3A1VA

Crystal structue of the cytosolic domain of t. maritima feob iron iransporter in apo form
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
254
structure length
252
Chain Sequence
HMVKVALAGCPNVGKTSLFNALTGTKQYVANWPGVTVEKKEGVFTYKGYTINLIDLPGTYSLGYSSIDEKIARDYLLKGDADLVILVADSVNPEQSLYLLLEILEMEKKVILAMTAIDEAKKTGMKIDRYELQKHLGIPVVFTSSVTGEGLEELKEKIVEYAQKNTHRMILDYGEKVESEIKKVENFLRDKKLRINPRYFALKYLSGDPEFYSEGVKLGLPELSEEERIGYRLLIAKRKREYVENVVKEAFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of novel interactions between the small-GTPase and GDI-like domains in prokaryotic FeoB iron transporter
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transport protein
molecule keywords Iron(II) transport protein B
total genus 87
structure length 252
sequence length 254
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02421 FeoB_N Ferrous iron transport protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3a1vA01
1ZP6A 1SVWA 3NXSA 4JJKA 3VAAA 3W3ZB 4AKHA 1P72A 4RZ2A 1JALA 3I61A 4KBGA 4EQ6A 4RKFA 5JRZA 3NKVA 2AXPA 2LKDA 2Q0HA 5JSZB 2QQEA 1RPZA 1N6OA 2WJIA 2QORA 4LPKA 4NONA 1TQ4A 3FPAA 2BC9A 5J47A 4EPVA 2BM1A 3L8ZA 4B75A 2ZSEA 3E2IA 5AJYA 1Z22A 1U9IA 2WWGA 2RGBA 3RRZA 2GZHA 1E4VA 1W4CA 3EAQA 5J40A 1MH1A 2FFHA 4LBYA 2KB0A 1EFRA 1E9DA 5HCNA 5JSZA 1E96A 3QKSA 4DUGD 5DNYB 4Q4JB 1CR0A 3ZVRA 3FMIA 1U8ZA 4IOKA 3U3OA 2ZM5A 4ERNA 1XTJA 2QE7D 4AG5A 4E5UA 3LVQE 4Q7LA 1QDEA 3CWZA 3SYKA 5AUPB 4ZO4A 5TV2A 5K8IA 4JVMA 4OK6A 1E2DA 2WSMA 2Q9AA 3LV8A 1JQJC 3TUJC 3KKQA 3CZPA 2VP2A 3DM5A 1NVUQ 4QKQA 3TH5A 2Q3FA 1FP6A 1K6MA 5IK2D 4OHWA 1SULA 2NO7A 4ZCIA 4R9UC 4MGZR 2FG5A 3BXZA 2L0XA 5LB4A 1KSGA 2C8VA 3O47A 2QAGC 4KVGA 4RCYA 2QQ0A 1I4LD 1TUIA 2EWVA 3IILA 3P20A 3DKVA 1N6PA 4Q18A 4P32A 1DE0A 5DHAA 4QM6A 1COWD 5EZ5A 3RNLA 4I81A 4JL5A 3ADCA 1IN8A 1BO6A 2JATA 3K70C 2XJ9A 5CK4A 3TJZA 4LI0A 2HJVA 2R6DA 1W7AA 2TMKA 1Z07A 2BBSA 2OT3B 3EW9A 2GAOA 3O8BA 5F2EA 2V6IA 2JLZA 4YMSA 2HT6A 5FPHA 3LA6A 5DGXA 5IK2A 3NHBA 2O8FA 2IA5A 3NBZC 3ND8A 2BOVA 3HR8A 3U3RA 4RSGA 4ILEA 5AUOB 4GMDA 4GRAA 2H8KA 3F3YA 2ZAMA 4Q7MB 1GITA 4URYR 2VH5R 2QUZA 3HU3A 3DM9B 2ZYTX 1R4AA 2G0NA 3SYLA 3TQFA 2BKEA 4RZXA 2ONKA 1JR3A 1VECA 4QJ4A 1WRBA 3SJAA 2HLDA 2PT7A 2EFHB 1NLZA 1KNXA 3PUZA 5A0FA 1OT3A 1KI4A 5CLLA 1E1RD 1AM4D 2JJ1A 2HV8A 2ZEJA 2J7PA 4HUQB 4TT3D 3ICEA 1E2IA 4TN1A 3OFNA 4LC0A 4D4MA 1LS1A 4OQXA 3VR3A 1HH4A 3ZLJA 1CIPA 2ODWA 5TXGA 2XNDA 4OK3A 1ZM3A 3Q7PA 3THOA 1BS1A 2C9YA 2J5XA 2N1BA 5BXQC 1A82A 1XXHB 1E9SA 4PZZA 3CRW1 3BH7A 4EQ6B 5CYPA 3LLUA 2CHVA 4RD3A 3ZZUA 4X8LA 2O0KA 3FHOA 1W4AA 4MDEA 1NVVQ 3AVTA 1R10A 1J70A 1Z6TA 2CK3A 2Z4RA 5EP3A 2CHQA 1JR3E 2KWIA 2P6NA 5M04A 3SC3A 3T1QA 4IJMA 2G6BA 1KYIA 3FMPB 2HCJB 1M7BA 1R8QA 4A4DA 4FXPA 3LQQA 1JAHA 2RGNA 3GFOA 3MWKA 1X86B 1A5TA 1U98A 3B7GA 1RRGA 2ZYVX 1OFHA 3PITA 4OHVA 4TYQA 5DO9A 1E0SA 5CLQA 2QEQA 4PSKA 3ZS9A 1NN1A 1KI7A 1SXJD 1J2JA 5CIQA 2R65A 3QQ5A 2CVHA 2EYQA 4IXMA 4V02A 1OKKA 5A5GA 2QAGB 5DYGA 1WP9A 1MT0A 3GLFB 1GL6A 3QI2A 5FTNA 2VRWA 1QHXA 1P6XA 2VHQA 1DO0A 4NYJR 2ZPTX 3DHWC 4TTQA 2J1LA 3TAHA 2QM7A 1N5JA 4QBIA 2WPDD 3EZ2A 2J45A 4MITA 4NCKA 1RC8A 1SGWA 1GUAA 1QRAA 1GFIA 2VHJA 4G01B 4QM7A 3AVVA 1VG1A 3RS2A 4A0GA 1ZD8A 2PT5A 3M0EA 4IDHA 4AD8A 4MUAA 4C0JA 3P27A 3CM0A 4EAQA 2SHKA 1G7SA 4D82A 3KB2A 4WIAA 2JIZA 1R8SA 2WIAA 4PHHA 1VKJA 3BBPA 4NYMQ 4US2R 2ORIA 3GCGA 5G53C 4LYJA 4MH0R 4KITB 2KE5A 3A1VA 4QBGB 4BUJA 3T61A 2XX3A 3UANA 5HKKA 5BYKA 3K0AB 3NC1C 1IN6A 2ZRKA 3L0PA 4B3BA 3W6NA 1XX6A 4QHSA 3EA0A 3NTUA 1E1QA 1U99A 1Z6GA 3Q5EA 2RCNA 1G8PA 3W34A 4IRUB 1G7RA 2IYXA 1TQ6A 3U7HB 1P4SA 3WMEA 4IXNA 3HP1A 1E0AA 2VSFA 1DAHA 1CJTC 2EU8A 2FMXA 2W6JD 2AR7A 4H1VA 4A2QA 3NH9A 4BLTA 2A30A 4TTPA 2YOGA 5KDDA 3NEJA 1E79D 4JIMA 3NBYC 4ZPXA 2WTUA 3WY9A 2DWQA 1W0JA 621PA 3PEVA 1VIYA 4XTCS 4N3NA 4PO1A 1QHYA 3AEZA 3SR0A 1CJKC 1FQKA 2YWGA 2J0UA 1SQ5A 4OI1A 3U5ZB 3RYTC 1FW6A 2HJGA 3EC2A 3H4MA 1TQ2A 1JPJA 4LSGA 4DSNA 1L2TA 2B6HA 2UVQA 4BRWA 3QXSA 2FSHA 1Z0KA 3BE4A 3K9GA 4M53A 5KSOA 2W58A 3GJ4A 5FR2A 2H1LA 3NWJA 2OXCA 3SEAA 4U5XA 2ZRMA 1GOTA 1IJFA 3AQ4A 5KUTA 1AIPA 1KO1A 2GETA 5J5CA 4G5RA 2ZREA 3R20A 2YINC 4C0HA 4DB4A 3L82B 1PLKA 3MLEA 4DIDA 4PO9A 2ECKA 3HDTA 4IEIA 4PO8A 3TR0A 1OH8A 4C7OA 3NBXX 2QNRA 2WKRA 4GL2A 1KY3A 1E1RA 2JJ1D 2XTNA 1D9XA 4FMDB 4IDOA 3CNLA 5BQ5A 1F2UB 5DE3A 3UMSA 1YR8A 3QIAA 4PSVA 1UM8A 3TLXA 1OXVA 2J87A 2GZDA 4JLVA 3HPRA 3ASZA 4A0RA 2XZPA 4B43A 4LJ5A 4ACBA 3IGFA 4CEJB 5IT5A 1XTSA 1AN0A 1N6HA 1Z0AA 4UNNA 2ZUDA 4XWOA 3JZMA 4JBWA 1UPTA 1II0A 3WRYC 3WYFA 3SJZA 1XFAA 2AFHE 3V4FA 3H86A 4UNRA 3QG1A 2EFDB 1T5IA 1NP6A 2GVDC 3QBVA 4HUQA 1G41A 2WAXA 2ZI7A 2X2EA 3BFXA 2IS2A 4TL6A 1Z47A 4NL4H 2C99A 3RRMA 3WHLA 2QGZA 1GM5A 4LV8B 3TUIC 3CRQA 2PMKA 1HT1E 3EZFA 3LLMA 1KK2A 3Q5DA 3B6EA 2ZRAA 5F9FA 3VR4A 3BB1A 1HY3A 2P2LA 2O8BB 4EIWA 1BYUA 1M7HA 1P61B 3LBHA 1DBSA 2ZRGA 2RHMA 4AURA 4DEXA 4DLVA 5FPSA 3KQHA 3O8DA 4XJXA 2FN4A 2F3TA 4PAQA 3I4LA 4LHXA 4PTLA 4ZCMA 3THXB 2VSXA 3GLHA 1LF0A 5E7JA 3EPKA 5FL3A 1TU4A 2VBCA 2BMJA 3BK7A 4WXPA 1E2PA 2FH5B 3O8RA 2BKUA 1IN5A 2G83A 2QRZA 3K0FA 4KLZA 4XSHA 1XCGB 3A6PC 1KZ7B 2ATVA 5L8VA 3ECCA 3DEFA 5GJWC 2CCGA 1N6NA 1QHHB 4Q1BA 1W47A 2H57A 4C30A 1E0JA 3A4LA 2IEZA 2QTHA 1SVIA 2GJAA 5FOUA 2F1HA 4ZDJA 2OILA 1E1QD 4CGZA 1TPZA 1GRNA 4JLNA 5HR5A 2QAJA 4URUR 3R9XA 1KY2A 2IYRA 2DB3A 1GILA 1L7VC 4JJZA 4KBFA 1DADA 2W2XA 3SHWA 5FUVA 1L4UA 2A9KA 3NIBA 4WZBE 1IY0A 2OE2A 5GVRA 4BRUA 1YZKA 3GLFA 1T91A 4Y0AA 3NBFA 4B3GA 3THYA 2ZE7A 3M1IA 1NIJA 5FI1B 4B6EA 1GKIA 1GDDA 1QF9A 1MO4A 2OUKA 2W6IA 3KQUA 2XB2A 3U6BA 1EFUA 3GLIB 4QRHA 2QPAA 4F4IA 2GJKA 4HB0A 4LDJA 2X1VA 4LV5B 3ZD7A 2IS1A 1OIVA 2BCGY 1DOAA 1JAIA 1CP2A 3KJGA 2RB4A 1W36C 4GT1A 1OYYA 4JYBA 1E69A 3ONWA 3MRSA 4G5OA 3IEUA 1SHZA 4M1MA 4P4UA 1IHUA 4JSTA 421PA 2UZ3A 4FMDF 1PV4A 1IXZA 1XU4A 4RVCA 5D3MA 4HLUC 2IUTA 3FVQA 1N5IA 4C9BA 3I73A 2Q21A 5KNDA 3IIJA 1NBMD 2V8OA 4OQFA 1EFCA 1XXHE 3ZGXA 3B78A 4DJTA 3BH0A 4B3CA 3B9QA 2WMOB 1VYTA 3FOZA 2ZRCA 2VP0A 3VX4A 1QHSA 2JLRA 4R2IA 3LBIA 3X2SA 4A8JC 4KFUA 4BFTA 2KBFA 1XEWX 4UXIA 5TY0A 4JVSB 2OHFA 3RRNA 1RZ3A 5GJBA 1U81A 1VCNA 2F3RA 4YC7A 5FOXA 1W0KA 3TGPA 2ZUBA 3CF2A 4Q4LA 1TNDA 1D2MA 4TLBA 4IVQA 2PJZA 4M1YA 1VG0B 2QU8A 3WBKA 2V7QA 2ZRPA 3A8TA 1GIAA 2E87A 4JLOA 4NMMA 4O3MA 4DT1B 4DDUA 1TTTA 3MG9A 4JBYA 1OFTA 5A4JA 1ZM9A 1QHHA 4M8NE 2ZSBA 2Q6TA 4LYHA 3QNUA 3T1TA 1Z08A 1XPOA 2AX4A 5IRCD 3LDAA 4US1R 1KI6A 1NY6A 4XH9B 4B76A 2QBYB 5J4KA 1N5KA 2FPLA 3VNVA 1CEEA 5CJ2A 2IXEA 3KXLA 2JJ8A 2DBYA 2WWHA 1JQLB 4TZ6A 4BPBA 1KI9A 1DAGA 3U7EB 4M2LA 2GHIA 3ADDA 3K0EA 1J90A 121PA 5TARA 1E2JA 3VR6A 5JZVA 2C2HA 1Z63A 3T1OA 2JLUA 5L3RA 1G3RA 5JEEA 2ZJYA 2GDJA 5DISB 1XTKA 3SJBA 2OBNA 4I1UA 4RFSA 3GP8A 1TADA 2GXUA 5EP1A 4MUBA 4BLSA 3K0AA 3IPXA 1SXJC 1B0UA 1XEWY 3E70C 4PPFA 3T34A 4ZIRB 2IX3A 1E6CA 4MGYR 1FTNA 4ZKEA 3S1AB 4DCTA 2JJ2A 1IOZA 2VPPA 2ZE8A 3LAWA 5D3QA 4DIEA 4C2TA 3QF7A 1CRPA 3SNHA 1G5TA 3AP2A 3A37A 4DLYA 5EE1A 1I2DA 1P9NA 4QGHA 3LFUA 2DHRA 2W0MA 4WBSA 1EESA 1NMYA 2FDCA 1Y63A 3K8YA 3PEWA 2ZTSA 2DFNA 4FCWA 3SU8A 4CYMA 4URWR 2F43A 3TE6A 3RC8A 2JASA 4ASUA 3CBQA 1XNJA 4Z1MA 4B44A 1W46A 4XD7A 2ZAOA 2J41A 4C4PA 2OFOA 2RGAA 5J4HA 3GLFE 1Q12A 1ZINA 3KKNA 1LW7A 1NBME 1Q20A 4JT2A 4QHYA 1N0VC 1QHGA 4TYWA 1E9BA 3GJXC 1F5NA 4R7ZA 3R9IA 1NN0A 4NCJA 2DPXA 4E22A 4HSEA 4PAOA 2JDIA 2BBTA 3GJ0A 1ELOA 2FGJA 4CZ2A 2A2ZA 1XZQA 2IBMA 2ZRLA 5HTKA 2C04A 4MRSA 5CIWA 1XB2A 5FTMA 821PA 1N0UA 3DO6A 4DCUA 3H1TA 5HKKD 1DVRA 1TU3A 2QSYA 2WAYA 3VKGA 1E2GA 1Z0JA 2YWFA 2OV2A 2A5JA 2ZE5A 1G8YA 1RJ9B 5KO2A 2REOA 1W1WA 1T0JB 3B60A 4DZZA 2FX3A 1H8HA 1P62B 4KAXA 3I8XA 1OH6A 2W6ID 4LV6A 2CCKA 4N0EA 3EPJA 3B1XA 5JMTA 4AYWA 3F5FA 4Q9HA 2IXFA 2P6UA 1E0KA 5CM9C 4XVRA 1XCPA 3ZVMA 2PX3A 5DIFA 4RZ3A 3CIOA 1AJEA 2VA8A 4RCZA 4ESVA 5KNBA 1U0LA 4QC2A 2P5TB 3K0CA 1IJEA 4QJ3A 2ZJ2A 3KXIA 4A9AA 1JI0A 2BJWA 5HE9A 2QMEA 3SBEA 1E2QA 4HAUA 3ETLA 4FD2A 2F43B 4D4JA 3BC1A 1ZYUA 2PLRA 2ERXA 2XSZA 4HLCA 1LB1B 1NBMA 3EC1A 4NTZA 1E2KA 1UADA 1ESNA 4PHTA 1U8YA 5FUWA 1PUIA 1ZNYA 1OW3B 2RGCA 1J8YF 5JEDA 2K5UA 1ZJ6A 4M0LA 2OZEA 1KI6B 2ZJ8A 4U7DA 4BLOA 3WYGA 1YQTA 3QBTA 3PUWA 5JI2E 2VO1A 1IQPA 4NP6A 1TQDA 3I5YA 1RYFA 1PLJA 2Q3HA 1NF3A 2D2EA 1W4BA 1JXMA 2ZROA 4P4SB 1OV4A 2EFGA 4WW0A 4LWZA 1E79A 2D7DA 3EX7C 3KB1A 3CNOA 2HXYA 1HEIA 4LJAA 1Z83A 4C3ZA 4YXWA 4M1OA 5JJIA 5DYIA 5AUQA 1YRAA 4E09A 1LV7A 1D2EA 4H1UA 1KHTA 2X8AA 3LX8A 3Q72A 4OYHA 1D5CA 3PG5A 4LJ8A 4DWJA 1JR6A 3FKSA 1IXRC 1UEJA 2GJ9A 5SZKB 3I62A 1PUJA 1FL9A 4DSTA 2IYZA 221PA 5KSZA 3K0CC 4Q1CA 3RS4A 4NBSA 1P9WA 4XVUA 1RW4A 3KJEA 4BFZA 3OIWA 1DAIA 2NG1A 2QY9A 1MR3F 1KSFX 1NVWQ 3GLHE 4MRNA 5GJCA 4CEIA 4POAA 4AYXA 4LPSA 4C0AC 3THWB 1DTSA 3K0FB 2YOHA 5CK5A 5JS8A 1Z3IX 4ZI3A 1XRJA 5L3SB 1T5LA 3MD0A 5FPTA 1NLYA 5DI3B 3U44B 2ZR9A 1E3MA 1EFTA 1AGRA 4NKRA 3B2EA 4O25A 1NRJB 3HWSA 3OE7D 3I8SA 4HEJA 4JKIA 1NKTA 4GNKA 2CHGA 3W5JA 3DKPA 3QKTA 1Q1EA 3CR8A 3QPUA 3SJCA 2J0SA 2ZJAA 1TAGA 5FL7A 1CJVC 3Q3JB 1NN3A 1M34E 3DDCA 1G4UR 1OPXA 3LW8A 4NH0A 1KAGA 1HA3A 1MOZA 3K9NA 4E07A 1ETUA 1RYHA 1DG1G 3AM1A 1UKEA 4XD7D 1NJGA 2VHUA 2WJJA 1SVSA 1S9HA 2I3BA 2OAP1 4TMVA 3U4QA 1WXQA 2BMDA 1X1RA 3CX7A 1NMZA 2PLFA 4LHYA 1Z2CA 1PZNA 4NYIR 2HF8A 5JWOA 5BWMA 2IHBA 3FB4A 1GRQA 1XJQA 5FL7D 2VP5A 1KO5A 5CB6A 4BLQA 4XTRA 3WYAA 1NVXQ 3VU9A 4GSYA 1I2MA 3CH4B 1VMAA 1LNZA 1XPUA 2OG2A 4IOLA 2JGNA 2GCNA 1G3UA 3SN6A 3TMKA 3AVWA 5EE0A 2XTMA 4CEHA 1X8KA 4KFSA 2AWNA 3H0KA 3FDIA 2GA8A 2BMEA 3K1JA 1EK0A 3PENA 2QTFA 2QG6A 4DB2A 3D3QA 4H9GA 4EJSC 3RVBA 1Z6YA 5EE5B 4RKEA 2FZLA 5JJLA 1ZC4A 3X1XA 1GNQA 1P2UA 1KJWA 2HXSA 1NG1A 3QPVA 5JBQA 4QBFA 2MMGA 4V03A 4PQFA 1TL7C 1NKSA 3CRMA 1E4YA 1KSJA 5BW8A 4F92B 1NVVR 4RD4A 1NI3A 2P6RA 3EIHA 2W2VA 2OXRA 2WHXA 2IF0A 3NDPA 5E4FA 5DN6D 1LY1A 1R0YA 1I4DD 4P31A 4M9SA 2PZFA 3N2IA 2H92A 1JNYA 2WWFA 4F7WA 4F93B 1OYWA 3U7GA 4AG6A 3G0HA 3GFTA 2ZI6A 4HDCA 3PUYA 2ATXA 1Q1ZA 1KJZA 3NEYA 3WNCA 2O8BA 1XMVA 1ZM7A 1KJYA 1KI8A 2RAPA 2YC2C 5AK0A 3KQLA 5C18A 2DFTA 1EGAA 1Z2AA 3T35A 4MKHA 2XB4A 2CLCX 2P0EA 1CXZA 4RJLA 1XEXB 5EE3A 3WP1B 4ZKDA 3DZ8A 4MRRA 1EG7A 4KYUA 2AWOA 3HYRA 3V00A 3K09C 4P33A 3TVTA 4YXWD 5BN4A 4NE2A 5F3WB 2WSSD 3U44A 2BHRA 2RH5A 1IONA 1K8RA 1W5SA 1S1CA 3AUYA 3ZDQA 1E32A 3AP1A 4TSFA 3WMFA 4LJ4A 1EFHA 4OKSA 4HLUA 5K8TA 4GP7A 2ORVA 2B92A 3EARA 3D8BA 1II8A 1US8A 1MO3A 3U2QA 4AKGA 3TAUA 2AKYA 1ANKA 3BB4A 1C4OA 2WPDA 1DEKA 1DO2A 3IBGA 4FMCB 3FE2A 3HU1A 4DRZA 1U9IC 2XOKA 1KO7A 1CTQA 2D3WA 2ZSFA 5AJVB 4DLZA 5GVSA 1RRFA 2WSSA 1VDZA 1AKYA 1F2UA 2ZSDA 3AF0A 1ZD9A 2YZ2A 2XJ4A 4RD6A 4TQ9A 5TDHA 2FA9A 1KZGB 2NGRA 2ZR0A 5KYKA 1EWQA 1NY5A 4KO8A 1WA5A 3AB3A 3KUCA 5FOWA 3TQCA 2ZJ5A 4JYCA 1T4GA 5TB5A 4QNRA 3B1ZA 1S4QA 3Q85A 4QGAA 1VCMA 4CVNA 3OF5A 1ZM2A 1E2EA 1P2SA 2GEDA 2PZEA 2PZGA 4TTRA 4OI2A 3NH6A 3SBDA 1X6VA 5C4MA 1ZC3A 2H7VA 5C46F 3I32A 4A2WA 1EX6A 2WJVA 1EFRD 1Z6AA 1UEIA 4HATA 4JLJA 3UATA 1T3HA 1FPMA 4TL7A 2WV9A 3RRYA 4CEHB 4LRWA 3QXXA 4PC2A 4GZLA 3WP0A 4DC9A 4FWTA 1W2HA 2ZRDA 3HJNA 2DWOA 1SKYB 1OFUX 1UDWA 4W5HA 4KHZA 4HB4A 3U7FB 5G41A 3VQTA 1OF1A 4LX0A 1XPRA 1GP2A 1WDTA 3JZAA 1KMQA 3OAAA 1LTQA 1XBTA 4IOMA 4HLQB 1AQYA 1ZU5A 2ZJZA 2A5DA 2F1JA 3VTKA 4M22A 5E7IA 2R6CA 4R98A 2O0JA 3RWOA 2OM2A 1CULC 2VF8A 1LFDB 4BE7B 2PMDA 5JRJA 4U00A 4TMXA 3QPWA 3KUDA 1O87A 4LHVA 4F91B 2WJYA 5GJVC 1E9FA 3ASYA 3GQBA 1U90A 4TL9A 1P2VA 2QPTA 3CRRA 4DLTA 1G18A 1GNPA 3B13B 4NYIQ 1G1MA 4B3FX 3TW4A 1ZD1A 4FI3C 1XMJA 1OXSC 2WVJA 3CRVA 1ZIPA 4MYCA 4JL8A 2VHTA 5TMPA 3IQWA 4WZAE 3T5DA 3LXXA 1E9CA 4PR0A 1ZW6A 3C5CA 2CDNA 4CF7A 2D4HA 4GOXA 1ZUHA 1A7JA 2GRJA 1XD8A 3ZYCA 5KPDA 2ZE6A 4MGIR 4GOKA 3GEHA 4EPYA 5FTJA 1G16A 1Z06A 2AKAB 1QBKC 1FX0B 2NOAA 2WMNB 4A8JA 2G88A 3KKMA 3T06B 1FX0A 1LF5A 3MJRA 1WF3A 2WBLC 4DKXA 4I4LA 2GCPA 2J59A 5LD2C 5J4YA 2E1RA 2BIFA 4TYPA 5HCIA 3LQRA 4W9MC 2GESA 4A92A 3AVPA 1U8AA 3WHKA 4WVFA 4BZQA 2VIIA 2CBZA 2V6JA 2FNAA 3CX8A 5ANRB 2CLSA 1DARA 2HYDA 5P21A 2NQ2C 1F3OA 3U6KA 1JEEA 1KMHB 5FBLB 1NG9A 1XJ0A 5CITA 3IO5A 2C03A 3LNCA 2YWHA 3OIYA 1XMIA 2ODNA 4G3XA 4OHXA 3B9PA 1E99A 2F9MA 1OXXK 4KODA 2NZJA 3AKEA 2GZAA 3KQNA 2O8FB 3ZZTA 4KI0A 5KHOC 3GLGB 3KJHA 3QXHA 5SZJA 2O8DB 3S1AA 2FPMA 4NDZA 4KJZA 1U94A 2F55A 3IIKA 5HE8A 3PIRA 5TVKA 1KIMA 3DL0A 4M1WA 3CW2A 3GEEA 5CJPA 4GP6A 3NVAA 4WXRA 1UKYA 2R44A 2NPFA 2GTPA 1OB5A 1FMLA 1CBUA 2OO7A 4IFBA 1SVLA 2FFAA 1VCOA 3U3JA 4EFNA 3ADBA 1AZSC 1ZCAA 3ZH9B 3G82C 2QMHA 2DFKB 3IHLA 3W6PA 5CB8A 3AKCA 3FHCB 4DDTA 2ZI3A 4Q9IA 3BFVA 2E9SA 2NTYC 1P3JA 2XNDD 3D6TB 1E2FA 4UQOA 1SXJB 1Z29A 5LPNA 2CL6X 1R0XA 4V0OA 2C96A 2JIZD 4AKIA 5DHFA 3ND9A 1FP7A 1NNEA 4KFTA 1G291 1M1YE 3SQXA 1VYVA 4A8JB 1KKMA 5JJKA 1AQUA 1MABB 3RC3A 2ZVPX 1EXMA 1MO6A 5EQTA 5EUQB 3P26A 3AVOA 1FTSA 3K09A 2YC4C 4B48A 2O8EA 1CJUC 3E1SA 2FE4A 5G3ZA 4M21A 3UKDA 4GOJA 4ZI2A 3PEUA 4FMBB 4JLDA 2NO0A 4IHQA 3C15C 3QKSB 3WBJA 3SE0A 4Z8XA 4MRPA 4DLWA 2BWJA 3AGQA 4PQYA 5EXXA 4TYYA 1OSNA 1KGDA 2FZ4A 2J0QA 3F0TA 3VKHA 4YMVA 3PJRA 1CRQA 1SXJA 2QP9X 1BOFA 2N42A 1NSTA 3QF4B 4TQUS 3X1YA 2ZUCA 3MMPA 2IF2A 2NO6A 1CLUA 5F98A 1U0HC 1P7CA 3AH8A 4RD1A 5KSYA 4B73A 2KBEA 1T8TA 4JLBA 3LBNA 2AK2A 4V0LA 3OFND 4MYTA 2C98A 2Q9CA 2GXSA 4ZDKA 3JVVA 5JHHB 3SQWA 3DZDA 2OESA 3EZ6A 4ITRC 3TW8B 3QOFA 5C1BA 4M4SA 5FTLA 1XF9A 5ELXA 1ZM4A 3N5CA 2O8CA 1GL7A 2JLSA 2VF7A 3GD7A 4PC1A 1FNMA 2C95A 3UWOA 4MRVA 4A82A 4ZV4A 3K0SA 2PH1A 2QM8A 1WQ1R 1T8UA 3OEHD 2LCFA 2RGGA 1T3LA 4JBXA 4FCVA 1EX7A 3M4YA 3C5HA 5FBRB 4HAZA 4TYNA 1IN4A 1LS6A 1GKYA 1DELA 5L3QA 5DN6A 1ZUIA 1M8PA 2Q9BA 2EVWX 3EPLA 1VCIA 2O5VA 3A1SA 4JKYA 4NU0A 4QHTA 2PJRA 3C8UA 3W8NA 1L8QA 2G3YA 3EASA 1XTQA 2HEIA 4WA7A 4Q1FA 5H70A 4DBLC 2CE2X 4DLSA 1IY2A 1RKBA 1C9KA 1ZNWA 2ASEA 1Q1BA 2NMVA 4I1VA 2FEOA 1QVRA 2AN9A 1XP8A 4NPHA 3W6OA 3B1WA 2Q3MA 1KI1A 2MMCA 2VP6A 2ZVQX 1ZMXA 1SVMA 1YR7A 2Z0MA 3TK1A 3B85A 3P1JA 2J46A 3ADKA 1N0WA 1TEXA 2ERYA 2V9PA 2VEDA 3EG5A 5B2ZA 3ZJYA 1OHHD 4DEYA 2IYWA 2AD5A 1KK1A 4L9SA 2CL7X 1VIAA 1UKVY 3QEJA 4OK5A 1GAJA 2XAUA 4UXHA 5J4VA 2ZSAA 1F2TB 2AXNA 4ABYA 1Q3HA 2KJQA 5EUMA 3C41J 2XZLA 2OBMA 1TF7A 4YMUA 4ZDWA 2D62A 4D0LB 1W44A 4KXFB 2IYLD 2RGXA 3PCRB 4WZ6A 3Q8XB 3VR1A 1RRCA 1VG8A 3EZ9A 4L8GA 4G5SA 4IDPA 1J99A 1GL9B 2XSZD 1Q3TA 3FYHA 4QG7A 3AV0B 2Z4SA 1W48A 4YDSA 4HAVA 2DY1A 4K46A 4O2RA 1DS6A 1YR9A 5FH9A 3O8CA 5BYJA 2IYQA 2FU5C 1Q44A 2R8RA 4D2IA 1SZPA 5FFMA 2CJWB 4O0MA 1G64A 3AVQA 3UG6A 3MWLA 4Y0VA 5FBWB 2Z6VA 2JCSA 4AY2A 4Q7KA 4ZCLA 1J7KA 2B8TA 2C9CA 3C14C 5B57C 5FOVA 4LYAA 2ZS7A 3B1YA 3R7WA 4WOPA 2ZQ5A 2YNMA 3JVUA 2MSDB 1KDTA 1WBDA 3OESA 3R7WB 2V54A 1E98A 5E7MA 2ZRJA 1E94E 1FMJA 5FOTA 4Q48A 4A6XA 3QXCA 2GVZC 4AC9A 1UKZA 2QL6A 1JBKA 4IDNA 4F4CA 4TWZA 3LY5A 3C16C 4Z8YA 1QG4A 1P2TA 2GAAA 1Q1QA 3EXAA 5JI3E 4IOJA 2J3EA 1E2MA 2PL3A 1KK3A 2GJ8A 4FMCF 4PX9A 4F4JA 4XVQA 2R6FA 2FSIA 4V0ME 3LW7A 4A1FA 4R71A 3A4NA 4Q1EA 4A15A 3W3AA 1CS4C 4YQFA 1E2NA 1NSFA 1IBRA 5LD2B 1R6BX 3I1FA 3FFBA 3GJ5A 2PEZA 1P75A 1HYQA 3QXJA 1SKYE 5EJEA 2X19A 3THWA 2JEOA 3KZ1E 3LD9A 1HUQA 4DDWA 2B21A 3K53A 1N6RA 4X8MA 4EJSA 3AVYA 4GI7A 4DCVA 5EZ6B 2OLKA 1K5GA 1FQJA 2F1RA 5HZHA 2P65A 3KFXA 2IYTA 4M9XA 5FUYA 1VHLA 3MJHA 3ZZ0A 1FUKA 1G6OA 1XXHA 4NYMR 3RANA 3SOPA 4EPWA 5EXPA 3B8HA 4L16A 2HT1A 4A2PA 2R2AA 3BFKA 4QL3A 1RE0A 5EE9A 4N0DA 4AYTA 1FUUA 2HLDD 3TKLA 5J4LA 2VSOA 2JA1A 4ARZA 4B34A 1S96A 4UKDA 5UKDA 3VR5A 5FPKA 1JR3D 5DLQC 1XD2B 1S2MA 1FNNA 3DMNA 1L4YA 1R5NA 2QN6A 3FFAA 4MYUA 4W5WA 2WIBA 4Q9LA 1G7TA 1Z0IA 4URZR 1G8GA 3TNFA 3WXMA 2CMKA 3ZIAD 2QGNA 2QA5A 1MV5A 1KTVA 4AIIA 4LOAA 3ZD6A 4PC7A 1H65A 1IAQA 3CZQA 4M1KA 4MKFA 3BORA 4DDVA 3K70B 3TSZA 1UJ2A 3CF0A 3QVUA 4CEJA 3QKUA 2A78A 1LVGA 3B1VA 4TZ0A 1RFLA 1RJ9A 1YKSA 2G1KA 1SKQA 2CVFA 1BMFD 1OH7A 3BS4A 5CM8B 2XOKD 4QOSA 4QXAA 3RS7A 4B3XA 3A1TA 4QFMA 2PCJA 1OH5A 4Q00A 2ZRBA 4J0QA 3LH5A 5DSZA 1FOEB 4LJ9A 3HYTA 2VP4A 2WJHA 2FOLA 3KXKA 3U60B 2VP9A 1Z5ZA 1XDBA 1GVNB 3C7KA 3C4JA 3MAAC 4QJ5A 2LWIA 4CIDA 5JECA 1ZNZA 1W49A 2C9OA 5G3YA 4DXAA 2Z43A 2OFXA 1WMSA 2KSQA 3NDBB 2H16A 2BMFA 3CONA 1AS3A 4LGMA 1CR4A 1M7GA 1OIXA 1TEVA 1BMFA 3PXGA 3OEHA 4YMWA 4UNQA 1AKEA 1TF2A 4EJSB 2OSBA 3PR1A 4BWYA 2G9NA 3X1WA 3CO5A 3CPHA 4Q7JB 2FFBA 4TLEA 5H1YA 4HZUB 4C7OB 4LJ6A 3GJ7A 2ZRIA 4BEJA 1UBGA 1UFQA 3RAPR 6Q21A 8OHMA 2QBYA 3T12A 2GEUA 1R2QA 2ZANA 3RS5A 2OCYC 3PUVA 3R9WA 3GLHB 1W4RA 1D2NA 1A2KC 1X3SA 1C1YA 4JLPA 2V7QD 1V43A 4DSUA 4PHGA 1A1VA 1YU9A 1JB1A 3K9LA 3RSLA 1JECA 3RHFA 1E2LA 3NC0C 5EP2A 5LBIA 4KVAA 4QGGA 2EFCB 4MGKR 2J0UB 1GZSA 3NG1A 2XGJA 2ZJBA 3AF2A 1OHHA 5CYOA 4YONB 2ANBA 3D7MA 4C0SA 2GNOA 2ONJA 4HAYA 2IL1A 1E9AA 1YR6A 1E2HA 4G5GA 1N5LA 4M9ZA 2IWRA 5KNCA 4TMZA 1T6NA 2W6JA 1F2TA 5LB2A 2YKGA 2H5EA 3PVSA 3W8RA 4UNSA 4ESHA 2ZRHA 1WBBA 1CR2A 2MSCB 3QKRB 4PQRA 2Z5FA 2XNSA 4W7SA 1VHTA 1ZU4A 1NIPA 4EFMA 3IKJA 4B3DA 2BBOA 3RS3A 3VHXA 2LKCA 3IUYA 4XIGS 3OZXA 5E95A 2BCJQ 1HURA 3FGNA 2AHOA 2J9RA 4JMPA 2CLDX 4LHZA 1YZGA 2DR3A 1OXUA 1I4TD 4PFSA 3LX5A 3WNBA 1W2GA 4M1TA 4D0GA 2A5YB 1S0UA 2C78A 3CB4A 4GMXA 1CJMA 1G3IA 3TIFA 3AF1A 4URXR 4KSCA 1Q0UA 3G5UA 2OEPA 4CDGA 4LJ7A 2PEYA 4OQMA 4LBZA 4NCIA 1ONBA 2I1QA 3I92A 3EZ7A 3UMRA 1NL3A 1XMSA 4RY2A 1G3QA 3MSXA 4HB3A 2MSEB 4YMTA 3QG5A 4Z54A 1S3SA 3CUEF 3ZS8A 5KDOA 3UXMA 1NMXA 2PBRA 1BH2A 1DAEA 3IDQA 4P4TA 1XTIA 2JDID 4RD2A 2QP4A 2RGDA 4D26A 2R9VA 4P4SA 4TLAA 1G7CA 1KNQA 4UXJA 2IUSA 1UBEA 2P67A 3CR7A 1VYUA 1KDPA 4B47A 5KTYA 3N2EA 3TVDA 2AK3A 4PZYA 1HE8B 1XZPA 1UDXA 3CPJB 3KTAA 2HUPA 1KDRA 2QENA 2G1JA 3PFIA 1JJVA 1DAKA 1YZTA 3THYB 721PA 4DVGA 3GJ6A 3D31A 4ARZB 3UPUA 4D25A 3BGWA 2YHSA 2FEMA 1G4AE 1GWNA 2A7QA 4TT3A 2DCUA 2DFLA 2FSFA 3CLVA 4LUCA 3ZQ6A 5DI9A 2ANCA 4PAMA 4BFWA 4NCNA 4HZUA 2ZYWX 3U4QB 4E03A 2BV3A 1VTKA 4DHEA 1V5WA 1F6BA 2I1VB 4D4KA 4G0NA 1AS2A 3RWMB 4DT1A 4GFDA 4YLGA 1WB9A 1N2CE 3BIFA 1MRNA 5AJXA 3R8FA 2GK7A 3SFVA 4BFSA 2RHDA 2RGEA 1DAMA 2O8EB 4IVPA 4BZPA 3AVXA 2P5SA 3U3MA 1XD2A 2W00A 4ON9A 4AI6A 2QI9C 3RSOA 4Q1AA 1G6HA 2QP3A 5HPYB 3P32A 2DWPA 5IDVA 2RKOA 3FHTA 4TL8A 4NZYA 5KDLA 3CPEA 4OBEA 2IWHA 1ZRHA 2H18A 1CF4A 4C0QC 2QT0A 1YZQA 4FIDA 1YZUA 3DMDA 4BEBA 2YVUA 4D80A 5CDFA 4GBMA 1KO8A 3DOEA 4FWIB 1HTWA 4PXAA 4LCBA 1N6IA 4XOIA 4RFSB 1H8HD 2O52A 1W36D 1Q57A 5FPYA 1AGPA 3IEVA 5IHPA 2OCAA 2OCBA 3V9PA 3FMFA 4DUGA 4C0BA 4KU4A 2AFIE 3ZVNA 3VNUA 3THXA 2V1UA 3ICQB 2WWWA 3WNDA 1COWA 2ZI9A 3DOFA 4JLKA 4Q02A 4JS0A 2EYUA 3MGCA 2D06A 3GJ3A 2X77A 2FJUA 1E9EA 2IYVA 3BAFA 3VU9B 2RMKA 2EW1A 1KI3A 4X8OA 4NHOA 1Z28A 1QHNA 3CWQA 4B32A 3QENA 4BFYA 4HDOB 2QRNA 1W36B 3GMTA 3CF6R 5L3SA 2CCJA 4RFVA 4A0FA 1H8EA 2WOOA 4F38A 3GLIE 1OIWA 5JHGB 2JLVA 2IS4A 3A1WA 3ZIAA 5JWRA 4BFXA 3VMFA 2OFWA 2GWHA 1BIFA 2CL0X 3BD9A 3EWSA 3FKQA 4JL6A 1MKYA 4Q4AB 4UJ5A 1ESMA 3RABA 2ZI4A 3IHWA 5C2JB 2GXQA 4V0NA 2CJWA 3L43A 3M6AA 4EDHA 3RS0A 1P73A 2V55B 2WKPA 2F6RA 4A6PA 1WCV1 1IM2A 4BFUA 4K8OA 2IK8A 4KFRA 2ZS9A 3EWAA 4EPRA 3RDPA 2ZU0C 1N6LA 3QEOA 2BEJA 2WWYA 1H8ED 4HAWA 1R5BA 2WOJA 2HYIC 5K8LA 1XCMA 4LC1A 4C0KA 4LY6A 1VG9B 3X1ZA 4HZIA 4C0LA 1HQYE 3A1UA 4EPXA 3K70D 4PSAA 3SI7A 5JCPA 3TUZC 1ZVQA 4LHWA 2IXGA 1QZXA 3KX2A 1W0KD 5GADl 2OLJA 4DLUA 1ZCBA 3KJIA 4MYHA 1AK2A 3HR7A 1G5RA 5DH9A 1G17A 5EXTA 2P3SA 3AP3A 3P4XA 4MKIA 1G5PA 1G3MA 1XEXA 4B2IA 2A3RA 2HDNB 4U02A 1G21E 2JLQA 4A0HA 4HUTA 4HDQB 4BZXA 2GBLA 3EA5A 1MO5A 1U2RA 3DVLA 4B35A 2QT1A 4ZIRA 2J7PD 4IKEA 1J8MF 2QMUA 1D8TA 5KPJA 2IC5A 5CDFE 1UBCA 2CEAA 1OKKD 3HU2A 3W5IA 2ZXUA 2VQSA 4NCHA 1ZUNB 1G8FA 1DG3A 2EFEB 3Q7QA 3VHLB 1GNRA 3BERA 3MCAA 4K81B 1F48A 3T5GA 3L0OA 1DAFA 1Z0DA 1YHNA 4RD0A 4EPTA 2JLYA 4GDFA 2YV5A 1XWIA 2BM0A 3KQKA 1YZNA 1NN5A 3VR2A 2YOFA 3SZRA 3SFZA 5E3HA 1QG2A 1KI2A 1KK0A 1ZIOA 2DYKA 4KSBA 3VFDA 3LO5A 1D9ZA 5IF9A 2FF7A 4QGFA 4ACAA 4OL0A 4Q19A 3BRWD 2GK6A 1M74A 2FGKA 2IUUA 2ZI5A 3BWDD 2XITA 2R6AA 4ASUD 3A58B 5KOYA 2VHCA 3IQXA 4I1OA 5LDDC 2ZIAA 3L8YA 2V4ZA 3B5JA 3IO3A 4IVRA 1S9DA 5SZIA 1IY1A 2J0VA 2ZYUX 4G1UC 1OFIA 4BGDA 2I4IA 4KV9A 5KU1A 4AWXA 5HZKA 2CXXA 2CE7A 2J7KA 3K9HA 2ODEA 3WMGA 3X1DA 3H2YA 4OQNA 3FWYA 4Q4AA 3DPUA 4LBVA 3REGA 1P60A 4TSFD 5JCZA 5B64A 1TF5A 1HT2E 3KL4A 1PVOA 2GCOB 2IT1A 3OAAD 3A36A 4I99A 3LVRE 4JLAA 2ZJOA 4DSOA 1A4RA 1NLFA 2EWWA 4KLNA 1JJ7A 2ZR7A 4KYIB 4TMWA 2BEKA 1P5ZB 5FOSA 5B58C 2R62A 4OHYA 2D7CA 3EIQA 1K5DA 3REFA 2QPOA 1KSHA 1MRSA 1KKLA 3LXRA 4LJYA 1M6NA 1RRPA 4FCTA 4B71A 1YJ5A 1OJLA 3WRXC 4PANA 4D6PA 3QUSA 2B7BA 2GBLC 4IDQA 2JLXA 1Z0FA 3Q9LA 3QKRA 4O2LA 4CT4B 1EWRA 3GFPA 2RGNC 4Q4HB 1T3SA 1SHKA 4Z1MD 2ZETA 3GJ8A 2ZU6A 2FV8A 1XEFA 2QMOA 1W5TA 4JVLA 4X8HA 3RLFA 4HLDA 2WWXA 5H8WA 4B6FA 1OB2A 3TBKA 2GXAA 4OI0A 1IN7A 3V4RA 1R0ZA 2C77A 4C2UA 1Y3AA 1RIFA 3I5XA 3AUXA 2WICA 4B33A 1CKEA 3AF4A 3VX3A 1JPNA 1PLLA 1RVDA 2A5GA 2WKQA 4L9WA 3QE0A 3CNNA 1QVAA 5C4GB 1ZNXA 1N3BA 4B2LA 2JAQA 2XTZA 2D2FA 3E5HA 4IFEA 521PA 5BN3A 2V3CC 1G9XA 1Q22A 1E9RA 3MWYW 4CW7A 2GEVA 3GLIA 1N6KA 1SVOA 5FR1A 3QSYA 2W83A 4UJ3A 5FBVB 5BN5A 4S2EA 4DLRA 3UIEA 4FN5A 2C5LA 2Z83A 4HAXA 5DI3A 5H68A 4Z51A 3AKDA 2UKDA 1JEDA 2QROA 1AS0A 1TMKA 4Q21A 3PUXA 3J81k 3AKYA 1GTVA 1FFHA 2IYYA 2QE7A 4GZMA 5F9HA 1M2OB 3UMFA 5D3MB 1P9RA 4MQBA 2N46A 2EQBA 1II8B 4V0KA 3T1VA 1GSIA 4JSYA 5KSPA 4EKDA 1U0JA 2FSGA 3L2OB 2UZIR 4OJKA 3GPLA 5JLJA 3FTQA 4PHFA 2NIPA 2HCBA 4W5JA 2OAQ1 1MABA 2IEYA 5FUXA 3UWKA 4EUNA 3QVVA 2X2FA 1GRRA 4OI4A 4D4LA 3SYNA 4TMTA 4FW9A 1KOFA 4YDHB 3VKWA 3PEYA 2O8DA 1R7RA 1G8HA 5AR1A 1A2BA 1AZTA 4AKEA 3TRFA 3BB3A 4M9QA 2FFQA 3CH5A 1JXOA 4JZKA 3OIVA 1G20E 4CEIB 1GG2A 1US8B 3AVUA 4Q1DA 1ODFA 5AJWA 1XJCA 2OCPA 3I3SR 4BLRA 5AUNB 2VL7A 1KMHA 2V1XA 4US0R 5EXSA 4JLMA 2FWRA 2O0HA 4Q4HA 1ZBDA 2FPKA 1OE0A 3IPYA 5JS7A 3NHAA 4WAUA 3MUFA 2IS6A 2ORWA 2CK3D 2WJGA 5JFGA 4LBWA 1BKDR 5L3VA 2R6GA 5SZHB 2BVNA 1X8JA 3UK6A 4Q9JA 4PC6A 1BYIA 2OBLA 4BFVA 2ZS8A 3AF3A 2XEXA 3LRPA 1HV8A 1WE2A 3MWJA 2G0TA 1UAAA 1YVDA 4TLDA 1FZQA 2O8CB 3KFVA 4LK2A 4S35A 1S3GA 4GPTA 2W2TA 1KDOA 3U61B 1XD9A 2IYUA 5JWHA 1S1MA 4L5BA 4BLPA 1YE8A 3H84A 4Q66C 3GLGE 1CU1A 1TX4B 4PZLA 1Q21A 3KKOA 2IYSA 1XTRA 5L3QB 4Q5IA 2IW3A 2F9LA 2GF9A 4D81A 3CKLA 4L15A 1Z6XA 4TLCA 2VYFA 1GKUB 4M1SA 3KTAB 4OJQA 4IW3B 4LYFA 3BH6A 4CRWB 4FINA 4OQLA 4TQAA 4EFLA 4PPQA 3N70A 3OEEA 2PCLA 4KCGA 3MFYA 4TMKA 1HE1C 1PJRA 2JLWA 2A5FA 3ZQJA 1X8LA 2B8WA 4V0MA 4MA4A 3BOSA 2QSZA 2ZRNA 5EP4A 5FBQB 3OIUA 2GKSA 1VPLA 4G5QA 4HI0E 3A4MA 4P0TA 4BASA 2JJ2D 4Q4JA 3QJYA 4N1AA 3W90A 4XWKA 1SXJE 2CNWA 5AJZA 2W0SA 2XXAB 1CR1A 2NZ8A 3EIEA 1D6JA 2REBA 1TUEA 3BJIC 3L0IB 5FI0B 4MDFA 4IEEA 3FMOB 2HF9A 5G40A 3KDSE 1HQCA 2Y8EA 4ZDIA 3QY0A 4OHZA 1F60A 2REXB 3HPQA 3OEED 2ODBA 3QF4A 4PPNA 4XSGA 2QZ4A 3KKPA 1X1SA 2GF0A 4NYJQ 4QBHA 3SDZA 4Q01A 1N25A 3T15A 3TR5A 2VTKA 2AD1A 2YWEA 4JT4A 2WM9B 3I72A 2WZQA 4HB2A 1AA9A 2F7SA 2YJTD 3TSWA 4DCSA 3R8CA 4MKGA 2CNWD 3L0SA 2NO1A 2NO9A 3OHMA 2ZRFA 4HYYA 4LZZA 2GILA 4P3YA 4RZUA 4II7A 1KO4A 1ZAKA 1R0WA 1T0HB 3PQCA 2IHYA 1YRBA 2BJVA 3ZVLA 2YYZA 3SS8A 2B7CA 2QAGA 2QTVB 3P4YA 4XWAA 1B23P 4BECA 5FTKA 4PC3A 4BQSA 1R5OA 1NJFA 4Q03A 3PV0A 1KAOA 3IBYA 3B82A 4D0NA 2XZOA 3GEIA 4I1SA 4L4UA 4R2HA 3LWNA 3W9YA 2BDTA 4JVNA 4UNPA 2XXAA 4QNMA 1O3YA 1OXTA 2GJSA 2H17A 4DLXA 3EPHA 3SHFA 2KI5A 3FKSD 3UG7A 4PPGA 4URVR 4DCNA 4A36A 4B74A 1Z8FA 2BBWA 3F8TA 4Q9KA 4B2PA 1UBFA 1T9HA 1W0JD 3IIMA 4Q47A 2G77B 1IXSB 2D74A 5AWFC 1G19A 1S8FA 2GCOA 4AK9A 3TSOA 2AL7A 5B30A 2WWIA 2ZITA 1II9A 2PX0A 2F1IA 5K8UA 1QHIA 2NPIA 3U3KA 1SVKA 1DPFA 1UF9A 3AGPA 4CT5A 3GLGA 3OE7A 2VLIA 3CX6A 1OLOA 1YZLA
chains in the Genus database with same CATH superfamily
4ZOAA 3ONEA 2HSWA 3QFSA 3G79A 1Q5PA 1YKGA 1GPLA 8ABPA 3GGCA 1KR2A 1G2IA 4J91A 3L92A 3H2HA 2KYRA 3N74A 2NU6A 2PL9A 4S1PA 3VC3A 4JI8B 5TQ2B 3KDPA 1E3TA 2FEXA 3U9TA 5JRZA 3SXPA 3D6MA 3NKVA 3H2KA 5JSZB 2LKDA 1PFYA 2QQEA 2EWMA 2ZLBA 3JQAB 3KZNA 1FXWF 1NZJA 4HNRA 4KE6A 3TLMA 4I9FA 2WJIA 2CFCA 3EEBA 1JDUA 3NBAA 2OY0A 3FUXA 5JIBA 2OWEA 1ZPDA 1SUDA 3TFOA 4OKIA 4N4AA 1U8EA 3FTPA 3E05A 2XV1A 4RKQA 1Y7PA 2PH3A 1C7QA 3LECA 3OJ0A 2ZSEA 4N3CA 3RFUA 2HSJA 1PJ4A 2OGWA 1Z22A 4CV3A 2GI4A 3C1TA 2WWGA 4IGFA 3IRUA 4I3GA 2QD5A 4J0FA 4PWYA 4PV7A 4D6YA 2RGBA 2GZHA 1X42A 1I4OA 1ZNQO 3EAQA 5I9NA 3OLVA 1YDHA 3IIEA 1R6AA 2GEBA 3AJRA 2UYOA 3NPAA 3QJ5A 4MRAA 3H1FA 3RS8A 1E9DA 4NPAA 2ZBFA 2AGVA 2YCBA 3H16A 1UFKA 3OX4A 5HCNA 2IYPA 1E96A 4HXEB 4KR2A 2BHLA 2OC4A 3CEJA 4ID3A 3PE6A 3QOYA 3LY9A 3FMIA 3G2QA 1TUGA 5B6IA 2ZM5A 3F4KA 4ERNA 1DLJA 2QE7D 4HPXB 4RQBA 4E5UA 5REQA 4X6XA 5A4KA 3QWBA 1TKCA 1XCOA 4JNCA 3CWZA 2FMKA 3MLAA 1QU2A 1P1HA 4UTPA 1XVLA 3FJ1A 4ZO4A 2X23A 1QS0A 2F9FA 3TD9A 4JVMA 3LLCA 1VLMA 2WSMA 3PVCA 4TTIA 2CLKB 3DKKA 3LV8A 2DTEA 4P0PB 3KKQA 4M36A 2OTCA 3T5AA 2VP2A 1L0BA 4AQYB 2CDBA 1UBKS 2V96A 3COZA 3TH5A 3V7NA 4QPZA 4XQ9A 3JX9A 1YUMA 3CUUA 3KWMA 4OHWA 4I6JA 4RKWA 4ZCIA 3HJFA 2D1RA 3AV3A 1IG3A 2VJDA 3BXZA 2QTAA 1KSGA 4ZAYA 2QIOA 1NDUA 5LB4A 4BNXA 4PFKA 2QAGC 1TCUA 4RCYA 2QQ0A 2HPAA 4IKPA 1I4LD 3NHWA 5IT9A 2XQKA 3IILA 3NT2A 3EULA 4Q18A 1TCBA 4DMRA 3ZWCA 1COWD 3RNLA 5JARA 1LBTA 1IN8A 1A9YA 1G20B 2R79A 3I23A 4L28A 4LMAA 2Q2OA 2O3JA 4IX1A 2R7MA 3PQ2A 3FZEA 4EW2A 1Z07A 2BBSA 4XB6B 3SGLA 2HRDA 4M76B 5AQ1A 1TK2A 2NQ8A 3L04A 2AZDA 3LA6A 4I1YA 4TUYF 5DGXA 4JASB 4Q7QA 3RRXA 2IA5A 3EBOA 2O8FA 1V2GA 4U0JA 4Z3OA 1H1LA 1ZO8A 2QGFA 3GGJA 5F33A 3JRXA 3ROMA 3U3RA 1BQ4A 3B6ZA 5JNUA 4YP6A 3U4MA 4MKXA 1ODSA 2QTLA 3BBLA 4I9GA 3DZBA 1RHJA 2ZAMA 4NICA 1GITA 2G70A 4TX1A 2QUZA 3JAKA 4URYR 3NDJA 4BBAA 3DM9B 2JK1A 3AW8A 4O4LF 4YIHA 1VL2A 1PZGA 1WHSB 4R8VA 3SKYA 4G1CA 3SYLA 3TQFA 1EIZA 2ISSD 3TTVA 3I4CA 2BKEA 1TW2A 1A7AA 3J81A 2ONKA 3DC2A 4OD0A 4JJ7A 4CM6A 3GBVA 4QJ4A 4UTOA 3RTEA 5I9LA 1T8PA 3NV9A 2HLDA 2PT7A 1PAUA 5KOHA 1NLZA 3GFRA 3RLIA 1N2BA 1OT3A 5CLLA 3DT8A 4ZZ3A 4TT3D 2OO5A 5COQA 1E2IA 4ME6A 5GM1A 1A8QA 4FNOA 4GRDA 4LC0A 2INGX 2CGEA 1W76A 4L27A 1IMJA 1C7IA 3ZY4A 4Y1FA 1DCFA 1U0TA 5AVTA 3VBCA 3GGDA 1HH4A 1MPTA 1CIPA 1BE8A 4AZVA 1ZM3A 4EW3A 3ZHTA 3KJQA 4UUMA 2C9YA 2GPWA 2J5XA 5ITSA 1TYBE 5H3CA 1X87A 1E9SA 1RLMA 3DKIA 3G3EA 4MPPA 3PFNA 3LLUA 4PZZA 4ZQEA 2CHVA 3U4DA 3IAEA 2H5LA 2O0KA 4F60A 3FHOA 2X41A 4AX8A 1YO6A 6REQB 1Z9BA 9MHTA 2PUWA 1R10A 1J70A 1Z6TA 2CK3A 5CPBA 5I51A 1GTG1 3CG0A 5TMDA 3FUCA 2X0JA 1AHPA 3AWDA 1BX1A 2AZ4A 5DWVA 5M04A 4TV9F 2A67A 4GOND 3TKAA 3PQ8A 2JAWA 4TYQA 1KOJA 4IUBS 4OHVA 1OFHA 2HD4A 3H5IA 1E0SA 3CZMA 2QEQA 5CLQA 3WSWA 3ZS9A 4Q05A 1QG0A 5EMNA 3GVHA 1JEQB 2R65A 2BHSA 2EYQA 4NMHA 1ORTA 4PSUA 1B7GO 4PN3A 4WLVA 3QI2A 4NLLA 5AXAA 2CVOA 2VRWA 1M2KA 3A4TA 1IPFA 3OCJA 1DO0A 5K8JB 4I5IA 4JJIA 2PV0A 3TAHA 2QM7A 1EVJA 4DNQA 4QBIA 4EGQA 4YV0A 4PF1A 3EZ2A 2J45A 3UNXA 4C7MA 1RC8A 3EFEA 4WK6A 4DIMA 1GUAA 1Z8NA 1WUYA 2CD9A 3QP9A 3PNSA 2W2KB 3OO0A 1T0UA 3LOQA 1IHPA 3A14A 1Y34E 4JU9A 4WKNA 1ZA1A 3P27A 4KXQA 4OIFA 2R1VB 4QULA 3ZG6A 5E2AA 3KB2A 3QHQA 4WIAA 4N41A 3DZIA 1R8SA 3W06A 2CHUA 2WIAA 4TMFA 3WE7A 4CTOA 4EL0A 1YB2A 2X9NA 2QI9F 2EG5A 4NYMQ 1IB6A 2XYGA 1R00A 1UFRA 3OBBA 4GXNA 5AQEA 1D2CA 2R751 2DLDA 4KITB 5IJWA 4QBGB 1I3NA 5EJ2A 3MOIA 3UAOA 3PGJA 5BYKA 4KR3A 3KSUA 3EXG1 4DNFA 3A1NA 3ZNOA 1DBRA 2ZRKA 1ACLA 3E15A 1GVHA 1O0BA 2CNKA 4Y8VA 2BUBA 3LUHA 1U3GA 1YJQA 2JGDA 2Q4TA 1U99A 2QUBA 2OV4A 3K0BA 2RCNA 4IX9A 3WIDA 4AJEA 5JADA 2QL5A 3SR3A 1LNQA 1UQUA 4H7KA 4HFRA 4IRUB 2XQJA 3DTVD 4JEIA 2NXEA 3FLBA 3U7HB 1ZK4A 3KQVA 3TRJA 4EUEA 1J2YA 3O7WA 4BYGA 2VSFA 4X1KB 2VK2A 4H1VA 1G2QA 2FLWA 3M6MD 2XZTA 1M2GA 3DF9A 1KHHA 2YOGA 3A3YA 4NRDA 3NEJA 1OX4B 2VNKA 3ZNNA 1KJNA 4WY5A 2QMZA 4NG4A 3WY9A 2EBHX 4HN9A 4TXJA 1GPMA 1F14A 2Y1OA 2D6FA 2ISQA 621PA 4P7GA 1ZJWA 3PEVA 1VIYA 4Q6WA 4MR8B 4PO1A 1QHYA 5BOSB 2JFQA 3K9WA 2XA1A 1URPA 3VH4A 3IKLA 2QXUA 3FF4A 4GYJA 1ZD4A 1SXHA 1XZJA 4HGOA 3U5ZB 1FW6A 2HJGA 3EC2A 2ZSUA 3LRTA 2Q3CA 5FT9A 2JGJA 2X4GA 4LDQA 1AKQA 1S5PA 1VCHA 2B6HA 2UVQA 4BRWA 1MDBA 2FSHA 1YQUA 1Z0KA 1GGHA 1WO8A 4UU8A 1KJ8A 4QTXA 5BRJA 1SG0A 2OXEA 2Q3JA 4HFJA 3LSYA 1AIPA 3MCUA 3B3JA 3FN4A 3SQMA 3CLUD 3PVZA 4G5RA 3M3DA 3R20A 2YINC 1WS6A 1KKUA 3M4NA 2VQEB 3CZRA 1PLKA 3MLEA 4XPZA 1JMKC 3RM3A 4DIDA 1P2GA 2IYOA 2ECKA 3QPAA 2HJHA 4KYTA 3RKRA 2C88A 4LRXA 3TR0A 3NBXX 2YR0A 4GL2A 1K7YA 1KY3A 1Z62A 2I80A 1PDWA 2XUZA 3KVYA 1IEXA 3KOXA 1F2UB 5DE3A 4HWKA 3PUHA 2QXTA 1IY8A 4Q3KA 4QVIA 4E6PA 5TX7A 5A0VA 1J0DA 2B1RA 3H87A 2EKPA 3BWVA 4LF8B 1UM8A 3LHSA 3BZBA 3R8XA 1RE1A 4N8DA 2OC9A 4QGSA 4EVSA 3HQ4O 4LDZA 2QLLA 4QDKA 1O58A 4B43A 1XN4A 4ACBA 3ANMA 3WXBA 3PRHA 2N0SA 1AN0A 2Z3ZA 1Z0AA 5ECWA 5IFLA 4XWOA 3GDHA 4Q0MA 2XBUA 3HE3A 3T5CA 3TLZA 2HBRA 1KS2A 1V35A 5F2KA 1YQQA 1M8JA 1EEXB 1JX6A 2Y99A 3VTFA 3K4PA 3SJZA 4RS3A 4CM9A 4B6QA 5I5EA 3H86A 3C8DA 3LX6A 4CXMA 1RWXA 3DG9A 4N7RA 1YFKA 4B87A 1ZSVA 3BFXA 2O8VA 4RHXA 4TL6A 1MC1A 2QL7A 4CIVA 1A9XB 1N2CA 1Y8CA 2LCQA 3WHLA 3TUIC 5BMVB 2AJTA 2M6LA 3RTGA 3O8QA 1O7JA 1N8KA 2DSTA 3HDVA 3C7DB 4PGMA 1WDKA 3CLUC 1USVA 3LPMA 4JUDX 5CT8A 1DJOA 1K89A 3I9OA 5LWQA 1RBZA 4I3FA 1ZOLA 2PQ6A 4KQGA 2O8BB 4X3OA 2X7HA 3FROA 9GPBA 3SVLA 1BYUA 3QOXA 4FKZA 4UE6A 4JQSA 1VSBA 2OCXA 3Q9SA 4JC0A 2IYNA 3KS9A 4YWJA 4AAYA 1PU2A 4C4AA 1YB6A 2J0EA 5FQOA 4CN8A 3KQHA 4NMXB 5TEWA 4C04A 5HRAA 5C8YA 2F3TA 4LGCA 3GUYA 4J4HA 4LOIA 4MUMA 4PAQA 5J3JA 3SLKA 1SUBA 1P77A 2IU4A 2VSXA 5BN3B 5E7JA 3RJ5A 1V45E 3BMCA 3JW8A 3JV7A 4OH7A 5AVYA 3DXXA 2FH5B 4HWOA 5EWLA 2NUTA 4Q16A 2BKUA 1IN5A 1NVGA 3DUFA 3R3UA 4P38A 1D2HA 1WY7A 3MWFA 8ADHA 5L8VA 3HCPA 3U1VA 4LVCA 1THTA 1CYDA 1QHHB 2ZIXA 3DDWA 3CCCA 1K08A 4H3HB 1VBNA 1CZUA 2N47A 1P31A 3A4LA 4ITVA 4DMHA 2NU8A 2C5GA 2JGLA 4CCAA 4JA2A 3TXXA 4LOLA 1GRNA 5HR5A 4URUR 2X0FA 3Q0EA 1QHFA 2VPZA 2DB3A 3R9XA 1IVNA 1Z2OX 1L7VC 3JQEA 4QT0A 3RWBA 1L7DA 4FI3F 4KBFA 4ZK6A 1ST2A 2ONCA 2HI0A 3CN9A 2A9KA 2YW9A 3NIBA 1YGPA 3BULA 3T0IA 1DKPA 1F1BA 2GHTA 2OE2A 4MPRA 2C07A 2HEGA 1H23A 4WESA 5GVRA 4BRUA 3MXOA 4L76A 2JA2A 1XZNA 2XMCA 3NBFA 2COUA 3H1GA 1M2WA 4N7BA 4W8HA 5LP6A 4B6EA 3THYA 5FI1B 2JARA 4AROA 1V1RB 2YWBA 2F8TA 2BY4A 1GDDA 2QLMA 2W6IA 2IYFA 4AJOA 4IHJB 3U6BA 1XKQA 1Y3FE 1NBWB 3KAJA 4G56A 1XDSA 2X1VA 3UJNA 3I5AA 4LV5B 3L4BC 1EUCB 2YXPX 4P3OA 1QORA 1Y8QB 2XXBA 2M98A 2P9FA 1CP2A 1NQOA 3I0ZA 1W36C 2RB4A 4GT1A 5B7QA 1IVYA 4GOLD 4G5OA 4P54A 1PJCA 5DNAA 1UWVA 2Z2XA 4JSTA 4P4UA 2O1XA 2UZ3A 4RPKA 4O02B 1D3AA 4CG1A 1H69A 5B4UA 5D3MA 1ECFA 2IODA 4FZ3A 3FVQA 2QW0X 3IUPA 3K9FC 3I73A 1XZAA 1C3VA 2YHAA 4OQFA 2YWDA 3ZGXA 2Y77A 2VCYA 1L1QA 1YACA 3UGQA 3L7CA 1YR3A 2WMOB 5A3JA 2G25A 4JOBA 2ZRCA 5EZYF 2P1DA 2VAVA 2XDQA 4IO0A 3HU5A 2R68A 4YT5A 3RU9A 1QHSA 3G9UA 4EJMA 3ZY2A 5DNDA 3I6QA 3GFSA 1W52X 1X94A 1Q1NA 2WJWA 1XZLA 3A2MA 2X2PA 1L7QA 4W7HA 2HMVA 3TW0A 3A0UA 1L5FA 4W4TA 4WERA 1T9BA 4A5OA 4HV4A 2FX2A 1JZSA 1N7JA 1W0KA 3DF7A 3HLKA 4E4TA 3TGPA 4Q4LA 2V3VA 4BP8A 3PE4A 4RHFA 5A04A 4ENWA 1ZFNA 4U63A 3ZGNA 3DFFA 3T94A 1A5BB 3PC4A 3A8TA 3LIIA 4G25A 4D74A 1BN7A 3ST7A 1JYFA 1XWWA 3C70A 3FFWA 1I2ZA 3B3AA 3FPBA 5JYCA 1TTTA 1DT3A 1OFTA 3LYAA 2BZGA 2PH5A 4IJ5A 3HKEA 4JBYA 5A4JA 6Q21A 2HL6A 3FX2A 4M8NE 4F2DA 1XPOA 5J1SB 2DM6A 3ZDRA 2AX4A 5IRCD 4PYRA 3SK0A 3KSRA 1YBVA 4US1R 1ESCA 2XE6A 4KYVA 1VL6A 3VR6H 2YV1A 1N5KA 3OEYA 4OL9A 3V97A 1VGVA 4YT8A 3N9IA 3VNVA 3AFOA 3KXLA 2B82A 1FLNA 4NXNB 2WWHA 1JQLB 1NONA 1OXKB 3W05A 5AO9A 2XUAA 1T4BA 3AFIA 1J90A 5KNCD 2YMQA 3DWEX 3VPFA 3FTDA 1YFZA 3VR6A 5AHWA 2ZT7A 3O21A 2R4QA 2C2HA 2QW1A 3O84A 3ND6A 4U7GA 3KALA 5I5GA 2P11A 4F86A 3SLGA 5JEEA 1E3SA 2LV8A 3KQPA 3H5LA 1TVKB 3SJUA 4RFSA 4DY4A 3QLEA 3VU3A 3GP8A 3IPXA 4PS1A 1PD0A 4YBZA 3T34A 4RA9A 4NCBA 3AR6A 4G63A 2AZMA 3ON5A 3KOMA 2G1AA 4G9EA 4OHOA 3NM6B 4U2KA 4MEBA 1U7WA 1Z2NX 1DPGA 3WV5A 1IOZA 4JI7B 3PLNA 1T1JA 5C8XA 1GXSB 2EBUA 2HLPA 3WRYA 3R09A 1MAUA 2N1MA 4MUEA 5EE1A 3CVYA 4RTRA 5HRCA 2W0MA 1J07A 4WBSA 1R8XA 3M2TA 1BWSA 3PEWA 4JODA 2ZTSA 1JW9B 3PC7A 5WRFA 4WOCA 1Z7GA 2ACWA 4URWR 3RC8A 3OC0A 2HA5A 4KSYA 5DYWA 4B44A 1RC1A 1W46A 1QX4A 4OXKA 5I7VA 5J4HA 4UMDA 1NBME 3LCJA 4QHYA 1R4MA 2E5LB 1E9BA 1E4EB 4R7ZA 3R9IA 4NCJA 3L77A 1J5PA 2JBAA 2WPNA 4FHZA 4PAOA 3K1TA 2JDIA 3NS7A 1XHLA 3X44A 2GZMA 3E5RA 5CVUA 3GJRA 2V97A 1PT5A 4MRSA 3WL5A 3LIPA 4J03A 2ZZKA 4TWBA 3W6UA 2G7MC 1I2AA 3LCCA 1DVRA 1TU3A 2P4SA 2QSYA 1Z0JA 1TCVA 1HDRA 1UC9A 2A5JA 1G59A 2XWPA 4ZJZA 1G8YA 3DEKA 5GQSA 3M6XA 2REOA 4RL4A 5KO2A 1Q50A 1W1WA 4HRVA 4BNWA 2FX3A 2X8JB 1LD3A 4GLLA 1Z15A 3L8EA 1OH6A 2W5UA 2W6ID 3BZUA 3EPJA 3B1XA 3ZW8A 5JMTA 3F5FA 1P39A 2B2XA 2P6UA 3MFQA 3O82A 4XVRA 1XCPA 3R7NA 3FY4A 5ALJA 4ZAGA 4YB8A 2NUPA 1IZ7A 1UWCA 4RCZA 3RYCA 1A97A 1QGYA 5KS2A 1U0LA 2WA1A 4PZPA 4IH1A 2KQUA 2AEJA 2XHZA 2ZJ2A 1PJBA 1Z17A 4ZAXA 2QVYX 5HE9A 4NBNA 1THMA 4HX9A 2DQSA 3BJZA 1IUNA 1IZ8A 4I8IA 4R2KA 3E9CA 4NSNA 3BC1A 2BHNA 2PLRA 1IM8A 4B40A 1MJGA 1NE7A 2W4MA 3LPAA 1UADA 1ABFA 1WF6A 3N8HA 2V5AA 4MS1B 4PHTA 4U1RA 5FUWA 1ZNYA 1HDIA 2R4UA 3UJCA 3EK2A 4BJ1A 4UM5A 3LBYA 4BKRA 4RW0A 3UAZA 1ZJ6A 4M0LA 2QX7A 2H2AA 4ZVLA 1YIOA 1UKAA 3UMCA 1Z7EA 1VL5A 3AERA 4GP9A 4WEOA 5JI2E 4MYDA 1U4OA 2WNHA 2YFHA 3KQMA 3LUAA 4FGWA 4IJUA 4IQGA 1RYFA 3NJRA 4Y1EA 2XMRA 4CG2A 1Q15A 4H1WA 4P4SB 2D2EA 1BE6A 1PTKA 2Z30A 4RZQA 1SQ6A 1A3CA 1A8UA 1V5IA 1EXDA 1U7OA 4X6YA 4E12A 1ECBA 3WTCA 1U8CB 1EQAA 1T9ZA 4RM2A 4PRZA 1E79A 3K71B 3A3NA 5T4FA 4AMUA 3MCTA 3KB1A 2N9UA 1QV9A 2E6UX 1UT5A 1XU7A 3KU4A 3L40A 2E2WA 4RBNA 1E61A 4JR1A 4LJAA 4YJDA 4ZAVA 3ZKWB 2VPQA 3BHNA 4D9NA 1H5UA 3JTMA 4M1OA 2AOTB 5T67A 6AT1A 5AUQA 3GAFA 4HXYA 4E09A 4CMAA 5IVHA 1D2EA 4D3ZA 2JI4A 1RZRA 3Q72A 4D3XA 1E8NA 4LRSB 3EF1A 3ZHBA 4H7PA 2H2HA 3FCEA 1N2ZA 3FKSA 1IXRC 1WX1A 2WM2A 2X8BA 3BSYA 4MDHA 1PUJA 2ORYA 3G0OA 1E0DA 1YDMA 4W9NA 4EG7A 3K0CC 4MAAA 3DJFA 3RS4A 5B55A 1CUWA 3EQ9A 1V7ZA 3T3PB 2WUEA 3UH1A 1KSFX 4K9SA 2R84A 1LQUA 5HQTA 1M66A 3IVXA 5KVCA 3QWHA 3FRHA 3PL5A 4OHPA 5LBUA 1E8MA 1JUDA 1MJFA 1DTSA 2Q3EA 3AU9A 3GFQA 3W1VA 3THWB 5E0KB 2YOHA 1C0EA 3G6KA 1DZ3A 4MW7A 4K9LA 1DEAA 1XRJA 3CINA 2GERA 5DI3B 1E89A 4E94A 3FOFC 4GWGA 3OCZA 4NKRA 1FNDA 3V4ZA 1E3MA 1FRNA 3OE7D 5CCXA 4HEJA 2QL9A 1YZ3A 1BZYA 1NKTA 2JFHA 5EKXA 3WLQA 3DKPA 3QKTA 1CQJB 4PLYA 5K7SA 3L1UA 1E8DA 1ADBA 5BQOA 4K6MA 2HKIA 3LUJA 4Y1RA 1AHIA 1TAGA 3FA2A 2J0SA 3Q3JB 1NN3A 1NXQA 4D02A 5TGZA 3DDCA 4EB6B 3LW8A 3LBFA 1MUUA 4NH0A 3EQ2A 1ZJ5A 4P4NA 3OLQA 1MOZA 1KFCB 2CZQA 3ACDA 4D3YA 4RKYA 4E5VA 3K9NA 2ST1A 4N8SA 4UHJA 3CISA 4JI1B 1RYHA 4YAGA 2PPVA 1NJGA 2I4LA 2SKEA 1ZZEA 1QCZA 1SVSA 4YRLA 4CLDA 3ZZMA 1BQ3A 1WXQA 2A9RA 1NWHA 2BMDA 1NMZA 1PR0A 3COSA 4NEQA 2PLFA 4X20A 3JATA 1KL7A 3HBNA 5B1EA 2FUG6 5BWMA 4IXDA 1MX9A 1XJQA 5FL7D 5CFZA 3RRFA 1D1SA 4NCXA 5CB6A 5HOEA 3BEDA 4RIIA 5ILOA 1PJSA 5CCEA 4XTRA 4DNOA 5EWLB 1JV2B 2FPGA 3T3NA 3AETB 4YP9A 3T7JA 2O48X 3TCXB 4GSYA 1I2MA 2BFDB 1A96A 3CH4B 3NWOA 3KK0A 5AH0A 5K51A 4IOLA 3FPEA 1SUIA 4M98A 5I3CA 3CX4A 1RWNA 4OXXA 4BO6A 5LLDA 4WVLA 3ZCUA 2Q5QA 3LUPA 3K0HA 2PUBA 4P9NA 2XTMA 2QN7A 4KFSA 2DR2A 3FVWA 3H0KA 1VFNA 1W8DA 1PV2A 3OTHA 2EX4A 5K0GA 1JSZA 1PZEA 1YU6A 4YYZA 4AW9A 1QIJA 4IRXA 4DB2A 3D3QA 4H9GA 3K2QA 4MO9A 1Z6YA 3KXDA 2ID7A 3MCZA 5JJLA 2DLCX 1M6YA 3R0IA 5A5VA 3QWFA 1NG1A 2H31A 4M0FA 4BO2A 4QX6A 1QU3A 1EJBA 3EMBA 3C3EA 3NEAA 4K2HA 5DB4A 5ALUA 4LJKA 4C0WA 3UJ3X 1GKKA 3V42A 1DDIA 1KMMA 3ONFA 5LUAA 1ENZA 5IZ4A 3CVVA 3R4CA 4F92B 1NVVR 3DWIA 3K92A 4ZCPA 4K9RA 2P6RA 3OTIA 1RLOA 1U2QA 1D04A 3FVVA 3E82A 2A4MA 1M6WA 5KIAA 1Q0SA 2IF0A 2ZQZA 3BTUA 4KO3S 2JANA 1WQ3A 4IJKA 5DN6D 3K2IA 3MN1A 1WMEA 2NZVG 4P31A 4C76A 2PZFA 2VKTA 4DQUA 4B4UA 4MHTA 1HOXA 3R3XA 3N58A 4BJHB 1OYWA 4OA8A 4AL4A 4HDMA 3G0HA 3SBDA 3VNQA 1JH9A 1NF2A 2VPYA 2ZI6A 1X92A 4NJEA 1BU8A 2JFPA 4ZT6A 1E6UA 2O8BA 1XMVA 1FFCA 4J0JA 6NULA 2I54A 1KI8A 2RAPA 3ZU2A 3KQLA 3U3XA 4DLPA 1U3FA 1ZMTA 1EGAA 4X63A 4MKHA 2XB4A 4H3VA 4NOMA 3UGKA 5BSRA 1CXZA 3G02A 4LSWA 4OYLA 4RPGA 3I53A 2BGNA 5EE3A 1WPGA 1Y3BE 4ZREA 1EG7A 1FYXA 1G5IA 3AFGA 4M46A 4ENSA 1HPLA 1JT9A 2AWOA 3JAWA 3V00A 1GDTA 3TVTA 1RQXA 2ZUUA 1RP1A 3WWCA 5C8YB 3TOXA 1YFJA 2VHZA 1S1CA 4HNUA 4L02A 3VBEA 4E32A 2G1PA 2CXPA 3WMFA 3NEPX 1EFHA 2WWTA 3PXBA 3RAGA 3TOSA 4BX2A 2VC2B 3AEUB 1GZUA 3KYIB 2HA4A 3NBUA 4S1NA 4HT3B 1V9CA 3F71A 2ORVA 4FFNA 4ZVRA 3REQA 3IP3A 3LKBA 3X3HA 3EARA 5IFKA 1II8A 1FSSA 1US8A 2Q1YA 3HS3A 4IF6A 4LAFA 2PSJA 2MCFA 3OCVA 4LNUA 2XWJI 2EDAA 3DB2A 3A27A 3U2QA 4UE3S 4BS9A 4OQPA 1DEKA 2WWRA 3IBGA 4LXXA 3HU1A 4X44A 5CVCA 5I4CA 5DDIP 1TZCA 3AJ8A 1ITZA 2ZSFA 3G85A 5GVSA 4F4DA 4DNPA 1GGVA 3HZOA 3U17A 1AKYA 4CKWB 2ZSDA 2B25A 1UXJA 3AF0A 1I9GA 2GBIA 3AUKA 3BAZA 3AR2A 2FA9A 2NGRA 1CNMA 4OGKA 3HI4A 5TDHA 5I45A 4FZJA 2WD7A 2VATA 5DLPA 1FP4A 3AB3A 2ZJ0A 4TV9A 2O06A 3S1SA 3PLAE 2CLLB 2ZJ5A 3LWDA 1E18A 1T4GA 2YN4A 5DYYA 5HSGA 4ZTZB 1S4QA 1XKTA 1DC3A 1HK7A 1V95A 3FCAA 3WQQA 3OF5A 2G72A 1ZM2A 3PJEA 3RASA 4TTRA 2GEDA 2PZGA 1B14A 2H2GA 2GM9A 2X1LA 3DVAB 3NH6A 3DNFA 5CHYA 1NQWA 5CURA 1ZC3A 4CT0A 1EUYA 1A95A 4C6TA 5YASA 4UBNA 1Z6AA 4EY8A 2MR5A 2IDZA 3IEIA 2VCEA 3ONDA 4DV1B 1FPMA 3NIFB 2VWHA 4TL7A 2O4CA 4MK4A 2O7QA 3BHJA 2IXDA 4YRTA 1H9BA 2NO5A 3IURA 3QXXA 4LRWA 4HNQA 4PC2A 3E5MA 1DEOA 1GNVA 3EYWA 3MWEA 1NVTA 4UVDA 4Z4IA 1JDPA 5G1PA 5LYJB 2FPOA 3EN0A 2ZRDA 4DIOA 3UVEA 1ESDA 4AP9A 5B1IA 1LRJA 1CHDA 3CB2A 1BHJA 4BNMA 4L0MA 4E2ZA 4HB4A 3U7FB 4MIKA 1X1CA 4W5RA 4K1XA 3MYRA 3TZBA 3VR6D 4N9WA 1MJ5A 3OAAA 4E46A 1KDYA 1WVMA 4JN6B 2UUAB 2BFBA 4FR2A 3UWMA 1BKSB 1ACMA 1PK9A 5HF9A 1LLDA 1XQWA 1U0SY 4R1UA 1WZ2A 2ZBUA 2W2NA 1HZJA 2PVSA 1DI0A 1ZK0A 4J7AA 4KDCA 3ELBA 3RWOA 3TX2A 3H8JA 1JWBB 4M3NA 5BPHA 2VF8A 3M1YA 1MT3A 4LEIA 1EZ1A 5JRJA 2XUGA 3QPWA 3AJ9A 5KINB 1W9MA 2OOKA 4G2TA 5CVTA 4F91B 1E9FA 1H3EA 3LBAA 4P5PA 3ASYA 3II6X 4KQCA 1U90A 4ZYWA 2H4XA 3WNVA 1JQAA 3PU6A 1PTJA 1YMUA 5K0ZA 4P7BA 4EGJA 1XLUA 2VDMB 3QX9A 3P9QA 1H2AS 4LJRA 1G1MA 1QCCA 5LN1A 3CRZA 4XQGA 2WG2A 1Y7TA 2HN9A 1ZRNA 4TGLA 3CRVA 4MYCA 1EB8A 3EH1A 3ZPXA 2OQRA 3OPQA 3IQWA 5AOCA 2BRUA 3LXXA 1E9CA 4QEZA 4NIMA 5C81A 3ZWYA 3GGGA 3F49S 4R1QA 1PEYA 2O0MA 4ZHQB 2Q6OA 5A0TA 2PTGA 4PLWA 3WGUA 1A7JA 2WRZA 3OTOB 4MYRA 3SXJA 1M6VA 2A1UA 5CU7A 4G85A 1TO1E 5A9RA 2ZB8A 3OVMA 2QRMA 5JDIC 2IPLA 3NALA 4FONA 4KPYA 2ZPUA 3A6LA 3ANXA 3D4PA 1SUCA 1HDZA 1UZAA 1X1EA 3DAOA 3HNRA 3C6ZA 5FJJA 1FU8A 2J6BA 5FFNA 1HT3A 2NOAA 4HEQA 3WJ2A 4AM8A 2ABWA 3GX1A 1N8TA 2NV6A 3KKMA 3QLUA 4QQNA 4DKXA 1WF3A 2OSVA 2WBLC 2QTGA 2J59A 3LXUX 2IE0A 1YS7A 1DQNA 4G9GA 5LD2C 9ATCA 2E1RA 3L8FA 1O8BA 4MWOA 3UJ9A 1YBFA 2I4OA 5JG7A 2HMWA 1QYCA 3LQRA 1XPJA 2FETA 3GMDA 3KEQA 1Z7BA 2IY8A 3OJXA 1U8AA 4R3NA 1OFUA 1A76A 4Y67A 1SOUA 3C3JA 3ZDFA 4IIEA 4X1OA 2CF5A 3GGSA 3GRKA 1P0QA 4N82A 1FSZA 1F3OA 3HA7A 1R0KA 4JBIA 4R9SA 3ZXIA 4DY6A 4U8HA 4NMLA 3H5RA 2BEUB 4ZOCA 4Z4GA 1M2FA 1XL0A 1IHYA 3BWCA 3IO5A 4EHNA 3H4IA 4B3HA 2C03A 5KCMA 4CU2A 2YWHA 8OHMA 1O94A 5LQNA 4BQFA 2ODNA 4G07A 4J43A 4GR5A 4TKVA 3AESB 1HTBA 1OXXK 4ARVA 3BL5A 2GZAA 1KWKA 1K9VF 3BJEA 2REQB 1ISGA 1FRZA 1NFFA 3LZDA 2FN8A 1GPKA 4F2GA 3NKLA 4ZGBA 3AKZA 4TZ0A 3VZSA 3GK3A 3QYPA 3QXHA 4K9NA 1J49A 1RM4A 1K4KA 2AFVA 3AHGA 4FYIA 2HK9A 3ITKA 3DL2A 4R68A 1SR8A 2FPMA 1XTUA 1M2HA 2WZDA 4AJJA 2VQDA 2F55A 3COVA 3E7DA 4M8IA 2PD4A 3OPMA 3PNBA 2P30A 4R9VA 5KNDH 2WLTA 1J5XA 4M1WA 1Y1LA 4H35A 4BGUA 3TMYA 1E7QA 1NUPA 3S2GA 2MU1A 3D4NA 4J4BA 2CUNA 2O07A 1OB5A 3LKZA 1UBOS 2GTPA 1I10A 4KXLA 4UEQA 1FMLA 2OO7A 1SVLA 2FFAA 1VCOA 1YMQA 5T3YA 1LKZA 2ZIFA 1AZSC 2PKWA 2DKOA 4OXNA 3ZKAA 7ABPA 3WQSB 5LOVF 2EKZA 2DFKB 4D4HA 5CB8A 5HS4A 4DDTA 1CE8A 1TLTA 3WK8A 2XKKA 2AA3A 3UUWA 3VAZA 1E2FA 2J3KA 2YX1A 2HPZA 4UQOA 1IDOA 5CNMA 3LT1A 5LPNA 4MB6A 4CHTA 3G0DA 2AC7A 3ND9A 4AKIA 3VJKA 3A1DA 4AP5A 4PAWA 4X7MA 4EG8A 3SQNA 2GZ2A 1VYVA 1KKMA 2GPYA 4FDVA 1MABB 5BXYA 4G8DA 1PWHA 5A71A 1XDWA 3H8WA 3JQAD 4AXBA 3AVOA 1ODLA 3K09A 5G3ZA 3WZ2A 4EG0A 3IP6A 1WV0A 3DQZA 1VHDA 4GOJA 4KI7A 5I7OA 1DL5A 2KW5A 1DKQA 1WXHA 4K40A 3TJMA 1A72A 3SE0A 4MRPA 1XCJA 1QP0A 1Z34A 5AI4A 5H9VA 2I2XB 4YRNA 2DUNA 2FOIA 1YDEA 4FGKA 1KGDA 2W98A 3N6VA 2F90A 4WK2B 4KQXA 4YT2A 3A6JA 5J9FA 4YMVA 3AI7A 2ODPA 1TPYA 3H9QA 3P96A 1BOFA 2JI8A 4M83A 2ZUCA 3UV3A 1W73A 1U0HC 4XJSA 1ONOA 3ZU5A 1P80A 2KBEA 4H1HA 1ISMA 4N40A 4RYLA 4FCCA 2WFAA 1XNRB 4BLVA 1LPOA 3OFND 2IEBA 2Q6IA 1SCAA 3TDNA 1ZLXA 2ARKA 2GXSA 2A8YA 2QVBA 3I39X 3FBTA 3ZGYA 3SQWA 3GA0A 2CUTA 3D6AA 3GUHA 1STOA 1G8KA 4ITRC 3TW8B 4GZ3A 4JR0A 5D5PA 3F46A 4L3VA 4UHEA 1RHRA 3G2IA 4DNXA 3TDKA 3N5CA 2Q5FA 4P36A 3P0IA 2JLSA 3GD7A 4P5EA 4PC1A 5B4VA 4TKLA 1N7IA 1ZJYA 2C95A 4G89A 2P9JA 4OV6B 3UWOA 2ORED 3WQHA 2PH1A 2QM8A 1WQ1R 1ORWA 4ISBA 1XZMA 2LCFA 3GG9A 5H83A 1DO8A 3UT5B 3Q6MA 3QE2A 1PG2A 4FCVA 4WOBA 3RT1A 4LNAA 3C5HA 1U5BA 3ESZA 4QPPA 1K6EA 1TE2A 5FBRB 4HAZA 1IN4A 1LS6A 3G7SA 1RJEA 5L3QA 4YJ2A 1IK4A 1NMEA 1X9GA 3ESQA 1ZUIA 2Z8YA 4CM8A 3GDFA 3IBTA 4GLJA 5A6SA 4L2IB 2W2KA 5B53A 4QHTA 5AKXA 3U40A 3W8NA 1L8QA 3HVRA 1XTQA 2HEIA 1XJWA 3N0VA 3RRJA 1IY2A 1NW6A 4H77A 2C2ZA 1KE2A 1KEWA 1XRNA 4Y2PA 1P2FA 3LL7A 2FEOA 2RKWA 4GBED 3MWDA 1QVRA 4CMHA 1MTOA 1JLLA 1XP8A 2AHRA 3PPXA 1EFVA 1B8NA 1NPYA 2PYZA 2QD2A 1VJTA 2ZVQX 3ZH2A 1ZVVA 4RFLA 3GT4A 1YK1A 2ZSHA 1U5AA 5J5VA 4MZDA 1QIGA 1WABA 4RGVA 3RD5A 3VH3A 1W85B 1TEXA 2JFGA 3FNRA 1O94D 2HADA 1IM5A 2BSAA 2I7DA 3FCCA 4GM4A 5DP1A 1P81A 5EESA 3SVTA 1RHMA 2CUKA 2VK8A 2D5IA 4I3HA 3ISVA 1GPYA 1HETA 1KK1A 3I9MA 2CL7X 5FWAA 3S0JA 3QEJA 1RJWA 3MS7A 3GP5A 4OK5A 4X93A 1OVGA 5KMGB 4UZFA 5GIOE 5IM5A 5KYUA 2ZSAA 4QXQA 1TA4A 3KVNA 2H4WA 1GYPA 4V24A 4TUYA 3DL7A 2OBMA 1TF7A 2CJFA 2XRFA 4KE7A 4B5LA 2XZLA 2YNMC 4HDRA 1W44A 1M2EA 3WGJA 3PCRB 4PO3X 3Q8XB 1H3NA 2DKNA 1VG8A 3EZ9A 5A1TA 3JCZA 4L8GA 2XIQA 1IBCA 1V71A 2VDVE 4II3A 5AXDA 5HDBB 1O54A 1J99A