1P7VA

Structure of a complex formed between proteinase k and a designed heptapeptide inhibitor pro-ala-pro-phe-ala-ala-ala at atomic resolution
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTDILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a complex formed between Proteinase K and a designed heptapeptide inhibitor Pro-Ala-Pro-Phe-Ala-Ala-Ala at atomic resolution
rcsb
molecule tags Hydrolase
molecule keywords proteinase K
total genus 88
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2003-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1p7vA00
1TM4E 1AU9A 1OYVA 4CFZA 3GT3A 2DP4E 1AVTA 1P7VA 5JMOA 1Y1KE 4AKSA 1GA6A 3SQOA 1C3LA 4OMCA 1Y3FE 3LPDA 1AF4A 4WOCA 2Z56A 4WOBA 1TK2A 3Q40A 5I9SA 1KE1A 3VV2A 1GTG1 3DWEX 1NDQA 1TM3E 1SCDA 3AJ9A 1BE8A 4BWGA 1KE2A 4H6XA 4YN3A 4B5LA 1MPTA 1SIUA 4H6VA 5ARBA 5SICE 1TM5E 1BFKA 1P7WA 3DE1X 3A3NA 4OV6B 3A3OA 3VV3A 1ZVKA 3A3PA 4GI3A 2XRMA 1SPBS 1Y34E 1SUPA 1OT5A 2TECE 2W2OA 2Z57A 1Y3DE 2W2MA 1SBTA 1GA4A 2P4EA 2HPZA 1SUDA 1SCAA 1OYOA 1GTL1 3ZXXA 3F7OA 3F7MA 5CW1A 1SCBA 1THMA 4H6WA 5B1EA 4OMDA 1Y3BE 3DW1X 5K7SA 1EGQA 2Z2YA 3DVQX 3QTLA 2SBTA 5AVKA 1T1IA 1SVNA 1P8JA 1WSDA 1BJRE 3DE4X 1IAVA 3DW3X 3WQBA 3P5BA 5JXIA 1SUAA 1TO1E 3QMPA 4NMXB 3DDZX 1KDZA 3EIFA 1TM7E 2ZWOA 3BX1A 1YJCA 2ID8A 3DVSX 3Q5GA 5FBZA 3VYVA 5JXJA 3I37X 3LPAA 2ZWPA 2Z30A 1WMDA 1CNMA 1WMFA 1PFGA 2DUJA 1Q5PA 2WWTA 2B6NA 2X8JA 1GT91 2Z2ZA 1C9JA 1ZVJA 1Y4DE 1KDYA 3VHQA 4DJ5X 1S2NA 2Z2XA 1DBIA 4JP8A 1AQNA 2ID4A 5B1DA 1WVMA 2SICE 3DE3X 3GCWA 1KDVA 5JXGA 1VSBA 3LPCA 1MEEA 1YJAA 1YU6A 1AH2A 4Z2AA 2X8JB 2ZRQA 4J94A 1SUEA 1EA7A 1PJ8A 1ST2A 1TMGE 3PRKE 3DE7X 3DE2X 3I34X 2G4VA 1UBNA 2IY9A 3WIUA 1AV7A 1PEKE 1A2QA 2IXTA 1SCNE 3BGOS 1T1GA 3AJ8A 3TI7A 3TI9A 3WHIA 5AQEA 4CFYA 4MZDA 1GCIA 4DZTA 5FAXA 2XTJA 1GNVA 1GA1A 1R0RE 3I30X 1IC6A 3HJRA 3I2YX 1R64A 4I0WB 3D9QX 1Y3CE 2W2QA 4KG7A 3UNXA 3VSBA 3QFHA 1SIOA 1NDUA 2PWAA 3AFGA 5JXHA 3D43A 3DYBA 2PYZA 4DWWA 1CSEE 3L1KA 2WUVA 1V6CA 5ARDA 1LW6E 1SELA 1SUBA 3GT4A 4HX2A 4M1ZA 4NE9A 3WIVA 1TECE 3VTAA 4K8RB 3ZXYA 1S02A 1ST3A 1Y9ZA 1SBHA 3GCXA 1C9NA 1BFUA 1T1EA 4LVNA 1NLUA 3DE5X 3EDYA 4KPGA 4ZARA 3F49S 2HD4A 2SNIE 3BPSA 5AMXA 1V5IA 2Z58A 4RYDA 1SIBE 3CO0S 4HVLA 2QTWB 4CG0A 1DUIA 4LVOA 3EE6A 2PRKA 2ST1A 3SICE 4ZOQI 1YJBA 1C9MA 4KB5A 4NE7A 2PKCA 2WUWE 1GNSA 4C3UA 2WV7A 4FONA 2PMWB 2V8BA 2W2NA 1WMEA 5FFNA 1TM1E 1SBCA 4C3VA 3PTLA 1AK9A 1SBNE 3H42B 3LXUX 1Y48E 5AVJA 1GTJ1 1SH7A 2PWBA 3DE0X 3CNQS 2DQKA 1Y4AE 2W2PA 3OSZA 4AKTA 1SCJA 2SECE 2E1PA 5ARCA 3T41A 1TO2E 1PTKA 1S01A 1XF1A 3TECE 1JEAA 1SBIA 1BE6A 1R6VA 2GKOA 2PQ2A 3DE6X 1HT3A 3DVRX 1BH6A 1SUCA 1Y33E 1SN7A
chains in the Genus database with same CATH superfamily
4DYVA 5DSZA 1XDGA 3HC7A 3K4HA 2PKEA 3CINA 2X0FA 1IHOA 3OKPA 1C7QA 4KMSA 3A9TA 1F2TA 1TZBA 2QR2A 1ZICA 2WTBA 3KS9A 4U63A 3WGKA 4NNOA 3GXBA 2C2HA 3GDFA 2EFJA 4HUJA 3IUEA 3EEBA 3PBKA 3L7MA 2VK2A 1KE2A 5DM60 1QV9A 1CIPA 3DMDA 1W85A 2OQVA 4I1OA 4X24A 5JH7B 3QPUA 4LYGA 1BXGB 2P0YA 1ES9A 3FPAA 3R0VA 4FD2A 5EVCA 2O2GA 1EX9A 2CMKA 3P8ZA 3SSMA 1XDSA 1SZCA 3OHMA 1P4AA 5IAEA 5C34B 5CLFA 1RJFA 4URYR 1MHTA 2ZDHA 4WJKB 5BW6B 1I7SB 4FEEA 2IIBA 2Q2NA 3HDHA 1R9GA 1WDTA 5TQJA 1QX3A 3CTMA 5K0ZA 3OJWA 1CIJA 3KJZA 2NT3A 3R4VA 1JA0A 1PJLA 3P4UA 3L18A 4JX8A 5LCXA 1EJ0A 1UKYA 2O2HA 3H5OA 1BJRE 1MRZA 1U8UA 1W5SA 2XRYA 3NXSA 4D9GA 4FX5A 3VKGA 2Y9MB 1UT6A 2JA2A 2NZWA 1S2LA 1O6GA 4G07A 3FVVA 4B3IA 5CLJA 4MWSA 5L9AA 1ZR4A 1YK1A 5HBRA 4M76B 3H1TA 1XDUA 4PQRA 4EECA 4IGEA 4L0CA 4X8MA 4JJIA 4BNKA 1ZL0A 2VP5A 1RE1A 4CLRA 5KREA 5AVVA 1WCXA 2YCLA 1JEJA 3EARA 1I9CA 3PFCA 2VN8A 1JAXA 1NC3A 1YZKA 2DCMA 2JHCA 1PUXA 2G83A 3M9XA 5LZ8A 3TNJA 4AUMA 4XVUA 1YJAA 3OP4A 4M0MA 3VSCA 4ZDKA 1E8NA 1A2OA 1F4LA 5CVTA 2EGHA 3O2SB 3AG6A 2UYHA 2ZXUA 2IXTA 3BGOS 4FMCF 4LNHA 3EFOB 4G85A 3S8MA 3SOZA 3O9ZA 1P7CA 3K53A 3PXUA 3UUGA 5C7LO 2EL9A 3I39X 1EUYA 4KQXA 5IJWA 2CLCX 4PZ9A 1WP4A 2P5YA 1VXRA 2INGX 3B51X 3DDUA 4NZMA 2G0TA 3VR4H 2BKVA 4RESA 3PFHA 1IJKA 3KB1A 3KJIA 2AWOA 1D7OA 1QSGA 1XMJA 2O7QA 3M49A 3QUTA 1WETA 1RE0A 1H8HA 2W90A 3ICVA 2GD6A 3QIVA 3VTAA 4OSEA 4PLPA 3SNHA 2FRXA 4IEEA 1UJ2A 2GBLA 4E5MA 1BVUA 4GUDA 4LNUA 2VT7A 3UA3A 3ZI4A 1BVYF 3AFIA 3TE6A 3UAGA 4I2VA 4O5AA 1GZDA 4BP9A 3JPWA 4LQDA 1UZLA 4Y6SA 3LJKA 4ZK2A 4CVNA 3Q87B 4M55A 2WHPB 1DPFA 4N7MA 4NYIQ 1OI3A 1RPJA 1U31A 1W49A 1K66A 4GPEA 3ILYA 2HRCA 1PW5A 4Y8VA 3HCBA 1ENZA 1EVYA 4YV1A 1FU8A 4B75A 2FVXA 4HEA6 4XVQA 4HAYA 2JLBA 4BNIA 4QOSA 1NJ1A 3H3XA 2D8MA 5TS2A 1SG0A 1W46A 2FRDC 3EG9A 1QQBA 4RAQA 2EF1A 4W5OA 4JLBA 1E9DA 3ROFA 1E3LA 2N47A 3B1YA 4I4CA 2VXYA 2QP3A 3ZLBA 5COAA 1MFPA 3KSBC 2CNNA 3CC8A 5KOJA 4OX9Y 3WQQA 4HDNB 4YP0A 5LR6A 3UCEA 1GEEA 1VCHA 2HWXA 4JQZA 4O59O 2MYUA 3ZVKA 1IXYA 5JDIA 2CUNA 2Q07A 4KSBA 3C1OA 2XHEA 3FBWA 1PTJC 3MCAA 4RXTA 4XDZA 2Z5FA 1Y1LA 2AFIB 2P5TB 4IQ8A 3VSAA 4BVJA 2VH1A 5CX1A 5KQLA 3PUVA 4FK8A 1CS0A 2WG0A 4DMLA 1X92A 1WUYA 2GN6A 3UFBA 3WGTA 2PMFA 5AVZA 3HCPA 1ID1A 3GLRA 1YKGA 1LSUA 4ZYLA 3V8RA 4IIJF 4OSPA 1GN9A 5DNDA 4TS4A 4YLGA 2I3ZA 3KWLA 4AWXA 4QTXA 2DTXA 3BUSA 1TZCA 4DQVA 2PR7A 5FJJA 4OMDA 3LQ1A 3PZBA 3GUVA 3IJ5A 4ZO4A 3EWSA 2YTZA 1P2SA 3SJZA 2X2FA 3ZBUA 4DIDA 5JFTA 4P2BA 1W4ZA 2AYYA 2BMAA 2K7ZA 3OLYA 1IY0A 4ERXA 4CF5A 2IIQA 4L9AA 4QG3A 3JAKA 2Q0SA 3QKSB 1YT5A 5IJ0B 4H4EA 1I3NA 5IKPA 3GFPA 1J6UA 1ECLA 3OPXA 1OUMA 1YR6A 4TV9A 4WNCA 2CB9A 2H65A 3SZ3A 2GI4A 4DC9A 2G17A 2GLUA 5DXFA 1Q20A 2AA3A 4WA7A 1U3WA 1QE5A 1XCJA 3QLUC 4MUGA 3RARA 4KQCA 2PEYA 1JG1A 2JH9A 1MEEA 5EWMA 2Y6UA 4ZHQF 1LY1A 3CUUA 5CFPA 4ZEOA 1W5TA 4JL5A 2VJAA 2D13A 3DXFA 3RVNA 4EHNA 5BMOA 1UBNA 3MIZA 4EUSA 3RS5A 1QHIA 1I4WA 1N2SA 1SURA 4V0LA 4QHTA 3U62A 3AUKA 3G23A 3IIEA 2Y1DA 2HTEA 4QYWA 1OH5A 1OBFO 2IGTA 4J9VA 4R9SA 5EAIA 3KIPA 4QJ4A 1NOIA 5L3ZA 2O5VA 5K2MA 4C6TB 3UJAA 3MB8A 3HWX1 3SKXA 1XDDA 3VTFA 3MLBA 3QXHA 5F12A 2ZI5A 5EHZA 5IZ4A 4OXXA 2OVFA 4HNAB 3UAXA 2QYOA 1JDTA 5GV8A 4C1NA 5BN3B 1QAQA 4E15A 1MC5A 2ZQ5A 1M1ZA 4L78A 4TXLA 2RGRA 3BL8A 4WW0A 4ZARA 3MWLA 1J56A 4BNHA 1W44A 3ENWA 3DKRA 4ZREA 1J5XA 3HFRA 4DXAA 1N3BA 2GZRA 3DT6A 3ADPA 5EPUA 3DTVD 4WK0B 1BGXT 1QV6A 3AILA 4IDOA 4UM9D 4CKZA 5EWJA 4MULA 1OAOA 1K7FB 9LDBA 2PUEA 1QZXA 4HMOA 3W4IA 3SZLA 3EFOA 3RFTA 4DGSA 4ZHQA 5B3AA 2ZJ4A 1NWHA 3ZV7A 5HS4A 1PTKA 1ZNYA 4M8IA 5JNSA 1W7AA 3M6FA 3BIJA 4GQBA 4U2EA 5F9FA 3P0RA 1U1IA 4Y1EA 3UXHA 2IHVA 4Q37A 1ETUA 3OBIA 4NV1A 5I7AA 4ZMBA 5EJGA 2DPGA 4PZ0A 2ET6A 2RIPA 3LZDA 3KSDO 3LPDA 3KQNA 4DPKA 3EEFA 4DV0B 2PD4A 4MW0A 4YUZA 5JVDA 1E64A 2JFGA 5KTMA 4B2PA 3ANNA 4EYEA 4W7SA 2PGJA 1SMKA 2XTMA 4KAAA 4W1QA 3L8EA 3O8NA 2NO4A 3CGGA 1MQ8B 2B4AA 1E9RA 1DI0A 1WEKA 1Z8FA 3ND9A 1I2BA 4HUTA 4MTLA 1L3IA 3A3NA 1L7EA 3S0JA 5AVSA 4L4RA 2CNOA 2YZ7A 4X1YA 4FYHA 2ONZA 4IIJA 3TBKA 2LV8A 1G9SA 3JQRA 1UPAA 1KK2A 5CT8A 5DW3A 4Z51A 1YE5A 3C8MA 5IJ9A 2ZYDA 1TD9A 1E3IA 5EP2A 3Q1KA 3QVVA 2HA5A 4A6EA 3ETEA 1CE8A 3F5FA 1S7GA 1TJNA 4UQLA 2G4CA 4RZSA 3A9CA 5SYMA 4OU5A 5FBVB 4ZVRA 2W2LD 3ILSA 4HSGA 3K0SA 1IXSB 4DLXA 4O4HF 4RYLA 3DOIA 5HTKA 4KFTA 3J81k 2YX1A 5C4IA 2H85A 3DTVA 4JSYA 3T15A 4TTSA 4CM7A 2CT8A 1VLVA 2EIXA 1G16A 1ISGA 3WLEA 4BNFA 5I5EA 2I33A 3L7KA 4HYQA 4TQ9A 4BAZA 1Y4DE 3LPMA 2KI5A 1O6ZA 2QENA 3C8UA 3TB4A 4BFLA 1R0BA 3EB9A 3N2LA 4C0KA 4QJ3A 1N5DA 3D2BA 6PFKA 1Z7YA 2I29A 2RHCA 3K31A 3ZWAA 1LDEA 2MMCA 2PYIA 2NW6A 2YBEA 4PGAA 2ZDGA 1Z26A 1GL9B 4AJ9A 1GKUB 5FOTA 2Q45A 1RAAA 1QIHA 3PJEA 3WGMA 4RNCA 2XVXA 3FPEA 3D3WA 1ORDA 1RI2A 3N74A 2HCRA 4NNPA 3GJSA 4YAUA 3DAYA 4I0WB 1GL7A 2V03A 4X00A 4MIEA 5H0IA 1QB8A 3VNBA 1T6NA 4INZA 2BT4A 5JRDS 3DF7A 1Q0PA 4MHOA 3PPWA 1YRYE 2XHZA 3U3MA 1STOA 5ESXA 3AETB 4MRRA 2UYGA 5EWLB 3QM1A 1ZLXA 3C7CB 3WV4A 1GPMA 1KORA 5FR1A 2DFNA 1GPDG 4C7XA 3PPYA 3ROXA 3NC1C 1Z4QA 2HPHA 1Y3AA 5HDBB 2I8AA 4DCPA 3K70D 3WO0A 5HF5A 2I99A 4D43A 2GDZA 3B1XA 3CZPA 4LOAA 5BORA 1H4VB 5DLQC 1UM8A 2YXPX 4JUFA 1TNDA 5REQA 1UMBB 2H1HA 4DM3A 3E2MA 3P96A 5LUBA 3S28A 4JUCA 3ODPA 5BNFA 3FTFA 3E1GA 4ZEWA 1KI3A 1VFNA 2W4QA 3PTLA 1WXEA 1LRJA 4R3WA 2C7QA 3SQXA 1SVOA 4HUQA 2FRVA 2G36A 5FXMA 2SECE 1Y5IA 3HDGA 4PCLA 4Z4IA 3NWJA 1VKNA 1FDRA 3N3AC 1I2DA 1XVUA 4IMIB 4D82A 4A2PA 2NUPA 3MT7A 2BZ0A 3W34A 1Z4IA 3CLUC 3UMGA 1VBMA 6AT1A 3AYZB 4CI9A 2B2XA 3AU8A 3MTGA 4DA7A 1GA6A 2YZMA 3CNOA 4WOCA 2Z56A 5DYYA 3H11B 4JT4A 3SBOA 2KX7A 4JI6B 2H4WA 2X6TA 1XJ0A 1F38A 2FMXA 2GPAA 2IYLD 4M0DA 3ML1A 4TVKA 5BN3A 2UZ4A 3QXSA 4BWGA 4EARA 5AHXA 1DWQA 3FXAA 3H5WA 1FSFA 1VSTA 3KALA 3L6UA 4R1MA 3G79A 2EP8A 2X76A 1AB5A 2FFJA 3QF7A 4G84A 1QPGA 4JEMA 4JQYA 1T3LA 2TMDA 2ZVPX 2WKQA 4G2NA 1U2DC 2PU7A 2VDOB 2RB4A 3OIDA 4R5HA 3I62A 1ISSA 4AECA 1V1MA 8OHMA 2CYBA 2BGLA 1TA9A 2NGRA 2A1IA 3F97A 4G0QA 4MS4B 3BL5A 4TRJA 4YQEA 4BO6A 2Q2WA 4XWOA 2N1MA 4J43A 4KQMA 4KUGA 2ADOA 3GLVA 4AP6A 5B1EA 1CG6A 3C6XA 3K8OE 3KOYA 4HLUA 2C5FA 1EP2B 3IODA 4R8MA 1IHUA 1ACJA 3H2IA 3I9V6 1NW6A 3P26A 4DXHA 1FNCA 2SBTA 2YNMD 2H1OA 1YTLA 3DE4X 5I6DA 5DH9A 4ARAA 1XMQB 3GIDA 1I1HA 3DQPA 3ZK9A 1TQ4A 3VPSA 1NKVA 3FCAA 3JW8A 2I1LA 4XWGA 3L1UA 1XJWA 1RI1A 4GKBA 5KVQA 1JXOA 4KH0A 3ZHRA 1UMDB 5KDDA 4U8GA 2BFEA 2C3OA 2ZIXA 3C74A 1T6BY 2W70A 2H63A 1UQRA 4FTWA 3RUIA 3BULA 2A0FA 3U80A 1D0VA 3B6EA 1FDOA 1KI8A 1KAOA 1U3CA 2A4MA 4ND8A 4QU8A 4RHYA 4S0XA 1E59A 2EKQA 5CD9A 2CEKA 2EX1A 2R1TA 4I9GA 2FFAA 1AK2A 2OV8A 4IIJB 3VHXA 4MQ5A 1OFUA 2O20A 3CE9A 4J9UE 3SC2B 4D56A 4D9JA 1RM0A 4RF5A 2F62A 5E1MA 4ERNA 3CF2A 4TS1A 3LL4A 3I72A 3A6DA 2EERA 5EOVA 1P0PA 3TZCA 4FGLA 4EO7A 2J1LA 2OOSA 2CFCA 3ZYZA 3VU9B 4BYMA 5BNTA 1JNXX 1P18A 3W1WA 5J58A 4AYWA 3AI3A 3HKEB 3WIOA 4US2R 2WWGA 4TVOA 2X8LA 5FOSA 3KHUA 3T9BA 2JCVA 4ML3A 4BTVA 4DREA 1QF6A 3FZQA 1I4LD 4LDRA 2QL6A 4M36A 3T7JA 1L5WA 3FMFA 1QXSA 2DWUA 3CLUD 5FEMA 4G5SA 1JFFA 4M53A 3VR3A 3NGLA 1XXHE 1CQXA 2Q28A 2QRQA 2WRZA 4UZSA 2O52A 4PICA 3RYTC 3GPCA 4MO2A 4E2WA 4JIGA 4TV8A 2PRKA 4YP9A 1M8GA 4E5KA 4JBHA 1WSAA 3GDHA 1U2QA 2OD2A 5ALRA 4L0MA 1OH6A 3LLSA 1O96B 4HXEB 3CTPA 4UAGA 1IZZA 1PGJA 3I05A 1CDOA 2SCUB 3DULA 1R4MB 3I4LA 3LXUX 4IOKA 3K71B 1DAFA 1G21B 1FTNA 4CV0A 1Y9AA 5BOSA 4JI7B 2ZIVB 3W2HA 3NHAA 4MV7A 4P31A 5EIOA 2I6FA 3DTNA 1VMIA 4UZEA 1UIRA 1PJBA 1ZGBA 2YY6A 4J0FA 5EEGA 3UQYS 1NMSA 2XAUA 4IJQA 4G9BA 4FT2A 4EKDA 3I8SA 5KU1A 4P3XA 4X60A 2O8NA 2XMZA 3FHTA 3ICWA 3AVPA 4M8NE 3I45A 4JYAB 3UBTA 1TZKA 2IUSA 5K4AA 1CVRA 4RY0A 1CKEA 2C03A 2HRQA 2IP2A 4DSOA 3G2OA 5DEIA 8ATCA 4L51A 4X54A 1WZ2A 1BDMA 1UZAA 3UOAB 1QIJA 2OECA 2SKEA 5E2IA 1QCYA 1NGSA 4LJYA 3QEOA 1E32A 1XFDA 4OO3A 1CJMA 3KQWA 5CG2A 3U4QA 1HURA 2XTZA 4P3OA 3AFOA 4G5YA 2IA5A 4AZ3B 2RIRA 5KTRA 4C7OA 3GBPA 3VM6A 4U5XA 5ALPA 4WINA 2V6FA 4HQ6A 4QUHA 2NQTA 1KZ6A 3SSNA 3IOBA 1H94A 221PA 2GPBA 3F0TA 3PJGA 4K9NA 5KI6A 2A67A 2OEPA 3Q0IA 2GCEA 2V9PA 2VF5X 2EYUA 4LSMA 2IPXA 4URHA 3WMEA 1W75A 4D9KA 1H6AA 5ADWA 1ZNQO 2XXAB 4UJ3A 3T7KA 2JIDA 1NR7A 5MGNA 5B7QA 3RSCA 1PL8A 1A9XA 3GRPA 4MLZA 3RLFA 1DRWA 4L9WA 4EITA 4Y2QA 3WAKA 3N2YA 3EW7A 4EFLA 4LY3A 2TMGA 2GNPA 3WVNA 5A5EA 3IR7A 1I6LA 1WLSA 3FDIA 3I37X 5G3YA 1LX7A 2QTAA 4RF2A 4J29A 4JGBA 5DNCA 3UJ9A 2PLRA 5C18A 3SNKA 1PK8A 3O4GA 3DBRA 3T61A 4DM4A 1KEUA 2EG9A 2I71A 3QLVC 4ER3A 5HTOA 2F8MA 4UBIA 1RXVA 2YVAA 3NOOA 4EJSA 2CZQA 1J0AA 2PSDA 4ARCA 3G2KA 5AICA 3ITEA 1GPUA 2WM3A 5LDGA 1K8XB 3OZXA 3UTDA 1JUDA 2FMUA 2LD4A 3NWOA 1T9HA 5L3SA 4GSLA 2XCSB 1X9IA 3RFFA 1X1DA 1TQHA 1DEKA 4Z4EA 1Y0BA 2IOQA 4G4IA 2AYXA 5G1OA 4BNUA 1QGAA 5KYWA 3HTXA 1W0JA 5DBHX 2ZFUA 3KR9A 1UBFA 2W6ID 2V59A 4PZPA 3AFGA 5L4NA 1EWTA 2D1SA 3ZCUA 1PWHA 1JHQA 1SR8A 1UDXA 1V35A 3F67A 3RUHA 1HDYA 1Q84A 2NAFA 3IBSA 4IAOA 3VU3A 2XOKA 1JBEA 3SYTA 4AB1A 1REQA 3N2ZB 4ZQCB 4BQFA 1IVNA 1PQYA 3PHCA 4J1QA 2X0DA 2QD4A 4UTRA 5MHTA 1YHZA 3A6JA 4WQMA 2D1QA 2ODEA 3PCXA 4C03A 1N5KA 3I04A 2JS7A 4GM1A 4V0NA 1JJIA 2H06A 2OD7A 3D3NA 4PLFA 2FYTA 4RFVA 1HI9A 1QLJA 2A0XA 4EBBA 3OZ7A 5K3OA 1LC0A 2DAPA 3R9XB 3GJ6A 4Z8XA 3LCCA 3RT9A 1I01A 3WZLA 4DCNA 1GZ5A 3IMEA 2TYSB 1L4NA 1PZNA 3R7WA 4H59A 3U39A 4ZCIA 3TRIA 2R4TA 4N49A 4RY9A 1N6LA 4B4UA 4PHHA 3WL3A 2W6JA 1Q1GA 2BSXA 4KO4S 4LMBA 2HYIC 1VECA 1FX1A 4PG8A 1O97C 1NJSA 4M1QA 1HEUA 2J3HA 2YYAA 2WM2A 2O3SA 1HT3A 1QTIA 4JVMA 4BIMA 2QW8A 3A7DA 4PINA 5IN5A 2OCPA 1UQUA 2YVQA 3RTEA 1POWA 5A04A 5EP4A 3BJIC 1MJHA 1QE3A 3HN7A 3QPAA 3UTCA 2K87A 4G5OA 3FROA 3LXMA 3AVYA 1B6TA 1BD4A 1G3MA 1NR1A 3R9IA 1C1YA 4OB6A 7GPBA 3WKAA 4KDEA 3IJRA 4TRRA 1HDZA 1UBEA 4TSFD 2MR6A 2E4AA 1W8DA 4MVYA 1JFFB 3U4CA 1P4SA 4N5DA 4EY6A 1I7DA 4Z49A 4U2GA 5ALQA 5M34A 2CVOA 1J8QA 3LWNA 4C30A 3VXKA 2VQSA 1XZQA 1GKLA 5KQRA 1SQFA 2ODBA 5TE9A 2HWUA 2PX2A 1SRQA 2R6DA 4KN5A 3TGWA 4DBVO 5A7FA 2DRIA 2QF7A 3ETJA 2LPMA 4TRMA 3W9UA 1T10A 1S2GA 2M1ZA 1GA4A 2HPZA 2P9EA 2P41A 3ZU4A 1DADA 4YP5A 3ZGXA 2DQYA 2W48A 4C1BA 1PHPA 3AEQB 5DTIA 1JFTA 4J0CA 5AM5A 3T5GA 2AUNA 1E2BA 1W5BA 1U1EA 1JKJA 1YZHA 2QB5A 3MBKA 4B8WA 3FOWA 1AA6A 5C8YA 2JJ2A 2C3UA 4WFKA 4XFKA 5GONB 5IJXA 1QGYA 2BDTA 4RY8A 2IPAB 4FBLA 4URZR 4D8VA 3HP7A 4FZJA 1P73A 3ICCA 4MUJA 3WGOA 3WLIA 2YWXA 1U02A 1XZJA 2JC3A 4MX8A 1X1CA 2F55A 2R6ZA 3KLOA 4Q6BA 1JHVA 1B1CA 1BMQA 4L1KA 1G8SA 3FKQA 4LHWA 2FUG1 1CERA 4QRIA 5DX1A 1CIVA 1ABEA 1RKXA 2VJNA 3BMNB 4G97A 3ZY6A 1JQ5A 4EJ6A 1F1BA 4Z3OA 4JUBA 4EMTA 2NSJA 2AJTA 5F5XA 3FDZB 5LQCA 1A9SA 4FNGA 1FYFA 1NXWA 4C5BA 1E7WA 2BHRA 1G7RA 3F46A 4YECA 3SKVA 2XNKA 1IDN1 1K8YB 5BMVA 1PYOA 4C6TA 2UUCB 1PLLA 2XDWA 3C16C 4EP1A 4XWYA 2FQ1A 5ITVA 5GOZA 4PR0A 4R3NA 3GU3A 1J24A 4GWKA 4R54A 4BGDA 3LQ4A 4Q4JA 1I0LA 1MKYA 2PWAA 3BF8A 3HACA 2VBCA 3KE9A 3L8FA 2Q1WA 3UQZA 4CM4B 1NJ5A 4OTZA 2GK7A 1QHSA 4L5YA 3F8SA 4MV3A 2FSHA 5D86A 4E4TA 2WFZA 3NLLA 2ZI6A 4ZOEA 2F2TA 2FN3A 3UG7A 3PPXA 2V3CC 4X92A 3MC1A 3OLVA 5DNEA 5AW6A 5DCWA 2V5VA 3IB6A 1M75A 3DVAA 3OPYI 1V43A 3PEEA 4YAJA 1W96A 2IU4A 3GUCA 4A10A 4ADSG 4BBPA 2WZCA 4C06A 1SCKA 1Z13A 3DPSA 4NMWA 3PE3A 1QHGA 4HMPA 2PFKA 1IAQA 1OAOC 3OCCA 4YB8A 2HEIA 5FFNA 4BVFA 2VRBA 2VWHA 4OY3A 3R41A 3H1FA 5AUOB 1N7GA 1W25A 3K92A 5BRNA 4HC4A 4EG6A 1APBA 1ADJA 5DHPA 2AXEA 1ZRHA 2JIBA 4BN5A 3B1FA 3EIOA 1KFCB 1YRHA 3JZMA 5ECWA 6NULA 1XYYA 5JARA 3E8SA 5TRTA 1CZOA 3UENA 2OHFA 2XQIA 1HLDA 2CDBA 3WLHA 1P1RA 1W1UA 3DC7A 3IIJA 4YCBA 3SQOA 4F8YA 5ADUS 5ICEA 4IZ6A 3VDRA 2QL9A 2UVDA 2QTNA 1UFQA 1CB0A 1EDEA 3HMQA 4OHPA 3C8HA 4YY3B 1G98A 1Z3CA 1JTEA 4DS3A 3LMKA 2X23A 4X1YB 4WECA 3QFTA 2AXNA 2VPYA 2PG3A 1NVTA 3O2NA 1EBFA 1V95A 1VOTA 3ORSA 4TWAA 3UJPA 1US8A 2XMQA 4BFTA 3A6HA 2HSGA 3R20A 2YV3A 1OFVA 3OQ1A 1AKMA 4I5IA 3BXOA 2D54A 1HZJA 1N75A 1Y3DE 2XB8A 4YS6A 3A11A 3L9WA 1XRRA 1ARZA 2VNIA 4MUAA 1HF3A 4QAJA 1K98A 5KVCA 5JWRA 1DMSA 3ND8A 3ODGA 2V55B 1SQSA 5AJVB 1FSGA 5A5GA 4Z4CA 4UUNA 3ZXUB 3CX7A 3MJRA 4XW2A 4DPMA 3KO8A 2QGFA 3H13A 1NW4A 2EZUA 3PL1A 1WUIS 4UNRA 3OY2A 3P2KA 3BILA 3WP0A 1FEZA 1Y7HA 3OEWA 1BNCA 2R8ZA 4BFZA 4BVKA 3W7VA 1U0OC 3GGJA 3S1SA 1KYXA 5LB4A 1S0UA 5E4FA 3QX3A 1WAMA 2QUIA 2D5AA 3MWYW 2PMBA 4GXQA 4Q3EA 3A6GA 3HP1A 3KXLA 3SPXA 2UZ3A 3UMBA 2ZUEA 1BS9A 3HSSA 5JY1A 4J6EA 4G6ZA 1Q5PA 2H4HA 3TTVA 1ENPA 3ESAA 2RK3A 2ZJYA 3KT3A 2B21A 3PUIA 5B2ZA 4YO7A 4U9HS 4BC1A 1OXBB 1OWLA 2UYOA 2XUQA 1YCDA 1JGTA 1I14A 5I51A 2QRZA 2JL1A 3ABOB 3P32A 3TRFA 3ESZA 3LQYA 1N2XA 2AR0A 3OIGA 2FW0A 3EY9A 3QY0A 1IQUA 4J1SA 4AQDA 3SF8B 1UPTA 3H4TA 4DJEC 1TYZA 1JN0A 1ZSNA 3EXAA 1YR1A 5T57A 5HXAA 5KB3A 3DEZA 4HAOA 2X4GA 3H9EO 5TQ2A 2ZS7A 1UEXC 5CNKA 1N1MA 1PD1A 5DVZA 3HCRA 4JNCA 3C87A 2I67A 1CY2A 1OAKA 4X1OA 1SD1A 4W5NA 3A2LA 4LNUB 3UKDA 2PY6A 1Q0QA 1U0EA 2G04A 3VC3A 1MAWA 2DUUA 2OZLA 2BDUA 4Q66C 5IBQA 4OL0A 1ABBA 1E2NA 1HXHA 2BDEA 4IIFA 3K9HA 3UXEA 1HEYA 1JB9A 2GZHA 5JYCA 1JG3A 3ISTA 4HD8A 5I7OA 5LSAA 5BW8A 3DNFA 1WRBA 1VLJA 1BFDA 1UC8A 1S8OA 1XWWA 4DUGD 2B99A 2X9NA 4C05A 3WGQA 1G4AE 1XQ9A 3M2PA 1JSRA 3PUKA 3H4IA 4NU8X 3NCHA 2ZYTX 1EJBA 2BHLA 3OQNA 4YUWA 2R8OA 1M34A 2LE0A 1P5RA 1OFUX 1QCCA 1WXFA 2VEDA 2ZE7A 1I4EB 3G9QA 3MVEA 4L2IA 4X8LA 2E6KA 3L3BA 2HMVA 5E4JA 3PJDA 1OLXB 1KO1A 3NHBA 3PGVA 1YS1X 4UTZA 2V4MA 5H1YA 1XA3A 1JLHA 1IN5A 4NK4A 1QGDA 2BEJA 3LNCA 2ZW9A 1RQ2A 4K28A 3K70C 4ZV9A 3DL7A 4DMKA 1L7RA 4FMPA 4COOA 3ESRA 4S2UA 1JI0A 2GN2A 2O2DA 1W2WB 3RSZA 2A57A 3GZNB 1UEJA 3LT2A 4M1OA 3UWKA 1GTVA 2PZBA 2VYNA 3JWPA 3W5BA 2P5SA 4PFJA 3NRBA 2WAAA 4Y2SA 1CP2A 1Y3FE 5CIWA 2PL9A 3BSYA 1NR5A 2YNMC 3QKIA 2EJCA 1CF2O 1R9NA 4O4HA 1DAGA 2G6TA 4EKYA 1K08A 1BW9A 3MS2A 5KHOC 2I7XA 2YJ4A 5BSKA 4L85A 3GJQA 4XIGS 3ZC3A 4M0CA 1D2CA 5J2UF 4B5LA 2I2XB 2O2SA 1HRKA 1KJ9A 2C3YA 2BGIA 2ZRIA 3DC2A 1P39A 1OFIA 4HQNA 2XKJE 3T0IA 3ZHOA 2GERA 3A9RA 3H99A 3I09A 4TPKA 5ES3A 3KWMA 5EHNA 4Y1RA 2A9PA 1HZZA 1NPDA 3EWNA 5FPYA 2F59A 1T3HA 4IIYA 4JJAA 5AKZA 1JDUA 1SVUA 2O0HA 3AEUA 1OYOA 4OQQA 4DLBA 1E2JA 4JEUA 1SU7A 5ADHA 1EVIA 3C24A 3U48A 1QOZA 3DKIA 3OFSA 4EYKA 1TUEA 4J0EA 2HIMA 3OTHA 1EFHA 3BWDD 3COZA 3GRFA 3IBFA 5CA0F 1PV2A 4KRGA 2GETA 3VKVA 2QAJA 4NG4A 4PVCA 2GPTA 2WD7A 4X8HA 4YMGA 1H23A 3RVRA 3PD1A 2Z83A 3QFRA 2GARA 2ONJA 3SJ7A 2BUCA 1KH3A 3AEKB 4M0LA 1SD2A 5AFSA 5HKLA 1MJFA 1SU4A 5TPZA 2Z2ZA 3BGSA 4HDAA 4JBGA 4Z7OB 2H8KA 1KVUA 2DQZA 1M1YB 2D3TA 4XD7D 3D6TB 2VDPB 1ZBQA 2HQRA 4JYMA 3SS9X 1AQNA 3CCBA 2AEMA 4LF7B 3W6NA 3KR2A 4O3FA 3PXEA 2VEOA 4L73A 4NF2A 1GU1A 1LBQA 4PX5A 1ZCBA 1A9ZA 3TO5A 1GNLA 4E30A 2CBGA 2B4RO 3AC0A 1FYVA 5GVRA 1M83A 1N6OA 2G9QA 4PBTA 3BM5A 5EJAA 3UJ3X 4YNBA 3WICA 3Q15C 5IBPA 5IBCA 1YNOA 3VU9A 1G4HA 1MXHA 1R0RE 1WQ3A 4QBTA 2E3JA 2G88A 3T12A 3D6FA 3FUVA 1RCTE 4FJ0A 4JI2B 3K9BA 5EJIA 2H6EA 2NYAA 4ZVTA 5TQ0A 1K7YA 1XQXA 1G5FA 1RZUA 3BMXA 3IPXA 1SOMA 1N33B 1JAIA 2Y2UA 1NVVQ 1GFIA 4CMKA 1FRZA 4EA8A 2QMYA 4UTOA 2VHWA 2FPLA 3MWFA 3HFJA 3NFRA 1W30A 5KQMA 4K8RB 1K0UA 4PSAA 1Y9ZA 2OGZA 3HCAA 1EG2A 1CWUA 3HPQA 3MZ0A 5IF3A 3B6JA 1IJEA 1Q1EA 1KK0A 2BFOA 3UJ7A 3GD7A 4P7FA 2PZGA 5K4GA 2LDXA 1RLOA 2OC9A 3TJZA 4HBZA 2O7RA 2AHRA 2JJ8A 3UAZA 4EDHA 4EJSB 2E89A 3UV6A 5A62A 2NU6A 4V3BA 3I0MA 4QTUB 4YJKA 3VI4B 1NVGA 3LW7A 4HI0E 4RLFA 3HBMA 7AT1A 4FFPA 2QMEA 2Z04A 3H2ZA 2RHRA 2AX3A 4CQJA 3O95A 4YT2A 1TPZA 2OD9A 3NHWA 3DVRX 3I58A 2XUKA 2AE1A 1GUDA 3G89A 3A3OA 4P6VF 5E7IA 3ZDAA 2W8BA 2GILA 3BEDA 3ZS8A 3C6YA 4IDNA 3GT3A 1EWKA 3KLBA 2GJKA 2ORED 4JLKA 1Y8QA 3BH6A 3TQTA 1D6SA 1U0RA 3GMDA 2HU8A 2CFIA 3QVGB 4PVDA 5KNCD 2XB2A 1RJDA 3BTUA 2J0VA 2ZRFA 2G08A 2NM0A 4XGRA 2LP4Y 3ABSB 1UIMA 4XOUA 5TMBA 2ZBRA 3RS7A 6LDHA 3ANTA 5HRUA 4KXLA 4PC2A 2WG1A 5A3RA 1RFLA 1YBFA 3WX0A 2RSLA 4EPWA 4MXDA 1VG1A 1W1IA 1MRSA 2IQIA 4JB8A 2WFAA 3R7WB 3RSLA 2C7PA 3ZE9A 1YZGA 4N6OA 4I36A 4RPJA 2PT6A 4H3HB 1AMOA 2Q4RA 3DHYA 3R4CA 4WLUA 5K20A 2O23A 2YXEA 1II9A 3CG4A 4BMXA 5TIIA 3H9JA 1VDMA 3LKBA 3ESBA 1N2HA 1R0SA 1WX1A 3OLQA 2JNWA 4ENSA 4H1WA 2XUAA 1UPBA 3ZEIA 4B17A 3T3OA 1I24A 1RC1A 2B36A 2A5GA 1UBJS 2G5PA 3ASUA 2H7XA 1QO0A 3FGPA 4FB4A 3KHTA 1O8BA 4GKAA 2BRUA 4QUKA 3NBKA 3BE5A 4AX4A 2HBRA 5HZHA 3KTAA 1T25A 2X0RA 3RS2A 4WBNF 2DE0X 1J42A 1JFVA 3AVQA 3M8KA 3L7CA 3R7LA 1JR3D 4YAEA 2D0IA 2W6ZA 4YUVA 1CR4A 1WCIB 3SFZA 4POOA 4GS5A 5K6AA 3IE1A 4EW1A 3HK2A 2QL7A 1D1SA 1DINA 1FCJA 1PN3A 4LE0A 1IM2A 3LLCA 3WADA 5JATA 1B8NA 3N0WA 1T0IA 4LOLA 5H81A 2OGWA 4A26A 2YFQA 1E99A 1W5FA 2ZAYA 3E5HA 5LYJA 4G0NA 3RS3A 4G8BA 3WBFA 3P1JA 4Z3KA 2ACVA 1K8RA 2J09A 5EUCA 5K8JB 1SQ0A 3CVXA 2QSUA 3EUWA 2UDPA 4UAUA 1LZLA 5K09A 1M2VA 2PLWA 2XCLA 1N9KA 2ZUBA 3O9VA 4AF8A 4ALNA 3I61A 2ZJ6A 2B34A 1NFQA 1RABA 3WKDA 5LP6C 2PUVA 3NU1A 2C5EA 3A27A 1BWPA 1WB4A 2OK8A 4JN6B 2CHVA 3HH8A 4CF3A 2HN9A 2HLNA 3JV7A 1QONA 4I5GA 2HLHA 1Q57A 2GCPA 3WS7A 5ITWA 4LPSA 4YLYA 1ID8A 5EJEA 3W5UA 5B5SA 2VJMA 5JJLA 1CFZA 1J22A 2PXHA 1S6YA 3DOEA 4C7KA 3BD8A 2H9AA 3DSRA 4F4DA 4GM0A 3OJCA 4KVZA 4EF5A 1QR6A 3S44A 4D6PA 4F11A 2JD2A 1ZI6A 3KB6A 4YRBA 2GAAA 3AZPA 1IOWA 4F2WA 2H1FA 1TKRA 2BEUA 5HFJA 1X0VA 3HB9A 1KFKB 5HJ7A 2JI7A 4QOEA 4KL8S 2ZVDA 1VTKA 3EG5A 1MZPA 1HRDA 5FLYA 4NNJA 4OAPA 3GRAA 1GZ6A 3PITA 3NASA 4YDRA 2JATA 2Q6TA 3LC0A 4EJ2A 2W83A 3R9KA 5BMVB 4KI0A 2YIMA 3EC1A 1P6XA 5CDFE 1BGVA 1K1EA 3DLAA 5FO1A 4TROA 5EIHA 5D2CA 3OLCX 2ECQA 2GM5A 2PZLA 3IJPA 3S4YA 1YZTA 1E6MA 3K1AB 1RHQA 3KVOA 3I5XA 3HUUA 4K9OA 4NICA 4C43A 5EJ6A 4OKIA 3JQ6A 4QHSA 2Y4OA 3MTDA 2CFRA 3V1TC 2Q3DA 4JXJA 3SVTA 1MFZA 3ISVA 4BC0A 2F9FA 2C31A 4HLUC 1Z0UA 4OLBA 3L0IB 5FIUA 2JJYA 3GRKA 1EB8A 3D6HA 1RQGA 1ORIA 4D8YA 5IS2A 1EFVA 4ZZ2A 3AXTA 4HVTA 5CDTA 2ZBQA 1VXOA 3G2QA 2HGSA 2XMRA 4Y2XA 2Z0MA 1YJXA 4MQEA 3A14A 1EK0A 4TV9F 4MIOA 4FQ5A 1SK9A 4N01A 2CCJA 3JAWB 2PKWA 1P2GA 2HYDA 1DCTA 4N76A 3GA7A 3A4NA 4WDQA 1W36B 2JFVA 1MX5A 2NADA 1P0IA 3ZQKA 1J49A 2AK2A 1OX4B 1G59A 2CCKA 1RJEA 4LJ8A 4TSKA 3W5IA 3AEZA 1TQ2A 1WZIA 5DNAA 5DV9A 5DSTA 2CD9A 2WPDD 4P35A 3OTIA 5HUJA 1M2GA 1F0PA 4IJ5A 1M2WA 2W8BB 4DDMA 4F5ZA 1COWD 3EGVA 2J08A 3AU9A 4KO1S 4DLYA 4S1WA 2WHYA 5B1HA 4YQFA 2V7BA 3RUEA 1XTPA 4FGUA 4DIEA 3D6NB 4JKIA 1CUCA 1VIMA 3BMNA 2GN1A 4DCOA 3TDNA 1THZA 2P6NA 1JG6A 5IAGA 4QA9A 4ENVA 1M74A 3JQEA 1C9JA 3H84A 3LHIA 1VA5A 2RAUA 3AR6A 1GSAA 5G4KA 3NYIA 4RX1A 4P9NA 3S7TA 5HPYB 4OMFG 3EUFA 2FW8A 5DDIP 3HABA 2DHRA 2CNDA 2CVFA 1TE2A 1JVBA 4M9RA 1U0GA 1OZGA 3GB9A 2A94A 1Z17A 4XE5A 2IHTA 1F8GA 4DMUB 4UAVA 1L6RA 2WF8A 1VKJA 2IXAA 4IDQA 4LYFA 1YI8A 2ES4A 3EDOA 3IDFA 4E6EA 3NP7A 1TAUA 4GNKA 1G21E 2JGNA 4M7PA 4RV5A 3OKFA 2UUOA 3FOBA 4CG3A 4ZDJA 4IGAA 4NBUA 3GGGA 4N6NA 2WJGA 3DZFA 4CQMD 4ZPJA 5GJCA 2XUZA 3I8OA 1ZCFA 3EDMA 1ADYA 4GUAA 2BV3A 4NP6A 4PGMA 1CHDA 3U7JA 1FXWA 2Q5EA 1GPNA 2NXWA 1T3GA 2FMFA 3AR2A 3V8MA 1ZMTA 4AJ4A 3N8KA 1B3RA 1L1QA 2OUKA 3GLGE 2C5AA 1G6KA 4INOA 4G23A 1JSLA 3IEIA 4OATA 5DRYA 2C59A 4IOMA 4N5IX 2O8BA 3D3QA 2JIZA 2PAAA 1H0RA 1VA4A 4QT0A 1FFYA 1ZH8A 1Q21A 3M5CA 4WKGA 3OC0A 1NBHA 3L7NA 4DHEA 2HQBA 5FL3A 4OHFA 4C78A 2EKZA 1LBTA 1NASA 4IJ6A 4C3UA 4JC8A 4QL3A 1L8LA 2O2ZA 3A70A 4BXOB 1JHZA 2XNCA 2XVZA 3N28A 2OZPA 3WB9A 4D9BA 1E2HA 3K5PA 1N2CB 3QEBZ 1MT0A 3IP9A 2Z2IA 5EIWA 4I1IA 1NN5A 3FPCA 2VAXA 2Q5JA 3CZRA 1W29A 3V4LA 4DCGA 4DIFA 4E94A 1BMTA 4GWGA 5FWNA 1XYVA 1DQPA 3CIFA 1YCGA 4MCIA 5BVGB 1JAHA 3BCHA 1TEXA 1Q0LA 3DO6A 1E7QA 1KE1A 2IT1A 1DQRA 3IXMA 3UWOA 4CM1A 4LF6B 1K9SA 4FOLA 1DOZA 4IXTA 5AW4A 1A69A 2JI8A 2LRHA 4M21A 1M1YE 1TD1A 4JVSB 3QSGA 1QBKC 4ER0A 1COZA 1XVIA 3CRRA 3GLKA 1OU0A 4FNAA 1JQBA 3RYHA 5THXA 1B0PA 1UK7A 2OORC 3R3ZA 4CEHA 3VUEA 3TX6A 3H9BA 3ORHA 1NVAA 1CD5A 1QO0D 4LVCA 3KL2A 2IJGX 2YR0A 5KKAA 1SCAA 3CUEF 3GJ0A 3QBTA 2HSEA 4G5FA 3C3KA 2XF2A 3I53A 4OJQA 4EL5A 4B79A 3IT2A 2G25A 3SSOA 2BLNA 4GMHA 1VGVA 3QJGA 4B3HA 4DDKA 1WLYA 2RGBA 3GZNA 5IF9A 2GYVA 2BMVA 2C2YA 2A9JA 4FUQA 3BWVA 3ZDCA 1N77A 3BE8A 3W1VA 1NI3A 4MRAA 2XZTA 4JWKA 1WD7A 2VUUA 4OUKX 4ESEA 3TSYA 1J9ZA 1C1XB 1NBMA 3ETHA 1GPKA 1LPBB 3L0BA 2PX8A 1LB1B 5THQA 4KXYA 4D9CA 2JBWA 3GVCA 2CF6A 2X8JA 3DFZA 2P2DA 3QE0A 4PU0A 2QTGA 4RVUA 5IT5A 3G85A 1P80A 1R0WA 2Q5OA 3MLEA 2AOUA 2E4UA 4TTTS 1G3UA 1CDDA 3HLKA 3DZBA 4MV1A 3VRHA 9ATCA 3AI2A 2E5LB 4ZU1X 1SBQA 3RTAA 4HQ0A 4JA0A 4BO0A 2RE8A 1G41A 4J91A 4D42A 2XCRB 3U60B 4MDEA 2W6CX 5CB4B 3EPJA 1YIAA 2A1UA 2OWEA 3AUYA 1K5HA 1ZNXA 1P1HA 2WVGA 4KXQA 2QW1A 2TMKA 5CT5A 1WVGA 1OX4A 4HRXA 5DWVA 3BTOA 4CKEB 1R6AA 1E1RA 3CU5A 3E9QA 3WK9A 4ZAGA 4OXNA 2R1ZA 4D98A 2XD9A 4F96A 3UJNA 2DM6A 4G4JA 3NBQA 4IKEA 1PUIA 1Z47A 1P8AA 3AHDA 3L1VA 1GN8A 2ZRNA 3IA2A 2CBXA 3UWPA 2GBPA 1MVLA 2O06A 4IR7A 1G2QA 4NDNE 1L5KA 5HCUA 3MUNA 1ONPA 2Q27A 1JLLA 3CMCO 3NHZA 3KZVA 4M9QA 4D41A 1A7AA 1G0OA 2OXCA 2WJVA 5F64A 2LCQA 3NAZA 2NQ8A 4IFBA 5M2QA 3LUHA 1TEZA 5AVYA 2BFNA 4G3XA 4HVAA 1AKQA 3ROQA 4BFWA 4N9WA 2HRRA 5BW5A 3I04M 3QVWA 4UU0A 4RD4A 3WBBA 3JWGA 4WVLA 2ZTMA 3DNMA 4UD6A 3ITDA 2YASA 4MI9A 1VPWA 4DCSA 1XQ6A 2RGCA 3MTQA 1JLRA 3Q2KA 4RKRA 3WGIA 3X1JA 3MEQA 4HWKA 3N53A 4DBLE 3LY7A 3U4DA 1J8YF 3Q9SA 1YGYA 3RLIA 2HH9A 2IZ1A 1VB3A 4GT1A 3X2EA 5AOCA 5GGXA 1FY2A 1GPLA 1UR5A 1ZUNA 4PLWA 1HQKA 1Z88A 4X7BA 1YL7A 1B43A 2GF9A 2IYXA 1DG9A 1RZVA 1RXWA 5JMOA 3O4VA 4DLTA 4ENUA 1PWXA 2VJBA 5CGQB 1YQ9A 3ONEA 5CVVA 4MW6A 3AFHA 1H4QA 4MDHA 2C0QA 1GGMA 2YXLA 3H2YA 4RVOA 1GP2A 1R8QA 1N2EA 2X41A 3FYSA 2XA1A 1TVKB 2G7MC 3I5YA 2C4VA 3A58B 2E4ZA 5C8XA 5A3QA 4K9DA 2O8EB 1V1RB 3HUDA 1GADO 1P4JA 3PENA 1SWWA 2B94A 2YRWA 3RVMA 1I32A 3ZLJA 1YK0A 3IH5A 1JX6A 1E2KA 1BU8A 3ZR4B 3C7DB 2YWJA 1RAFA 3R5SA 3RANA 5HF8A 3KEOA 1M6HA 4KO3S 4MUEA 5HZKA 5K1ZA 1Z83A 2X2EA 3TEFA 4BLSA 3D0KA 2CD7A 2RDMA 4HOYA 3EVBA 2WD9A 1U2GA 4FYJA 1H3FA 3QUBA 5KWVA 3IESA 4FE4A 1Y9EA 2BR4A 2NZJA 2P27A 4BDSA 5H4GA 2VSFA 1JQEA 2ID8A 3D59A 3JSXA 4MPRA 3ZU6A 5CVDA 1H9CA 2VPPA 2ZU6A 3MWEA 2MINB 4WN9A 1PT7A 4QJ5A 4D97A 3VHQA 3LBNA 3VR5H 5HOEA 3OPYA 4KLCA 3ERCA 3K0HA 3KAJA 5CEEA 4IF4A 2AE2A 4M9XA 3NTXA 4N18A 5A71A 3AHEA 2G67A 1JQJC 1YH3A 1KJQA 4FS8A 3HDQA 3QVSA 2BM0A 1FFGA 3KPVA 2YWHA 2VJPA 3BSFA 1RAIA 5EPEA 4DG8A 4UTPA 2VHCA 4BNGA 3KOXA 4C0LA 1PEKE 3KOUA 1SCNE 1U7TA 4D57A 5JZBA 5MN6A 5C51B 4AKHA 1M0WA 1XEWY 3NG1A 1QG2A 1ZCAA 2YWGA 4F5WA 1NQ5A 3N8DA 5K3DA 4AS3A 4WNYA 4GEKA 2I8CA 3BFKA 4KQIA 2D4AA 5T4FA 3OMLA 4MWZA 2V9CA 3H9UA 4O2RA 4R1QA 5EHGA 9ABPA 5LP6A 3WYAA 3SZRA 1U1CA 2ONKA 5BUCA 2X86A 2G77B 4RTLA 4R7TA 3OOEA 2YS6A 1FW6A 1KZ1A 1NJ8A 1MH1A 4Q4DA 5CX1B 5LB2A 5FOXA 5J47A 1RFGE 4OM7A 3ONNA 4MR9A 4A15A 3A2NA 3B6MA 2O8DB 2ZE6A 1TZJA 2YH2A 2HU7A 1G6OA 1EE1A 1FNNA 1R0CA 1O5TA 4NZYA 3SVZA 3QE2A 3X1ZA 4FOTA 4MDYA 2QN2A 1QFSA 2OOKA 3Q5DA 1HKUA 2AOUB 1E92A 1WQ4A 1SA0B 3M5WA 4PYQA 5EQJB 5A9SA 3HFGA 5CYPA 4DRYA 4IHQA 2XIJA 3AY6A 3TSAA 4AWBA 3DCNA 2IRWA 1MUUA 2DWOA 1Z9BA 1FBNA 2WDZA 3E0QA 2DQSA 3QJYA 3PXCX 2WABA 1AOXA 4K26A 5CCDA 1V1JA 3PNMA 1NATA 1NONA 3HVIA 2FWJA 3NC4A 2DP4E 4OFWA 2C4KA 4M8LA 5G40A 4ES6A 1P9WA 5AM1A 2PH5A 4OG2A 3PSHA 2AN1A 5FBRB 1NXQA 3T9AA 3AP1A 1JDVA 1MTOA 2HSWA 3FYHA 3T5BA 1T5IA 4PGFA 5EIEA 1BMFD 1CT9A 2HSZA 1YIDA 2GHTA 3AJ9A 3VBEA 3CXRA 4XQEA 3MPOA 3A6EA 5EJ4A 2WTNA 1L5SA 4FFBA 5EUMA 3DF9A 2BEUB 4J7UA 2E4WA 4P98A 4LUCA 4HNUA 3ZH2A 1VJ1A 1H42A 2WD8A 3AUAA 3OIFA 3EEQA 4IDFA 4UUBA 3U7FB 3GK3A 4QGFA 1TUBB 3RE1A 5CMLA 1JHDA 3WGZA 2O0KA 1BOFA 4JLDA 3OI7A 3U17A 2VOEA 3CRQA 5DYGA 1YWGO 1PJAA 3IMGA 4ME6A 4RORA 1ZK1A 3SHWA 1L7NA 1U65A 5I7EA 3PNBA 1LVGA 2OM2A 2HOQA 4Y6PA 1T3TA 4OJYA 1NLMA 2EIHA 4R9RA 2QUJA 3NBZC 3UB4A 2QS9A 5B4UA 4RD1A 4XVHA 5BWBA 4IVNA 1JQDA 3F3SA 1NN1A 2JKZA 3K9QO 4JJEA 1RBMA 5I7VA 1HDIA 1GOTA 1WW8A 2QW0X 4MWDA 2HO5A 1MPXA 4HAIA 3SIXA 3H8SA 3RSHA 4JBLA 3JD1A 4DB2A 2ZR9A 3R6LA 4E21A 4B3MB 2ATXA 3KKMA 5B55A 4I7EA 1YULA 2E4XA 3G2HA 4LDJA 3SMVA 4N39A 4Q5IA 1ZWKA 4X94A 5CRIA 3ZGZA 5FX2A 3BBPA 3HJGA 1DOAA 3OLXA 4A8JA 2OZLB 4OBEA 4K9KA 5AQEA 2Y05A 3R6WA 3HY6A 1NW9B 4RHXA 3R7DA 3T4PA 4F21A 1F5NA 1HETA 1IJFA 3R3WA 2HB6A 4YRSA 1QRUA 4HRAA 3HCNA 3ABQB 2A3NA 3Q12A 3TTSA 3C14C 1X77A 1P4GA 1HWYA 1A4RA 3DBHA 1YRQA 2Q5LA 3LHKA 5KYUA 3FSEA 1BX3A 2WHXA 3ONWA 3PP8A 1ULHA 2IYWA 4GGOA 3RWBA 4C4ZA 3FOEC 1FRFS 3ASVA 3JWHA 5CX4A 1FVXA 2DH6A 1B0ZA 3TQFA 3BK1A 5K45A 4UUAA 1LWOA 4ZKDA 4EIWA 2IPNA 4TLEA 1SXPA 2DC1A 1VHQA 1OLUA 1OFHA 1XELA 5AI9A 3VHRA 4CQLA 4EHIA 1DTWA 4F8EA 4UHBA 3EVEA 1IZ8A 1ZW1A 4YWHA 5J59A 2N1BA 4MWBA 1E62A 3RVQA 4Z1MD 5EIAA 1DKMA 4H1TA 1AZTA 1E79A 3L1JA 2F9MA 2HC9A 2YHAA 4BJ6A 5D84A 2BJHA 5ILOA 2J7PD 2RHDA 2H1SA 3K1AA 2P2GA 4U02A 1XU4A 2WHEA 1BDJA 1ZK2A 2D5LA 2HA7A 2PH1A 4OBWA 4QUAA 4ZV7A 3BD6A 2FGKA 1ICEA 1XN1A 1YDEA 3KNZA 1V4VA 1IHXA 2A30A 1YI0A 1XZEA 2JEOA 2ZRPA 4CDRA 1ZRMA 3EAFA 4X41A 1S2IA 3MWJA 4K40A 4ZJUA 3EHEA 2F4NA 3BICA 3F9RA 4PBSA 3IPCA 1ECPA 1QZZA 3RS0A 4S12A 3AB7A 3EAQA 4W1PA 4V0QA 5BR4A 2E21A 4W9MC 3G0HA 3EODA 2EBHX 3M4NA 5SY4A 1JFSA 1GYRA 2ZTSA 1GFWA 2XWSA 4UFOA 3CEAA 1BKSB 3DYVA 5DWDA 4XIYA 3VNQA 5IW8A 2ZLBA 1RWWA 1GWNA 2WA2A 2HM7A 2CGEA 1E9CA 4RZHA 5DMHA 1Q1ZA 2CV0A 1NVVR 3A4LA 1G20E 1KVRA 4LV5B 1M5RA 4NBRA 1YB7A 3OQOA 3LY9A 4H3SA 4DARA 5KTKA 2WA1A 4WKCA 3R09A 4M3NA 4RPCA 4CM6A 1W4LA 3PKJA 4UCWA 8MHTA 1O3YA 5EWLA 3TSCA 5TV2A 2DG2A 1V8OA 2FFQA 5LLDA 2BKXA 2PGXA 4EY5A 2QTRA 5JV5A 2JH8A 2J6CA 4ZVKA 3HXLA 3L7OA 4RM2A 5JXIA 4CXMA 4J2HA 3TQOA 1K06A 2CHEA 4GZMA 3EIFA 1AKNA 1Y5RA 4P80A 5D51S 5DJ5A 4CG1A 1KIMA 3COVA 3QU9A 2R0QC 1MABA 2J6HA 3VZQA 1IBLB 1ESMA 2XDYA 5H3CA 4AVYA 5JR3A 1USKA 3P20A 2VJLA 3O7WA 3KETA 2YYYA 4V0SA 5F3RA 3KVNA 4LBVA 4OJMX 1DJNA 4DCJA 1KJJA 3FGNA 4YCJA 2ZZMA 1YB4A 3LFUA 4L74A 4ER7A 4RLHA 1M7GA 4EG3A 2IZ6A 2QR5A 4M8SA 2D2IA 1OLSB 5KOHA 5L95A 3RS9A 4Z4HA 3NH9A 3E8XA 4BQIA 1Z22A 4RL6A 1I1OA 4KDCA 4DF3A 3A6LA 3FLBA 3MWDB 4O8ZA 3QSYA 4LK2A 4DCCA 4DANA 5JCJA 4KYVA 3ZHTA 3IOYA 4LZAA 4PPGA 3TCXB 3MOIA 1IZ7A 5DGIA 2CWDA 1TU4A 1X3SA 2YZGA 2XUDA 3GX1A 1V3TA 2VP9A 3C3JA 3T7IA 1MX9A 5CP8A 3V42A 3E7DA 1PG5A 1SUBA 2OCKA 5DT2A 5AO9A 4U9IS 3HR7A 2VZ9A 2LNDA 3NVDA 2C4UA 4HNSA 4JLVA 1T9KA 4LJ7A 3N7TA 2WV9A 4MB0A 5A4IS 5HIAA 4FCCA 4IIBA 4U3JB 3W78A 1OREA 5AKHA 2GK6A 2G9RA 3I92A 3PA6A 4K9LA 3WA6A 4DYHA 4M0PA 2XADA 4RYDA 3G2LA 3S81A 2AZMA 4RACA 2FZLA 1LZKA 2ZRLA 2XYHA 1FOEB 4NPCA 5FNVA 4AN0A 4Q21A 1KY4A 3BWYA 3FPHA 3S29A 5AESA 1H8EA 3WXBA 2I4NA 2A9OA 3I1FA 3KFLA 4JGGA 4N9QA 2B4TO 1SCUB 3QH4A 3RGWS 3BHJA 4I66A 2VHVA 1Y8QB 3FD8A 1GCGA 2ERYA 2J31A 3LCMA 4ZU6X 3USES 2HBYA 5DW0A 2CNLA 3H2GA 4OD0A 1EWQA 5KHAA 3VPFA 1RPAA 1PO7A 4I4TA 2V3WA 2C4WA 3O8LA 1PFYA 3K8QA 1AU9A 1F5SA 2RBEA 3M33A 4K9PA 4PO3X 3RAPR 3DGEC 3HGTA 3LBIA 2WSLA 2DHDA 1TRKA 3AG5A 5FOVA 4NL4H 4V38A 5P21A 1UBKS 1BDHA 3CZQA 4GQIA 3RPEA 1C3EA 3CWZA 5DPMA 4MARA 3QOYA 3DHWC 3T34A 3I12A 3HP4A 3GRVA 2AYZA 3ZKWA 2YHIA 4G9EA 4I8IA 3W6ZA 5HM8A 2I3GA 2DFTA 2YDYA 3F4BA 2R1TB 3KTFA 3Q0EA 2BZGA 2ZBPA 3EOBI 4JDPA 4RKWA 4UMFA 2IV3A 1QYVA 4FGSA 5ED0A 2B61A 4R0NA 4G0UA 4LJ9A 2J3QA 5IZCC 3A3KA 3EW9A 5FUWA 1UDAA 2Q6KA 2GD1O 5TF0A 1EGHA 3ND7A 3CNHA 2PRYA 3OEHA 3UCXA 3L49A 1A8HA 3KUDA 2HGZA 4QDTA 2Q6OA 4P22A 2YC2C 1URPA 2OMEA 4HAWA 5LZ5A 2IXBA 2QE7A 4HQOA 3AETA 1PR2A 3IT1A 3KQVA 4TZKA 1EH5A 2B98A 2NTYC 2P78A 3E7FA 3LK6A 4KUEA 5E6UB 4RVHA 1NA5A 4ZC1A 2JGEA 1ZL2A 1X0XA 1RAGA 5I9MA 2D1YA 2QQEA 3V4RA 5COQA 4UEOA 4ZTZB 2PZJA 1KAMA 1XN4A 2AFVA 3NTVA 1V1MB 5HGXA 3O21A 4YQZA 1XZKA 3HDYA 3JWJA 1E1RD 2IPLA 2PGDA 1VIAA 2B8TA 1IHDA 3MRSA 4FHGA 3B1JA 4J0IA 3J7AC 1Z2DA 4H7KA 3R7BA 3WGGA 3LC2O 3R8CA 1WU8A 2GH1A 2XMDA 1AXGA 1M7BA 2VK4A 1BCSA 3P19A 4KJXA 1PWEA 5IAJA 1WB9A 1QYWA 1NXVA 1A4UA 4DAOA 4TLLB 2C2KA 3T6KA 1T5LA 1A8UA 1U3UA 5C5EA 2H5JA 2XMSA 2XT9A 2C95A 1X1EA 2Q3LA 5A3JA 3AW8A 1WUJS 3KQMA 4F46A 1KBQA 4F3TA 3IQXA 3WHIA 1T1GA 4Q9KA 4DXDA 5JU6A 2FB9A 3F6SA 1SAYA 4CFYA 5K6RA 2O8CB 5DBGA 4PQFA 1GNVA 3AUTA 4D0GA 4GKKB 2QLBA 3UMVA 2XA9A 3AR4A 2ZSFA 3JQBA 1CLEA 3IO3A 3Q41A 4QQKA 2QBYB 3HY4A 3KUKA 3VNVA 1QO9A 1RLIA 4EZIA 1X94A 5TQVA 3U7HB 1KJIA 2X42A 3MTEA 5KQPA 2O3UA 3H5LA 2F8TA 4AKGA 5F77A 5IYZA 1Z6XA 3E61A 1CUUA 2OQIA 3KVYA 3GBVA 2GXAA 4FXOA 1PRYA 3COYA 2UAGA 3L46A 1WUTA 5ABPA 2GHIA 1JQ3A 2QNRA 3ITKA 4MGKR 4YV2A 1E0AA 2BFWA 3G0IA 4K2AA 4PPQA 2I9PA 4PX9A 1S2OA 5B6PA 3NBXX 4I14A 1G17A 4ACAA 1EFPA 4B40A 1IYZA 4Y1GA 2JDID 3EE6A 4KGDA 3T9DA 3WTBA 1O0SA 2R8YA 1K6MA 3GJ3A 2QWXA 3F96A 3LX6A 4DBZA 4RTOA 1UMKA 4JHLA 2WV7A 3DOUA 2Q2VA 4HH0A 3T1NA 1EZ1A 1P1IA 1OZHA 4B9AA 1LJ8A 3PWZA 5T4EA 2IVFA 4MCAA 5JYDA 4PZYA 3F5DA 1E5DA 1KI2A 1VPTA 4WESA 2AK3A 2G9ZA 1RS0A 1C3VA 1BE6A 1PL7A 1PW7A 2DFPA 3G13A 2FQQA 4KPFC 4D25A 4TTQA 3PKIA 1N8TA 1VPLA 5JDCC 3NVKI 1EMDA 3FDXA 1HDXA 2NZ2A 3GLQA 4MLPA 4HATA 1IBMB 1IEXA 3C70A 4M6WA 2XSZD 5A0TA 3B20A 4FGZA 2Q0QA 4KOEC 1LDMA 3MTIA 3EIQA 2VYQA 4L02A 5I9SA 2ECFA 4ROSA 5BNZA 2XUOA 2QJOA 4NC9A 1RYHA 3QVKA 5FORA 3IXLA 1AQIA 4U3JA 1SRRA 2V4ZA 4UARA 3VX3A 5FUQA 2GOYA 3BG5A 3DL0A 3IP1A 3TAXA 5C7IO 3E7XA 4LXYA 4ANFA 4E11A 2X1MA 5KTYA 3OIYA 3ZGVA 1KS2A 5ISMA 1VE3A 4QELA 3FPFA 5FWDA 5FPHA 4X7PA 1FP4B 2X1LA 3TTXA 1MJGM 3PGMA 4ZPXA 5DBEX 3UA4A 2BFDA 2JZNA 3DOFA 3OEED 1T6ZA 1TK3A 4IP0A 4F7WA 4L4XA 3R3HA 4EQ6A 4PNZA 4C5CA 5HOQA 4IFEA 4KNWA 1CZLA 1YUMA 4PLCA 5BQ3A 1C1DB 3OTQA 3BD9A 4BZZA 4BKPA 1T1JA 1HA3A 2K2QB 1ZG3A 2PMKA 4Q03A 2XE4A 2ZT5A 2AEJA 3CM0A 4EUEA 1MIHA 5K0BA 2BEKA 3R6GA 1PT5A 1TZ2A 3QA3E 3A2KA 3NCTA 4F4FA 4KREA 4MV5A 1QC5A 5C52B 4AX8A 1TO1E 4GI5A 3ZHXA 1XMOB 2O5CA 4YP6A 5F7XA 1AD2A 2Q4BA 1BU5A 4KR0A 3L7AA 2AI3A 4MQMA 1FRVA 1P0CA 1JEEA 3O94A 1XCOA 3PC7A 3ZKWB 1OBOA 2BM9A 3QU2A 3U0BA 2IKQA 3S7ZA 1JMYA 1P77A 2RHGB 2WKPA 3NTLA 4Y2RA 3EIEA 2DMRA 2ZEJA 4DV2B 2H4YA 2SCUA 5ICMA 4S35A 1JIXA 1AKTA 4C08A 5KNCH 2X5KO 2G4VA 3BJEA 4PAWA 3ZHVA 5BOSB 4HAUA 4GMKA 1E3EA 3WLFA 3L07A 3Q7RA 4BQSA 3SKYA 3IAEA 4KXVA 1BH2A 1Z25A 2FE4A 4NR0A 1LC3A 1SXGA 4IS3A 4HWPA 2OBMA 3JU3A 1U6KA 5K2OA 1C3XA 3QOXA 4PX2A 2HF2A 3JQGA 4JQOA 1MF7A 2HSJA 4KIWA 3GP5A 4KV9A 2DLCX 2RHWA 3A4TA 1E6KA 3IBCA 2CZGA 4X45A 5JADA 2C9OA 3TD6A 5FI0B 2AVNA 5AM2A 1GUAA 3AUFA 2CJPA 5C32A 1GFSA 4PYMA 5TVKA 5DU2A 4RXUA 3P4XA 4R7ZA 3QU5A 1OVMA 1UINA 2ECKA 1Z4NA 3PXAA 4KR6A 2OUIA 4RANA 1WVIA 3DE5X 3TS1A 1U8CB 1A7JA 1DBVO 3KYDB 1AO3A 5FI1B 1Q77A 5T67A 4IWNA 1LJUA 2VJQA 1KKMA 2YMQA 2Q1SA 3G2PA 3IR5A 3TINA 4YRDA 4O3MA 2NAPA 2XI4A 4KO8A 4EO4A 1QVRA 3TB6A 4FI3C 2V7PA 2DPYA 4E33A 3B38A 3OJOA 4Q39A 4UKDA 4AUEA 2QORA 4N3CA 2NYUA 3ESXA 4UCQA 3TIIA 4WY2A 4NJOA 2FPPB 4C5AA 4GKVA 3QITA 1NW8A 4R4JA 1T8TA 3FKSD 1WF6A 1WXXA 3HZHA 4D4JA 2J9YB 5I4CA 1ISFA 5G0UA 2EF0A 3G68A 1WPGA 4JLUA 5ECGC 1N5IA 4WXHA 4YRTA 1Y1KE 3QW4B 3UV7A 5B1SA 4EATA 4ZO8A 5TT1A 2CHUA 3MMSA 3PK0A 1E9EA 1G9XA 3KEMA 2ZIEA 3RRZA 4RV4A 2J0UA 5ILGA 1N7JA 4AY4A 4Z1MA 2IH4A 1VE5A 3L6OO 5A4KA 1AQUA 1EFPB 4HKTA 1NQTA 3E9RA 5J43A 1C41A 1R4NA 3AUSA 4TLMB 4MHTA 4H7HA 2A7XA 3O4FA 5JY6A 5CYOA 5J4YA 1N8SA 3A6ZA 3EGEA 3P2MA 1Z18A 3RUPA 3OA0A 4ZO7A 2LTAA 4KQ9A 4BO4A 5A4JA 4PLYA 1NYLA 1FUIA 1Z0ZA 4PYJA 2P9BA 5IXSA 1OPXA 2PWZA 4MW4A 1ZR2A 2VAMA 1KOLA 1A72A 1RXEA 2O2CA 3CA8A 2C2GA 3D2CA 4M98A 1R66A 4DLUA 3O7MA 3H5VA 4LV8B 4R9NA 3T7SA 4AO8A 4ESOA 2B5OA 3VR5D 3C5WP 1F2UA 1GR1A 2OCDA 1GHTA 4HEQA 2VBIA 3U09A 4E5PA 3PD0A 4KFSA 2IYSA 2R47A 3WYGA 1T9DA 2V7WA 4M6WB 3AWDA 5KSWB 4QPDA 4GW3A 3L1HA 4IINA 3TFOA 1VPEA 2RFLA 1MQ9A 3ET5A 4MVJH 1HQYE 3HYCA 3WMGA 3GYBA 5J1SB 3KCQA 4AROA 3MT8A 1ESZA 1LVUA 3OESA 1Z37A 1DDIA 5FB3A 1ZNZA 3Q3VA 1XTSA 4PCAA 2ZSIA 3GA5A 3CPJB 1V3VA 1G3QA 3LPCA 3AGPA 1XTUA 4RW0A 5HZMA 2MT9A 2PUWA 3DD1A 2J0EA 1OROA 2DWPA 1K4MA 1WSBA 4UEWA 1V5WA 1CUSA 1IHPA 3TD2A 3TKYA 3M6VA 2WY2D 1KKLA 2OP1A 2GXSA 3BA6A 3QOWA 3GRYA 2WU4A 2WJHA 4KQJA 4NU0A 4TWIA 3ABZA 1SOUA 2WOJA 2RI1A 4R1SA 3JQAA 4EEXA 3ZJVA 5F98A 2ZR0A 1ND5A 4OA8A 2BBWA 4MGHA 3IL2A 3A9SA 1FF9A 1NDUA 1PZFA 5GMOA 4ZCQA 621PA 4AMZA 4RC9A 3CNNA 1UFVA 1Y42X 3OZFA 3QPBA 5EE5B 3UHFA 2X5OA 1SXJE 3LP8A 1JZSA 3GLFB 1BKDR 1ZM7A 1DFIA 3GLHA 3MBOA 4ZOLB 2J3LA 1RLMA 5EYPB 2JAWA 4RE6A 1CRWG 4LVNA 3SC2A 1RCFA 3DMPA 2ZI3A 3M1YA 4QEZA 2ODAA 1R00A 3GVXA 4JCCA 4KV7A 4B2LA 1Q3HA 4BMOB 3URMA 1FUKA 4IL5A 2BGTA 3CW9A 2OCGA 2Q4TA 3HEAA 4EMBA 2VP0A 1PK7A 2WIJA 4HQRA 4MWCA 3RTGA 3T3DA 1NOKA 4KB5A 1A5TA 1C8BA 2JFHA 3ZJ5A 4ZI2A 4JYCA 1V6AA 2FVYA 3DEAA 4OMUA 4C87A 3VPAA 4XQ9A 4OL9A 5DLDA 5DXAA 1C7IA 2DTDA 4CMJA 1OKKD 2I7DA 4DNOA 3DA8A 2PZMA 5C3UA 2JGMA 1GTJ1 3DE0X 1YKSA 3WLMA 3I2FA 3RDPA 1YACA 3IBYA 4YJGA 3HVRA 5KX5F 4Q9IA 1MW9X 4RAOA 3VNRA 1IK4A 2FJUA 4MVJA 4EHLA 2YYZA 4O2LA 2GKSA 2JB9A 2PZFA 4NV0A 1AZLA 1VMKA 1JIUA 3SJBA 3EVNA 4B3TB 1I9GA 1V9LA 5JSZB 5KHLB 3RAEC 2VKTA 3NUZA 2A86A 1BSVA 3MRXA 4DG5A 1PQWA 5FHRA 4Z7QB 4QICA 5KVSA 1KDOA 4Q3NA 1C2YA 1GUZA 4LHSA 1ZMRA 1WJGA 4H0NA 4S1OA 2GJ9A 5IUJC 4FNOA 4B2IA 3FPLA 4O1HA 4AF7A 2A4KA 2V98A 4ZT3A 2XIQA 5A6SA 2YOGA 2EV9A 1TT5A 4AJIA 1K7EB 1VYTA 5H02A 3K35A 1QRTA 4P7JA 2VA8A 4PXAA 3C8DA 5J5VA 2QTFA 3P2YA 1N92A 4TWRA 1AA9A 5TQ2B 4EVIA 2FPIA 1G1MA 2QLNA 4HHEA 2HFJA 4MVCA 3FMPB 1IWBB 3LUPA 4BZWA 1XOIA 2QI9C 3KZNA 1QHNA 4L8GA 4Q4HB 3F7MA 4JK3A 2Q8NA 1OBHA 2OR3A 2QZ4A 1Z06A 3BJRA 4II7A 2OO5C 1KFBB 4CL8A 2ANCA 1ATIA 1US8B 3IPRA 2ETXA 1Q7EA 1RXSA 2GPWA 4LC1A 3TMKA 1C0PA 2OCBA 1R5BA 1Z5UA 2C99A 3DZIA 3EF3A 3MD9A 4HTFB 5IC5A 3ZCXA 1GTRA 4DLPA 1GNTA 2MSNA 1ILWA 5FBZA 2ZRKA 3URKA 4DJDC 4F0JA 1YTUA 1UANA 2MR5A 5DYTA 5CFRA 4BZPA 4ILEA 3V97A 3R7SA 3AMVA 5BPHA 1M34B 4MJXA 4D4KA 2I54A 1B6RA 1MLDA 1YAJA 3T9EA 4CDMA 1ML4A 1K7XB 1JT2A 5B1IA 3RC9A 5LXTA 1EBBA 2Y0DA 4BQPA 1IUPA 4G0OA 3VZBA 1Y8RB 3LUCA 4U6NA 3P0FA 4ZTUB 1E8MA 3V1NA 2RGNA 5LQUA 5C4GB 2FCAA 1AY0A 3KJNA 3QXCA 5LQSA 3VR1A 3R3JA 4A1FA 4DZTA 3ZDZB 2GVZC 3FVWA 5TF4A 4C04A 5HKBA 3WLOA 1O97D 1FP1D 3CRVA 2XB6A 4DNPA 3D9QX 4KXUA 3THSA 2OB1A 3PQ2A 2YIJA 5JHGB 5A4MS 4B7UA 1Q7TA 1Z0AA 3EZXA 1VE1A 3L84A 4X7RA 3LDFA 5TMDA 3U4HA 4CCAA 4DJFC 1QP0A 2DETA 1KRXA 3KD3A 4G81A 4MGIR 5AXCA 3DTYA 1Q6ZA 3OCZA 3L6EA 3MLAA 2VNJA 2VRWA 3E7WA 3FCEA 4M1WA 4ZQIA 5HEKA 1JBQA 3M83A 3O31A 1ZFNA 1OLOA 4OQYA 1UWCA 4E22A 4B47A 3PFWO 5FUVA 4AY5A 4RK6A 2NU8A 1D0IA 2R1VB 3BH7A 1XDZA 3RU7A 4MUNA 3E23A 1LGYA 3NGMA 3ZJYA 2WP0A 1ODIA 2JGDA 1BGWA 1K97A 1TU0A 1LJLA 1X8JA 2PQ0A 2Y67A 2ZB8A 3CKLA 3LDGA 5K3FB 5BRJA 1JDJA 2HWWA 2PH3A 3WGHA 3O0TA 1ZGAA 4JSRA 1RWXA 4RVGA 2YWDA 3U9LA 4EYQA 1HPLA 2CJWB 4YRCA 2WYIA 3S55A 5I7HA 4TYNA 1TFUA 3WYNA 4BGEA 4US0R 1Z4OA 5CJJA 3B36A 4WD3A 5KDLA 3SEZA 5K3AA 1ISJA 1V5FA 5G1NA 1OYWA 5L7YA 2IITA 1RHKA 1SN7A 3PFFA 1T0PA 2R6JA 3C98A 1TAQA 3II6X 1K5DA 1J2RA 4GU5A 4E4YA 2P90A 4WV3A 3WGYA 3WJ7A 3V4PB 1E6LA 2EFCB 1N0UA 1EIWA 1C29B 1HUQA 1RPNA 5DCYA 4ENQA 2UUBB 2P2NA 1CTQA 3L01A 2ZITA 3E22A 4PZLA 1Y1PA 4L2IB 4ENTA 2J46A 2Z8XA 3GLHB 4ZOLA 4QXRA 3KJXA 5JCOA 1W48A 3A6PC 5ALOA 1T2DA 3WLJA 4L27A 1L8XA 1AN9A 4FR0A 4NATA 4JBWA 3WWCA 3AWIA 3K1ZA 3GH3A 2GA8A 1Y4UA 2P9ZA 4D74A 5JZ9A 2GT1A 1R4ZA 3IEMA 5HCNA 3UW3A 3U13A 1KEEA 1R4AA 2ZKLA 3A05A 1G6HA 4OQEA 4ZAZA 2M2IA 2E85A 3GFOA 4F6RB 2IH5A 4MINA 4DY4A 4IV8A 1CJVC 3T7DA 1TJPB 4R01A 2MSCB 1E0SA 2GZAA 4GRDA 2XBUA 3OFND 4Y67A 2IZ7A 2XUGA 5CURA 4WEQA 1F8XA 1BCSB 4E1VA 5IH7A 3KQHA 1U0FA 3BJMA 3HU2A 4HYTA 5TMPA 2OB2A 2Q3MA 1MNAA 5D01A 2AKEA 4V39A 4BMSA 2WT4A 1J4AA 1ECJA 1RWOA 3UKOA 5A6SB 1JKJB 1OCEA 1V41E 3MFQA 3QV2A 4PWYA 2Q2OA 3NM4A 5LL6P 1FS6A 4I5FA 1WIWA 1RLTA 2R6AA 1O08A 3BWBA 1E5QA 3GCGA 4WXPA 4REQB 1E69A 1YDMA 2DECA 4JBXA 3LRTA 5C31A 3Q6IA 1J99A 2GCOA 3ROTA 2D62A 2C1XA 3GEPA 1WXDA 1KRHA 3VU1A 3DZJA 1W6RA 1J0XO 1YAHA 2WK1A 5K0FA 1PR5A 1SZDA 3VPCA 2AJLI 2VHTA 1S8AA 5EZ5A 4BFSA 1XRLA 2QRVA 5DI3B 3DMTC 3FMGA 3G2MA 4PONA 4G67A 2AEEA 2OP0A 2Q5FA 2YQ5A 5IKXA 3VR0A 1V8FA 3QP9A 2ZUFA 1D4OA 1N6HA 2N0SA 1EE9A 2HA6A 1XAIA 1VHLA 2I6SA 2JFYA 3BRWA 4P4NA 1JR6A 3OZAA 2C92A 1PGPA 3NM6B 1N5OX 3NXKA 1U8AA 4BLTA 3ZW9A 5IASA 4IHJF 5DYIA 1WBBA 4BMNA 4MR8A 2EHDA 3ZV4A 1AQ6A 1VRWA 1WBJB 4A36A 2B8WA 5BQXA 1N0WA 1Y98A 3B5IA 2BGNA 3OJEA 5DHTA 1PYGA 2YUTA 3RWMB 3BGWA 1G8PA 3TQSA 1Z8DA 2FPKA 4YONB 1BOOA 1P2UA 2WT8A 4I9UA 4ZOAA 521PA 2LKDA 3ONFA 5T41A 2IUUA 1N2IA 3O1LA 5EMKA 3B1WA 1JU9A 1Q50A 3J81A 2H4FA 3H5TA 5AJHA 3RKRA 1NOJA 3LXXA 1O58A 5I4KA 3CVVA 2H57A 3AK4A 3JYNA 2ON6A 3TE7A 2NPOA 2UYYA 4C9BA 2DERA 5JNLA 1AKWA 4PAMA 3D5QA 2YHUA 1RAHA 3DEFA 4KLNA 3SP1A 2YV2A 5KNBD 3N75A 1DBQA 2PSJA 2W6MA 5JNVA 2IPMA 1DJQA 3CX8A 2LW7A 3KHSA 1U7WA 3GLTA 3VISA 3UCFA 1P2FA 4LN1A 4YAOA 3K2QA 4DGQA 5TPZD 3ET4A 1XU9A 4NXNB 1V96A 4LRTB 4EHHA 1D6JA 1U2ZA 2J45A 2EAUA 2NTVA 3FLMA 2PJDA 4C6SA 2JGDB 2JRLA 2NSLA 3Q0TA 4UUOA 3A3PA 1L4FA 3W2FA 5KSOA 2AUTA 2I34A 3D8RA 4AD8A 3KZOA 3LC7O 1H9AA 1YBHA 2VTBB 1YGPA 4ZD6A 1GLVA 4EFNA 2HKIA 2V58A 1T2EA 4UVDA 1DKLA 4DLNA 1L5NA 1PU2A 3TAUA 1LQ2A 2VNAA 1R0YA 4MV0A 4CNQA 4IWXA 4PQEA 5SZJA 3ZPXA 1EM6A 2P62A 1E18A 2PR2A 5EQFA 2I3BA 3DP9A 3ZDBA 2IS4A 4ZCSA 1NIPA 1HX7A 5F23A 2XD4A 1LRKA 4YJHA 5A7HA 2CUZA 2JFWA 3THXB 3DZHA 2OFWA 4UNIA 3KJQA 3L5KA 2P9TA 5BN5B 1CUHA 2I1QA 2HRDA 3O83A 4LYHA 4N3NA 2XWQA 1P5HA 1S3FA 4ZYZA 3UV3A 1P44A 1KAQA 2P69A 3OO1A 3PHGA 1NUAA 4XUGB 5AI4A 5HR5A 4IJKA 4ZCRA 3ZUPA 5SY6A 3PQ8A 1V71A 1RXCA 3ZCQA 4D5EA 5L3VA 1ST2A 1DWUA 3U3OA 1XPJA 3OEHD 5EZSA 5CDGA 5EFOA 1U9IA 3W3AD 3A9WA 5E9QA 2J5RA 1X7XB 5AKKA 2W6OA 5C0OE 4XXHA 4II2A 4YRFA 3K70B 1BMDA 3HV2A 3X1YA 3NPAA 3ONVA 4Q3LA 4ZOCA 3F7TA 1ZOLA 2ISCA 1GKYA 2BRUC 3A4IA 1K5GA 3GFSA 4AY3A 1Y6GA 3CUVA 2QV0A 2BEWA 1CY4A 3LP6A 3PXXA 2OPHA 1H1LB 2ZRJA 2Z8YA 4ARVA 1G18A 4GX0A 4D80A 1MW8X 2WSSD 4IX1A 3GI1A 2X0IA 3HKCB 4I1SA 2GJ8A 1RAEA 1KYWA 1M2VB 1XALA 2REXB 1FJHA 4RK0A 1QHHB 1U6JA 3ON5A 4YRNA 2MSDB 1DO0A 1GZ3A 4YTEA 4PLGA 2O7NA 1V4BA 3DCIA 4BGIA 4JAVC 1GSOA 1LNQA 4FOPA 3M9WA 2VOJA 4R5MA 4C7VA 5BSVA 3CGWA 2BKAA 4W5RA 5HQ3A 2OBXA 4DQKA 3L92A 1P1FA 2DBZA 1VLQA 3Q9UA 1DC3A 3VNAA 3RYIA 3OWHA 3VYSB 1HBJA 1Y48E 4HAVA 4AO6A 4DNXA 4HX9A 3GNQA 1NN0A 2CXXA 4BATA 1TYDE 2WNHA 3DMNA 2WDPA 1SBIA 2W37A 3K96A 3ENVA 3MQ2A 2QVBA 3SHFA 2A9QA 1QP7A 2ZSBA 2WJAA 1U8YA 3R74A 1C2TA 3DLPX 4UOZA 5ITZA 1GY8A 2KYRA 3IIKA 3RNOA 4QT4A 2ZRHA 1T4MA 3QPCA 3VDQA 4CT4B 3TG2A 1E3WA 1O95A 1HO3A 1OLXA 2ZBDA 1KPHA 4XD2A 4RA9A 2GZMA 4DSTA 2ZUSA 3MSCA 1WABA 3STTA 3X2SA 1KETA 2FH5B 2R6HA 1RSZA 3R5XA 2ZG6A 1CR2A 3L8MA 3NYRA 2OORA 5CDUA 1JVSA 1ZXLA 1SCDA 3F8WA 5IHXA 1NNSA 1V39A 3JD3A 3IUYA 4ITUA 1CNFA 4HWGA 4QM6A 4FWBA 2PWPA 3IEXA 4XM1A 3K8ZA 2J59A 4CUKA 3IQGX 2QVGA 3IKVA 3U6BA 2OVBA 3L5OA 1J0EA 4KN8A 2Z57A 4FBGA 3AI7A 4YALA 3V8QA 1FMJA 1NYRA 1BW9B 2ZRAA 4I9FA 1SUDA 2H11A 1W9HA 2WIFA 2XTAA 3KKOA 3AM5A 5BN4B 3F7OA 2R5NA 4HEA1 2HNAA 1JIVA 3TEMA 5IFKA 3TGPA 4J2OA 4F45A 3RVPA 2MHCA 2BI4A 3COSA 1G8F