1RE1A

Crystal structure of caspase-3 with a nicotinic acid aldehyde inhibitor
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
140
structure length
140
Chain Sequence
DNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Caspase-3
publication title Reducing the Peptidyl Features of Caspase-3 Inhibitors: A Structural Analysis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 49
structure length 140
sequence length 140
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2003-11-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1re1A00
1I51A 3DEKA 4PS1A 1RHMA 2XZDA 3EDQA 1RHKA 3QNWA 4D3YA 1CP3A 2QLFA 3D6FA 2H48A 3IBCA 3K7EA 4FDLA 4FGUA 4ZVUA 3DEIA 5IASA 4QTYA 4QUEA 5H0IA 4HVAA 1NW9B 2C1EA 2QLJA 1I4OA 1SC4A 4QU0A 3UO8B 4QUGA 2H5IA 3P45A 5IC4A 1KMCA 1K88A 2CDRA 5IARA 4QUHA 4D3ZA 4NBLA 2C2ZA 1ICEA 3KJFA 4FXOA 5IBCA 3IBFA 3R6LA 1SC3A 2P2CA 4D3XA 3H11B 4AW9A 1RHRA 1F1JA 3P4UA 4N6GA 2H65A 3R7SA 3V3KA 5LU9A 1RHJA 1I3OA 4NOKA 1PYOA 5IABA 3UOAB 4ZVQA 4ZVOA 1PAUA 3H13A 3R6GA 4I1RA 4N7MA 4QTXA 3NKFA 2J32A 4PRYA 2H4YA 3PD1A 3SIRA 3V4LA 4QU9A 3V55A 2QL5A 1SC1A 1NMEA 4JR2A 5IAGA 4DCOA 4EHAA 1RHQA 3KJQA 3S70A 2C2MA 2CNKA 4EJFA 4NBNA 4ZVTA 3DEJA 2CNOA 4LSZA 3S8EA 1RHUA 4HQRA 5IC6A 1RWMA 4IEFB 4NOJA 3R7NA 2Y0BA 2J33A 2J31A 2Y1LA 4EHLA 3EDRA 3H0EA 5JFTA 3V6MA 1GQFA 4QUIA 2CJXA 2QL7A 4M9RA 4PRZA 4EHKA 2HBYA 5LUAA 3PD0A 1JXQA 1RWNA 1M72A 1QTNA 4ZVPA 3RJMA 4QUBA 3GJSA 2XYPA 3NR2A 4ZVSA 2H4WA 2H5JA 2XYGA 3GJRA 5IBPA 4JB8A 5I9TA 3V4OA 4JR1A 4QU5A 4JJ7A 1I4EB 4ZVRA 3R7BA 4EHHA 4N5DA 5LU8A 5IAKA 1RWPA 4QUDA 2C2KA 2XYHA 3R5KA 4QU8A 3NS7A 2AR9A 5IANA 1RWWA 4JQZA 1IBCA 1F9EA 4FEAA 1CVRA 3V6LA 4DCPA 3DEHA 2FP3A 4PS0A 2CNLA 4QUJA 2FUNB 4JJ8A 1GFWA 1SHJA 4N7JA 3GJQA 1RE1A 3H1PA 3ITNA 4EHNA 5IAEA 2HBZA 2HBRA 2QLBA 1RWXA 2CJYA 4QULA 3BIJA 5I9BA 5IAJA 4IYRA 5IBRA 2DKOA 2QL9A 3D6HA 3SIPA 4N6NA 4EHFA 4AWAA 1K86A 2K7ZA 3OD5A 1RWKA 3H11A 4NOLA 4HQ0A 4NOMA 2H54A 1RWVA 4AWBA 4EHDA 2CNNA 4I1PA 2HBQA 3D6MA 4JR0A 4DCJA 2NN3C 4JJEA 2XZTA 4JQYA 2C2OA 1QX3A 3PCXA 1SHLA 3R5JA 1NMSA 2H51A 4QUAA 1BMQA 1NMQA 2J30A 3GJTA 5K20A 5LUBA 3E4CA 2FQQA 4NBKA 4N6OA 1RWOA 3KJNA 1QDUA 2WDPA
chains in the Genus database with same CATH superfamily
5AJUA 4XDHA 2P40A 4FCWA 1GG2A 1RVDA 2H48A 1JTVA 4OXRA 5CAEB 2X2PA 2J07A 1RRKA 4R8KA 5AHOA 3RYHA 4JGIA 4BVJA 3D54D 4WVLA 3GUCA 5TGTA 3NJ4A 1LPSA 3IKLA 2JGFA 3CZRA 2DWPA 4MB2A 1ILWA 1YJCA 4KQGA 1GGMA 2ZR8A 3DLIA 3QHQA 5KI6A 4F5YA 3SSNA 3VZBA 5HS6A 2D1QA 2WINI 1GPUA 1YZFA 2OSVA 3I0ZA 2YWHA 4RQBA 5DBOA 1H6AA 5LBUA 1ICEA 1RABA 3T0IA 4V0MA 4DUGD 5JJCA 5KVQA 4OYYA 1SC3A 3MCUA 5TARA 4R2HA 3JWHA 4A1FA 2XRZA 5BV1A 5ESWA 3HRHA 1DKPA 4GZMA 4TQAA 4NL4H 1YL5A 3IP9A 1XVVA 2P5TB 2QVYX 3F71A 3ZJ5A 4D9CA 1CXZA 2CFCA 2NQ8A 5ES3A 1ISHA 4OGGA 5JLAA 1PZFA 4DMUB 2ZAIA 4G81A 2BBTA 3RF7A 1OAKA 1TECE 2GEFA 1TGVA 1DBSA 4L1KA 4ZHQF 3F49S 3NALA 4NCIA 1CY8A 2XWQA 3LUFA 4CCYA 4JBWA 1R0XA 1M5RA 1DTEA 1E0AA 2CNOA 2XXBA 4B71A 1M83A 3JAWB 4RF2A 1BXGB 5BOSB 2C1XA 2EF1A 2ZREA 4GWLA 1SU6A 4NDAA 4XRGA 2R96A 3E7WA 1DSSG 4BFWA 3H2YA 3SPXA 1R5BA 1I32A 1U8YA 4UVGA 2ZULA 1AKQA 1RPTA 2F8LA 1TT5A 2P91A 5HE9A 4C7XA 4PAOA 1QAOA 3RSGA 2A4MA 5L4NA 4PNZA 4JY7A 1Q0QA 1KBZA 2ZUDA 4R7TA 3GJSA 3CB2A 4HXFB 4JC5A 4WN9B 3BB3A 1PKXA 5D8DA 3FVQA 4JI1B 4DIEA 4Z8XA 4Y9UA 3BH7A 2PLAA 3IEVA 1X7XA 5EGSA 4A5OA 4F8YA 1ZK3A 4Y6GB 3P2JA 4KQ9A 3IGFA 1SCKA 4M1SA 1EP9A 4QVGA 4BNNA 2J5KA 4BXOB 3GN1A 2A86A 2X5KO 1IBLB 1VRVA 2YYAA 4K0RA 1XDZA 4OI4A 2C5EA 3SEZA 3LGXA 1NUHA 3CH5A 3AFHA 1QIDA 3JARB 4Q5IA 3VPDA 1UXOA 4D9GA 5JC1A 1E0SA 2GGSA 4K9QA 5HG0A 3RC3A 2C1ZA 1XRNA 3GUYA 4JELA 4GYKA 4CEIA 4R8RA 6REQB 2CV1A 2BKLA 3D1JA 3I30X 4H1WA 2CF6A 2HBRA 4M54A 5JAIA 5CW2A 2VF5X 5BNIA 4HRAA 1JU4A 2AJDA 2CE2X 3I6IA 4Q37A 4EUEA 2EJUA 2BYTA 2NXJA 2NAFA 2JG3A 4DL9A 4E11A 1S1MA 2ID9A 2PL5A 5FLYA 1KP9A 1Q57A 1P81A 1RQPA 1U8ZA 3BL5A 5COBA 4FWTA 2CZGA 3H97A 4GUDA 4C4OA 2XE6A 1NPYA 1ZI9A 1LI7A 1EFAA 5ES4B 3A31A 3H65A 5TMDA 4I50F 5KQLA 1GADO 2VUSA 4CMJA 4DABA 3B2QA 1OT5A 4W6QA 4A15A 2FZ5A 2UU9B 4JA2A 3VZRA 1RT9A 1SCJA 2FFRA 3MM4A 5T4FA 5ICGA 4TN5A 1NXWA 3C3PA 1QG6A 3GQVA 4D4GA 1TAHA 2QPOA 4IHJA 3M6IA 4ARUA 3LK7A 3I5UA 3L84A 2QLFA 4IKOA 1WB6A 4WFQA 3WZLA 2XVZA 1X8LA 2QVXX 3JQGA 1Y7TA 1XL1A 3ZE9A 4Q19A 5JZ9A 2JAHA 4OP1A 4YJDA 3JSXA 2GXSA 3AFIA 3ETLA 1KY3A 1TM1E 4QU0A 5DX8A 4MQFB 4IFBA 2QP4A 3RW9A 3OZIA 4D9NA 1C8VB 2I99A 4J9VA 1CIVA 5BN5A 1IRXA 2IP2A 2EC5A 2C7VA 4GQBA 4Z0PA 2V7PA 1X15A 4FXOA 2FR8C 4P3NA 3U44B 1VA4A 1PFYA 3B82A 5KS2A 1XJCA 2WF6A 5ITZA 3GELA 1V16A 5LQNA 1RXEA 3KAQA 1IUOA 2HD4A 4QPJC 2REQA 4NJOA 1FRZA 2P9EA 3BS4A 4I4NA 1IQPA 2G7MC 2K2WA 1Q17A 3JZFA 3ZLTA 2J9GA 3LTEA 4AO8A 2CD9A 4BO8A 3PQEA 2FLVA 2VP5A 5KNBH 4BE4A 2EZ9A 4KUHA 2KLHA 3M4NA 4L57A 1JHVA 1T9GR 3OT5A 4PO3X 3U13A 4RKRA 3MJ4A 4LJ7A 3LPMA 3QE3A 3LLUA 3RS8A 5IUNC 4KVGA 5EMHA 1FFXB 3PI6A 1T1JA 1XDUA 1KO5A 1XD2B 3DAHA 4RTJA 3KCQA 4WNYA 2H7VA 2PZ8A 2JHAA 2YMMA 4IIDA 1E1CA 3PUVA 2YWDA 3WWPA 1E7RA 1FQWA 3RS4A 4KZKA 4GLLA 3L77A 1QGED 1C29B 5CYOA 1KEEB 5JNTA 1KYXA 3G2MA 4DANA 5HRAA 2G9QA 5C8VA 1DARA 1P8AA 4ZVLA 5DB4A 1KI4A 4UHHA 3UHFA 2XYPA 2VAPA 1L7QA 4GI3A 2EU8A 3ABRB 4O4IF 1KHTA 4UHCA 3KTAA 3HKEB 2XUOA 5EKDA 1PZGA 1TO6A 4ZXPA 5E6RB 5EJ2A 1ICIA 4L0DA 4MYUA 3LC0A 3T9FA 3BCSA 4GR9A 4S1NA 4KXLA 1T8SA 3EMDA 4NATA 3DE3X 2P78A 3EXG2 2AOXA 3W7BA 4CM4A 4Q12A 2DLDA 1M2OB 3T5GA 1L7VC 1Y5MA 4ZOBA 4BV9A 2NMVA 3QV1A 4UCXA 1QO9A 2CMFA 3FNQA 4J0HA 3UWOA 1OLXB 3ICOA 2GA9A 4JBYA 3BIXA 4F6CA 2B5VA 3QXHA 4QO8A 2Y67A 3AGQA 3STUA 3ZHRA 3K0AA 3LIPA 4JLMA 3ZQJA 1IN4A 3F1LA 4BAZA 1BJKA 1TM5E 2BOVA 4OMCA 5A7GA 4AY3A 1OXSC 2LWIA 4O59O 4B2LA 1ZD5A 4NS1A 4Q7KA 3WRWA 2GO7A 2G40A 5JSZA 1DJNA 1RXUA 5I7SA 3RKUA 3LYLA 4ZEOA 4NPHA 4UHKA 3U4MA 1XZJA 1T8YA 3CKLA 3TUIC 4FYHA 2R00A 2QJRA 1UMBB 1XROA 1VQ1A 1Z75A 2XV1A 1P0FA 3VJRA 5LB2A 3EPLA 4PU0A 3ZYZA 1A69A 2CVQA 2R65A 3CBGA 4RDCA 2A59A 4QIHA 5T8KA 4BJ3A 4KPUA 3NTOA 4HWTA 4S1WA 1TAGA 1Q22A 5LVAA 3DBLA 2PQ0A 2HGSA 2XEDA 2ZJ8A 3HY6A 3WGNA 1RXCA 1FPMA 3NAMA 721PA 4CW7A 4QPPA 3NAGA 2QMQA 4WINA 3KELA 1N8KA 2AG6A 2WP0A 2HIAA 2JIPA 4GPTA 3EA0A 4MW6A 5FR1A 2Q4RA 1QV7A 4TSFD 3KT6A 1EGQA 2QJFA 1KPHA 4JLOA 2O8DB 1B0PA 1PWZA 1U8CB 1Z5UA 2ZYAA 1HV8A 4V39A 4IGEA 4XVCA 4RY9A 3FPGA 1AUXA 1YU6A 3GJZA 3MT9A 1M8PA 1P4SA 1L3IA 1E5XA 3BRCA 4IFEA 1Y6ZA 2PGDA 3VOBA 2O1XA 4WNCA 4DQ0A 2DQZA 2HXSA 2XNDD 2AFHA 3CW9A 3RFTA 2CK3A 4WQMA 4ZRNA 3IA2A 3PJRA 4ZMRA 3O21A 3T1NA 1C30A 3GLRA 2HDOA 1O4WA 1ATZA 3KHKA 5ERYA 1W52X 3RVNA 1J5PA 3OKCA 4B3IA 3K9BA 4UAVA 4IVPA 2AOWA 4A8JB 4J16A 1JJ7A 2NV2B 1SGWA 2B2NA 1I6MA 4E88A 1V26A 2GESA 2I2XB 4HB3A 1OV4A 2Q9CA 3QE2A 4RLHA 4JMLA 1DKUA 4TV8B 4ILKA 3ESZA 1EDZA 5K0TA 4Q9HA 1EU1A 1NXTA 2C2GA 2VQ3A 3DEJA 3NIWA 1G8YA 2HL6A 1XVLA 2FUG1 4Y6OA 1QCCA 4FFMA 4UAJA 1BD4A 1JR3A 2LW7A 1P31A 4HWKA 4JJ4A 4NOJA 4BP8A 1Y7HA 1ISSA 1E6UA 3B5EA 4YP6A 2PMEA 5A0TA 3TVTA 5DTIA 5HDQA 1UK7A 1CUJA 3KB1A 1NDQA 2XCOA 3N6VA 5EWLA 1ZM7A 4GVXA 4E46A 4LFCB 5I4KA 2AOTA 2QUZA 1JXQA 3RUAA 3UA4A 4OK6A 2DZDA 4DTIA 2CLHB 3ZCQA 4LBZA 4UTOA 1BVUA 2E4WA 1W48A 1QGAA 2UYOA 1M0TA 4YP7A 1FDTA 3UG7A 3UC5A 3U40A 2EFCB 3PT9A 4N5DA 3VMMA 4KK3A 1KVUA 4M9SA 3WGTA 4CEJA 3F6RA 3U7GA 2PLWA 5MDHA 3NIGB 2R85A 1U9IA 4L2IA 3FFWA 5IH3A 2DJ5A 2BAGA 2FZWA 1M2VB 2VNAA 2PR2A 4FKBA 3T3MB 1XZGA 3FWNA 2VHUA 4FB5A 1UDAA 4N7RA 2REXB 2DMRA 4EA7A 1WULS 1Q0RA 4IUBS 3RODA 1E98A 1IUKA 1U9JA 2AD5A 2R1VB 1VSQA 2XZPA 1Y81A 1I36A 3VU0A 1TCBA 3SG0A 2ZYRA 4E1BA 5EXEA 3A1DA 4KC0A 1STOA 2V3CC 3TRHA 3C6QA 1T36A 1Z56C 1JE1A 2H85A 1TEXA 2RKWA 4ZXFA 1V47A 2WKRA 3R7WB 2XOEA 3BE6A 1AXEA 1SC9A 3ZV3A 1WSDA 3WGQA 2N1BA 2CBZA 4G1FA 1RAIA 4Y2VA 1OXUA 1EX9A 2IPLA 4YECA 4LJRA 3CISA 1EFCA 3U6BA 4AMBA 3IB3A 1PN3A 2VK8A 4XVUA 3KXPA 3A10A 3EGXB 2ZSDA 4JVLA 5JISA 4BNHA 3I9FA 5CGZA 1HDEA 1NIPA 3CLSD 4YUZA 2FXIA 4LYHA 5JW6A 3ND7A 4YLGA 1SBNE 4BRSA 4IIVA 4MQEB 3JQ7A 4QM7A 1ULHA 4V1CB 3ESQA 4IIYA 1YKSA 1E18A 1YR1A 1Z0ZA 1COWD 4KQ2A 4JA0A 2NYRA 2V74B 3MJEA 3PSHA 3S7ZA 2WMDA 3KM0A 3AOEC 3JZAA 2I3ZA 1B2RA 4XTCS 3IBFA 1L5KA 1WUYA 4MEJA 2YVAA 3G79A 2XI4A 3CG4A 4BO3A 5HZKA 4KAFA 1IY1A 1GV0A 1QB8A 1P73A 4C2AA 2C4TA 3UY4A 2YHAA 1XTTA 3O95A 5EUBA 2O9JA 1IWBB 4IXNA 5BSFA 4MH0R 2F1RA 3DMPA 3D59A 1EB8A 3I3OA 4C78A 7MHTA 4EY5A 1HK7A 1UBOS 2ZRMA 1YE8A 4I14A 1R8QA 5G53C 3S5UA 3KZOA 2F7SA 1I01A 2JHFA 1R18A 2AQIA 4TWIA 3T12A 3SJZA 2C2MA 1GM5A 2JJ1D 4BWVA 4PRLA 4FHFA 5HKOA 2PUCA 1Y37A 4UW9A 4MZDA 1L7DA 1E2NA 4J8PA 1FXWF 1TXGA 4Y2QA 1USGA 5IC6A 4L0QA 2FX2A 2PSDA 2GAFA 2WHPA 3BMCA 3CB4A 1RACA 4NV0A 4TLMB 2G76A 3O9ZA 4K2HA 3SYLA 1NF3A 4HNUA 2QN2A 2G25A 2IZZA 2WFLB 4BLUA 4MR7A 3R20A 5LBIA 5AW7A 1QDEA 2OM2A 2PJRA 3PPVA 4WLUA 5E0OA 4HDAA 1ZPDA 4PYMA 4QUBA 4U7PB 1W85B 3EZLA 4IH1A 1AQ6A 1FUYB 1QC5B 1NW7A 2XUJA 3GF4A 4N0QA 1FRFS 5FFNA 3W9YA 5EEGA 4ND7A 4CUZA 1Z63A 4OJMX 4L8LA 5MN5A 3FWHA 4URUR 1RYYA 3PNVA 4NYJR 2IW3A 4C21A 3LL7A 3JQFA 1QVAA 2ST1A 3OZUA 1MX3A 3N2ZB 2GAJA 1V3TA 4K9KA 5CK5A 3ROEA 1UJNA 1ZIYA 2PVPA 4FOPA 4CEHB 1P4AA 2PSFA 4HAWA 4BFYA 9LDTA 2RHCA 2YHUA 2G1AA 3L4EA 2PVSA 4DWJA 1H0SA 3E03A 5B3AA 3MD0A 1NL3A 3LLSA 3HNRA 1L8OA 1E9RA 1VKZA 3EN0A 3FIUA 1VJ0A 3GLUA 4WCFA 1V7ZA 4K2AA 5BUZA 3WYAA 4PHHA 1M5TA 2OG1A 4M0EA 3PGVA 5K0NA 3PQ3A 3H5IA 3OTWA 5F3DA 1Y1QA 3D6JA 1PK8A 1NFFA 3W2HA 4H17A 4B6OA 2GAOA 1JFFA 3LT4A 2Q3CA 3NWBA 4GM4A 1E3DA 4XM2A 1IBMB 1E1KA 1M2NA 2ACWA 3IO3A 3M1AA 2GTIA 3IQXA 3KQMA 2X7HA 2PFKA 3BMOB 1MPTA 1UJCA 4IS3A 3WKDA 3DR5A 4F93B 4RAOA 3NUQA 4I1SA 2Y0DA 5DP1A 4HFNA 4AXXA 4CR6A 1JFRA 4EB8A 1X1DA 2R1ZA 4DCGA 3SKVA 1HDIA 1SULA 3J81k 4X3CA 2MWMA 3GEEA 1OZ0A 3MD9A 4YBRA 1ZISA 4E07A 2AI2A 2BFFA 5FPYA 4FQ5A 5GJBA 2DUMA 3PFKA 3ROXA 1QF7A 3DEKA 3USZA 2HN9A 3N8DA 2A30A 2XRFA 3OG9A 3C2QA 2OL4A 1FYVA 4OMUA 3C1OA 4ZHSA 2IPOA 1RYZA 5FWDA 3VDXA 1NQWA 1T2NA 2C1EA 4NZ9A 4XLLA 2JEYA 1KAEA 5L51A 2HF2A 4JBNA 3T7AA 5TNXA 4BNMA 3GLFE 1BQ4A 1C1DB 5SYAA 3DDUA 3IULA 4O1HA 3R7FA 4J1SA 4TTPA 3SK0A 2CDRA 1WZCA 4GQAA 1YL7A 2FR1A 3C3DA 4UEQA 1ZJJA 3EMKA 4IXTA 2WTUA 3BIOA 2R44A 3LKVA 1QG2A 1Z2NX 4HYQA 1VPDA 2NSJA 1UK6A 1E6CA 4AN4A 4A4DA 4I99A 5ILQA 3TEMA 4JFAA 4EEZA 5SY4A 3AW8A 1UC8A 1XQWA 2IDZA 3IVXA 4Y2SA 1AU9A 3SC2B 1A8SA 3TQHA 1I5OA 3EEFA 3L1VA 4J4TA 5GWXA 1B0AA 3IHWA 4TS4A 4WT7A 1W5TA 2QZ9A 4ND6A 1K6EA 3OZWA 5JCOA 4JJGA 1ECLA 4JFRA 2MYTA 2IKSA 3QV2A 4P32A 4GZLA 2AZXA 1B00A 1A76A 3OCWA 3ZD9A 3LBYA 5HE8A 2H1WA 3QY9A 3VR4A 1G8SA 4EJSC 1DKLA 1H6DA 1MNAA 1FTNA 3KUDA 1M75A 3S8EA 2B83A 2FJ0A 5AHWA 5IFKA 1UPFA 4FKMA 3IQWA 3ZWNA 1YC2A 1L7MA 3CKYA 2HA4A 2ASEA 2X3FA 3FPKA 3HYCA 3LT5A 4PZDA 5K3AA 5KKNB 4YIKA 1M73E 2ANBA 2PL9A 2ZRKA 3ECAA 4OFXA 4HLDA 2E5WA 4U3JA 3R9KA 1B93A 1PHPA 1SD5A 1KQ3A 2HF7A 2P8SA 1JFLA 3WRXC 5L4LA 4HDKB 1A5AB 3E22B 4AZSA 3DV2A 1DKOA 2EX0A 1K5HA 2HIGA 4LZZA 2J59A 4UPDA 2JLXA 1OC2A 2E1PA 3M6UA 5FFFA 3COWA 1W49A 2VJQA 2D13A 5EFZA 1ODSA 4YFVA 2WMYA 1XA0A 1NASA 4U5XA 5JS7A 5LA6A 2HDWA 2II6A 1IG0A 3IYLW 1XQ6A 3KZKA 4O02B 3ZQ4A 3B1FA 4PLZA 1E1RD 2XKBA 2WNHA 5KVCA 5HSGA 2HR1A 3I52A 2AZMA 1Z2CA 3AYZB 3GCGA 3INTA 3KSRA 1VKNA 2J3QA 3L01A 4I9NA 3LVRE 4WCDA 3WB9A 1NQUA 1PL8A 3EUAA 3IV6A 3NWPA 3UUEA 2HK6A 2ODAA 4E14A 1ISMA 2RD2A 4CV2A 1GTSA 1SN7A 4BY9E 4N8EA 3K5IA 1E3EA 1RRMA 1ODIA 1UOOA 2OBFA 4EG8A 5L40A 2GM5A 2VTBB 3MLAA 3QKIA 3V1NA 2D3TA 1UP7A 3EQZA 1AZLA 5CT5A 1ZQ9A 1ZCZA 4EVIA 3ZXIA 1KI2A 2GZMA 2G9ZA 1WHTB 1TC1A 3ADPA 3EQ8A 4WSOA 3MUNA 1O6BA 4QAJA 4QHTA 1JDBB 3BREA 4MB6A 1GSIA 4B80A 4BVEA 4UHDA 1GRNA 4UNNA 3D7SA 3ABQB 2IDJA 1W2GA 2O2XA 2ZANA 5CCBA 3ZHZA 1DX6A 2QU7A 2Q6TA 5G0TA 2MINA 4OHMA 5JUWA 3NU1A 4XUDA 4W5TA 3K6KA 3ME5A 5G1PA 1PT7A 3FSJX 3T5DA 1AMNA 2AQ8A 1V25A 1N2OA 3MBKA 1RHMA 1MIOA 2ZAGA 4RJJA 5GQSA 2D8MA 4YRIA 5KPJA 1DX4A 4PYRA 2JK1A 4FGUA 4LNUA 1F12A 3U7QB 5A9RA 1IHXA 3WB0A 2ZIXB 3QTBA 4F60A 3U9LA 2X5JO 1DQPA 1OLSA 4IDPA 4NU5A 3VSDA 3VGJA 4DA6A 1ZH0A 3HZHA 3OIWA 4P0TA 3FPBA 1CJSA 3LQRA 4UXHA 1M0WA 1A2QA 2N42A 4V1CI 1MDFA 1CFZA 1UH5A 1U81A 3ITEA 4UM7A 4Y1RB 4KPEC 3WIBA 3CX4A 1GGJA 2CKMA 5AW9A 4MW1A 2RMKA 4UOEA 3JYQA 3S40A 3AFOA 4AX8A 4CQLB 3O0TA 2GAAA 5ADUS 3FHCB 2AVNA 2VJBA 1KWKA 4BVLA 1AQYA 1Z6GA 4HLCA 4PF1A 3W5BA 3TG8A 4LEIA 2ISCA 4ZAVA 1CZUA 4LJSA 1FYWA 3OURA 1H22A 4Z4HA 2XNKA 4LQDA 2XB9A 3E9EA 5JXWA 2VWHA 4AKTA 1KYYA 1W6RA 1WMFA 3HKCB 2R8XA 4JR2A 4QO7A 4RS3A 1P4HA 4PFSA 5ALKA 1JT2A 3MYRA 3GD7A 2ZJ3A 1W5BA 2IFTA 3ZZTA 2XNJA 5DBFA 4K8OA 4TS9A 1KYTA 2NO6A 1IK4A 3IELA 2VHWA 4MAAA 3L93A 5IHXA 4RE6A 3EGWA 1P6XA 2BELA 1GKYA 1G17A 3ED5A 3NBKA 4HJXA 3PLAE 1IDOA 1UC4B 1PWXA 2J41A 3D8UA 5HIIA 3LDFA 1NJGA 2OD2A 1DBIA 5FHQA 3OWHA 1OB2A 3NOOA 1I24A 3F8WA 5DASA 4ADSG 1O9GA 2Z6VA 3EG9B 1PK7A 2F9MA 2XWSA 4KRYA 5H1YA 3ZBTA 4BBZA 3P9YA 1SIOA 5BRJA 1WZNA 5DOZA 3IJRA 5C8YB 3WKEA 2GQ0A 4B85A 4DV3B 1BRMA 3SU8A 3RSOA 2ZAYA 4DJEC 4B4UA 5TPWA 2HYDA 1Y7LA 3BSSA 2RI1A 2XCTB 2O5EA 1TQDA 3A14A 1KDYA 1CUVA 2RAFA 5F9MA 1OXVA 3GT3A 1SU8A 3OZGA 4MUXA 5EE0A 4QU8A 5J2UB 3V4PB 1L1RA 1EVQA 2GJAA 3A6PC 3P8ZA 2IZ6A 2OAQ1 2CFTA 4Z86A 2F3SA 3SNHA 2FMIA 3DNFA 2FUEA 2O2EA 3AJRA 4Y0VA 4AMVA 4MW2A 3LBIA 2GZ2A 3MMXA 4M60A 3UJ7A 1G20B 4BFXA 5E1BA 2ZIVB 1T8RA 2GBIA 1LTQA 5FBZA 3VTZA 2V45A 2HDNB 3O74A 2DKOA 1CYDA 1NPDA 1NP7A 2O0JA 4HB4A 4EYQA 4IJQA 2QW1A 3R3SA 3C7CB 3DTNA 3R09A 4I0WB 4CE6A 5A7HA 5JNWA 5B30A 2KB0A 2YIVX 3DQPA 4EBFA 5INTA 4D9MA 4HDMA 4X60A 1AA6A 2ATIA 2ISSD 4TKUA 1G38A 2C7GA 2A9VA 4I55B 4BV2A 2QX9A 2AN3A 1FMJA 2WKQA 3FSRA 5BPFA 3LO5A 4TMXA 2B61A 4G4JA 3TSZA 2IY8A 4J0IA 1TVCA 4ALNA 4REMA 1Z5PA 3QMVA 4IG9A 3WK8A 3N5CA 1C2YA 1BMQA 1CJUC 1PTKA 3I9V6 1JECA 2ZRFA 3OQIA 4HTFA 2V96A 4JB0A 4KPYA 3G7NA 4NESA 1G8FA 2B36A 5AJXA 4IJVA 5HEKA 3VR0A 2BR5A 1GTL1 2B8EA 4I50A 5K3BA 3X1WA 1UJMA 2WDPA 3DLCA 1OQAA 3CRRA 3E1SA 3P9XA 4LGYA 4ZEXA 2RHGB 1JEYA 5HBGA 3AW9A 2W70A 1L7EA 2OVFA 1IXKA 1BU5A 1O0SA 2ZRBA 3K0FB 1J39A 1WQ4A 4PAGA 4C0QC 4DSUA 4OLHA 5FHRA 3UN1A 1KVRA 4TYMA 2PQMA 2QK4A 4K86A 5GM1A 4Z3OA 4JJZA 4DYHA 1VC2A 1UJBA 1DQRA 2C9CA 3SBOA 4YAGA 2HC9A 3QVGA 1AQIA 3C6BA 2WOOA 3GEBA 1T13A 1T43A 3DT8A 4MP6A 4DMCA 1XCJA 1T2CA 4P5EA 4QDOA 1X6VA 4R40A 1PP4A 4FHEA 1RJ9A 1XZFA 3JQ9A 2J6HA 3C0KA 4K1XA 3JD1A 1W1IA 2M1ZA 3R3XA 2GKOA 1VB5A 4GSYA 4N7MA 4PQFA 4EB3A 5BVGA 3EFHA 1QGZA 4XWOA 5C8ZA 3UJPA 2IEYA 4YRKA 4CTJA 1UMCB 3IIJA 5TF4A 5DI3A 4FC6A 1SC1A 4FNMA 1PZEA 2FWPA 2RGNC 3LUBA 4GZ5A 4RPIA 4U2CA 4WY8A 4MVJG 4HLNA 4Y2UA 3WIEA 4XYLA 4ZDJA 1F9AA 4HEA6 3ETEA 5I7RA 5JRJA 2I3AA 3VYVA 4X62B 2CNBA 2X9NA 4ZPJA 1OOEA 4BL5A 1V7PC 5EP1A 1ZM4A 3ZPXA 1LSUA 4INOA 4N0DA 4U9IS 3W3AA 3WNZA 5LOVF 5JWOA 1YCHA 1Q3TA 3HO8A 5L7TA 2GZSA 2Y0BA 2Q5QA 4GEKA 1CY7A 3R0XA 2XUFA 2FMKA 1X7GA 1WDMA 2WVAA 4OAPA 3W4IA 2UXBB 1HC7A 1HLGA 1Y80A 4BPRA 1V7QA 4ND5A 1TKRA 2ZSBA 1F51E 4F2DA 4BB9A 3UOGA 2BTOA 1XKTA 2EW2A 2DLNA 2EVWX 2NO5A 2BKEA 2Z2YA 1E89A 2VUUA 4YCBA 2SCUB 4NBVA 2R9VA 3A2MA 4DJJA 2BD0A 4GYYA 4EVRA 1LBTA 4O4IA 3RASA 4DY4A 1V1MB 4CF4A 4O29A 4M0UA 3SYMA 4BMXA 3N2GB 4CMAA 4PLCA 4FOLA 4IIEA 1AKUA 3DNPA 1GU0A 1W1WA 2B30A 3ASVA 2XOXA 3DEFA 4S1OA 1HOTA 1DXOA 1E3WB 4IZIA 2XA9A 2JFHA 4IW3B 1N1MA 4OU4A 2I8LA 4XB2A 4CMEC 1X87A 2YICA 1ZW1A 1YIAA 4BFSA 4D44A 4D4IA 2ZGVA 1Z0AA 4D8TA 3TTYA 4RSRA 3RSFA 4UDXX 3WBJA 2VDWA 4K9PA 1NYRA 4G1CA 4EIWA 2AQHA 5CPBA 1QBGA 1T9HA 4JYBA 4C29A 3N39C 1E6LA 3P9NA 1YDMA 3RH0A 1W8DA 1TQ6A 2GEJA 4CLOA 3ZVNA 1QTQA 2B4AA 4BDTA 2VOEA 2PX8A 1XCOA 2NN3C 2IYSA 5HP4A 4C4ZA 1PI3A 4JJAA 3T3DA 1UZLA 4Q1DA 1CQZA 1R0KA 3R9WA 2I8AA 4LZWA 1NNLA 1TF5A 1XDBA 4BJ6A 1JMVA 1VP9A 2HIMA 2WV9A 1E5VA 4NNOA 2V7XA 4JDUA 4RF5A 5AKEA 4QD3A 5TQJA 3UCXA 2V9ZA 1N0IA 1Z16A 1P1HA 2FMHA 4AKIA 1U8TA 3N2IA 2Q28A 5HJ2A 5FNZA 2QN3A 4LF4B 1T5LA 4DF3A 5BNZA 1TD1A 3MWJA 2X23A 3EC1A 3WHIA 3KTDA 3ZHSA 3OCUA 2QQ0A 4CKXA 3QW2A 5F1KA 8AT1A 3RHSA 1BE1A 1QG4A 3K1AB 4HYTA 3ZE7A 4EJFA 3GI1A 2V65A 1W36B 2BZSA 3F9CA 3FXAA 3AETB 1QE0A 2WAYA 1O6GA 2OD7A 1BXRB 1UBEA 1U7PA 2R4QA 2YQ5A 3FNBA 3CUEF 5CFZA 4CXMA 1EUZA 1L8QA 3U39A 2EJVA 3S2ZA 1KU6A 4H18A 1XVUA 2OFWA 1KZ7B 3VKUA 4AN0A 1ZGJA 2V7WA 2Z3ZA 3V46A 3CXUA 2V7EA 3VHRA 1FFAA 4O8ZA 4WZAA 2DUJA 1ONPA 2HMVA 3WLKX 2BKAA 3W5AA 5KCMA 3BGSA 5FTWA 5B1SA 1CRPA 3LDUA 4QICA 1Q95A 2HJRA 5EXPA 3D0OA 3FA2A 2FZLA 2PLNA 2GEKA 4X45A 1YZQA 4I1RA 2IX9A 4NR0A 2XXAA 3VU9B 3QMMA 4M46A 3TLBA 3FNEA 2Z58A 1EWTA 2ZVQX 3NTRA 4IIGA 4MMXB 4QKQA 5FPKA 1V39A 4EG0A 1P7WA 4NBNA 5ERGB 3VSCA 1QHFA 2CN1A 3VYUB 2AWNA 3UPUA 4U2FA 4B5KA 3BE4A 3DMYA 1Y8ZA 1O1YA 3HO6A 3KWLA 2QAGB 4P33A 1Y6RA 1KQOA 4Q4HB 5IT9A 3EBPA 3VC3A 1JQ5A 2FEXA 3KPWA 3CUYA 5JPIA 1U5BB 2XBUA 1PG5A 1YU9A 2VLIA 3OPXA 5ALIA 1VG8A 1FFWA 1HE8B 3BWEA 4GPD1 4BEVA 3EDCA 2D7CA 3TLAA 4EFKA 1ADCA 1ZSNA 4BWFB 3W9SA 4XQ9A 3CT6A 3L07A 3VNQA 2O4CA 4B4KA 3D6UA 3KVRA 4QYIA 5HIAA 1XOIA 1XPOA 3HDJA 4EVQA 4ZMSA 5CT8A 3HFSA 3GAFA 1G7CA 4GMHA 4OHRA 4H77A 1PQYA 4KOAA 2CFRA 2XTMA 3UXMA 4YRLA 4YYEA 4ZJYA 3G0DA 2QBYA 4RY0A 1X1QA 3SYRA 2H1OA 3GFQA 1P4GA 1VJTA 4FEAA 1L8XA 1UXGA 1KJYA 4EO7A 1GUFA 2J09A 3M6WA 4MV4A 2R8PA 3GJQA 4TKZA 3R7LA 5AI0A 2Z09A 1LQTA 1ULSA 4MEAA 5DXJA 1KO7A 4I19A 4JU8A 3KPYA 1N2CB 5DW3A 2GCIA 4F06A 2VYNA 5DHTA 3T7RA 1JEOA 3QELA 4ZV7A 3NI2A 5IM4F 2XXJA 5GZ6A 2QN1A 5TGZA 4ZDIA 3QUBA 3P26A 3QKWA 4RF4A 1GSHA 1NW3A 1DRWA 2AG0A 4I2VA 4PSAA 4L27A 4ZQCB 3W3AH 4TVSA 3UKDA 1PW7A 1NOIA 3VO9A 1VLHA 3F3KA 3E3NA 2YVUA 5CDFA 5AUPB 2A9RA 4BO2A 1FX0A 1R0BA 3Q6NA 3I5YA 1C8KA 1T5SA 1DCMA 1B6GA 5HFJA 3TMYA 3DM9B 3V5NA 1CZNA 4LG1A 4V02A 3OEEA 3JVEA 1ELOA 4EF5A 5TVGA 1QNFA 4YUAA 1M6VA 3HEBA 5LWHA 1ZAYA 2JIDA 1V1RB 3BXPA 3BIFA 4ZK2A 2O5CA 1C7JA 1U11A 1Z8DA 2QZJA 3GFRA 3BGDA 4CKBB 2SKDA 1SCBA 3P9SA 1SC4A 2JGLA 4BBJA 4ND1A 4U7TB 4IG4A 1KAMA 2CLLB 1C80A 2XCRB 3JVIA 5IC4A 5I47A 2QM0A 3TZ6A 3ZWCA 2A1TR 1UR5A 3N7TA 3G2KA 2ZLBA 2R11A 3NFYA 1I7QB 4NHOA 2J45A 2WAOA 2JLAA 4Z1OA 1WZ2A 2IBSA 5K0JA 1MF7A 2LRHA 1IY9A 3WLHA 5FWYB 3TQTA 3U7RA 3DHNA 3HVKA 1QYVA 2QMYA 1DAHA 4OM8A 2J9FB 5FYQA 4BVAA 2EFGA 2XGMA 3IALA 3K1ZA 4JH0A 4P98A 4U5QA 3EGDB 3MWYW 4NBSA 5LP1A 1LLCA 1E2FA 2Z5GA 1PE0A 1UK9A 1DV2A 1MQAA 1POXA 2QXYA 1UWKA 1A4UA 3ES9A 4NWIA 3W3ZB 1CUBA 1VKRA 1EVZA 2XLBA 3NFRA 3P19A 4QYXA 5BVHA 4CN9A 2KE5A 1GRVA 2Z83A 1JU9A 3AUFA 5K0LA 1FA9A 3RYFA 5IZCA 3CEAA 4S35A 3DOHA 3GV0A 1YXMA 4ON9A 4ZYYA 5I7VA 5JSUA 1H66A 2ZXEA 3I9KA 4QHSA 3VHQA 5JU6A 2AMLA 3MF4A 3V97A 4TMVA 3V34A 1KMHB 4IZ6A 4IQGA 2LCQA 3P20A 1PWHA 4S0ZA 2FSHA 3N2EA 3GVXA 3IMGA 3GDOA 2Q62A 3V8EA 4D25A 3CXRA 2E37A 3HCFA 3R6WA 2PO5A 4NKRA 4AKSA 1P7VA 1UBMS 2X15A 5JNVA 3ZDCA 2H1SA 4M6WA 4LS3A 1RC0A 1L4HA 1Z7BA 2QI9F 3RLFA 1T1EA 3BL6A 2X0KA 5JD5A 1Y6FA 2NG1A 1O9HA 2ZJ1A 3LVBA 1UAGA 1LK0A 1UJ5A 4BP3A 3L8ZA 4A8HA 2W0MA 1VDMA 4OU5A 4RIEA 4QATA 4RE5A 5E4TA 3RUFA 2VC2B 2Z43A 3B1KA 3AR5A 2YFKA 3BD9A 3C74A 1RBQA 3M70A 1OXMA 2J5QA 3EC7A 3P5SA 4FBMA 3SOPA 5C51B 1DWQA 2WILA 2WB2A 4PBSA 4CG0A 4PLFA 2OK8A 1UMDA 1SVKA 3RTGA 3PXUA 3VVLA 3HL0A 4P4UA 3SM9A 1JDUA 2W83A 1RPJA 3JALA 1GL7A 3CLRD 2E0IA 4R51A 4V2UA 4DQXA 2F1IA 2ZJAA 2K87A 3OCCA 4X7MA 5KWSA 3E8SA 1S0UA 2WZCA 4HZUA 1NNSA 4W7HA 1XQVA 2JFOA 2WJYA 5G4KB 3ZC3A 1YFZA 2IV3A 2J48A 3QW4B 4QGAA 1B43A 4H59A 3GUUA 1I7PA 5FOQA 2CHQA 1AC5A 1LH0A 2EWMA 2JCYA 4PX9A 3KQNA 1O8CA 1U0FA 5DGTA 3T7EA 3T1HB 2AMVA 2FJPA 3EXHA 4JZKA 3SSAA 3TGWA 1L5HB 2MSCB 3BXXA 4TZ6A 4YDSA 3ISVA 1Y82A 2C59A 1RRVA 2XWPA 1IXYA 4RMHA 1W36D 3N3BC 3ZOKA 4IH4A 1GYQA 2PKXA 2RHBA 3QMWA 3BXHA 3K5PA 3NHUA 3IT2A 4QJIA 1N5JA 1J06A 2Z1DA 3KJNA 3R6GA 4YHBA 4KEAA 3NTQA 4DMFA 4JYZA 4LVOA 4CUKA 4YY3B 1H4VB 1M2EA 1NF2A 2F1KA 4LHYA 1JVNA 3HCPA 4LY0A 1NW9B 3KLOA 2AKEA 7GPBA 2YUIA 1KAQA 3FNFA 4PZCA 1R3UA 3AUSA 1KY4A 1IAQA 4EOGA 4LDNA 4HATA 4O2LA 4ZOLB 5E7JA 3BE5A 5I7UA 2IT1A 3UAWA 3KQVA 4YA6A 3SR3A 1CUDA 2ZJ5A 3MIIA 1NN3A 2NZVG 3FRHA 4Q1AA 1S7GA 5K3CA 4XYMA 1OROA 1EB9A 4RJ2A 3RK4A 1AHHA 4M7RA 1OI4A 2H1FA 1V8FA 3WNBA 2FUKA 3KL4A 5KKCA 2YZ2A 3OZFA 2JATA 4URHA 1C9MA 2YC4C 2WIBA 4BZZA 1I7LA 4HH0A 1G4HA 1ODFA 5CA1B 3C5CA 4B6SA 4B83A 3BXFA 3DBRA 1FMCA 4PZAA 5IAGA 3KEQA 4E4RA 5IHPA 5DM70 2AMFA 1DEXA 4M0PA 5EIWA 5DM2A 2GCGA 5HUHA 3BA1A 3VPXA 1W5EA 4R8LA 1MG5A 2QE6A 2HNBA 3KDSE 3KQPA 4FHCA 4TN1A 3X1DA 3GP5A 1NLZA 3CRZA 3FWYA 4CIDA 5CDGA 5HM8A 3K5HA 5FOXA 2UXCB 2PKQP 3GU3A 2DERA 1EX7A 4RQAA 3U3JA 2OE2A 2IH4A 4FCVA 3AKCA 4B73A 3N6RA 4LHWA 4EL0A 3AIMA 1U0SY 1W0JD 1ZJ4A 3G7SA 1HM5A 3OQVA 3PRKE 4S1VA 3TLGB 4BLPA 1KAOA 4BAUA 1PS9A 2DH6A 3GJRA 3SN6A 3GGDA 2CUTA 4W6ZA 2I2AA 1B0ZA 2VDPB 1CIJA 3OU7A 3SFVA 4IWYA 4Q4CA 5EIXA 3TYXA 4TRJA 5JSYA 1Y3BE 4AO6A 2IU0A 1MOPA 1B7GO 4OH1A 1QHXA 1TJ3A 4D8WA 4TV8F 5JXHA 2DBVO 2JLZA 4KSYA 1CQIB 4MS1B 4TLDA 1U0RA 5AJVB 4JQZA 4F3RA 2WYHA 1QYXA 1JYFA 1Z06A 3I01A 1N2HA 4FI3C 4QYMA 5DTEA 3S2IA 2IHVA 5LSAA 2C7OA 5E8RA 4DR3B 3LGAA 4QG7A 3OIYA 2CFOA 2EV9A 4KQ1A 3UG6A 5JXGA 4TTSA 4OBEA 2PZGA 5DV9A 1L5MA 1SXJA 2QRHA 3E2MA 2PUGA 2CCKA 2YZ7A 3L40A 3REGA 1JP7A 4H6XA 3ML1A 2C84A 4CRWB 1QYDA 3HZRA 1U5AA 5TQVA 2F6RA 4PZPA 2E4ZA 2FPGA 2P5SA 2RHHA 2XTAA 2ZTSA 6YASA 3THWA 5A5GA 1T3ZA 2FSPA 2OQVA 2PMKA 3N7UA 4CG3A 2V8OA 3H4IA 2XHEA 2PWZA 3KYCB 3PENA 1Z15A 1MC1A 5K0SA 2FSFA 3WLMA 2D7DA 3IMFA 4DEVA 2O07A 2VJOA 4ZVVA 4BVBA 2C61A 3RYCA 5B3JA 3A8TA 3EBOA 2TMDA 1C5KA 1JPNA 1TMGE 3JD0A 2FW6A 3BSWA 4A2WA 1AK1A 2AHOA 4IOKA 2JI6A 3VR6D 4R0NA 2HT6A 2PFSA 2XUPA 3GP3A 3EE6A 5ABPA 1N6HA 1LBHA 1H8HA 2J5XA 3WIUA 1YR7A 1VCMA 2C97A 2R6ZA 4EPTA 4HF7A 2X9QA 1R6DA 1XJWA 3CRNA 4H1VA 3OZBA 5JS8A 2DR2A 1YR8A 3RG8A 1UKVY 4Z54A 1K92A 2VA8A 3ICVA 4CWAA 1YTLA 2QG6A 3PK0A 3FI9A 1UDCA 2VQDA 4I3GA 1TZMA 1AUPA 1DAOA 1XIVA 4KN5A 1O6FA 3M6AA 3UBTA 1CP2A 3B8EA 3MWDB 2GN4A 3KQTA 5BT8A 1BDIA 4EGFA 1CE8B 2XCQA 1ZQ1A 1PFVA 4UUAA 4L7QA 1PR1A 4KXXA 3HCOA 1OGIA 2A0FA 9ATCA 1GN9A 1N1GA 1JAIA 2BM1A 2O8NA 5KYXA 3EBLA 3VDMA 4MIYA 1PAUA 5LM3A 5LNK1 4HGYA 5D3KA 1WXWA 2VYQA 4KIGA 4Q4AA 1GKUB 1E9FA 2X2EA 2JI8A 4BS9A 3UC9A 2JJ2D 3CNHA 2E85A 2Q3MA 5LB4A 3TCXB 3W77A 2Z08A 2G1KA 2QSUA 4QQKA 2OBXA 3QENA 3AZQA 4BTEA 5MFZA 1R6XA 2VATA 2VPZA 4MKZA 4KOEC 1QRDA 3U1VA 1NX9A 3C85A 5I4BA 4ANFA 5COQA 2B82A 3ACBA 5IN5A 2Z6UA 4DM3A 3NWOA 4KL8S 1LRLA 2Q6KA 2PGAA 1O2DA 1U28C 4KUGA 1EAMA 2D0OB 1Y8QA 1GG9A 3DMTC 1U7DA 3WK7A 4MVYA 4IDAA 3UOWA 4GM0A 3U1TA 5J4HA 1BC5A 4UXJA 3VISA 3L6OO 4J3FA 3RVKA 2H8GA 1Y4SA 5JAOA 1LY1A 3MFYA 5ICCA 2VVTA 5B2ZA 4HVLA 3F6BX 1ZP6A 1VL6A 1WXGA 4UPEA 3RJZA 5A4IS 1BA2A 4FP9A 4AJ1A 2GNAA 2L82A 4CKCB 4V03A 2G67A 3A06A 2NVOA 3EVFA 3S1SA 2DSNA 1L0BA 3THOA 2BR3A 3UAGA 2OCIA 3CE6A 3TLXA 3MELA 5K8TA 3ENQA 1L5WA 3IUYA 3V7UA 3R3VA 1NFQA 2YUTA 3AHHA 5JNRA 1PDVA 2OHGA 4WECA 2PU7A 2O3JA 4Q9NA 3PE6A 5IBRA 2D1YA 5IEBA 5FOWA 2Y2UA 3ZTTA 1GZ7A 1M1XB 2PVCA 3EZNA 1MD9A 4PYNA 1B8NA 3W2FA 3WC4A 4WXYB 1DBRA 1I4WA 4RVHA 1BKSB 1CKEA 2H9AA 1VHTA 3RUHA 1HE1C 2W42A 4H2DA 1QRAA 4I3FA 1J20A 1TUBB 4WD3A 2OHIA 3H1AA 3IKMB 4QBTA 4U4AA 2KYRA 3Q72A 4FINA 1YVRA 3DGEC 4PYJA 5B12A 1XZCA 1YHZA 5BYAA 2OHOA 3T9DA 3MJTA 4HNTA 3FW1A 3C8HA 3IPYA 2VDJA 2H0RA 2PUHA 2WRZA 3B9PA 4Q1EA 4ZYZA 5K6TA 3W5CA 3E70C 5I3CA 1WX1A 3A1SA 1L7NA 5JMWA 3T9AA 3DBOB 3S99A 1ND5A 5FPSA 1MR3F 2XCUA 1ZUD1 3GQBA 2ZJ0A 4LVCA 5CTAA 3BMNA 3KOOA 4G07A 4YV1A 5GIPE 1E3SA 2F8TA 4DM4A 1P7CA 2CDCA 2HKIA 3N0WA 4LXUA 3UGKA 3UK6A 5JXIA 5LZ9A 3BHJA 1TYBE 2G5PA 2BFDB 1I4OA 4RVUA 2G0TA 1C4WA 1SVLA 3NLLA 3CVXA 1DBVO 4R1OA 1T2AA 3T94A 4X8MA 3WSVA 1TFRA 1J56A 3DG9A 3GLKA 5KTMA 4DEXA 4R9NA 1NVWQ 4NJMB 1KSFX 2IUTA 3V4SA 2QSJA 3L6UA 1KDVA 1WB5A 1NBIA 3IP5A 3GLGE 1XWFA 5I6DA 5IJ0A 5L4SA 3IR5A 3HN7A 2OBNA 3ND6A 1JDSA 4Q34A 5KOHB 3K70B 4R9RA 1O87A 1G8HA 1NVMB 1QO7A 2CNWD 2XKAA 3GR6A 3Q1LA 5FUYA 2J9YB 4ZVNA 4U2EA 3I2GA 4L28A 3RHZA 3KE9A 4MITA 1PJ2A 2BF7A 3D3WA 3SQLA 2VRNA 3HJHA 4NONA 1YCFA 2D5AA 1KK1A 4BN4A 3ZDAA 2QRPA 5D7BA 1DL5A 2BBWA 4KB5A 4QYWA 1XZHA 1T15A 3S2EA 2AGVA 3DHWC 3BFJA 3ETDA 1NMEA 2OGTA 3OHMA 4GC5A 2C2HA 3I28A 4NEHB 4Q03A 1NVGA 1Y6JA 4ITUA 4UQPA 2X6QA 3WP1B 1YS6A 2PKWA 1T1SA 1OA1A 4AMYA 3CMMA 3LQ1A 1IATA 1NYLA 1Z7EA 2JS7A 4B8ZA 1I30A 1EEXB 2CEAA 4J3NA 4GI5A 3PE4A 1MEOA 3KDAA 1TM4E 4Q3CA 1IE3A 3RC2A 4JCOA 4Z4EA 2RC5A 3VPHA 4TMFA 5CMLA 3ITDA 1OI3A 1ZI6A 2HTFA 3HR7A 3MUFA 2Q1TA 3F3MA 2M6KA 4BZQA 5AVRA 2ZR7A 4LDZA 3K2BA 1QIKA 1CETA 2H5JA 1IZZA 3GGGA 3OCJA 4FFDA 3V8PA 4NIMA 4ZCSA 3T4PA 3JATB 3Q2IA 1Z3IX 2Q9BA 2QPLA 2VZ8A 2GRUA 4UUPA 5EPOA 2O7VA 4D0NA 3I04M 4TUYA 3GY0A 3HH8A 2I6SA 1JQDA 3PNQA 1K5DA 2H00A 3IV9A 3TQIA 5HFAA 6GPBA 4L07A 4BTVA 3GX1A 1JJVA 1VL5A 1SUWA 2DY0A 4JSTA 5KU7A 3QXCA 5IZ4A 2ZM5A 1AJEA 3A25A 4YRJA 3SHWA 4P4GA 3KJXA 2W2OA 2O1WA 1XYGA 2JFUA 1DHRA 1P39A 2VK1A 4Q7EA 1B6SA 5C7OO 4COKA 1XEXB 4M9CA 1SU4A 2BC9A 4KLNA 2PRIA 3Q8XB 2BGRA 3F2VA 3WYCA 1XQXA 4KODA 3P9ZA 4BGEA 4YV7A 2LDXA 4I1VA 2Q1SA 4OJTA 5JAPA 3SVLA 3G13A 1EDOA 1TF7A 3DONA 4OSEA 2Y68A 1L5RA 4A9AA 5J5CA 3U7HB 4NCNA 3ADKA 1UZUA 4TWJA 4UEOA 1OFGA 2MHCA 3AKDA 4U7WA 3BFKA 4WZBE 3M5DA 5AESA 3OPQA 3C3BA 1U0JA 4ATNA 3U3RA 4X92A 3DHYA 5K20A 3RVBA 5DPMA 4BNTA 1D4FA 1EHIA 1BZYA 1FFYA 2ZTMA 2E6KA 1VG0B 1MA3A 3W1VA 2BFCB 2C4WA 4F5ZA 2R79A 3ICQB 5C5IA 2J0VA 2EBFX 4J0DA 1FQOA 2RIRA 4RMGA 3SMQA 3TTWA 1UINA 5KTSA 1EWKA 4F46A 1UFKA 2O0LA 1PIWA 3JSAA 4YMTA 4LUCA 4M86A 4ZT3A 3ZD6A 3VX3A 1YJXA 521PA 4LMPA 2HJHA 2F3UA 1RPAA 4P36A 5T64A 1IONA 3GLHA 3L0ZA 3F6EX 3F90A 4TMZA 3A1VA 421PA 2QDKA 3DLHA 2W2VA 1G16A 3QPBA 1OI7A 2FRXA 4MB0A 1E63A 3GFVA 4CTKA 1T1GA 2DFLA 1Q0ZA 3R74A 1G21E 4JODA 3TH5A 3VGPA 2QN7A 2BEKA 4IWXA 3MCTA 4HQOA 3NETA 2I7DA 4X7PA 1CEXA 2DHEA 4L5IA 4AZ0B 3O8RA 5DYGA 1PL6A 3AOGA 4HQ6A 4ZKEA 2ZOSA 3OP4A 3HKBA 3RK1A 4A82A 3TX2A 2HLDD 3IHKA 1VKHA 2RKOA 1SVSA 3L0DA 5BWOA 3SHTA 3THXA 3DP7A 4YAIA 4PY2A 1H2BA 3AFMA 1TM7E 3TW4A 2W8BB 5LZ4A 1RADA 5EP2A 5EPUA 2ZE6A 2GN0A 4QXPA 4ZVTA 4BE7B 3G8AA 5EESA 5FD8A 5HJEA 3U62A 1XZQA 4YAOA 1BW9B 2VYVD 3CPHA 4PLHA 4Y2HA 3SX2A 2JDID 4F8EA 4TM7A 2QV7A 1TU4A 4BNDA 3LCJA 1YGPA 3EFEA 1WETA 4BC1A 4R9VA 3ROKA 3T6KA 3ER9A 3PDJA 4LSWA 4LF5B 4Z0HO 2FNAA 4OHZA 3X1JA 1Z18A 3HDVA 4LDRA 2CMKA 3C7KA 5IM5A 1FDSA 1K6MA 4FW9A 2CFIA 4DR6B 1A9OA 3WWEA 2CXSA 1CJCA 1E79A 1NRWA 3I64A 4LXXA 1QIEA 2NV0A 1NV8A 3AF2A 4NPAA 3T0GA 2GFQA 4TROA 3ZE1B 3BK1A 2GEBA 3DKIA 3GVPA 4BWYA 2YNMA 1X92A 2F1HA 1MV5A 3GLTA 5CLGA 3TNFA 4F1JA 5C8DA 4ASUA 3NTLA 5TMEA 3GGCA 1CB7A 4RFSA 4NJEB 3RRYA 1S8FA 3ASZA 4TTAA 3ADBA 3UK1A 1YVUA 2BFWA 2YV5A 3MTBA 3PNOA 5DZSA 3GL9A 3TIGA 5AW0A 4YMGA 1FLDA 2QRJA 4W82A 4RADA 3HS3A 1JLRA 1V71A 2H2AA 4H1HA 4OY3A 3ZWPA 1L5QA 3OCVA 3K9NA 1L9KA 5DNYB 1FQJA 2Q1WA 2ZUBA 2IQIA 3Q7TA 2XUDA 2CDAA 1LS6A 4TXMA 3BMQB 2WHRA 3RU9A 5C8YF 4B6GA 3GFGA 4D0GA 2EL9A 2R6R1 5LDDC 4PSUA 2PE5A 4Q9DA 1L7XA 3RS5A 2HBQA 2VK4A 3F47A 3I8SA 2XNHA 4QJ4A 5K8JB 3AUXA 4J43A 5DM60 4QEDA 5IM4A 4HAZA 2HFJA 2X2OA 2J5BA 1Z22A 2BEJA 3FE2A 2PT5A 1DQSA 1KZGB 1PO7A 1TK2A 2FZKA 2B98A 2F4VB 1X7DA 2GNPA 1Z4MA 2I4NA 3HR4A 5FYDA 4O2BB 4C4PA 2YXDA 1ID8A 3JARA 5T6MA 2HMYB 1MAAA 2JAOA 2ZJ2A 1PUIA 3M0EA 4KBFA 3EZ7A 4KQXA 4N5LA 2ENUA 2OCYC 3A2LA 4GP7A 2WJVA 4QECA 5H0IA 4AP6A 2ZR9A 3K70D 5K99A 4LWPA 1JB1A 3UO8B 4QOEA 3ZDXB 4IYJA 1TM3E 5KTYA 3O3OB 2LGJA 1DAMA 3OJWA 4CGYA 1OPXA 1FJHA 1EM6A 1VPLA 4HWGA 4I55F 4WKPA 2ZDQA 3BOSA 1WR8A 4UFOA 4ZIRA 5DX1A 4DQUA 2O2IA 3MOSA 3LP6A 5FNVB 3VPFA 2W0SA 1Z83A 4KE6A 3ZX4A 1CF4A 1AUVA 4LIPD 3SIWA 1XNHA 5KHAA 3IPRA 4M0DA 5D6OA 1SCAA 2W8ZA 3KV1A 1C0PA 2R1TB 2FFHA 4N6GA 4G0QA 3V9PA 1AQJA 3RC8A 1WSBA 2QZPA 4F9FA 1HX7A 2QYOA 1N6IA 4E5DA 4ZVOA 1GIAA 1DJPA 3T1YB 3TTSA 1RPNA 2QP9X 1OX5A 1HG0A 4I66A 1RC8A 4KAJA 2C5AA 4KQMA 5K7SA 3BICA 4C7KA 4F9GA 3CW8X 2CNKA 1BRTA 3E81A 4ALIA 4E2ZA 1RXSA 4QXAA 4G5QA 3RSHA 1A88A 2RSLA 3MCZA 4QFMA 3IBTA 1UOQA 3R4CA 1G9TA 1O89A 2W2KB 1GEEA 1S4MA 4UFNA 1DS6A 5G1OA 2BGWA 3EDOA 1WRBA 3SXUB 3DXXA 4JC4A 4K6OA 1G8PA 3ZN2A 2I80A 1R27A 2O3RA 3DOJA 4HPJB 1OYYA 3COSA 3FPAA 3NV7A 1U4OA 3L4BC 3ONNA 1F4PA 4HX5A 2PXAA 5H81A 4XDGA 1H3NA 5I7HA 1RPZA 3RVSA 2ONZA 1A72A 2P79A 4XGNA 1PGNA 3VTKA 1CDDA 2V1UA 4IMJB 4Q47A 3TM5A 3ZJTA 1VMDA 2RI6A 3TIVA 1XRJA 3PUWA 3H1TA 3T1QA 3W7AA 3ZNNA 4L4YA 2X0JA 1OAOC 4OHBA 5J43A 5KTRA 4DE5A 1HE3A 1YUNA 2IJGX 3GCDA 4Q66C 4Q01A 4UEKA 5JT1A 2FGJA 2AR9A 3ASUA 4IWNA 4BLTA 2VZ9A 1HDRA 3SEQA 2PUFA 2VPXA 3IAAA 3KEGA 4M0CA 4CF5A 4GSLA 4G0WA 3Q8KA 4DCMA 3F1KA 3ESAA 4KW7A 2HM7A 4AK9A 1OUMA 2ZSIA 3ND9A 4MVJE 1KRXA 1US8A 4MWBA 4YI5A 1S3GA 1DFHA 1GPKA 1GPNA 1BMDA 1HE5A 1HYEA 1KYQA 2ECKA 1GEGA 2XD9A 3CNQS 1M8JA 3H1EA 1G8KA 1TC2A 4FNAA 4HB2A 4IYRA 5A2GA 4W5RA 4PG5A 2WJIA 1T9AA 3UV6A 3WGKA 5KU1A 5JG7A 4CM1A 4F6RA 4L6IA 4IZOA 4Z99A 3K0EA 5A9TA 1CJTC 3GFOA 3IEKA 3T5MA 3F73A 3GLQA 3RI3A 5FAXA 4RD2A 1ONOA 4ECAA 3HSKA 5ALWA 2QD3A 1YK0A 1YH3A 3UFBA 4EHJA 1EVEA 1HLPA 4WKBA 3D5EA 2C5LA 3L7KA 2O54A 2IEGA 5A3JA 4W99A 3MT0A 3IUPA 1TD9A 4RNDB 2FQQA 4H9GA 1M2OA 5IS2A 4CLEA 1FDRA 1DEHA 1LJ8A 4KI0A 5KMGB 3KPVA 3AR8A 3IAXA 5IVKA 2IYPA 3F5SA 4MPDA 4EPRA 4YFYA 3TW8B 2FN8A 3GUZA 5CX1A 4CR7A 3OX3A 3VSBA 1XA4A 2QTCA 1HRDA 3D4OA 4GLFA 4CI9A 4D3DA 1PR4A 2WIAA 3O47A 3P97A 1ZUNA 2C8JA 1QP8A 2CYAA 5CT9A 2NU9A 2O0HA 3AR6A 4E5NA 3ZZMA 1OWLA 3CEPB 1BH6A 1N4DA 2PX4A 3L6BA 3OI7A 2LZ0A 3OU6A 4RDXA 5KQSA 2O8CA 2Q5EA 4A27A 2ZSFA 3EGVA 3DPUA 5IMSA 4MHSA 3VJMA 3KHSA 4DIUA 5EMMA 5LQSA 5JPCA 1PFWA 1U02A 1KZHA 1WXIA 3KBOA 1UC9A 1WXXA 3SSOA 3WLOA 4ENSA 4F91B 3TUZC 3H5VA 3AP1A 3E9CA 3OZTA 1JG6A 2ZI5A 1C8LA 1J2JA 1WE2A 1BDHA 5ELMA 1JILA 1PFKA 2CFSA 4GH5A 3E7DA 2D5IA 5EP3A 4CNQA 3A4MA 4AJHA 5MN6A 1RHQA 1W46A 4LRXA 3DYVA 2QIPA 3RV3A 3I34X 3L6RA 2FN9A 3PNKA 1YS9A 4D46A 4EMBA 1DINA 4WACA 5ALXA 4M0LA 1C50A 2PMWB 4UNPA 1FBNA 3WWCA 4F1WA 2PUWA 1PCXA 3EEOA 1V8DA 1XP8A 1C7QA 2CWDA 1GTMA 2OY0A 3T41A 1WHSA 3UYLA 8OHMA 4YRNA 3O8OA 2PA0A 4W7IA 3RYHB 4NCBA 2IU6A 2QLNA 3CX7A 3IQZA 1YULA 3TFQA 4D79A 4DW8A 5C7YA 3B7PA 2FMTA 4P38A 1GLNA 3ANTA 5FA8A 1C9YA 1ZR2A 4CF7A 2C98A 3TKLA 5EZ6B 1GVHA 1Q5PA 2EBWA 3FKJA 1G5RA 1KNQA 3B6MA 4LYJA 1ISIA 5CDSA 1FMFA 5BQFA 4LPKA 3UENA 1H2XA 2F59A 2DTEA 1PV2A 1Y5NA 4AJ2A 4G8BA 2HX1A 4UVEA 4NZNA 1VSTA 2OO5A 3PQ5A 4NRDA 4Q4JA 5H68A 2CVHA 3BAZA 5TS3A 2DBZA 5IWAB 4K8RB 5CBPB 5KTNA 4BGIA 4KQ6A 3WGJA 4TV8A 5EQJB 4ILEA 4ENPA 3W5DA 3HNPA 1NAIA 4CCAA 4DRXA 2R7NA 1QGDA 1A2BA 2A9PA 3ILSA 4UE3S 4ZYTA 5IU6A 3SR4A 3AHDA 4CCYB 5KVAA 1GZVA 5KSYA 2ET6A 2XLCA 1PF7E 1OJ7A 4B34A 5F2OA 1KHHA 3V48A 3H86A 5ECGC 2A84A 1NIJA 2VH1A 4OV6B 1Z39A 2P1DA 3P2YA 1U0EA 3RBXA 3H2GA 2CL0X 3H4MA 1B6RA 3ED1A 1P91A 3OTGA 1WW3A 3KKKA 3CG0A 3U5TA 1YO6A 1TT5B 3CSUA 3WZ2A 3WIVA 3GBPA 1I33A 2XOKD 1KOLA 1IU9A 5DYYA 1O95C 2C8KA 1AF7A 1HR0B 3ZE8A 1XKXA 2Z2ZA 4MUEA 4Y9DA 1VP3A 4DQDA 4F2PA 5CLIA 7ADHA 3JW8A 4JT2A 4LQLA 2FWMX 2C96A 1T4MA 1X7XB 1P0MA 4X7RA 1N2JA 2JVIA 2XH8A 4GLBA 1IB6A 4HN9A 4MUIA 4WL0A 2IWHA 3UMVA 2VCEA 2PD4A 3PFWO 2WWXA 4LOJA 2VZ0A 1N6NA 3ZCRA 2MSWA 2XMRA 2B9VA 1RBYA 2RGGA 5AVTA 3F0TA 5FWXA 4CCSA 3IODA 1AMUA 2ZDHA 2OUIA 4BO7A 4IF6A 3GCWA 3MRXA 2QQEA 2FQYA 3RBZA 1L1QA 1VL1A 2OGUA 1YRYE 3TGLA 3MAAC 4LI0A 1TYZA 4OVKA 5I9NA 3I2FA 1E1RA 4CEIB 4P5PA 1AGYA 3A0RB 2GCNA 4IV0A 4OL0A 4X5OA 1WZUA 1JL3A 2GAIA 5EQTA 3EPHA 1FUIA 1Z7YA 3TQSA 1RQXA 1UM9B 1H8ED 4NEQA 1G3RA 4NNJA 3FCXA 4FILA 1UJ4A 5KSOA 1DJQA 3QPUA 3P4UA 3EWAA 4I9UA 4CIYA 1ZN9A 2JCSA 4Z9XA 3MGGA 4RIIA 1OFUA 1WM1A 2HXYA 2P4QA 1EINA 1YBHA 3EOZA 1CZLA 1I6WA 2ZUWA 3DBIA 3R7WA 3SZLA 1RJEA 1HZZA 1K6IA 3NTXA 1A5SB 3DE2X 3GLVA 4KIFA 4RGVA 4YP5A 2FEMA 1CR0A 1KGSA 2QUAA 1BQEA 3C3WA 3SGLA 5KQMA 1N77A 1WD5A 4GX0A 1EFUA 1F8XA 3OSZA 4ENQA 2FZ4A 3H5RA 4XB1A 4XH9B 3EGXA 1KF0A 4QM6A 2R66A 2ZYUX 4IHJB 2BE7A 4E5VA 4M87A 3OEHD 2QE7D 4MI6A 3CT4A 4IXWA 2QD2A 1J0DA 2UVQA 1BKYA 1H65A 1THGA 3JQGB 4R2IA 3D3EA 1QHIA 5GGYA 4HMQA 4DPMA 3TFOA 3PYMA 2BM8A 3DM5A 1NSTA 1XYVA 2PH5A 3ZU2A 1GDDA 3ZWOA 5HZMA 1QV9A 1C9DB 1JUDA 3P52A 5F73A 3AR3A 2JFNA 1D07A 3ZCUA 1Q0TA 5BN5B 3LUDA 3V8VA 1A96A 4Z1MD 1Y5RA 5FI5A 5C8XA 1RYMA 2BF4A 4A0GA 4PYOA 4FN4A 5ITZB 2IZ1A 3S81A 3ISTA 1I4EB 2C77A 4XVRA 1VE5A 4TWRA 2E48A 3LXUX 5CFOA 5LQRA 2REQB 4ND3A 4EPYA 3VNVA 1ZK1A 4O0LA 3RVJA 2W48A 4ZYXA 2BTEA 3AEZA 4NQZA 3MJDA 2R48A 3N28A 1MEEA 3R0JA 1TVKA 5DRYA 3C8UA 3RRXA 1JNYA 4FYPA 1GFWA 4LF6B 2I2BA 2I55A 4FEEA 4FYIA 3L4JA 2QLBA 1OR8A 4IKEA 2WUEA 2ZPUA 5K6RA 2NZUG 4URVR 4M8LA 2C3OA 5ISMA 1ENOA 1KTVA 3C6YA 5JJKA 1P3DA 2AV6A 5AR1A 1VIMA 1E1CB 5BW5A 3FNGA 3NC1C 3TW6A 3NQ41 4QSMA 5TGDA 1GTG1 3H4VA 4L75A 3VKWA 3CF4G 3LC2O 4J9UE 1OPRA 5CNIA 3OJCA 4RD0A 4FYVA 2O0KA 3QZUA 1LBIA 2BT4A 3O75A 4NX2A 2OO3A 4EKEA 4YCNA 3KTAB 3ZK9A 3IUSA 2HT1A 4P4SA 2H59A 2NWQA 4CEHA 2OFFA 2NQTA 2OXCA 3LRTA 1UBRS 3ZUGA 2Z95A 5JC8A 1XZAA 4EA6A 1M2WA 1K4YA 1U6KA 2YZGA 2QAJA 3PWZA 4MPJA 3QNWA 5CYFA 4CM4B 1UP6A 4DBLE 5KJ1A 1WCWA 3IBCA 4QWMA 3ZCVA 3DEIA 4HTAA 4A0HA 5EKXA 3T38A 3S4YA 1JEQA 1SQ5A 3K0AB 1A8IA 2M32A 2G9NA 4Q82A 4TTRA 2I03A 3OX2A 4PFJA 4TLCA 3RS0A 4IDDA 821PA 2XVAA 1EVIA 3LY5A 3P9RA 7AT1A 2VSXA 4R83A 1N57A 5DN9A 2VHXA 2YQZA 1YNOA 1SD2A 5HKAA 3ONDA 1KP2A 1KR5A 4G26A 1GHTA 1JQLB 2XR1A 4RW0A 2Y9PB 1Y9ZA 2VDOB 1S5PA 3R3JA 4FGWA 4A6DA 1D2RA 4NG4A 3JYPA 1E2JA 3R0ZA 5FI3A 1Q0SA 1CV2A 1QGYA 2QG9A 5LR6A 1A7JA 5D5QA 5HPYB 5LL6P 2AIRA 2WLTA 1T0PA 1U9YA 1Z7GA 4KPUB 4ZOLF 2GMWA 3DBLB 3G9XA 3ZW7A 3FAKA 3RABA 1NVDA 5CK4A 1W5AA 4FKZA 3UQZA 4CDGA 1KRWA 3AR7A 2JJ8A 1KJJA 1I2CA 4MLPA 3ILXA 3I8OA 1N0HA 1P7YA 1PNQA 1W9MA 4OJNA 4RO0A 5A03A 2NZYA 1TAQA 3HDTA 3LUAA 1GILA 3IIEA 4QGFA 2ZZNA 5LMUB 1SRQA 1TJNA 3BQMB 1SQ6A 1ORRA 1V96A 1ST2A 3R8XA 1Q1BA 2DBYA 1D3AA 2ZSJA 3KD3A 2ATEA 1CG6A 1A71A 1Q20A 1QK3A 3AX6A 3N8IA 4JB8A 2XKKA 2C9OA 1OLUB 2IEAA 3LFUA 1GDHA 2AX4A 5LP6C 4A8JC 1ZGHA 2AFHB 2JRCA 4LV8B 5D1NA 1GGNA 4OAOA 1YR3A 4U8GA 5AM5A 1Z6YA 4JT9A 1JEEA 1WSWA 2I7CA 2O2CA 3AI3A 1C30B 1RYEA 4WDRA 3OZEA 3PGKA 1IPEA 4UTXA 4AZVA 2BLLA 1SKYE 4EK9A 1XF9A 1YR9A 3MBOA 2VT3A 3BYZA 3OFSA 4L5CA 1J7KA 4CHTA 4G0PA 1SBQA 1MO2A 3OETA 3OOYA 4A8PA 3EIWA 3NWJA 3AB7A 3I9V1 3N8KA 4M1MA 5DEIA 4M1KA 4XGQA 2DQKA 3NVMB 4G4SO 4ENRA 1OFHA 1ORDA 2I5PO 2W6JD 3DCJA 5JYBA 1P6UA 3ZVMA 1X2BA 1P2GA 3D4LA 3Q3VA 4N6NA 4JSRA 4H4EA 1GCOA 3RC1A 2PSEA 2AJ8A 4GXTA 2XQGA 3WWOA 3ZWVA 4D0LB 2ES4A 1K27A 3DV0B 5DGCA 3K35A 4K9NA 4N3CA 1M10A 2GBPA 2ISQA 3OLYA 1EE2A 5EWLB 4EUFA 3GLIA 2HF9A 2AOTB 2G7ZA 4OFZA 4RZXA 1Z0JA 1HOXA 2DE0X 1HORA 4Q15A 2VZLA 1PJQA 1KSGA 5AM3A 3W5IA 1JHPA 1JKJA 3I05A 4LTNA 5ECYA 4K6MA 3ZQUA 3TQOA 3NBAA 4NBKA 2Y1XA 1VSBA 4RESA 2XUHA 1O94C 1RWOA 1TYDE 3L82B 2H7CA 4CEJB 1DHTA 2NAPA 1TU3A 2Z4SA 3GDWA 3PC7A 3TRIA 1Q2XA 2ODEA 5E2IA 5AHKA 3EGEA 4L2IB 5CEEA 1OGJA 3OBBA 3VH3A 3IEMA 4Z4GA 4IIFA 1XVTA 2OP1A 3CBQA 3HG7A 2IYAA 4Y30A 3N86A 2IYQA 2WJ3A 3TLKA 2VUIB 4F2GA 2OHXA 2IGBA 3JD4A 3EW7A 4PRKA 2G9VA 5ILOA 1PLLA 2FRDA 3PJGA 2ZS8A 2A0XA 3ZNPA 3OECA 3EUFA 5GMOA 1K3TA 1JDPA 1D0IA 2PZAA 4MVXA 1H9BA 4RSMA 4ARSA 1H3FA 1BSVA 4MYCA 3VR3D 5BSGA 1VSUA 5JFOA 4XM1A 1QHEA 3AESA 2QZSA 4BVKA 1XRPA 3Q8MA 3AUTA 4ZQGA 2C58A 5K2OA 4C05A 2JIOA 4YXWA 4GKVA 4E33A 3KT0A 4LOKA 4Z4IA 3RS7A 3PTAA 3EYWA 2B1IA 3FCSB 1QZTA 4DC0A 1ZC3A 5F1YA 4RHFA 4MIOA 3EIEA 5DEOA 3UCFA 3WX0A 1IEWA 5HKKA 5F9HA 3C3MA 3RS3A 4EX6A 3S5JA 4XWGA 4BX0A 1NR5A 2IXAA 4UD2A 4ZGWA 2GM3A 2GHRA 3AQIA 1BOOA 1G8MA 3E53A 3T52A 3IUQA 4M7WA 2J33A 2Q6VA 3QX8A 4C6HA 2BMJA 3S2GA 2R97A 4A8TA 2QL7A 1D2CA 1MU0A 2CLCX 1N1EA 3JQ7B 1U8FO 2YJGA 1XDWA 3IX7A 3O8QB 2V6FA 3UMGA 4LC0A 1G5TA 3W5VA 3QUTA 3KUUA 2Q29A 4JI3B 3ZCXA 3TM4A 2QU8A 3O3CA 4H3KB 2W7TA 1JZTA 4IV5A 4M8SA 3PQ7A 4H4DA 4P34A 1JSZA 2Q2WA 4P93A 4C4YA 1GDTA 3ZIAA 1FDVA 3ZWMA 2Q4EA 5CURA 1TLFA 2P69A 4J3JA 4KO4S 3GLFA 2ERYA 5JJIA 4DILA 2DU8A 3MBIA 2CVOA 4YACA 4JKOA 1TOAA 2IZ0A 5AI9A 5BRNA 3I42A 3CVUA 4DZRA 5JATA 5JE8A 4GPZA 3RO7A 1T2FA 4RV9A 3VOSA 1SBTA 1M54A 1XELA 3QNMA 4GEGA 2ID7A 3ZI0A 1LTKA 1IXZA 2ZPTX 1S1CA 4OQQA 4JLNA 3TZEA 1QHHB 3GMSA 3IDAA 1H5UA 4OKNA 2FUNB 3CQ9A 3IDQA 4Q48A 1T6ZA 2FLKA 5IVIA 2BDUA 3EW9A 4CM6A 2YFQA 1XDSA 2IZOA 5I9LA 2FSSA 2QZ4A 4FYYA 4UNSA 1YSCA 4LGVA 5E2BA 2GXAA 2B8TA 3JQQA 4Q18A 4E70A 5JJ5A 2WHPB 3OD5A 1GL6A 2GYWA 3LZCA 1CPYA 1T1RA 2ZTLA 1ZG3A 4QJ3A 1QQ5A 5F35A 1I2BA 3EG9A 4MR7B 3VR1A 1PSZA 3LP8A 1N5RA 3KKZA 1PEKE 4H15A 2CSUA 5DNVA 2TMGA 3IOEA 1DG1G 3OSUA 1G6OA 3CU5A 3OJLA 4ISBA 1M6EX 4PIMA 3H75A 2O1EA 3TNDA 3V7WA 5JYDA 5FV4A 1CRQA 1Y3AA 2P67A 3VU8A 1OZFA 3HN2A 3UV7A 4QDTA 2FX3A 2NSYA 1A8QA 1IL0A 1P75A 3H6KA 4Z51A 4AZ3A 4JYAB 3KJGA 2CUKA 1UKEA 3G7UA 1CSEE 1F14A 2CEKA 2I1LA 3DAGA 3MCAA 5G2OA 3BCHA 5AXDA 2B35A 2FWRA 5F3RA 3DVLA 4MQMA 5EXTA 4B1FA 4AY5A 1Z7WA 2WWIA 3F6PA 4WCFB 3O83A 3SQDA 4URXR 3MGBA 2UUOA 1Z47A 1VL8A 3NTVA 1VI2A 3EFBA 2XCSB 4OBWA 1NWCA 5HTOA 3QUAA 3I83A 1IZ0A 4Q9AA 4R5MA 2B2XA 4WJKB 3NRBA 3KJFA 4UCQA 1R0SA 1ZCAA 5I7AA 1B2LA 4KXUA 1JFFB 4I55A 2IV7A 4U7FA 2AXEA 1MO3A 1XRQA 4DIOA 1UPUA 2XAAA 3PUIA 2BFAA 1UKBA 1MAWA 4EY3A 3ZJYA 4G56A 5HCUA 3KSBC 2OXFA 1KE2A 5KQGA 2NTVA 3SYKA 4BZPA 3GGOA 3CEJA 4PLTA 4WN3A 4WOKA 4BPBA 1IOLA 4UTZA 2C4NA 3KOUA 4ALJA 3E58A 4DIDA 5EE9A 3P0IA 3Q3CA 1WCIA 1LC0A 2DKFA 4ZCIA 1LNSA 4AULA 4TZTA 1JXOA 2XVYA 3HB5X 4UKDA 4FVTA 5ANRB 1FXUA 1UIRA 1UKZA 1U3UA 4R2XA 3RTBA 3LQQA 1TF2A 3DZBA 3NRJA 3O9VA 5DNAA 3VC2A 3X2EA 4Z7OB 1Q16A 3QLVA 1CLUA 2GVNA 4MW4A 5KSZA 4B3RB 3KUXA 3QUQA 2O2HA 4X91A 3TXXA 1FNCA 5CLFA 1D9XA 2EAUA 3CRW1 2VQ6A 3VDRA 4B31A 2HW8A 3IC5A 4L4SA 4MIEA 1ECCA 1BS1A 5ALMA 2GPAA 3G6KA 4HQLA 1TKBA 3QX7A 4YRGA 1F5NA 1U0HC 1USKA 4KO1S 4TL8A 5A4MS 4LRTB 2ORIA 3I32A 2YXPX 2Y1KA 4BNVA 3QSYA 3U61B 2FZEA 3I5XA 3USES 2A9FA 4LXQA 5CFQA 4BECA 3KOZA 4ZAYA 4L5AA 4MGYR 4P80A 2G4VA 1N7JA 3KKLA 5JLJA 4H0CA 3PFCA 5J23A 1FDUA 1UPBA 4G0NA 1PDOA 4GMKA 1E6MA 2DC1A 2ILTA 1EQUA 2WSBA 5IRCD 3RT1A 4PW0A 1Z25A 3JASA 2ETXA 3AYXB 1SXPA 4Y7CA 3LW7A 1POWA 2FMUA 2OXIA 1GNPA 4IHAA 1E64A 2JC3A 3VTFA 1JR3D 2G07A 3K0KA 3QXXA 2PN1A 4FU0A 4HEJA 1Z0UA 3GK3A 2DUNA 3IP8A 1ACMA 1NP3A 5KJEA 4DCTA 4YCSA 2JK0A 2Z8XA 5I9BA 3IBYA 3GRCA 4EHFA 1QU3A 1YS4A 1J1ZA 3Q5EA 1DIHA 2ZSUA 1Z2AA 3H11A 4ND8A 4PGHA 1VJGA 1OXTA 3G85A 1VXOA 2FPUA 3DCIA 4F11A 4WTOA 1TU0A 2ZQYA 1T34A 4U3JB 2XB4A 2GM9A 2EJWA 2X4LA 1R9MA 4CMHA 4R71A 4JLWA 2Y2VA 1YZKA 1HT3A 4G5HA 4LHSA 3WRYA 3F8TA 3O1LA 4EB0A 3O0DA 3H2SA 5JDCC 2C42A 3UCEA 2WA1A 3O8LA 4DJFC 5AK4A 3C6MA 2VT2A 1B8OA 3FYSA 5LA6B 4MUGA 4NCKA 3HXQA 3QLTA 2P9BA 3FFXA 1P5ZB 4ZV4A 1JF8A 3ONVA 2I1WA 4ARVA 5JANA 3QRWA 4YDHB 3LXMA 4TX1A 3WWDA 3BTOA 2J7PA 1TYCA 3WOVA 3FOFC 4KGZA 3QOYA 4MYHA 5AICA 3BRSA 3GIWA 3BCRA 5EJ7A 2PO7A 5KTKA 4D3ZA 1RYBA 1NFRA 1UXHA 3PEUA 1JDBC 4V2IA 4YCMA 3HN6A 2XE8A 4H7JA 2QF7A 3MS4A 4M8KA 4U63A 4CVNA 4ETNA 4WXEA 2ZYWX 1IJKA 5ALGA 2WKPA 3EK2A 4JCCA 2GLTA 1B76A 1SUDA 3L43A 1R8XA 2BCGY 4OHPA 3HVRA 5J4YA 4L16A 1J24A 3JWIA 3COPA 4F4UA 5FUQA 2HB6A 1RNLA 2F9LA 1KBQA 1WQ3A 3N76A 4D1YA 2J0SA 2ZIZA 3BHNA 5G3ZA 5BQOA 2O8BA 1P61B 2BI8A 1UUFA 4ZZ3A 1BFDA 2DTXA 1ML4A 1IQUA 2MINB 1E2UA 3LUHA 3YASA 3PJEA 1WKBA 2ZSHA 2DLCX 1UJ6A 2ZROA 4WOPA 1KIFA 3DFIA 1MIOB 2WD8A 1DUSA 3AM5A 3EXEA 1FS5A 2G82A 4R6XA 1NVTA 4LNUB 3ZZNA 2YYZA 4JKYA 4NENA 2C04A 4JD5A 4OBXA 1IBKB 4YRSA 4OI1A 1XXHE 2JCXA 4OXYA 5L3QA 2FN3A 4EYSA 3LVFO 2O6HA 4KH0A 2H2DA 1VA5A 2Y05A 1YJBA 3FYUA 5CVDA 2EGUA 5B6JA 5ALDA 1ZLXA 3PQ4A 1KEWA 3R6TA 3SWWA 3TGPA 2PUJA 2I54A 1IHPA 3PLRA 4FW8A 3IVMA 3EVEA 3OA0A 3KQYA 1GTRA 3B48A 4RK0A 5H8WA 4Y1FA 2CC2A 3E1KA 4OA5A 4QUDA 1XRLA 1ZS9A 1DC6A 1JHOA 1OZAA 1SWWA 1SZPA 3S8YA 2O8FA 2HHHB 2GDJA 3D3NA 3LOQA 4OEHA 4R68A 2P9TA 2JA2A 3TVYA 1H85A 2I8CA 1ZICA 3KZCA 1W4BA 3MJCA 2FI1A 1X1BA 4PSDA 1TJ4A 4EP1A 5AP9A 4ENUA 2OGWA 3D6AA 3HXMA 3M6XA 4ZCRA 4C0JA 2QT9A 3JYNA 3V3KA 3UT0A 3AL0C 2HU5A 4YO8A 4QA9A 3BEDA 4YB8A 2AC2A 4OG2A 2DAPA 3K4HA 2GWRA 2OWDA 2C5HA 1YCGA 5DJ5A 3BDVA 4D8UA 3DWIA 3LQ2A 3PVSA 1TVEA 4NCJA 5IT5A 5A71A 4QOGA 1YS2X 3ETJA 2ZRDA 5CNKA 2ZUTA 3SLKA 3C41J 3WTCA 4A1OA 5LZ2A 3UJBA 3BGOS 4O4LF 3HXKA 1TMKA 3B6ZA 4PHGA 1Z8FA 1HQCA 3G2LA 4WFKA 4BNWA 4NV1A 3RYIA 4BRWA 1UFVA 1CQXA 1Y48E 2P2NA 3PL1A 4JI6B 5TPWB 1QF6A 4OM7A 1N0UA 1K6JA 1YD7A 5C3MA 4R01A 1X3SA 3MS7A 1OKKD 3CH7A 2Q5JA 3HM9A 2J0QA 2OK7A 2COKA 1NXSA 2ZBFA 3VYWA 4PAQA 3FTCA 1SH7A 3KVYA 3Q85A 5BR8B 5EMKA 2RG7A 3CVWA 4ZJZA 3K20A 2C8LA 1LF0A 1K6XA 1MJGA 2PQ6A 2QRUA 3I01M 4IJKA 4L6AA 4MWEA 3O3MB 5BO5A 3ZV7A 2GPBA 1QZXA 2ATXA 4AP5A 2PEYA 3L4KA 2IHNA 3FFTA 4K05A 2D06A 1A0OA 2Q3JA 4M8IA 3ZJ4A 2C5BA 3QKRB 4I7EA 1RHRA 1KFCB 1WP4A 2HI0A 2RK3A 2WJ6A 5LLTA 1YRLA 3PEFA 4HDMB 2O8VA 3GC6A 3AM4A 4NYIR 4KVFA 4TKUB 3QITA 4H3VA 1M6NA 1T5IA 2Q21A 4FOSA 2MSNA 2W22A 2PLFA 3B20A 3LNTA 3NKFA 4P3PA 3S0JA 3FHTA 3AV0B 3HJGA 2OV2A 1JE0A 5C5CA 4KI7A 2WZBA 5GINE 5U1PA 4HWSA 2V6GA 4OI0A 1AY0A 1HE2A 4HTFB 3OQIB 4D7AA 3ZDDA 5JROA 2O6LA 1V1RA 1PL7A 2WPDA 2ZI9A 4YT4A 4LWQA 1TADA 5IXYA 4I50B 3UICA 5HOQA 4UFPA 1FW8A 3HB1A 4IRUB 4OGKA 3HV0A 1JEYB 2QTHA 3A2KA 5AO9A 5FNVF 1WMAA 2NUBA 4NAHA 1DXHA 2I2WA 3CNOA 3CJQA 1ZWLA 1IULA 3VZDA 2O59A 5E7QA 3MWEA 2Z5FA 2SBTA 5KNCA 4V0QA 4B4OA 5DXFA 3ZV4A 1IN5A 2IF2A 1SHZA 3U2QA 2W6CX 1EM8A 1JQEA 1LX7A 4GZ3A 1PR0A 1XNRB 5H3CA 1F7UA 5CXXA 2C88A 3A1FA 2NUTA 2RK4A 1FJXA 1YT5A 4LKOA 1LSOA 1Z45A 3DQQA 3QVGB 1MVLA 4U0JA 4XAQA 1II8A 2JBWA 5HMMA 2L0XA 3ZS9A 2IPMA 3AC0A 2VXCA 1KDOA 3NIFB 3CCBA 1UEXC 1OWOA 1ZNQO 2X0FA 4YRAA 1Z4KA 2FPIA 3UMBA 1QFJA 1QM5A 3AHIA 1BX1A 1H0KA 4KK4A 4WEOA