3A1VA

Crystal structue of the cytosolic domain of t. maritima feob iron iransporter in apo form
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
254
structure length
252
Chain Sequence
b'HMVKVALAGCPNVGKTSLFNALTGTKQYVANWPGVTVEKKEGVFTYKGYTINLIDLPGTYSLGYSSIDEKIARDYLLKGDADLVILVADSVNPEQSLYLLLEILEMEKKVILAMTAIDEAKKTGMKIDRYELQKHLGIPVVFTSSVTGEGLEELKEKIVEYAQKNTHRMILDYGEKVESEIKKVENFLRDKKLRINPRYFALKYLSGDPEFYSEGVKLGLPELSEEERIGYRLLIAKRKREYVENVVKEAFA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Iron(II) transport protein B
publication title Structural basis of novel interactions between the small-GTPase and GDI-like domains in prokaryotic FeoB iron transporter
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transport protein
total genus 87
structure length 252
sequence length 254
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02421 FeoB_N Ferrous iron transport protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3a1vA01
4F91B 2FSHA 2VP0A 5JJKA 3TSWA 1VCMA 1Q1BA 1TF7A 1TNDA 4OI1A 1M74A 1E9RA 2DB3A 1Q1ZA 4PX9A 3TR0A 5DH9A 4OK6A 3W6PA 3U4QB 3SBEA 3PUYA 2JCSA 4LPSA 1BKDR 2ORVA 3AVTA 1KMQA 4X8HA 2G3YA 2AKAB 2IUTA 1WQ1R 4W7SA 2AKYA 4V03A 4C0SA 2R9VA 3RS0A 2C96A 2GCNA 4I99A 2O8DB 1AQYA 2IF0A 4DDTA 4LHVA 4ZPXA 1W0JD 1ZM4A 2GHIA 2GVDC 2WV9A 1NIJA 2IYXA 4A0FA 4BFZA 4TT3D 2JJ8A 5B2ZA 1KZ7B 4D81A 3GLGA 3CUEF 3RS5A 3UG6A 4G5QA 3EZ6A 1S4QA 2PCJA 2R65A 3LFUA 4US1R 4KYIB 1SHZA 1AN0A 2BIFA 3IIJA 3B1XA 1CULC 2NPFA 1ESNA 3IQXA 2QSYA 3SC3A 4L5BA 1AZTA 2GDJA 3JZAA 1XXHB 2HLDA 2WMOB 3TKLA 1RFLA 121PA 4BFWA 4F4CA 4BFTA 2JLVA 1ZMXA 2V3CC 4H9GA 1WCV1 4DXAA 5FPHA 1KTVA 2QORA 1NSTA 4TLAA 1G8PA 3QXJA 1MV5A 1VCNA 3MWJA 3MMPA 3A1TA 3CX8A 4I1SA 1FPMA 1CBUA 1ZD1A 2V7QA 3AKEA 3KJIA 4LRWA 4DCVA 3BK7A 4A0RA 4LX0A 4BRWA 3TGPA 2ZRHA 4RD4A 2A5GA 2REBA 4C30A 2RHMA 5FPYA 4DBLC 1CF4A 1EFRA 3R9WA 1WBDA 2GCPA 3ZGXA 2BMDA 1N6PA 1NG9A 2CDNA 1WA5A 3SFVA 4A1FA 3PCRB 4OBEA 1GDDA 4IJMA 2O8EB 3AKYA 2WTUA 1Z63A 2WWHA 1WE2A 2GZAA 1EX7A 2VF8A 3DDCA 2OCAA 1E2PA 2N1BA 3MJHA 2Z5FA 4LJ5A 3WBKA 4DCUA 5F9FA 4TQ9A 5AUPB 2Q3MA 2ZRNA 3B1WA 4FMCF 5JCZA 2FSFA 5GVRA 2EU8A 3K70D 3EWSA 2GK7A 5FL3A 4AKEA 4CVNA 4XJXA 4B6FA 4A2PA 4IOLA 4HEJA 2LKCA 2I3BA 2PBRA 5HTKA 1RVDA 4P33A 1KOFA 5EP4A 2CHGA 1N0VC 3FVQA 2QQEA 3PFIA 3QENA 5FOVA 4CYMA 3A1WA 2NZJA 3O8CA 4IFEA 4ON9A 1LS1A 3GJ8A 2AK2A 4YDHB 4MGZR 1KAGA 4V0KA 2P3SA 4PSAA 4XVRA 1P2SA 4AYXA 3W34A 3EZFA 3KJGA 3NDBB 1E1RA 4NKRA 3AKDA 5DSZA 3EPHA 4JSTA 1KDOA 1CXZA 1R4AA 3AVWA 4EFLA 4KSBA 1P9NA 3I8SA 4R71A 2HYIC 3K9GA 4PANA 1OXXK 4K8OA 1AS3A 4Z51A 4G5OA 1Q12A 1GKUB 2IK8A 3GQBA 4GT1A 4MKGA 3EAQA 4Q4JA 3X1YA 4B44A 4ZI3A 5KHOC 1VMAA 2WSSA 2ZYWX 3L0PA 3MAAC 5EZ5A 2NO0A 3ASYA 2BVNA 3FMOB 5L8VA 4OI0A 4URYR 4A4DA 1UKYA 3GLHE 3C15C 1QF9A 4GI7A 4GSYA 1YZGA 1BOFA 3L0OA 5EXTA 4DHEA 2OXCA 4TMZA 1A82A 2KB0A 5CDFE 3IGFA 1SXJA 1E2DA 3BB1A 3VQTA 4F4JA 1FMJA 2ZI7A 5AUOB 4I1VA 3AEZA 3RSOA 4JJZA 1OB2A 3B5JA 1E2IA 2ZS9A 1ELOA 4PC3A 3SNHA 4TYWA 3BD9A 3AV0B 5EE5B 4DT1A 1E2JA 1MH1A 2Y8EA 4YLGA 1TL7C 3D31A 3Q72A 5TV2A 2ZVQX 2VHJA 2XGJA 1N6KA 5F3WB 4QG7A 3C5CA 2YZ2A 4Z1MA 3WMEA 5J47A 5TMPA 3K0CA 4Q48A 1XEWX 2G0NA 2X77A 2WKRA 3LNCA 2HT1A 1P6XA 3TQFA 4KFSA 4UXJA 1NLZA 1XTJA 3P27A 4KFTA 2F1HA 3KDSE 4CT5A 3NDPA 5GJBA 4BLOA 3R8CA 2BMJA 1PLLA 4HZUA 3CO5A 5JCPA 4LJ6A 2GJ8A 2IT1A 2W83A 1N6IA 3KB1A 3ZZUA 5DYGA 4WBSA 2IYYA 3DVLA 1I4LD 3ZIAA 4ZCLA 5E4FA 4Q9KA 1KSHA 3GLIA 1KKMA 1UKEA 3TSOA 4IVQA 4LBWA 1X86B 5HZHA 3A37A 1COWA 1NN3A 3K0CC 4JVLA 4LJYA 1CJUC 3Q7QA 3GLGB 1ZD8A 2IYWA 5HZKA 3K09C 3K53A 1T0JB 4DSTA 4PO8A 1DG1G 2A5DA 3QVVA 4KLZA 4V0LA 3BH7A 4B3GA 3KZ1E 2XTNA 1Z5ZA 3F0TA 2QA5A 4JLMA 2ZI4A 1OFHA 2P2LA 2IWRA 1T8TA 3UXMA 2Z4RA 2O0KA 1PZNA 1QBKC 3SE0A 4B71A 1E2LA 4FMBB 1U8YA 2XX3A 4Y0VA 2FU5C 2Q3FA 1U0JA 1P62B 2IL1A 5E7IA 3WHLA 3K0SA 3Q85A 4EFNA 4QGHA 4R9UC 1XB2A 4URVR 2PZFA 3NH6A 3IHWA 3WY9A 1OIVA 2O0JA 3BH6A 3R9IA 1JR3D 2OAP1 1HUQA 2ZSDA 1EESA 4E07A 2EFDB 2VSFA 2Z0MA 1TX4B 4GOJA 4XVQA 4WAUA 2D7CA 1SQ5A 4UJ5A 3KQKA 1CP2A 2J7KA 1TADA 1P3JA 2P65A 4PPQA 3T5DA 1FW6A 3GMTA 4NU0A 4AKGA 4QM6A 2GESA 2B8TA 1MO6A 4D80A 5CB6A 1MRSA 3BGWA 4WOPA 1R0XA 2XZPA 5IRCD 2AL7A 3M6AA 2IYZA 3QF4A 4N1AA 4BWYA 2B7BA 4A2WA 3I8XA 4JLVA 1U94A 2BMEA 1R5NA 4FMCB 3FWYA 4HZIA 4BLSA 5C2JB 5LD2C 4IEIA 2H1LA 2XNSA 4TL9A 3L8YA 3SBDA 1EK0A 1KO8A 1NBMA 5E7MA 5FTLA 2HCJB 3NBZC 3T61A 4DB2A 3A8TA 3ZZ0A 1T0HB 4XVUA 4Q4AA 2E1RA 1R6BX 1IQPA 3RS4A 4C0QC 3W3AA 4JLKA 2CVHA 3SEAA 4I81A 1E98A 2ATVA 1NMXA 1GTVA 2F9LA 3UATA 4B43A 1X1SA 1BS1A 3IBYA 2GAOA 4B3CA 1X6VA 5FH9A 1UADA 2RGEA 4GPTA 5EXPA 1D9XA 4GBMA 4Q4JB 2FN4A 3QF7A 4YQFA 2FFBA 2W2XA 1G6HA 2BJVA 1EFUA 4NCNA 1RZ3A 3GEHA 4OK5A 2ZRBA 5IF9A 3I61A 3THWA 3A4NA 4GMXA 4TLCA 3RRZA 2NGRA 3VR3A 5JLJA 2FV8A 1S9DA 2QU8A 3CF2A 4XWKA 1M7BA 1SXJB 3ECCA 3QY0A 3ZVLA 2I1QA 1AZSC 4MGKR 2VP4A 3ZD6A 2ZS8A 3OAAA 4PPNA 5EE9A 3B1ZA 1KNXA 4DWJA 2JLRA 1IHUA 4XSGA 4DT1B 2EVWX 2GCOB 1W1WA 3CM0A 1P2UA 3Q5EA 1KDTA 4JLDA 3LBIA 4TQUS 4QOSA 4XWAA 1CJTC 2NG1A 1E69A 1YJ5A 1E99A 5IK2A 3IIMA 1Z0FA 4IOJA 3ND8A 2WWWA 5FBRB 5HE9A 4IDNA 4ESHA 3PITA 4OJKA 4PPFA 4LJ8A 2KWIA 2PZGA 3AUYA 2W00A 1OLOA 4TTPA 2EFHB 3QQ5A 2W0SA 2O8BA 2REXB 1UKZA 1JAHA 2VIIA 4JL8A 2N46A 1NVVR 1T3HA 3HYTA 1XZPA 4JKYA 4BFVA 3TAHA 2QNRA 4MUBA 4AK9A 3FHTA 1E2NA 1GITA 2C03A 3WRXC 4EFMA 3GLIB 4JBXA 3W9YA 2J0VA 4B33A 4IVPA 4HAVA 1A4RA 3T34A 1N3BA 3BXZA 2FH5B 2OHFA 2HJGA 1QVAA 2YWFA 4AKIA 3SHFA 1UEIA 4JBYA 4XIGS 3GFTA 4D4JA 1W47A 4F92B 4HAYA 2Q9BA 5JJLA 2AWNA 3CIOA 3U7GA 1DAFA 2ZIAA 2C2HA 4JVSB 4F7WA 4WXPA 1F2UA 1OF1A 2GEUA 2PMKA 4ZKDA 4D4MA 3W90A 1QHHA 3EG5A 5HCNA 2R62A 1P61B 2GJSA 4UXIA 2GA8A 1JXOA 2JLUA 1MOZA 1KNQA 5TVKA 2ZITA 2JASA 2GXQA 1NBME 1PUJA 3MCAA 5DNYB 5A5GA 3C41J 4YMTA 4M1TA 4J0QA 4DLWA 1W4BA 1IY1A 2ZRGA 1U90A 2ZUDA 3LH5A 2H16A 3QNUA 2WZQA 3AH8A 2OG2A 2WSMA 3P32A 4AWXA 4DEXA 1T91A 2JJ2D 1WF3A 3SYLA 3AVQA 1DE0A 3X2SA 2FF7A 1JXMA 3BC1A 1Y3AA 3G0HA 4G01B 1GNRA 2QPOA 1FP6A 1K8RA 2ZSBA 5CYOA 4AY2A 4Q9JA 2VYFA 3BJIC 1H8HD 4OQMA 4M9SA 4TWZA 2YWEA 3BB3A 4MKFA 2WWFA 4KFRA 2PH1A 1KI2A 2WKPA 4BGDA 2P5TB 3LV8A 4L4UA 1KJZA 2WJGA 3OIUA 3OESA 3WHKA 4OQXA 1JPJA 4FCTA 1NI3A 1RIFA 3OEED 5G3ZA 4QJ3A 3REFA 2D06A 3QF4B 1RRCA 4QHYA 2FDCA 2UZ3A 1JI0A 4NBSA 3B13B 2EFGA 2X2FA 3CH5A 1FFHA 1Z07A 2PCLA 4PO1A 4OQLA 2QE7D 4B73A 3FDIA 3I72A 4Q9HA 3LQQA 1M34E 3ADKA 5C46F 4LV5B 3GFOA 2XOKD 4U02A 421PA 3UMFA 1ZU4A 1ZCAA 4Q4AB 3QKSB 3EZ7A 4HDCA 4LCBA 5FTJA 2BEJA 1H65A 1Z29A 2OM2A 2CCJA 1IOZA 1OH5A 1O87A 3AF4A 2OCBA 4Q21A 2C5LA 4NYIQ 2R6AA 5EUQB 1KI6A 1N0WA 1GRNA 1II8A 4NYMR 4UNRA 5JJIA 4A8JC 3BIFA 5FOWA 2W6ID 1KI9A 3KXIA 1CR0A 3WYAA 3VR1A 2ZSEA 1PV4A 2IA5A 1CKEA 1ZNYA 3FTQA 3W5IA 3THWB 4D4LA 2ZRPA 1GOTA 3IKJA 4ASUA 2F1RA 4R2IA 3H86A 1G5RA 2REOA 2B6HA 4CIDA 1OSNA 1IXRC 3W8RA 1IY0A 5J4LA 5EQTA 3FYHA 4XTCS 1L4YA 2QM8A 4P4UA 4R98A 5CIWA 3I5YA 2FOLA 2YC2C 5ELXA 1XMVA 1BH2A 4PHFA 5GADl 1S1CA 5FL7A 2R8RA 4QGFA 4CEHA 2ZRAA 3K1JA 1UDWA 3IDQA 3CRQA 1E0KA 4IXMA 3ASZA 4QFMA 5K8IA 1IN7A 1TQ6A 1X8JA 1E32A 1UDXA 2OILA 3PEYA 3VNUA 1X1RA 3MJRA 3AF1A 1DPFA 2BJWA 4NCHA 2PMDA 4C2TA 3PQCA 3LO5A 1G21E 1U0LA 2DFLA 3PR1A 4NZYA 3OEHD 1E9CA 3SJBA 2KJQA 1JECA 1NF3A 1I4DD 2O8BB 4OQNA 1MO5A 1YE8A 3M1IA 4XD7A 3RANA 4XSHA 4PTLA 3U3OA 2JDID 5JWHA 5CJPA 4AI6A 5CK5A 4ZI2A 2ZAMA 3QXXA 2BDTA 3TVTA 3IHLA 5D3QA 4LDJA 1EXMA 4OHYA 4LZZA 3GEIA 5HR5A 2IS6A 5J4YA 4UNPA 4HLUC 3IPYA 4PHTA 5FI0B 1R7RA 3REGA 4ACAA 3QUSA 4MRNA 3ZJYA 2WWYA 5EE1A 3CB4A 2H8KA 1F48A 2DWPA 4OI2A 2KSQA 3LVQE 4HUQB 3CF6R 3KB2A 4LYFA 1KSJA 3OFND 4LJ9A 2GILA 1XCMA 3LW7A 3FHCB 3GJ7A 4W9MC 2ZRLA 1E0AA 3DZ8A 4YONB 1UAAA 1NN0A 3VR5A 2CK3A 4HUTA 3QPUA 2O8FA 1E9AA 1G19A 1OW3B 1F2UB 2RGCA 1TTTA 5DHAA 3HU2A 1VYTA 1QHHB 2QTHA 1WDTA 4C0BA 2ZRCA 2CJWA 5L3VA 4Q7KA 4QXAA 4OHXA 4RSGA 4DJTA 1ZNWA 3K9LA 3M4YA 3IEVA 2WPDD 4P4TA 3VR4A 1MR3F 2BBTA 1KI4A 4CRWB 4H1UA 3T1OA 2QGZA 4IDPA 2IS2A 2QT1A 4WIAA 5FTNA 2CVFA 2ONKA 4D2IA 4B3BA 4EQ6A 1Z08A 1GAJA 3V4FA 3W5JA 1DAEA 1J70A 1HQCA 3HR8A 2PJRA 2QAJA 4US0R 2BC9A 3GEEA 2FPMA 1GRRA 2ZJ8A 5AJWA 1D9ZA 1XJCA 2VP6A 4QJ4A 2DHRA 2PLRA 1KKLA 5KSPA 1N5LA 3QXCA 4RFVA 1N5KA 5J4KA 3EWAA 2VHCA 2VHUA 2FFHA 2OESA 4CEIA 3VFDA 4B35A 1YRAA 1XWIA 1XBTA 4LC1A 1QDEA 3N2IA 1UM8A 3QJYA 4RY2A 1HY3A 3U6KA 4KSCA 4JYCA 2JLXA 4HI0E 3UPUA 1M2OB 4Q01A 5CYPA 3HR7A 1E79D 4TMTA 2WWXA 3FMPB 4ACBA 3AP2A 2JLQA 4LV8B 1R10A 521PA 3PEVA 2MSCB 1GZSA 4A8JB 2VRWA 2FNAA 2XSZA 1V5WA 1Y63A 2DWQA 1TU3A 1XF9A 2GVZC 4POAA 3VU9A 4ZIRA 2WMNB 3A1UA 2ODBA 1E0SA 4GP7A 4Q1CA 4C4PA 2YKGA 4UNSA 3SJCA 3HPRA 2ZRFA 1DAMA 3GLHA 2QRNA 4Q1AA 5LB2A 2H57A 2QMUA 2HT6A 4AKHA 5CDFA 5L3RA 2RGDA 2H5EA 4MITA 5BN3A 3CX6A 3FMIA 1N25A 1G4UR 4UNQA 4UKDA 2QP3A 2IUSA 1KI6B 4RCZA 1G8HA 2XJ9A 3EIQA 1II8B 5EJEA 3IPXA 1JQJC 2JLWA 2IYRA 4MKHA 2A30A 3U3KA 1XEFA 4Q5IA 3NVAA 3QI2A 1SVOA 3C16C 4YXWD 2BOVA 2X19A 3NIBA 4TSFD 1W48A 1DAGA 5KSYA 2JLYA 3Q9LA 2C98A 4F4IA 4MYCA 1F5NA 1HT1E 4FIDA 2F7SA 2B21A 2QAGA 3B2EA 2JA1A 3MWLA 4LBYA 1XDBA 3EC1A 5FPTA 4QL3A 3U2QA 4TL7A 3EPJA 1LTQA 1XCPA 1U2RA 4DSNA 1E2QA 1L7VC 1OT3A 2W2VA 1VECA 2OCYC 2Q6TA 4CEHB 2OO7A 5FBWB 2X2EA 4V0ME 4N3NA 1G7CA 1XD8A 2YWHA 2ZYUX 2OBNA 1C9KA 1HEIA 3FKQA 5KU1A 1SKQA 2Z43A 2ZRDA 1NN5A 4B34A 1P75A 5TDHA 3NKVA 3D3QA 1Z0KA 5GJWC 2OSBA 4Q66C 1G64A 2IYVA 4M1OA 4FINA 1E1QD 3AVYA 2QAGC 1Q1EA 3Q5DA 4DUGD 3AVVA 2DCUA 4DEYA 1BMFD 2WWGA 2BBOA 2F6RA 2V8OA 3QXSA 1SVSA 2RB4A 2C95A 4Q19A 4ERNA 4FN5A 3KQLA 2ZU0C 4LYAA 1P60A 3RYTC 2FMXA 3V9PA 1TF2A 2RGAA 2ZETA 3PG5A 3I62A 2ZREA 2CE2X 2O8CA 2C9CA 5FFMA 1GWNA 1G7RA 2ZJZA 3KXKA 3ICQB 4FI3C 1G1MA 2FJUA 4I4LA 4GDFA 3T5GA 3OE7D 2ZUBA 3ZQ6A 1OHHA 1Q44A 2W58A 1T8UA 4BUJA 4URWR 1Z6AA 1KJYA 1Z6YA 1XPUA 4Q9LA 3RS3A 3FKSD 2K5UA 2QG6A 4DLSA 3SJZA 2D74A 1GNQA 3AF0A 4QKQA 2ZE8A 3I92A 1KY3A 1NKTA 4UNNA 1XZQA 1GILA 2B8WA 1OXUA 2RGXA 2CLDX 4TTQA 4AC9A 4D6PA 3WMGA 1AS2A 5LBIA 1A7JA 3TE6A 3KJHA 4AIIA 5JEEA 1IM2A 4M8NE 3RRMA 1W2HA 4BPBA 3H4MA 5H68A 4KVAA 3LAWA 4Z8YA 1CS4C 2CJWB 5EE0A 4BE7B 2WAXA 3KQUA 1ZC3A 4BEJA 5LPNA 1JR3E 4TL6A 4PZLA 4IW3B 2W0MA 2FEMA 4RZXA 4TYNA 4EPTA 2CCKA 4LPKA 4NYJQ 4NMMA 2IX3A 1G4AE 2RGGA 5BQ5A 3EPLA 2CNWA 1AGPA 2GZDA 1JNYA 1KMHA 3DHWC 1ZUHA 3KUCA 4BZQA 4EQ6B 2FPKA 2V1UA 1GVNB 4FWTA 2W6JA 1Z28A 1JR6A 3CNOA 1YRBA 4X8LA 4B76A 5CB8A 3GJ4A 2GRJA 1CR4A 4HB2A 3TMKA 3KUDA 3CRW1 4C0JA 4ITRC 1U9IA 4RVCA 3EPKA 4LWZA 1ESMA 3G5UA 4G5SA 2ERXA 4U00A 3T12A 2AXNA 5KSOA 2BM0A 2F1JA 3DMDA 3MWKA 4DSOA 4C7OA 1HT2E 1TUIA 2ZJ2A 5KDLA 4LYJA 4LBZA 1SXJC 5DN6D 2ZUCA 1GKIA 3CWZA 4RZ2A 1W36B 3SYNA 5DI9A 3EIHA 1RKBA 3FPAA 2AFIE 4FW9A 4LBVA 4TYPA 4ZO4A 5FPSA 4BLTA 2FSIA 5AJYA 5JEDA 3ZLJA 3VNVA 4JYBA 1FTSA 2X8AA 3GLHB 4B2PA 3DO6A 1IJFA 3OIVA 2OLKA 5DYIA 4DRZA 4M4SA 3U61B 2PL3A 3V4RA 4PHGA 1Z83A 2FFAA 3VX3A 2HF8A 4NDZA 2PLFA 4BZXA 2VQSA 3BBPA 3NEYA 4M53A 1HQYE 1TEVA 4IVRA 1N6NA 4G5RA 1FMLA 1E6CA 5EE3A 4HAWA 4NONA 1T5IA 2VO1A 4ZDWA 3HYRA 1G8GA 4HAXA 3NXSA 2VA8A 4D82A 2NMVA 5TB5A 2XXAA 3B82A 3RSLA 3PUWA 3B9PA 1E0JA 2ZU6A 3KX2A 3CH4B 2Q9CA 5L3SA 1CU1A 3FHOA 1US8A 3RS2A 4X8MA 4PC2A 3EA5A 1NLFA 1E96A 2OEPA 1VCOA 5DIFA 1HYQA 1W4RA 2PX3A 2QAGB 4IFBA 5C18A 1XTSA 1RJ9A 4M9QA 1MO4A 4PR0A 1KJWA 3U3JA 2JIZD 1KO1A 1H8ED 1GP2A 2CE7A 1LB1B 4UXHA 1PVOA 1T5LA 3B78A 2WJJA 1G3UA 4IDOA 2JJ1D 1OKKD 1ZRHA 3VTKA 3GD7A 4JLBA 4RKEA 4BECA 4DSUA 1LY1A 4KAXA 4EPXA 5CM8B 4D0NA 2ERYA 3NTUA 4K46A 3CLVA 4MDFA 1YZNA 2XAUA 3MRSA 2QTVB 4QJ5A 2IXEA 4H1VA 4Q7MB 3B60A 2NPIA 2D62A 3TW4A 2YOGA 1NKSA 2GZHA 2XNDA 5KOYA 4G3XA 1QHIA 4JSYA 4TMXA 2ODNA 4FCVA 4TYQA 4WZAE 5FOTA 4IXNA 4MYHA 1W7AA 1IN8A 3VKHA 1G7TA 2CCGA 4OHVA 4TN1A 3SDZA 1OH7A 1J8YF 4BFSA 2O8CB 3H2YA 4GZMA 1XCGB 3A36A 4JMPA 4OL0A 2ODWA 1KSFX 5J5CA 4MH0R 1R5OA 3JVVA 4LV6A 3SS8A 2C77A 2MMCA 4M1WA 4MRRA 4BRUA 3VMFA 2OFWA 2VH5R 3BAFA 2PT5A 1ZAKA 2TMKA 1XMIA 2J7PA 1E2HA 2ZTSA 2QENA 1GNPA 2ZRJA 3UMSA 3ETLA 5JMTA 1LFDB 2H92A 5H8WA 2HYDA 2PEYA 2DR3A 2C78A 5G3YA 1XJQA 3V00A 4A15A 1CRPA 3AF3A 3FOZA 2PJZA 2Z4SA 4PO9A 5FBLB 4EPRA 1RPZA 2XZLA 1FP7A 2G1JA 3QKUA 3T1QA 1OFTA 5FOUA 1N6LA 4DDVA 3KKQA 5AR1A 5JRJA 5JI3E 1Z6GA 2AD1A 1CR2A 1KHTA 1OE0A 3NC0C 1II9A 1Q0UA 3JZMA 4WZ6A 3CPJB 2JAQA 2PZEA 4QGGA 3FGNA 1FNMA 3THYA 1L4UA 2R44A 3GJ6A 2HLDD 3DKPA 4CF7A 3MLEA 5AUNB 2KE5A 4IHQA 3NBFA 4MRPA 2I4IA 4LHWA 2QPTA 1X8KA 4RFSA 3L0IB 5EP2A 1Z0IA 4OJQA 2QBYA 4RZ3A 4PC6A 1KMHB 3EA0A 2HEIA 2V7QD 1EX6A 2GAAA 1R8SA 1ZUNB 3BOSA 1XNJA 1E2MA 1S96A 2OXRA 5JBQA 4DVGA 3PEWA 3I32A 4B2IA 1XMSA 3GLFE 3UMRA 1ODFA 3KKNA 1EFRD 2ZRIA 2NO6A 4HDQB 3X1DA 1W0KA 3MD0A 3G82C 1M8PA 1ZM7A 1SKYE 5JS8A 3BWDD 2QTFA 4TZ6A 1XJ0A 4PAQA 4RD2A 2GBLA 1DS6A 2FGKA 1C1YA 2WOJA 1HH4A 1KO7A 4PQYA 4C7OB 4Q02A 4Q7JB 5JI2E 3Q3JB 1FX0A 1VYVA 2SHKA 5EZ6B 2F3RA 3GPLA 3CF0A 2HXYA 2EFCB 4BLPA 1JJVA 3IBGA 3TH5A 1CLUA 2VP5A 4NE2A 2L0XA 2RGNA 4R2HA 1QHSA 3RS7A 6Q21A 1QRAA 4LC0A 1IN6A 2KI5A 4B75A 1ZNXA 4HZUB 2H18A 3U7FB 4YC7A 1W49A 1LF5A 3RVBA 2VLIA 4FMDF 4C0LA 3Q7PA 2QROA 1OH8A 2XTMA 3RRNA 1DADA 1VG1A 1W5TA 5FPKA 3A6PC 3LDAA 2R6CA 4O25A 1E1RD 2VEDA 3HDTA 2OT3B 3TSZA 2C9YA 4ZV4A 3DKVA 2B7CA 5DE3A 2V4ZA 2VSOA 2UVQA 4BLRA 2GTPA 2ZEJA 2WJVA 3DEFA 1KI1A 4FD2A 4GOXA 5TY0A 2RGNC 2VBCA 4YDSA 1AS0A 1FUKA 1XFAA 4QBHA 4G5GA 5L3SB 4AURA 4BFUA 3FE2A 1US8B 4NCKA 2ZXUA 4QC2A 1E94E 2WSSD 221PA 4TYYA 4E22A 1SULA 5FTMA 1Z0JA 1YHNA 2G77B 2H7VA 1KI3A 2WKQA 1RJ9B 2OBMA 4OQFA 4URZR 4MGIR 3FB4A 4EPVA 4AYTA 2Z83A 3PIRA 3WBJA 5DGXA 1SXJD 2MMGA 2WWIA 3LQRA 3BORA 2YOHA 3B1VA 4XOIA 3EXAA 2BMFA 3RC3A 3U44A 2B92A 1W0JA 4QBIA 4W5WA 4CW7A 1QHYA 4TT3A 1JAIA 4ILEA 2YVUA 2IXGA 4MGYR 2G88A 1GL6A 1BYIA 4EDHA 4NYIR 2RHDA 3EASA 1OYYA 2ZSFA 4PZYA 1NL3A 1E4YA 3DM9B 3MFYA 3WMFA 1HTWA 4Z1MD 2EW1A 3LX5A 1JQLB 2JATA 2IWHA 4IKEA 4CT4B 4L16A 2C8VA 4IDHA 5JRZA 1KZGB 1Q21A 721PA 1R2QA 3PEUA 1U98A 2J1LA 2ZPTX 3AVUA 1WP9A 3PUZA 1DELA 4KU4A 1E9BA 4URUR 2IC5A 3WP0A 4X8OA 1G7SA 4A0HA 8OHMA 5BN5A 3BE4A 2WIAA 1JB1A 3W6OA 1ZD9A 1NSFA 3ZIAD 4EKDA 1D2EA 4R7ZA 3NH9A 2OCPA 2BWJA 3LBHA 1COWD 4A82A 3B8HA 3C4JA 4O3MA 2QZ4A 4A92A 3KKPA 2IS4A 1HE1C 5AJXA 4HLCA 2HUPA 2GNOA 2E9SA 3K9NA 5J40A 1GL7A 2O0HA 5B57C 1G8FA 5FUXA 1JJ7A 3THYB 1TEXA 4B6EA 3ZVMA 3ZS8A 1T3LA 2ZI5A 1FOEB 1AQUA 1NMYA 1ETUA 3AVOA 4M1YA 2W2TA 4KLNA 3C5HA 3AUXA 3LVRE 1JPNA 2ZI3A 1KYIA 1XD2A 3X1ZA 1K6MA 3A4MA 5AJVB 1W46A 1OIXA 1ZM9A 1KI7A 1Z2CA 2D2EA 1F6BA 2ZVPX 4RJLA 2QBYB 1EWRA 1FUUA 3P20A 1Z2AA 4GOKA 2FSGA 2ZJBA 1R0YA 1SVIA 1Z8FA 3AQ4A 2OE2A 2RKOA 3N2EA 4Y0AA 2XB4A 2EQBA 5AWFC 1G3QA 4IDQA 3SU8A 4D4KA 4E03A 1Z47A 2VSXA 5JS7A 4KV9A 1B23P 1ZIPA 2VL7A 3AVPA 2EWVA 2HDNB 2ODEA 4P3YA 3ADCA 1GUAA 4JIMA 4N0DA 4CDGA 4B2LA 3KL4A 2ZSAA 1OFIA 2FWRA 4D25A 2H17A 5CITA 4P32A 4DLVA 3TUIC 1G6OA 1FX0B 1XTQA 5HPYB 4M0LA 3RRYA 2HCBA 1VCIA 4TLEA 3SI7A 3A1VA 4DLZA 1DAHA 2XZOA 1PUIA 4PSKA 3GCGA 1U99A 5FUYA 2CEAA 2YC4C 3SOPA 2P0EA 3ZDQA 3K9HA 2CHVA 2J9RA 4ZDIA 1DO2A 1P2VA 3DPUA 3P4XA 3VR2A 5CLLA 2VPPA 3ZQJA 2AXPA 5SZHB 5G41A 5CIQA 1NBMD 3T06B 5GJCA 2WHXA 1IAQA 2JLZA 2A5FA 5CJ2A 4GZLA 4KBGA 3ZYCA 3J81k 3WP1B 2CL7X 3VR6A 4BZPA 2R6FA 3TQCA 3EX7C 1JEDA 4V0MA 2AFHE 4FMDB 1G9XA 5DN6A 3SQXA 4LJ4A 4A9AA 4AG5A 2IYUA 3P1JA 1G20E 3AF2A 1RW4A 1JALA 1M7HA 1G3MA 4JLPA 1E9SA 1HV8A 1N5IA 1M6NA 1DTSA 3U7EB 1J8MF 2KBEA 2NO1A 4P4SA 1GIAA 2ONJA 5KDDA 3N70A 4YMWA 4B32A 3UANA 1YVDA 2Q0HA 1SVKA 3OIYA 1NVXQ 1VHLA 2CLCX 3OAAD 4LJ7A 4DDUA 1RYHA 1L8QA 2QL6A 4OK3A 3U44B 2OFOA 3UIEA 3GJ3A 3PUVA 4WW0A 1Q3HA 4EJSA 1WRBA 5E95A 1Z6XA 2YHSA 3C14C 3HWSA 4Q7LA 1SZPA 2G1KA 2QEQA 4EUNA 5FUVA 2YYZA 5IK2D 4UQOA 5HE8A 1KO5A 1QHNA 3D6TB 2IUUA 5KPJA 2RGBA 3IO3A 1OB5A 1OH6A 3T35A 1BIFA 1P73A 5ANRB 3GJXC 1W44A 4EPYA 4NHOA 2DPXA 3E2IA 1U8AA 2ZR0A 5SZKB 1RRPA 3HU1A 4ZCMA 5CK4A 4B74A 4Q4HA 3MWYW 3I3SR 1S0UA 2CBZA 2C04A 1P72A 2FFQA 1JR3A 3DZDA 5KYKA 4Q4LA 4HLDA 3K0EA 1OV4A 3EZ9A 1FL9A 1VTKA 4JT2A 4B3XA 4KXFB 1G17A 3KQHA 4NTZA 1OYWA 2WAYA 4NCJA 3SZRA 2F3TA 3T1VA 1FZQA 1P5ZB 2J87A 3AB3A 1IXZA 1XXHE 4PFSA 2IYLD 5DI3A 2FGJA 3GJ5A 4AYWA 2ZRMA 4GMDA 4OHWA 1IXSB 4QM7A 2QP9X 4NH0A 4PZZA 3K70B 4D0GA 1NG1A 4A6XA 4C9BA 1N5JA 5KTYA 1UPTA 1G18A 3IILA 4OKSA 1KO4A 1W36C 2Q21A 2IEYA 1E2FA 4QGAA 2IEZA 4JZKA 1BYUA 5FUWA 3UK6A 1XD2B 4C2UA 3FMFA 3RAPR 1HA3A 2GJ9A 3LD9A 3LA6A 2ZQ5A 5TXGA 5GJVC 1EFCA 2QPAA 1TU4A 2ZRKA 1JEEA 1Z22A 3T15A 3OHMA 2VP9A 1IN4A 2VTKA 2AX4A 4GRAA 4EPWA 1LS6A 2AK3A 1EFTA 2GETA 4QNMA 4B3DA 3NHBA 3PUXA 5BN4A 5IDVA 1XEXA 3LXXA 2D2FA 4TMWA 4BLQA 4KHZA 5UKDA 1I4TD 5FOSA 4HB4A 3KTAA 3EC2A 2VHTA 5JWOA 3SQWA 2J0QA 1X8LA 1ZUIA 2RAPA 2FX3A 3CRRA 2NZ8A 1R5BA 4I1OA 3B85A 5FTKA 2V54A 1VG8A 3C7KA 1NVUQ 1OXVA 1DAKA 3D7MA 3P4YA 4M1SA 5LDDC 2P6NA 1ZIOA 1YZKA 2FA9A 1T9HA 2GF9A 4NL4H 3QBVA 4LUCA 2ZJYA 4FXPA 3EIEA 1D2NA 4NYJR 2ZJOA 2Q9AA 1MABA 2P5SA 1LF0A 1NP6A 2BKEA 2QN6A 2XEXA 1HURA 2IYSA 4LHZA 3FFAA 5J4HA 5AJZA 3TVDA 4JL6A 4JKIA 1F60A 4QHSA 1XTKA 1TF5A 2QMOA 3AKCA 4KJZA 621PA 5L3QA 2BCGY 4Q47A 5EP3A 2D7DA 2YV5A 4DIEA 2Q3HA 4TTRA 1A2BA 2VHQA 4G1UC 4DZZA 1XD9A 2GJAA 4LHYA 3RABA 3UKDA 1R0WA 3NWJA 5JHHB 2JLSA 3CPHA 4DLYA 2OZEA 1NIPA 3L8ZA 3ND9A 4HAZA 4HYYA 4E5UA 3U5ZB 1FQJA 2AHOA 4E09A 1TAGA 2A2ZA 5JZVA 1Q57A 3QPVA 1VPLA 1NY5A 4U5XA 3SFZA 4EAQA 2O8FB 2DFTA 2QMHA 4Q1BA 4D26A 2QMEA 3LWNA 2R6DA 3X1WA 2LWIA 2GXSA 2NO9A 4O2LA 1VG9B 3CR8A 3QPWA 2F55A 2NO7A 1AA9A 3PENA 3S1AA 3CZPA 3BFVA 4P4SB 1YR8A 2IHYA 4ASUD 1N6OA 4AD8A 1J7KA 5F9HA 2F1IA 3TJZA 1G16A 2BCJQ 1LNZA 3R20A 4DCNA 3NHAA 3QBTA 2RH5A 4O0MA 3WRYC 4OI4A 3CBQA 1Z06A 2NIPA 1G3RA 4BQSA 1YZUA 1DEKA 4M1MA 5KO2A 1D5CA 4NPHA 2RCNA 3BRWD 4HATA 3U60B 4FWIB 3IQWA 1PLKA 4EJSB 5FL7D 4PHHA 2J41A 3AP1A 1NMZA 2BEKA 3WNCA 1Z0DA 1W4CA 4L9WA 3C8UA 5JHGB 3QSYA 2V9PA 4TMVA 3LRPA 2P67A 2WJIA 1MT0A 1P7CA 3ZZTA 3R7WA 2WBLC 5SZIA 1JBKA 3SJAA 2WVJA 4GL2A 3D8BA 4CEIB 3CKLA 1YKSA 1AKEA 3WYFA 4HAUA 1OPXA 4P31A 5FR2A 4CZ2A 2CLSA 3CX7A 5DLQC 3QVUA 3U3RA 4Z54A 4HB3A 3L82B 5FR1A 4XD7D 3BFXA 4JLNA 2A5JA 4JVNA 4LI0A 3QG1A 4Q4HB 5C1BA 4A0GA 4LJAA 2IW3A 2BM1A 3E1SA 3JVUA 4IOKA 3VU9B 4ZIRB 2GCOA 2JJ2A 4XWOA 3GLGE 3ZD7A 3CR7A 3MG9A 1AKYA 2GJKA 3QE0A 4Q03A 3VX4A 3UWOA 1U9IC 4DC9A 3M0EA 5HKKD 1H8HA 2A78A 2IHBA 5DI3B 1KGDA 1RE0A 2QI9C 4C0HA 1NY6A 4C3ZA 1G3IA 1ZW6A 1VIAA 5KNBA 2A3RA 3DM5A 3TW8B 5B64A 3GLFA 2ZJ5A 2CK3D 2XB2A 3E70C 2ZS7A 3K09A 2YOFA 3OEEA 2FE4A 1AM4D 3E5HA 1QG2A 5J4VA 1N2CE 4C0AC 2O5VA 3IIKA 5SZJA 3K0FA 4TMKA 4OHZA 1E3MA 1E2GA 4D0LB 2ORWA 2DFNA 2QE7A 3QKTA 1XPRA 2QGNA 3NBYC 4DCSA 4BFYA 1S3GA 2XOKA 4KITB 5EXSA 2WOOA 1QZXA 1YZLA 2QM7A 3UG7A 3VHXA 1ONBA 4ZCIA 3R9XA 5K8UA 3SHWA 3K0AA 5P21A 1XU4A 3KJEA 3EARA 3LLUA 1NVWQ 1BO6A 1XEXB 3KKMA 4Q1EA 3VHLB 4HSEA 1J90A 3KTAB 1Q22A 2BV3A 5D3MA 5FBQB 2XJ4A 1R8QA 5IHPA 2DYKA 1CJVC 3KFVA 2QUZA 3ADDA 4A2QA 3RHFA 2HF9A 2ZM5A 1ZCBA 1UBFA 1S2MA 2W6IA 2J0UA 2HV8A 2IBMA 3TUJC 1LW7A 2CL6X 5KPDA 1Z3IX 1CR1A 2OBLA 2WICA 2WJHA 3CNLA 4RZUA 1QVRA 4BFXA 1VIYA 2ECKA 2GF0A 1KI8A 1DARA 1SVWA 2ZYTX 1MABB 4FCWA 4M22A 5G40A 3ZH9B 2ZANA 3T1TA 2ZE5A 4ARZA 2ZE7A 4XTRA 3MUFA 1W36D 3W8NA 2XSZD 4RCYA 1NNEA 3CZQA 1ZVQA 1CJMA 4W5JA 5L3QB 5CM9C 3AM1A 4QBGB 3X1XA 4JLAA 3LBNA 2GEVA 3OF5A 3O8DA 4V0NA 3WNBA 1TUEA 4PAMA 2E87A 1S3SA 5F98A 3PVSA 4KVGA 2NQ2C 4P0TA 3F5FA 4MRVA 1IN5A 3EW9A 2IS1A 3SYKA 1KK1A 3LW8A 1DBSA 1O3YA 1W4AA 1YR6A 3KQNA 4IEEA 4QRHA 1XTRA 3B1YA 3B9QA 3OEHA 3CW2A 4DB4A 2VF7A 1SXJE 821PA 1Z0AA 3GFPA 4MRSA 5B58C 2FG5A 2ORIA 4ZDKA 5JSZA 2JDIA 2AN9A 5K8LA 1OIWA 3S1AB 2I1VB 1A1VA 2X1VA 1VHTA 4RKFA 4KCGA 4QHTA 4CEJA 3VKGA 1G5PA 3K8YA 1B0UA 4DKXA 5A4JA 1ZM3A 3OZXA 3TBKA 2QSZA 3I73A 1M1YE 2FEOA 1XEWY 1GSIA 3QKSA 4IOMA 1AK2A 4UJ3A 1S1MA 1ZBDA 2ZR9A 3BH0A 4PQRA 1OXTA 3W3ZB 2P6RA 5AUQA 3DOFA 3OFNA 3BFKA 4HB0A 4KO8A 4DLTA 2QQ0A 1AIPA 3ONWA 2A5YB 2GXUA 1DG3A 5A0FA 1ZP6A 3O8RA 2F43A 1VDZA 3KXLA 1ANKA 2MSEB 3R7WB 4IRUB 1E9FA 3WNDA 2WM9B 3O8BA 1GKYA 1M7GA 1AGRA 2G83A 3FFBA 1Z6TA 4Q9IA 3THXA 3B7GA 3TNFA 3THOA 1UBCA 2WPDA 4BEBA 1NLYA 1SVLA 3GLIE 1OJLA 2FPLA 4QBFA 3B6EA 5JWRA 1G5TA 1KDRA 4PQFA 1OXSC 5H1YA 5KNDA 4W5HA 2XITA 1F2TA 3WXMA 3ICEA 1J99A 2NOAA 4LGMA 1S9HA 3I4LA 3F3YA 1NJFA 1KSGA 4KI0A 4S2EA 1OHHD 1P4SA 1MKYA 2YINC 4OYHA 3ADBA 2GBLC 3QKRA 3HP1A 3U3MA 2ZYVX 1WMSA 2J59A 4LYHA 3TK1A 5M04A 4JBWA 1RC8A 4U7DA 1EFHA 1KY2A 2DY1A 3GLFB 3GP8A 3U7HB 3BB4A 4M2LA 5GVSA 1SKYB 1E79A 2EWWA 2XXAB 1G291 3K0FB 1U0HC 2GWHA 1YZTA 3NC1C 2HJVA 5BYJA 1WBBA 2EYQA 3GJ0A 3ZS9A 4C0KA 1D6JA 4M21A 4CGZA 4MDEA 1LV7A 3HPQA 2CL0X 3LX8A 3IO5A 5BYKA 3H84A 2XTZA 1EG7A 3OIWA 1XX6A 3K0AB 5IT5A 2CNWD 4L8GA 4RD6A 2HXSA 4HUQA 2OLJA 3VKWA 3AP3A 1UJ2A 2W6JD 2EFEB 3DL0A 1TQ4A 2UKDA 4KBFA 4TLBA 5D3MB 1NN1A 2A9KA 4RD3A 1QHGA 4A36A 4Z8XA 1I2DA 4PPGA 3MSXA 1SGWA 1YR9A 2IXFA 3Q8XB 2J0UB 4URXR 4YXWA 2BBWA 4TSFA 3PV0A 1XMJA 3TUZC 4YMVA 2A7QA 2G0TA 1VYUA 2LCFA 2J3EA 4NP6A 1XP8A 1KK0A 1TQDA 3WYGA 1P9WA 5JFGA 3AGPA 4RD1A 1II0A 3A4LA 4B3FX 2ANBA 2IYTA 1DOAA 3L0SA 1NVVQ 2AD5A 1U81A 2C9OA 1YU9A 5TARA 2YWGA 4ARZB 5KSZA 2QP4A 5E7JA 4BASA 4GNKA 2JGNA 2ZI6A 1CRQA 4TLDA 4WA7A 1PJRA 1DAIA 1RYFA 3N5CA 4MA4A 2ZJAA 4MQBA 3CWQA 4YMSA 5AK0A 4B48A 5LD2B 3H1TA 3IUYA 1KIMA 4GFDA 1U8ZA 1UBGA 4JT4A 3NG1A 3HJNA 3BS4A 2J45A 1E1QA 1F3OA 1VG0B 2FZLA 4DUGA 2PT7A 1V43A 1BMFA 2IF2A 3RDPA 4M9ZA 1HE8B 5BW8A 2KBFA 3SR0A 1E4VA 3TIFA 2ZROA 4RD0A 4DDWA 5JSZB 2LKDA 3TR5A 4LHXA 5G53C 3ZVNA 4GP6A 4A8JA 5HCIA 1SHKA 1RRGA 2G6BA 3DMNA 3NBXX 1E2EA 4A6PA 1W5SA 3MGCA 3NEJA 1A2KC 4B47A 4CEJB 2OV2A 4WXRA 2CMKA 1G8YA 4DLRA 3U4QA 1T3SA 5EP1A 3OE7A 1YR7A 2BKUA 1A5TA 2BHRA 1TQ2A 1RRFA 4RFSB 4L15A 2RMKA 1G41A 1UBEA 4HLQB 2J5XA 4US2R 2N42A 1DO0A 1NRJB 3FKSA 5FI1B 2O8DA 2YNMA 1R0ZA 1FNNA 4HDOB 1KK3A 1T6NA 2FZ4A 4MYUA 1X3SA 2GXAA 3K70C 3LLMA 3L2OB 3U6BA 2F43B 1EWQA 2YJTD 5C4GB 4M9XA 3CONA 3P26A 3KFXA 1YZQA 4KODA 1S8FA 1IY2A 5K8TA 5B30A 1E9DA 2XNDD 1VKJA 5EXXA 3THXB 4V02A 4LY6A 1SVMA 1W2GA 1XXHA 2O52A 3QOFA 1GFIA 4PSVA 1C4OA 4EIWA 2ZAOA 2JEOA 2ATXA 1PLJA 1WXQA 4F93B 4Q00A 3RLFA 5KUTA 4WZBE 3BERA 1YQTA 1D8TA 3CPEA 1F2TB 2V1XA 2ASEA 1QG4A 1I2MA 1XRJA 2D3WA 3TLXA 4WVFA 1UKVY 1ZU5A 1KDPA 2BBSA 4LOAA 3AVXA 2PX0A 1ZINA 1DVRA 3A58B 1E9EA 3QEJA 4MYTA 1XPOA 5C4MA 3QKRB 4DIDA 2GKSA 4HLUA 2OUKA 4JLJA 4DCTA 1UEJA 3SN6A 3RWOA 2UZIR 2OFXA 1FTNA 1MO3A 3CRVA 2J7PD 2IYQA 3HU3A 1GM5A 5BXQC 2F9MA 2O8EA 4G0NA 1ZNZA 1LVGA 5FOXA 2CXXA 1ZJ6A 2ANCA 3I5XA 1L2TA 2AR7A 1Q1QA 4ZDJA 4NYMQ 3CNNA 1Q3TA 1P2TA 4Q1FA 1WB9A 3IEUA 1GG2A 2DWOA 5E3HA 1CIPA 1IJEA 5DO9A 3VAAA 3QXHA 4M1KA 3PJRA 2GEDA 1N6RA 4PC7A 5F2EA 4V0OA 2WIBA 1CJKC 1EGAA 3O47A 2NTYC 2EYUA 2J46A 1QHXA 1GL9B 2G9NA 3W6NA 2GK6A 5HKKA 4Q1DA 4YMUA 2ZR7A 4O2RA 4TL8A 4TZ0A 2CHQA 2R6GA 4Q18A 4QNRA 3UWKA 3RWMB 2QY9A 2P6UA 1E2KA 1IONA 2QRZA 3LXRA 4MKIA 5CLQA 1AJEA 4KYUA 1K5GA 5LB4A 4PAOA 5H70A 3R8FA 2WJYA 4I1UA 2ZI9A 4PC1A 1Q20A 1OFUX 3L43A 2AWOA 1W0KD 3A1SA 1CTQA 4MUAA 1CEEA 4L9SA 4II7A 4K81B 5KNCA 5EUMA 4XH9B 1J2JA 4N0EA 5FBVB 1ZC4A 1GRQA 3QG5A 4JS0A 2J0SA 3TRFA 4LK2A 1KAOA 2R2AA 4F38A 1N6HA 5KDOA 4DLUA 1UFQA 4JVMA 2V6IA 3AGQA 1FQKA 2Z6VA 1ZYUA 1K5DA 1P9RA 2JIZA 1ZM2A 3H0KA 1H8EA 1TPZA 4ABYA 4LSGA 4ZKEA 1UF9A 1D2MA 2DFKB 2C99A 3QEOA 2V6JA 3KKOA 4PXAA 3DOEA 2JJ1A 5DHFA 2DBYA 4EJSC 1OKKA 4JLOA 1KK2A 4KFUA 1IBRA 3I1FA 5JECA 4ESVA 1MRNA 1T4GA 2OAQ1 4AG6A 4JL5A 3ZVRA 4DLXA 3QIAA 4S35A 2D4HA 1TMKA 5DISB 5BWMA 2VP2A 1N0UA 3PXGA 2V55B 3CRMA 3F8TA 2ZE6A 3TAUA 3RNLA 2QT0A 3EZ2A 3LY5A 4NCIA 2PEZA 2MSDB 3RC8A 4JJKA 1XTIA 4TQAA 1NJGA
chains in the Genus database with same CATH superfamily
4F5YA 1R6DA 1P5FA 2CFCA 2OORC 4AZ0A 3I1JA 4F9GA 5CBPA 1Q1BA 1XZKA 4OI1A 1M74A 3ZK9A 1E9RA 2RIPA 3MCZA 2DB3A 1SR8A 4YJFA 3CQ9A 5HS4A 2O3QA 3OA0A 2F3QA 1I32A 5DWVA 3SBEA 1GZ7A 6YASA 1MTZA 3DR5A 1VLMA 1VE3A 2ORVA 4FEEA 4U39A 3LHKA 1F9EA 1UJMA 3K8QA 5ICEA 4INJA 1WQ1R 2AKYA 1LBEA 3RAGA 5B6IA 4EI2A 3EODA 1QVWA 4V03A 4E46A 2WUWE 3NRCA 4QECA 1JPUA 2C96A 1NZJA 2I2FA 3E2PA 4YWHA 4JI0B 1AQYA 4BBPA 2F4VB 2B82A 4GKJB 4TTAA 1I4EB 4DDTA 2QRUA 1YBMA 1YDHA 3O3CA 1W0JD 5AI9A 5ARBA 5I7SA 2GVDC 3H1BA 4DNQA 5G4KB 4TT3D 2RKBA 3C1TA 1OX4A 1RLMA 2HCRA 2HJWA 2XGSA 2O05A 2PCJA 3F6RA 3H13A 3IODA 3F9IA 2R11A 2BSAA 5AXBA 3RHTA 4KYIB 5LKAA 3P4UA 1AN0A 2BIFA 2PSSA 4R1SA 4WN9A 1H22A 1ZMTA 5ALOA 3SC3A 4AROA 2VPTA 4B8YA 1HETA 4ZV7A 4O4IF 1AZTA 2PGJA 1XXHB 2HLDA 3R2JA 4LAFA 3TKLA 4B4UA 3BXOA 1SZDA 1T25A 3TEFA 3WYNA 1FFSA 1XFDA 4BFTA 5JARA 4GVLA 1KTVA 4TLAA 4ARVA 1WXIA 2I6UA 4IIUA 1Q0PA 2XVXA 4B85A 1MV5A 5CLHA 1VCNA 1DFIA 3MWJA 3A1TA 4I6EA 4MVCA 1FPMA 1CBUA 4DCVA 4LRWA 3LUJA 4HFMA 4WLNA 1UC4B 2VPXA 3HNRA 2A5GA 1SIOA 4RSRA 2CFRA 4UVGA 2GFHA 2RHMA 4IAOA 1YKFA 3E3AA 4C30A 1CF4A 3EGCA 3ZGXA 1KJ9A 1HZZC 2CDNA 1WA5A 2BKLA 3AERB 3GV0A 4A1FA 5JQGF 1WG8A 4K9DA 1U31A 4GQAA 3RPEA 5KYXB 4X97A 4XIFA 2WWHA 3PXAA 2VDOB 2VF8A 1KAEA 3Q7IA 3UAGA 4HPWA 3FWPA 4OGWA 5C8YA 4TQ9A 4UM8B 2ECFA 3E9NA 3PGXA 4FMCF 4KIGA 4GHWA 5FHQA 3ZI4A 5JCZA 1SEPA 1KH2A 2EU8A 4HUJA 4K6GA 2IW1A 3AHEA 2QD4A 3EWSA 2Y71A 3DLIA 4C4YA 4ZEVA 5FL3A 4XJXA 2RE8A 3EGXB 2MINB 1X87A 4BHTA 3LDFA 1JN0A 1KOFA 4CMAA 3D64A 2EX0A 1NNSA 4D46A 2QQEA 1PF7E 2B1JA 3LUGA 3PPVA 4GPZA 4EKYA 5H02A 2EIXA 3HDYA 2NZJA 2W22A 3PEFA 3PUKA 1DBWA 3R77A 1U8TA 1JHAA 1JSLA 4J0IA 3D59A 4RAQA 3GJ8A 5CG2A 1I2ZA 1RWKA 4MGZR 3TQIA 2P3SA 1P9LA 1P0IA 2VTDA 4LNUB 1GEGA 1KEEB 3ESXA 2PMEA 3W34A 5A4IS 1L5HA 1MJFA 1NVGA 1UC5B 1XDUA 3DJYA 3PC8C 2VHWA 4GSKA 1CUAA 4HN4B 4LMBA 1UQTA 1W94A 4PFKA 5DM4A 2JI9A 2XYQA 1KDOA 1E6UA 3IOMA 5C7YA 5EWLA 2YJ4A 4ZQBA 2CBXA 1P9NA 2NUAA 4R71A 1OY1A 2HYIC 2C3YA 2DM6A 1M6EX 4PO3X 1GNTA 2WJWA 5SY4A 1AS3A 1DJLA 2AJCA 1TCVA 3V8MA 3VPDA 2O1SA 3UK2A 2IK8A 4MKGA 2XYPA 4HX5A 1ISMA 5DYTA 4ZI3A 2C3UA 3E22B 3HP7A 1WOYA 3MAAC 4CFYA 3H2GA 4OI0A 4A4DA 1UKYA 2FHSA 4G07A 1K3UB 2BHLA 3EAFA 1EK6A 4YEDA 1U7PA 5EWMA 2X58A 2FPXA 3STYA 2M6LA 4H7JA 2AI3A 3GQVA 3IT3A 3MJSA 4GRIA 5CDFE 2KB0A 2J5BA 5LFAA 4RKRA 3UQYS 1E2DA 1FU8A 4K0RA 4PN3A 1Y8ZA 4FZRA 4UBMA 1Z5WA 3TXAA 4I1VA 4BB6A 4WQMA 1RWXA 1E2IA 2EKPA 3VZRA 5L51A 3QYJA 4OA5A 4QPDA 2R7MA 3T5BA 2FDXA 4UUOA 3RC7A 5DHTA 2JAXA 5L45A 1MH1A 3RFXA 5CH3A 2PNJA 3CTMA 3ZDEA 3MT9A 1QQBA 4YLGA 2FG6C 3VRHA 2A57A 1MHPA 3G0DA 1UH5A 4RWEA 1E1MA 4R7GA 4J0CA 5TV2A 4EUHA 2ETXA 2ZVQX 2VHJA 1GTL1 4DIBA 1ZG3A 3R09A 4QG7A 2QG9A 4NOJA 5FWXB 5A7HA 2QV7A 5K0ZA 2ZUFA 1E1LA 1GCGA 3E9DA 3ON5A 2QYTA 1T13A 1IZ8A 3DB1A 2C4KA 4MAAA 5GGYA 2JHPA 1XA4A 5T6BA 3CS3A 2PXAA 4Q48A 5ECGC 4UBNA 2X77A 4KGVA 2Y4NA 1PQWA 1PI3A 2VJDA 3DXZA 1U02A 3MC1A 4KFSA 4MINA 4YUVA 4OKIA 3QKWA 3R7AA 3SM9A 4NZPA 2PKXA 4CKBB 1P2DA 5LA6A 3ZCXA 4OX9B 3CB2A 5FWYA 5EL0A 3OFKA 4QXPA 4YCLA 4F5EA 2X8JA 1PLLA 3N53A 3P0IA 5CT9A 1DQZA 3O1LA 1XE3A 2OD9A 4HAIA 4MW1A 5FI3A 3KB1A 1LBTA 4W9RA 3O9ZA 4DS3A 1CDEA 4Y6GB 2QZSA 1QFYA 3FA2A 4WBSA 2G4VA 3D3WA 4CPDA 1I4LD 5HILA 3ZIAA 4RTNA 5JS1A 1TECE 4OFZA 4JQYA 3AG6A 4MEAA 3T5MA 5AKZA 1DBQA 1CEYA 1UKEA 2Q07A 2VDNB 3QLUA 3H11A 1W19A 2VWPA 3SLKA 1EHYA 4LJYA 2B4TO 3ROTA 3KEOA 2P77A 3HVKA 1R6TA 3SE7A 4AECA 1WUYA 4CL8A 1RWOA 1VJ5A 5JFOA 4YQYA 2CVQA 5COAA 5IJAA 3LDUA 2X3YA 4EECA 3A26A 2OMEA 4YPOA 4DZRA 1YK1A 5HZKA 3K53A 4DSTA 4PO8A 4G26A 5K3FA 5EJ8A 4NX2A 3VSAA 3KWFA 4HNHA 4X65B 1J0EA 3N87A 2FUCA 3MUOA 4D56A 4CKZA 1Z5ZA 3KYCB 4JLMA 1O1YA 4NZNA 1T5DX 1NXVA 2IWRA 2PRZA 4PG7A 1NULA 2Z4RA 5DP1A 3AM4A 3A28A 4IMPA 4ZHQA 5JH7F 4TWBA 2HQBA 3PDWA 3RARA 3SC4A 1U8YA 1USIA 1WPGA 3KYDB 1TEZA 2Q3FA 1U0JA 3WHLA 2C5GA 2IOHA 2J9XB 3K0SA 1U6IA 4QGHA 1KE2A 3DZKA 1P0QA 4O4IB 1SC1A 4L5CA 2C42A 4GPD1 3R9IA 4F7DA 4EMTA 4I3GA 1YR1A 2OAP1 2WYHA 3GL9A 4DLNA 1L5VA 3I34X 2OHOA 3JWHA 4Z0HO 2OR3A 2HCTA 4B3IA 1WM1A 1TX4B 1PZGA 2BI8A 4XVQA 3KYJB 5A9SB 3A2NA 3RROA 1ZN8A 2H0RA 3NWBA 4D8UA 1FW6A 1NF9A 2ACWA 4O0LA 1CP3A 1M10A 1YVPA 5CDHA 1H66A 4AKGA 2FZWA 1ODSA 1CJSA 2W43A 1Y5LA 5IN5A 4E1AA 3DUFB 4B45A 4C88A 5JQGB 1R8XA 1XTTA 2XZPA 3GMDA 4F45A 3KBBA 3RBAA 4D99A 3PGMA 5TRTA 3E5MA 3EULA 2IYZA 3QF4A 1EWKA 1WNFA 1A9XB 1W1IA 3I8XA 2QX9A 2D54A 2Q4TA 4FMCB 1TC2A 4HZIA 2DP4E 4I6GA 2H1LA 1QG0A 2XNSA 3SBDA 5I9MA 1EK0A 1KO8A 4FVTA 5E7MA 1OUMA 1Z15A 3NBZC 3AINA 3LC2O 4L4YA 4ENQA 3AR8A 3WLQA 4XVUA 1IQPA 3K16A 3RS4A 3KOWA 3W3AA 4X1YB 4JLKA 1P44A 4BV8A 4Q05A 1KWGA 4I81A 3J7AC 5K0FA 2PUTA 5K01A 1BS1A 2CZCA 3JQFA 4L28A 4R8SA 1X6VA 3QEKA 4JENA 1YA4A 4NU8X 2E55A 2ZVDA 4HDNA 4XVHA 5EXPA 4IIDA 4JOBA 3RKRA 4BKRA 5AIBA 4AO8A 1XNRB 3LFHA 5AKIA 4IJKA 1G6HA 3R5HA 2FUG6 4RHUA 1WXGA 2X8LA 5IF9A 1FVHA 1AUVA 3GEHA 1I01A 3H1GA 2FR0A 1QO0D 1HF3A 2HLPA 3A32A 4GLLA 2CZQA 4MJ7A 4PGAA 2SNIE 4PFQA 1V37A 5JLJA 2FV8A 1M5RA 4CL3A 1SXJB 2CZGA 3UOAB 3HJAA 2YXLA 2OV4A 1AZSC 4I3FA 4MGKR 4BBZA 4K28A 4A6EA 5H9WA 3QU9A 3NBUA 3FROA 5CDGA 5BYBA 1XTUA 2O7SA 5AK6A 3ROFA 3FPEA 3DZJA 1WW3A 4KQGA 4WEOA 2EVWX 1ZGHA 4YCMA 4Y9DA 4TQUS 2P75A 3UFXB 2YWDA 2WTMA 5AW9A 2O2EA 1E99A 1ADYA 3IIMA 9MHTA 4IOJA 3V1LA 4F2WA 1WABA 3DO5A 3W04A 2HRDA 3AFMA 3FBGA 2ILVA 1QORA 3KQOA 4OJKA 3LC0A 1QAMA 2Y76A 1NFFA 4HMQA 2P3LA 4EMBA 1FDVA 3AUYA 4I4CA 4XYEA 3HA2A 1YD7A 2BEWB 4Z3OA 1UJ5A 1DL5A 4HGQA 3D6JA 4X6LA 2VVTA 2O8BA 4GIBA 1JAHA 3BJMA 3VSEA 4BJ3A 4MEJA 1R15A 4JNKA 2C2OA 2MJLA 3R5TA 3N0XA 4RXMA 4DLLA 3TAHA 5MGBA 2QNRA 4KLRA 1AKRA 4GICA 4V38A 2VDVE 2RDMA 5L4NA 1LDEA 5HCUA 3TWOA 1UDBA 3HE3A 1GITA 4WOBA 1YFKA 3Q6MA 4V1CB 3T0FA 2OQ2A 4JBXA 13PKA 4N4AA 2J0VA 3W9YA 1POWA 4ZAWA 4CQLB 4IXWA 3O38A 3DV0B 1NLUA 4F3CA 3H97A 2PM8A 3ZG6A 1A4RA 2B4KA 2RB5A 3BXZA 2BUBA 2OHFA 3ICPA 4IX9A 4YCJA 2H06A 3FSRA 4R8LA 3ROKA 5J47A 1C0IA 2AN1A 2F17A 4D4JA 3NS7A 2H4HA 2I7VA 1W47A 4HAYA 2C1XA 2Q9BA 4BO1A 5JJLA 1GQFA 3V48A 3SKYA 2AXQA 1MW9X 2QL9A 4CDRA 4P7GA 4MQFA 1F2UA 1XZNA 3TZCA 5E4TA 1SWWA 4DPKA 1TK3A 1YFZA 3WFJA 3TG2A 3OPVA 1KIFA 2IODA 3R6TA 3BE5A 1P61B 2RK4A 1JXOA 1MOZA 1JG7A 2CFTA 1QOQB 2PUVA 4WLOA 1GU1A 4DSAA 2C84A 4LY9A 3H6GA 4UPDA 2GXQA 1PUJA 5DNYB 2VNAA 1ZY2A 1M33A 2ECQA 2PL5A 2WFMA 4EARA 3R8XA 1M6VA 2PX5A 3H5OA 3OE1A 2ADFA 4J0QA 3I9V6 3C7DB 4M1TA 2C9BA 5BR7A 3HHPA 4CKWB 4GD3Q 1NATA 4OHRA 3LH5A 3AFGA 4KVFA 4ZREA 4CU2A 4ETNA 4MHOA 3G2NA 1H0KA 1ZGZA 1PEAA 3AH8A 5DHUA 3EUAA 3HU5A 4A0QA 1ZN9A 4P92A 4J76A 3O82A 5TEWA 1W75A 1KETA 2W5UA 5JH7B 1Y3AA 3CJQA 2TMGA 2ZCUA 4KH0A 1C0PA 2P91A 3WAKA 1IUOA 2QPOA 4GBED 1BKSB 1DRVA 1TM7E 1HT0A 4R81A 2IOYA 1H8HD 3NIWA 4PGFA 2WF5A 5B1EA 4MKFA 2WWFA 3H42B 2FQYA 2H4JA 4NDNE 4RY9A 2WKPA 3KP1A 4E6EA 1IM5A 1UXHA 3ILHA 2HR1A 1PW7A 2QHXA 3FAZA 3GBPA 4XFJA 5CVJA 3UKJA 3WHKA 1JPJA 3BTUA 3JQAB 5EJIA 2WINI 3CINA 5FADA 4P34A 1RIFA 3AR4A 5JASA 3L01A 5LQCA 4BB0A 4LXQA 1YJXA 1JI0A 1LPNA 4NBSA 2GR9A 1C80A 3T99A 3TXXA 4DR5B 1FFHA 1KFBB 4PO1A 2CT8A 3VZPA 2QE7D 3FDIA 1XPJA 1M34E 5C46F 3GFOA 4P7FA 4H7FA 1X7DA 4P82A 4U02A 5CEEA 2JFYA 5EA2A 4I50B 4HZGA 4ZALA 2Q1WA 5DLDA 5JNRA 1UMBB 4KPYA 4TXNA 2QBYA 1JU3A 3EZ7A 4HDCA 4EUSA 3RKSA 4LRYA 3V1UA 1Z29A 1U7TA 3QU4A 4WKBA 2O4CA 3W9BA 3FRJA 1OH5A 3RG8A 5BV7A 4Q21A 4OM8A 4RA6B 3ZWAA 4JBHA 4IGEA 3E4CA 5CB4F 4ZCTA 3PR2B 4M37A 1LH0A 5EUQB 3JQ9A 3K9FC 1DKRA 3SXUA 4CFSA 3RR2A 1MAHA 1QAQA 5EHXA 3WLEA 2PGAA 1C8VB 3O75A 4B31A 5KWIA 1KI9A 2JFZA 3KXIA 1CR0A 4QUJA 1E7WA 4DMMA 3IMCA 4AP5A 2LTAA 2L42A 1MX9A 3TMAA 1XL1A 1HR0B 2AE1A 4EGFA 4JA0A 1ZLXA 2FR8A 4R2IA 5E6RB 3MLAA 2B6HA 5CGQB 3GN1A 1QHEA 3QE9Y 3SKVA 2IH2A 1J0AA 2GBPA 3SFTA 3OCZA 3U3XA 3IYLW 1L4FA 1U5BA 2XCQA 3M6FA 3NANA 4R98A 2FOLA 5CIWA 2YNMC 2BFFB 3VU1A 4DMUB 3I5YA 4K26A 1XMVA 3BRWA 1XMXA 5GADl 3GPBA 4W8GA 5FL7A 4IM7A 2ZRAA 3OJ0A 4B8WA 2ZT8A 2PGLA 1UDWA 5AJUA 2QJWA 2B5WA 1PVDA 3W5UA 1E0KA 4NK5A 2YZMA 1SBIA 1TQ6A 1X8JA 1W6RA 2H1FA 3GMSA 1LQ2A 2NUPB 1LX7A 2OILA 3JQBA 3D3JA 1T10A 2BZGA 2P8JA 2A0FA 4O4JF 3VNUA 3H4VA 3QU2A 3AF1A 4JR1A 1DPFA 3DWEX 2X1LA 3N8NA 2GD6A 3T1HB 4B46A 1E1CA 4KE9A 4BNIA 1UIMA 3A1CA 1K7EB 4Z7OB 3QPBA 5J2UF 2YTZA 4NVRA 2AOTB 3G8DA 3M70A 1YE8A 4CCWA 1FJ2A 1L4BA 3RVNA 4UHEA 7GPBA 2KX7A 1TOAA 3TOSA 1QQ6A 4KXUA 3VDXA 5HQJA 4K6KA 3TNLA 5D3QA 1SU6A 3F5MA 1WVMA 4HK4A 4U2DA 4YASA 2N75A 4OHYA 1BWRA 1BMTA 3E2MA 3G8BA 1B6TA 4OREX 3IPYA 4D02A 1SBTA 2OL4A 3LHIA 3JQ8A 1RQLA 2RIRA 3AEUA 1HKHA 3E9QA 3EIOA 4PLYA 3QUSA 4WZBB 3IIIA 3ZJYA 4EI8A 1JKXA 4N3BA 3T38A 3CB4A 4WD3A 1F48A 5ALUA 2G25A 1QUEA 5LOVA 3GAFA 3LVQE 1X14A 2C1EA 4HUQB 5FYQA 2PGIA 1NZFA 1CY4A 3KB2A 4LJ9A 4LYFA 4XM1A 5E6UA 1FFWA 5FTWA 4HVLA 3DVAA 3FHCB 3GJ7A 2AMYA 3KJNA 4HFJA 2AG8A 2ZRLA 4J2TA 4PU0A 4W9MC 5FNVA 4MAMA 5L7YA 1E7YA 4RV4A 3L8HA 3QPUA 2QQ5A 3D4PA 1G19A 2RGCA 1TTTA 5JG7A 3E15A 4DARA 3MMXA 1J23A 4RQBA 2OHVA 4TQGA 3MHTA 4CMJA 3Q1LA 5ALMA 1UUFA 2ZRCA 1P4AA 1RPNA 2ZPUA 1YCGA 2Q4OA 4N8SA 3GYBA 9ATCA 2E5FA 3NPAA 5EJ9A 3C7TA 4G65A 4QXAA 4RSGA 3IUMA 3I5MA 3PA8A 4LMAA 3QOYA 1RI5A 1HDXA 3GFFA 2Y1CA 4QEKA 2BBTA 4F11A 4I5EA 3BDIA 3RM3A 1F9AA 1NRIA 1A4UA 3JYQA 4XJSA 3K1YA 4RMNA 1ZD2P 2EBWA 4D2IA 5JCPA 2JKZA 4HFNA 4B3BA 1Z08A 3IAUA 1GAJA 1Q74A 3FCSB 3IVGA 4MW5A 1PG5A 1YB7A 1XI2A 2Q4RA 3RIGA 1P4RA 1YAHA 1UFOA 3L49A 2EFJA 3K15A 4QQFA 1XJCA 1WWKA 3F97A 4W5TA 5DF1A 4YRGA 1S01A 2J3KA 5LN1A 1K1EA 1V16B 3QXCA 1DMSA 1IEVA 3KOYA 1N5KA 3TTUA 4CG2A 4D9NA 7MDHA 2FFHA 3KJQA 5I7HA 2ZB7A 1P80A 3DDHA 4FXOA 5HKLA 3VFDA 3KL2A 1XWIA 4LC1A 1TYCA 3COWA 3N2IA 3EOBI 2BFWA 2Q2VA 4ETIA 1I1QB 4DJFC 1HY3A 1JXQA 4IZ6A 3R0XA 4DIFA 3R4CA 1WMEA 3UPUA 2XKBA 1PYGA 5CYPA 1E79D 2WWXA 4D8WA 5FB3A 5I6DA 1IBMB 3PEVA 3QVGB 4BXOB 4GRDA 4RU1A 1WP4A 3KV3O 2QDXA 3VU9A 5I7UA 3TQHA 4WFQA 2QK4A 1E0SA 3BL6A 4GP7A 5TQ2A 2VJYA 3RNOA 1SCDA 2C92A 2YKGA 2O54A 3SJCA 2Y9MB 3EHEA 5KU7A 3JD0A 1V1RA 3HPRA 4KYVA 2BHSA 4I9HA 5I7RA 3L1UA 1EEXB 4PX5A 2ONYA 1RAIA 2JJYA 4K8RB 3MQ4A 1KZ1A 1RBYA 3RTEA 1JFFB 5L3RA 4RLHA 2XMPA 4MITA 4XLZA 4N76A 1M73E 1XJ5A 1QCDA 3FMIA 3U4HA 2WU1A 5AVVA 1ILWA 4ZK6A 2O5EA 2IXBA 2ATEA 1G8HA 1GV0A 3T7DA 1EXDA 1ZKDA 1JQJC 1UFRA 3LRTA 2IYRA 3TLGB 2ACVA 2A30A 3PQDA 3HDJA 4C29A 4YAKA 1XEFA 4Q5IA 3NVAA 3CUKA 1SVOA 3AI2A 3C16C 4YXWD 1DX9A 5CT5A 2X19A 3KSAC 4NIMA 3EXHC 1W48A 1UANA 3HKBB 3SEZA 1P8JA 2C98A 3Q9LA 4F4IA 3UWKA 2WD7A 5TLSA 2WKWA 5JSKA 2QX8A 3EGVA 5KYNA 3CA8A 2ATIA 5CB4B 3GUVA 4LBYA 3O2JA 2FP4B 5FPTA 5JNTA 3ET5A 4F1WA 3U2QA 1B6SA 4TL7A 5BWOA 1AG9A 5IULC 2NADA 1PT9A 4ZGWA 4JOQA 1HTTA 4UU0A 3KKEA 2W2VA 1X2EA 2QZ9A 4JUCA 5FJJA 5AI0A 3R7NA 4V0ME 2ZBEA 4N3NA 4TTTS 4J9VA 4XFDA 3FYUB 1NN5A 1P9OA 1Y1SA 4KL8S 4IPTA 5FORA 1P75A 2IZOA 3DAPA 3NKVA 5GJWC 2OSBA 4OMCA 1G64A 1WY7A 2VHVA 3AR2A 2IYVA 5BQPA 4FINA 1REQB 3AVYA 1OFVA 1QO0A 3EVAA 3LUFA 1Q1EA 4DEYA 3VPGA 4AMVA 4Z2YA 1MQ8B 2BBOA 3DDNA 4YRMA 1SVSA 5EMNA 3ZOKA 4LZJA 4FN5A 4UBOA 4LYAA 1PGOA 2VQDA 1PVVA 2JGIA 2CE2X 1NPDA 3DXYA 3PIIA 2O8CA 2C9CA 4O4JB 1P1IA 3LT0A 1G7RA 5EG5A 4I36A 3WTCA 2VQFB 1DRJA 2ODPA 3W7AA 4I4LA 5DVZA 3UF0A 2L69A 4GDFA 4RLQA 4A7PA 1VQ1A 3OCXA 1T8UA 2B94A 1X80A 3EH1A 3BHJA 4IUDS 5DEOA 5KQRA 3FZNA 3ID6C 3UMJA 2YVLA 4KRGA 5L6MB 3LL4A 1Z6YA 4IJWA 3VPAA 4BAZA 2ADMA 3ESCA 1XPUA 1JQBA 2K5UA 4J0FA 2YNMD 3SZUA 1GNQA 2P8SA 3PNBA 4YAEA 3I92A 1CE8B 1TCAA 4ER6A 2M9MA 1MB0A 3EVDA 4D6PA 2XV1A 4TTQA 1JQ3A 2PQ0A 3WMGA 3TE6A 3KJHA 1CY6A 1NJ8A 1U3WA 2VNKA 3Q3CA 5EFZA 4MPTA 4QOHA 3RRMA 3RVRA 2B9VA 5H68A 1FFXA 1SA0A 4KVAA 1CS4C 4OHBA 3EUEA 3TW0A 3KQUA 3SMVA 3OM8A 2J4DA 1Y48E 5EJ5A 1RI3A 4CQMB 3RADC 1BA2A 2ALJA 2IIQA 1WZUA 2FEMA 1ZHFA 2I62A 2A8YA 3GVIA 3IMFA 3O95A 1H69A 1AQ6A 1WY5A 3FUUA 4G9EA 4NMMA 4NYJQ 3PQ6A 5JYBA 1AA6A 3EGDB 3NXKA 1MQ9A 4DTIA 5LP1A 1D07A 2O9JA 1EBUA 1B41A 2G06A 2HJHA 4GLOA 3DLCA 3V32A 4IGFA 2GZDA 4A5SA 1KMHA 1FXUA 3DHWC 3A4IA 1LBHA 4JH0A 4JJ7A 4LRTB 1R4NB 2JW5A 2QI9F 1GVNB 4C4OA 3DKIA 1GA1A 3AY3A 4DBZA 2XT9A 1QSGA 2X8BA 3WFIA 1O89A 2WU3A 4LXTA 2V5VA 1NT4A 2Z1DA 4YV2A 5CB8A 1PL8A 3GJ4A 1FXWA 1Y6RA 3P7MA 5IPFA 1GAXA 3FPBA 4HMOA 4J0JA 2H5LA 3KUDA 2GA9A 4DCMA 3BKXA 3ADPA 3ZUGA 3ZE7A 3CNBA 4KSYA 1O6GA 2I8AA 3MS7A 3Q1KA 4RVCA 5CNIA 1LTKA 1FP2A 2JHCA 4LWZA 1ESMA 4N5IX 3X2EA 1S8NA 5IU6A 1UXJA 1G66A 2Z2XA 1ZVJA 5KSOA 4S1PA 2BM0A 2F1JA 3PL1A 3QUQA 4JKOA 2PFKA 2HGZA 4U2EA 4DSOA 1X7ZA 2GFQA 4LYJA 5ALIA 2I2DA 5LWQA 3WZMA 5C8DA 3ORHA 4IILA 3HM9A 3MJTA 4KDRA 1R6UA 5F5NA 4O33A 1FLNA 5DI9A 4ZZ1A 3EIHA 2AFIE 3ZLJA 2D5CA 2QM3A 1RLJA 1ZLYA 1QH1B 4BVAA 3RF7A 1LGYA 2A84A 4MJXA 4Q3OA 5T4BA 3RT9A 4ENPA 4BNLA 2HK8A 3B52X 1NI4A 3OIVA 1XZCA 4LGCA 1H1LA 1JQEA 1GAEO 2ZT5A 1QH9A 4M4SA 5JCJA 4XCXA 3V4RA 4REMA 4PHGA 3PRJA 3ROEA 1J7JA 1TO6A 2PLFA 3BSSA 4GG1A 3SQOA 5K0EA 4C6HA 3MT0A 5D51S 3EEYA 4M53A 4E4YA 4IVRA 1N6NA 5HS6A 3TAXA 4FFPA 1ZJJA 4NONA 3D4LA 2VO1A 4ZDWA 3IJRA 3CX3A 3RK4A 1B14A 4EBFA 3N0TA 4D82A 4L4XA 4F2GA 1ZJYA 3PR3A 1R4ZA 1ULUA 4EYGA 2R8XA 1E0JA 2ZU6A 3KX2A 4A26A 2PV0A 3RJ5A 2ICAA 3RS2A 1SIBE 3EA5A 1NLFA 2DCMA 1KYXA 3D8NA 1GL3A 3FYSA 2IQIA 3IP8A 2XRZA 2W6CX 2PX3A 2YUTA 3PRHA 2PWAA 3LECA 3GB9A 5LP6C 3GF4A 4M9QA 2W37A 3P9IA 3L05A 4E14A 1Q5PA 2V6FA 4DQ0A 1MJGA 4EG8A 4B6RA 2ZM6B 4COKA 1U65A 2JF0A 4UXHA 1O5OA 1DTWA 1XAGA 4LDAA 3NW9A 4BATA 3OPNA 3I9OA 3KEMA 1XK6A 3FF1A 3QSGA 5LUBA 5JW6A 1CHDA 1OKKD 4MR7A 2V4UA 4DSUA 1ZOLA 1BMQA 1LY1A 4EPXA 3NTUA 3JRXA 2D0DA 5FEUA 5K8VA 5AH0A 4M0KA 1RHRA 1YDGA 2QTVB 2F3UA 3QA3E 3OCWA 2IXEA 4QX6A 3B60A 2D62A 4NNOA 4WSOA 5KYWA 2YOGA 1NKSA 2V4MA 2XNDA 3OT1A 2GN9A 1OPRA 1QHIA 4TMXA 4YMHA 3KYBA 3QX3A 4LFAB 2W42A 4KR9A 2HMAA 1M2HA 3I6QA 4WZAE 2P2NA 5FOTA 4F8JA 3JATB 3WGUA 1W7AA 1IVSA 3VKHA 4EFDA 3ZE9A 3P5BA 1GA6A 4GZMA 5JATA 1QPZA 4PRZA 3FI9A 4OL0A 5J5CA 3QFHA 4MVXA 4MH0R 5BUZA 2Q5JA 3WQQA 4D9JA 3JVVA 3SS8A 2C77A 4Q6BA 2Y0BA 2EP7A 3PHJA 3UAZA 1VDMA 3SS9X 4F9EA 3R3XA 1Z56C 1ECLA 1SQSA 2JLBA 2FPSA 2J3JA 2UAGA 3CLTC 2YMPA 2FPOA 2H1IA 3GEPA 1K2VN 3O2SB 2DBRA 3P9KA 3SXPA 5B6PA 4NOMA 2FLVA 2BFCA 2R8PA 2IPLA 2ZUEA 1B76A 2ZT6A 3ZR4B 3BK1A 3B51X 2OK7A 1ZH4A 3ETLA 3N74A 5LIRA 1H4QA 2H92A 5H8WA 1U1DA 1MN6A 3UENA 5KTSA 3AF3A 5IAAA 4PO9A 5FBLB 5CPFA 1JWLA 1VYHA 3QKUA 4JSRA 5BR8B 1EZZA 2FEPA 5JRJA 5AR1A 2OV3A 1WPRA 1KHTA 2C0PA 3PFWO 3P2IA 3JZMA 3KRTA 5IAJA 3FGNA 1FNMA 4GMGA 1NJ1A 4BMXA 3LQ1A 2R44A 4K1XA 3WLAA 1YR2A 2GSDA 3C5EA 3DKPA 3ORFA 4EUFA 3MLEA 3ZU5A 1ZH2A 1EFPA 1C3LA 3NBFA 4WEQA 4CLEA 4LHWA 1R0SA 3DLTA 2QPTA 4K3UA 5JXGA 3L0IB 4EHKA 1DQSA 1HE4A 1WDMA 2J67A 4YROA 4B09A 3E7DA 4CIXA 5BQXA 5ICMA 3CMMA 2PV7A 4RABA 2OQIA 2QTTA 3SG0A 2V7QD 1EX6A 3JVEA 1R8SA 1LPOA 4MYSA 5LMNB 4OH7A 5AI6A 2RCYA 3VC7A 4JUIA 1EFRD 2ZRIA 3X1DA 1EFVB 1CETA 1JKFA 2QE6A 3A2MA 5DK6A 3T54A 2WZCA 4BU1A 3TSAA 2OP1A 2VNIA 4YP9A 3V5NA 3AFOA 1IPEA 1PYDA 1JZQA 2E82A 3QE3A 3INYA 3K0KA 2VZLA 3WVNA 1IVYA 1HH4A 1E1NA 4C7OB 3EIUA 4Q02A 2EV9A 4NAHA 4ZO7A 2FPWA 3QUTA 1FX0A 3CN7A 1ZIYA 1MB2A 2W2PA 1JHDA 1GGVA 1Z74A 3F4LA 1T8WA 2VPWA 4M9CA 2R5FA 3TOZA 2HADA 4UTVA 2SKCA 2D8AA 2F3RA 1CDOA 1R00A 3GVPA 4M36A 4MNTA 4C20A 5AVUA 3GPLA 2EFCB 3ACBA 5I8ZA 4BLPA 1JJVA 3IBGA 2F4NA 2VP5A 3RS7A 1UBMS 2L0XA 3TH5A 3WBBA 2QUJA 4ND7A 3JPWA 1IN6A 3OZVA 4KR7A 4B75A 2WB4A 1E5LA 3KPJA 2GYUA 3M2PA 2KYRA 1C81A 3PKJA 2QN3A 4U2KA 3U7FB 1RC1A 1OLSA 4C7XA 4MCHA 4ANFA 3AU8A 4ESOA 2XTMA 1DRWA 2FZ5A 2QRMA 5K05A 3LSTA 5GZ3A 3HRHA 1W5TA 3ND6A 4U7WA 3S3TA 2N0SA 2G76A 2L17A 4PY2A 3TFWA 5I7OA 2PVPA 2RAUA 3WLPA 4FP9A 2Y0EA 2VEDA 4DV2B 1VBFA 4O29A 3ZXUB 3HJHA 3DKVA 1EDOA 4YJ2F 2B7CA 2HSDA 3R3HA 3L7NA 3E58A 2ZEJA 2RGNC 3F1KA 3MHPA 1WKVA 3ZDDA 1B15A 3HB5X 5JD4A 2XMSA 4CL2A 1LDBA 3PDHA 4G5GA 1T24A 3OOJA 2XUZA 1V5IA 4RHFA 1P1BA 4L50A 1A9YA 4OXXA 4O6VA 5CH5A 3C6ZA 2WSSD 2XVAA 4RTOA 5FTMA 1UFVA 1U2TA 1KI3A 1DC5A 2A6PA 3NWOA 4HNVA 4FNOA 4OQFA 2OYRA 4DMCA 1G21A 4MGIR 4BOYA 4AYTA 4MUMA 3CE9A 3W06A 1RAEA 1KTIA 1FNDA 3COJA 1F14A 4Y7CA 3AWDA 5DGXA 1TTPB 3D3KA 1VKNA 2WWIA 3H8JA 3LQRA 3CVWA 2YV4A 5IAEA 3C8ZA 3BORA 3W5SA 3RU3A 2GD1O 2BMFA 2XYGA 2B92A 3N8HA 2I91A 4W5WA 2WDPA 5JYDA 3AJ8A 1QHYA 5HOEA 1HE3A 2YVUA 2QTNA 4EVSA 1K08A 4JGIA 2XBUA 5J23A 2H7YA 1NW9B 1BYIA 4NYIR 3TD2A 1XT6A 3MRVA 3M34A 4YDRA 1YXMA 2ZSFA 1U63A 2CD9A 2RHJA 3QWFA 3O3NB 4NZ9A 3R5JA 3GOHA 4HQLA 1HTWA 2QL5A 3QMPA 4DSZA 5IVKA 3A70A 3O73A 5AKJA 4E3ZA 2YWBA 3IAM6 3L7CA 4X6UA 2PDAA 4CT4B 3QY9A 1RXCA 3DYIA 4L16A 1OILA 4C4TA 4D4IA 1U28C 1UXGA 2QWXA 5ALSA 1KQNA 4QUHA 1ZD3A 1OD6A 1UJ6A 3I2JA 4Q6WA 4TKMA 1KZGB 5KNBD 3R6DA 3CZ4A 1RJEA 1ZGCA 1V8ZA 3K2EA 4N0QA 1PEKE 1BE0A 4ENVA 2JFPA 2C82A 1PJTA 2WZBA 2ZPTX 3RYCA 3U1BA 2QVCA 2FMHA 4F04A 3AVUA 1DELA 4KU4A 5KS2A 3GNLA 3PBKA 4URUR 3V2HA 1KEWA 3RGGA 1G2OA 3WP0A 3DEAA 8OHMA 4J0KA 3OP4A 4PPYA 5BN5A 1VKRA 1JB1A 1WLYA 4F8EA 2R6JA 3EFOA 1T9DA 5H83A 1L4LA 5JO0A 2F2TA 4IIEA 1NSFA 4EKDA 1XMOB 4RS4A 3NH9A 3IC5A 3IT2A 4L73A 4JYPA 5BOVA 2X3FA 3AV3A 1A5AB 3LBHA 3H8SA 3WGNA 1COWD 3B8HA 4H18A 4FYVA 2B8NA 5JBNA 3WWEA 2FEKA 1Q84A 3N8GA 3HWRA 1QZUA 3CU5A 2YZ7A 2GNOA 5AHOA 2BGKA 3ELWA 3JY6A 1SM4A 2O59A 3KG2A 3ZN2A 3INTA 3IAAA 4KO3S 2O0HA 1Y98A 3R3SA 5FUXA 3BMOA 5AVRA 1JHZA 3C3PA 4KQFA 3THYB 1N77A 3ZNPA 3ZS8A 1VHDA 1FOEB 3ZCQA 1NMYA 4GLFA 4X00A 4M1YA 5ALNA 3RSSA 4BVFA 2V7TA 3L7YA 4AP9A 2A1IA 1YFJA 2GZSA 2ZI3A 1KYIA 1XA0A 4IHJA 4ND5A 2VK1A 1XLVA 1YWGO 4CETA 1OIXA 4RADA 4RJLA 1CNMA 1F6BA 3GWZA 2ZTUA 1Z2AA 5HBRA 2ZJBA 4EKGA 4OMFG 5BSTA 3QNWA 4CXMA 3PDJA 2RHWA 4CMGA 1YV9A 4ER5A 4D4KA 1G3QA 4WKNA 3O4IA 1Z47A 1QG6A 2H9IA 4QQKA 2B0JA 3PC4A 2AUTA 4INAA 4BMOB 1ZIPA 3EF0A 3M8KA 4DRYA 3NWEA 4GM4A 2EWVA 5KB3A 5C3MA 1GG9A 3CLTD 2M32A 3OJOA 3WLMA 3ADCA 2WM8A 1NVMB 3L4EA 3PC7A 2G04A 4DV0B 4AMUA 2Q2NA 2ID7A 2OYSA 2ZSAA 5EJ4A 1P4GA 2FWRA 3WQHA 2H17A 2WPNA 3NBMA 4W5NA 3R5KA 4AY3A 4EHDA 1XTQA 1PX0A 1VSQA 2BP7A 2HCBA 2WWRA 1A76A 2UVPB 4DLZA 3H1PA 1VB5A 1K0UA 4JEHA 2IZ5A 3F5DA 3JAMA 3W3AH 4Y7DA 1MJGM 2Q29A 5HIIA 3IAFA