1P7VA

Structure of a complex formed between proteinase k and a designed heptapeptide inhibitor pro-ala-pro-phe-ala-ala-ala at atomic resolution
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTDILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords proteinase K
publication title Structure of a complex formed between Proteinase K and a designed heptapeptide inhibitor Pro-Ala-Pro-Phe-Ala-Ala-Ala at atomic resolution
rcsb
total genus 88
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2003-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1p7vA00
4KPGA 1SUDA 3GT4A 2DP4E 3Q40A 4WOCA 1V6CA 1SUPA 1SCBA 1Y48E 2WV7A 2G4VA 4H6WA 3I30X 5AVJA 1R64A 5AVKA 2Z56A 3DE1X 3Q5GA 1MEEA 2SBTA 3AJ9A 5ARDA 2SNIE 2PKCA 2XRMA 1C3LA 1TM5E 3GCXA 1WMDA 2W2QA 4KB5A 1BE6A 1PJ8A 1SUBA 2PWBA 3BPSA 1DUIA 1IAVA 3T41A 2B6NA 4BWGA 3A3PA 5ARCA 3I34X 3DE2X 2WUWE 1EGQA 4J94A 1SELA 3CNQS 3VHQA 2W2NA 1A2QA 1PFGA 5FAXA 4YN3A 2ST1A 4HVLA 1Y33E 1AVTA 1SIBE 1LW6E 3AJ8A 2PQ2A 1TO2E 1GT91 2X8JA 5SICE 3SQOA 1ZVJA 2W2PA 3TI9A 2P4EA 1AQNA 1Y34E 1S02A 1CNMA 2X8JB 1OT5A 1SCAA 2PMWB 1BJRE 1GA1A 1YU6A 1Y9ZA 3DE7X 4B5LA 2HPZA 3GT3A 5JMOA 2W2MA 3DE6X 5JXHA 1SIOA 1JEAA 1PTKA 3DVQX 1TM7E 3WQBA 4C3VA 1OYOA 3DVSX 3DE4X 3DVRX 5I9SA 1P7WA 3OSZA 5FFNA 2GKOA 5JXIA 1UBNA 1Y4DE 1GTL1 1TM4E 3WIVA 3TI7A 5JXJA 1MPTA 1CSEE 1BFKA 1AK9A 1SUEA 1SPBS 4CFYA 1TM3E 1WVMA 1KDZA 3WHIA 4ZOQI 1GCIA 3EDYA 1GNVA 1GA4A 3DE5X 1ST3A 4GI3A 2ID4A 4AKSA 1C9NA 1SVNA 1WMEA 4KG7A 2Z2ZA 2Z57A 1BE8A 3LPDA 3ZXYA 1T1IA 3DW3X 3VV2A 2PWAA 1Y4AE 2QTWB 1T1EA 2TECE 4CG0A 4M1ZA 1HT3A 3PTLA 3CO0S 2ZRQA 1KDYA 1R6VA 1AF4A 2WWTA 1GA6A 3VYVA 4RYDA 3DWEX 4OMCA 4WOBA 1YJBA 1C9MA 4Z2AA 1IC6A 1Y3BE 1YJCA 3DDZX 1KDVA 3LPAA 4H6XA 3UNXA 1SBCA 4HX2A 3LPCA 1SBNE 2Z2XA 2E1PA 1WSDA 5JXGA 4AKTA 1NDUA 1WMFA 1SN7A 3D9QX 3I2YX 1SUCA 2V8BA 1GTJ1 1KE1A 1S2NA 3DE3X 1R0RE 1SCJA 4DZTA 1NDQA 2SECE 3QTLA 2PRKA 3PRKE 3GCWA 1Q5PA 1PEKE 3LXUX 4NMXB 1NLUA 1T1GA 4DWWA 1VSBA 1SBIA 3TECE 3BGOS 2ID8A 4ZARA 1Y3DE 4NE9A 4H6VA 1TM1E 1AU9A 1Y3CE 3AFGA 1SIUA 1YJAA 1BFUA 4OMDA 3F7OA 4I0WB 3H42B 4JP8A 2DUJA 2ZWOA 2Z58A 3I37X 3BX1A 3QMPA 4LVOA 1THMA 2IY9A 2WUVA 2HD4A 5K7SA 1XF1A 1TO1E 3DYBA 3VSBA 1TMGE 1TK2A 1ZVKA 4LVNA 1GTG1 3ZXXA 5CW1A 4OV6B 1OYVA 5B1EA 1TECE 2PYZA 1SH7A 1SCNE 1V5IA 1SUAA 1Y1KE 1ST2A 3SICE 3L1KA 4FONA 4DJ5X 1SCDA 2ZWPA 4MZDA 1C9JA 3EE6A 4C3UA 3F7MA 2XTJA 3A3NA 3D43A 3DE0X 1BH6A 3EIFA 3P5BA 5AMXA 3QFHA 1P7VA 1SBHA 4CFZA 1AV7A 2W2OA 3HJRA 1GNSA 1KE2A 1S01A 1EA7A 4NE7A 3VTAA 2Z30A 3A3OA 3DW1X 2SICE 4K8RB 3WIUA 1AH2A 5ARBA 3VV3A 5FBZA 3F49S 1P8JA 1Y3FE 2Z2YA 5AQEA 2DQKA 1SBTA 2IXTA 5B1DA 1DBIA
chains in the Genus database with same CATH superfamily
1OROA 2Y0BA 4PC6A 3LT5A 4J4HA 2ZIAA 4KOEC 2EVWX 4OHYA 2JCSA 3BE4A 3GJQA 4P34A 5AICA 5F98A 3V5NA 1YJQA 4DSNA 3AF6A 3I9NA 3PNMA 1CEEA 2XCLA 4OYLA 4PSUA 2VP2A 3DAFA 3LKDA 2XE6A 3R3HA 2WPDA 2PKRA 2JCXA 4ESEA 1JILA 4EAQA 1CDZA 1N8KA 1TVKB 1V16A 5FV7A 3KUUA 5IM4F 1P2GA 4OBXA 3AG6A 1VIVA 3EGOA 2NO5A 3ZX4A 5C8XA 1RRVA 1AE1A 1RYNA 3P9PA 2XQVA 5K3FB 1IVNA 5EINA 4H7FA 5DISB 3T4UA 3LCJA 3UB3A 1JXAA 1Z82A 1U2DA 4INJA 5J4KA 2P0EA 1CFJA 3EC7A 4QXPA 3AHJA 1JPJA 2FCAA 2CBXA 3F9RA 4LV8B 4EB6A 2X4LA 5EJ8A 1REQA 2WSLA 3UJHA 3ONNA 1SCUA 1CIJA 2C20A 2W2QA 3WG9A 4C2BA 5ICGA 4OD0A 4RHCA 3T3GA 3K72B 4X1IA 5SZKB 2HRCA 2WB4A 1KRHA 1L5QA 2Q2VA 2P79A 3D3QA 4MZXA 3SQDA 3SCZA 4ZCIA 1PEAA 1L5ZA 3ZYCA 5B7QA 1FSZA 4C0HA 1TKRA 5C7OO 2IHNA 4B9AA 1K97A 2EX0A 2VK2A 3C7KA 4BNNA 4JJZA 4ZVMA 1NULA 3IMFA 1CD5A 4HNSA 1BWQA 4QWWA 2B7CA 4AO6A 4DPKA 3S2UA 4DQKA 4EHDA 3ZBQA 3MINA 1U3VA 5JYBA 2GNOA 3KYIB 1KL7A 1QGUA 2DPLA 2L82A 3G0IA 3MCVA 5KYTA 3MWEA 1BMFD 2VFAA 3WGTA 1J2RA 4GHWA 2NVOA 5A9SA 5EQFA 2IX3A 2RHOA 4JZKA 3WNBA 5IJ9B 4Y2SA 5E1BA 1AVTA 4ETWA 5C31A 3RPEA 4DVGA 2X22A 2OC9A 3KX2A 3D54D 2OKCA 3F6CA 1XUOA 1QG6A 3K6SA 2FPGA 3AHIA 3HI4A 5JD3A 5I7FA 3LUFA 4AUKA 3FCXA 4DNQA 4WVFA 3PEEA 4EDHA 4NNJA 4MEJA 4E31A 4URUR 5BQFA 1ZVJA 1FYVA 3OX3A 3UW1A 5EVJA 1M6VA 3CUEF 1BW9B 2OCXA 3LQ1A 5GM2A 1U0RA 5JS8A 1EDZA 1ENOA 4NFSA 1GTSA 3E53A 4ZJZA 5ADUS 2HHHB 1FP1D 1DTWB 1VSUA 1YNOA 1B4DA 3QVGB 2WE7A 2Z6VA 3MT9A 3K9CA 2YV2A 1PNVA 1QS0A 1C3EA 3FWNA 3OEEA 2FFQA 1JPUA 1O8CA 3PFBA 4YJDA 1TJNA 1EZZA 4YJ2B 1P7CA 2VXCA 2WZQA 2DGDA 3SZMA 1WTCA 3MUEA 2NYUA 2XY4A 3V1UA 2FWPA 1YXMA 4PQGA 3QXGA 4NBVA 4Q4HB 3SLRA 5F9FA 3OMXA 3QUTA 3QUBA 5EEGA 4BO5A 1BG6A 3IO3A 4P53A 4U9UA 3WLKX 4REQA 1LSOA 4LJRA 1WX1A 2PKWA 4OYRA 1H4VB 4PIPA 1EUYA 2FR8A 1JR2A 1YUNA 2B9VA 1KY2A 1A97A 4TS4A 4CLXA 5C46F 1P6QA 1PJ4A 1QH0A 2CFRA 2FZ4A 2P9TA 2Q9CA 3OMWA 2W83A 4R54A 4M83A 5SY6A 1HDOA 1YRLA 2CMGA 2JA1A 2ACWA 4JR0A 3NKFA 4CIWA 3K2BA 2GUWA 5CVUA 4D4JA 2I1QA 1EP3B 2VSXA 4UE6A 4N18A 3T3MB 3SIWA 1LLUA 4QM6A 1LLDA 3ZWWA 1D2HA 1I8TA 3CMMA 4LXGA 2HSJA 4MWCA 3GRAA 4AN1A 1TZJA 2ZI6A 3A04A 3R44A 4N6OA 1J9GA 4IIGA 1YFKA 3K1ZA 3IT2A 2WAOA 3RSOA 1DC4A 4DUZB 1XA3A 3MWDA 5HRUA 1IN6A 3RSHA 2QN3A 1MW9X 2CFIA 1NXOA 3BD7A 2DQSA 3I2JA 4INPA 3CZPA 2IPAB 1JHUA 1NMXA 2BI8A 3KAJA 4HR7A 1YDHA 3D6HA 4EYSA 2X2EA 3FETA 5CLFA 1ISFA 3R7FA 3P4YA 4BX2A 4KN8A 1KC3A 2NZUG 3EUFA 4BVEA 1V96A 2ZR9A 4PY2A 4R0VA 2WWGA 3H05A 1W0JD 6CHYA 4HX9A 4CEIA 4GQAA 1J0BA 1RI2A 2JIRA 1ESNA 2VNIA 1AK1A 4ZA2A 1JHZA 5A5DA 2CEKA 5TQ0A 1FFEA 4UTOA 2P5SA 3HCEA 3V7UA 1YBHA 2Q9BA 1YHZA 2BN4A 2BZ1A 4EKNB 1CP3A 1P4JA 1VA5A 2CLKB 2QR5A 3ADPA 3W5SA 4WSOA 3A1TA 2PKQO 2HJSA 2R97A 1FW8A 4DQDA 4R2LA 3U7EB 3MJSA 2CC2A 3CJRA 1I30A 1U3CA 3O92A 3AXSA 3UMVA 4EMTA 3IDZA 1K8YB 4GLBA 1TM4E 3A1CA 2IHJA 1Y82A 3JY6A 3NOOA 5JQGB 3I12A 1K1EA 5J43A 5TC4A 3QEBZ 4QU9A 2IQ5A 2UXCB 1E4EB 3L6CA 2DSNA 3U49A 1RAHA 4RORA 2O8DA 2PWPA 1X80A 1UJCA 3QEMA 4YK7A 3CVYA 1KERA 3TO5A 1JIQA 4G4GA 4DLNA 4G0OA 4BBAA 1EFRD 1R8SA 3IR6A 4MR7B 2C5LA 3JQCA 3GQVA 4ADSG 1OWPA 1MR3F 2AMVA 3CIFA 4UUOA 4BO3A 4OBWA 4F6RB 1MOQA 1PLJA 1AN9A 5TT0A 3OQOA 3QM1A 2JLCA 4QDKA 4EW6A 4CMJA 5HS4A 1NLYA 5CFRA 1DT3A 4QDJA 2C99A 3T4XA 3U3RA 3NBYC 4RQBA 4WA8A 4WACA 3RK0A 1M34B 2ZSHA 1TF5A 1GGVA 1W4RA 3FLEA 3H2JA 5C34B 2O0LA 5LN1A 2OO3A 1M8FA 3F3KA 3M5DA 2YN4A 4LBZA 1YFZA 2H0AA 5JU6A 5AJUA 3EZXA 5HKLA 3GNSA 1QV7A 1CF2O 1N2XA 1D2AA 2GD6A 2J7KA 4RK4A 1GNTA 1PO7A 1QH9A 4U1RA 3AHHA 3THRA 1QGAA 4PZ0A 4E11A 5T67A 2J85A 4NYMQ 3K0CA 2YVKA 1ZWLA 3R7WA 1U0EA 4O4JB 4V1CA 1U5BB 3E8MA 5BNIA 2XYGA 1OE0A 1DQNA 2GLUA 3C14C 3EDOA 3NBXX 5LDHA 1FJ2A 3USES 2VAXA 5CCBA 2I3DA 4DJEC 4AYXA 1PGJA 1I6LA 1YR8A 2PBRA 1B6TA 3E03A 1E92A 3DMYA 2C97A 2WYIA 1T1EA 5EMKA 3A9WA 2QU8A 5ER6A 3WSVA 2J3MA 1XCOA 2W90A 4RJKA 5AJWA 3C41J 3ZWVA 3WP1B 5LPNA 1ZS9A 1ZH6A 4YAFA 3O95A 5GM1A 2FWAA 4UHHA 3WBFA 1YDWA 4UQLA 2H6EA 4PHHA 1KDYA 5B64A 2VAPA 5E6RB 1EX6A 2VI5A 3TINA 1TIBA 3A6ZA 1ZCBA 3OEWA 3N8IA 2JI7A 1GN9A 3L01A 4HH1A 5LP1A 3FR7A 3FNEA 3SLKA 2FPMA 3TGPA 4EDFA 3K4HA 4FR0A 1KEEB 3ZBUA 4FE4A 1LDEA 2QD4A 3MWLA 4RL4A 5EHIA 3L04A 4ZOBA 3DBHB 4R8LA 4EA7A 1SBCA 4EUNA 3HGTA 5A4KA 2ZRDA 3LPCA 4QOGA 3ANTA 1W85A 3O3CA 3RR2A 1ARZA 1KO5A 4RK1A 4MRVA 2H48A 3AU8A 5ALJA 3IBFA 4DDUA 1QF7A 4HEA6 4ZVRA 2PX0A 1KAEA 3PK0A 1I10A 4BKQA 5BUCA 1OUMA 2IWRA 2WT9A 3KB6A 5DGIA 1WE2A 1Y3IA 3C8DA 4DB4A 1FFHA 5A3QA 2CLLB 1XC7A 3E2MA 4ZCPA 3HBAA 4TGLA 4B4WA 4P1ZA 3HY4A 1GPLA 5DBOA 4B2PA 5IYZA 3HA3A 2IHTA 5E4TA 2FWMX 5JNWA 4C7JA 1X87A 2HRBA 3I2YX 4MVJD 2TSYB 1EXNA 3RFUA 1V25A 3V1KA 3DJFA 4KC0A 4Q1BA 3U4CA 2VJBA 4KN9S 4M0CA 2IQIA 1EDOA 4G97A 1PG5A 3O1JC 2XNCA 3Q88A 1ZG3A 3M6AA 1PX0A 4BL5A 3HWWA 2FFJA 4R3WA 1KVSA 5IDYA 2BE7A 1UADA 4MUHA 2LP4Y 1IUOA 1ZI8A 1QH8A 1J8FA 1IDN1 1SOVA 4QGAA 4TUYA 5H02A 4BE7B 4D9KA 2VR1A 1D04A 2P9HA 3JQ9A 5FTMA 1KEWA 2PRKA 4AQ7A 5C8YB 3GJ0A 3UK7A 1N36B 1EKXA 1LS6A 1TX4B 3FUWA 5BXYA 4IR7A 3A28A 3K1JA 1XMSA 2BEVB 1K0UA 1YS1X 2O0MA 3AR3A 2OESA 2VDRB 4L4SA 3RARA 4EPXA 1L1RA 3DB1A 3KKPA 3L40A 3PIIA 4KXFB 4PPGA 5CVEA 3UMCA 2Q2QA 5CBPA 2RIPA 2WICA 1LSJA 4DPMA 3P9IA 1NQOA 2OD2A 2ZB3A 4J91A 4LE2A 3KQNA 3Q85A 2Q8NA 1XCGB 4R0NA 5C4MA 2F48A 2PSJA 3AUSA 1HOXA 2IP1A 2CHFA 3FPCA 4LX8A 1J24A 1Y8RB 4G1VA 3D8RA 3PWSA 5K6TA 4KP7A 2VPXA 5KYWB 4KUHA 3WV5A 2JCGA 3HPQA 1UZNA 1HFKA 5HGJA 4QICA 3KFXA 2JASA 5IVPA 4Y1RB 2JGIA 1DAGA 3BQNB 4B74A 2JFQA 2WPDD 4LHWA 3UB2A 4E51A 6PFKA 4GKVA 2O7VA 3Q4GA 1LKZA 1MUUA 2RFLA 2QF7A 2IZ6A 1X0XA 5JZOA 3EEOA 2ZKLA 4EGCB 3UM9A 3FR8A 4G0VA 4Q5IA 1DRVA 2VA8A 2C5GA 3RVDA 4EG3A 1NW7A 2JEYA 5IJ0B 3GWZA 1N3IA 1CDOA 3PDIB 3PYXA 3RT7A 3T1NA 3V3TA 3L7OA 1TYAE 4EGQA 1NMEA 1OGIA 5A4IS 1KKUA 1B3RA 4L8GA 4IIJB 2EP5A 3S8EA 2NYVA 3ZW7A 5F4ZA 5G1OA 3C7AA 3T61A 3TQCA 1HDEA 4BC1A 1UBOS 1KVQA 1KZ6A 2G6BA 2IY9A 2W22A 3GIDA 4FMPA 4PGAA 1UC9A 1IU9A 3BM5A 1RI3A 3LECA 1K8QA 3BL8A 1Z34A 1DADA 1CUCA 5AM0A 5AW3A 3DBLA 3I5AA 2XB6A 1NXPA 3UWOA 3ZU4A 1ZJJA 1YFLA 2A67A 5AHKA 1RRKA 2DPHA 4LFCB 2YYYA 3LUAA 1ZM9A 1HLDA 1U7WA 1CQIB 4HRAA 5A05A 2FW7A 2VO1A 3C3CA 1AQUA 4LTDA 3DZ8A 2BEKA 2JHPA 4H7EA 3TIIA 4OXXA 3LO5A 2CHGA 3CLRC 3KKZA 2OG2A 1Y98A 2WOJA 4XQGA 1RE1A 3IH5A 4Y6LA 3VMMA 3P0HA 2HR1A 1AMNA 2KE5A 5GAJA 3ZLVA 1C3OB 3M7IA 1ZRHA 3K7EA 3FFBA 2XOKA 4BP3A 3PTAA 1SCNE 1GO2A 2C2YA 5HJ2A 2Q27A 4NI5A 2WRZA 1V71A 1OFIA 3EPJA 3WDKA 4FE7A 1JDJA 1R6TA 3AG5A 4ZOLB 4DQVA 5I6DA 4FCWA 5JASA 1X3SA 3X1XA 4WBSA 3L1IA 2BPOA 5JYCA 5LLTA 1XCPA 4UUMA 3VKUA 3AHCA 1RYDA 4NQZA 3IJEB 1G5QA 2WP8J 2OV2A 2REOA 4XQ9A 1JJAA 1E0KA 1MC8A 2YHAA 1V3TA 3U3OA 2JLUA 3IBCA 5M29A 3WMRA 4Q3LA 3EMBA 5FPKA 2A0FA 2ZQZA 4N3GA 2CCKA 2F6RA 2IGBA 5BSWA 1DBSA 1MRNA 3P0RA 5CYOA 4BIIA 4LSWA 1JFTA 3P2JA 3OE1A 4QGHA 3E82A 2PA3A 4WKNA 4ZEOA 3RWBA 3CX4A 2J8ZA 4YY3B 1QP0A 4KFCA 4LJ8A 3P9CA 3A3YA 1VSQA 2Z6QA 2LTAA 1F14A 3COJA 4WEQA 3OOWA 2NUTA 1OGJA 3FMOB 3ZVRA 1RQ7A 4QBFA 2YWHA 3WBJA 3F5DA 4R8KA 3SX4A 4LDAA 4WV3A 2CJFA 2GF0A 4MRMA 1LDYA 2BFOA 3DDCA 3MK31 4YI3A 1TPYA 4CT4B 1ODFA 3BWBA 4FIZA 4KIFA 4ZRNA 3PQ6A 2NTJA 4JX8A 4B6GA 1F2UB 2B4TO 3BMOA 3EMDA 3ID6C 4X90A 3WGQA 4P35A 3HEMA 3BIWA 1SVUA 1YRWA 4O2BA 4PCAA 3DMRA 3P0JA 2W00A 4UE3S 1KOJA 1ZMOA 1YRQA 2CVZA 3RJ9A 1JFFA 4GP9A 3RS3A 2PRYA 2VC2B 2XBLA 2YNMA 1FLVA 2AI3A 5E7JA 1VKZA 5FFMA 1J56A 3W05A 1K2VN 5ILOA 4ZT3A 4CLRA 3AVQA 1QVZA 4LDNA 2X15A 2QR3A 2IOFA 4DAEA 2FW8A 1UBLS 4PQEA 1UBRS 2I62A 2ODQA 3GJ4A 2WJ4A 3LA8A 3PQ3A 5FNZA 1H5NA 1ONBA 3WLEA 4BNXA 4QRDA 3WV4A 1XN1A 1KORA 1VFNA 2PMKA 1ZI9A 5DEOA 3I52A 5D1NA 3S70A 3T7JA 4AZSA 4EGJA 1E7MA 2H54A 2ZKIA 4ZCLA 1G16A 5B4UA 1QO0A 2ATVA 1N2ZA 1XQYA 4J0QA 2ZFUA 4MVWA 2IITA 5LYJA 4C76A 1Q7CA 3RT9A 4WOCA 5ERYA 1YQQA 1C0IA 3LHIA 1E1MA 3LW7A 1TZBA 4IJWA 4MRNA 1FE8A 2C94A 3B20A 3KB8A 2IUFA 4Z3KA 2F55A 1OXXK 5IC5A 1GU1A 5KOHA 2EFEB 1G6KA 1LPMA 2NU7A 4H6WA 5LJLA 2GCEA 2NP7A 1NQVA 1RM3A 3LDFA 4RE5A 4QBGB 4DIUA 1YRAA 1A5SB 3HY3A 4MW7A 1KEPA 2VPZA 1HDCA 2HXGA 4IOMA 1B23P 3P71T 1SHTX 4TTJA 4MGIR 8ABPA 2P2YA 5GJWC 3WO1A 2PMCA 2X0IA 3VZQA 3FYDA 3UH1A 2FW1A 2BM8A 1I4LD 5EAIA 1Y6JA 3T7RA 1BA2A 2WAYA 4UUAA 3RCBA 3PGXA 1TQ6A 4M86A 1OAAA 4US0R 1XF9A 4CE6A 5DULA 2P9FA 4LYFA 1TAUA 2E5FA 4LY0A 3U3DA 2YJ4A 5E2IA 2Q6OA 1CY2A 1USIA 1BE6A 3K96A 4FOLA 1FTSA 1XKTA 3UICA 3DHYA 3V42A 3TQRA 3CLKA 4Y0NA 5IH7A 4RHYA 4PZUA 3RVRA 1G38A 1XG5A 2LDXA 1AX9A 4WK2B 2ZTUA 1IK4A 2JIDA 1E7RA 4Y2XA 2ECOA 4MEBA 5LBUA 4F9GA 4B3MB 5LMUB 2B20A 4JLWA 4I9FA 2JKZA 3ENNA 4DV7B 3ZR4B 5IWAB 4Y0AA 4CETA 5GINE 1JU4A 5HKOA 1TNDA 2MR5A 1P77A 1Z2EA 2ZE6A 3PT9A 2CYCA 1IJBA 1IM8A 1WZIA 3DOCA 4QTTB 1RR6A 3NTLA 2Z8YM 4BNZA 1D4OA 4BGDA 3CNQS 1C7EA 1E2LA 1RLTA 1UMCA 2EGHA 3GN1A 3MTJA 3MWGA 3OY7A 4WXHA 1ZRSA 4BLPA 2Q4RA 3IYLW 4KR6A 5TMBA 1JB9A 1ESEA 4W7HA 2BUCA 3BS4A 1L5GB 5DK4A 3ECSA 2HNBA 3HWX1 4QBTA 1PKXA 1TO6A 1U02A 2IHYA 2GXAA 2ZPTX 6GPBA 4Q1AA 5I01A 2HB6A 4BMDA 1MAUA 3Q3IA 1PSDA 3ZE6A 1ODIA 2MR6A 2R7KA 4WLNA 1M2OA 4AL4A 4R9VA 3GY0A 2OWEA 4QHSA 1GT6A 1ZK1A 3T3EA 3TUJC 5KKCA 5ULLA 2NVBA 5SY4A 4OFZA 4Q01A 2XT9A 4OGLA 1EEHA 3TI9A 3IV7A 2DR3A 2ONKA 5I3ZA 1M6HA 1L8OA 4MUEA 2FPOA 3HN2A 4FDAA 3WK4A 9LDTA 2PVSA 2QXUA 3TOXA 3UA3A 2ERXA 1PV2A 4RJ2A 2BGLA 3X1DA 1VE6A 1CNMA 5L7WA 2XQGA 1IWOA 4L7QA 1L7RA 1DKUA 3HB1A 3LGXA 4M9CA 3UMBA 2E37A 3DL0A 4UUBA 4E3ZA 1QORA 3KELA 3CSUA 1TIKA 2JLBA 4DT1B 5HUJA 4RELA 2QAGA 1ID8A 3UKDA 1G60A 2X14A 1TCUA 4XVCA 3I0NA 1Y3AA 1T91A 4I36A 3TLMA 1UK8A 1B1CA 1WQ4A 1CETA 2MMGA 4PPFA 2O2HA 4R1PA 4DBZA 2DERA 5JBNA 3KHUA 2QXYA 3ND6A 4MLDA 3RSLA 5EJ4A 2OZLB 3D4NA 3QBTA 5COAA 4ZYTA 4B83A 3CN7A 2VNJA 1LQ2A 2OHXA 5B37A 3UKJA 4ES6A 1W9MA 4X20B 4ZV9A 1EWRA 2A1UB 4Z3OA 1KYYA 3R0XA 3UATA 2OHJA 4WNIA 2QL7A 4PCUA 2ISCA 4HZIA 4I9NA 3TCNA 4GRIA 2ZDQA 2WJAA 1AB6A 3C70A 2HQ1A 4BZWA 4QKQA 4WXMA 3W5DA 4F2DA 4KJXA 3CPHA 4X61A 2VDWB 3EEQA 2RKBA 1DS6A 1EP9A 1CUAA 3NKVA 1FVHA 2GZ1A 3EF1A 4TN1A 4JBHA 1MFPA 5I4KA 3UWMA 4ZGGA 3HL4A 4S05A 2XGJA 4BQIA 1ZIOA 1EXMA 4HI0E 1P7WA 1E2UA 3PWZA 1XZGA 3RVQA 2A0XA 4MARA 4A0HA 4PN3A 4WOJA 3GLUA 1LJUA 1IG0A 2P2CA 4XASA 2J59A 3LQQA 2YN2A 4ZVSA 1NOKA 5TMPA 3FOEC 1FMTA 3ABSB 3WK9A 2ZRHA 3IJRA 1UJ5A 1G2QA 1HM5A 3E9RA 1P0PA 5JAUA 2B78A 2BZSA 5B4VA 5IDWA 4OK6A 1SR8A 1VG1A 1Y4DE 4I5IA 5EFZA 4M9QA 1Z25A 2QL9A 1ZOLA 5JECA 4PG8A 1RBQA 4OH1A 2HREA 1HETA 4YDRA 3T3PB 5JXJA 3WXBA 3GLFB 3KL4A 5CT8A 4A8JA 4EZIA 4FQ7A 5DGCA 3ZUPA 3Q6IA 4POAA 1T9ZA 7ABPA 4L73A 3CF4A 2QOEA 2GPYA 3WA7A 3N75A 2DC1A 1E60A 3IP6A 5EQDA 3A8TA 3KSBC 1FFXB 3TW4A 2NU6B 5L4SA 2ZZMA 1MB2A 4EF6A 4ZXPA 1HQYE 1R27A 3H2ZA 4BJ3A 3BB3A 3FDFA 2QRQA 3S1LA 1O95A 5LXTB 3ZXUB 4ZI2A 1SPBS 2NTNA 3V97A 4LHEA 1R0XA 5JUWA 3B1KA 1T3ZA 3NEPX 1V39A 2I4TA 3KKEA 1V9CA 3DONA 1VL1A 2FFRA 1WXDA 2A0KA 4PZPA 3ROTA 3SNHA 3VTFA 1TZCA 4Q9HA 2I4RA 3U5TA 4TV9F 1X15A 1WUTA 2J3EA 4HAZA 4Y2QA 2CYBA 3TLZA 1E6WA 3AL3A 3K9HA 1G41A 3KT8A 1CIVA 4IJUA 3W77A 1PFYA 1TT5A 2WTAA 4BQRA 5LQKA 1NJGA 5TMDA 1RPZA 3U4QB 4JX9A 1ZJWA 4MRAA 1EGHA 1XA0A 4YP9A 1A9TA 5BWBA 1SA0B 4NG5A 4D97A 1RBMA 4BVAA 3KYJB 1W9HA 3ENKA 2KMLA 3RC7A 2E4AA 3M9XA 1CRLA 4OOFA 3ZXSA 3UFXB 5BUSA 3VDQA 2HF2A 2Z2ZA 3O1HB 3QNMA 4JJIA 5GV7A 2ONJA 3TTUA 3NM4A 2QU7A 3F8TA 5HWSA 1GKKA 1Z13A 2B8TA 3ASUA 2EERA 3OT1A 2DY0A 4OXYA 3KZVA 4RKQA 3T3IA 3UJCA 3GLSA 5KVSA 3QEAZ 2ZIXA 2IDZA 1M2GA 4EL5A 4AJEA 3LFTA 1T3TA 3GFBA 1GXSB 1SG6A 4EJ2A 3NHPA 2WIBA 4UXJA 1IIBA 2PAAA 4V0LA 4NAUA 3B78A 4ZGBA 1M2VA 3CVVA 1GUFA 3PKIA 2QTWB 4XZ3A 3H9CA 3PNVA 4BJ6A 5BSGA 1ZBQA 4BJHB 4COOA 2BTQA 1GCUA 1V3VA 4I14A 4CLOB 3DQQA 3VVLA 1F5SA 3A9TA 3AHDA 4CQMB 4DNXA 1ECFA 1CKEA 2P5YA 4US2R 4Y7CA 3H8SA 4DUGD 3IKTA 1BIFA 1G291 1NONA 1ODTC 1IZYA 2WSSA 1DKQA 3OEHA 3O74A 1UAYA 4GWKA 3A6EA 2QM8A 3ZI7A 3IMKA 4YTEA 1WUYA 4MV3A 1C9MA 2Q49A 2XOKD 3CF0A 4AP6A 2O8NA 2WIJA 3C15C 4NYJQ 1G8YA 1ISPA 4BMOB 3THYB 4L2IA 2OCKA 1GU7A 4E5VA 2AOTA 1H05A 2QUHA 2HSEA 3RVBA 3ZEAA 1OTXA 1Z22A 2HLHA 1GV0A 1DIOB 2W4IA 1P73A 1XXHB 3FI9A 4O1IA 3E8XA 5CFZA 5KQSA 5KWEA 2DUMA 1EWVA 2ONCA 4OL0A 5K3CA 3V48A 4BU1A 3OJLA 2XUHA 2GM5A 4DY4A 1IXKA 2XA9A 3ZDQA 1I13A 1W4CA 4HMQA 2QGZA 3LCVB 1H94A 5DNDA 4ZDWA 1FQOA 4CKEB 3AVYA 5IAEA 2HIMA 4YH1A 2Y6VA 4NOJA 1E2FA 4ENRA 4RWEA 5JH7F 4D98A 2YXBA 5FWNA 3K70C 1NKTA 1T3LA 2ISSD 1DAIA 2JZNA 3L1HA 4N5LA 4NJEB 4B6EA 3LPNA 1TCVA 4BO9A 1DEOA 2MU1A 3MYYA 1LZLA 2C4KA 2D3TA 3FCEA 4P8RA 5F1KA 5AK0A 7AT1A 4PS1A 5DGTA 3HA5A 4H0CA 1T36B 3LBYA 5FO1A 1GJRA 1G1AA 5KVCA 4WCFB 1VIMA 4WASA 3RRMA 3D4IA 2GBFA 1RT9A 5B58T 5CCEA 3FAZA 5C8ZA 2P68A 4UUNA 5BMVB 5IBQA 2XOEA 1J21A 3FFTA 5BSEA 3CPJB 3TEMA 4KRFA 2O59A 2H7XA 2SECE 1CYEA 1WR8A 2J6IA 3OLCX 1OASA 3F2IA 4D81A 2ICAA 1J0CA 2JDIA 2UZ0A 3IQGX 3GZTB 4PLPA 1E5XA 3COSA 4FLEA 4XWKA 1G9XA 1E9VA 2AFRA 1IG3A 5CNMA 3R41A 1UEJA 3K8OE 4HMOA 1KU0A 3VGJA 2YNMD 1P9RA 2I54A 1Y7LA 4TS3A 5E8JA 5HW0A 1WHSB 4YGYA 2G3YA 1QZUA 4A82A 3H6KA 1FRZA 3COWA 3FROA 2UV8A 2PXCA 4GMFA 1RXCA 3BRCA 3AYXB 3O94A 2P9QA 4IO1A 3EFOB 5H3LA 3ROFA 1UOQA 5BY2A 1A9XB 2YJ5A 3VYWA 2H5JA 2PZ8A 5KO2A 1SVIA 1N5DA 1NBAA 3C5CA 4O5OA 2PYDA 4RY9A 1QR2A 4M1MA 3NHRA 1R8QA 4TOIA 1QO0D 3L6DA 2Q8PA 2QI9C 2OGWA 2VPPA 2XTNA 3O83A 3IUMA 4HFMA 4KH1A 3TIFA 3MIZA 4ZDIA 1OIXA 1PR9A 4K9DA 1FU7A 3STYA 1OV6A 2X4GA 2WFLB 4M9ZA 3DZJA 3EXFA 3UH0A 2WWVD 4DCJA 4A2PA 1U7PA 3VPBA 1QQBA 5F2EA 2GGSA 3N0WA 1GRCA 2FVYA 1AZWA 3N0XA 4B5KA 4EVSA 3DTVB 1GGJA 5I7AA 3NGLA 2CJPA 1J0XO 1PQPA 1XLVA 2J3QA 1Z4LA 2P11A 5F78A 4N48A 3RNLA 2XMSA 3PFNA 3N3BC 3ACCA 4DBLC 3NBKA 3SC6A 3C3YA 4UOEA 1JT9A 3LS2A 3IILA 2DUJA 2QY6A 4IMRA 4U2BA 3RHSA 3HCBA 4BVHA 5KPDA 2QKYA 4LCBA 2IFTA 3AI2A 1O94C 3CW8X 4LXHA 2YHSA 1MT0A 2FU5C 3EXIA 1P0MA 4WLUA 2LNDA 4GU5A 4IY1A 1R6XA 3JD1A 3DLPX 1MIHA 3FYHA 2PMBA 4CPDA 3GP5A 4KYIB 1JJBA 1HC7A 2F9LA 2FRXA 4MUGA 4RVGA 4HSGA 1HEIA 3E5HA 2PJUA 4RNDB 1RAEA 6REQB 7REQA 2INGX 1TU4A 3MLBA 4URVR 1D3AA 2NZ2A 4ETMA 1ZM2A 2OLJA 3RJ5A 2GZ3A 1UL1X 2VAMA 2ZI5A 3F5FA 3H18A 5AR1A 2G9NA 3B6ZA 4YJKA 2FP4B 2F9MA 4L6CA 2PU7A 4U2KA 3TLKA 1HY3A 2Q1TA 2YQ5A 3LV8A 4LVCA 4EI7A 2DWOA 2NOAA 4OA8A 2QN8A 5BR8B 2NYRA 4ARAA 4MDFA 2WJJA 1JQJC 1MEOA 1T15A 4RMHA 4S1TA 1PS8A 4LZPA 3QWIA 2R8RA 2ODWA 1QH1B 4GE3A 2P41A 2QUAA 3I45A 4TTAA 1UZUA 4JFRA 5FOVA 4CWAA 2ZTMA 3WGLA 2F4NA 4GGPA 1UBEA 1XHFA 4IGKA 4O5AA 5IJWA 4WKPA 5CX1B 4MZDA 1AT1A 3H5OA 5JSKA 1NVFA 5F33A 4BU0A 1U81A 2O2JA 4E5PA 1B7GO 3CZAA 4JJFA 4W1PA 2GXSA 3EE6A 3IODA 1YS2X 1AKMA 3QU9A 3R6DA 5FTNA 5B3LA 4G36A 1UCFA 4CKCB 4FFOA 4OB6A 3F7MA 2FLWA 2IYEA 3NBMA 4C7OB 5CYFA 4YMHA 1F9AA 1F4PA 2OBYA 2PRJA 4L9SA 2PKXA 2VHJA 2RHWA 1KFCB 1PJ3A 1L8AA 4F8YA 1ZMXA 4TSRA 1EJ2A 1ORWA 1TYDE 4I4TA 2CNKA 2FSUA 2I2XB 3TQIA 3WDSA 5BPHA 2F3TA 2FX5A 4GZMA 2YN0A 3QFHA 4MW0A 2ZVJA 5JRZA 2ZTVA 5HRAA 4TTRA 3O9MA 3UC5A 1KK0A 3OKAA 3SIPA 4MB0A 2W2OA 4S1VA 1JWAB 1T5IA 3PCRB 2JIPA 3AHEA 1W49A 4K9KA 2A6PA 3RU7A 3TSOA 4HFRA 1RW4A 3U3XA 3TNDA 5EE0A 5JCZA 3CUYA 1R9JA 1KHHA 1U65A 2QV7A 3FSRA 3LX4A 1OSNA 3ABOB 3BWVA 3ETHA 3ODPA 4QYMA 5ECGC 5E9AA 2O8BB 1QV9A 2PTHA 1ORDA 4UTXA 3BMNB 3O9VA 1RYYA 2Q5OA 2R00A 2CHVA 3IMGA 4TMFA 3SDSA 1ZA2A 3ZU3A 1SKYB 2ECKA 5LCXA 3GPLA 2ZRJA 5D5PA 2FMHA 3BFVA 1QB7A 4Y1FA 2ETVA 1QONA 4K3VA 4B4UA 2WY2D 1Z4KA 4N39A 3PQ4A 4ZD6A 4JLUA 1H66A 4LJYA 2BDEA 2DR2A 1JEDA 4EFLA 1RLOA 1RACA 2WC1A 4I4CA 4EG7A 4ZO6A 5TX7A 1K6EA 2PO7A 2QTGA 3CWCA 4KVZA 4N6GA 3Q40A 3NANA 5CT5A 4AJ9A 3FYCA 4YRNA 2QN9A 2W6MA 3I4CA 5JAHA 3E5MA 1RXUA 2OV3A 2V59A 4R69A 1GTZA 1RMQA 5AJZA 2ZPAA 1NRWA 2JCBA 1NGSA 3FGOA 4HNTA 4QG3A 1DX4A 2H1LA 1O6CA 2Z83A 2WABA 2NAPA 3MPOA 1YJXA 2HMWA 2PT5A 3KQVA 4FEYA 4IIUA 5AVKA 5KJ1A 4QEDA 1HYEA 1FW6A 4P4TA 3V2IA 4DV2B 1ZRMA 4C05A 3K31A 1ENYA 1MEEA 3BIOA 3VBCA 2IOQA 3GLVA 1RWMA 2AB0A 2JGEA 3LHSA 4KLAA 1OJLA 2BGUA 4PGMA 2TMDA 2Y0CA 4Z7OB 3ER8A 3VJLA 5A3RA 3V4LA 2DTDA 3K0FB 1Q3HA 2IBMA 3QFRA 4ZANA 1WVIA 5AKLA 3HCNA 2V4MA 1PEYA 1WIWA 1WTAA 3I9MA 3G0HA 3RJTA 1NF9A 4DQ0A 3O03A 3KJHA 1WB4A 1QOQB 2C2HA 1Z5ZA 4Y6RA 2M6KA 1K7FB 5MHTA 5LQRA 2DWQA 2XMZA 2X5OA 2HK9A 3CRW1 2ZIVB 2VKQA 4WCVA 1O95D 1F38A 2VF4X 5TGTA 1KY5A 1V7CA 2Z95A 3FPKA 4MPPA 5TS2A 1QLWA 3RANA 4EY6A 5B3KA 2P9YA 1VIYA 3W5CA 1U3UA 1Y6QA 1BGWA 4UNPA 1QG4A 2XCSB 1GKUB 3IBGA 4WK4B 3CXUA 1HG1A 4NCXA 3TTYA 4JLSA 4JYZA 1PQYA 1OBHA 1PNOA 5G53C 3GJZA 1J33A 4ZCQA 1WXWA 4OLJA 5JFGA 3WGNA 1MJGA 3EVZA 1C7RA 3HMKA 2IYFA 4JGIA 1WY7A 3IUNA 1EAYA 1E5DA 2QRVA 3UGQA 4F4CA 4C7VA 4CRWB 4W1RA 2GTIA 2CUTA 3CSSA 4WNCA 5J4LA 2I6FA 3VPAA 4ZU3A 1YCDA 2D00A 5ICEA 1UXHA 2GT1A 4X92A 1P1RA 4M7WA 1QHHA 2ZTHA 2V5VA 1J22A 3L1UA 3C3MA 1YRHA 4LXTA 1F17A 3BVPA 4K9SA 2GPNA 3JD3A 3SQOA 4Z9BA 3RUPA 4FEEA 2WV9A 5TVKA 1YKGA 2AQHA 4JUAA 4X00A 4WXPA 3IT3A 2HUPA 2QTAA 3R77A 1DO0A 1V26A 2FPXA 5EMMA 3V8MA 2UYHA 2L42A 2BEWB 4I08A 3R8FA 5AW6A 1FDSA 3B70A 1Q3TA 4DADA 1YOVA 3Q2OA 3LPMA 4K6MA 4MIOA 3TZBA 2Q45A 1AS0A 4M3NA 3ZKWB 3LC7O 1ZITA 1UT6A 4FHEA 4J29A 1MX9A 3GAMA 1FSPA 3SQXA 1GQQA 2WSSD 3OEHD 3MWFA 3NPMA 4O8ZA 3UJPA 5LM3A 5EHXA 2AFIE 2VHUA 2WF9A 3ABQB 3VYSB 2OVFA 2J0UB 3D6JA 2VJCA 1YJ5A 4NFLA 4QJ3A 4JOBA 3TDMA 2GNPA 3MBKA 1VL2A 4H0FA 4CL3A 1W36B 2JANA 4F96A 2OFPA 4KWHA 4QUJA 3CNNA 3KYCA 2CMFA 2O8CB 3HZRA 2LIPA 2QS9A 2JLXA 4LFBB 3R5JA 3NNSA 4IIXA 1X7YB 3BYZA 3EWNA 4P6VF 4E70A 4JL5A 3OKCA 3PXAA 4XXHA 1G6Q1 1ABFA 1SM4A 2JBWA 3UT5A 2FPLA 4WD3A 5J2TA 4E5YA 1RAAA 2KLBA 3MAJA 4P5DA 1IXRC 1FFAA 3WKCA 2CWDA 1T8YA 1EB9A 1X3LA 1CJSA 1DG3A 2IEDA 5DNYB 2O14A 4MINA 4NZ9A 3BK2A 5DVZA 3P9NA 2BVNA 3E3AA 1QLHA 2B1GA 4OX9Y 4YHBA 1FZQA 1MX1A 4RTNA 3UGJA 3MTIA 1Z8NA 1TM7E 1JS1X 2OLKA 2ORIA 3OSUA 4GGOA 4KUGA 2O8FA 5LU9A 2I65A 4AKIA 1OZAA 4K03A 4WUTA 5FIUA 2ZJZA 3DVRX 1I7DA 2RGBA 1E5LA 3DO5A 4A7PA 1R6AA 2CZCA 2XCQA 3TBKA 1CUJA 3GVPA 4EY5A 3K0BA 4LZAA 1KARA 1E8MA 2I7VA 2JAOA 3JZIA 2QT0A 4GS5A 4J4TA 1G7TA 3ZE2B 3QLVC 5EIFA 1Q0HA 3TRHA 4AIIA 1YL6A 2R2GA 3JW8A 5J5VA 2WJIA 2JDID 4AZ0A 2X8BA 2JAUA 3OU7A 5A9RA 2E55A 3EHEA 3EH2A 4UHDA 3S27A 5BWOA 3BFJA 3FAKA 1W30A 4PYIA 4L0QA 2FSPA 2Y2VA 3WGVA 1HLPA 3ZDXB 1IJFA 3LUPA 4BV8A 4EUKA 4KPYA 3SHVA 1EVJA 3U44A 1TQHA 4E5KA 4KAFA 2JIQA 3HPRA 2YW2A 1QHIA 2KHZA 3E27A 3DUWA 2WD9A 3NHSA 4Q66C 4DMUB 3IQWA 4OU4A 3H11B 4YCDA 5TF4A 4BX0A 1Q0SA 2I6XA 3G2LA 2BBSA 2I7DA 2ZSUA 2ZJ2A 3OQHA 4TLEA 1E3SA 5CB6A 1UMBB 5EEHA 4FN5A 1Y1TA 3JWIA 5EE9A 1EP2B 3EDYA 3FX2A 1JQKA 4BZXA 1CERA 1RVDA 4YRPA 4MLPA 1Z0UA 2ZYSA 1Z2DA 4MWTA 3ICCA 1L3CA 2X13A 3DDSA 3OJCA 4B31A 2KSQA 1XAGA 4B2YA 1LK7A 4L4XA 2RKWA 5JCOA 4JI8B 1DFHA 4YYZA 3JWJA 3CX8A 3UJNA 4LA4A 4AKSA 4R16A 1G5FA 4Y7DA 3ISVA 2OGZA 1SD1A 4OMUA 3SMQA 3CVWA 1JEQB 4Q4LA 1LWOA 1SVNA 1QHXA 3AJRA 1CDDA 2VYVA 1HNWB 2FWNA 2HWYA 2YFHA 3AERB 3JAWB 3V8RA 3Q5EA 1GQYA 3N2LA 5AVUA 5EJ6A 1E7QA 3QKSA 3TRJA 3GYGA 4M6WB 2XXAA 3EGVA 4QPZA 3BF8A 2DHDA 1Y4AE 4ZXFA 1IBMB 4R40A 5T7BA 2C54A 4EG8A 1PFWA 1ZUD1 3BIJA 4IDQA 4A0SA 5ADVA 1UINA 4KPUB 5CIQA 4J9UE 4P7FA 4ZT7A 4E1AA 4E08A 2A0UA 5IXJA 1A4IA 4XWYA 2W2VA 1R4NB 5DIFA 1T0HB 3U4IA 1KFKB 2Q5JA 3TQTA 3MS4A 3SR3A 3D7MA 3GQBA 2ZI3A 2ZAOA 4HV4A 3P9RA 1ZUWA 3L9XA 3WYNA 3VYRB 4FP9A 5DYYA 3TSWA 3HB0A 3PC8C 4D9NA 4PFKA 1UKZA 1ND5A 2W0MA 4URWR 1VGQA 4GOND 1GGMA 1GRRA 3A6LA 1QE3A 3RFFA 2P9ZA 1YR6A 4WESA 5CNIA 3ZK9A 1CQZA 2WT8A 2PUFA 1JSZA 5EJIA 1PL7A 1ODCA 1X9IA 4ALJA 5A5EA 5KYUB 5K8LA 3OICA 2PTGA 1NUUA 2J32A 4L8FA 4ARUA 4BN0A 1O6GA 2D62A 4DA7A 2WKSA 3DFZA 2HUNA 2GFHA 1AKUA 1KYIA 4OY3A 3UHPA 3L5KA 5H4GA 1WPQA 1E5VA 1USWA 3UK0A 1NE2A 1D7AA 2HA3A 1N2CA 3MJ4A 5H70A 4P9NA 3P0IA 1MTOA 1TEVA 3CBQA 2JVJA 3AR5A 2F43B 4TYYA 1G2OA 4HAUA 3R75A 1A9RA 4TZKA 2C2OA 1GVHA 3LBNA 1XHEA 4P92A 5DV9A 5B1HA 4IKPA 4CKZA 2H1IA 1FNCA 3ZKAA 1I7QB 3IE1A 1VYUA 1XAIA 3DFMA 3NORA 2G77B 4FYXA 1N1MA 1SKMA 4OQEA 4BNUA 3U7QA 4DCUA 1O5OA 1ZONA 2N0SA 1XVAA 4MKFA 3QQ5A 5D3MA 4F1JA 4PRLA 5A2GA 4Y3UA 4LN1A 3LIIA 2LD4A 1GPDG 4ZQGA 2GOYA 2JFYA 2ZYRA 1DOAA 1YQDA 2BV3A 5ABPA 1IVSA 2IYZA 1E3JA 3QUAA 2JJQA 3RUFA 1RIFA 4ZVUA 1UKAA 4AP5A 4RQTA 1B76A 4TYQA 4F2PA 4CEJA 4JJ8A 3DZDA 4FFLA 5DXJA 4ALLA 1J4AA 1VKHA 2VLBA 3FIJA 1SCJA 3WQHA 3BSFA 4F4FA 3A05A 3DZGA 1RAGA 4WY5A 4CXMA 2PZKA 2A4MA 5H59A 2DKNA 1UOOA 4XSVA 3NVDA 5JD5A 1HSZA 3IAHA 3OP4A 5H81A 2VQEB 1E69A 5KIAA 2ADMA 5B1IA 5I9MA 3G2NA 4E09A 3D6NB 1I7SB 3LKZA 3RV4A 1U8AA 3NM5A 3T3DA 3BCUA 2RE8A 2ZOSA 5D5HA 3HCAA 4XM0A 4LISA 1GZVA 4UMFA 4PTZA 2YYZA 4G4SO 2FMUA 4I5FA 3ZIAA 1MU0A 2Y77A 2F67A 4OJKA 2DX7A 1UKEA 3TZ6A 3ZOZA 2X3UA 2I0FA 2OPBA 1PK8A 1K5DA 5LA6A 1H85A 1I0LA 3I72A 1O5TA 4P82A 3G2OA 3TECE 4ZALA 2I6TA 2W4QA 5CJPA 3AGPA 3GMSA 1UEXC 3D8UA 3C3AA 3R3JA 4FFMA 2F3UA 4X0EA 5JCPA 2V8OA 2HYDA 3U7GA 5DBEX 2IYWA 4KQHA 3TN7A 4HTFB 4OLFA 4ALKA 3R74A 2EKBA 1C9KA 1WCXA 4H7HA 5CW2A 4WOKA 1KAQA 1T0PA 4MYUA 1JV2B 4NPCA 1WETA 1M6YA 4PVDA 4CV2A 5D85A 4DIOA 4GPD1 4OMDA 1SU8A 5DGDA 4RZHA 3ZE0B 1P44A 3OF5A 3Q7PA 4I0WB 4X7MA 3P9YA 4BZPA 4D3YA 4PU0A 2I4OA 1GLGA 2R96A 3HXKA 5EP4A 1SXHA 2IPXA 3BICA 4K0RA 2HNKA 1V41E 2HK6A 1FFBA 2ZRCA 3EUEA 3O73A 4MA0A 2CSXA 1THTA 1XALA 4LVOA 2FG5A 4N54A 4FUQA 4BVLA 3C2QA 1BKDR 1DQRA 1M75A 2XWPA 4LDRA 1U2DC 2WFAA 2WJ6A 3ZCTA 5KINB 4N76A 4WBNA 3O8NA 1XCMA 3MAAC 3K2EA 4FQ5A 1NVXQ 4TL6A 4X3PA 4BQSA 2C9MA 1TK9A 5AW8A 2IYYA 3ISJA 3UMSA 2QZZA 2CD7A 1PD0A 5BR7A 3ZVLA 3CJQA 4ZODA 1O5IA 1ISMA 4Y6OA 4QTYA 1TVCA 5JW6A 1DJOA 2ZI9A 4ZP1A 1X9HA 2FF7A 3H2KA 4Y1GA 2JHCA 1NV8A 4C6HA 2OOKA 1X77A 1G5RA 4DN6A 2IVFA 3RHFA 1UDRA 2P27A 3HH8A 2VA9A 3M1AA 4RTOA 4N3BA 1O6FA 1XRNA 2LUOA 3ER9A 4LE0A 3GFOA 2NSDA 4V02A 1BXKA 1GHTA 4J90A 2H8KA 3SZLA 4DG8A 3O7MA 1YDMA 4KZPA 2XUKA 3CRRA 3F67A 2JGNA 2REQA 4FYIA 5DJ5A 1JBEA 3E58A 5AP9A 2DFVA 3MILA 4E7OA 1O9GA 3R5HA 2B99A 2LCIA 4LOKA 1IK6A 4E2XA 3M5CA 2ZVPX 3FNQA 4DBVO 2DCMA 3BORA 2CV2A 1JKMA 4E2YA 1MQ8B 5LB4A 3F5MA 2OORA 1MPXA 2X9QA 3MVEA 2F64A 2H1OA 2E48A 1AKNA 1RWVA 3ZJ5A 1SC4A 3WSWA 4EYGA 4N82A 1UBCA 3BZBA 3LY9A 4UEJA 5KKAA 4ZMRA 1AHNA 4TUYF 1G20B 2B3DA 4BNDA 2VSFA 4Y8VA 4GLFA 4D8WA 5AW5A 3AFNA 1NVVR 2BZ0A 1MCZA 3GA7A 3N59A 1AHPA 2DQZA 2PGDA 3D43A 4JL8A 3GHHA 4NWIA 5CR9A 5BOVA 1UAAA 3FCAA 2NU9B 3A2KA 1IHDA 1S1MA 1ZNXA 1OPRA 4CFZA 2C2WA 3F3MA 4FB4A 4F5ZA 3OZVA 1Z4QA 3CPEA 1PVDA 1SOMA 4QGSA 1VI6A 4PR3A 5BN5B 3IKVA 5EIBD 1XU7A 1GNSA 1L5WA 2QA5A 3W2HA 1KE2A 2HRRA 2X77A 1KYTA 1L5HB 3BZUA 1PLKA 5AVWA 4FD2A 2PR7A 4G63A 3KUXA 4KO2S 2Q3DA 3A3OA 4JBGA 3DW1X 1UIMA 4YFYA 4IVRA 4Q4DA 2VHEA 2WD7B 3L7DA 1L7BA 3GJ6A 1N57A 3DKRA 4B34A 1R7RA 3GVCA 5FAKA 5A62A 1OX6A 1AH2A 3D7LA 1SHLA 5B12A 4R41A 5THKA 2ZYWX 1ZMTA 3N6VA 1OH5A 3DEJA 4AD8A 5FI5A 1S2DA 3SYRA 2G5CA 5B2ZA 1X2EA 5AH0A 4HAWA 4JOCA 3QKRA 4HEJA 3C6KA 2Z5LA 1CR2A 1YI8A 4B3XA 4NAHA 3OU2A 4DA9A 1K89A 3I6QA 3LYHA 4H17A 1NPDA 4WKBA 5DW3A 5EIHA 2O2CA 5A4FS 5FOQA 3UAXA 2P2SA 2DP4E 1DTEA 1M1YA 4HXEB 3OWOA 2BISA 2WJWA 2FZ5A 4LIPD 4XLLA 4GR9A 5FBWB 3V33A 4AX4A 2P4HX 3PTZA 3HVKA 1Y7PA 2GPBA 3WGKA 1IZZA 4OQMA 5JR3A 2AC2A 2QTLA 5CHYA 3WLIA 4BVFA 1D5WA 6YASA 2QGFA 3UT0A 3PICA 1XD2B 1DG9A 3OVMA 3M6XA 4COKA 2VZ8A 1QC5A 3Q9UA 4L07A 5G40A 4FGLA 3BJMA 4GFDA 4DLKA 3OOEA 3ZTWA 1SQ6A 4A4DA 3LQ2A 5K6RA 1VMEA 2FQXA 2FN7A 2B1IA 2QG6A 4DTCA 1NYRA 3C39A 3K2QA 3EZ7A 1PGNA 1Y9DA 1TZKA 1Z5NA 4KFRA 3PSAA 4LRSB 4FGUA 5K1ZA 4YJGB 2OHIA 4C3OB 1M3SA 1M1XB 1MHPA 4LBWA 4Q0MA 3W79A 3CNBA 2AUTA 4OQXA 3VTZA 2ZS9A 2VEDA 1YDGA 1O9BA 2MINB 1P9OA 3VUEA 2XNKA 5T8KC 1DJLA 1V8BA 1C14A 4P5EA 1G4AE 3OUZA 5C5DA 2J5BA 3IOMA 2DM6A 1JLMA 4BLVA 1T1SA 4YRRA 2GAFA 3KLMX 3IAS6 1QTIA 3GLIA 4FR2A 1KO4A 2CSUA 3OWXA 4V3CA 2O1XA 3LVRE 1LV7A 3FOAA 1QAQA 3KE9A 3PF9A 4RGBA 2GCOB 3MUNA 3WLOA 4E0BA 4ZHQA 1IEVA 4V24A 1F06A 3Q41A 3UCFA 3VNVA 4NZOA 3ZGYA 5K8TA 1EGQA 4WAUA 3W4KA 4IHJA 1DKRA 2A3RA 1OH8A 4WZBB 1BQEA 4AY2A 2NX2A 2W2NA 5IT5A 2VF5X 1A2QA 1JLRA 4GUDA 3TR5A 2ZUBA 4RIIA 3MT0A 4R8VA 4KYVA 2Y1EA 3OPYB 2FY8A 3FTQA 5DI3B 8GPBA 2EFGA 4EGFA 1CS0B 5ADWA 2AFHA 3HXOA 3WE7A 4R83A 3EVTA 3HDYA 2HJGA 2VYVD 4ZFNA 4TLAA 5AW1A 1E77A 2AN1A 3QVOA 4LWQA 1ZUNB 4IH1A 4OK3A 3GMIA 4TYPA 4UCFA 1KIMA 5F2KA 1KI7A 3T38A 1TO2E 1AXGA 1I7NA 1TF7A 1XE3A 1VCIA 3N8DA 4HEA1 1GT91 4UFOA 3REQB 3RU2A 4DLSA 3ROEA 2W2PA 1AGNA 1FVXA 2PZAA 4JEHA 4W6ZA 3ZD8A 1EJ6A 4E21A 3ADDA 3P0EA 3F6PA 4BUZA 4NABA 4ITVA 4IV5A 3A26A 5AT1A 3GZNB 4F4HA 2NMVA 4O2BF 2ZM5A 2ZIWB 4TV9B 3DBRA 2J6CA 4MS4A 2P0YA 1G8SA 1XDUA 1MVOA 3L05A 3TPFA 3OT4A 5A06A 2HJVA 4U2FA 2DHEA 1WABA 4CMIB 1HE1C 3E9EA 4XEHA 1RRMA 1RVV1 2JJ1A 5AW9A 5T57A 1U4NA 4U02A 1Z6XA 2E6UX 3VC3A 2AMLA 1YA8A 3MS7A 4Q4JA 2ID9A 3CEJA 3HA7A 3THXA 4G0WA 4D1YA 2P1ZA 3ZHSA 1K68A 5EHZA 1P2BA 3U3KA 4IH4A 4EA8A 1Y9ZA 3VU9B 4CQLA 2G36A 4F1KA 1MX5A 1ABEA 1WF6A 3JQ7A 5DT2A 4ZT5A 5LYJF 3VC1A 3PXCX 4IQ4A 1FFDA 5E6SB 2G4CA 5B7NA 3D1VA 721PA 1ZICA 2SCUB 1XTVA 4RBNA 4EHHA 4EQ6B 1G18A 2QDXA 4ID9A 3CG4A 3UV3A 5JMOA 3W06A 5IAAA 1JHOA 1Y8QB 2D7JA 3ZHCA 1AZTA 3MTDA 5LR6A 1UMDB 1WD5A 3I2KA 3S2GA 2DLDA 2N75A 4RZUA 5ES4B 1ULHA 2G06A 3TRFA 4DR5B 4KVGA 4R6WA 1G9TA 3QYFA 1TJ5A 4WTOA 1BXGA 1N2GA 1X7WA 3NTXA 5KI6A 1TQ4A 4NDAA 1XZNA 4MKGA 4E5NA 4EKDA 4QJBA 2QN1A 2BP7B 1E2QA 2BMJA 3WRYA 4B2LA 2QSZA 3B6IA 4AQYB 2EW8A 1NSTA 2O3QA 5EUQB 5IK2A 1OYOA 2ZXEA 3D3KA 4B87A 4EG6A 4XUEA 4A10A 2OCAA 1OPXA 3NB0A 4Y9RA 2FWIA 1CQWA 1RQXA 2HI0A 2OGSA 4CLHA 3HO6A 2GK4A 4OU5A 3V80A 4UFNA 3FPBA 1XQVA 3MTEA 3PE4A 4KAAA 5CH3A 4L4ZA 1MO2A 2QMQA 2YQZA 4EVQA 1OLXB 1SK9A 4FVTA 4P4NA 2OMKA 5IVKA 1NJ2A 4CM8B 3EOBI 3K9BA 2FW0A 4OQQA 4Z0HO 2ZUDA 4C7XA 4C4AA 5FBQB 5FNVA 2GEBA 1JWBB 2RB5A 5EE5B 3RYIA 1QX3A 2DECA 1WMBA 2ZU6A 2DFPA 3IP5A 3WKDA 5P8WA 4IHKA 2WIKA 4MIYA 2I6SA 3EQZA 2FEAA 3G79A 2UKDA 3GT7A 2V6IA 5HZMA 2V97A 4HLDA 1N2IA 1K86A 2Q5QA 3BERA 2JC3A 3EJ6A 4MGEA 3ZIAD 4EAAA 2DFDA 3VOSA 5JH7B 4J49A 2QX9A 5DGXA 2X9VA 1KMHA 4NEHB 1LRLA 5B3JA 3EQ2A 4NBWA 4X6XA 3RS7A 1CVRA 3UJ8A 1TB4A 2BELA 1PS9A 1FRFS 4BFWA 3NR2A 1Y5NA 3QBDA 1CUZA 1M6NA 2ZB7A 3LT1A 2AYYA 2HCFA 4MQBA 3WHIA 3EDQA 4RJTA 2AVDA 4DMMA 4J6FA 5EC8A 5EN4A 4B46A 3DZCA 4YCBA 4Q9JA 4OXNA 1GA4A 4GD3Q 4UASA 1Y5RA 3KB2A 3HKCB 3QMVA 3C98A 2F1IA 4OP2A 3LBHA 2VYQA 3JYOA 1QHFA 3FOBA 4GI3A 3IVAA 4KGXA 4MSUA 2FRDC 5AESA 4MLZA 3A10A 3Q9LA 5JNVA 3IQDB 1A1SA 1X7XA 3K5HA 4I50B 3JQ8A 1M2EA 1U94A 4X1OA 3WAKA 1JLLB 3PX7A 1UBHS 1LPOA 4H77A 3SI7A 4BWYA 1V2HE 1DC3A 1KJJA 1WW3A 3QYPA 1L5YA 1GU0A 5EWJA 5L40A 1Y6GA 1TE2A 2IGTA 2WSBA 3HJFA 2WUFA 1NBIA 4DLWA 1U3WA 3GLGB 4HH3C 4IFTA 3DLBA 4PHTA 5G0TA 1UXOA 2FV8A 2R1VA 1FYDA 1I3MA 1XU9A 1K7XB 3DW3X 3ZE1B 3G82C 3KAKA 1G64A 2O6HA 1CNFA 1PQ4A 1H9BA 3HVRA 4GMGA 4L8WB 3RVNA 5I7HA 5D6NA 5JNTA 1VECA 1JQDA 1P9WA 1T2AA 1R88A 4G25A 2VATA 3AFOA 3DBIA 2A9KA 1KQOA 4TT8A 1RQPA 5D7BA 3VDXA 4IS3A 1W1UA 5JMPA 4EW1A 4GYKA 2FSIA 3NHJA 4PO3X 3Q3JB 2Z6AA 4BN4A 1R0ZA 2HEGA 2QZJA 4RYDA 2OXIA 4BGIA 1M8KA 1V1MA 1YJBA 3P2YA 3CX6A 3K5IA 2CLSA 3RG8A 3TL3A 1NG9A 1MEJA 4JJ7A 1YE3A 2FVXA 4MVJM 4TS1A 3TLGB 1CEQA 3KPUA 1YJCA 1WZ2A 3VKGA 1SG0A 3KXLA 2D8AA 2PX4A 4KE9A 3R23A 4WXRA 1INLA 4JNCA 4O59O 4D82A 3PNSA 5KWIA 3HLKA 1J1IA 3SKVA 5BYBA 1W36C 3WX0A 2ILVA 2VOEA 3OZGA 2CNNA 1ZSVA 4E1VA 5EKDA 1JW9B 3I5YA 1BWPA 1IXZA 3OIWA 3Q8WA 1WSDA 3ZWKA 2LWIA 2WM3A 1Z5PA 2BSAA 1EVQA 2IYPA 3EGXA 3G9QA 5CITA 5KHLB 1OH6A 4DQXA 1H6DA 1OLSB 3GDOA 3LXXA 3QU2A 4Y0VA 1O03A 3B3JA 5NULA 1P80A 3WMEA 1CWUA 4QLBA 4AKTA 1NDUA 1WSWA 1E3DA 1UANA 2Y27A 1A9QA 2YHIA 2GHIA 4EHJA 4QA9A 4ZVVA 5TQ2A 2F8SA 3WB2A 3EG5A 3TLYA 1E4VA 4RLHA 3VU8A 4J8PA 4EHKA 1K6IA 4ISCA 1XTZA 5C4IA 4L6IA 3UYKA 3RT1A 1ATIA 1HI9A 3WGHA 3ZWDA 2DEUA 1CLUA 1CZHA 2WTEA 2GAOA 4RLQA 4BX9A 4NIMA 1X7ZB 1AMOA 1CLEA 4GLJA 3Q8LA 4QREA 5L3QB 4MP6A 3INRA 2VT7A 1J90A 1SXIA 3A11A 1CY6A 2HF9A 4OXKA 3HKDA 3SE0A 2RKOA 3SC4A 3D8SA 4FZ3A 1K5HA 3EH1A 3VH2A 4XOUA 4G2TA 4DJAA 3UVEA 1SXQA 5A6SB 3GEIA 4KDRA 1XQ9A 1Q5PA 5ALQA 1U1GA 4RTMA 1COWA 5F52A 1RHRA 3C48A 4UDNA 4G84A 1STOA 2FPSA 2EL7A 3PYMA 3SDZA 2R48A 5DM4A 3FSEA 1CRWG 1JH9A 5FPQA 4WHMA 2BLLA 1ZA1A 2V4UA 2UUOA 4MAFA 1CVIA 1E99A 3QPAA 1GRQA 2PGIA 2VF7A 3CRNA 4EG0A 2J3JA 1C2YA 3DD1A 4CQNA 2HW8A 4GSKA 3HTXA 3L4JA 3O4IA 1YBVA 3KSZO 3K8YA 4RABA 1AXRA 3AW8A 8ATCA 3RAJA 3GOQA 3KPJA 1Z68A 3M1LA 2X5JO 2M9MA 1GG8A 4IMIB 5E3IA 2OBNA 3NGXA 4NCJA 4DMFA 4ZARA 4XPIA 5DT9A 1NPTO 3IQEA 5C7YA 1WHTB 2C2XA 3IKJA 1W8DA 3VDNB 1OX4A 1ZDMA 2XD4A 2ZRNA 1FL9A 4F38A 2PN1A 5I4IA 5C80A 1YGYA 3B3AA 2YJNA 1YQUA 4I5GA 4Y2TA 2VUSA 5EA2A 3SYLA 1DJMA 2ZBDA 2XYVA 1T4BA 3QRWA 4GG1A 2Z8XA 4H3HB 3W0LB 1FLAA 2PCLA 5M04A 1PG2A 4IUCS 3FOWA 5B1YA 4MQUA 1TKAA 4QOEA 3KYBA 1NL3A 5TQVA 2JEZA 2ZT8A 3E3NA 5CYGA 3K94A 2LIVA 2XQJA 2ZT5A 4NZNA 2QY9A 1XPJA 3QMPA 4BP1A 1LGYA 2I87A 1EXVA 1JVSA 4X84A 3UJDA 3C5VA 3TB4A 2I2DA 1OVGA 1Z74A 3KZNA 4V39A 4BE4A 4F3KA 1CUWA 1DBWA 3SMVA 1DIRA 5K7SA 2G8NA 4X1KA 4EW3A 5CM8B 2V1XA 4QGBA 1DCFA 2R25B 4PGHA 3VDRA 4TMVA 5T41A 3KEQA 4Q1EA 3MCTA 2G82A 4FC7A 4MB2A 3OCCA 4RD6A 2QL5A 4XUCA 1NXXA 1XSEA 3JZFA 2AR0A 2GLXA 1CU1A 2AQ8A 3PE6A 4YRJA 4ZJPA 4RULA 1DOHA 1GTG1 3VM6A 2ILTA 1N2JA 5AJYA 2J0VA 3W6NA 1DU4A 4MAAA 2BFCA 1IWPB 1OYVA 3IB6A 4Q93A 1HT1E 1Y9AA 1JQLB 5I9BA 2PNJA 1E98A 5A1TA 4MUJA 5CLLA 5C53B 1HFWA 4QOHA 4EJMA 4B7ZA 5JMTA 1QM5A 4KUEA 4KQJA 4QVGA 4TYWA 3QK7A 1KKMA 1TLLA 2X8WA 4J7AA 2GK3A 3NWOA 5JDIA 4ZZ1A 1QRTA 1IMOA 4HO1X 3KS9A 3SS9X 2XCRB 2V7TA 2RHRA 4HG2A 3IPXA 3IPLA 2PEYA 4AVYA 4AW9A 3CVOA 2H31A 3NT4A 2H2FA 3U31A 2O52A 4TWBA 4YAKA 2Z6UA 1WZNA 4DCMA 1OAOC 3PUHA 3EF0A 4QUDA 4OHOA 1ZVVA 4M4SA 1HSOA 2ZUEA 4NEGA 5K01A 4XW2A 3WLNA 1RPAA 1UBUS 1QIFA 1VMAA 5I5GA 4BBZA 5BSVA 4R05A 4X71A 3G0BA 4MS1A 1H4TA 4QJ4A 4C0XA 1VE1A 3SR4A 5THXA 3T9CA 1BH6A 4G8DA 5C5IA 1H0HA 1AGPA 1XN4A 4FCCA 3WGMA 3P52A 4BZZA 4O4LA 4CIBA 1ATZA 1GLVA 3A9VA 2X4DA 3GW8A 3LP8A 2JLWA 2ZB2A 1AV6A 3GLHA 4DDVA 1NTRA 3G5MA 3VR0A 4DB2A 2IOHA 2QQGA 2JJ1D 421PA 4YVFA 1XTPA 2IPOA 2JA2A 3ILYA 3MLEA 5FUVA 3KKOA 1HTWA 3HJHA 4LUCA 3EX7C 3C74A 2NZVG 3COVA 1Q2UA 4WMLA 1NNLA 5K0TA 2A9QA 2R5NA 2J9FA 5FCDA 5FBLB 1BTOA 4H6PA 1FC0A 3IERA 4PPYA 1MAWA 5ALUA 2RGNA 4KNYA 3U4MA 5BN1A 5HMLA 3A9UA 4PFJA 3FMVA 3CLTD 5F9HA 1XVIA 2IHKA 3ILVA 4BKUA 4KO4S 4NYMR 1OFUA 2HKIA 2G63A 4H9GA 3IHTA 5L3VA 4ND6A 1DEKA 2I8CA 3ACBA 2CJWA 3TD6A 4CMKA 1JDNA 1BXRA 1EUDB 2QZ9A 3MB5A 3RIMA 5BRJA 4RZQA 4HQKA 3UK2A 1Y3FE 5EZYB 3FZEA 4P4GA 4JZYA 4BNIA 2OXRA 3W6OA 3C0KA 1IM2A 1ITZA 2GF9A 1A9OA 1QJ4A 4H3SA 4DJDC 3H0CA 4KPGA 1NWCA 1JQ3A 1J5XA 4LJ9A 3L8HA 3USZA 3QMMA 5IK2D 1QE0A 4POOA 2FPIB 1JTVA 4UHEA 4Z99A 3PXXA 1LEHA 1BKYA 1QO9A 2OV6A 5T6MA 1I5EA 1NJFA 4V2UA 4BNWA 3GLQA 3WB1A 3GP8A 3A4TA 5KYYA 2G0TA 4G5FA 2J4DA 3E4DA 3HV0A 1BWSA 4JSTA 4BFYA 4WA7A 2G4VA 3RAPR 1TJ4A 1PJ2A 4BQNA 1S2GA 1BROA 3CTMA 4L72A 2HDOA 4BRSA 4ZPJA 5GJCA 1ABBA 4PYJA 2ZUUA 4WINA 3S28A 1FTGA 1FSGA 1YBFA 3KJXA 2XUJA 2DR0A 4TSFA 5GQSA 1G5TA 3A4MA 3L0YA 3I6ZA 3WFIA 1GARA 4RF2A 1KJYA 3W6UA 4HKTA 1M2FA 1P4AA 5JAIA 1G21A 1XGKA 2XRMA 5ALOA 5AVXA 1GUAA 4GZ3A 3EVCA 1VE7A 2NW6A 4DEVA 3CH5A 2OBFA 2VH2A 4BKMA 2J6BA 1ZZEA 3GGSA 1XZJA 2G25A 2Z08A 3UW3A 2YJ6A 3H9JA 4BVGA 5B6JA 4CKWA 1N3LA 2XQKA 4JKIA 4NCKA 1I33A 1U8XX 4QATA 1AGYA 4QDZA 1PZFA 1WSAA 4XJVA 5EUBA 2VS1A 2QR2A 3ZHZA 3ZQUA 1DUIA 1P0QA 2ZRIA 3IAM1 4XIFA 2D54A 3IEXA 3KDAA 1VHDA 2AXPA 4NU5A 3NQ41 3KQWA 4J9VA 1NQUA 4FGWA 1FQWA 1SCUB 3HLYA 5SZJA 3SYNA 3VDMA 2O0HA 3WLFA 2JGFA 4TLLB 3CRQA 1OWNA 1EJBA 3KQSA 2IIQA 2O3SA 4FZJA 2WUWE 1C29B 3OFNA 5BT9A 3VYTB 3PE3A 2V7EA 2ODPA 5KC8A 3E1KA 1ZC3A 2E4WA 4U7DA 3O8CA 3AO0B 1Q1EA 3BEOA 3SYTA 3PS9A 2RHCA 2HWUA 1OLUA 3KKLA 3LXRA 1IEQA 4K9RA 2BSXA 2YC4C 1P81A 4I4TF 3AUUA 3SZUA 1E9RA 4YWHA 3N2KB 2HJWA 5HF6A 1B41A 1OW3B 1SIBE 4E33A 2F90A 2RK4A 3MWEB 1G3RA 2R8PA 4DXAA 4J3FA 4OAQA 3HDJA 1GKIA 1O96B 1PW7A 1SD5A 3REGA 2AEEA 2O5VA 3KB1A 2ZYHA 5SICE 5LDDC 3PEVA 1NW9B 1Q57A 4UMVA 5ECYA 5F77A 1U3FA 3TQHA 1ADCA 3ML1A 1GYQA 4Y6SA 4PBTA 4XRRA 5HDBB 1D0IA 1EBBA 3OQPA 1Q11A 4LZZA 2OY0A 4MV4A 3S7ZA 4UATA 1W35A 4PSAA 5DBIA 3W2TA 3K6SB 4XDHA 4W63A 2XYRA 5JZBA 4UAJA 1VXRA 5JSFA 1AGXA 1YJ8A 3M5PA 1S8NA 2OM2A 3GCGA 5KU1A 1M6VB 4X8HA 2WAAA 1VRCA 1Y4ZA 4D4HA 1D0VA 2GCIA 2Z3WA 4YA6A 3NDJA 4S0XA 3WGIA 3AI1A 1WP4A 1W52X 3OKFA 3CCBA 4F0JA 1N9GA 2WR8A 2ZIFA 3NCTA 3WNVA 4OJYA 1N5KA 2AH5A 4RH1A 3ZJVA 4ACBA 4DE5A 1SRQA 4JQYA 5CVCA 1XA4A 2D59A 4ZDKA 1H1DA 1NNEA 1L4LA 4GMXA 4QJIA 5FYDA 4CODB 4GRDA 4UNQA 2OL4A 1L4UA 2MHCA 2V54A 4REQB 3ZHQA 3V8VA 5K8CA 4LJ7A 2HLPA 3CN9A 4HFJA 1SBQA 1MAAA 2PSDA 2JKVA 3HFJA 3JR3A 1AY0A 5KDOA 3R3VA 3UXEA 3H5RA 2VCYA 3DE6X 4JA2A 4N7BA 4EA9A 3EAGA 5D6OA 3RYHA 2HT1A 1N9KA 4TVOA 1SIOA 2ZDGA 4D9JA 2F4VB 2AJ8A 3CISA 4FXOA 4M2LA 2AF4C 4F93B 1N8NA 1C8KA 1ES9A 2XEXA 3IP7A 3PQEA 1XK6A 3FYTA 4NJMA 4ZO4A 2CCJA 3LW8A 3Q11A 2EOAA 5IBRA 1V3QE 1R6BX 2OK8A 3GBSA 2XUDA 4PC3A 1J8YF 4OP3A 4S2EA 2A5GA 3V8PA 1NOJA 3PJRA 3EZ6A 4C3VA 1HL3A 3Q7IA 1XFDA 4M87A 4IHQA 3DE4X 3PBKA 4D6XA 4QXMA 3MA0A 3F7TA 4N5HX 3VU0A 2AT1A 3R8XA 4F85A 2F1JA 3IIJA 1L9KA 1PN3A 3MQ4A 1BCRA 3N9IA 4JI1B 2QVLA 4C5CA 1Z38A 2AJCA 4KQ2A 4NJOA 3HUUA 4TWAA 3CMCO 3KKKA 5LZ9A 2FPKA 1WQ3A 4C7BA 4CFSA 3AF1A 1EUCA 3AVXA 1PCXA 1M2JA 1Z0JA 4LJSA 3WB0A 2X7JA 3K35A 2QRUA 2B2CA 4PWYA 4B09A 2QLNA 1COWD 3G68A 4RNCA 5TQ0B 1GTL1 4I1SA 4AU1A 5C35A 1GL6A 3KQYA 4FNGA 1HRKA 1XDGA 4ITUA 5DEIA 3PQCA 4IDOA 2QTZA 1BQ4A 3OZBA 1DDIA 1S1CA 4ATNA 1ZSYA 2V0NA 4QVKA 1VCNA 1ESCA 5EQTA 1U3GA 2C5EA 4IWNA 2HQSA 5JDCA 3AETA 1UPUA 4LJ6A 4TV8F 4BNHA 1ZM4A 3FMIA 4MQ4A 2Y4OA 1CSEE 3RB8A 4I4IA 4I9UA 1WD7A 4OIFA 2R66A 3MD0A 3LE8A 4QYIA 1QCCA 1PD1A 1XNJA 2GM9A 4ZOAA 5JDIC 1QPZA 4ETNA 3DEHA 1LPSA 1KH2A 3QFFA 4BTLA 3HG7A 5LIRA 4JEUA 4D9HA 2O8DB 2HSWA 5AUQA 5ICCA 1CRPA 2BDUA 2VF8A 3UXYA 3QEMB 1E79A 4YNBA 4JA0A 4N8SA 1JAYA 5GONA 5PNTA 3H5AA 3I64A 4JWKA 2IVZA 3BK1A 4YCLA 3C45A 1PJZA 1QKKA 4XFKA 2YXPX 2A9RA 3A1EA 3LQFA 1RJ9A 1IBKB 2FN4A 1N0HA 2EZUA 1KAGA 1VJRA 2HSGA 2QENA 3HJTA 5IEBA 2FZKA 4DMLA 1ENPA 1VTKA 1H6BA 2QMZA 4YRBA 4MKHA 4LTNA 4ARZB 2R8EA 3NDBB 4FLFA 2FSVC 1HRDA 1X1EA 2JK1A 4A0FA 3JV7A 1AUQA 1SB9A 3WIEA 5LWQA 1ISSA 4BRUA 4BXOA 3NBFA 4Q1VA 2H57A 4RY8A 5AM1A 1RWXA 3RK1A 3IUEA 4CLDA 1YQTA 1QFMA 2Z5VA 2XODA 4RC9A 4RTSA 2IXEA 1TVEA 3UKOA 4YRAA 5KSWB 4TYNA 4KX5A 1XR3A 2O57A 2FEMA 1TMKA 4US1R 4HQOA 4CM4A 3O4GA 5LLDA 3IELA 4ZT4A 3R7WB 4UOQA 1DVRA 3SHWA 4AN0A 1YOBA 3JALA 2G17A 3GJ8A 2ZUSA 4V1CB 1NUTA 4ZO8A 4IYJA 3NC1C 4E12A 1K3FA 1GAEO 3OPYI 1PSWA 1UZAA 1UK7A 2L18A 4Y2RA 5HIJA 3AOEC 1DBPA 3PIRA 1ZD3A 3HUFA 1RC0A 1YRBA 4L5BA 5J2TF 4CTOA 4CIYA 3RADC 4S12A 2BM0A 3WNQA 4I3FA 4MGHA 2FEOA 1CY7A 2PX8A 3GAFA 2I22A 3KOOA 3ZWQA 4P33A 1I51A 1Z6PA 1IC6A 1NTOA 3L8GA 5TNXA 3CH7A 4AS1A 4TQGA 5FP0A 1LXCA 2JKYA 1KBOA 1YBAA 3NEAA 1Z4MA 3PPYA 3PWTA 1J25A 2CT8A 1CJMA 2PFSA 4U3JA 3HDVA 3RTAA 2GX6A 1EMDA 1LJLA 1O57A 4G86A 5CIWA 1G0OA 3MCWA 3ZIUA 3MMNA 4B6RA 1PWHA 4W9NA 4C07A 4YGXB 2JH8A 4B80A 1S7GA 1IEXA 4XSGA 5CPBA 3QVTA 621PA 3B13B 3D3EA 3THWA 3DOEA 4FX5A 1XRLA 4UNNA 3TMYA 1ZEMA 2Y99A 3G5LA 2FZLA 1L5MA 3PDHA 1FP6A 4FNOA 4JWTA 4TMYA 5H0IA 1DWPA 3O47A 1XQ6A 1W85B 3BWDD 1Q7BA 4F4IA 2HCJB 4P7KA 1R10A 5H5JA 3A0RB 5AM3A 1P2SA 2J5RA 4LJKA 2JD2A 5JJCA 1XMXA 4QC2A 1JJIA 3RU3A 4Z4IA 4K81B 4P2BA 2G70A 2O3RA 2BCEA 5LP6C 3KK0A 1KS9A 1NUHA 1RM4A 1EK6A 1RTTA 3A70A 3D64A 4PLHA 4WLOA 3LYLA 4BECA 4X6UA 4ZYVA 5B55A 1U5AA 4NXNB 5K9ZA 2QE7A 4MQEA 5IYZB 2ZJ4A 1U6JA 3LL7A 4DSUA 1YB7A 3G5TA 1GGKA 3I1JA 2UZ1A 4Q9DA 2NUAB 1OIVA 5JATA 1TIPA 1H1LA 3RUDA 3WYEA 5FF9A 3UUGA 5FPYA 1Q84A 1MG5A 4CVNA 3DEIA 2EFCB 1PJBA 2XF2A 3QTLA 4QYWA 5HK9A 2YWXA 3ANSA 3KTAB 1HDXA 3X1MA 2VOJA 3GF4A 1AHHA 2ZJ3A 1MO6A 2A0YA 4AKEA 10MHA 5G0SA 3DH0A 1QH8B 2VHQA 2FMIA 3KCQA 4HL6A 4LRWA 4QPJC 5AXAA 4NBRA 3U3MA 4QFBA 5KNLA 3L8EA 2Q46A 4MYRA 2E4UA 2DLCX 1Z7BA 5EKTA 1GFIA 3OHSX 2C2BA 5DTQA 1YSCA 4KLNA 3ZGVA 3K0KA 2EKDA 1NP7A 2O1WA 3VPHA 1G1MA 4Q24A 1JMKC 1MORA 2VPQA 2VVTA 3Q3EA 4MR9B 4S0ZA 3E3MA 1OGYA 2EQBA 1Y3DE 3BXZA 5CBPB 4ZJYA 4H2DA 1NRXA 4NY1A 2VJQA 3ABIA 2IWHA 5BWLA 2GZDA 5HMMA 1XRPA 2PGNA 3AFGA 2ZATA 7ADHA 3GD5A 1E58A 3UAWA 4B43A 3BGSA 4HADA 2IZ7A 5DBGA 4NV3A 2P30A 2QVYX 3I3OA 4RSRA 4TSFD 4WH0A 3KRTA 2WM2A 1E0SA 5J2UB 3I2IA 4PTLA 1U3TA 2DTEA 1AQYA 3SHFA 3KQMA 4ZC8A 4B6OA 1PT6A 4A27A 1NNI1 2PXHA 1DWQA 2WG1A 4KXWA 1XRQA 3TJMA 3Q3HA 4OATA 4BRZA 4EHIA 1D2CA 1NYTA 1YH3A 5DBFA 5LMNB 3PD7A 3KJZA 2AF3C 1RLIA 1CQPA 1SGWA 3I6YA 4U39A 3JQDA 3FMFA 3EPHA 1NNUA 3K5PA 3NWEA 4NENA 1IPEA 3H2GA 3DLIA 3VSBA 2XDQA 3HU3A 1FFWA 1OY1A 3BXEA 2NTVA 4H1HA 4BO6A 5JJ5A 1T9DA 4PO1A 1T25A 4X1YA 5HFNA 5IF9A 4OUDB 1L0BA 4MKXA 5KYGA 2ALJA 1JSXA 2ZR7A 3OJOA 1NR7A 3UHOA 3QIAA 4JP1A 3SX2A 2YV3A 3M9WA 3DBLB 4Z5XA 3GEEA 3QE3A 4HNHA 4TM7A 2PZLA 4HP8A 3WFZA 4EUFA 2GBCA 3E1SA 3ONVA 13PKA 4R9SA 3OFND 3Q8XB 4R2MA 3K09C 3OFJA 4HDAA 1NATA 4YRFA 3T0FA 2J4CA 4ARVA 1KFBB 2JFHA 4JENA 3UA4A 3BUSA 1WZEA 2CUNA 5FFFA 1J49A 5F51A 1SQSA 2FCRA 4I55A 2BFFA 4KZKA 2C5FA 3ESCA 4QU8A 3NZEA 4PQRA 4O4IB 4J7XA 4V0QA 5CDFE 3FZQA 1CF9A 3W8FA 4LZNA 1DIHA 3HR4A 3KQOA 3A6HA 1FSFA 1EFTA 3HJGA 3RFTA 4DDTA 4BCCA 3ZD7A 3IUQA 1IEWA 4G9GA 2Q7DA 1C9JA 2PWZA 3ASVA 5JS2A 2X23A 3FWPA 2GTPA 2OR3A 1FX1A 2B36A 4FYJA 3T5BA 2KM1A 4AS2A 4HAXA 1E2PA 4F9TA 2RG1A 3LY5A 3PDCA 5KSOA 1G8HA 3KR2A 3FH0A 2PSHA 4A0GA 1N6PA 1JG1A 2IT1A 2XDYA 5HTOA 1QRSA 1EK1A 1DRKA 4JVLA 3R4CA 5AXBA 4P98A 3EULA 1WV0A 2XE4A 4G5QA 5KTSA 4L3WA 1R2QA 1BRMA 2DT5A 1WMSA 3OOSA 1I9GA 2PL1A 4TN5A 5FR2A 5CA1F 1ZISA 4F04A 2E4VA 1K8RA 1Y4UA 1XROA 3S1SA 2G08A 1HDRA 4XCXA 1O1YA 5B4TA 4KREA 1SD2A 2QBYA 1Y5MA 2CE7A 1MC5A 3TG2A 3T52A 4IOLA 2OILA 3WJ1A 2NVUA 4JKYA 1R66A 3AWDA 3CT4A 5LA6F 3V6MA 5K8VA 2IYRA 4PLYA 1S01A 3B2QA 1PGPA 1TUEA 4NDZA 3VPCA 3ENZA 2RHHA 4JK3A 1VRWA 2XDAA 5B2EA 5HCUA 3O8OB 3GRCA 2NUTB 4IIDA 4ZAFA 2QRZA 4MITA 4ZZ3A 2O2DA 2W93A 2V1UA 3CU5A 3FW1A 4WVLA 1JBQA 3AF0A 5ESWA 2VDQB 6ADHA 5CFLA 4MRMB 5I8PA 2GN1A 2SICE 4R31A 1DAOA 4IDAA 5FUBA 4LGYA 3G6KA 1UBJS 1GR0A 5D7NA 3R6TA 2XV1A 1AQIA 1JU3A 4B6QA 5K0SA 2WNSA 1ZBDA 3B7WA 3ZGXA 4B4OA 1VHWA 2GKGA 1RWNA 1V6AA 3W4IA 4KN6A 4CUZA 4A16A 4EWLA 4MS3A 1IPFA 3FTDA 3C8UA 3ZVKA 2I8LA 4BOYA 1CYDA 3BTUA 1I24A 1JFFB 1ZAKA 2ZZKA 1ICEA 4TMZA 4X95A 1HTBA 4GKAA 3SXPA 4F21A 1QCYA 4RK6A 4CLRB 4GKJB 1HDIA 1KQNA 2DPMA 1YRYE 3IUSA 4WZZA 5EJGA 3FGZA 1CX9B 2ZXFA 3EA0A 4MJLA 3RVMA 1RLMA 4WBNF 2F7SA 2Y71A 3RVOA 4YJFA 3B3FA 1X7GA 2H59A 2EU8A 2CFTA 2H2HA 4ENTA 2VRBA 5EPUA 3WLAA 3F98A 1XZCA 3MWKA 4NYJR 5AJVB 4EELA 3BA1A 3JVUA 1ORHA 1OV4A 4LF6B 1UXKA 3MBOA 4LKRA 3AZPA 2RI0A 1BHO1 5FXMA 5ARDA 2V45A 4DUPA 1T10A 2EAUA 2I67A 1LRKA 4ZWNA