMA 5KSYA 4L15A 4Q1DA 4XSGA 2WICA 3VHLB 1UADA 3KL4A 2FN4A 1QHSA 2AR7A 1ODFA 2O0KA 5FTNA 2GAOA 2EW1A 5AWFC 2IL1A 4KAXA 4HDCA 1E4YA 2W6IA 4Q21A 2J0SA 1W2GA 1IY2A 2ZXUA 4UNQA 1X8JA 3RC3A 4PO8A 4GFDA 4PSVA 3CPEA 3GLHB 5BYJA 1FUUA 3Q5EA 3U4QB 1Q0UA 3RVBA 1G6OA 3TAUA 5DHFA 3CIOA 1W46A 4PAMA 5G53C 3U60B 1DEKA 4IFBA 2XGJA 3O8CA 2FE4A 1PZNA 3JVVA 5HR5A 3W6NA 1XEWY 1DE0A 1R6BX 4OI1A 3QXSA 4FMDB 1R10A 2QORA 1JXMA 2PEYA 2CNWA 3KXKA 4WAUA 5H1YA 2WKPA 3PUWA 1G17A 2P3SA 4LV8B 4TL7A 3U3RA 4JKYA 3GLFE 3WYGA 1KY3A 1CR2A 3NEJA 1E3MA 3H0KA 1YZTA 3CZQA 2JA1A 2G6BA 1FP7A 1G18A 4LY6A 1NLZA 2VP6A 2CK3A 4HAZA 2C04A 3DPUA 3LW8A 1JB1A 5FBLB 4DT1A 3AUXA 2AFIE 2J1LA 3VR3A 4DSOA 2RGBA 2W58A 1CEEA 1DG1G 3QIAA 4R98A 3T1VA 4Q1BA 4GOXA 1ZM3A 5FPTA 3CRW1 4HUTA 1T8TA 3FMIA 4M1KA 3TR0A 3VKWA 2ODEA 5B30A 3PEUA 4U5XA 4IEEA 1E9AA 2EYUA 1YHNA 1XTIA 4LYJA 1CKEA 2IWHA 3AEZA 1GRNA 3EAQA 4BLRA 4L8GA 5G40A 4EQ6A 2ZE8A 3QPUA 3X1DA 1J70A 3FYHA 1LW7A 5HCIA 2VBCA 1C9KA 2A3RA 4AG5A 1T8UA 2QGZA 1IOZA 1E99A 2VP4A 4U00A 1VPLA 4BUJA 1T5IA 5TVKA 3FFBA 4X8LA 1VHTA 2ZYWX 3BIFA 4GT1A 4WA7A 4QRHA 4OHZA 5JS8A 2ZJ2A 2WZQA 3B7GA 4DCNA 1AKEA 3T35A 2WIBA 3GJ4A 2OG2A 1SXJE 1YR9A 3GMTA 2GA8A 2REBA 3OE7D 1NKTA 4NU0A 1YU9A 1AZSC 1XU4A 2CJWA 1HYQA 4B6EA 1OH5A 4JLVA 4MGYR 4V03A 3THYB 1XWIA 1GWNA 4RFSB 4A0HA 4HDOB 2ZETA 4URYR 3LFUA 2PMDA 2NGRA 3HU1A 5F3WB 4Q9LA 4FCWA 4JL5A 3CR8A 4NBSA 4TTRA 3GCGA 3WHLA 2BMFA 2FNAA 1TADA 4GOKA 3CM0A 2ZRNA 1G5TA 4OI4A 4DSNA 3FWYA 4CEHA 1Q3TA 4DWJA 4CEIA 3SQXA 1CIPA 2F43A 4RCZA 3QUSA 1E9SA 3RDPA 3K1JA 3B1WA 1TU3A 2IYQA 2QY9A 4AC9A 1PJRA 1P9WA 5FTJA 4Q1CA 4RFVA 3UG6A 5FPKA 4QGFA 3CH4B 4D82A 2XZOA 2F55A 1EWQA 1GOTA 4DSUA 1LB1B 4XH9B 1SKQA 3EG5A 1OKKD 4OK6A 2WOJA 1NKSA 4LJ4A 4ZIRB 3EA0A 2G1JA 4E5UA 3B2EA 4RZ3A 2OV2A 2Z0MA 1P72A 2JJ2D 2PLRA 4HI0E 1S1CA 2OBMA 2WMOB 4YC7A 1Q22A 1ZM4A 1YZQA 1P61B 2VTKA 2KSQA 4P4SB 1SVIA 3KTAB 1D8TA 4UQOA 5LBIA 5AUOB 1JAIA 1CRPA 1CJTC 2V7QD 1UJ2A 2IXEA 4YXWA 2OBNA 1C4OA 1P62B 2ZAMA 2CCKA 3BFVA 4Q4HA 5KO2A 2J45A 1TUEA 1L2TA 2YVUA 1P9NA 5UKDA 1F2UA 4E22A 2JLSA 1UDWA 3ICQB 1LF5A 4PC7A 4GSYA 1I2DA 4JKIA 5A5GA 3TVTA 3VR5A 4PHGA 3C8UA 1GL7A 2HXYA 4Q1FA 2HV8A 4MRPA 1OH8A 1XD2B 1E2FA 3EIHA 4F92B 1Z0DA 2ZRKA 1FNMA 3O8DA 1HA3A 1U8ZA 2F6RA 3BXZA 1M34E 1OFUX 1RRGA 2ZRHA 4G01B 2CCGA 1Z83A 3UIEA 1BMFA 4RCYA 2BOVA 5FTMA 1E9EA 1D6JA 2ATXA 2VIIA 2OAQ1 4ZKDA 2W0MA 1HY3A 3SJCA 3SYNA 4Q9JA 5KHOC 1W5SA 1UF9A 1NN3A 2P5SA 1YVDA 1ZUNB 4AIIA 3C5HA 1E6CA 2O8CB 1OYWA 3BC1A 1KAOA 1COWA 4AY2A 4U02A 2QU8A 1LVGA 4KBGA 1AGRA 4M1OA 2ZPTX 4WOPA 1CJVC 4PQRA 2X2EA 4OHVA 4WXPA 3ZDQA 1MO4A 3GLFA 5KPJA 3NIBA 4EKDA 1I2MA 4G5RA 3AV0B 4M1WA 3L0SA 2WWGA 1T9HA 1R0XA 2ZI3A 4XSHA 4BEBA 2G88A 1E1RA 4NYJR 2A7QA 2GJKA 3NKVA 4TYYA 3GLIE 1QHHA 4FXPA 3AM1A 3QG5A 4MH0R 2FGJA 2IC5A 3KKPA 3PFIA 3TW4A 1AKYA 2JEOA 5D3MB 3QBVA 3RNLA 2ORIA 3U5ZB 3GPLA 4TT3D 2ZJAA 5FOVA 2AK2A 1V5WA 2WWFA 1PUJA 1FL9A 4TYNA 2GAAA 4A2WA 1IAQA 5JRJA 5G41A 5P21A 1RC8A 4URXR 1E9RA 1M8PA 3OESA 2JLXA 3NH6A 1KK0A 4NCHA 1HURA 2RGDA 2YV5A 1Z3IX 4LUCA 2VEDA 1ZM7A 5H8WA 4QHYA 4N0DA 4DCUA 1GSIA 2NTYC 1VIAA 4CDGA 4AG6A 4TLDA 4DUGD 2VPPA 1JR3D 4PX9A 1Q1BA 2JLQA 3PQCA 5EE1A 5LD2C 3BOSA 2ZRJA 3LQRA 3D3QA 5DN6A 5FUVA 2G0TA 4DT1B 2FJUA 1JEDA 2BKEA 1KGDA 3DO6A 1XNJA 2O8BA 4DJTA 2QSZA 2UZIR 2F1JA 4HLDA 4CW7A 1ELOA 1JQJC 4RKFA 2YHSA 3L2OB 4P3YA 4A8JA 5FI1B 1DOAA 1ZJ6A 1J8MF 1CR0A 1GKYA 4ZDWA 4MITA 5EXTA 4FMCF 1R0YA 2XEXA 3C14C 2CL7X 4GI7A 2YOGA 4MGKR 2R65A 1YZGA 3KKQA 4EQ6B 3T1QA 4YMVA 3ADCA 2BCJQ 4US2R 2ZRLA 4ITRC 4KHZA 3T1TA 3THXB 3RS5A 2OLJA 2X8AA 4I99A 1VMAA 1G64A 3T61A 2YZ2A 2O8EA 1E9FA 3X2SA 1UKEA 4D0NA 2QMOA 4HLUA 2ZJYA 3UPUA 5FPHA
chains in the Genus database with same CATH superfamily
1JU3A 4M49A 3VO1A 3O92A 5IKEA 2WUWE 3VU3A 2H9YA 1QIEA 2A9KA 3A4YA 1CEQA 1HM5A 3L7CA 5JWOA 4BO2A 4BQQA 2E21A 2ZYVX 3ZOZA 4TQ9A 2WWHA 4HAUA 2BKUA 1JI0A 3EISA 2AEFA 4NBWA 1X9IA 5CX1B 2UZAA 2VDQB 1I4EB 2GWHA 4MCHA 1MAWA 3BDIA 2H9AA 5K0CA 1SUIA 2QTRA 3ASZA 4C04A 3PSAA 1R8QA 2BFMA 1OILA 3JQFC 4OH1A 1GL3A 5EIBC 3LCCA 3N2LA 2Y1EA 2PL9A 2JCVA 4PZCA 5C5CA 4NRDA 4M4SA 1C8LA 2QZ4A 4YPVA 3J7AC 4C7OA 4EPVA 3G1UA 1Q92A 2TMGA 3QX7A 2JAXA 4YO8A 5TJHA 4NHEA 3KIPA 3JRNA 1OXBB 1XMJA 2V8OA 1JZSA 2RB4A 2VDKB 1JZQA 4LNUA 1G5RA 2GO1A 3WR5A 1TVMA 5CLIA 2WSSA 3GELA 3HZHA 1ZIOA 1V8ZA 2QMEA 3P2JA 4IDBA 4JJFA 4KNVA 4W1RA 5CW1A 2D0PB 5AKEA 1EFRD 1WRBA 3A4NA 2ZSJA 3KVVA 5A3SA 2F48A 2YJGA 4N76A 3GEEA 2I7CA 2YICA 4P5DA 4R0NA 4XJVA 3RH0A 2SCUA 5IPFA 2HOQA 3O1IC 1GDDA 2ECFA 2IU4A 3CHYA 3LUAA 4MVJP 2BEWA 1RQNA 3OC6A 3F73A 2BM1A 4V2IA 3ZI7A 3RROA 2AF4C 1JEQB 2D2FA 4HB4A 4HT3B 1FRNA 2ECOA 2QDKA 4Y1FA 4Q47A 2V98A 4P3OA 3FKSA 3K8ZA 1HDOA 3WB9A 3EPHA 1W0KA 2H29A 2VHUA 5CK4A 4LZZA 1J20A 2CNLA 3ASVA 3Q7IA 3UC9A 2G3YA 3R0QA 4HR7A 4IILA 4KQJA 1XWFA 2WSMA 3GEMA 3V42A 2V1UA 3FMPB 2N75A 1HEYA 5EE0A 5E7MA 1X94A 1Z5VA 3BDVA 1DAPA 2J7PD 4V02A 1X3SA 2WIFA 1AK2A 2I3DA 2A4KA 1UMBA 1BCSA 1LS1A 2DWOA 2HEIA 5IH7A 3VBEA 2RGXA 2REQA 3STXA 2JJ1D 3UW3A 3NKFA 2QVBA 4KE8A 3WNCA 3G2KA 1L0BA 3DF7A 4O33A 2GK6A 3V4FA 4LYHA 3RGGA 3AQ4A 3SSMA 4ENUA 2GF2A 5FA6A 4QRIA 3WHPA 1O2DA 2WJHA 3K1AA 1NBMD 3WGNA 1XDBA 2QMHA 1XZIA 3I8SA 3Q9UA 4JFAA 4I8IA 3UB3A 4BLTA 1DAOA 1Z5GA 4C3OB 3A1FA 3DL4A 2ZUEA 1VHQA 4JLSA 1HV8A 1JLMA 1NNUA 4UVEA 5C52B 3JXEA 2IHTA 1U98A 2XB2A 1I6KA 3W5HA 4MVJG 5C37A 2VUSA 4NE2A 5DTEA 1VGVA 1STOA 4JI7B 2MMCA 6REQB 4WY2A 1V11B 3KYCA 1J99A 3VVCA 1YS4A 4GSKA 4P4NA 1XHEA 1IFXA 1BCRA 1V6AA 2IHJA 1BD3A 4KWIA 1CWUA 4K46A 2P1ZA 3AR5A 5DYGA 4KJZA 3JYOA 4EGAA 3T1HB 4BMVA 2O5EA 2RHLA 2EJWA 2ICAA 3VTAA 3WI7A 4W7IA 4EG3A 4M9XA 3O90A 4D57A 1ZL0A 1IY1A 3NBFA 5LYYA 4JT8A 3GUYA 3FOCA 4E70A 3NM5A 1OZ0A 1OX5A 1Z6GA 2FUKA 5BYBA 4M9ZA 5M7EA 1KP2A 3MIIA 2MCFA 1THMA 3DHWC 1XTTA 4A0QA 1DKPA 1VRCA 5K4HA 4UTZA 2PQ2A 3DBLA 3JRXA 4K0RA 2XHEA 4ED9A 5LPNA 3EULA 1G8AA 4NEGA 5JV5A 2OXRA 3D8HA 4PPQA 3KJHA 5F4BA 2ERCA 2OFPA 1YL6A 1JA1A 3DL2A 4IYRA 4XA8A 2HIAA 3DV9A 1EFVA 4ZMBA 1L5VA 2YV2A 1A2OA 1KVUA 1AQLA 1LRLA 3KKNA 1KHHA 4G5GA 2GF9A 4LDPA 4G5OA 2Q6LA 1HT0A 1GYQA 1V5FA 4RJJA 3KFVA 5H9VA 4EYOA 3IUEA 1H4TA 3LKZA 3IEKA 1RI1A 1WZEA 3WJ2A 1X8KA 3NC4A 3DDUA 1O6CA 1HRDA 5I7SA 1N2EA 3BH0A 3D9QX 3IQWA 4H31A 2C2ZA 3BB1A 2IZOA 3ND7A 2A9QA 5DYIA 4D0SA 1HT3A 2QRVB 3F0TA 3TPFA 3ONFA 4RA9A 2O23A 1T4CA 2PD3A 5FOXA 3W4JA 3VZBA 3ZGLA 2FW7A 1ZU5A 1W5TA 3BD7A 3ROPA 3AJAA 4G0UA 2DFLA 1C3XA 1Q20A 4DLXA 4JIGA 1Z8HA 2OHVA 2J4FA 5ICCA 3QLJA 3DDOA 6PFKA 3PVCA 4HN2A 3K9BA 4ZODA 2G83A 2R8ZA 4AS1A 4NI5A 4MGHA 1KOGA 1ZR2A 1HSZA 4YX9A 1GKIA 5ITZA 1U7DA 2EHDA 3I2IA 3Q3HA 2FWNA 1T3GA 5BUCA 2CZCA 5EGSA 4RZXA 5K4AA 1LLUA 2BELA 2IUEA 4F3KA 3TDKA 3RK1A 2UYOA 1BYUA 1XC7A 3ZXUB 3WGVA 4EIWA 1LW6E 4C0SA 3OCXA 5DIFA 4Z3KA 2W70A 3R5KA 5JH7F 1X38A 2WHEA 4U9IS 3KFLA 4BNVA 3WSVA 4W5QA 2QPOA 4MX8A 2JLVA 4ALMA 1A8SA 1R1DA 4IHJB 1XDGA 4JENA 1VGQA 1RQXA 3OH8A 1I5EA 2Q7XA 3T5MA 1TVKA 4KWEA 4MV3A 4MCAA 5CD9A 5CPFA 3M8KA 1CHNA 1GNSA 4LRWA 4RF5A 5JS7A 4PX3A 2NTEA 4PGAA 4DMMA 4EJ0A 3OBIA 3M1LA 3KJNA 3EFEA 1RWQA 2B25A 3DBRA 2YZNA 1U2ZA 3G0IA 3G3EA 4FVTA 4QU8A 5KHLB 1RWOA 3RS0A 2PHZA 2GEVA 2JLCA 4ZYXA 4WIAA 3STHA 4YMUA 5H9WA 4LXGA 2YFHA 1TZJA 3OAAD 1BXRA 4JY7A 4O1HA 5HUQA 2W2KB 3KZCA 1J2TA 4FLMA 4BCCA 4EAQA 3VNQA 2NNWB 3AJDA 4MS4A 1TKAA 1RAAA 2PBZA 3I30X 2IHBA 4DCGA 1DKMA 4URUR 1O3YA 2B4TO 5EINA 3AKYA 1UJBA 1CPYA 3TZKA 1GJRA 3R5SA 3OUTA 4ICIA 5EZQA 5HFAA 3STYA 5EIEA 2QD5A 3SF8B 4C3VA 4RTMA 4D8XA 4KO8A 4PIVA 3MNFA 1KMQA 1YASA 1IIRA 3QVWA 3S40A 1QCDA 4BN0A 2FDCA 2RH9B 1NE2A 4KK4A 3EJ6A 4K3UA 4P81A 2V1XA 1JEEA 2FR8A 4PYNA 3PNOA 4X8MA 3UAWA 3OE1A 3BXEA 4INOA 4D9KA 4WZAA 2IY7A 1UANA 3GLQA 3UMFA 1AS2A 2O3SA 5I51A 4M55A 5IASA 4LHWA 1EM6A 3H4VA 4QBFA 4D44A 1BKSB 3WYEA 2VK1A 3KRTA 2HBZA 1UZNA 5IDWA 3CS3A 1MP0A 2DR0A 3QNUA 3V33A 4ER7A 2GQ0A 4FT2A 1ZUHA 1RVDA 3E3MA 2PVSA 3BMCB 1YC5A 2C2OA 2P4UA 2JC3A 2J48A 4EVQA 4JXKA 1V35A 1FFWA 2PKWA 2H5LA 4YDHB 1KSFX 2A5YB 1NASA 4KI7A 4LSWA 4XSVA 1ZD1A 2H9IA 4FUQA 2OGTA 3TQOA 1J23A 3LC1O 3EX7C 2V7XA 5A71A 5D6NA 4AMGA 3MRXA 3EWNA 2CXPA 2EX4A 4A0RA 1Y5IA 3D8NA 2XMDA 4QA9A 5KKAA 1RRFA 4BL5A 3C7DB 3O5AA 4W8GA 2Q1XA 1SU8A 1OFHA 2YWRA 4I5GA 4BO6A 4DQVA 1W30A 1WY7A 3ZBTA 2ZWOA 4ZQEA 5KNCH 3CLKA 4YMGA 4D9HA 1IVSA 3C5WP 1E89A 3DBIA 1YRYE 1Z62A 4JB0A 3WGKA 4PZZA 4TUYF 1TAUA 1SG0A 5JRDS 3I2FA 3PXXA 1J1UA 3QMPA 4LX8A 3RIGA 4HWPA 1FNBA 1IXSB 3ROEA 3CTMA 2HBRA 3TCXB 2M6RA 3HYLA 3WL7A 2QN8A 4PR3A 4XDGA 1FSSA 3RSGA 5E6RA 4O0MA 5H4GA 3MQ2A 3E8SA 1E4EA 5E7IA 3O7MA 1XMSA 4IDQA 4B85A 1XTVA 2ORWA 4RX1A 4R5MA 3ZD9A 2OQRA 4MQ4A 4AJEA 1G41A 3GWGA 1JHVA 4ESOA 2GTPA 5REQB 4Z49A 1O5OA 5DRYA 3OQHA 2FW1A 5TGTA 2BH9A 3RSLA 3BBPA 3BYZA 1A1VA 2D1FA 4TKVA 1YZ3A 3HJNA 5HK8A 2QN3A 5ITSA 1Z22A 2R8YA 3D7MA 4KITB 1YR6A 3GGSA 1TA9A 1W9HA 1KZ7B 4WLUA 2A1TS 5CVUA 3RG2A 1T10A 1Y1SA 2CXOA 4DJFC 1MIHA 1GNLA 2VWGA 3OEWA 1H3FA 2XUFA 3NFYA 4LXUA 4ZQGA 3TIXB 4NENB 5FUMA 2CXQA 3QKRA 4Z1MA 5J4HA 3QVOA 2RBEA 3OM1A 4X44A 4OHXA 4CJXA 2XVZA 2CZGA 3H5AA 4O63O 3K70D 1RAHA 1GQRA 2HFKA 3OJ0A 3VTKA 3MQFA 4FLEA 1JLSA 4WNIA 3WX0A 4IX1A 4U2DA 2V03A 4WVLA 1MABB 1RHJA 2YMLA 1H1TA 5JH7A 2IXAA 4MYRA 3AU8A 3EQ2A 3INRA 2I34A 3YASA 1T0UA 4HNAA 4DN6A 1TJPB 3FCOA 1MG5A 1A7KA 3GRCA 2JFQA 4WLNA 1G21A 1GA6A 3IRUA 4ZO4A 1TEZA 2CDNA 4E5MA 2X9LA 4LHVA 4C9BA 4KAFA 1JHZA 3PXCX 1DEOA 4R3WA 3WQRA 3DE7X 3LC2O 5BN3A 1CUUA 5H0IA 3IUQA 1NSFA 1VLJA 3G79A 3GZNA 1BHJA 1V4BA 3UCEA 1RSZA 3RAJA 3VC7A 1BU5A 3WMEA 1MX3A 3VHRA 1YULA 1TD1A 3J81A 2PKXA 1MLDA 2OZEA 3AVYA 4Z9BA 5AVOA 3ZCRA 1NTRA 3CGGA 4YRMA 5KMGB 3C6MA 2WY2D 5K05A 1Z4PX 2FOXA 2G40A 1YB6A 1A8QA 2WSYB 4IICA 1U04A 2I4NA 1BMDA 1O4WA 2IP1A 2A9FA 2IYFA 3PE3A 5I7UA 1MT3A 3PHJA 4Q4CA 3THXA 3HO1A 2QF7A 4R2XA 4NNPA 1B8VA 3EF3A 3EXEB 4CUZA 1HSOA 1TVCA 5TF4A 2W2LD 5CLJA 3V8BA 3OCWA 1K86A 1YRAA 3TVDA 2NQ2C 2VF5X 1H5QA 2BGMA 4J3FA 4E7PA 4DB4A 5BWBA 2F64A 3CF6R 3EVBA 4L3OA 4N9WA 3MPUA 3SBOA 1PJZA 2AN1A 4OX9B 3AEKB 2J9FB 2O2IA 5D86A 2JD2A 2VUHB 1VYUA 3DAFA 4NG5A 4R1NA 2VPZA 5ABPA 2YYSA 4UBKA 3T95A 4D3ZA 3AEQA 4FOPA 2ZBPA 5DP1A 2UZ0A 2L2QA 3EPKA 2X0EA 1QJCA 2MWMA 4G23A 2PD6A 1FPMA 3SC6A 2Q0QA 2RKOA 2Y1KA 3KVOA 2J9XB 3KJFA 3R4CA 4NG4A 4CUKA 4REOA 2AG8A 5B58C 5IUNC 5J4VA 3EB9A 4P4UA 2NU6B 1F51E 4HRYA 3P4XA 5T4FA 4MAMA 2AZMA 1DC7A 4GKAA 1NZJA 1QHIA 2HU8A 5CLQA 1T2FA 1E5QA 2E85A 5K2MA 3ZE9A 4DDTA 4UVIA 2XQGA 5F2NA 3IEXA 3FH0A 1DRKA 4X71A 2CXRA 2HJSA 4Y2HA 5FV4A 2DEUA 1FRQA 2EL9A 1ZVKA 1Z8NA 2VJAA 4U5QA 4F21A 2QX9A 3EIXA 3U7RA 1QNLA 4WFKA 3GDWA 2PAFA 3RR2A 1MC5A 3CEJA 3OE5A 5F73A 4J1NA 4A3SA 2FR8C 3QBTA 5LQRA 4MHTA 2BEKA 2YN0A 3S2UA 4JKOA 3L5KA 3ZU2A 5BV8A 1LZLA 2GAIA 2VEOA 2WRZA 1SCIA 1B00A 3IQEA 4WGGA 3PT9A 4OHYA 5JVDF 4NBNA 1D2RA 4TSKA 1C1YA 1CULC 5EPOA 3N8KA 1XN4A 5LSAA 3PEWA 4X90A 3ZHVA 2X0FA 2V0NA 5D1HA 1H8HD 4ZZ2A 4UAVA 3ZWBA 3ZGZA 1K7YA 1MPTA 1U0RA 3LT1A 3KX2A 3FLEA 1XEXA 3LVFO 2D5BA 2CGEA 3CX3A 5C51B 4X65B 1Z73A 4TUYA 3EGVA 2OILA 4DILA 1OF1A 2PGJA 4GW3A 4JU9A 1JQKA 2LDXA 4YAKA 4XX0A 4TKLA 2JAHA 1N6NA 4EKGA 4IYJA 3EVAA 3TQQA 5IDQA 5JJKA 1X1TA 4KODA 3UT5B 1U0NA 4EKYA 1CZRA 2PYIA 3WE7A 2YVQA 3M89A 5I47A 5DX0A 2C77A 4G9BA 1TCBA 1FMLA 1RR6A 2D54A 1E7MA 2IA5A 2P2CA 2ZJFA 3Q7QA 4A8PA 5TB5A 1E1QA 1BE6A 2H92A 3QFCA 2X76A 2H0RA 3QM1A 3ZLVA 3GFSA 4BZQA 1E32A 1AS0A 1OTYA 3WQQA 4G8DA 5ALZA 2PH7A 3NDIA 2X40A 3FTPA 4TLAA 2OC9A 5KAPA 3V4VB 1XE3A 5AW7A 4P83A 1YRBA 1X92A 1NUAA 1GITA 5B5SA 3T4EA 4M36A 3AB3A 4B2IA 1DIRA 3RSCA 5CXSA 1TX4B 3CWQA 4F6RA 1I2BA 5JHHB 5JXGA 1T5LA 5EQFA 5LBUA 1Q14A 3K30A 3SE0A 4ZGWA 4X97A 5BW6B 3OTOB 1N32B 3QA9A 3GARA 1OIWA 5K0NA 5KVVA 4R9NA 5JHGB 5B1SA 5M3BA 2YCBA 1HX7A 4B3FX 5DULA 2JBAB 2P75A 1JG6A 2J3QA 3AUJB 3OQMA 1FP6A 1CNEA 2GDJA 3Q88A 4MA0A 3C16C 5BQ3A 1S8OA 4GNKA 4HZUA 5C9ZA 4BS9A 1UFVA 3EARA 4JMPA 2GETA 3MQ4A 1P4RA 3Q3JB 3W77A 3WMFA 5JAMA 3CW8X 1PL6A 4C43A 4QJ3A 2YKGA 1HNNA 1Z6XA 2VRCD 4L7QA 2IF2A 3OY7A 1NQVA 3BHMA 2PMEA 5JSFA 2MYUA 1U28A 3O31A 2J32A 3B60A 3VSEA 3KKZA 5CJPA 2XGMA 1UOQA 3TQRA 1CZOA 3O9MA 4G0NA 3NC1C 1DZIA 1JFLA 4QECA 1U80A 4HRXA 3BMNB 4DMRA 2WUVA 3UOWA 4EYKA 2I2FA 2DR3A 3GJ6A 1VBNA 2QRZA 3QEOA 5IAOA 3I62A 1G2PA 1CJUC 1QXSA 1D03A 3RHTA 3BK1A 1I5OA 3LO8A 2NSYA 3P9YA 2POCA 3Q5GA 1SR8A 4NF2A 5TSDA 4AXXA 2XYPA 3MTDA 2OUKA 3ZWWA 2Y1OA 3PUHA 3MHTA 4AD8A 4BECA 3D7SA 3ZJ5A 4HAIA 2BZ0A 3C3YA 2QLMA 3B70A 3UJ6A 1SULA 4UM9D 3T9AA 4QELA 4RH3A 3VU9B 4ZICA 3G0HA 3CJTA 2CYCA 2YV1A 4UU7A 1QU2A 2VPXA 3AOGA 2DU8A 4B4KA 4G4GA 3DZHA 3SXUA 1GGKA 4CCSA 3N0VA 2PUCA 2LTAA 3SN6A 4CL8A 5LQDA 3Q7SA 3OC0A 4H7FA 3I72A 4TXNA 1DQPA 1CLUA 3AY7A 3O8OA 2X42A 2H4YA 3X43A 1ITZA 1VG9B 4EL0A 4IDOA 1WVMA 3B89A 1Z7EA 4DEYA 3QY9A 1M0EA 4UOQA 1A4XA 2YASA 1BXZA 5LJLA 2BJHA 3GDOA 4RBNA 4P2BA 4IJQA 2IFTA 3KQKA 1T3LA 2ZKLA 4X61A 3DGFC 3EUAA 2JRCA 1F2TA 3UXEA 4FWTA 4YT2A 1W4LA 2GFHA 5K3FA 2AG1A 3TE7A 2GXAA 3WYDA 5LL6P 5BWCA 2CSXA 5BSVA 1AURA 5DYTA 4EB3A 3OQJA 1F14A 2A57A 4ILEA 1NRWA 2HQOA 4IGIA 4MMZB 1TPYA 2GHTA 4XVRA 3KZVA 2VRWA 5SZKB 5U1PA 3W2FA 4EVIA 4YV2A 4DR6B 4GPBA 4UVGA 1RM0A 2EGGA 1OKKA 2RBKA 1JPVA 3A1SA 4DS3A 4MOWA 2HA2A 4Q1EA 4BN4A 1EXWA 3RYHB 4XE5A 3O0DA 2HL6A 1KWKA 3ELBA 2P79A 5D1NA 4B17A 4EITA 3RVSA 3HDQA 2X8JA 3I83A 1IDOA 1VYVA 1RQGA 3B6ZA 3MAAC 4L3VA 4PC2A 3BIJA 1XQYA 2NU8B 3ZN2A 5JS6A 3L8GA 1TAGA 2A9VA 2J9RA 2Q5CA 2LGJA 4MWGA 4ZI2A 4DJDC 5BN4B 3EY9A 2HWYA 2QMUA 3JY6A 4R6WA 3KPUA 4LWOA 2VTBA 3KJXA 4XYEA 2FJ0A 3TN7A 2I6XA 4UMFA 4ZVQA 2O05A 4M1QA 2P6OA 1JZTA 4OP1A 2ZVQX 4B6FA 4M1SA 4Y6RA 4I4CA 1W2WB 3JWEA 4MUHA 4RUKA 3VSBA 4US1R 3WC4A 3QJGA 1WXEA 2W2OA 1KRWA 3HJUA 3IHLA 4KH0A 3D3WA 1W1WA 4FFSA 3P2YA 1V8BA 3C6BA 4D0LB 1OIVA 2VZ8A 1ISRA 5EZYF 2AJTA 4JLMA 3S2IA 4GOMD 4MPPA 1S2GA 4ADSG 1L7QA 4MYHA 4YMHA 1IY9A 3K0KA 2BT4A 3JTEA 1KJWA 4MMYB 4R2IA 1B3BA 4PFKA 1JYFA 1OV4A 4P53A 1CIVA 3EVGA 2KX7A 2BVNA 5A05A 4B09A 1C7ZA 1ORRA 1KNXA 2F1HA 3K0AA 3UQZA 4AY4A 5E1DA 2IBTA 5HNKA 1ZEMA 3DEJA 2HJ9A 5GP1A 5TPWA 1AMUA 1G5QA 3ZE0B 1C4WA 3ORQA 2QRKA 2WIKA 3DTTA 1B14A 3SKYA 2NQ8A 3AL3A 3D54D 3EZYA 3K3PA 4H27A 1ZVMA 1WZCA 1AMNA 1IG0A 4ZEOA 3AHHA 3WLAA 1T1SA 2JIPA 3OD5A 1B7GO 4XUDA 5A9SB 1M7BA 4Q1AA 3IP3A 4KFUA 1UMDA 3KL2A 2O4UX 3K96A 4MJLA 3MSCA 4DIDA 4IJKA 5B36A 3QYPA 4G97A 2UYHA 3CUWA 1KZ9A 4H1VA 4LRQA 4D96A 5FH9A 2VCHA 4DQUA 2ZYUX 2MSCB 1SPBS 1QHFA 3TCKA 1BN7A 4G25A 5FPYA 2J59A 2Q9AA 3KKMA 2Q27A 2NU7B 4GGOA 1JBEA 1JW9B 3R7AA 3FDXA 3DLHA 2PSFA 2PUAA 1E79D 1ZQ9A 2NT4A 2VOEA 4L4YA 4QFBA 5KOHB 2XDYA 2DWCA 1GL9B 3CG4A 4ENPA 5AM3A 3HN6A 4KO4S 1EX7A 2WM2A 3W05A 4QPPA 5CEFA 4QYXA 2WHRA 3CX4A 3F7MA 3CU5A 5K8TA 3L0DA 5LM3A 2C2BA 2CJFA 3NB0A 1G7SA 1WAMA 3OQIA 3N2ZB 1UFQA 4FYMA 4IIHA 1GSOA 1C7FA 4LRTB 1C7QA 4N40A 1U8TA 3W06A 3X1KA 2Q50A 1PWEA 1MDFA 5DBFA 5ETJA 3LT5A 3B53X 3VH3A 5IEJA 4YAUA 1ZGJA 1CCWA 1Y7LA 2CF6A 4HDKB 1UR5A 2H6EA 4L75A 1FMTA 2I6GA 4B34A 1XJ0A 2IYOA 4AJJA 4BFUA 2XOKD 1EQ2A 2WWIA 4Y6QA 4YFVA 1MTZA 1W76A 2X8WA 4JUAA 1ZM2A 3PG5A 4M0CA 5ALTA 3ED1A 1R4NA 4EJFA 5ADVA 3U44A 1R9NA 3N2NA 1D2EA 1RRPA 3AR9A 4FX2A 2BM0A 1M2FA 2G9VA 1LLFA 1UODA 2P6UA 2VDWA 2A14A 4ROSA 4MDHA 1Z33A 4BFZA 3FHTA 5E0KB 1KJJA 3HLYA 1D1TA 3PPIA 1XCGB 5IULC 1TUBA 1H2RS 3GT3A 3MM4A 1U28C 1CUYA 2HDOA 3NJ8A 4P2GA 1NYRA 4PG4A 1L5QA 3EZLA 3EH1A 4HB0A 2HMUA 2IYEA 2WNIA 2R6HA 3ELUA 1DU4A 2H17A 4DOMA 2WAYA 4YUZA 2WU4A 1N2CB 3ZIUA 1GTZA 3G8AA 2P91A 3IT3A 3IQDB 3FDFA 2VT2A 3O2JA 4R3NA 4X5OA 2DP4E 5LLTA 2A1UA 4B3DA 3PRHA 3E7XA 4JLKA 2D1YA 2PZMA 2XLBA 5JANA 3E7PA 3MPOA 1DX9A 3O8LA 4LYFA 2BGRA 3TKLA 2QQGA 2FZGA 3T94A 1JEJA 1QFXA 3BRQA 3FOZA 1ICEA 3STUA 4ZGGA 2V0CA 4DR2B 1Z2NX 1KO1A 2CLDX 5KTMA 3WBFA 2C5SA 2BCGY 2C5EA 5CT9A 2HHLA 1T36B 1YQDA 4Y1RB 1ORWA 4RMGA 2BEVB 1PG5A 1VC2A 1KQNA 4BJ6A 3RAEC 1LF0A 3E81A 5JE8A 4JYCA 3D2LA 4CCYB 4QGGA 1RHRA 1OZHA 1Y1LA 1QO7A 3AV3A 3NDPA 3W0LB 4W5NA 4NP6A 1ISJA 1VCHA 3OZFA 4GPEA 4MPJA 4RDHA 3RC9A 5AW8A 4YP7A 3FCCA 4YFYA 1YOVB 2PAAA 1TKRA 2ID9A 1X3LA 3D43A 3AEUA 3V4OA 3IO5A 3PI6A 4AMUA 1T9DA 4GEGA 1UDXA 3IJ5A 1OZGA 4EG1A 5K8VA 1Z5UA 2I33A 4EUNA 2X4GA 3WJ1A 2NX2A 1V8PA 2OXTA 3AKDA 1ZCBA 4K86A 5JJLA 3O4RA 1P2GA 2BMEA 4R0MA 4FZJA 4JEMA 1UXJA 1EMDA 4EI9A 4Q01A 2GERA 3OJOA 4DIKA 4C1BA 1K08A 1N1GA 1HYHA 2H7CA 5KWVA 3LNTA 5EZYA 1MOQA 1LQTA 2OCPA 3OMWA 5HPYB 2ZLBA 4PWZA 4P31A 2JVKA 4BO4A 2VFAA 5EJ2A 4H4EA 3IEUA 3KHKA 2PZBA 1YRWA 2Y1WA 4GXNA 5BMVB 3LD9A 5JT1A 5FBRB 5SY4A 1M10A 3VYTB 2NG1A 4Z0HO 3AWDA 1FQWA 4CMIB 4JNKA 3WLEA 5IU6A 3O8BA 3C6QA 5CK5A 4OGKA 1QHGA 3M3DA 4YMTA 3TG2A 4GPTA 2FZEA 5JAOA 1DADA 3G0OA 3WISA 1E1NA 4TLLB 5G3YA 1Z3CA 1XA3A 2P41A 4G85A 3P45A 4RJLA 4A5SA 3ZQUA 5KU7A 2GPJA 3PEVA 3S1AB 2WJIA 2O3QA 4B48A 2IEDA 4FK8A 4IOLA 5CDFA 4DR7B 1R5OA 2DFVA 4C0XA 4PLVA 4N3BA 3W79A 4OYHA 2YDYA 1YVPA 5FO0A 4Q6WA 1R8YA 2XW6A 3KPYA 4YALA 4F1KA 3LBHA 3S2SA 3JWPA 3IT0A 4D6XA 5DOVA 2W48A 4KPUB 1CEXA 1JVSA 3IA7A 2YINC 3PKJA 1G8FA 4ZYLA 1ECPA 2PO7A 4JN6B 1M1YE 3UFXA 3GDFA 4QPJC 1NNI1 2O2XA 4Z6KA 5C7LO 3OZIA 3NBQA 3TW8A 4ZJUA 5ALVA 4ZREA 1JUDA 1NJ2A 3GNQA 1Z4NA 2AMFA 3W5AA 2HA6A 3EBOA 5CAEB 1LKZA 3ZHYA 2ZSIA 1TO2E 4B7ZA 4GLFA 1I3KA 3UCXA 2QN7A 1KZHA 2W0SA 3OURA 4V0NA 3U37A 2WR8A 4F8JA 1Q19A 1X86B 3AI7A 3ODGA 5EHIA 1PNOA 5LA6F 1GPYA 5A3QA 2WB2A 4JXZA 4X1IA 3AFNA 3DDHA 3GVPA 2ZIAA 3NANA 2EFDB 3WMXA 4LJAA 2GBIA 2ZS9A 3TUZC 2I2DA 4B81A 2HYDA 4MWBA 5A3RA 1TYZA 3BPSA 3GWZA 5HX7A 5FYQA 3ZEAA 3FYUA 2VAVA 4FDLA 4QOIA 1RCTE 3CF4G 4C0HA 1X0XA 3L41A 2W2TA 4YB8A 1H2HA 2PS9A 3A7EA 3U9LA 1P1HA 1CY0A 2E2WA 2C3MA 3BQNB 1LPOA 1N5JA 3DHVA 4FMPA 4JLDA 3L7MA 3A28A 4NZNA 3SEQA 4IGAA 4IV0A 4DLAA 1R64A 2ZIVB 3O1LA 2C83A 1E4OA 2IEZA 3K4HA 3P32A 4OXXA 3RWBA 3UATA 1GPKA 5EIXA 3M49A 4GMKA 1E0DA 3SX4A 4BVGA 3DV0B 3W9SA 3LYLA 2R8OA 3QKIA 5ALNA 4LE0A 4DMUB 2XRZA 2GJAA 3QHAA 1NVGA 1X7WA 1F1JA 2ZRGA 2Y9MB 3ZC3A 2QLBA 4EFKA 5JD3A 2WE7A 3CRQA 1SCAA 1ZKDA 2CFSA 4EYSA 1NW3A 5EWLA 1BQ4A 1II8B 4P86A 2G4VA 2NZXA 3KAPA 4FJ1A 1PGPA 1XELA 2Q49A 4BBZA 3MTGA 1M2KA 1N5OX 3HADA 5EERA 4LVNA 2QS9A 1DQSA 1E0SA 1Y4AE 4WZBA 3R7FA 1IOWA 4FN5A 3SR3A 721PA 3HR7A 5KYXA 1YGYA 2IYSA 3S28A 4DC9A 1L9KA 5FPPA 3GEIA 2NUTA 2ODWA 4MVYA 3ZY5A 2ADOA 3T9FA 3RO7A 4JX8A 5KSOA 4IIGA 2IHVA 1GTVA 3EIOA 1LJUA 3UJNA 5EUMA 1KTVA 4LXYA 4JWKA 1ZMRA 3ZWDA 4EJMA 4ZHSA 1Z6YA 3NHSA 3EK2A 3INGA 3ZQJA 5IJ9A 2P8SA 3QOFA 4O4IA 3VJKA 1IXKA 3JD3A 3HCWA 3MWYW 4B4OA 2WVJA 2J41A 1E9DA 5E2AA 1EKXA 1ENPA 2HV9A 3LGXA 5FWXB 1I4WA 1XZGA 3OKPA 3KQUA 3T5PA 3H2KA 1OPRA 1SKUA 2BUBA 4HDMA 5CVDA 2IU0A 1AIPA 1VDMA 1HH4A 4ML3A 5FORA 1OFVA 1OFUA 2ZU6A 3S55A 4ACBA 3VO2A 3HL0A 4U7FA 2NXWA 1KL7A 1IXZA 5EP4A 2YWEA 1FUYB 2IHYA 3R2JA 2QUKA 3UWOA 3KYJB 2XCQA 3WTCA 4MUEA 4EGCB 4O2BF 2IJGX 4OHWA 5DI9A 1C9JA 5KTRA 1QGOA 4ARZA 1I1OA 3C24A 3CGWA 5EIBD 2HXSA 5G4KB 3DAYA 1QWOA 1OFIA 2JGDB 4CM9A 2ACWA 2FPKA 4I4IA 4L76A 4PSKA 2IX9A 1G9SA 3W8RA 3H17A 3R3UA 2BFFA 5FUBA 2WABA 2ZDGA 2JGMA 5SYNA 3I09A 4GOOD 3CZ9A 5B57C 3K2BA 3KUCA 1C9NA 2YJ4A 3KR9A 3S7ZA 1KMHB 4A2QA 3M6LA 1PV4A 1N2CE 2O52A 1YDWA 2GXQA 3PFHA 5IVIA 2HNAA 4LN1A 2JFUA 2ZT5A 3CCCA 4E2FA 1NVVQ 4NICA 1ZONA 1LBQA 5DLQC 3RWOA 3PC8A 1Q0QA 4M8NE 3O2NA 4YXWD 2I4OA 2XNSA 2ZS7A 3U4QB 4KZKA 4DCOA 5KTYA 1LSJA 4OLFA 4ATNA 5ALLA 4MYCA 2LCQA 4N3NA 1XUOA 1IDN1 1KA9H 4AP6A 3I5UA 4BFCA 3GUZA 1KETA 4MQBA 1FX0B 1VLVA 2BJVA 2G80A 5C8XA 1UMKA 3VR1A 1FXUA 5CXUA 4IWYA 1XZAA 3D6AA 3I73A 5E8JA 5IYZF 4E14A 1EVYA 1KYIA 2NTJA 5HF9A 1ZNZA 1OX6A 4JJ7A 2Z2YA 4MIOA 5KB3A 3TJZA 4PV7A 1WDMA 2H48A 3PCTA 1K5GA 3UWKA 2IXDA 1KIAA 3LA6A 4F5ZA 4L0QA 1J09A 1PYOA 2Q0HA 2QMYA 4RE6A 4YBRA 3UHJA 2A7XA 3LFTA 1BMFD 3PZBA 1JHAA 4RKYA 5F77A 4RIHA 4REQB 5EKXA 2FFRA 4GAEA 1V16A 1YB5A 4L2IB 4Y2RA 5JWHA 3RREA 4B6RA 2VDVE 3M6FA 3EZ6A 1M2JA 1PWHA 1ULHA 2XF8A 4M7RA 1KAGA 1QR6A 5DGXA 4RXUA 4M83A 4PE5B 1MB0A 5LIPA 5LA6A 1WXIA 1COWD 1ML3A 3MWKA 4KQXA 4MV6A 4OXKA 3TF5A 5A6SB 1T0PA 1E2DA 4D92A 3T1OA 5DHRA 4IGEA 5HFJA 1KK3A 2ZR9A 3ROZA 3E22B 4I2VA 3WV4A 1X1EA 5EN4A 4S04A 2OR3A 4MVJD 1YC2A 4R41A 3HFSA 3I52A 3CEMA 1CR4A 4RMHA 1LTKA 4FEGA 2N46A 2YIMA 2ZYAA 3E35A 4Y2PA 2RGCA 2W2QA 5JR3A 3AERA 2NXEA 2OPHA 1OASA 4B80A 4E09A 5JC1A 1KVTA 4LECA 4FXOA 4XYMA 3D1LA 5AK5A 4C4TA 3OT1A 1ZFNA 4YWHA 2BFEA 5LXTF 3K92A 4J7AA 2WP8J 1CP3A 1L5OA 1JQ3A 3ISVA 5K99A 2JIBA 1CY4A 1XD9A 2W11A 3RIMA 4PONA 2JHAA 3KEOA 2PSSA 4FS8A 5T3YA 1F4VA 1XTUA 7AT1A 1W96A 2ZJ3A 3UQYS 3KAQA 3QOWA 1E0KA 3H4TA 3HR8A 3MMSA 5EE9A 1T9GR 1E2MA 3GFVA 3O4GA 5IJ0A 2W37A 3R3SA 4EY8A 2CVFA 3FYUC 3S1SA 1DC4A 1WE2A 2IYWA 5DTJA 2RFLA 1BEZA 1RYZA 4TL9A 5IG2A 2IUYA 3IBYA 3LIPA 4HK4A 4D9MA 4GGMX 2B4QA 5IARA 3OTQA 4X62B 3VHXA 1PLJA 2AXNA 1Z18A 2JGAA 4JC5A 1WL8A 4OMCA 3EF0A 4TKUA 4DMKA 3IAM1 1B1AA 2EP5A 4TS4A 2JLUA 5FI0B 1IQPA 1N2ZA 4YV0A 1WPRA 1VJ5A 2C2HA 4PC6A 2F3TA 1F17A 5K8IA 1M5RA 2WKWA 1L4MA 3B1KA 3DDWA 3F5FA 1J9ZA 1WMBA 4B47A 1Q2XA 2FWBA 1P4GA 2HLDA 3S6JA 5KZMB 1Y3CE 3KB2A 1M0SA 1NBAA 3LUBA 4ITVA 4JOBA 5HKKD 4Q39A 1TUIA 1KEEA 4FQ8A 4C14A 4RH0A 2G06A 5IXYA 1NW8A 3LF2A 1E9BA 4MKGA 1JXQA 3U81A 1WBDA 1U0TA 5H80A 1P8AA 1C1XB 4C7KA 1Y7TA 3B9PA 4HO1X 4BMSA 1OR8A 4Q7MB 3LPLA 4IUYA 4UULA 3UJDA 3I1FA 1VECA 4L50A 4HC4A 2P6MA 5EXPA 3MMXA 1ZNWA 4OB6A 1J0DA 1QNFA 2EIXA 4RNDB 5DM1A 4C21A 4BGVA 4NPCA 2PT9A 3U7QA 4B8WA 5BVGA 4LX0A 3E7DA 4TS9A 3CH7A 3A6JA 2GPYA 2IIVA 1CY6A 4HDQB 4I3HA 5F1PA 3DQPA 1TKBA 1LA2A 1H3NA 1C0LA 2B4RO 3AZPA 3PYLA 4LVUA 4Q82A 3FOFC 4GP6A 2UYYA 3QXCA 2QUIA 1VE1A 2OCYC 4OGWA 3UXMA 4A27A 1FS5A 1VP9A 4BFXA 2F67A 4ZFNA 4CLOA 1XAHA 1FU7A 2Q29A 3AC0A 4PZDA 1XQ9A 1YR7A 1IVYA 4ZEVA 2R1VB 3UWMA 3WLHA 1U7HA 3F90A 4OFBA 4FHGA 4CKEA 4LGVA 3ROTA 2J0UB 3LDAA 5BYKA 4EHKA 2YV3A 2Z8YM 4EJSB 4DLVA 1HLFA 4KN6A 3EQ8A