3A1VA

Crystal structue of the cytosolic domain of t. maritima feob iron iransporter in apo form
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
254
structure length
252
Chain Sequence
HMVKVALAGCPNVGKTSLFNALTGTKQYVANWPGVTVEKKEGVFTYKGYTINLIDLPGTYSLGYSSIDEKIARDYLLKGDADLVILVADSVNPEQSLYLLLEILEMEKKVILAMTAIDEAKKTGMKIDRYELQKHLGIPVVFTSSVTGEGLEELKEKIVEYAQKNTHRMILDYGEKVESEIKKVENFLRDKKLRINPRYFALKYLSGDPEFYSEGVKLGLPELSEEERIGYRLLIAKRKREYVENVVKEAFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of novel interactions between the small-GTPase and GDI-like domains in prokaryotic FeoB iron transporter
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transport protein
molecule keywords Iron(II) transport protein B
total genus 87
structure length 252
sequence length 254
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02421 FeoB_N Ferrous iron transport protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3a1vA01
2CL6X 1W48A 1Z2AA 1G7CA 4FCTA 4RZUA 3C16C 4RZ3A 4OQMA 3EIEA 4BFSA 4DSNA 4HDCA 2OCYC 2F1JA 4A82A 2ZIAA 1KO7A 2BMJA 2ZEJA 4PO9A 1W47A 3HPRA 3SFZA 4NCIA 1FW6A 1QF9A 1XTKA 2ZREA 5DYIA 4DB2A 3HWSA 1XMJA 5BYKA 2VP6A 4ZPXA 1GIAA 1Z22A 2WWGA 2ORVA 2QGNA 4EPRA 1JR3E 4GFDA 2H57A 2ZSFA 4TYNA 3Q5DA 2WSSD 4P3YA 2UVQA 4BLRA 2CJWA 4TQ9A 3BH6A 4FMCF 2ONKA 2RGXA 4N3NA 4JVMA 2IS1A 4EKDA 1KDRA 2QMUA 1AA9A 5CK5A 2MSDB 3FYHA 3WMGA 5HKKD 3B60A 3K1JA 2DB3A 2YC2C 4CDGA 3A4LA 4XVUA 1W44A 3WHKA 3WYFA 2A7QA 2WWHA 4PQYA 3WYGA 1ZNXA 5JHHB 1T9HA 2CDNA 5JFGA 5K8UA 3A6PC 4EPWA 5BN4A 4HUQA 4D25A 1ZNYA 4JBYA 4LWZA 2QENA 3BBPA 1ELOA 1YR6A 1RYFA 4BWYA 2CVHA 3CRVA 4KITB 4GL2A 1CJVC 3A4MA 1YZLA 2R8RA 1LF0A 2AFIE 1S1MA 2XTMA 1A5TA 3OIUA 5G53C 2WJYA 4TQUS 1M7HA 2IYYA 3UMRA 2O5VA 1S0UA 2J41A 1MABB 3RHFA 1UBEA 2PEYA 5J4LA 4L4UA 4RFSB 2EFGA 3CH4B 2B8WA 3CX8A 1W4AA 5KOYA 3V4RA 2ZUCA 4DT1A 3L0SA 3AP1A 4LJYA 4ZO4A 1ZM4A 1HT2E 1Q3TA 2JLRA 1E9CA 4ZDKA 3BH0A 2FX3A 4V0ME 2ODEA 3H4MA 1ZM9A 4L9SA 1UBCA 2QA5A 1H8HA 2W0SA 4FMBB 1OPXA 2ECKA 5L3QB 4XSGA 1W49A 2WJGA 3BB3A 3CR7A 3PJRA 1GRQA 1OFUX 1TQ6A 2FN4A 4JJZA 4NYMR 4DLVA 1UPTA 4QG7A 4GDFA 5AWFC 1QZXA 5J40A 3QKSA 2FH5B 4LHZA 4Q9LA 421PA 1JQJC 3OEHA 3CX7A 2VP4A 5F3WB 4JSTA 2GAOA 4D6PA 2CNWA 3VU9B 3CZQA 3BE4A 3EAQA 4Q4HA 1CRQA 3GFPA 5TXGA 1M2OB 1EGAA 1D5CA 3W6NA 5FI0B 4M1WA 4MKIA 4I1UA 3QKTA 1U0HC 3UG6A 1ZYUA 3VR4A 1OB5A 4LDJA 2QAGA 2VP2A 2WKPA 5TB5A 1GDDA 4TMWA 4EFLA 1N6LA 2FWRA 2QAGB 5SZIA 1AKEA 4DCTA 2HDNB 3KKPA 3WMFA 2QP9X 3VX4A 3GJ7A 3OAAD 3K9GA 4GBMA 1GNQA 5F2EA 1NMZA 1OV4A 2XTZA 3AUXA 3R8FA 2JJ1A 4RFSA 3LVRE 2ORIA 4DBLC 2F55A 3QOFA 4A9AA 1KNXA 3ADDA 1PVOA 4HAXA 1NVWQ 2GKSA 3RWMB 1ZD1A 3IILA 1ANKA 2F43A 2JDID 2CHGA 1DAMA 2OFOA 3I32A 2KWIA 2P2LA 4OQXA 3DKPA 3FB4A 3VFDA 2DWQA 4JVLA 3LA6A 3B13B 1G8GA 2YC4C 1J2JA 2AR7A 521PA 4B6EA 5K8IA 1DBSA 2QQEA 4B76A 1SXJE 5L3SB 3G82C 3I5XA 2WOJA 4DLUA 5AK0A 3SR0A 1W0JA 3K0CA 3WBJA 2C95A 1GTVA 4D0GA 2XEXA 2IWRA 4MKGA 1E1QA 1M7BA 3WP1B 3AVVA 1CKEA 3FKSA 4FCWA 3C5HA 2C9OA 4AYWA 4LV8B 1NL3A 5KSYA 2CVFA 3W6PA 4AYXA 4CGZA 4BZXA 4LGMA 3E2IA 3ONWA 2ZRMA 1JPJA 4US1R 1JPNA 3D31A 2JLQA 3K9NA 5A5GA 2ANBA 4LK2A 2O8CA 4YONB 3LH5A 2JLUA 4QGHA 1U0JA 3LQQA 3REGA 1US8A 5FBLB 2JCSA 4CEJA 2OE2A 3ZVNA 3PCRB 1FQKA 2G3YA 3KTAB 2YZ2A 1FUKA 3IHLA 2GZAA 2GNOA 5TVKA 3RS0A 2V1UA 4AI6A 1U81A 2JATA 1QHNA 2OXCA 1XBTA 4H1UA 3TAUA 3A1SA 3EG5A 4IDOA 5DIFA 5C4GB 1PJRA 3ZGXA 5K8LA 4W7SA 4Q5IA 1VHLA 5G3ZA 2ZAMA 5LDDC 1EWRA 5FUXA 2XNDA 1B23P 5KDDA 4IOKA 2RGEA 1R5BA 3QY0A 2F43B 2FU5C 1IN6A 3ZZ0A 2XXAA 1HA3A 2GXAA 1N5IA 3UG7A 1XJ0A 3FKQA 1E2EA 5CK4A 4C7OA 1G8YA 2O8EA 1KK0A 1HE8B 2FGJA 2ZAOA 3MGCA 1A2KC 3IIKA 1OFIA 4AKEA 1SXJD 2H18A 1ZBDA 3O8CA 2DFNA 5J4VA 2X2FA 1CRPA 3OHMA 2D4HA 4GOKA 4UXIA 5J5CA 3TGPA 4F7WA 5JECA 3M1IA 1ZIPA 4ZI2A 2GCOA 3A37A 4PQFA 1Z6XA 4OHWA 1ZNZA 4TMZA 3V4FA 2XNSA 4CRWB 1KDTA 4A6XA 4URYR 2BMEA 4G5GA 4A1FA 1QHHB 1CIPA 2BV3A 1RJ9B 2J45A 1UEJA 4FINA 2O52A 3NWJA 1YR9A 1P62B 4OI1A 1M6NA 2TMKA 1N6RA 4FMDB 4JVSB 3EIQA 1F48A 2NG1A 1E1QD 1J7KA 2Q0HA 1KZ7B 3RS5A 3TSZA 2PJZA 1W0JD 2CK3A 4I1VA 2XB4A 3OF5A 3RLFA 4BGDA 1N5LA 3QKSB 1G8PA 2R44A 3HR8A 4LPKA 2FJUA 3TUZC 5EJEA 2JLYA 4GNKA 1NY6A 3THYB 3FFAA 4M2LA 4ON9A 3RC8A 1GUAA 3TK1A 4RD1A 1OFTA 4AK9A 4C0SA 1XPRA 2PL3A 5FBQB 1M7GA 4HUTA 1T3HA 4QKQA 4ZV4A 4CZ2A 2DR3A 3KQLA 4LBYA 2WJVA 2CXXA 4HB4A 2REBA 2WAYA 3GP8A 1BO6A 1F2UA 2GESA 3I73A 2RHDA 1VCMA 2ZRKA 2JDIA 1Z6YA 2B92A 2JA1A 3VNUA 2O8BA 3U3RA 2V54A 1QHXA 2QEQA 2VSXA 3EZ6A 3LW7A 1ZNWA 4QBHA 4WOPA 4GI7A 1OIXA 4TLDA 4B2IA 5KHOC 5JRZA 4U7DA 3RANA 1EWQA 3KFXA 2QBYA 4PZLA 2GXQA 2V9PA 2ZJOA 1GL9B 3AF3A 1XX6A 4F93B 4PSVA 4MGYR 4B35A 1Z47A 2WWIA 4JKIA 1L8QA 3NC1C 3W5JA 3U61B 3KFVA 3EA5A 3Q5EA 5B64A 1JI0A 4DCUA 2RMKA 3J81k 4O2LA 4HLQB 5EP2A 2JEOA 5LB2A 3RC3A 3B7GA 2R9VA 4BLTA 3GLIA 4IDNA 4BLPA 4LHYA 3QQ5A 3EPHA 1HQYE 4FIDA 2QNRA 2CNWD 1GKIA 4TLCA 2FFHA 2J46A 2A9KA 2NTYC 2ODNA 1Q57A 3KXLA 2A2ZA 4AKHA 3LLUA 1Z3IX 1Z0AA 4ACBA 3R7WA 3DOFA 4DIDA 3PITA 1V43A 2OILA 1W36C 1M8PA 2BCJQ 1HURA 4PHHA 4TSFD 2HYDA 2ZRGA 3CRMA 1SKYE 4TTPA 1E69A 1W4CA 1T0HB 4AKGA 3CKLA 1DAFA 1II8A 3GQBA 2XZLA 4MRRA 4JLOA 3MCAA 1T6NA 5L3RA 3CW2A 4IEIA 1LS1A 3IQXA 4K8OA 3T34A 2ZJBA 5A4JA 3BFKA 1E9FA 3BERA 4MYTA 3VR2A 3L82B 3O47A 4EUNA 2VL7A 5A0FA 5EE3A 1U8ZA 4QJ4A 4IXMA 5HCNA 5KPJA 3LWNA 621PA 1CLUA 1Z28A 4HDOB 2MMCA 1NRJB 2FEOA 2Y8EA 4R2IA 4KFTA 2GTPA 3TSWA 5JSZA 3THWA 4N1AA 3SJBA 1IN7A 2IXGA 1GL6A 2VP5A 2Q21A 1F2TA 2HJGA 4LJ9A 4DC9A 2GJSA 4YMUA 4XTCS 5H8WA 2AXNA 1XCGB 3GEHA 1XD9A 2KB0A 3UKDA 1FP6A 1NJGA 4URUR 4F92B 3ZDQA 2ZSBA 1XCPA 4LOAA 3QPWA 4FN5A 1OFHA 2OFWA 3QPVA 1UEIA 1YZTA 3GJ4A 4QJ5A 3AKEA 3N2IA 5F98A 3ND8A 3P27A 2JJ8A 1DVRA 2ZSEA 4YXWD 4A8JC 1COWD 2G88A 4Q4LA 2NQ2C 1XPUA 3ADBA 2N46A 3BORA 1N5KA 1A1VA 2C9CA 3HJNA 4AG6A 3W6OA 3X1ZA 1OW3B 2ODBA 2OBMA 3TKLA 5JRJA 2D06A 4I81A 4DSTA 3AM1A 2CLDX 2WSSA 1S96A 3LBIA 4TZ6A 2DYKA 3AEZA 4HLUC 1UFQA 4LV5B 4NCHA 2IC5A 3RABA 3A1VA 5KNBA 4JBXA 3TW4A 2BJWA 3PV0A 4D81A 1ZRHA 2QT1A 3MJHA 1S1CA 3PUXA 5CLLA 1IAQA 4IDHA 4Q1DA 4DLXA 3OFNA 5FFMA 3P1JA 2GCOB 1LW7A 2IYUA 1NVVR 2QRNA 1KI3A 5LB4A 1CR0A 3RYTC 1KY3A 4BUJA 5CDFA 3TQFA 1H65A 3CNNA 4MITA 3GPLA 1IY0A 3KKQA 2PLRA 3TAHA 4B71A 1UKYA 2ZITA 1S3GA 4LJAA 5LD2C 2QQ0A 2QP3A 1FPMA 4HLDA 3IIMA 1LNZA 5EXTA 2NO0A 4BE7B 1T3LA 2L0XA 1Q1QA 4L16A 4G5RA 1F2TB 1P9NA 4JJKA 3AVWA 3U3KA 2CK3D 4JL6A 3AVYA 4HYYA 4V0NA 4F4JA 2D74A 4A6PA 2J0UB 1JNYA 1O87A 2XSZD 2ZE5A 1E94E 2WPDA 4Z1MD 4C9BA 2HXYA 2JASA 3I92A 2IXEA 5C4MA 1Z6GA 1R8QA 4DRZA 1P6XA 2CE2X 1E1RD 3IEVA 1WP9A 2ZRFA 3U44A 3ZD6A 1ODFA 1AJEA 3R9XA 1VDZA 3NHBA 1XTSA 3C4JA 4W5HA 1SKYB 3L0PA 5F9HA 3NEYA 1X6VA 4C2TA 4ASUA 4V0LA 2PZEA 3FDIA 1W2HA 3BK7A 2KBFA 5DGXA 2CLCX 2MSEB 1QHSA 1SXJA 3PFIA 2GBLC 3I72A 3ZZTA 2J7KA 2RGAA 1VIAA 1E2QA 5FBRB 1NBMD 1KO5A 3OIWA 2LKCA 2XNDD 2X1VA 2JIZD 1R6BX 2X19A 1DAIA 2NIPA 2WBLC 1FZQA 1T5LA 4OK3A 1CJKC 2PT5A 1TADA 4XWOA 4BEJA 5EE9A 4PPFA 4EPXA 4GOXA 2IYQA 3NBZC 1BYIA 2H1LA 4LC0A 4WVFA 3FMOB 3CRW1 4M8NE 4NZYA 1DPFA 3P26A 2GWHA 1SHZA 2QY9A 4GP6A 1WF3A 2PMDA 1EESA 2V6IA 1MT0A 3Q9LA 2QUZA 4Q1FA 2XZPA 2A5GA 4Q9IA 5E7IA 2GF0A 5EUQB 4NTZA 4YMTA 4M9XA 1FX0B 2AWOA 2F7SA 3GEEA 3ND9A 1P7CA 2EQBA 5FI1B 1SHKA 4AYTA 2IX3A 3F3YA 2YWGA 3U7EB 4JKYA 1ONBA 3L43A 2IW3A 1OH8A 1MO5A 4DUGA 2HV8A 3Q85A 1KAOA 1NVVQ 4Q9JA 3TNFA 4RJLA 3F8TA 4RY2A 2KE5A 4ZDJA 3AQ4A 3E1SA 1UKEA 3IGFA 5TV2A 1XMSA 2FSGA 1G3QA 1TAGA 3TJZA 5SZJA 2GZDA 4GMDA 3SE0A 4PFSA 4E09A 4NCNA 1L7VC 2Z0MA 4OJQA 4Q21A 1YRAA 3CH5A 2OFXA 5AJYA 3TR0A 4ESVA 4LJ6A 1GFIA 4OK6A 1EFHA 1LB1B 1RRPA 1KI9A 3KUDA 3CIOA 3WYAA 5LBIA 4DWJA 2D2EA 3NG1A 5DI3B 5B30A 1JXMA 2OSBA 3K9LA 3WHLA 4CEIB 4Z54A 3KDSE 1RRCA 4EAQA 2Q9CA 5JWRA 2O8FB 4KFUA 4BLSA 2PT7A 3I62A 4YDSA 2IUSA 3ZVLA 1WDTA 3I3SR 2BBSA 1F3OA 4IOLA 1VPLA 1Z29A 3MFYA 4RCYA 5TMPA 1Q44A 3A1WA 1CEEA 4HZIA 2GBLA 4QGAA 2OAP1 3NBXX 4YLGA 5BQ5A 4MDEA 4B6FA 2C78A 1EX6A 2HUPA 4MKFA 1W7AA 2CCJA 2UKDA 3W8RA 1OXSC 1L2TA 2VEDA 2PH1A 1PV4A 2ZJ2A 2XGJA 2VYFA 2QRZA 3HU1A 5CB6A 3LV8A 2ZPTX 3RS3A 4BQSA 5BW8A 4NE2A 2QTHA 2BMFA 2H8KA 1NLYA 1ZP6A 3H0KA 2IHYA 4LJ4A 2W58A 3EC2A 1N6OA 3H2YA 5EXSA 2OT3B 2VBCA 1SXJC 3PUZA 4O3MA 4LYAA 4NYIQ 4B2PA 1ZU5A 3K0AB 2ZRCA 3HU3A 3W3ZB 2DHRA 2BEKA 4OL0A 4WW0A 3CPEA 1VG1A 2CEAA 4E22A 4CEHB 1CF4A 1EFCA 2IK8A 2ZRAA 3PXGA 1BKDR 1EFUA 1JECA 4ARZB 1W36B 1J8MF 2KBEA 3NDBB 1XWIA 3PG5A 1H8HD 3AP2A 1KI6A 4MDFA 3U44B 1IN8A 4Y0VA 4OKSA 2O8DB 4BZPA 4FCVA 1J90A 4F91B 4DLSA 4HSEA 2GA8A 2YV5A 2C99A 5C46F 1X86B 2P6RA 3EPJA 3EX7C 4KI0A 4NYMQ 3AGQA 1E2MA 1NKSA 2G0NA 1Z5ZA 4TMVA 4KXFB 2AL7A 2GHIA 4U00A 2Z4SA 1E9AA 4PR0A 1ZUNB 5G3YA 4D0NA 4KVAA 5DO9A 5CITA 3IEUA 2FDCA 2HJVA 3W8NA 4C0BA 1TQDA 2W6JD 1G7SA 2A5JA 4NCKA 4TYQA 4PX9A 4IVRA 1E9BA 1G6HA 1CU1A 2PZFA 1GILA 2ZRDA 1TF7A 4DLWA 4V03A 4PSKA 1YE8A 2BOVA 1G5TA 5AJWA 3IO3A 1I4LD 4LZZA 4JT2A 4LYHA 4OQFA 3RSOA 1CR1A 2D2FA 2AD1A 3EIHA 3C15C 1E2KA 1Z2CA 4MGIR 2NPIA 2FZ4A 3BH7A 2OM2A 4NYJR 4S2EA 4NYIR 3GMTA 1N2CE 1AN0A 1Z07A 3AV0B 1E79D 4B3FX 4LSGA 3RRNA 5AUPB 3FHTA 1XTQA 4L5BA 2ZYWX 1CP2A 1HT1E 4FWTA 3VX3A 3LD9A 4F4IA 3GFOA 2FF7A 4X8LA 3VNVA 1GAJA 2XB2A 2DFTA 2UZIR 3C5CA 1RKBA 2IYWA 2IXFA 1VYUA 1XRJA 3BGWA 1W5SA 4JLPA 4PAQA 4PO8A 4UKDA 4CT4B 2RGCA 2QL6A 4JVNA 2FA9A 4B3CA 3OEED 2CMKA 5L3VA 2X77A 2EFEB 2K5UA 1ZINA 3CX6A 3ZLJA 3PR1A 2EFCB 1FUUA 3I4LA 3EZFA 2W6ID 3NEJA 1T3SA 4DDTA 3AVQA 3E5HA 1N6KA 4JBWA 3U7FB 2PLFA 4PPNA 3NH6A 3WXMA 4Q9KA 5D3MA 3ZYCA 3EW9A 3QIAA 2JGNA 1CS4C 2XJ9A 4RKFA 1U2RA 2Q3FA 2D62A 3RNLA 1IY1A 1OXVA 2BC9A 4UNPA 2DWOA 5GADl 4PHFA 4WZ6A 1IOZA 2VSOA 2ZVPX 3T1QA 3UK6A 3FVQA 2YYZA 3PVSA 3M0EA 3FMFA 5DNYB 4NU0A 4LI0A 2XXAB 1KI8A 2KJQA 5BXQC 1SVKA 2BJVA 4Q03A 1X8LA 1DAHA 2C2HA 4EQ6B 3KL4A 2NO7A 4DZZA 4MUAA 5JSZB 4Y0AA 2FPKA 4RVCA 1U94A 4MYUA 1W5TA 1NY5A 5KDOA 4CYMA 1WBBA 3DKVA 2WHXA 2R65A 1GITA 1G21E 4M9ZA 4DDVA 2W2TA 2FE4A 2VPPA 3AF4A 2MMGA 4P4UA 2REXB 4BFZA 5CJPA 4TL8A 1ZM7A 3CBQA 2O8CB 1DARA 1H8EA 1OB2A 3UANA 2GRJA 5B57C 3EC1A 2VA8A 3S1AB 2EW1A 4PHGA 2ZU0C 5JBQA 5FUWA 4D80A 5FUYA 2C8VA 3CONA 2CE7A 4TMTA 3ZS8A 5FBVB 4PSAA 4YDHB 4PHTA 1XF9A 4DKXA 1EX7A 2IYXA 4YQFA 4DLZA 1E98A 2HCJB 2FOLA 2ZVQX 4HLCA 3KKOA 3SJAA 1TTTA 3UMFA 4B47A 4IDPA 5HE9A 4IFBA 4MRPA 3SJZA 1K5DA 2O0KA 4JLVA 3BWDD 2WV9A 3R8CA 1LFDB 1BMFA 3W5IA 1OLOA 4AC9A 4QNRA 4E03A 3QF4B 3KJEA 4LC1A 2CL0X 2O0JA 3QBVA 1VECA 5JI2E 5GVSA 2BM1A 1TL7C 3TR5A 3VR5A 2E9SA 4A92A 1KSFX 4BZQA 2AFHE 4NH0A 2O8FA 5JJKA 3B1XA 2WZQA 2AKYA 1G3MA 1VHTA 4LBWA 2YWFA 5KNCA 4O25A 4QXAA 2A30A 3TIFA 4GP7A 2V7QA 3SQWA 2ZI9A 2W0MA 3FPAA 2YNMA 3O8DA 2V3CC 3PUWA 4IOMA 4DVGA 2QAGC 2FSHA 3FHCB 4XD7A 1GL7A 2ODWA 2BDTA 2R6CA 3BFXA 2WM9B 3DMNA 4HAUA 5FL7A 3RVBA 2ZM5A 1KSJA 4ZDIA 2FZLA 4OJKA 1Q20A 3U2QA 4A36A 1G4UR 4C0HA 2DBYA 2WOOA 3U6KA 1KNQA 2C77A 1OSNA 3BC1A 4LJ7A 3SBEA 3B9QA 5GJWC 2VP9A 3SEAA 2BBWA 4NKRA 4BECA 3RDPA 4D4LA 1KKMA 3QBTA 3LVQE 1XZPA 3QXSA 3CPJB 4XJXA 5EZ5A 1YHNA 5CJ2A 2RCNA 2XOKD 4M1SA 2YJTD 3L2OB 1EXMA 3K0FA 1SVOA 2A3RA 3C8UA 3LY5A 2J7PA 1P4SA 4S35A 3SYLA 3IO5A 3TBKA 4Q7LA 4Q4HB 4E5UA 1D2EA 4G5OA 5CM9C 2WIAA 4BRUA 1DELA 4JL5A 3GCGA 2AHOA 4DJTA 3TUIC 2VP0A 1R2QA 5KO2A 1N25A 2AK3A 3WP0A 1SGWA 3IQWA 2DFKB 1N6NA 3SQXA 1G17A 4LV6A 4IKEA 3MRSA 3BFVA 2P5SA 1XMIA 4PC6A 2IEZA 3GFTA 4TL7A 2R2AA 2F3RA 1G4AE 4JYCA 4GZMA 3VHLB 1P72A 2OZEA 2X2EA 3QF7A 1E9RA 5FPTA 5J4HA 3DOEA 3TQCA 5EE5B 3WRXC 4Q7KA 2OXRA 3A1UA 1EG7A 3IDQA 1D8TA 5KUTA 4QBFA 2OCPA 2Q9AA 1C1YA 3B78A 4M9QA 3T12A 1ZD9A 4LYJA 3ZVMA 2RGNA 3BJIC 2GJAA 2IYZA 5B2ZA 4D4MA 5IK2D 2WJIA 2XITA 1JALA 3QKUA 4EFMA 4NP6A 2BBOA 2WWFA 1N6PA 1XFAA 1P75A 2QROA 1CR4A 4AIIA 2OUKA 4PXAA 3THXB 4TYWA 1IJFA 1TUEA 5JEDA 3Q8XB 4A4DA 3T15A 1LY1A 1N0UA 2ZANA 1KAGA 4HZUB 4RFVA 3TRFA 4ARZA 4XVRA 3QUSA 3MWKA 2ZI7A 4M22A 2VRWA 4GSYA 1E96A 1A7JA 1KIMA 3ZH9B 4POAA 3EWSA 3EASA 3WNCA 4HZUA 3UXMA 2NZJA 2ZYTX 5SZKB 3B85A 3CZPA 1MRSA 1KI2A 1T8TA 4C7OB 1IJEA 4D4KA 4QHTA 1U8AA 1P9WA 3L0OA 2VSFA 3MWJA 5AJXA 4TMXA 3AF2A 1T4GA 3K53A 1ZUIA 4JLBA 4P4SA 3DHWC 3TE6A 2DY1A 2XX3A 1L4UA 1QHHA 3ZS9A 1CJTC 4QHSA 1K8RA 1PLJA 1OKKD 2WJHA 4JIMA 5EUMA 4B3BA 2F9MA 3L0IB 5DI9A 1XXHE 3TSOA 4Q66C 1E2FA 2JLSA 4QNMA 2BIFA 5JWHA 2J5XA 1T0JB 4KBGA 2RGBA 1SVMA 5AUOB 1TF5A 4WA7A 2OBNA 5AUQA 5BN3A 4ZKDA 4FWIB 2GETA 4NONA 4OQLA 6Q21A 2NPFA 2HT1A 3GLFB 2IS4A 4BEBA 3LAWA 1RVDA 3MMPA 2FSFA 1G64A 2V7QD 5AR1A 3SYKA 2I3BA 4GOJA 2BMDA 1OJLA 2QPOA 2YOHA 3OE7A 2BVNA 2RGGA 1X3SA 1IN5A 3B5JA 1AS2A 3LW8A 3QEOA 2VHTA 3PEYA 3SC3A 2Z5FA 4CVNA 4OHXA 2ZR0A 3ADKA 3LO5A 1DOAA 2PEZA 2VHQA 4M1TA 1E32A 1Z08A 1R10A 4TYYA 2ZJ8A 2IYSA 4BFVA 4C0QC 3SS8A 2F1RA 2AK2A 4PC2A 1S3SA 4O2RA 1ZCBA 2J87A 2EYUA 3A58B 3K09C 5CDFE 1G3UA 1XTIA 4BFUA 3GLIB 2PCJA 5DN6A 1IHUA 3LXXA 1ZMXA 3P4XA 3CO5A 3VR1A 4BRWA 5TARA 2CHQA 2I1QA 3GEIA 1XEXA 1CXZA 3C14C 3I61A 1SVSA 1M74A 4URWR 2HF9A 5FH9A 1EK0A 1N6HA 2ATXA 2ZRJA 4C30A 2OEPA 1AIPA 3LX5A 1UKVY 3AH8A 3ECCA 5J4KA 2GDJA 2J9RA 4EJSB 4OI0A 5D3QA 2V6JA 4L9WA 1P2SA 4EJSA 3NBYC 3C41J 5HE8A 3C7KA 4EPYA 5TY0A 3VKWA 2FNAA 2IYTA 3GLIE 3CF2A 2QTFA 2Q9BA 3GD7A 2AN9A 2W2VA 1DAKA 4ZI3A 4MKHA 2QM7A 3AP3A 3H84A 2CLSA 5FTJA 2QE7A 3LLMA 5EXXA 3FMIA 3OZXA 1R0XA 3SYNA 3K70C 3QEJA 4M1KA 1U90A 4R7ZA 5SZHB 1A82A 4UNSA 121PA 5TDHA 4Z51A 1I4DD 5K8TA 3IBYA 1AS0A 2PBRA 5G40A 2QPAA 2VHUA 4Q4AB 1XXHB 2IWHA 3Q7QA 3MG9A 4QC2A 5JMTA 3D3QA 3ICEA 1RRGA 1R4AA 1QVRA 3BXZA 3DM5A 1PUJA 4LJ5A 1QHIA 1P2UA 5H1YA 3QVVA 2ZE6A 2JLWA 3A4NA 2GEDA 1NLFA 3B1VA 1ESNA 2QE7D 1KMQA 5EP1A 1VG9B 1G8FA 4MQBA 4JZKA 4TT3A 1I2DA 4WAUA 4Q4AA 1E2HA 1E4YA 4V02A 1II0A 1Z63A 2P0EA 4Q9HA 4MGZR 4BPBA 2A5YB 2W6IA 2GCNA 4ERNA 2RAPA 4GRAA 4EIWA 4HB3A 1KMHA 4ESHA 1L4YA 3X2SA 1EFRA 4IW3B 4DSOA 3VR3A 2J1LA 2RHMA 4RZ2A 3EPKA 1PLLA 1W46A 3AF1A 2EU8A 1LTQA 3PUVA 3B82A 1K6MA 3AGPA 2JJ2A 4H1VA 2QI9C 5FPSA 1JAHA 1RYHA 4TTQA 4KFRA 4QM6A 4TLEA 3OESA 3EZ7A 1AK2A 3KKNA 1IBRA 3CUEF 4ZDWA 4D4JA 4I1SA 2H92A 4WXPA 1ZIOA 1E79A 3FMPB 4US2R 1KHTA 2QU8A 2OLJA 3HPQA 1U8YA 3E70C 3SNHA 1SVLA 3V00A 2WMOB 3QXJA 1MKYA 1XXHA 4UXJA 3CB4A 1UADA 4R2HA 1Z6TA 1QHYA 2J3EA 3MLEA 3HP1A 1RRFA 4XOIA 1QRAA 3WY9A 3QNUA 2I4IA 2QPTA 5FOTA 1NSTA 4JS0A 2FPLA 3VKGA 2W6JA 1E9DA 5KYKA 5FR1A 4ABYA 4HEJA 4QFMA 2IUUA 3UWKA 1AGPA 2GILA 4YC7A 2FG5A 2QORA 1TEXA 1Z0JA 4MRSA 2ZRLA 3DZ8A 4I99A 4B34A 4A15A 1TX4B 1WXQA 721PA 1OKKA 1FL9A 5EXPA 5FTKA 1RJ9A 5FTLA 3T5DA 3R20A 2HT6A 2ORWA 3EPLA 2PCLA 3TUJC 2CCKA 3AKDA 3HDTA 4MRNA 4QOSA 4KSCA 1W0KA 3PEWA 1G3RA 1R0WA 4R71A 2WKRA 1RPZA 1GG2A 2O8BB 1JR3D 3NH9A 3VQTA 3QENA 1NG9A 4HLUA 4JLDA 3KZ1E 4P31A 5KU1A 1QG2A 3JVVA 4KAXA 3TW8B 1F60A 1GNRA 3PEUA 2D7CA 4K46A 4LHVA 2QG6A 4CEHA 1NN0A 4O0MA 2ZJZA 4B44A 4ZCMA 4GZLA 1N6IA 3IIJA 3IKJA 5JZVA 1US8B 3W3AA 3U7GA 5FOUA 1E2PA 5E95A 1TNDA 2IYRA 2RGDA 5JCZA 1AQUA 1T91A 1ZJ6A 3QE0A 2G83A 2WKQA 1SKQA 5BN5A 1A2BA 3UPUA 1J70A 1JR6A 1UBFA 4LHXA 1UDXA 3GJ0A 5DYGA 5EP4A 2IUTA 4MYCA 4P0TA 1XEWX 1P5ZB 1VCOA 2ZU6A 3AVTA 1M34E 1VMAA 4NMMA 1OH5A 1P2VA 1T5IA 4QHYA 1ZD8A 2R62A 2ONJA 1N5JA 3DZDA 2AKAB 1ZW6A 3GLGA 1YR8A 2ASEA 2V4ZA 1WRBA 2KI5A 1KI4A 1OYWA 3GLHB 2WVJA 2PZGA 2ZI3A 2EFHB 4AWXA 1UKZA 3REFA 4A2PA 5ANRB 3EA0A 4KSBA 5FTNA 2BEJA 3TVDA 3ETLA 1X8JA 1X1RA 1KJZA 1JAIA 2RGNC 1KK3A 1KDOA 1YZNA 1U99A 1VCIA 2NO6A 1SQ5A 2YWEA 4P4TA 3LFUA 4CT5A 1UJ2A 3PEVA 5JI3E 3U4QA 1Q12A 5JS7A 4PC1A 4OK5A 1E4VA 5HTKA 4LPSA 1HE1C 1FNMA 4KFSA 4MYHA 4ZCIA 4FD2A 2J7PD 3LBNA 5JWOA 1XEWY 1KJYA 1Q1ZA 3ZVRA 4QJ3A 4QRHA 1XCMA 3DEFA 3P4YA 2ZI5A 4LCBA 4CEJB 2G9NA 4M21A 2F3TA 3ASYA 3F5FA 4KLZA 3ZQJA 1BYUA 2J0QA 1R7RA 4DUGD 1E99A 2PX3A 1Q22A 3PUYA 3T61A 1HUQA 1Z0FA 2QMHA 4OQNA 3TH5A 3U7HB 1DTSA 2HYIC 3KXKA 3KQNA 5HZKA 4UQOA 3I1FA 5JJLA 3K70B 2R6AA 2J0VA 5GJVC 5LPNA 4M0LA 1KKLA 2SHKA 4U02A 3LDAA 2W2XA 2EFDB 4RD6A 4DSUA 3VU9A 2JJ2D 4PAOA 2ZRPA 4F38A 1OH7A 2EWWA 3KJIA 2OBLA 3H1TA 1WE2A 5E4FA 3U6BA 1CJUC 1UDWA 1EFRD 2QZ4A 4BFYA 1P9RA 1W1WA 2P65A 3RRYA 4EJSC 1JEEA 3SFVA 2H17A 4PPQA 4PZZA 1I2MA 3B1WA 3CF0A 2DCUA 2HLDA 3NC0C 4IEEA 3Q72A 4B32A 4BFTA 1YQTA 4B75A 2QMOA 2BM0A 3RSLA 5FOWA 1E0JA 5HPYB 3AVXA 4TT3D 1D2NA 4RZXA 1AZTA 2JIZA 3ZJYA 1E2LA 2B21A 5E7JA 4TQAA 2PJRA 1NBMA 5JCPA 4TTRA 2NO9A 4GT1A 5G41A 2ZJYA 4UJ5A 4N0EA 1G6OA 4IHQA 1J8YF 2ZROA 4RD3A 3ZIAD 2BKUA 4DIEA 1U9IC 4N0DA 1Y63A 1XU4A 3RRMA 3SOPA 1AS3A 1ZUHA 3O8BA 2BHRA 5DISB 3Q3JB 4B74A 2ERXA 3BS4A 1QG4A 1RC8A 1IQPA 3D8BA 2ZS7A 3DL0A 3BB4A 5FL3A 4IFEA 1X8KA 3EARA 1IN4A 3U3OA 1H8ED 5ELXA 3NHAA 4ACAA 1I4TD 4WBSA 2Q3HA 4LYFA 1NMXA 4Q48A 1GM5A 4R9UC 5EE1A 2O0HA 1MO3A 2KSQA 2AXPA 1EFTA 1PZNA 1FNNA 4TL6A 1RIFA 4DXAA 1TEVA 3GLFE 3KQKA 2MSCB 4CF7A 4IJMA 1MR3F 5BWMA 4RD2A 1Z06A 3OIVA 4YMSA 4LBZA 2XZOA 3HU2A 4B3XA 3QSYA 3R7WB 2P5TB 1NIJA 3QXCA 2A5DA 1TQ2A 4KO8A 3ZIAA 4Q19A 4B3GA 4NBSA 5DN6D 4WZBE 1J99A 5FBWB 3PQCA 1DAEA 1Z8FA 2AWNA 4G3XA 2ZUDA 2NGRA 2CJWB 4DCSA 4AURA 2JAQA 2WWWA 3EZ2A 5C1BA 3EWAA 3X1XA 5JLJA 1P3JA 5L3QA 4NDZA 3KTAA 4ZKEA 1KJWA 1NN1A 1G19A 2VIIA 2OAQ1 2WJJA 2ZRHA 3SU8A 4B48A 3V9PA 1YU9A 2N1BA 2IHBA 2HLDD 4PO1A 5HR5A 2VQSA 2R6FA 2ZQ5A 4DLRA 3OFND 4IDQA 3W90A 1A4RA 1PLKA 1G7RA 2ZE7A 3OE7D 3THXA 2C5LA 2GZHA 4LHWA 4LBVA 2G1JA 1NKTA 3RRZA 4Q47A 3X1DA 1CBUA 4M1YA 2FFBA 5FOSA 1AQYA 3BOSA 2OHFA 3LQRA 4ITRC 3NKVA 3ZQ6A 4RD0A 3WBKA 3R9IA 3AB3A 3A1TA 2F9LA 2GJKA 5FUVA 1JXOA 1CTQA 1E2JA 4GPTA 4M53A 3U5ZB 5GJCA 5KTYA 1W4BA 3T1TA 2O8DA 2C03A 1VYTA 4DEXA 3GLHA 3IPXA 2YWHA 4YXWA 2H5EA 5FTMA 2IYVA 2EYQA 4QBGB 1XEFA 4M1MA 3EZ9A 3WNBA 2YOGA 4XSHA 3SBDA 2VTKA 3LBHA 2UZ3A 1GRRA 3IBGA 4LY6A 2WWYA 3PENA 1ETUA 2YVUA 2BBTA 1OXUA 3TMKA 1KTVA 2IL1A 3JVUA 1YR7A 5P21A 1GRNA 4WZAE 1SVWA 3QJYA 2QN6A 3AVUA 2OCBA 3GLGE 2CHVA 3B9PA 1TF2A 4PPGA 3FFBA 2ZR9A 5HZHA 3MWLA 4RSGA 3SHWA 4DB4A 1D9XA 1XP8A 4I1OA 5IT5A 2IF2A 1KY2A 4Q00A 3PIRA 2XAUA 1QHGA 3NTUA 3K0FB 3SDZA 4EFNA 1E9SA 1XB2A 3GJ6A 4LJ8A 4IXNA 2ZS8A 4JLAA 5C18A 2AD5A 1DEKA 1MRNA 1NNEA 4D2IA 5FOVA 1E2DA 1FMJA 2D7DA 4E07A 2N42A 2W00A 1G5RA 4FI3C 2VLIA 1U98A 2G1KA 1ZAKA 1KMHB 5L3SA 1NF3A 1AZSC 2IS6A 1OIWA 1FTSA 1Z0IA 1II8B 4LUCA 4FMCB 3BB1A 2H16A 3CM0A 2Z4RA 1HTWA 2G77B 4XH9B 3THOA 1IXRC 4TSFA 4WIAA 4D82A 4RKEA 4RD4A 2IYLD 4PTLA 1M1YE 2B7CA 1NI3A 1P61B 4X8HA 4B3DA 1MOZA 1KK2A 1GOTA 4KBFA 2IA5A 3KJGA 1BIFA 2G0TA 4MRVA 5DI3A 2WAXA 2ZYUX 3W34A 4DLTA 3DVLA 2E1RA 1FTNA 1XZQA 2GXSA 1OF1A 4D26A 1NBME 1E3MA 5FOXA 1N0VC 4YMWA 4ZIRA 2F1IA 2DFLA 2V8OA 2QSYA 3QG5A 2VO1A 5AJVB 2NMVA 4AD8A 3B1YA 1KZGB 4HAZA 4OHVA 2YINC 3FOZA 3P20A 1G16A 2FFQA 3SN6A 1XNJA 1ZVQA 2PMKA 2ZETA 221PA 2P67A 3HR7A 4A8JB 4Q7MB 4Z8XA 2IS2A 4P32A 4LRWA 5KDLA 1JR3A 1NJFA 2ZR7A 3A36A 5DHFA 2GK6A 4JT4A 1Q1BA 4P33A 1W0KD 4JMPA 2QGZA 1XDBA 2GEUA 4D0LB 4URVR 4Q4JA 1S8FA 4I4LA 2XOKA 4XIGS 4CW7A 4QL3A 4ZCLA 5AJZA 2A5FA 1MABA 1GP2A 3CR8A 4J0QA 1XD2B 1BS1A 1W2GA 1UM8A 3AF0A 3UMSA 3T1VA 4DHEA 1IONA 2OV2A 3GJ5A 3UWOA 2WWXA 2EWVA 3KX2A 4OHYA 3BIFA 4OI4A 3N70A 1D2MA 1IXSB 3MAAC 1IY2A 4OBEA 5FL7D 2GF9A 4XD7D 3X1YA 1DAGA 3NIBA 2HF8A 4LX0A 3I8SA 5DH9A 4PQRA 2V55B 2LKDA 1XJQA 1F5NA 2FFAA 4MGKR 2FV8A 2BWJA 4G0NA 1AGRA 4A2WA 2GEVA 1C4OA 2QTVB 1Z83A 3HYTA 3RAPR 1OYYA 3DO6A 5L8VA 5IRCD 4EPTA 3VTKA 1B0UA 1HEIA 2D3WA 4B2LA 2ZSDA 3SI7A 1PUIA 3ASZA 1XD8A 3GLHE 5B58C 1P60A 4KV9A 1YZGA 1KDPA 4A0RA 1BMFD 1ESMA 1QVAA 1DS6A 4OI2A 1Z0KA 1S9HA 1T8UA 4DDWA 4QGGA 5JS8A 1NMYA 4U5XA 3TVTA 1RE0A 1VTKA 4JLNA 3WRYC 4A0GA 5KSOA 3ADCA 4A8JA 1LVGA 4Q1EA 4F4CA 3CWZA 4DLYA 4EDHA 3BAFA 3QXHA 5CIQA 1KSGA 3AUYA 2CL7X 2OG2A 3K8YA 2HEIA 4TWZA 4URZR 1E0AA 1G9XA 3D6TB 3RS2A 1Z0DA 1Q21A 2J0UA 2QBYB 1JBKA 1GVNB 3QXXA 4UNQA 3U4QB 3FHOA 1DG3A 1TU4A 3N5CA 2WICA 4TLAA 3GJ3A 2I1VB 3K9HA 2ERYA 1TMKA 2J0SA 4R98A 1X1SA 3QG1A 3T1OA 1FFHA 4G5QA 1IM2A 1F6BA 4NPHA 3W9YA 5D3MB 1LS6A 3QF4A 2JLXA 1WMSA 4KHZA 4Q02A 4URXR 2ZI4A 1XTRA 1VIYA 1CJMA 4US0R 3THYA 1GWNA 4ASUD 1YZUA 2ZJAA 1ZC3A 2CBZA 2DWPA 1KO1A 3GLGB 4JSYA 1P73A 3KB1A 4EQ6A 2ZTSA 1OXXK 1HV8A 3CRQA 3VMFA 4W5WA 2Z83A 1YJ5A 1MH1A 3UATA 4BFXA 4X8OA 4Q4JB 4A0FA 1VG8A 3B1ZA 2O8EB 5JJIA 2WPDD 4Z1MA 1N3BA 4NYJQ 1G41A 3FKSD 5KNDA 5F9FA 1VG0B 4TN1A 1G8HA 3K0EA 5CIWA 3U3MA 4IOJA 1E9EA 1ZU4A 3MJRA 3OEEA 3M4YA 2IEYA 2GXUA 2NOAA 4ILEA 3GJ8A 4IRUB 1KI6B 3B6EA 2GVZC 5EZ6B 2VF7A 4A0HA 1ZC4A 5EQTA 3T35A 821PA 4QBIA 5FR2A 3I8XA 1G291 3KKMA 1NG1A 1E6CA 2P3SA 1ZM3A 4W5JA 3MWYW 3NVAA 4Q18A 4JL8A 5DSZA 2WTUA 4Z8YA 4XWKA 5KPDA 1QDEA 1OT3A 1DO2A 2Q3MA 1G1MA 3QKRA 4JLMA 3WNDA 4TZ0A 1Q3HA 3D7MA 4GMXA 4QM7A 3K09A 2XJ4A 4DCNA 4V0MA 1BH2A 2CCGA 3DM9B 4BLOA 5IHPA 2JJ1D 2XTNA 1SXJB 2WMNB 5FPYA 1Y3AA 1E2IA 2VH5R 3GLFA 2ZE8A 3OAAA 2GJ9A 3UIEA 2HXSA 2GVDC 4KCGA 1V5WA 2E87A 1IXZA 2V1XA 4IVQA 2B6HA 1W4RA 1Z6AA 1XPOA 4KJZA 4XWAA 5LD2B 1WBDA 2IF0A 4W9MC 1YVDA 1MV5A 3M6AA 1COWA 4C4PA 2YKGA 3LNCA 1S2MA 4YMVA 1KI7A 1R5NA 1TUIA 3K0SA 1D9ZA 3H86A 4Q1AA 1G3IA 4FMDF 2ZUBA 2GAAA 2YOFA 3P32A 3QI2A 4Q01A 1KI1A 3O8RA 4P4SB 1U0LA 1OIVA 4HAVA 1Q1EA 1SZPA 3N2EA 4HI0E 5J47A 1AKYA 3OEHD 1NSFA 2VF8A 2Z43A 1XTJA 1LF5A 3KXIA 3HYRA 1SULA 2AX4A 1VYVA 4KODA 3QKRB 3THWB 2JLVA 3G0HA 1R8SA 3U60B 2ZI6A 4MUBA 2ZJ5A 4B73A 1G18A 5AUNB 4UNRA 2OESA 1U9IA 1KK1A 3DDCA 4M9SA 1NP6A 1NVUQ 3BD9A 4WXRA 4C0AC 4DCVA 4C2UA 3F0TA 2F6RA 3K0AA 4JLJA 1NN5A 2PX0A 4JLKA 5CLQA 1FOEB 1G7TA 1HYQA 2GCPA 4V0OA 2REOA 4Q7JB 4EPVA 3SZRA 1E0SA 4B43A 1UBGA 2QMEA 1GZSA 2Q6TA 5H70A 3U3JA 2P6NA 4L15A 3KQHA 2WSMA 1HY3A 2GJ8A 2OLKA 1OXTA 4OYHA 5IK2A 2J59A 3K70D 4XTRA 1KOFA 2H7VA 1JJVA 4QGFA 1GKUB 2IBMA 5E3HA 1FX0A 2EVWX 4CEIA 2BCGY 1CR2A 4KYUA 2P6UA 5IDVA 1DADA 2FGKA 4KVGA 3FE2A 4NCJA 3VR6A 5J4YA 3ICQB 4AY2A 4OHZA 4TMKA 1NN3A 3CF6R 1E0KA 1K5GA 1QBKC 3RS4A 4M1OA 3NBFA 4MA4A 4CIDA 1GSIA 4PANA 2ZS9A 1S9DA 4G1UC 1XJCA 4ZIRB 4RCZA 3RWOA 8OHMA 3T06B 3K0CC 3AVOA 5HKKA 4G01B 4UNNA 2X8AA 3AKCA 3FGNA 5DE3A 3CNOA 1DO0A 1RZ3A 3B8HA 5FPHA 3R9WA 3WMEA 1KO8A 1TPZA 4AKIA 3OIYA 3QPUA 1WB9A 2WIBA 4PC3A 2OO7A 3LX8A 4TLBA 2R6DA 4JYBA 4UXHA 2B7BA 1RFLA 5KSPA 3JZAA 3SHFA 4TL9A 2BKEA 4HAWA 4PAMA 4DEYA 4NHOA 3LRPA 1WA5A 1KGDA 1R0YA 4HB0A 2LCFA 2QM8A 4C3ZA 1FQJA 1Q0UA 2C9YA 5HCIA 4C0KA 1WQ1R 1F2UB 2FPMA 3KUCA 3SJCA 4C0LA 4Q1BA 1XD2A 1OHHA 2QAJA 3DPUA 3IUYA 1SVIA 5GVRA 2A78A 3IHWA 3KB2A 1BOFA 2RH5A 2W83A 1C9KA 3L8ZA 4NL4H 1LV7A 3RS7A 3L8YA 5GJBA 1E2GA 3X1WA 4A2QA 3ZZUA 2QSZA 4HB2A 1ZM2A 1NLZA 2C98A 2QP4A 1VCNA 1R0ZA 3JZMA 1HQCA 5JEEA 4KU4A 1O3YA 3TLXA 4C0JA 1KYIA 2FMXA 3G5UA 4HDQB 1DE0A 3VKHA 4G5SA 5JHGB 5CYPA 1FMLA 5DLQC 1OH6A 1S4QA 4BLQA 1OE0A 3A8TA 5UKDA 2HCBA 1R5OA 2Z6VA 1KO4A 1P2TA 4KLNA 3NXSA 5H68A 2NO1A 3Q7PA 1CULC 2G6BA 3MD0A 1JEDA 1NIPA 4V0KA 3EXAA 1GKYA 3MSXA 5M04A 2B8TA 5KSZA 1HH4A 2VHCA 4B33A 2IT1A 3NDPA 1TQ4A 2ATVA 4X8MA 3CRRA 1W36D 2ZRBA 5BYJA 3AVPA 4FW9A 5IF9A 3MUFA 2QT0A 5E7MA 1VKJA 1UF9A 2R6GA 3FWYA 4DT1B 1D6JA 2C04A 1E2NA 1JQLB 1XMVA 1YZKA 2GK7A 2LWIA 3BRWD 5DHAA 1GNPA 5CB8A 4HATA 2JLZA 1JJ7A 1YKSA 4L8GA 3QVUA 3I5YA 3B2EA 4M4SA 3S1AA 1YRBA 1II9A 1KSHA 3DMDA 3VHXA 3CPHA 1XEXB 3KQUA 4DDUA 5EP3A 3IPYA 5CYOA 5C2JB 1E1RA 2OCAA 1DG1G 4TYPA 2FEMA 4UJ3A 2NZ8A 1G5PA 4XVQA 3GJXC 1YZQA 3FTQA 4II7A 1N0WA 4H9GA 1MO6A 1FP7A 4HUQB 3ZD7A 2F1HA 2XSZA 2ZXUA 3CNLA 2VHJA 1AM4D 3CWQA 3KJHA 2DPXA 4K81B 4HAYA 2ZRNA 1NVXQ 2ANCA 4KYIB 4AG5A 5FPKA 2ZSAA 1ZCAA 3CLVA 2RB4A 4BASA 4IVPA 2ZYVX 1JB1A 5EE0A 3T5GA 1WCV1 3LXRA 4Q1CA 1MO4A 3AKYA 4PC7A 1G20E 1RW4A 5CM8B 2FSIA 2ZRIA 4MH0R 2YHSA 3VAAA 2C96A 1UAAA 2RKOA 4BFWA 4FXPA 1OHHD 4PZYA 1TU3A
chains in the Genus database with same CATH superfamily
1KS9A 1W48A 1Z2AA 4RZUA 2CJXA 1RNLA 2NXCA 4I0WB 4OQMA 2PT6A 1Z38A 4RZ3A 4DSNA 1UMKA 2X5XA 4NU6A 1D6MA 3SFZA 3CZAA 1FW6A 2NSHA 2ZREA 5DYIA 5BR4A 2V8BA 3DZIA 2R7MA 1GIAA 5LC1A 2WWGA 1XDDA 3VVLA 4GKJB 3KQWA 2HSGA 1Z68A 2ZSFA 1XA0A 4LVUA 3HNRA 3NV9A 4DLPA 5KNBD 1UPCA 3Q5DA 3EQ9A 2O8VA 1DEHA 2O7QA 3VPXA 2WC1A 5A4KA 2HPZA 1Z37A 4ZYYA 1BE1A 4EWLA 5CFRA 4FMCF 3ZI0A 2ZIVB 4N3NA 3FLMA 1EG2A 1LVUA 1ST2A 3KK0A 4PBTA 3NHSA 4C0XA 5B3JA 3ZBUA 3FLEA 2W6PA 1AA9A 3R5TA 2GGSA 1AXEA 4ZREA 1Z9BA 3G5TA 1XQ6A 1J23A 4QXOA 2F90A 2C2BA 5BWNA 2G36A 3KYCB 4RPKA 1V3QE 1DQYA 3WYFA 1EMDA 3WYGA 4PQYA 3VDXA 1SQSA 1KFBB 1BS9A 2CBGA 1J2UA 4IFIA 5DGCA 1OOEA 2NZWA 3HEAA 4R51A 3T9EA 2WJZB 3VBEA 4F3RA 1M2VB 2BFDA 4FW8A 1CJVC 1MUUA 1YZLA 3R76A 4MAFA 3WKEA 2FW8A 3I04A 3KLMX 2AFIE 3ESXA 4HDRB 4MS1A 5BWOA 1S1MA 3HGTA 2DERA 3L8GA 3KSBC 2RC6A 2VXOA 4TQUS 5G53C 1PT5A 1I2BA 1Z33A 4G0ZA 3GQVA 2IYYA 4AN1A 2ZG6A 1V35A 2WWTA 3PUIA 3ZDZB 1SHUX 4DMUB 1UBEA 2PEYA 3BUSA 4JB0A 4KRXA 3P94A 3AUJB 4UW9A 4L4UA 1J1IA 1JLLB 3RIYA 4RFSB 4EB8A 1DZIA 1DRKA 1HDYA 2HU2A 2IYPA 1KZ6A 1O6FA 3QX8A 4ENVA 3IMCA 3TN7A 5K3OA 3CX8A 1W4AA 3V4RA 4R01A 4PX2A 4RY9A 4QRIA 1T1RA 4Y0NA 1HT2E 3KAKA 4LN1A 2ZR8A 5K3BA 3QYFA 4PYJA 5A1JA 2C83A 2R8EA 4FN4A 3BH0A 5IYZB 2OHXA 4XEHA 5ALMA 1JLRA 1ORIA 2HO5A 4V0ME 1IZZA 1ZM9A 3ID6C 1UBCA 2QA5A 2W0SA 1I7SB 1OPXA 1EGMB 2B6NA 3ONFA 3RBZA 1I2AA 3PPIA 2AQKA 1ARZA 2INGX 3PJRA 2VLBA 3V55A 3TJRA 4CKWA 2IHVA 3VU0A 3KOWA 2HLPA 1WPQA 4DLVA 5LQKA 4BNTA 1JNXX 4K9NA 4K05A 4RKRA 4YALA 3TQSA 4NNJA 5JU6A 4UEQA 4KQKA 5J40A 3WLPA 1NRXA 2FH5B 2OXFA 3GCDA 3LU1A 4ZOLA 1JQJC 4GPIB 3OEHA 4LSWA 2PYIA 3IPCA 5EMNA 3STYA 2ZRQA 1UZNA 1ISIA 3LDHA 4V0RA 4MARA 1N32B 4QQ8A 4DMKA 2CNWA 2WDZA 3BE4A 1KERA 5FP0A 3PLAE 1XJWA 3HHEA 3EH2A 3P2JA 2Y4OA 4UBLA 2FMTA 1JDSA 1EGAA 4JJIA 4CV0A 3EGVA 3A6DA 3FRHA 4DCPA 1GGEA 3KFLA 4M98A 4QO8A 1WSBA 2CVQA 5DKFA 5F2KA 2EWMA 3HDVA 1E7QA 3N53A 2GOYA 3QKTA 4X84A 1ITZA 1JIIA 3U7RA 1I0LA 1N2IA 2BELA 2F8MA 2X5KO 3TZQA 3VR4A 5CBPB 2O9JA 1KFEB 5AHOA 3S2EA 2QS9A 3JR7A 2WKPA 1GDDA 2Q2WA 4B5LA 1YNSA 4EFLA 5FFNA 1PDVA 4EG3A 6LDHA 1AKEA 3B3QA 2VHEA 3WMFA 1RHQA 1M5RA 1Y9AA 2QRMA 1V95A 4FLFA 3I23A 3K9GA 1EVLA 5FNVB 1V11A 5A6SB 4YMIA 1CUXA 1QJCA 1LDMA 3SIRA 1NMZA 1OV4A 3UJ3X 4AJPA 3OTQA 2JJ1A 3R8FA 2G63A 1D7AA 1G98A 4RFSA 1CZOA 2ORIA 4DBLC 1QE5A 2B2XA 4UBIA 1WOMA 4Y2QA 3PGA1 5IXYA 1ZD1A 4IDEA 2F43A 1K08A 2JDID 2CHGA 1DAMA 4R8RA 1P7ZA 2FSPA 1R4MA 4LRQA 3GJYA 2HRQA 3CYFA 4OQXA 3UHAA 3UJDA 1BKYA 5F5NA 2C5BA 3WRXA 1JIKA 3BSSA 3DKPA 9ATCA 4JHXA 3IMFA 2QHXA 3CWCA 4JVLA 1GLNA 3PL5A 3LA6A 1SHJA 3TS1A 3H1AA 1G8GA 1GZHB 2YC4C 1XFDA 521PA 4IQFA 4BHTA 4MMXB 5K8IA 3RYCA 1ZDMA 4BPRA 1SXJE 2JJYA 1XZEA 4GOOD 3WWYA 3L06A 3GPDG 3WBJA 3SR0A 3K0CA 2XEXA 3E7FA 1VI6A 3OTHA 3KT8A 3PNLA 4LRXA 3FBWA 3TTSA 1O8BA 3QVOA 5JFTA 2O3TA 3FKSA 5IDQA 2AJTA 4AYWA 1SZCA 1NL3A 1PT7A 2CVFA 2JFPA 3BZBA 5AK6A 4BZXA 5IM4A 4W6ZA 1XZCA 1W5EA 3E2IA 4K6MA 1OJ7A 2CNOA 4MA5A 1SC9A 3MS4A 2FXVA 2VF4X 2VC2B 3EGXB 1DC3A 3F6PA 1JPNA 3GFRA 2LR0A 1D0VA 1LFAA 2ANBA 3RBXA 1I10A 4PW0A 3LH5A 2XT6A 1Q95A 4L73A 4LEIA 1K1EA 1S2DA 1W29A 1U0JA 4QGHA 4UU1A 4L07A 3ENNA 3I2GA 3B89A 1RE1A 4HNSA 3TFWA 5KEIA 1US8A 4G5HA 4EGQA 1HFJA 2WIDA 2VWGA 3ILXA 2AG0A 1T2FA 3PCRB 1FQKA 2GARA 3CGGA 3KTAB 3WLTA 1KPHA 2GZAA 5JVDA 3EDCA 5TVKA 2V1UA 3BX1A 4MYSA 1QYVA 2HQRA 4NHEA 4AI6A 1P1HA 2JATA 4EG1A 1JMVA 1I1NA 1IVYA 5B37A 2O54A 2A0WA 5EIHA 1ENZA 5LUBA 3AR5A 4HY3A 4IGEA 3OI7A 3ZGXA 4NJEA 3P9QA 4YWJA 3U49A 2NO4A 4Q5IA 1EBUA 1PEDA 2EZUA 1R5BA 3CMMA 2F43B 3ZZ0A 3B53X 2ID8A 1FNCA 1N5IA 1YVUA 1ZISA 5AW1A 3FKQA 2D1QA 3A6EA 1ECLA 4L57A 3H16A 2ZQZA 3ETJA 1HE8B 1WB4A 4H3KB 4L5IA 1A2KC 1OFIA 4AKEA 2H18A 5JBIA 1TTQB 3JARA 3TZEA 3I39X 1OXMA 3WWZA 2ROQA 2FUKA 5TT1A 1IHYA 4MLZA 5DSTA 3OHMA 4MZDA 4RTJA 4EF4A 4W6QA 4RSMA 3DTYA 4B17A 2WVAA 4KK4A 4OREX 5J5CA 3TGPA 4IJ5A 1AHPA 3M1IA 1LC3A 4G63A 4Q6BA 1ZIPA 3X1MA 2GBCA 4QVKA 4P34A 3A37A 4O4LB 3QLJA 1MC5A 1TTHA 4RH3A 2ZP1A 2DXIA 2VSNA 3PR3A 3QKWA 2QTCA 2XNSA 3L01A 1KDTA 3QMMA 5J1TB 4A6XA 4URYR 3VH1A 5DBIA 2FCRA 3O1LA 1LUAA 2BV3A 4D7AA 2W70A 2J45A 2ZSUA 2DHEA 4FINA 3R0ZA 3LS2A 3R1IA 3DHEA 4WADA 1YR9A 3KBOA 5YASA 3VZRA 4BNUA 5B4TA 1T1IA 3HXMA 1N6RA 1BHSA 1DKMA 1F48A 4XQ9A 2CHUA 1O0SA 1Z56C 2Q0HA 3RS5A 3T4UA 5ESWA 1EZZA 4E5MA 1GRVA 4N7JA 2XB4A 4JY7A 2N9UA 3H9CA 1AKWA 3JWPA 4CI0B 4WJLA 4BGDA 1VSVA 2IVZA 2Q29A 3SQMA 2JLYA 2GKOA 3THYB 1RPTA 4ON9A 3RC8A 3LLSA 1XPRA 2NP6A 3GOQA 5JH7F 5DT9A 1P5HA 4FDTA 1XK6A 5CW1A 5AP9A 1SCAA 1X1QA 4DCGA 4HUTA 4QKQA 2DR3A 4OXKA 5I4CA 4EW3A 4UQPA 4YT5A 4HB4A 3R3YA 3LMKA 4ZHQF 3I73A 1OWMA 3QLUC 1J00A 1JQAA 4PLCA 4F3TA 1N8SA 1KJNA 3WFZA 1QYWA 1IH8A 3EHEA 3EZ6A 4G84A 1ZNWA 5L7TA 5CNMA 4NULA 4IRMA 3OU6A 2K6GA 4GI7A 1OIXA 4TLDA 3PB3A 3ZDXB 4NBLA 2PD6A 4IGIA 4MB0A 2OSVA 3V48A 1ATIA 1AGXA 4FYYA 4CUZA 4IV0A 1XX6A 4F93B 1IJKA 5G0VA 3V2GA 2JFZA 4RK1A 3PRJA 1JIQA 3U3XA 3CZ9A 2Y27A 5K6AA 4G0MA 3KFVA 4MNTA 5B1HA 1JI0A 3A10A 2RMKA 4IDFA 1Q2UA 4O2LA 3MS2A 4HLQB 4KX3A 3OSUA 3UAXA 2C5GA 5FO1A 3RRJA 2HV9A 2NUAB 2QK4A 5BYBA 4QQNA 3EZXA 1JDBB 4MO2A 3V4LA 3NIDB 3ZNPA 2H1HA 2JGFA 2QNRA 4KPEC 4O1HA 2LE0A 4TLCA 1OU0A 2FFHA 3ZW7A 3S55A 1Z2EA 1OI3A 4AP9A 1QZ3A 5FA6A 1VMKA 2A9KA 3AK4A 1T9AA 2P79A 4A10A 4D5EA 1GGMA 2C3MA 2OV6A 1AUXA 3K5WA 3BVPA 3PC8C 2ZDGA 4U4AA 2C2GA 3DXYA 2XRFA 1YQDA 4U3JB 3R7WA 3UY4A 4OEHA 2OILA 4LY9A 2ZIGA 1W36C 4WK2B 4PHHA 1HURA 1RVV1 4RJIA 2C1XA 4TKUA 1SKYE 1HO3A 3CEJA 3OD5A 1W4CA 4XB1A 1Q0LA 1MVOA 1E89A 2R68A 5K3EA 1ZKMA 3LA8A 1SOVA 2BSXA 3RGWS 1G20A 4EGAA 2XZLA 1C4WA 1WEHA 4MRRA 3HFSA 4JLOA 4IKOA 5DTRA 2UXCB 4R3NA 1N2GA 3CW2A 3SU8A 3IQXA 5JV5A 3DUFA 3NWBA 2M6RA 4MK4A 5A4DA 1DMSA 1E58A 4JJ4A 3T34A 5FF9A 2HFJA 2VZLA 3WGVA 4ER7A 3FOWA 4UCFA 3BFKA 1KWKA 1E9FA 1WU8A 2WJWA 3BERA 3RTCA 3VR2A 3GA0A 2XTJA 3G17A 3IE1A 3O47A 1EE2A 3I76A 4DIFA 4EUNA 2VL7A 3O8LA 1XCLA 5A0FA 3IUEA 3F8WA 1DTEA 3Q15C 4LZJA 2RGWA 1Z28A 2O1SA 4GM1A 2X8BA 1DJOA 1NRJB 2FEOA 1M8JA 4CTKA 3RE1A 2Y8EA 4R2IA 1HT3A 5A4FS 2ZSIA 2GTPA 5GZ6A 2GD2A 3TSWA 2COKA 5KYXA 1ZVMA 4HLNA 2O2IA 1X77A 1IN7A 1WXEA 2IXGA 2VP5A 2W2LD 2HJGA 3OKAA 3BPSA 1XCGB 4G8CA 2QD4A 2W6QA 3HBNA 1NJGA 4F92B 4RIIA 2ZSBA 1X7HA 4LOAA 1NTRA 2YWJA 2XMDA 5I7RA 4Z9BA 3C7DB 4U8HA 4QJ5A 3AKEA 1JYFA 5F98A 1V8OA 2OGWA 1T6BY 2WU0A 1HG0A 4YCNA 1NUAA 2CNNA 2G88A 1BQEA 4HAIA 2OZLA 1FDVA 3GNLA 1N5OX 3NHUA 2N46A 1YMUA 4DN6A 5SY4A 1RBMA 3ADBA 1DQRA 2C9CA 1GAEO 2F3SA 3HJNA 1QVVA 1UWVA 4HD8A 4JX9A 1ABBA 3E84A 4R1MA 4O6VA 5ALTA 4RTOA 4OFZA 1RQXA 4I81A 2YASA 1TOAA 3A6FA 1Y4AE 5DNEA 3TXAA 2AVNA 3EZNA 3AEZA 5KNBA 1UFQA 4I1PA 2I6QA 1KRWA 3JPWA 3A1VA 4ZAGA 3TW4A 3UB3A 5ITSA 3S1LA 2QT1A 5EOVA 5DLYA 3E8SA 1JFLA 1GU7A 1FFAA 1KKUA 3KYBA 3OFNA 1G2QA 1U0SY 3QU5A 4LOKA 4V3CA 3RB8A 3W2GA 3ZE7A 3PICA 3ZU2A 5B6JA 5CDGA 3GAMA 1IUPA 1CR0A 3RYTC 2A3NA 2I4LA 5P8WA 3EVGA 1NMEA 4BMVA 1E1MA 1KY3A 1TIPA 1ZGBA 2TECE 3TW0A 1H65A 4N47A 3JAMA 3T7CA 3GPLA 4R5MA 2XUKA 1J09A 3N7AA 2EX0A 4TTVA 2PLRA 1ZJYA 4M7OA 2ZITA 1ONPA 4RULA 3TCNA 3EGDB 2YIVX 2JD0A 1CPYA 5B1IA 3PXEA 1FPMA 4PG4A 4Y6RA 1ULTA 3WIVA 3VJKA 3CV3A 3NTXA 2EKPA 4F2HA 4FR0A 2R48A 1T3LA 1U5CA 1B74A 4BE7B 3LJKA 2PMBA 2VHVA 4ND8A 5C0OE 3WL4A 1HYGA 4Z9XA 3RUPA 3OT1A 1ZD5A 2G08A 2VHZA 2CK3D 3U3KA 1YS9A 2BFBA 2CXUA 3MCVA 1NNLA 3LCMA 4JL6A 1ZY2A 4U63A 3BFPA 4AZ3B 3AVYA 5AW0A 4RV5A 3AY7A 2QRGA 2DFPA 4E12A 2H1IA 3GGDA 3OH8A 4HADA 4E94A 4P4NA 2WPDA 2MIIA 4EVRA 4Z9YA 4UDNA 2JI7A 2HXYA 1Q16A 3BBLA 1TZ2A 1QE3A 1R8QA 3ILSA 1E1RD 3IEVA 4G1VA 2ZRFA 4JQSA 3RFTA 4G0PA 1TW3A 4P5PA 4W5HA 1XTSA 4MV3A 4ENUA 4DUPA 3FZEA 1Y6FA 1EDEA 1NVKA 1ORRA 4OXRA 1UDRA 1WQ4A 3SC6A 2EARA 1V0JA 5FLYA 4RY8A 4F9GA 2FSSA 1QOPB 1K68A 3UCEA 3N76A 4I5DA 3L6CA 2ZJ7A 3MTBA 3ZV3A 4RJ2A 5BOSB 2KBFA 2OCLA 3RT1A 3VHQA 2MSEB 1QHSA 3TIIA 4EHIA 5KKCA 4WY8A 3BM5A 1T9ZA 3HBJA 5K0JA 2Q3JA 5LYJB 5CVEA 1UM9B 3A4IA 2XLBA 2C00A 3IODA 4DWOA 2HCFA 5F76A 3PFBA 4LF9B 5TMEA 1EK1A 1VIAA 3I2JA 1E2QA 3ABRB 2QX4A 4TRNA 4GR9A 3HJHA 3L02A 1Z7YA 1W5FA 2CSUA 1VP3A 3I2FA 4O5OA 2JIZD 3LWZA 2ZIWB 1WABA 4AS2A 4LJRA 4I7EA 1K27A 1E20A 2EJBA 1ULZA 4S1VA 4BEJA 4JQCA 5EE9A 4YCSA 3NOXA 4K88A 4QU5A 5CXQA 3PYXA 1YH3A 5ALQA 2XGMA 4N0PA 3EQ7A 2DKNA 3NBZC 5DT2A 5HSGA 5AM4A 4LC0A 4OB6A 1WO8A 3QEBZ 1SU4A 2ABWA 5F52A 3TYXA 2GFIA 5COAA 3T9CA 1DPFA 3MSCA 3CUUA 5BNZA 1PJCA 1E6UA 3JQFA 1D2AA 3OZWA 1SHZA 1O57A 2RI1A 2Z1NA 3WL6A 1B26A 5E3JA 1W94A 1RXYA 2QUZA 6REQA 1W88B 4MJLA 4YMTA 4NTZA 1N2SA 1ZAYA 3ND9A 2JRLA 3OCYA 5JYDA 2XYRA 1P7CA 1JT2A 5FI1B 1G2IA 3G9UA 2LW7A 3P9XA 1UIMA 2AW3A 1DCMA 2JKZA 3U7EB 1MGPA 1AGNA 3L43A 2IW3A 1OH8A 1P8JA 5AVZA 4I9HA 3AERB 2HFKA 3G6KA 4KOAA 1PR1A 1Q83A 4J90A 4DUGA 4CGYA 1N9KA 2HV8A 1SBZA 1RWXA 1RJDA 1UDCA 3PNVA 3F8TA 1YDHA 2VUIB 2KE5A 4JX8A 4WX2B 5DYYA 3IGFA 1LBTA 3HJUA 3NDJA 1G6Q1 5AHWA 1KEWA 5KQGA 1UXHA 5AM0A 1L5WA 2A9VA 1TAGA 5IC6A 4EKIA 3TJZA 1FSZA 4H4EA 2GZDA 5SZJA 2HMSA 2DZDA 3LHKA 1AKMA 2I6XA 1TD1A 4OJQA 5AJYA 2SCUB 4LJ6A 1GFIA 2YRXA 3H4IA 4OK6A 3QNMA 3VDQA 1RM5A 3KUDA 3OPMA 3WYAA 1Y4DE 1KFKB 4DWJA 3NG1A 3RK1A 4UM5A 5DI3B 1KWGA 1OX4B 1GCUA 1RLUA 3DF7A 2G72A 4Z54A 3R7NA 2YTZA 1LXCA 3NZEA 2VVTA 4G4IA 4MIEA 4LRTB 4NAUA 4EAQA 5JWRA 5JYCA 2O8FB 1M8FA 1CUJA 2HRRA 5FYDA 4B6OA 3VPGA 3L8DA 2JGIA 4P80A 3D81A 1OLSA 4FX5A 3AF6A 1WDTA 1VMDA 1JG7A 3AFMA 3CTMA 1F3OA 2XHEA 3B6ZA 1VPLA 3MFYA 4N12A 4RCYA 3ZWBA 5TMPA 4D8XA 5HNKA 1L3CA 2PH7A 4HZIA 4MVJM 2GBLA 1CUCA 3WRVA 1WS6A 3TRDA 1FMCA 1YS4A 1QCDA 1YIOA 3GPIA 3IRVA 4J0HA 4QYTA 4DA0A 5HRAA 3K30A 3H6KA 3TPZA 4KAJA 3RVRA 2HUPA 2K7FA 1V26A 3VSBA 4GECA 3ZCPA 4OHUA 1L2TA 2AB0A 5J2TA 1V4BA 5F1PA 2W6NA 3JWHA 5F7OA 2XGJA 4YAOA 2R00A 2ZPTX 4MI3A 5BW8A 5FUBA 1XQVA 2ECQA 2QTHA 3A06A 3R6GA 1NLYA 1BMTA 2FPGA 2EP5A 4YQYA 1V16A 2IHYA 2WV7A 4NPAA 2B5VA 4LMBA 1ZI6A 3IP6A 4GGMX 2GX6A 3OPXA 3EVDA 5AVVA 4RANA 3MLBA 5EHNA 2I1WA 3H2YA 1BQ3A 1C5KA 1VSQA 3I6BA 1SXJC 4HN2A 2WF6A 4F2GA 4PNEA 4GBED 2UZ1A 1FJGB 4B2PA 1ZU5A 2EZ9A 1TLLA 4D9KA 2YH2A 4RCVA 2XECA 5MN5A 1VG1A 2A0XA 5AH0A 1SK9A 5BNTA 2V3VA 5JQGB 1U7XA 2DULA 4ARZB 1A0OA 1EFUA 1JECA 1W36B 1J8MF 3BXFA 3WL7A 5A3QA 5DZSA 3TLEA 4NOLA 2PGAA 4O2BF 4AO6A 2D5CA 3ON5A 1KEVA 5JSFA 1ILEA 3QXGA 3U44B 4OKSA 2KMLA 4BX9A 2O8DB 4FCVA 3TL2A 3WOVA 5FWXA 1U2GC 3FPFA 2EW8A 5I01A 1Z2NX 5T41A 3T4XA 1SCKA 2IZ5A 5DLDA 5C8YA 3VTAA 4RHFA 3BJZA 4FYHA 3S5UA 3ZY2A 4C4OA 4DNXA 4R2MA 2QMZA 2ZYRA 3BHJA 3MM4A 4RVGA 4Y2YA 1UJCA 5I4IA 2Z2IA 1C2YA 1RD4A 4U00A 2FEWB 2Z4SA 2CF6A 2Q1SA 2Y1GA 5EHGA 1MA0A 3IEUA 3FDXA 2FDCA 2HJVA 1RWMA 1USKA 1B76A 1D4FA 5TT0A 2A1UA 5SY6A 1QKJA 4V1CI 2OP0A 2W6JD 2DH5A 3D8NA 3EEQA 1NBEA 3PXBA 3GB9A 3Q88A 3HUUA 2XOEA 1G6HA 4IVRA 2DUJA 1CU1A 4PGGA 4G07A 1P2GA 1P2BA 4ZQFA 4CEHB 1E8DA 4DLWA 1DKPA 4TV9B 3RSSA 4PSKA 3K73O 1UWCA 3LPNA 1TT5A 1BFDA 1E3LA 1R4ZA 3TE7A 5I3ZA 1I4LD 1BXRA 5C8DA 3AJDA 1VKNA 1Y5IA 2IJGX 1SM4A 2JLBA 2D2FA 3O3MB 4CQMD 2AOUB 2I7XA 5EYPA 1NF9A 3DDHA 4Y6SA 4C5BA 5ADVA 1Z2CA 3UYKA 2FZ4A 4ZT6A 4QYSA 4ZU3A 3PR2B 1X1CA 2VDNB 4NYJR 1PL7A 1N2CE 1AN0A 1SUSA 1UIRA 3LOPA 1Z07A 4NYIR 4BKPA 1XLUA 4B3FX 3K05A 2TRSB 5H81A 3RRNA 5AUPB 1XTQA 2ZYWX 2GCGA 3FUVA 4J0GA 4JOQA 2VNJA 4GQIA 4R1NA 1B0PA 4TSRA 1XXLA 4BO0A 4E21A 1S2OA 1WUYA 3CJQA 4U39A 5ALOA 4PYKA 5C34B 1UXJA 5IH7A 2WG1A 1YS7A 2J6CA 1IZ8A 1L6RA 2DFTA 5ECGC 1U5BA 3N0XA 1YD7A 2GH1A 5D3KA 5DGHA 5T8KA 1MD9A 4PO8A 4UKDA 3OO0A 2IZOA 4HBGA 4R8SA 4XGNA 4IUDS 3R0VA 4EO9A 1RDFA 1QGYA 2CMKA 2QQGA 2ZCJA 4AY4A 3QEMB 2J3IA 1FDIA 5A03A 2EFCB 4D4GA 1NM5A 3I4LA 1T3SA 2H1OA 3FSGA 3G2OA 1N6KA 3FW1A 5DX0A 3FIJA 1BTOA 2WFMA 4YT4A 5FIUA 4NBKA 4Q9KA 5FJIA 3QIAA 4R2KA 1PG5A 3V3KA 5FLXA 2Q3FA 4TV8A 5SYAA 4MW7A 4UNPA 5I9NA 4P7JA 1I6WA 4PHFA 4HHEA 2OTCA 2VSOA 2ZVPX 4MMYB 3FVQA 2YYZA 4CODB 2BFBB 3LQ4A 2ZFUA 3BCSA 2VQ3A 4ZT3A 5G1PA 3QFFA 5HKLA 3ZKWB 3ROEA 3PA8A 4CV2A 2XXAB 2KJQA 1RXUA 2G7ZA 4KR9A 2BJVA 4ZEVA 1DAHA 2DBVO 2XYGA 2L42A 3ACCA 1T4DA 2WJ4A 4MUAA 4DZZA 5JSZB 1CZNA 1WHTA 2F64A 3NBKA 4Y0AA 3G13A 5LN1A 1SQ0A 3KUUA 3VO9A 3GDWA 1JU3A 4QFCA 1W5TA 3FNHA 1MOQA 2EQ5A 1WPRA 3V8NA 5TLSA 5KOHA 4AF7A 1KMCA 3SIWA 5AJTA 4I5FA 3V97A 2C5AA 4OP3A 4EW1A 2PM8A 3EY9A 4M9ZA 4DDVA 3GVXA 4FZJA 3DBRB 1YCDA 2BF7A 5BSRA 1ISGA 2G9UA 2QYSA 3ZWDA 5JVDF 1ZVVA 4DZTA 1O97D 4NV1A 4P4UA 3U19A 2X2OA 3LDUA 3OOJA 3VAZA 1CUAA 1T25A 2OKCA 3I2KA 4DZRA 1QP8A 2CB9A 3WNVA 3OKCA 4D80A 5FUYA 4M60A 2PBLA 2WABA 3ZS8A 1V1MA 5FBVB 3VO2A 3L6DA 3FPHA 4IJWA 4YY3B 1S2LA 2ZYHA 4EJ6A 3HZRA 1QSGA 1XF9A 4ZARA 3VZSA 3C7TA 4DKXA 1B6GA 2X0JA 1K3UB 4F6RA 3KEQA 1EX7A 4ZAWA 2GM4A 3F6CA 2VRCA 3BIJA 4F2WA 2PWYA 5B7QA 4HLCA 3KKOA 4MEJA 4PY2A 3KD3A 3BGIA 2FE1A 4L4SA 5HE9A 1JFVA 5TEVA 1C3XA 4OA8A 2A59A 3T5MA 4RV4A 1TVMA 2VJAA 2XF2A 1E77A 4M1QA 3V4VB 4ALLA 5BV0A 5HM6A 3BWXA 3ONEA 2C1ZA 3BXGA 4LC1A 5K51A 1VECA 2YVKA 5GVSA 2R751 2VJCA 3H8VA 5IMBA 1TL7C 1D2RA 1C7QA 1AHNA 4A92A 1QQ7A 1O77A 3DVQX 5D8DA 2EL9A 1QTQA 1G3MA 1I33A 1IEVA 5IXSA 5K4HA 1ID8A 3Q3GE 1M5UA 1Y5RA 4GIBA 4Y1EA 4GP7A 4EM6A 5K8CA 1AY0A 3ZY3A 3NGLA 3QQPA 1DOZA 2H59A 1HZJA 4IOMA 2C42A 1QRRA 4LWQA 4LMAA 2PSHA 1P7YA 3FHCB 4LXUA 3TR6A 3LYAA 1C2TA 1BVUA 3DMNA 1Z3CA 2H2DA 5I51A 1F20A 4F96A 3GRUA 4C0HA 1ZCFA 2DBYA 2WOOA 2DGDA 2TS1A 3BICA 1MV8A 3RUCA 4N41A 1EJ2A 3IHTA 3BC1A 4LJ7A 4UQLA 2VP9A 1YFLA 3SEAA 1HLDA 2BBWA 4NKRA 4NG4A 2ATEA 5HQ3B 1NUTA 4ZVOA 4ED9A 3PHBE 3DS8A 4GZ6A 4IINA 3CZMA 3PTAA 5T3UA 2RCNA 1X92A 2YJTD 3L2OB 1CIJA 4G24A 3K0FA 2FUG6 5HKOA 1XMXA 3LY5A 1EGVB 2CWDA 2YFQA 1P4SA 4S35A 3TBKA 1JLLA 1LU9A 4JNCA 3I9NA 1LK0A 2WIAA 4JBLA 2PX8A 1A8UA 2H0QA 2PQMA 3AXTA 3F9CA 4QUIA 4DJTA 3WIBA 3VZCA 1A5BB 4UEOA 3ESRA 5FD8A 3WBFA 1JMKC 1FLAA 4PYLA 4RGQA 5ER6A 4L3VA 3AJ9A 1CRLA 5TQVA 1EUDA 5CT9A 2IP4A 5GPBA 1G17A 1M2VA 1PK8A 3C3DA 3C3BA 4GQBA 3MRSA 4RABA 5DOVA 2P5SA 4AFNA 3AL0C 2IEZA 4N5IX 4ZEWA 3HVHA 1Q1GA 1G4AE 2F3RA 4FX2A 4MWOA 4NENA 3RSGA 3PYLA 1FJHA 1P72A 4XARA 2PBZA 5LXTF 4TVKA 4DCJA 2X2EA 4G5XA 4KXYA 3DGEC 1ADJA 2QD1A 5E4TA 4FB4A 4Q7KA 2NTEA 4CKZA 1MJ5A 3AI2A 5ALHA 5FAXA 5KUTA 1XHLA 3DE5X 2DTEA 3WXBA 4QBFA 1YR3A 1LLDA 4DRXA 5A6VA 5E2IA 2QTMA 1C1YA 3BXPA 2QTTA 1PFGA 3NDRA 3T12A 4LYJA 2RAVA 1NYQA 4KGDA 3ZV6A 4BEVA 5B2ZA 2IYZA 3HCBA 2YS7A 1Z26A 4D4MA 4YMLA 4KTVE 2XITA 3RK0A 4KO4S 4LDAA 4GX1A 4JSRA 1JKFA 2BBOA 2AR0A 1Z4OA 3A9CA 5D5QA 1YUBA 1L7XA 4KXNA 4QDXA 2E82A 4F3CA 3PWKA 1WMEA 2O2EA 1TUEA 1HE2A 2C5HA 1IWBB 2PUHA 4YCAA 3L0BA 3OQBA 4S1OA 3T15A 4N6OA 1LY1A 5JO0A 4ARZA 3ES9A 3MWKA 4M22A 5J9FA 3L1HA 2VRWA 4GO1A 1E96A 3MILA 4C78A 2A92A 3PF9A 3EDMA 3V7WA 5B3JC 3JQ8B 1DI0A 3EWSA 3WNCA 2W2KA 1X14A 2VF5X 2NZJA 5SZKB 3LBAA 4K9SA 3B85A 5J5VA 4UM8B 1KI2A 4C7OB 4Y18A 1OI7A 1LDNA 4NBNA 4U2KA 2HU8A 4ARUA 3DFIA 3GHYA 4RTRA 2OZKA 4MHSA 2PH3A 1VHWA 3KR1A 1ZK1A 4IDCA 4TMXA 2FG7C 3ZHRA 4CMHA 1PFVA 1JPVA 4MR8B 2ZB7A 3DVAA 2PSDA 3HGMA 2XX3A 3LWDA 1L5LA 4F9TA 1QHHA 1F7UA 4LYYA 4O2AB 1KIAA 4YLEA 1N2JA 5JSQA 5EUMA 4JIMA 4B3BA 4QQKA 1TCCA 3K35A 3L0IB 3D5QA 3B5EA 1VBNA 3F6RA 4OMFG 4Q66C 4TV9A 3TSOA 2J9FB 1T35A 1ZCZA 1YR2A 3AOEA 3I9FA 5ED0A 2ID4A 4BJ6A 1QFZA 2J9FA 1QKKA 2XWJI 1X38A 1DXQA 5EFOA 2J33A 5BN3A 4ZKDA 1THGA 4FWIB 4GRIA 4NONA 1QIGA 3MTDA 2WUGA 2RGUA 4H15A 5HUJA 3GBVA 4GC5A 1MAWA 3UH1A 5FNVF 4ZMRA 3K2BA 3D6NB 1CZHA 3MMPA 1G64A 2V7QD 3SYKA 2BMDA 2YXLA 1A50B 1KGSA 3GUZA 2OD2A 2YFHA 2YOHA 2RGGA 4N9QA 1FE8A 1J06A 4YRAA 5HP4A 3GJQA 1IN5A 4P86A 3LW8A 3COVA 3QEOA 4IMPA 1QPZA 3PEYA 3HUTA 1Z4NA 3BGOS 4JP5A 4JUCA 3JAWB 3WZ2A 3O8OA 4NR0A 2B30A 3KPUA 4M99A 4QFDA 4YI5A 1DOAA 4BL5A 1ST3A 3Q8LA 5ERGB 4QNNA 3TQIA 5CM2Z 4BO3A 4YRPA 2IYSA 3MOIA 4A8TA 3QJ5A 1N8TA 1TJ3A 1ZCBA 1DU4A 1FK8A 3KKLA 3EWIA 4EB6B 5JIBA 1AMNA 1G3UA 3G2PA 5DN6A 1EEHA 2ALJA 4N8EA 2VN8A 1L5HA 3UK1A 2JKYA 1LZLA 3GEIA 2Q5EA 4AY6A 5JJ5A 3SQDA 1CXZA 1I2ZA 4L5JA 3JYHA 1SVSA 2J4FA 4URWR 2HF9A 1SUPA 4IF4A 3KQTA 1N6HA 3R3XA 4NZMA 3NHZA 2IELA 2VT6A 4GYWA 2ZRJA 5AICA 1HTBA 1YK1A 4A23A 5KTOA 1W6UA 2JK1A 2ODAA 1UKVY 4OI0A 1A9OA 4QWMA 2J9RA 4YHBA 2WY2D 5KINB 5D3QA 1M6HA 4JOSA 5EL0A 4WLUA 2HLNA 1OX5A 3AZPA 4L9WA 1UBLS 1UZUA 1Y5LA 1Y8QA 2CF5A 3VKWA 1CY1A 2QTFA 2Q9BA 3GIWA 3OJCA 3AP3A 1V3TA 4KAFA 2CW5A 1W73A 3TLJA 3O4FA 4F06A 3LLMA 4OXYA 2YMPA 5BXYA 3K70C 4IY1A 3GRFA 3QEJA 2CXPA 1IRXA 1SXHA 2AJDA 3ICCA 3JWGA 1IXYA 5E2BA 4MJXA 4XPZA 3RVLA 1A82A 3GN1A 1EU1A 4UPVA 4JYZA 1JU9A 1R0RE 3M5CA 1FDUA 4ZO7A 2P4UA 3GNSA 3IBYA 1AS0A 3AEXA 3NLLA 2D1TA 3CUTA 3NDIA 4FEGA 4YK7A 2QPAA 5CCXA 1P0MA 4GF5A 1XXHB 4BMYA 5CURA 3PE4A 4EHHA 3IP8A 1A2QA 1MX5A 1QVRA 3DM5A 1LDGA 1U3CA 2CZQA 2ZE6A 3OM1A 3A4NA 1UZLA 1D0SA 1PL6A 2VDWB 4GOND 5A3SA 1BG6A 4EA8A 1Z2DA 1VG9B 3OTGA 2WHYA 4GXRA 4LXIA 5EP1A 4OAQA 3M9XA 3N7TA 3QA3E 3B1JA 4UREA 4WAUA 3BTUA 4AMBA 1E2HA 3KUKA 3W04A 3V34A 5JAQA 3SXUB 2GPNA 1RIIA 1Z18A 2EKZA 4BNDA 4BPBA 2IIPA 4ZFNA 4OLBA 3Q40A 1HMYA 1Z7EA 4EIWA 3NIGB 3WRWA 4Q4DA 5DWDA 5GZ1A 4TS4A 4UD6A 5A2QA 1GZ4A 3ACBA 4IW3B 3SKVA 2RHMA 2BFCB 3RVMA 1L5HB 3B12A 4RF2A 1R66A 4TQGA 2NU8A 1SURA 2IITA 4KPUA 3DFZA 1LTQA 2XYQA 2F1OA 3B82A 3AGPA 3LCUA 4UHHA 2WQ7A 3A9UA 4DLBA 4YJGA 1JAHA 4KFRA 1MB4A 1BGWA 1XCBA 1ATZA 2ES4A 2O6HA 4GM4A 4C2AA 2WF8A 4I9GA 2ZB2A 5JUWA 3S4YA 4D4JA 2H92A 2JFVA 3CLTC 1ZIOA 1CHDA 2VK8A 4US2R 3FWNA 3B1KA 1TAHA 4AWBA 1Y8RB 3I0MA 1FYWA 4GX2A 2P9CA 1JR4A 1SVLA 1RJEA 1BMQA 3V00A 1DZ3A 3M1YA 4H18A 3CNQS 4B7ZA 3CB4A 2PPVA 5AHRA 1GU0A 1Z6TA 5LP6A 4XOIA 1I4OA 1KDYA 4M3NA 2C7PA 2AC7A 3EVFA 3NVKI 2M2IA 2Q1YA 3U9LA 1JKMA 2Q1TA 1EP9A 1ACMA 1U8XX 2OENG 4MW2A 2YWBA 3QLEA 5KYKA 5FR1A 4G9EA 1ZH8A 3MGAA 3PKJA 1P74A 3GRZA 4H7DA 2FCAA 3DH0A 3W4IA 2XE6A 2QD3A 3C7AA 1A8SA 4YC7A 4LZAA 3UJBA 3GRRA 4OB7A 1TEXA 4ZN6A 3MJSA 1VOTA 4B2YA 3KTOA 4H2DA 1DKOA 2JAHA 2P0AA 3DZ8A 3FCOA 3RM3A 2J67A 4O2AA 2KS6A 3EQ8A 4DSZA 5L53A 3AHGA 4Y6QA 5FTKA 4Y8VA 2HEGA 3DEYX 3T5DA 4Q3EA 2ORWA 1D07A 3JAKA 3HDTA 4MRNA 2JGDA 2Q4RA 4W1RA 3SYMA 3SR4A 1G3RA 1R0WA 3LT0A 5BRAA 1JR3D 1Y3HA 5IW8A 3HCFA 3LZDA