1P7VA

Structure of a complex formed between proteinase k and a designed heptapeptide inhibitor pro-ala-pro-phe-ala-ala-ala at atomic resolution
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTDILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords proteinase K
publication title Structure of a complex formed between Proteinase K and a designed heptapeptide inhibitor Pro-Ala-Pro-Phe-Ala-Ala-Ala at atomic resolution
rcsb
molecule tags Hydrolase
total genus 88
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2003-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1p7vA00
4RYDA 4HVLA 4H6VA 1TK2A 3DE6X 2XTJA 5JXGA 3PTLA 5FAXA 3LXUX 3ZXXA 1SCAA 2XRMA 5ARDA 1Y3FE 2DUJA 3LPDA 1KE1A 3DE4X 3SICE 1S2NA 3WIVA 2X8JA 1C9NA 3LPCA 2G4VA 4LVNA 1HT3A 2PRKA 1PEKE 5ARBA 1BFUA 3DE0X 3D9QX 3I37X 4ZOQI 3TECE 1KE2A 3AJ8A 3ZXYA 3Q40A 4I0WB 3OSZA 2PKCA 2PQ2A 2PWBA 3DE2X 3F7MA 1AV7A 1SBIA 3A3PA 1SH7A 1SBHA 1WMDA 1SUEA 4NE7A 1SBCA 3EE6A 3TI7A 2E1PA 3DDZX 1BJRE 1C3LA 1GNSA 3UNXA 5B1EA 1AH2A 1Y48E 2W2OA 1V6CA 4H6WA 4C3UA 2Z56A 2Z58A 3VSBA 1NLUA 1SVNA 2ZWOA 4KB5A 4NE9A 3I2YX 2ID4A 3I30X 3F7OA 3VHQA 4DZTA 4AKTA 2IY9A 1S02A 5AMXA 1BFKA 1DBIA 3QFHA 1BH6A 5AVJA 2W2QA 2Z57A 1TM7E 4DWWA 4KG7A 3VYVA 1Y33E 1XF1A 3GCXA 1ST2A 2IXTA 1V5IA 2PMWB 2PYZA 5FBZA 1IC6A 1P7WA 1Y9ZA 3BGOS 5K7SA 3VV3A 2DP4E 1SPBS 1GTJ1 1YJCA 1Y34E 1A2QA 2WWTA 3GCWA 1ZVKA 2V8BA 5FFNA 4NMXB 3WIUA 4ZARA 4AKSA 1T1IA 1JEAA 2HD4A 4CG0A 1SIOA 2X8JB 2ID8A 3EIFA 1YJAA 3H42B 1YU6A 1SIUA 3VTAA 1OYVA 1TMGE 1C9MA 5JXJA 1ZVJA 2WUWE 1BE8A 1KDVA 3LPAA 1DUIA 2SECE 1TM1E 3T41A 5CW1A 2SNIE 3PRKE 2GKOA 2P4EA 3A3NA 1MEEA 1SELA 5SICE 1SBTA 1PTKA 1CNMA 1THMA 1TM5E 1MPTA 1SUDA 1YJBA 1Y4AE 2DQKA 4WOBA 3CO0S 3DW1X 3P5BA 4M1ZA 4H6XA 3DE3X 5I9SA 1GA1A 2Z2YA 1OYOA 2Z2ZA 3BX1A 5B1DA 1SCBA 1KDZA 1SCNE 4BWGA 5AQEA 1TM3E 1SUBA 1SCDA 1SIBE 3AJ9A 3HJRA 2W2NA 1Y3CE 1SUPA 1OT5A 3DE7X 4YN3A 2WUVA 1R6VA 1AK9A 4CFYA 4KPGA 5JXIA 1AU9A 2SBTA 3DVQX 1T1GA 2ZWPA 5JXHA 1TECE 2W2PA 4LVOA 3WQBA 1GCIA 1Y1KE 2HPZA 3DE1X 4OMCA 1Y4DE 5JMOA 1C9JA 1UBNA 3F49S 1GNVA 1CSEE 3WHIA 4FONA 1P8JA 3AFGA 1NDUA 4MZDA 1R64A 1VSBA 1EGQA 2Z2XA 2QTWB 1NDQA 2SICE 1GTG1 1GA6A 2PWAA 2W2MA 3DVRX 1PFGA 4Z2AA 1P7VA 1AVTA 3QTLA 3GT4A 1Q5PA 1Y3DE 4CFZA 3L1KA 4C3VA 2ZRQA 1T1EA 2TECE 3GT3A 3BPSA 3DE5X 2ST1A 1TM4E 1SBNE 3DW3X 3D43A 4J94A 1AF4A 1SUCA 1EA7A 1IAVA 1KDYA 1LW6E 3A3OA 4WOCA 1TO2E 3I34X 1GT91 1R0RE 2WV7A 1BE6A 4OMDA 1GA4A 1WMEA 4B5LA 3Q5GA 4HX2A 1WMFA 1TO1E 1SUAA 1WVMA 4GI3A 3VV2A 4K8RB 3DVSX 1S01A 2Z30A 1SCJA 3EDYA 1SN7A 3CNQS 5ARCA 1AQNA 1Y3BE 3DYBA 1ST3A 3DWEX 4OV6B 5AVKA 4DJ5X 2B6NA 3TI9A 1WSDA 1PJ8A 3SQOA 1GTL1 3QMPA 4JP8A
chains in the Genus database with same CATH superfamily
5F1OA 5IP5A 3K0EA 4INAA 1E7QA 4P81A 3H9JA 2ADMA 1KKMA 3MB8A 3RH0A 4DJAA 2PV0A 5AUOB 3WGIA 5E3HA 1QS0B 1Y1QA 3AFIA 3LCRA 2GZSA 3IOMA 3LLMA 2GTHA 2H7CA 4NICA 2HMAA 3GFSA 5NULA 3HO6A 3BBPA 1PNTA 3RAGA 1TVKA 1QRTA 1JEJA 1OZHA 1YA4A 4TWBA 3BE6A 3DPUA 5KX5F 1V8BA 1DC8A 2H2IA 2N42A 1IM8A 2OCGA 1K97A 3DXZA 3S2UA 3BA6A 4QT4A 2Z8YM 3PFFA 3PRJA 2ZKIA 3OU6A 1QF9A 2E5WA 1RXEA 5IAGA 3MTDA 2PBRA 3ESCA 4UUBA 3HP4A 2ZRMA 1M5UA 5AI0A 2OENG 1OCEA 2G67A 3AGPA 5ARDA 5KYKA 3FVWA 2VDWB 3KE8A 3U60B 1WQ4A 2UKDA 4I99A 3C5VA 1EVQA 4FMCF 2MYPA 3D1VA 3LPDA 3OWXA 4P84A 1OXMA 5IW8A 4FE4A 2HFJA 1KE1A 2IUFA 3LF2A 3FOZA 1JDJA 4A8JA 1KBQA 2ZTHA 3TD6A 1JWAB 3BXXA 1EWRA 3GC6A 3KSZO 4L8LA 1EUQA 1FPMA 3A1TA 2QX4A 3AEUB 4CEIB 3AERA 2WAXA 1YXMA 4PRYA 5J4YA 3E0QA 3M3DA 4HTFA 4AT1A 1KI4A 5IKXA 1BGVA 5G40A 4L51A 1OQAA 3RSQA 1GSOA 5IC4A 4W5QA 2JAPA 4HLUA 5TF4A 2BH9A 4MV9A 4Q4HA 3C4QA 1KEEB 3I52A 2J9FB 3AJRA 1QHNA 2YMPA 3MINA 4D3XA 3VMMA 3AH8A 1I1OA 2DWUA 3EVNA 4HYQA 4JBXA 5F51A 3U7GA 4EELA 3N6XA 2HJWA 4NZ9A 1FUKA 1FYXA 2A9VA 3B1KA 3IMGA 4K9DA 3RRBA 3WP0A 3ZU2A 1W36C 4CKWB 1X7HA 3MWKA 1IDOA 3ZXYA 4UJ3A 5F77A 3EIEA 2HDHA 4I0WB 3OSZA 2JL1A 5H4HA 2ZUTA 5JAIA 1IJKA 1KR2A 1MG0A 1PL0A 3C5WP 3GFRA 3NBZC 3NB0A 3NC1C 1PP4A 1R5NA 2DKNA 1ZNZA 2HLNA 1EMDA 3ZU4A 3I8SA 2H48A 3EGVA 4EO7A 1RAAA 2DR0A 2DBQA 3KTAB 5DBOA 2DU8A 3K4PA 2W48A 3M1AA 4X8MA 4CMBA 1EDOA 2F1JA 1QZTA 1FZTA 3SYMA 2ZBQA 5AOAA 4FGZA 4Z86A 3TLMA 3FPHA 4R81A 2LV8A 2Q9CA 1SBZA 2IJGX 1W1UA 3RV3A 3WNCA 3IVAA 4FLFA 1GKUB 1ORIA 4YRJA 1H2EA 5JD5A 1QYIA 2UDPA 1HG0A 1SXIA 1G38A 2HMVA 5AW4A 2BGRA 4RIHA 2QN9A 5DV9A 4LHVA 2Z6AA 4V3BA 3ZGNA 1RXUA 3I2KA 4TRJA 3BZBA 4RWEA 3VNBA 3KWFA 1VB5A 4UM7A 3LXXA 5E6UA 5IMSA 4M9XA 4D9BA 4HADA 4G81A 3I01A 2J85A 3V55A 1KZ6A 4ZKDA 4IV5A 3AO0B 1YTLA 2R60A 3C14C 1UZAA 2FFJA 3D6VA 3FNEA 5E8RA 2I5PO 1C14A 3HSKA 1HE4A 1X2BA 3F47A 2R11A 3Q7PA 4Y9UA 5BVHB 2VZ8A 3ZYZA 1NN1A 1ODTC 2BGNA 4ECEA 4W63A 1VKOA 3F6CA 4UNRA 5AW2A 2O14A 1AO0A 1NC3A 1C3XA 2XUDA 1ADYA 4LJ6A 1V3TA 4R8SA 2GO1A 2O5RA 3MTEA 1EM6A 1P2TA 3AIOA 3L0ZA 4O4HA 1O96B 2WF6A 3P9IA 1M6NA 1ENOA 4U2EA 5DP1A 2VF7A 3PNVA 4D25A 1YRYE 2I71A 3KVYA 3MCZA 1C4KA 4ZYVA 4ZQEA 2HA7A 1QYWA 2JASA 4X6LA 2CHEA 4A0HA 4KQGA 4J1QA 4ZREA 2QRKA 3I32A 1NZDA 3JTEA 4HNHA 4DEXA 5JH7F 2QRMA 2IXAA 3D0RA 4PGHA 2BKXA 4D0SA 3ASYA 3OQPA 3FD8A 3TVTA 3ZDXB 3BD6A 4R0NA 2ZUFA 3BB1A 3O8NA 3AF5A 1M8FA 1QPBA 2NYRA 4YP1A 3UJHA 5U1PA 4R1QA 4OSPA 1AS2A 4I9NA 4DWWA 3MD9A 3RC2A 1HDOA 5A06A 1UJ2A 4KIWA 4ZAFA 2IOYA 3MT9A 4AZ0B 2JRLA 4B6GA 1TA0A 3AUYA 4DV7B 1GYRA 2WJWA 1C0IA 5K3FB 4ZMSA 5K5EA 4UVHA 1J24A 4L6AA 2OC9A 3F4LA 3WGKA 2WSBA 5JYEA 3KSBC 2GAOA 2R66A 4KRFA 2ATXA 2CXOA 1OMOA 1IZ9A 3NOVA 3V4PB 1WB6A 2Y0BA 2R79A 1KPGA 1ZD5A 2Y4OA 1WBBA 1B0UA 3BGOS 1F51E 2Y68A 3A1EA 2CLCX 4B4KA 3QJGA 5KB3A 4LJRA 1P0IA 3DHWC 5IM5A 4A1FA 4BNJA 4G4GA 4HL6A 2YRFA 3SE0A 1JMYA 3U7QA 3ZNNA 4XM0A 1RJGA 2BDTA 2P2SA 1Y34E 1X1RA 1IQRA 3EXAA 3DXFA 3IBCA 3KZCA 4KITB 1SKUA 4KXFB 4KYUA 4AULA 4EY8A 1UP6A 3OKPA 2IPNA 3GEPA 4NHOA 5C8YB 2FF7A 4MPTA 3WGHA 1ML3A 1L8LA 5C8DA 2DPLA 2IZ6A 1MO4A 1N2CA 1V4NA 1AMNA 3U7HB 1NBAA 1OWNA 1FTGA 3J81A 5EMKA 4BKRA 3EWIA 2RONA 1W581 1LLFA 2CFOA 2IEDA 4DBLC 1E3TA 5LZ5A 3RIXA 4YY3B 3IAS6 4GH5A 4O2LA 1GAXA 3GRFA 1FP4B 4C2BA 4LYFA 3WLLA 4FMDB 4MNTA 4WAUA 4IWXA 5FB3A 1SY7A 4HEA1 3PLRA 3H1FA 4FK8A 4OFZA 3N74A 4UOZA 4AJEA 2FSFA 3RAJA 5I7UA 1E79D 4ZIRB 2TSYB 5LP6C 3UMBA 2FJ0A 2OZLB 1ILWA 1EX1A 4G9EA 2CUKA 4D9EA 1OIWA 1J8DA 2R7MA 3TLEA 3U56A 3IAEA 2H08A 1E6UA 1G5HA 4EHNA 1H4SA 1EWTA 3JYQA 1X9HA 1E1LA 1SIUA 1WB5A 2WMOB 3OEWA 3SZLA 1PG0A 2P0YA 1DTWA 3UIEA 3DFIA 2OCYC 3DZHA 2FW7A 4QTZA 1KPIA 3SR0A 1DJNA 1YI8A 2GWHA 4W1RA 2ZKLA 4MDFA 2R47A 4JQSA 5HCIA 2CZGA 1H0RA 4IINA 2ZAOA 2F1RA 4P8RA 1SHJA 4QSHA 2PRSA 3D0OA 1D09A 3P0EA 4XQGA 3TDKA 2ZYIA 2IHNA 5IJ0B 1SU6A 1LBEA 2HWKA 1GDHA 5EKDA 2LDXA 4KE7A 2C5HA 3JXEA 1QBGA 4BFXA 3JWEA 2LW7A 2XKBA 1V8ZA 1QZZA 2X3UA 1U8AA 3G0HA 1Y8QB 5ECWA 2DQKA 2D13A 2VDOB 4GLFA 5LZ4A 2PR7A 1CR0A 1Z28A 3UJNA 4IIDA 2JGAA 5CHYA 3V6LA 3ILVA 3LOUA 5IC6A 3NVKI 3DE3X 4BIIA 4BLVA 2I62A 5TXGA 3G68A 3NIWA 2CC2A 4DRYA 2I29A 2YTZA 3B2EA 5EG5A 4D9FA 1SPXA 1NW7A 1U9CA 1MOQA 1CPYA 2XXJA 3O9VA 3HY6A 4FXOA 4US1R 3C3CA 1B0ZA 1OXXK 4UUAA 5A5VA 3VU9A 3J81k 4W5TA 2DGDA 1SCNE 2AK2A 3AETB 3DO5A 3Q3JB 3THWB 1FJXA 1GPDG 4UTZA 3P19A 2FPOA 4J2TA 2QYHA 2XWBF 1OBVA 5F4BA 5I9TA 1CIVA 4W9NA 5T4FA 1Q16A 2KX7A 3TXXA 2HF7A 3RT7A 4O2BB 3T7IA 2Z5FA 3EQ6A 5GONB 4IFTA 2NUAA 1W85B 3K20A 3MILA 5DIZA 1DT3A 3VISA 4CIYA 3FHLA 1NVWQ 2Q2QA 1SCQA 2WVGA 1E62A 1KS9A 2SCUA 2X6QA 5BYKA 2W2NA 2ZW9A 5G4LA 1Y7TA 1PS9A 3PKIA 1E99A 2YJGA 4PSUA 2J4CA 3FTCA 5CX4A 1G8YA 5HJ2A 3BMQB 1BYIA 1OT5A 1ZM3A 2FI1A 3NCHA 3SDZA 3C7AA 4P4LA 3SQXA 2PBFA 2FZKA 4CMAA 4AWAA 1VM6A 2FQYA 1DAKA 2HRBA 2QLBA 4MB6A 1B93A 2XY4A 3RYHA 4JN6B 3KOXA 5H83A 3R7SA 2P91A 2XUKA 3FDJA 2ZSBA 3PQEA 5FIUA 3QH4A 2E4UA 3L7LA 5JXIA 4ZT5A 1AU9A 4XB6B 1K3FA 1XXHE 5IS2A 5DHQA 1N9KA 1W2HA 4ARZA 4YUAA 4DZRA 3OCYA 1KOLA 1SMKA 4PAQA 1U0FA 3Q10A 2RC5A 2ZANA 1T1GA 3BFKA 4INOA 1VXOA 4MUXA 5ENDA 5A3SA 2CDBA 3W7VA 1AK2A 1E0DA 2IHYA 2QMQA 2YHIA 1F6WA 5FYDA 3ETCA 4ZC8A 4CFSA 4EFKA 3A6KA 3PJFA 3WQBA 5C7IO 3VR5D 1GCIA 3AM1A 1UBHS 3NDRA 3QVWA 5AVJA 3AR9A 3V3KA 3WK5A 1MW8X 4G4JA 3GEGA 3VH1A 3D8HA 4O3MA 1XDZA 4JGIA 3RAFC 3GRRA 3K2BA 1T3TA 3W7AA 2RGYA 3H2IA 2B2NA 3ZIAA 2Q5JA 4MQEB 1TU4A 5EC8A 5EJGA 2FJPA 4MRAA 2Q46A 5CTAA 5G41A 1PJAA 1L4EA 1QAQA 2XNKA 3WB2A 2OBLA 1MJ5A 2AZ4A 4N01A 3O4FA 5HGXA 5GV7A 3WL3A 5AKYA 1SVOA 3N5KA 4GR4A 4LTMA 1LLQA 4H7KA 5IH7A 4XWYA 1RYNA 4UTVA 3UGJA 2Y05A 3AR6A 2NGRA 3H4IA 4DY6A 4MVJA 5ELMA 4DRZA 3N87A 4NJMB 4MUAA 5KQLA 2KLHA 2I6QA 2IDJA 4GSKA 1F60A 1GLGA 2Z2XA 1L1QA 3T7AA 3VR4D 1XVTA 1FJ2A 4ZDKA 3QKWA 1Z75A 2F00A 3MJVA 1M0WA 3UOWA 1ZRMA 4Q7LA 5I7HA 5IT4A 3N2IA 3SSMA 3K1AB 1KSHA 2RGXA 3WWEA 2POCA 4MRMA 1HE2A 2C5LA 2VPQA 3G1TA 3KKLA 3C8DA 3RUCA 1P6QA 4MVJH 4AJOA 3G82C 4OQYA 2R48A 1LSUA 2EHJA 1ICIA 2HJGA 1JSCA 5ALSA 3ZQKA 2AI3A 3C5CA 3P26A 4MVYA 3HXLA 3H05A 5J2TF 3LYUA 2FEPA 1JHRA 3PVSA 4MVJI 3DZCA 3G9ZA 6AT1A 2FVYA 1ZCAA 4KE9A 1QTNA 2FPRA 5H3HA 1O89A 4RANA 2GCEA 5DHRA 4EENA 3D3WA 4F4UA 2GLUA 4S1PA 1FS5A 3ZY4A 3VNUA 2FPMA 3ADOA 3JWPA 1ZA2A 3GA5A 2VAPA 1N6IA 1ND5A 3GGCA 3EBOA 4JOQA 5CT6A 2CYAA 3Q12A 3GFGA 2ZTUA 1AUVA 1CJKC 2DTDA 5ICMA 2P0AA 1L5FA 2WTBA 1LC0A 5CD1A 1JPVA 2ZRCA 4LE2A 3RFXA 2VCHA 1AB5A 2XSZD 3OD5A 4YT4A 3GZJA 2PWZA 3FROA 2NYVA 2OOKA 1OFTA 3NLLA 3PTZA 2FN9A 5EWMA 2HMYB 3FUCA 3H84A 3ZLJA 2X4DA 1LLCA 2BGWA 5K0EA 3RSFA 1P4SA 2VDJA 1VSVA 4E33A 3PGKA 4DLXA 5EQJB 1ULUA 4C7XA 3Q8MA 2BGJA 4GOXA 3RKRA 2PVCA 1E6MA 1GRVA 2GPSA 2ZCVA 2O20A 4UFOA 4MINA 4ZC1A 4JJAA 4R8LA 3KKEA 2ORED 4M36A 3EPHA 3NV7A 1TQHA 3EY9A 3IH5A 2QUBA 2ZDHA 4EZBA 3PNSA 2OGUA 4C21A 1NI4A 1JR3A 4RJKA 4Q6BA 4TKZA 3IP3A 1REQA 1DC3A 4UBKA 4DCUA 3IURA 3RRYA 2OQ2A 4OMUA 4G5HA 4LYGA 4E5PA 3CRW1 2J3EA 3ESDA 3M2PA 3BFPA 3QU2A 3M7IA 1KZGB 3AUJB 4H2DA 2W6NA 1L0BA 2PIDA 4QUAA 3O4JA 2A1TR 1YRBA 1WM1A 1KRWA 5CGQB 3UY4A 3W06A 4AO8A 4RVGA 1FF9A 1BMQA 4GDFA 1OIVA 2D8MA 5AHRA 4ZZ3A 7REQA 1KU0A 2QRZA 1Z33A 3N8KA 1DWUA 4RUKA 4I36A 4ZPXA 5ITSA 3BTSA 2B8JA 4G0XA 4N54A 2AS0A 2AKYA 2HI0A 1DIAA 1K2VN 2QTHA 2WVJA 4ZEXA 2FFRA 2IZ5A 1YO6A 2J32A 3RV4A 4PYMA 3S4YA 5JD4A 1D8AA 1QFJA 3MWJA 4X65B 2X14A 1BHQ1 4TLAA 1U5BB 4EB3A 4AQ7A 1M2VA 3OI7A 4QC2A 1HDCA 3RRZA 2AKAB 2A6PA 2VYVA 5KJEA 3AR3A 2OCBA 2Q2NA 4M8IA 4CTOA 3DEFA 3DOIA 4LZNA 1XCJA 4FC6A 4UE3S 4U7HA 1P62B 3ICQB 4IKPA 3BH7A 1ZHOA 1BN6A 3ECCA 1JS1X 2QM3A 3PXAA 2NZ8A 1M34B 5HGJA 1CHDA 1U9YA 3PD7A 4KUHA 3B60A 3R7WB 3UT6A 2QI9C 3WL8A 4OEHA 3RODA 3TKAA 1L8OA 3CLTC 4G4SO 3T0GA 1WY7A 3K9LA 1M2OB 2IIBA 3MMPA 5HWSA 4AJPA 3TEJA 2C4NA 5HK8A 3WNZA 3VBCA 2CBZA 3RS8A 2JJQA 2KB0A 2V7UA 4URVR 4Z53A 4TRRA 1T4MA 3WZMA 4BECA 1MENA 2I1WA 3EUWA 4L95C 4M54A 4L4XA 2XA1A 1RAFA 1EFUA 1OFGA 5ALZA 5JZOA 4MWSA 1I4TD 3U3MA 1ZJYA 2CB9A 2DVMA 1SRQA 3GEHA 5AKHA 3VNSA 4LF9B 3AV0B 2J0QA 2GN8A 3IE0A 4ER5A 4OH1A 1S2NA 5AKEA 3QX8A 1M2GA 4BHTA 3ZD6A 3MS4A 2A9RA 5EZYB 1FU4A 1K75A 1LBQA 3C48A 4B4UA 1NXTA 2VF5X 5IK2A 1BQ3A 1VIAA 4X7RA 4QRDA 4TT3A 3RADC 4JI4B 2VZ9A 1Z4IA 2CLDX 1MO2A 2R1TB 3OZDA 1QGUA 4NU0A 1IBLB 3A25A 3CBGA 1KRXA 1ZW1A 4RSRA 3HNOA 2F8SA 1ECBA 4I2VA 3JYPA 4R1PA 2A5JA 3OEHA 4OBBA 1UP4A 5DSZA 3BIFA 3VOBA 3BDVA 3SS9X 1E18A 3IDOA 3SHOA 1T0JB 4WNIA 1CUDA 3F2IA 1F7VA 4HB4A 2O8FA 4U2BA 3MSXA 5EJ2A 2AGVA 2EERA 5AXCA 4E5YA 1DCTA 2C9CA 3DL2A 3KB1A 3HXTA 2D2XA 3ZS8A 4NYIQ 1XCGB 2QNIA 3QI2A 3Q40A 4MVJP 4H17A 5EYPB 4YO7A 5F3RA 4EW2A 3C1TA 3SJBA 2P2YA 1NY5A 2I8LA 1RBZA 2OECA 3KCQA 2PKCA 3WQHA 2FEAA 4YJ2A 1U28C 3GUHA 4JYCA 3UMFA 3ASUA 4NPAA 4OQQA 4B6RA 3E9QA 1DIBA 1BS2A 1MV5A 4ZK6A 4P2GA 4RA6B 4F9TA 5EMNA 2WY2D 4DT1B 3C3MA 2D5IA 1SOAA 4CPDA 4D9CA 4YLEA 1N4DA 2O1EA 4FJ0A 5EZ5A 3FB1A 3BUSA 1NR7A 1EWYA 1AV7A 1R6AA 4NDAA 1AZSC 1FK8A 1PQPA 2IEAA 1MH1A 3O8BA 5HIIA 3O84A 5BYBA 2RGRA 3IHWA 4GEKA 2AOTA 1BE1A 4DL9A 4IJUA 2QAGB 1FP7A 1SD2A 2FW0A 2VNHA 3I2FA 4HD8A 5TV2A 1UAGA 1JRLA 1VSQA 1PSZA 2KW5A 1EFRA 4JJIA 2H7YA 2YINC 4ZYTA 3B70A 1NN0A 5K09A 3K9NA 3R9XA 2XE7A 4PZCA 4C7KA 1SOUA 5F9FA 2PSSA 2EX1A 1PK7A 3A28A 4ND2A 1GZHB 2GJKA 4NZMA 4RV5A 3WYAA 5KPDA 3GLGB 3B1WA 5UKDA 2EARA 4EGCB 1SVLA 1T15A 2GAIA 2IEBA 3E15A 3EGDA 4EB6A 1NIJA 5LYJA 3IFSA 1IMOA 5LWQA 1A5ZA 4D42A 1RWPA 3E05A 2G71A 4YGXB 4IUDS 4Y1GA 1WR8A 1OAOA 3PUXA 1FYWA 3ZWXA 1LTHR 2BTEA 4OSEA 4QODA 2ZR8A 1SB8A 3AONB 3HDQA 2YFQA 2O2SA 3VHXA 4F5ZA 4HMOA 1YR7A 3OTHA 2EG9A 3N0XA 4HATA 1F5NA 3HLTA 3OVMA 4JD5A 1XZHA 3OPQA 1YFJA 3NTOA 1M2EA 2BGIA 4PS1A 3U4CA 1XJQA 5L3VA 1WXXA 3AHJA 2CHFA 4JLOA 4O2AB 4D0RA 1H93A 1IHXA 2VT6A 5EHIA 1LBSA 4TXHA 3K0FA 1A8SA 1GZVA 2GAFA 2PV7A 1E3WA 4K9QA 3K2IA 3E6AA 1Z07A 1Q50A 4ZVMA 4EGQA 1CDEA 2WT8A 3PSHA 3CT4A 3DLAA 4AYWA 3SX2A 1T6YA 4UJ5A 3L43A 4R71A 1N5IA 2LVBA 5AMXA 1HPLA 3S70A 1J70A 3U2QA 3TTSA 4YPOA 1HLFA 4G0YA 2M2IA 2QMYA 2RH8A 3QFHA 4QPZA 3UUEA 3G7UA 2V7BA 1AQYA 2F43B 1T4DA 1S9HA 1UMKA 3F8WA 4WADA 3O26A 2XDQA 4IXWA 4KG7A 4LRXA 4TMYA 2H2GA 4JVMA 3U3OA 5I7EA 3VNVA 1WLSA 2QTVB 1USKA 4OLFA 5ICSA 1WWKA 3FYTA 3E4CA 3RUEA 5TQVA 1UFOA 2C0QA 1DUVG 1R4ZA 2QDKA 2FPGA 1C7JA 1FVFA 1M74A 2HU5A 1P2BA 2QG4A 3AQIA 3FWNA 3DP9A 3HA5A 4RWZA 4MQMA 1FSGA 2C59A 3H5IA 1DO8A 3C5HA 2YKGA 2HEGA 2P40A 2RBKA 3VYUB 2ON6A 1GGMA 5CURA 5HUHA 3AVUA 2CCGA 1T91A 3O4HA 4R2JA 4OOEA 5B3AA 1XKQA 2XIQA 3KHSA 3TJRA 5BSFA 3KEFA 3EQ7A 2V6GA 1VPTA 3FOAA 3W2TA 5LDHA 2ZZMA 3LPNA 4FGWA 2J5QA 3T8YA 1NT4A 1Q83A 3C6ZA 1K9SA 1KMIY 1Q20A 2PX3A 2XYQA 2YBEA 4XRGA 4D26A 2QN2A 2RKBA 2JKVA 3HDGA 3N07A 3JAKB 2WSLA 3QKIA 4C0LA 1LQ2A 3K5WA 2DFPA 4F3RA 4O2RA 4L2IA 3GHYA 1TKRA 2CDAA 2I4MA 5JS7A 1VFNA 3M9XA 2GFQA 3TG8A 4XIYA 4EMTA 4PRLA 4HEA6 3PE6A 1ZGJA 2X86A 3L7JA 1VBNA 1Z25A 2D4HA 2E3JA 2EW2A 3MPUA 4LXHA 4I66A 1YA6A 3M6MD 2O0HA 3BS4A 3HCDA 4W5WA 4YP5A 1N0WA 5DZSA 3WRXA 5JS1A 2C77A 1WU8A 4U6SA 4JLPA 4W9MC 2CHUA 4UQOA 3I01M 2PZEA 2VWGA 4CHGA 1IXYA 3PNMA 5TLSA 4ETMA 4CM9D 2FKAA 5D3MA 2A86A 3UK7A 1LI4A 3ZE9A 1JFFB 2XOXA 2ZIWB 1JIVA 1GUBA 1QXSA 2P5YA 1I32A 3B48A 3SKVA 1XZNA 2QTBA 4G67A 4TV9F 5JO9A 2AOUB 2ZTVA 3ZDAA 3B3GA 1KFJB 3IQWA 4U9HS 3ZNOA 1CW2B 2JA2A 5KKCA 2R8PA 2PBLA 3STVA 1IB6A 4ZEOA 2VAMA 1Q7RA 2XD4A 2VJCA 4IX1A 4QG7A 3K6SB 2Q3JA 4XR9A 3U4QB 4R3UC 3IILA 3E3MA 1I4OA 3N58A 5JNTA 3OMLA 1QYDA 1Z3CA 5CNMA 4OFBA 1BG6A 5JVDF 5KWEA 1YC5A 2I3AA 2NVUA 2WKSA 3HJGA 2QG6A 5G1OA 4F4FA 2WUWE 1BE8A 1IHUA 2RHBA 1JJ7A 3T3OA 1E0AA 2QRQA 2VC2B 1A77A 3LUBA 3MERA 1C7IA 4HQNA 4BNDA 2HR1A 4Y0AA 1J8QA 1UWKA 1QH8B 4L7QA 1O94A 5SICE 4PXSA 1SELA 2VAXA 5AHKA 3ETGA 3WLFA 1CNMA 4K9SA 2HRRA 2I4NA 4M21A 1Z0FA 3QSYA 1NRWA 2CV0A 3KSDO 1J2UA 1K5DA 1WTCA 2E89A 3DZ8A 3U1BA 1B14A 4RVHA 2B61A 5LBUA 3CW2A 1Q0PA 4O63O 5DRYA 2FZ4A 1ISIA 3B2QA 2J3IA 1J5XA 4G86A 4M1ZA 4ZO7A 1XQWA 2CL6X 4G2NA 2QE7A 3IAXA 2XPCA 1MJGA 2Q4EA 4KWIA 3EEQA 2V7QD 3LVFO 3Q0EA 5KJCA 1DKPA 1XRNA 3K0CA 4DUYB 2OKCA 4J0HA 4BZZA 5KQSA 4JDUA 1L7OA 2GK3A 5E0KB 1TQDA 5D85A 3ZHRA 1XLTC 4FHCA 3HK2A 1KMQA 2RHHA 1QMGA 2HY7A 1QV7A 3QHQA 3DBOB 3TR5A 2I8CA 4C0HA 2GEUA 3FYSA 2EX0A 4I1YA 5JV5A 5CBKA 1BQ4A 3FMGA 1T4CB 3AUAA 3BGVA 2BKAA 2MTBA 1DAFA 3L8GA 3PQ8A 4V0OA 1QM5A 4ITVA 3T5GA 2H1OA 5G1PA 4QQRA 4RCVA 4F45A 4N7RA 2FEMA 3NM5A 1MNAA 1U1GA 3E4DA 3SC3A 2H9IA 4OGGA 3HS3A 3G5UA 2C20A 1QDUA 3GJTA 3CGGA 3LJKA 1P33A 5GWXA 3HXMA 3SYKA 1UL1X 4J0JA 2NU8B 3GG2A 3MTJA 4LJ5A 1CUVA 2PLAA 2FW1A 4JJFA 3JZFA 4NZZA 3N8NA 3FR7A 4NATA 1VHTA 1PZGA 2DZDA 4IIJB 1PFYA 4YBZA 5FA8A 4I5GA 4RDHA 3OA2A 4S04A 4WZAA 5DYYA 1DBPA 5D87A 5LNK1 3FMIA 2IYVA 3ZH9B 3Q4GA 1BYUA 3GYGA 3EPJA 2SBTA 4Q9HA 3A1CA 2AMYA 2O3SA 1JXQA 3NHUA 4TL8A 4PPNA 2VTBA 2QMUA 1KKUA 1J0AA 1T6ZA 5K3AA 3AFOA 4V0ME 4GBED 3GLSA 3SCZA 1F2DA 3PHLA 1JU4A 1RXIA 2WUDA 2A9PA 2YCBA 4GMGA 2OO7A 3IO3A 1UMCB 1X7XA 1BXRA 2B37A 4IOKA 4PYQA 3SWWA 5K8VA 3LHFA 4DXHA 1AO3A 5CFMA 3MELA 2WD9A 4YMIA 1U7TA 4CTKA 1E5QA 3OEED 3U7RA 3WV4A 4JL8A 1A98A 4D7AA 1C9JA 2WG0A 4N7JA 1XB2A 4YRQA 4OPMA 5CT4A 3E3OA 1GNVA 3KHUA 3RU2A 1IE3A 3GCDA 1RRVA 4JB0A 5DGHA 3WOHA 3UFXB 4B33A 1DJMA 2GD2A 3U4AA 2IBMA 4I1SA 4AG3A 2GRJA 5JSZA 3S5JA 3ZR4B 5T3UA 3F5DA 3PRHA 2JK1A 4CTNA 1WUTA 1J0DA 1D2GA 3HRHA 4L6CA 3RFCA 5H02A 4YH1A 4RPCA 4E2YA 1V1MB 3NHZA 4GM1A 1IZYA 2AN4A 2PA0A 4JSRA 1XQ1A 1QK3A 4MW6A 1UINA 1BRMA 5KYUB 1IWBB 4KXMA 2HSDA 1L1EA 4YCDA 1FQJA 2HQ1A 4JNCA 3Q6MA 4Q12A 1Z06A 2ZE8A 1M3SA 1ZHFA 3EQ2A 4IR7A 1RKXA 2WE7A 2W6MA 4RKRA 1NBMD 1CC1S 1RQ2A 2JIBA 2VJAA 2XE6A 3L6CA 3Q3GE 3G2KA 4MDYA 4N3CA 4Y9DA 3RFFA 4RCZA 4E30A 1OC2A 5IBRA 4HWTA 2G36A 3KEQA 3SOPA 2PWYA 3HJUA 3B7PA 2YYSA 3WMEA 2YHSA 3FNGA 2PUCA 1D2CA 2BEVB 4MV5A 5KS2A 3UHJA 2F6RA 3BGIA 3ADDA 1WS6A 3SXUB 3KDPA 4AXXA 3LC7O 2AJ8A 5MDHA 3E9MA 3WKAA 4ZU1X 4DR1B 2JGEA 2TYSB 3ZC3A 4MQLA 3GAAA 1HNWB 3KZVA 2P1RA 4YRDA 3RSCA 2TECE 3OAAA 3T7SA 5AW0A 1I5OA 1KP2A 1XQYA 2YNMC 2Z09A 3I1YA 1DFIA 4P7KA 2C9MA 2ORYA 1KVTA 3QZUA 1CQPA 2D0OB 3FWKA 4DLNA 4A15A 1SNYA 2YCLA 621PA 1TXGA 3QGMA 1ISHA 2QR5A 4MB0A 3JQEA 1MABB 2B9VA 2OR3A 3GFBA 5JSHA 4FW8A 3DJYA 9MHTA 2K2QB 4JC5A 4UBIA 2P0EA 2A1IA 3B6MA 4D81A 4AN4A 5LUAA 2ZT8A 5B2FA 3FSRA 1PX0A 4J94A 1V7ZA 5T6BA 2YJ6A 1IY2A 2Y2VA 5EKTA 3THOA 5BR4A 1EA7A 2QIOA 1PUJA 1KDYA 3BHJA 3Q3CA 4C6HA 3FWYA 1KO8A 2XNSA 1P2GA 2F3UA 1HLGA 3PEFA 4LYJA 4QAJA 1Q17A 5J9FA 2DG2A 2Q2VA 4CW7A 4TWZA 4UUQA 4G6ZA 4O1IA 4MJLA 5LP6A 4IHJB 4WXHA 4HNQA 1C5KA 4BNFA 4G2TA 3RJMA 4MCIA 3E35A 4QPPA 4ZCPA 3OZTA 2IP1A 5JOQA 2AFHA 5ITWA 3SJZA 4AG5A 2AG1A 3VZRA 4B2PA 1J23A 3E9EA 3IE2A 5IANA 5KYWB 3AHEA 3ZWBA 1GZ3A 1K88A 1QYRA 3NKFA 4JC0A 3ZLTA 1LBHA 2BGKA 5AVTA 3WMFA 4LKRA 1YUNA 3I5YA 2JLYA 3WNDA 3CR3C 1ECPA 2VJMB 4OHYA 3V4FA 3L0CA 1FS4A 3E5MA 3UKDA 1M7BA 1N2IA 5KWJA 1JPJA 2OQVA 4OHRA 3R9KA 1RYZA 2PRJA 2C2GA 4QJ4A 1R88A 4K8RB 2GDJA 4E11A 2CXPA 3W6ZA 4HLNA 3F98A 3LUDA 5CB4A 1XPJA 4DKXA 1HDGO 1QAOA 4DDKA 3N6VA 4M8LA 2QZJA 1PGOA 2VVTA 4YJ3B 5I9LA 3UMCA 4MVJM 4ZU6X 1A82A 2XF2A 4N9WA 4UHKA 4MQFA 1KQ3A 4IDCA 2HK9A 3B20A 1Z73A 4TYNA 4RV4A 1Z8NA 3DBHA 4HUJA 4C05A 1QYVA 1F8XA 1N6NA 1Y6RA 1RI5A 4OGLA 2AUMA 4PHTA 2AI2A 1OKKA 3KTDA 2LWIA 1P6UA 5ITVA 4H0CA 4MYDA 2CDNA 1ETHA 1L9XA 1TKAA 1XJCA 3KQMA 2IH4A 1UP7A 2F3TA 4TTTS 1ZOIA 1LBIA 1L5WA 4OIMA 5AWFC 4NEHB 4FSHA 1TOAA 4B43A 2XGJA 3I09A 4ZT6A 5GTDA 2IYFA 4Y1RB 3DLIA 3G0GA 1PDWA 4XX0A 2AQHA 5DNUA 4COOA 4D4KA 2JI9A 2CNWD 4PTZA 1JQLB 5BSHA 4ILKA 3C7TA 4GYKA 2IXFA 2YOGA 3CWCA 1MP0A 2PVPA 3ESYA 4XOIA 4CQLA 2JLCA 1RBMA 1Z4KA 2VSQA 5JD6A 1PAUA 4CM6A 2ZRJA 2WT4A 1QIGA 3FUUA 3CO5A 3THXA 3L8DA 3CM0A 2W6CX 4CT0A 1QU3A 2Q6VA 5EGSA 2WE8A 1U99A 2CE2X 3M3HA 4X1YA 1MEOA 1T9HA 4YJHB 5JC8A 5KNLA 2W37A 4D9HA 1WHSB 4HP8A 2NAPA 2OAEA 5MHTA 1DFHA 4BLSA 1K8YB 3WRYC 1OHHD 3U44B 1QC5B 3NDJA 1Z3IX 3O93A 2BFEA 2O0JA 2D1TA 3HM2A 2C07A 1U1IA 3HUFA 5A6SA 5DNCA 1SCAA 2C4TA 4TWJA 5SYMA 1VJ5A 3IP6A 4B0PA 2YXLA 3IODA 2VT2A 1KHTA 3EXFB 5KYXB 3K6RA 2J7KA 2IPOA 1QX4A 2VUHB 2BJWA 4PQGA 4XEUA 1T36B 4F86A 2I76A 5CLFA 3L92A 2XGGA 2I55A 3N75A 2HIAA 3O38A 2JVKA 3PUZA 4GVLA 4ZGWA 2VCYA 3GLTA 1U2SA 4OAOA 2Y71A 2E5FA 3LPCA 2Q6TA 4DDUA 4ND4A 4LVNA 3JATB 4ALIA 4INJA 5A1TA 2XWJI 2MYNA 4CLDA 4AW9A 5ARBA 1X0VA 3JAWA 4ZI7B 3I9NA 4Y9SA 2WM8A 1VJGA 1DCMA 3DE0X 4MK4A 4PX9A 1AQJA 2A7XA 2C4MA 1WP4A 1AZWA 1JG3A 1P4JA 1HZZC 3BTUA 3PQFA 4V2UA 4YTEA 4C3ZA 5K0SA 1EQAA 1RADA 4B4VA 4QGBA 1LBTA 1YHZA 2LCIA 3RFUA 1J2YA 4NV3A 5B30A 3V4VB 4RF3A 3C8HA 4EYKA 1VJCA 5KTNA 5DM70 2JCBA 4HOYA 3QPAA 4KODA 3WI7A 1X0XA 4OUDB 2NMVA 3OA0A 2QSZA 1B6GA 2HREA 3OQNA 5BSKA 3P71T 1E6EA 3VBEA 5HOQA 5ALLA 2FHSA 1YS6A 3OTWA 4US0R 1ZD1A 1LKZA 1FFCA 1JNXX 3AHGA 1L4UA 1ZUNB 2PSDA 4KQMA 1YKFA 3VKWA 3QUSA 3OETA 1N3LA 1YGYA 3BYZA 1GQFA 1SC3A 4F7DA 5AW7A 2OFWA 2QN7A 4LGCA 5JZVA 1GTSA 5I51A 2QTGA 1SH7A 1IAQA 2PCJA 2E4WA 2IT1A 4PSVA 3N2NA 2ZOSA 2I1VB 4ZO8A 1CIJA 5T5QA 4KNWA 1AOXA 3MJFA 2P1ZA 1YA8A 5LL6P 4UEWA 2FP4A 5TRTA 4IEEA 4B82A 4B31A 2H2FA 3EIUA 5G02A 4HBGA 2BM9A 4JVLA 3G5AA 3SMQA 5JSFA 1WEKA 1XMXA 5E1BA 5E6SA 5FKJA 2Q6IA 4JJ8A 5JAOA 2NUTB 5C0OE 5DRTA 3LQYA 4D5GA 3NPAA 2Q1XA 1BZYA 2JI4A 5FADA 5K2MA 3VFDA 4YXWD 4Q3EA 3FW1A 3ZW9A 4D0LB 3BAFA 1L8XA 2AYZA 3OQ1A 4HAXA 2W2TA 3VZDA 1JE0A 4OAQA 1D2HA 1V7QA 2W2OA 2JIQA 1WF3A 4J0KA 1QQBA 1W5AA 4URYR 5ESDA 2ZWVA 1CEYA 1Y1LA 3KDSE 5HILA 1WX1A 4JOBA 1RI1A 4TVKA 4D46A 4ZWNA 2ZWOA 4MUBA 4K6CA 3JQ9C 2L17A 3SPXA 4UNNA 5LDGA 2GJ4A 4DVJA 2X4GA 5LLTA 3CHYA 3FLBA 5IXJA 1MDFA 2PUVA 4RF4A 5HM8A 5BW6B 1VMDA 3KQHA 4BO2A 4EQ6A 1G6Q1 3BCRA 5EAIA 1JLRA 2WSSA 3BL5A 1WCXA 3RW9A 2D7JA 5BN5A 2VIIA 3IS3A 1EP2B 4ZRMA 3TTTA 1NYRA 1M9NA 4HYEA 3EIWA 4ZHQF 4ZICA 3K2QA 1IY0A 4NULA 1LDBA 2Z3ZA 1RKUA 4BTVA 4MWTA 4KO1S 2AX3A 3G2NA 4PGFA 5EMLA 1W7AA 5J47A 4ZN6A 2R6AA 1EDBA 3IP5A 4IJWA 4DCPA 1L6RA 2PQ6A 2VHYA 2W93A 4YRPA 2OXTA 4DFDA 4P35A 4ZJUA 2PT5A 3ASZA 5DCWA 1CRPA 5AQ1A 3TX6A 1S8AA 2DUUA 1H69A 3DHNA 3JRXA 3O8LA 1YV9A 4FLMA 3PT5A 3I0MA 4K88A 5J23A 5I45A 2CK3D 3DT8A 1A8QA 1E66A 1JLKA 1TEHA 4MICA 1RI4A 2LD4A 2AG0A 4ZVPA 4DIEA 1HT0A 1J0EA 3N2GB 3ZWYA 4NABA 1DWOA 4R0MA 3U7IA 1I2ZA 1CQJB 1YZUA 1RYFA 2Q1WA 3Q3IA 3EEFA 1H94A 2HA4A 3DUFB 5CT9A 3EN0A 2GGSA 4L0DA 4LDRA 2KYRA 3TB4A 3BK7A 4RAOA 4L8WB 3DHEA 5AO9A 3OQJA 4R9SA 4AZ3A 3E9NA 1FQWA 1MXHA 1OXUA 2H63A 3BKWA 3B12A 3E3LA 2QU7A 4A82A 4DCSA 3CSSA 4BCDA 1J8VA 5DX0A 2P67A 2W43A 2YFKA 2E1RA 3BWXA 2XLCA 1T5IA 5HVNA 3E23A 3LY8A 1E6WA 2X5JO 1XVVA 3OC6A 4G5OA 1FNMA 4U00A 5KSOA 1YQTA 2V8BA 3AB8A 2Q7DA 1AC5A 5L4SA 4Z4CA 4MZXA 2F64A 2FETA 4KDFA 3WQRA 3D0KA 3LD9A 5A02A 4PC2A 3SF8B 4UPDA 5KMGA 4A2QA 3QY9A 1DNPA 1KHHA 1HT1E 4R84A 5ALEA 1NBHA 2GXUA 2WK1A 3GRUA 4IIBA 4PYRA 1JEAA 1UKVY 3RSSA 2J3HA 3NEAA 3G0CA 2IU0A 4CE6A 2R00C 2Y1FA 1FXWA 3AIKA 1ZH0A 5E2AA 4PE5B 3KKPA 2GX6A 3ZWAA 1FUIA 3NHKA 4Q1CA 5FWXB 4FHZA 1DXQA 2JFVA 1C7RA 3A11A 3CA8A 3CN7A 4UMVA 3L8ZA 3Q9NA 3ZKWA 4CDGA 5BVGA 2VQFB 1NXQA 2JEZA 4DYHA 1QH1B 3ELDA 3OQVA 1T0HB 1TJ5A 3KQPA 4J6EA 1PJ4A 4FKMA 3RYIB 4B7CA 5EP2A 4Q4DA 4HDMA 1TVCA 1RWVA 3W9YA 1NW8A 2J3KA 3TMAA 1BXZA 4YAIA 2XXBA 3BULA 4MSUA 5BP7A 1N34B 1DUSA 1UJ5A 2G06A 3GX1A 3P0JA 2BFBB 3T41A 1GPYA 2WF8A 2XWQA 3GROA 2DLCX 1PTJC 3P8ZA 2GKOA 1DWPA 1EK5A 1O0CA 4HX5A 1Q1GA 4PO3X 4H59A 1P31A 3X1KA 1AKNA 1FP6A 2ZIAA 4YHHB 5BQ5A 2LKCA 4Q02A 4IHQA 5CB8A 4BLWA 4BLPA 3TTVA 4F6RA 4F11A 3JTMA 4DQKA 3BDIA 4A4DA 3V00A 2E4XA 5BNZA 1FFXA 3DW1X 4A27A 1JHMA 2RAFA 3KXDA 4L3OA 1CZKA 1YZ3A 2D8AA 2Q6OA 1L7AA 1XEAA 3K5IA 1YTUA 2O7SA 3AUKA 4U7WA 4UOEA 4CG3A 2D5LA 4P83A 5HCUA 3FOBA 3PQ4A 4LHXA 1PU2A 1C81A 2Y27A 2AIRA 3A2LA 3B52X 2DHDA 3FLMA 1VYUA 1PJZA 1ZD2P 3C6MA 4FCTA 4PONA 2I6SA 2PLFA 2XZLA 1A4IA 1J21A 2LCFA 4WK4B 2NACA 3EF0A 3OJOA 1CQIB 4D43A 3O2JA 5C1BA 3CYFA 1T2UA 1L1FA 2O8EB 3NVDA 3OPVA 5H68A 5B3JC 2BTQA 4EGFA 3CLRD 1RFGE 1ZXXA 4QE3A 2R68A 1Z34A 1KMHB 3AY3A 2FG6C 3N39C 4F7WA 4G0VA 5KU7A 2UAGA 4BC1A 2ZITA 4WGFA 1FVHA 4JHLA 5EJ5A 4KUGA 3GDFA 5LBIA 1V1JA 4OAPA 1DV2A 1U2QA 3AHFA 3T4UA 5LNK6 1V8FA 4MMXB 2GMWA 2KSQA 2UVDA 5EJFA 2EXXA 3IALA 1IOLA 3KFLA 4TKVB 2ICAA 5EXSA 3W1EA 5C32A 5BSGA 1JXMA 5F3WB 1Z5OA 2RB5A 2X76A 2ZJ7A 2A92A 3PX7A 2H4FA 3CEHA 4MUHA 2CYBA 2EFHB 3AIIA 3CB2A 4LC0A 1JECA 3P7MA 3NXSA 4IDFA 1AK9A 1NOKA 3ZJTA 3DV2A 3QELA 3SBDA 5DFAA 4P4UA 3KU4A 2NZJA 1D0SA 4JSYA 3LCCA 2ZAYA 4B6EA 3L7CA 1R8QA 1UK8A 3BH6A 3DWIA 1HQKA 1ADJA 3M6LA 1CF2O 3OFKA 5BWBA 3RUAA 4B75A 4EJ6A 2W6IA 2W71A 5ADUS 4P3OA 1PL8A 4MWCA 5E1OA 4KSBA 1U3UA 1I6LA 1Z35A 3N2KA 1HM5A 1QH9A 4O4IF 5KAMA 1AURA 4JLUA 3E58A 1QCZA 2QQFA 8GPBA 2R6GA 1ECCA 4WD3A 5CAEB 4IXTA 4TLLB 5C1DA 4GFDA 4UU1A 3R7DA 2C4VA 3ZGVA 2BISA 1O6BA 3FZNA 4DNOA 1YS4A 1AX9A 2OLKA 2UYQA 3F78A 3G0OA 4FCVA 3CPJB 2HIHA 3WHIA 2XR1A 2R2GA 2IYYA 3GD5A 3RIEA 5C5IA 3A3KA 5AP9A 5CJ2A 5GOZA 3A2MA 1UPTA 3M1LA 1NDUA 4EO9A 1S3GA 2BONA 3FVRA 1TVMA 3NRJA 4PIMA 1HL7A 2D5CA 2YWRA 5K0FA 1XZQA 1DARA 5M5BA 3W4JA 3AW9A 1I7SB 1G17A 5KQMA 1HUQA 1XRJA 1I6MA 2NTVA 3VR3D 2OHOA 1JLMA 2IY8A 1XDWA 3A1WA 3NAZA 2FMUA 4O4LB 4QREA 5LZ7A 3PCTA 4PFJA 1LLDA 1YACA 3SR3A 3B6JA 4TZKA 4MTLA 1IVSA 1YCHA 4C04A 4CEJB 1MJGM 5IH3A 4D3ZA 5F5XA 4JA0A 3EXG1 3OJFA 1EK0A 5LXTF 3BMCB 3MJDA 1BKSB 4XLTA 4S2UA 3L4BA 1VRWA 5G0UA 3T3HA 5CDFA 1I6KA 3PNQA 3RANA 5CLLA 5JFTA 3K3PA 4YALA 2AJCA 3GLIA 2C57A 2MT9A 2VK2A 4X20B 1JHYA 2CKDA 4UEOA 4WFJA 1NMXA 4CCSA 3KYIB 2ZYHA 3VGPA 2AF4C 3LP8A 4QO7A 2ZRQA 3C3PA 4RLHA 5JSKA 2FQ1A 4Z4IA 2QT9A 2WRZA 2BMDA 2YY7A 3RD5A 1VPWA 5FNZA 2YZKA 2WWFA 1QIIA 1U2RA 2QPOA 5DBEX 4AUMA 1PHPA 4H4DA 3L5KA 1NNSA 5LQUA 2A0FA 1Z0DA 1PGJA 5L3QA 2VYNA 5EIAA 1P74A 3TPFA 3KQNA 1UWVA 4F04A 1BCRB 3COWA 3IOYA 4QU9A 1C0PA 5AICA 2V54A 3NYQA 4Q4JA 5CYPA 2ZUCA 3MWLA 1OWLA 1JIUA 3FNIA 5G1NA 3AV3A 1EX9A 3DAYA 4NG4A 1AF4A 2QQGA 3WB0A 2BEKA 4IIXA 5G0SA 1WDMA 1OTXA 2PZBA 1Z6AA 4QU8A 4P33A 3SU8A 3OCXA 2O3QA 3KZNA 3ZIAD 3FMOB 4DXDA 1M34E 2Z6VA 3H1PA 2OBNA 2CMKA 3CUWA 3OZUA 4U6NA 3VR6A 1YR8A 1T2AA 2R7NA 3WIBA 5I7VA 5IKPA 4X00A 3L9XA 1SVSA 1XNJA 2HQRA 2R25B 3RCBA 3URMA 1K6IA 4U6QA 5HIJA 5LP1A 1U63A 5I8WA 1KI9A 3F6PA 2XTMA 4RGQA 1HZJA 1XROA 2ZTLA 1ZGHA 3OZXA 4GHWA 3V1NA 4LFBB 3AR7A 3OJXA 5D3KA 1TC1A 3Q8LA 3ELUA 1Z7BA 3AVQA 4IHKA 3TLJA 2CFRA 5FWNA 3EG9A 4J76A 4RK0A 5BV0A 1ICEA 5HKBA 1TUIA 3VR6H 1G42A 4N82A 4XDHA 2OO5A 1MB0A 3PX2A 3QE4A 1NNUA 2YV3A 1GKIA 2HRQA 1D0VA 1GPJA 2LR0A 2V7GA 2QD3A 2XNCA 1LSOA 1NVBA 4QYTA 3JYNA 3DVSX 5KHLB 1XOIA 3PA6A 2RGEA 3QQPA 4LAFA 2I9PA 3FGNA 1BDJA 1KVUA 4CF6A 3S2FA 1E1RA 3HKCA 3P4XA 3IRVA 3T9BA 2ZI3A 1KDTA 3L7BA 5AKLA 3H2BA 4U7FA 2LPMA 2JAWA 2QWXA 2YS6A 1MC5A 3HCNA 3RSOA 4QJ3A 3CSUA 5A3QA 4V02A 4URHA 5CH8A 3DYVA 3U17A 1QFZA 4Y2QA 5KDLA 3TRIA 3RRMA 2V3VA 2CLLB 3DBLA 4F85A 1XDBA 4FEGA 2EKDA 4RZ2A 1ST3A 4B7UA 2W6ZA 3H8VA 4CIDA 4YRNA 1FS6A 1QWSA 2C00A 4ZVTA 5JZBA 2RH9B 3PUHA 3QU4A 1EBUA 4BKUA 2ZRAA 1VQ1A 3DWEX 3GLHA 1AHHA 5DCUA 3CJRA 4TXLA 5L53A 4EY5A 2XZOA 1V43A 2B5VA 3FHTA 3GDHA 1G20A 2GH1A 3HYNA 4TSRA 1WHTA 1RM4A 4Y9TA 4JU9A 5JCOA 1O1YA 3PQ7A 3ICEA 2BC9A 4TWIA 3HABA 4MS3A 4B3GA 4MP6A 1QGDA 3ND7A 2JFQA 4OHBA 3TEFA 1KOJA 2XNDA 5KIAA 2MINB 3HYSA 4Z4FA 4LQDA 1QJCA 4KQEA 3SVZA 3KK0A 4WN9B 4ZRNA 3ROEA 5M34A 1RWNA 1VI5A 1J6UA 2NSLA 2Q5CA 4N5IX 4HFRA 4I46A 4DIDA 3FA2A 1XAJA 4D3FA 1TYDE 4B9AA 2G9ZA 1NMQA 3P0FA 4Q6WA 1U3GA 1LDGA 1OZ0A 2GBLC 3NUQA 4E21A 4Q4CA 4YFVA 3AM5A 2DMRA 3M8KA 4M0KA 4DB2A 2AC2A 2C3UA 2YJNA 2IQ5A 1CS4C 1RYEA 3GNLA 1MAUA 3FNFA 3ZY3A 2B9EA 3QE0A 1CUUA 1BEEA 1JDZA 3HI6A 3LT4A 1F12A 1JR3D 3L7IA 3LE8A 3KXIA 1DG9A 4TKUA 5JY6A 3VPSA 4AI6A 4M1SA 1SG0A 4RQAA 4J4BA 1NW5A 5A3RA 2X19A 1QP4A 3Q87B 3OCZA 1SXJB 4OTZA 2CXTA 4UZEA 2R8BA 3V1UA 1OZGA 1PR6A 1OTHA 1VBKA 1XD9A 2J30A 3FCOA 3GAMA 2X8JA 2ZZNA 3F3KA 2Q5FA 4B79A 4BFSA 4FGLA 1C1XB 3H0EA 3BGWA 3AI7A 4E51A 4YEDA 4QYMA 3GJ8A 4UDXX 4ENSA 3EVFA 4KX3A 3ROPA 1JW9B 1SQFA 3HR4A 4QXOA 1Z82A 2GNAA 4RPLA 3W78A 2OXEA 5ALJA 3GNQA 1DIOB 2PL9A 5F98A 2AQ8A 4HDKB 1JDBC 4TS9A 2FXIA 1N0IA 3MCWA 1JGTA 1WZNA 3D7RA 3GUUA 4Q1DA 5CB6A 2BFCB 4XH9B 1Z15A 3FN4A 3T5CA 3T1VA 1KP9A 3AM3A 1W93A 5DWQA 4Q3CA 4CU5A 1FXUA 1W0JA 1EBBA 5A4MS 4F8YA 5AVQA 1DOHA 1K7SN 1B26A 1QG2A 2EP5A 3UZUA 5BRAA 4C0QC 1YVRA 5H1YA 3RS0A 3CF4A 5BW8A 3BF7A 4MYTA 4L3WA 3K8ZA 1OVGA 4OQMA 3T5DA 1C2TA 4P31A 3T3EA 2B4AA 3HJAA 4OP3A 2XTNA 4LOKA 1N6LA 1P5ZB 2QE6A 4IEIA 3E1SA 5IYZF 1MC8A 3C85A 5L7WA 3ZXSA 1LVGA 2WJHA 3R5KA 4KO8A 4WNCA 4WBNB 4AWBA 3IYLW 3I4CA 3L6UA 1AQ6A 4HEJA 4BTEA 1ULSA 4WKBA 4PO8A 1KQGA 5KX5A 1JQAA 3PD0A 2EZ9A 2N75A 1ND6A 2WB4A 1SBIA 5C8YF 3FFWA 3QI7A 4HO1X 1L1RA 3WL7A 1XRRA 2DFDA 3P2JA 4V1CI 2ZSUA 4FJ1A 1J9EA 3BGSA 1E2FA 3S0JA 3EOAI 2WU8A 4UREA 2YNMA 2CW5A 3I1JA 4GOOD 4C07A 5KNDA 1HSOA 4RENA 1V39A 3M4XA 4LPKA 1CULC 4PAMA 4KFUA 1A4UA 5BMVB 3DR5A 2CNKA 3GJZA 2NSYA 3I9FA 3UWDA 2N0SA 1JH8A 3PI7A 4BTLA 3D31A 4FMDF 1C3LA 2L2QA 2VPXA 3L7YA 4GMFA 3T61A 4M0EA 1NVFA 3AZQA 2FEKA 1IUOA 3GLRA 3BHMA 3QIAA 4FD3A 4FEEA 4QXMA 2XMDA 3WDKA 3O7WA 4GD3Q 5B1EA 1TIBA 3FFXA 3PQDA 2VJKA 4MPDA 4WGGA 1I01A 3CKYA 1CBUA 5SYAA 4CKBB 5I47A 3FPAA 3GUYA 4W7IA 1L4NA 4N6OA 5KNDH 4FFMA 4DUZB 5KYYA 4XEHA 2EVWX 3D8NA 4F06A 1MQ8B 3I1FA 2CFTA 4N0MA 1QWOA 2E18A 2Z0MA 1KK1A 2JAXA 3PUVA 4H0FA 4I4CA 5BSMA 3ZHQA 2HA2A 2GF9A 3LCVB 5BYAA 6Q21A 3MNFA 3WE7A 2Z2KA 2ZTSA 4B84A 4CQJA 4R3WA 3F6RA 4NE9A 4J8PA 4FS8A 5TNXA 3OJCA 1X39A 2X3YA 4EG5A 3EX7C 3OQIA 2C4UA 3F7OA 4EW3A 3OTOB 4HH4A 3N8HA 1Y7PA 1DDGA 2CL7X 1JEQB 2OZVA 1L7DA 1BGWA 3ANTA 1SAYA 4TSFA 3WKCA 1QSGA 1YU9A 2IYQA 4HDOB 1KO7A 1OFIA 2UVPA 5D3QA 3SZ3A 2J9ZB 3HC7A 1N4AA 3R6TA 2DUMA 1QFSA 5BQXA 4AMBA 1AUXA 4HWRA 4QHYA 1TD9A 2G4CA 2FGKA 1M8JA 3D6AA 4DG8A 3GD7A 4MDEA 3GMTA 4QGAA 5K3CA 2J6IA 4PINA 1TB4A 3QE9Y 3DAOA 3F9RA 2J5BA 2ZYRA 1HYHA 4D9JA 4H7EA 4GPIB 3L1UA 5GM1A 5AKKA 4ND6A 1I4LD 4OKIA 3OLZA 3I76A 2P2LA 2BLNA 1JIJA 4UW9A 2FR0A 4MGHA 5FYQA 3OU7A 2J0UB 2J87A 2YVLA 3RBAA 4HAUA 3MWEB 2EEPA 4FDMA 1P9OA 4DDTA 4BVKA 1YOVA 1N3IA 1VG1A 4K6FA 1UDBA 4JAVC 4I1OA 2OBXA 1N2HA 3I6ZA 4R6WA 1LDYA 3R5JA 2FSPA 4HC4A 1SU4A 3V8VA 4G37A 4YLGA 4PEVA 4F3YA 5HFJA 2ZGVA 3OZIA 3KQUA 2EJUA 2FW8A 2Y6VA 2O7VA 4W5JA 4CT4B 4F1KA 2VSFA 1YJCA 5DXFA 2CBXA 4KR2A 1OE0A 1BMFD 2C2KA 1PWHA 2G70A 1JFRA 1F5SA 2OHGA 2WWTA 1G3RA 4DA8A 1A50B 1ESZA 1YHNA 4DA7A 3H5WA 4CHTA 3CPSA 3RTAA 2V9PA 2P3QA 2ZU0C 2QLMA 1Z5GA 1TVKB 1DC6A 2QRVA 2JCVA 5LBTA 2XMGA 4D9GA 1YWGO 3HWRA 4EZEA 1KY3A 3AXTA 4EX7A 2JG3A 4UTOA 1NE7A 2FZCA 1RHJA 1NQWA 4HKTA 3TW8A 5A9SA 4CKYA 3WRYA 4IJ6A 4RVFA 4ZTZB 1SOVA 4FB5A 5CFOA 3HB4X 2D06A 3F8SA 2QUAA 4Q15A 2VTVA 5DTQA 1GGJA 3WKEA 3MBKA 4GLLA 3MQ2A 4GGOA 4KIUA 5DYTA 2TMYA 3ZVLA 5AVUA 3SBEA 5KNBA 4LF6B 4EF4A 2BL4A 3C6YA 1BKYA 2JH3A 3UAOA 2O19A 4GI2A 4LFAB 3D64A 1YS9A 2F9FA 1BJKA 2P4HX 4NS1A 5D1HA 3AERB 3HG7A 4D8VA 1Z7GA 2C5AA 4CL2A 1CTQA 1T8RA 1AS0A 4HTFB 4O59O 3H1BA 3QWHA 1RFLA 2AZMA 1PV2A 3W5VA 1CUIA 3FM9A 1OVMA 3HP7A 1ZMTA 3HPRA 4YDSA 4MIOA 3V5NA 1GRNA 1YT5A 1PJ3A 4MVJG 5KNBH 1NLMA 5HJ5A 1NONA 2K87A 2J59A 2OKGA 2HV8A 3IDFA 1MT3A 4HK4A 2I2FA 1QZ3A 2CSXA 4DR6B 1XTQA 2QYOA 3OLYA 3TXYA 2QQ5A 2WJYA 1DP4A 2GVNA 2GM9A 3IC5A 1G6OA 2FPLA 1G5PA 2YRWA 3GVXA 3LLSA 5T8KC 1AKRA 3LT5A 1UXHA 4UPVA 1HZZA 1Y5LA 1IY1A 3DTYA 4OP1A 1D3AA 4RVCA 5AK5A 5DIFA 3T4XA 4F71A 1LXCA 1MV8A 1SFRA 3OCJA 4ITUA 4OI1A 2QM7A 4PQEA 3MEQA 4NENA 4EARA 1EVYA 1GAJA 1EX6A 1VG0B 2AK3A 2PK3A 4ZOBA 4GSYA 3ORRA 1RRFA 2XCUA 3EVTA 3GARA 3P5BA 3S7TA 3MRXA 4JT8A 1S2IA 3MJRA 4KZKA 4I1RA 4BEWA 3GN2A 4U3JA 1GA1A 5EHQA 5I7RA 1HFKA 4OCZA 4DR7B 1PT9A 1NPDA 3N2EA 3IL2A 1O9HA 1Q2UA 1E96A 2IFTA 2VLIA 3IERA 3KKMA 4M22A 2X7XA 3NFRA 2DBZA 3AOEA 1NV8A 1SZJG 4KH0A 2DH5A 1PFQA 4JITA 1OY1A 4Q3NA 5B4UA 2FEXA 3DEHA 5KNCA 4BWGA 4OHXA 3ZH2A 1FRZA 1N5DA 4REQB 4EO4A 2D1FA 3GT0A 5A0TA 2H5IA 4YI5A 3B1XA 4J1NA 1C8BA 2EP8A 2FSGA 2GN4A 2PIAA 1EFPA 4QSMA 5AM4A 4EI7A 1R8SA 3EC7A 2I4RA 2TS1A 4NQZA 4P7FA 1IN1A 1ISPA 1GPWB 1WUJS 1V5EA 3JR3A 1YASA 5FR2A 3D8BA 4AX8A 1PO7A 4LC1A 4YN3A 1JDUA 2I2WA 3P4YA 1PBNA 4LY3A 4X1KA 4OVKA 3R9IA 3UMSA 1KH3A 3PWTA 4JEHA 3HR8A 4QQ8A 2IOHA 3RLFA 3TBFA 1I13A 1WP9A 2Z8ZA 6NULA 1BVYF 5IX8A 1UBSB 3L5OA 1OYYA 3NDPA 4RIEA 3OE7D 4IAOA 1G41A 1JU9A 1LY1A 1NQXA 2WV9A 5DP2A 1U3WA 3GCGA 3STWA 2FDCA 2XQGA 4X97A 1NDHA 4QGFA 1VJTA 1IK4A 1D1TA 1I0IA 1LF5A 4RDIA 4BAZA 4BP8A 1RM3A 2G4LA 2J09A 3AF3A 3O4VA 4YONB 3R5SA 2WABA 3M6XA 3UJ6A 3HU1A 3P9YA 5DGCA 3MWGA 5SV2A 2MSNA 4LBWA 1NA5A 1H8ED 1Z18A 4JB8A 4OMFG 5FFMA 4LFCB 3WSVA 5HRUA 2UZ1A 3WGVA 3GNSA 2OHXA 4BB9A 4MVWA 3A32A 1W36D 3U7EB 1ZA1A 3LU1A 1WU7A 4FONA 3GQVA 3OKCA 2VWQA 3HDJA 3INNA 4MVXA 1N2SA 1MOPA 1SU7A 2WIAA 5DLEA 5C31A 1PYDA 5B6JA 1M1NB 4J2HA 3HHEA 2JHPA 3TCKA 3KKZA 1ZR2A 1MIOB 4MZDA 4EG3A 1CIPA 2RGNC 4ZAGA 5BSRA 2QIPA 3KB6A 2CSUA 2DXIA 3DEJA 1Q0UA 5K8IA 4FJ2A 1Q3KA 4BGUA 3ZU5A 5FI3A 5DTIA 5F2EA 3C3JA 2QRGA 4B3SB 1QTIA 3ESAA 3BOSA 4MJXA 3ZHUA 3FIUA 1OGYA 4MTCA 4OXRA 4X1IB 3V2IA 2VHTA 2XAAA 4WKOA 1QQAA 4OA8A 2BCJQ 3FKJA 2EFJA 2QJOA 3QHPA 1FLVA 4RFVA 2FGJA 3UXEA 1R3DA 3FYDA 2NM0A 4KO3S 1U8ZA 3MRVA 3AL2A 3U7QB 4C4YA 4PZ9A 2FFHA 1E2EA 5SZJA 2Z2JA 2R65A 4AKEA 4ID3A 4LWQA 3T5TA 2E87A 1K7CA 3PGVA 5FL3A 1OU4A 3ZS9A 1S8FA 4ZD6A 4JLMA 3DF7A 3AM4A 1ABBA 1N2CB 2HN9A 2QVYX 2ZRHA 3JZAA 3GT3A 4K05A 5L95A 3HNPA 5EA2A 1OXVA 1P0PA 2BMVA 4RKFA 4QM7A 1PDVA 2VLBA 1IYZA 4AYTA 3EZ2A 4Q39A 4OLAA 3TGPA 3RAPR 3ZWDA 3CJTA 1YF3A 3MMZA 5MFZA 3F0TA 3F6BX 4R2XA 5ECDA 3ND8A 4GVPA 3ZLBA 4RPJA 4JI6B 3GLFA 4R3NA 1EZZA 3BJZA 1ZNQO 1VKRA 1SHKA 5DYIA 5CMLA 3FNBA 2R6DA 4W6ZA 2BKEA 2ZJ0A 1VKZA 1VPDA 4LJAA 4DQUA 1P2FA 2GEFA 3GEDA 3IB3A 1OBHA 4XQEA 4RTMA 3DD5A 3V33A 5JDCA 1KMCA 1ZK3A 1KI2A 2R00A 3S55A 2VSOA 1P5RA 4DCCA 1L5VA 5EZYF 3TEMA 3EGXA 3I9LA 3JQBA 3LRTA 5KJ1A 1CF4A 5CHEA 1DQPA 4QPDA 1DTWB 3M6UA 1JLHA 3AEKA 2BEWA 3MWDA 1E94E 1OX4A 3DOOA 1B23P 1RTKA 3NP7A 5EE9A 4AF6A 5EIEA 3FBGA 3E2MA 3ORHA 3SC2A 3GDGA 5TS3A 2F1HA 2QX8A 2WKQA 3M0EA 3NAGA 5T67A 2QY6A 1UOPA 1T5TA 1WMFA 3GZ4A 3JVUA 3NQ41 3BXOA 4HDRA 4L7VA 3S1AA 5BWOA 3E9DA 1U7WA 3QOXA 4FNOA 3PKJA 5KVAA 1JNYA 3HB0A 3G2HA 2JKZA 3HPQA 5G3YA 3G8BA 4AMUA 3ODPA 4B5KA 2O2IA 3MG9A 2WMNB 3USCS 4KTTE 3AG6A 4Z3DA 2NP6A 2DR3A 1X7YA 2HUNA 3BWDD 2OCPA 1WKVA 4AZTA 4J0QA 1TIKA 4KK4A 1GFZA 2EJWA 3LYHA 1HQCA 2RHJA 2VJDA 3A31A 4N9QA 2XMQA 3WJAA 4PIPA 5TJ9A 1EU1A 1X1TA 4JLWA 1W5EA 3BJMA 3ZDCA 4QOHA 3G1WA 1ULZA 3R44A 4RK7A 2H0RA 5SY6A 1DE0A 1NKSA 3QPBA 5CLQA 1D7AA 2BD0A 2N9UA 2X0JA 3IAUA 4TZ0A 3EXHC 3VU9B 4QGSA 4RPGA 4ALMA 2INGX 2IHZA 2QA5A 1WVGA 4TPKA 2H07A 4TLMB 4E4YA 1WMAA 4NTZA 4M3NA 3M34A 3E9YA 1T0UA 5DPMA 2DHEA 4OV6B 4HH0A 1U94A 2NO0A 4UNQA 5F76A 4ZKEA 2WF5A 5KI6A 4CI9A 1UPUA 2RKWA 5EJ4A 4D45A 2NUAB 3VU3A 1XA4A 1X14A 3C8ZA 3C97A 3EFBA 1R0KA 5B3JA 4HI0E 2H3HA 2SCUB 1WZIA 4BVLA 4C29A 1GRQA 4EB0A 3ZCSA 4JB2A 1IBKB 4CQNA 3DQZA 3SMVA 1FFGA 1EHYA 2JI8A 3WGYA 4B8YA 4M4SA 4QOEA 4YJFA 2JATA 3UH1A 1PT8A 3WSTA 2RCYA 3W1VA 3SY8A 1KY2A 3R0IA 5T6MA 1XHEA 4Y7DA 1NGSA 2FWRA 3RYHB 3WHPA 3F97A 1TF7A 1SVMA 3ET5A 2QVXX 4IW3B 3VVMA 5JS6A 4DR2B 2KE5A 4J9UE 1PVOA 3QLVA 4IKEA 4R69A 4J91A 2PKYX 4E88A 2EW8A 3OO0A 1UJ6A 1JXOA 3LUPA 5C81A 3H86A 2IX9A 2NV6A 5AHWA 3LXUX 3NR2A 4BBPA 1PQYA 2BHSA 2JIOA 3D2CA 3UWPA 2D0DA 3TW0A 5CUQA 3SFZA 5JR3A 4N8SA 2AJDA 3U9LA 4RLQA 4K87A 4DGQA 2ZPUA 4Y6GB 2B8TA 4O2AF 3SZRA 1VMKA 3U7JA 2QL7A 1K66A 5H81A 4LN1A 4GM4A 3C3AA 2JFNA 3HKDB 1I3KA 2FWPA 4POAA 4CETA 5EXXA 1KC3A 1P4AA 2G3YA 1CRZA 5CH3A 4P0PB 4KTVE 2O4UX 2PNJA 2OUKA 3T4PA 4M9UA 1FL9A 1G7TA 4YB8A 3TGWA 4I4LA 2C84A 3G2PA 3EC2A 1J90A 4MRPA 5AKGA 3A4LA 3E9CA 2AOWA 1JBKA 3H6GA 5CK5A 3TUIC 3WYFA 3DFFA 3G7SA 4MUYA 4JT4A 1OKKD 4AZWA 2I66A 4I8IA 1WZ2A 3IV9A 4Z0PA 4XWOA 3WR5A 1TCAA 4RHEA 4ED9A 4DRXB 2QUIA 3DR3A 1JSLA 3TLYA 2GEBA 2HF2A 4DC1A 3GGDA 4ZOQI 1Y8RB 1J2RA 3WL6A 1LPOA 4JYBA 4U02A 2GJSA 4ASUA 1NF9A 1ZCJA 3CUYA 4BAGA 3NORA 1E8DA 4GS5A 4NYIR 1U4SA 3U3ZA 1Y6QA 4BU0A 3HO1A 2K4MA 4QBKA 4MRMB 2VDLB 2J7PA 3MF4A 4ESHA 2VK8A 2RK3A 3E27A 4J03A 1PZFA 3DKVA 2PL1A 4K9NA 1OBCA 4WJKB 1XRPA 5CDUA 3NT2A 4PANA 5I6DA 4BN4A 2O6HA 3UUWA 3A2KA 3C3BA 4WBSA 3FMVA 4MPPA 3UATA 1D2AA 1XG5A 4FQ7A 3D3WB 4RABA 1FP1D 1FX0B 3AEZA 3ZWQA 1NOIA 2NVWA 3FUTA 4IUCS 3FPFA 5U4QA 3TZKA 4E6PA 4H31A 3EA5A 3O2SB 4L9RA 5ICCA 4AF7A 3RWMB 1ZIOA 2HHJA 3EE6A 4NMMA 4G5SA 3WJ7A 1EXVA 2WKPA 1L5HA 4I8XA 1RHMA 4UNIA 2IH5A 5ICFA 4QDTA 4BS9A 3ICOA 2BCGY 3DZBA 1TT5A 2P8JA 2QTCA 2PDAA 2IYAA 4UM9B 1JI3A 4V24A 4JH0A 3SEFA 4Q37A 2ZIEA 1YS7A 1RZ3A 4FNMA 4F4IA 2YJTD 1FSPA 4QZVA 3CF2A 3QV1A 5EWMB 1R0BA 1Q1BA 5HYVA 1Y48E 3FCAA 4DLYA 1CB7A 2PEZA 2VSYA 2PL5A 5JALA 1V6CA 3G5MA 4PN7A 1U2ZA 2PZFA 3FCEA 2Z58A 3KEMA 1ZYUA 4IF6A 4QT0A 4CMGA 4E2ZA 1ONNA 3T5MA 1XE3A 1Q95A 1CETA 3DQQA 3QVJA 3OQ6A 2I03A 3AQ4A 1M8PA 5IFKA 5HIAA 3QP9A 1LPNA 5HEKA 4M7OA 2VBGA 3LPMA 1VYVA 1NI4B 2X5OA 2GRAA 5GMOA 4OFWA 1RP1A 4BQQA 3CUSA 2IY9A 2F3PA 5BN3A 4HDSA 1ZDMA 1JALA 2RH4A 7AT1A 1QTQA 3QPUA 5DX8A 3KC2A 4PXYA 2ECPA 4QOGA 2VWPA 3MGBA 1GR1A 2AE1A 1JL3A 1H23A 1ZK2A 2BGUA 1HORA 2C2ZA 3CE6A 1V35A 3OJLA 7REQB 1OWPA 1TM7E 2FY8A 5DGXA 4Y6RA 3IVRA 2H5EA 4FR0A 4OB6A 4TYMA 2O06A 3VYVA 1L4KA 1RM0A 1GZ4A 2QTZA 1B8UA 1UJMA 4CF7A 1EVKA 3RRXA 1CX9B 3FTFA 5LQDA 3I92A 4HFMA 4ZVSA 3ZQ6A 4C7OB 2C82A 2VH1A 3HGMA 2IXTA 2YV4A 5EIHA 4P6VF 4LJ4A 5DEIA 3KL2A 2W2KA 2V1XA 4EK9A 5FAKA 3IPLA 1K68A 3WGTA 1M2VB 1RHRA 1V8DA 3LT2A 4ZOEA 3FCUB 4BO3A 1NV9A 5IKEA 3O8OA 3I9JA 1LFDB 1Q7BA 2Y3IA 3C43A 4C4AA 1TCVA 3VPXA 1J0BA 1XK6A 2A57A 2Q0SA 3Q7SA 4GE0A 2D00A 5IVDA 5JSQA 3SIPA 4DMCA 1XCPA 3L84A 3RTCA 3C1UA 1YI1A 5HKLA 2Z4SA 5SZIA 4L74A 1NURA 1U3VA 2VJPA 4ZI3A 4DCNA 3ZQUA 3LO8A 5EIWA 3TX2A 3NONA 1IHYA 1OREA 4WCFC 5LD2C 4I3GA 2D2EA 2O3RA 3IUPA 2B2XA 1F2UA 2P5SA 3FKSD 3KJNA 2HUPA 2ZB8A 4IOMA 4R5MA 1RYDA 3ORFA 3DMHA 1F2VA 4IIJF 3HJNA 4XX1A 4DQVA 5B55A 2XCRB 5HRCA 5DK4A 2P9GA 1IFXA 4A0SA 1HTWA 3W5UA 1PIWA 1AT1A 4MGZR 1T5BA 3P0HA 3ZBUA 4AY6A 1I10A 1NU8A 3IIMA 1QV9A 4ZOLA 5C8XA 4OL0A 5JDIA 1GLVA 2Q49A 4ZEWA 3ZU6A 4BQOA 1OASA 1WXWA 3NHLA 2F3RA 3CNEA 1YDFA 1FQOA 1O9GA 3OX1A 1WXEA 2D4AA 4HDNA 5FD8A 3WWOA 3E5NA 4JWTA 3BCHA 4LUCA 2JLZA 3TLBA 3GEIA 4RU1A 1IL0A 2PJZA 3IEVA 3B1VA 5FLEX 3HCPA 1FSSA 2PZKA 4ZVOA 1WPRA 1NVDA 3EMKA 3F46A 4FXPA 4X45A 2ECQA 4TVBA 5D51S 2OL4A 1QGUB 5CU7A 2IWRA 2X2FA 5LQAA 2CBGA 1U02A 1EKXA 2GB4A 2VF8A 3H18A 2G25A 2I3GA 4IZHA 3RG2A 3FVQA 3ZCVA 1DEKA 5JXJA 2IXDA 3D3NA 1NVMB 3R23A 4MW7A 1ONSA 2FRDA 3RVMA 5DBFA 3IQXA 3VR2A 3MWYW 4Z3OA 3LPAA 4OHVA 4LV8B 1GARA 3NOQA 4QXPA 1AHIA 2GN2A 4IICA 4DDMA 3R3JA 2O8FB 3DMPA 4F2GA 4LBVA 1AK1A 1Y6JA 1TX4B 2JGJA 3JZMA 4WXMA 2NO5A 3L8MA 4YFYA 3IXQA 4HYTA 2WWGA 3QVVA 4KNVA 1YJ5A 4Y6PA 3PTAA 2HO5A 1QRRA 3G2IA 2ZM6B 2OY0A 2ACEA 1OD6A 1GPKA 3PFWO 4DV6B 1T2NA 5AVWA 2PANA 1P29A 4XVUA 3KJEA 3R20A 4YJ2B 3A6DA 2P79A 1UODA 2VPZA 2YV5A 3HKEA 5BSWA 4F0JA 2PUDA 3FJ1A 4IYJA 1B2RA 1KJJA 3PHJA 4LNHA 1XZAA 3SBXA 2WQZA 1UK9A 1L5NA 5TQ0B 1GXSA 1F1JA 3KV3O 3PYLA 4LS3A 4X6YA 2DERA 1XYYA 4HXFB 3MQFA 4PR3A 4CKXA 1GUYA 4FOLA 1HRKA 1ZP6A 3C98A 4HGYA 1O7JA 1N1EA 2AOTB 2J41A 2Q3HA 3B3QA 3CLTD 1PR3A 3QE2A 4OGWA 3W04A 5EJEA 5H9WA 3ER9A 1ZK1A 1SUFA 3DT6A 1VL6A 3RTGA 2VI5A 1SUBA 1RHQA 3GW8A 4ZGGA 2IX3A 1AQIA 1YQWA 1QFXA 1UBFA 5K0JA 5BR7A 2UZIR 3FWPA 4XGIA 5K0LA 3L2OB 1DJLA 3DKPA 2WJ4A 3EZLA 3EGDB 2OP1A 4NPCA 4L0CA 4O33A 5JS8A 5LMCA 2HA0A 2FQXA 1SUPA 1CYDA 2RK6A 2YMQA 4EB6B 4GNRA 1ISRA 3IP7A 5G4KA 4YRFA 4CM4A 2H29A 3KZKA 3NKLA 2QW8A 2W8BA 4U7PB 5EKSA 2A9KA 4Q9JA 3OUZA 4JI3B 3A4YA 5CJJA 4ZI2A 1TZBA 3VHXB 2YVAA 3RWOA 1ULTA 2XOKD 3AR8A 4QRIA 4C7MA 2AHRA 3D02A 3VMFA 1V9SA 1E2MA 2RHMA 2H1HA 2G0TA 1PQWA 4IHJF 1WIWA 4RTQA 2Y77A 3HBNA 3ND5A 1SHTX 3Q3HA 3ZDQA 2YN2A 3L7NA 3WKDA 1CP2A 1MX1A 2UUPA 3K0FB 2HGZA 1Y9AA 4O3FA 3G79A 2FWAA 1E3WB 5BYJA 4ARUA 5BURA 4QBFA 2Q07A 1VGVA 1ITZA 1K8QA 3UO8B 2PG3A 3JCZA 4HWKA 1Y4DE 3RK1A 3JAMA 4LZJA 5JXWA 1E9CA 1TGYA 3OFSA 3T54A 3WFJA 2ZE7A 3HLKA 4BGIA 5JNLA 5C4IA 1UOOA 1DJQA 3V4SA 2G9RA 1Z56C 2BAGA 4RTJA 3A3YA 4F6LA 2NTJA 1I4WA 1HE8B 3HB7A 3PJRA 3BJIC 3COJA 1QP0A 4CL0A 1TC2A 2XDQB 4XPZA 1N57A 4YJ3F 3ZUGA 3FRJA 1Z17A 3OBIA 4KGXA 4QOFA 1CZLA 3IX7A 1VSBA 4ZAWA 2B21A 1EGQA 2FPGB 2AD1A 3JQAB 3X44A 4BEBA 4WOJA 3I2IA 2ZYWX 1TJPB 2EG5A 1UDCA 2R8XA 4G84A 4CIBA 2C7RA 121PA 2OXRA 2GBIA 3ZD9A 4KQKA 1DGQA 4B32A 1N3BA 3W9BA 3CONA 2ZCJA 2PS9A 3FWZA 3GZTB 3MXTA 4H3KB 4ROTA 5DULA 5I3ZA 1WRBA 3KWLA 2RE8A 5J3JA 2PD4A 5CK4A 2GTIA 5L3ZA 5EVJA 2OTCA 2CJXA 2IPMA 3VUFA 3VPBA 3NG1A 2MMCA 2HX1A 1FXSA 3TLZA 5AVZA 3DMNA 2JFOA 2IPXA 2Y93A 2QM8A 3ZWVA 4JGBA 4M55A 1I6WA 4YO8A 4L2IB 1YVEI 4DA0A 5L6LB 3GG9A 3QUTA 4IH9A 2E4YA 1E6CA 4FHGA 1E1MA 3U26A 3LWNA 1COZA 3N7TA 4B3XA 4WTOA 1ZJJA 2I78A 3VJLA 2PXXA 1OROA 4P4GA 4LF8B 2JLWA 1K5HA 2MOKA 4RF5A 1MC1A 2J08A 4A6DA 3BD7A 1GGKA 1I3MA 4MHTA 4XIGS 1Q91A 1LQTA 2W6ID 4NYMQ 2GCOA 3VYRB 5D3MB 3U40A 4JVOA 2ZRLA 3VNAA 4OM7A 4UU8A 2BFOA 4BNUA 3RKSA 3RS3A 3RU9A 3MGCA 2Q4BA 4KBGA 4J7XA 3PFIA 3LO5A 1C1DA 2W4QA 9ABPA 3D6JA 4NECA 4EHAA 1X9IA 3KAKA 1FFEA 1KEVA 2H5JA 3ZHTA 1EESA 1XQ6A 3RJTA 1X94A 2IOQA 1GL7A 4LDPA 2XTAA 5JG7A 2K7ZA 3LUGA 4BO8A 5C8VA 3ZZTA 1H9CA 3QRWA 5ITZA 5LIRA 1Z6TA 1SZDA 4IS3A 2PVSA 2HXYA 5AYVA 2ZSFA 1KRHA 2WYOA 3N0WA 4GXQA 4E5SA 5JPIA 3J7TA 2NVUB 5IAOA 3DTVD 2GD6A 1YB4A 1EVIA 1GCAA 2WV7A 1KBZA 3OT1A 4BEJA 2GI4A 1SK8A 1P3Y1 1C0KA 1S0UA 2CY0A 4ZI7F 1NUQA 1E60A 1M6EX 3WBFA 1NXWA 3SM3A 4RTLA 3QKRA 1OGIA 4LX8A 4RX1A 5JNRA 5C53B 1CT9A 2POQX 4EMSA 3VPHA 1E3MA 5EIFA 4H1WA 1DJPA 2NIPA 1WVMA 1Z38A 4CCAA 4D3DA 1DEOA 1CUBA 3GR6A 4B76A 1FEZA 1TIPA 1I3OA 4DLTA 5KYNA 4B3IA 2E2WA 2L19A 2HTEA 4I9UA 4RZXA 1SXJE 4W99A 2H51A 5FBRB 2CUTA 3V7NA 4YRBA 1GCUA 3FBTA 2IUYA 2CLFB 2JGFA 2VPWA 1X8XA 4FZ3A 4HRAA 1SN7A 3GL9A 4X85A 1IUNA 1KOFA 1ZCZA 3ZY2A 2IY7A 2O2XA 3DYBA 1QCDA 2XODA 5FBLB 5K8JB 1Q21A 1ISSA 3SVLA 3P0RA 3ZX5A 4B80A 1TNDA 3WGJA 2R7LA 2RBGA 1N2ZA 3MT8A 3D6NB 5TIIA 1X74A 3ZDFA 4B45A 1KEKA 2OHJA 3IDAA 4PICA 2VYND 2HA6A 2JAUA 1QIKA 1XU9A 4V0QA 5FOXA 1NXPA 1NC1A 1IHOA 1OFUA 1V1RB 1JJBA 3CLVA 3DH0A 3L01A 3C6QA 4XOUA 2G1PA 4GKVA 1E79A 1ZUD1 3Q0TA 4R2MA 1CY1A 4O5AA 2AUTA 2O3TA 1G5FA 4I08A 2CVQA 5BSTA 1WCYA 1YQ9A 2JIRA 3K96A 1JAHA 1RRPA 4H7DA 4X44A 4RYDA 4XFKA 3OUTA 1ZU4A 3B7GA 3UOGA 2QP3A 4NZNA 3BERA 5JWHA 1P3DA 4PG6A 2AB0A 1BSVA 2X9NA 5FTWA 2DSNA 1S8OA 4R6XA 1E69A 1EZ1A 2XMBA 3DE6X 3TNJA 3K5HA 3NPMA 3TR6A 1T2EA 2WUFA 4MKHA 4EOGA 3KOUA 2V6IA 2PNFA 4WZBA 4I4TB 2ISQA 1SC6A