4DBLE

Crystal structure of e159q mutant of btucdf
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
245
structure length
245
Chain Sequence
AAPRVITLSPANTELAFAAGITPVGVSSYSDYPPQAQKIEQVSTWQGMNLERIVALKPDLVIAWRGGNAERQVDQLASLGIKVMWVDATSIEQIANALRQLAPWSPQPDKAEQAAQSLLDQYAQLKAQYADKPKKRVFLQFGINPPFTSGKESIQNQVLEVCGGENIFKDSRVPWPQVSREQVLARSPQAIVITGGPDQIPKIKQYWGEQLKIPVIPLTSDWFERASPRIILAAQQLCNALSQVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Vitamin B12 import system permease protein BtuC
publication title Asymmetric states of vitamin B12 transporter BtuCD are not discriminated by its cognate substrate binding protein BtuF.
pubmed doi rcsb
source organism Escherichia coli
total genus 68
structure length 245
sequence length 245
chains with identical sequence J
ec nomenclature
pdb deposition date 2012-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4dblE01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4dblE02
4GICA 3CX3A 2Q8QA 5JJ5A 3PDIA 4CL2A 2M6LA 2R7AA 3K1AB 5BVGA 3MINA 5KHLB 4B8YA 3ZK8A 3ZK7A 4FI3F 4G09A 3TLKA 3EIXA 2MINB 1XVLA 5B58T 1FP4B 3AEKA 3AETB 4INOA 2WHYA 3AERA 5CR9A 4UTOA 1N4AA 3PSAA 1L5HA 1K75A 3HH8A 1QH1A 4M7OA 2ETVA 3PDIB 1N2CA 5BVGB 3MINB 4HMQA 4IRMA 1K0FA 3HJTA 4BBPA 1G21A 3UJPA 2YNMC 2XH8A 3AEKB 4FKMA 1EFDN 5JPDA 2WI8A 1QH8A 3ZKAA 1QH1B 2PS9A 1G20A 1N2CB 5KOJA 2O1EA 1N2ZA 4XPIA 1KAEA 1G21B 2OSVA 5HX7A 1QGUB 2AFIB 4TKVA 2AFHA 1QH8B 5GGYA 5GGXA 1MIOA 1K2VN 3MFQA 3AEUA 3U7QB 5M3BA 5KOHA 3NU1A 1G20B 2PRSA 5KOJB 4NNPA 5JOQA 5I4KA 4UTPA 4XPIB 3MWGA 2OV1A 4WN9A 4WZAA 3BE6A 4TKVB 2AFHB 3PSHA 1MIOB 1QGUA 2AFIA 2XDQA 3AEUB 5KOHB 3TNYA 5BVHA 3R5TA 3BE5A 3U7QA 5JG7A 4WN9B 4HMPA 3G9QA 4WZAB 4INPA 4H0FA 4FNAA 3LHSA 4TKUA 5CX1A 3ZK9A 2XDQB 5BVHB 4UDNA 5M29A 1TOAA 3AETA 3LI2A 3MWFA 4K3VA 4PAGA 5HDQA 4WNAA 2PS3A 4N01A 1M1YA 4MDYA 4FILA 2M6KA 4LJSA 4PM4A 2YNMD 4TKUB 5CX1B 3ZTTA 4G07A 2PS0A 5FLYA 1M1NA 4WZBA 3GI1A 2OGWA 4MX8A 2PHZA 3AEQA 3AESB 4WESA 4OXRA 5M2QA 4WNAB 1N4DA 1M1YB 2OV3A 2Q8PA 4UDOA 3MD9A 2QI9F 4NNOA 1ESZA 2XY4A 2XQVA 1M1NB 4HMOA 4ND8A 4WZBB 1K7SN 1KARA 4MO9A 2XV1A 3AEQB 4H59A 1M34A 4MLZA 4WESB 5M34A 1H1LA 2RG7A 3TEFA 5AFSA 3AESA 3HXPA 2XUZA 4HN9A 4OVKA 4DBLE 1PSZA 3K1AA 1KAHA 1PQ4A 4ND8B 4LS3A 3R5SA 3EIWA 4OXQA 3AERB 2MINA 2X4LA 2R79A 1M34B 1FP4A 1L5HB 1H1LB
chains in the Genus database with same CATH superfamily
3RRJA 2CZGA 4JC0A 2FEAA 4LMPA 2C03A 2GZ2A 1N0IA 1ENPA 2NVBA 1ZIPA 1GQRA 2G63A 3UUWA 2BGMA 4LFBB 2AZMA 1YZNA 2DT8A 2WMDA 1CZNA 4P6VF 3WNQA 5DO9A 5F7OA 4D0NA 2RGNA 4L08A 4TKMA 1EJBA 1X1DA 4JK3A 1SIWA 4M1KA 4QU0A 5FD8A 3WZ2A 1V9LA 1K5GA 1WABA 3MHPA 2GKOA 1LF0A 3K16A 4FYHA 3FYDA 5H1YA 4YCMA 3WOVA 1KSHA 1C3LA 2PBLA 3EIFA 4N6GA 3ZXXA 2HUNA 3QPCA 3TDKA 1SKYE 4TYPA 1N6NA 4IRMA 4QVIA 1WPQA 1H4SA 3GUHA 2WWGA 4C7XA 3GEIA 3INRA 4IIEA 4BLOA 1JG6A 1ZBDA 4E33A 2B78A 4RJTA 4NYMR 3CXRA 4CETA 3IKLA 2EFYA 1PFGA 3RASA 4HB0A 1W49A 1ZSYA 5FH9A 1Z2OX 4DEVA 2XCTB 2HHHB 2ZATA 3KOUA 2ILVA 3VOBA 4D7AA 4EABA 2F6RA 1YZLA 5JWHA 1G1MA 4AYWA 5EOVA 4IJKA 5EZQA 1S1CA 2Q0SA 3B9PA 3GCZA 2HBYA 3GFBA 3K2BA 1L7AA 3RC9A 4TUYA 4TM8A 1KI2A 2B69A 3ZZUA 1T2FA 3VNUA 2FUG6 1NM5A 4KVAA 3QX9A 4WKNA 1EGMB 4DCJA 4FINA 4IOMA 2CZCA 3TUIC 2FR1A 4F2DA 2O8NA 1T5HX 1GZSA 5HRAA 2RGYA 1DIGA 2QTFA 3OE7A 1EUYA 1TQ6A 4XJTA 1JLLB 1K3TA 4IF4A 3EHEA 1RMTA 3AIIA 3HJCA 4UASA 1SC9A 3S99A 1Y4AE 2JIDA 2A5YB 1VJTA 1JJVA 1P0QA 1A2QA 1P2BA 4L57A 4WN9B 2VHZA 5TE9A 1O2DA 1I80A 3CA8A 1UPAA 5D51S 1OAKA 1T26A 4LVCA 3HJAA 3GLIE 3QOXA 2O8FB 1QOPB 4HX2A 1JHRA 1ZM4A 3GMIA 1UBGA 1OQAA 1EK6A 1ECPA 3BPSA 4OXXA 1T10A 3FCSB 1L5LA 2IU6A 4R81A 2Q3FA 3LQ1A 4UULA 4EB6B 4JI6B 3WIUA 5GONF 2HB6A 4MS3B 2ZS7A 5JHHB 1I4WA 2IELA 3QEBZ 4YT5A 3OJXA 2XCRB 3WL7A 4GPEA 4HDMB 2I4MA 4H7IA 2SHKA 3D8UA 5G3ZA 2H8GA 2I2FA 5CLLA 4PIVA 2FMHA 2FV8A 2J5RA 1XMSA 3V00A 1S89A 5DYIA 2FW8A 2UUPA 3LQQA 2JIMA 2GBIA 5AVUA 1YL6A 3WGQA 4B46A 3OQNA 3FHTA 1ZIOA 2PS1A 1YRHA 4IJQA 3K8YA 1QFMA 4NXMB 2GLXA 5L8VA 3IP7A 1BKDR 4LF7B 3NC0C 3TIVA 1HQCA 1NUUA 4MAMA 2C1XA 3VKUA 1PNOA 3VH1A 3N2KA 4C5AA 1IM8A 3L40A 4HG2A 2ZSEA 3MRXA 4RD3A 1DELA 3ZU6A 2YDXA 5L95A 1S7CA 4B85A 3V4OA 2XOKD 3UAWA 3HKCB 4NOJA 3U6KA 1LDEA 1LK7A 1JFVA 1V16B 1ZNQO 3ZV3A 3KP1A 4Z7JA 3KUXA 2CLFB 2VNAA 1RKVA 4W6QA 2NUBA 2JW5A 4ERNA 3K31A 5IDYA 3FA2A 4S35A 3EUFA 2C99A 4XFDA 2KX7A 4L8LA 3HA3A 3NV7A 2O5RA 4U2KA 1R6DA 4EECA 5A02A 3OUUA 4EHIA 5JXJA 5AM4A 3M1YA 1I2CA 1TYCA 2OAQ1 4GKKB 3CWZA 2XNJA 2HLDD 3DDCA 2C2KA 3PVSA 5JSHA 3JD0A 4QXRA 2X5KO 1K0FA 3FJYA 1N9KA 3HA7A 5C1BA 3MVEA 3BWXA 5FBVB 2O59A 1CF2O 1RQXA 1WEHA 5TQ2A 3ADPA 2NSYA 1XTTA 1DKMA 3DG9A 3FBTA 1EWYA 3G9TA 1PHPA 1ITZA 3GLHB 3IOMA 5ICEA 2GMWA 3TNJA 4OK5A 3QU5A 3VO9A 1PCXA 1U0TA 3PUKA 3H2BA 3KLMX 4M7WA 4N3GA 3FPEA 5IBCA 3R3SA 2FRVA 1MIHA 2WIFA 1TIPA 3OD5A 1EQ2A 3RC1A 2O5CA 3N5CA 1GLVA 4F8JA 4LEIA 5DHFA 2ZYSA 4FYMA 4TMTA 1H9AA 4KQGA 3STHA 1KMQA 2XTJA 3JQ9C 1E2EA 2RC6A 5EVJA 4C3UA 3U0BA 2WLTA 3K1TA 2RJNA 1V8OA 4IM7A 1P1FA 1W4RA 1DINA 2XE6A 1Y5LA 3WWOA 3EVBA 4I4TF 5TV2A 2H1CA 1SCAA 4MW5A 1HDZA 4RKQA 3L6OO 3HWX1 2OLEA 3PSHA 5B1EA 3ESXA 4KXXA 2B61A 5BMOA 3WIDA 5SYAA 2GTHA 4JJ7A 4UZSA 3DE0X 5EERA 4JQZA 1Z3CA 1JZTA 1L5FA 1M10A 3H99A 1Z7YA 1T8YA 3PS9A 4LTMA 3I2YX 5EHQA 3WAJA 1JDPA 2HV8A 4R40A 4B09A 3ZDAA 3GZNB 3LY5A 2A2ZA 4OI1A 3OTWA 2GUWA 2H59A 1IQ0A 2BEUB 1TQ4A 3QVJA 2WVAA 2ZYUX 1K06A 5ALNA 2XYQA 2FCAA 1C30B 1TK3A 2FZKA 4EJMA 3S8YA 4UOEA 2ZYRA 3H5VA 4MR7B 3ZVLA 2DCUA 1DG1G 3NRJA 1P9OA 1QG4A 3O6VA 1JKIA 1SXJE 3Q2IA 4YMTA 5KQRA 2FSFA 1RKQA 3R0QA 5BQ5A 4MO2A 3CLSC 3PEVA 2Y67A 3BFPA 3EDYA 3FPJA 4CFYA 4E14A 1N5MA 4DJAA 4LVNA 4P0QB 1BHO1 6PFKA 2I7DA 1PIWA 1VIMA 3LTNC 4TOIA 1OTXA 3QX8A 3T7KA 8OHMA 1WE2A 1GCGA 2DTEA 4P84A 4R3NA 5U4XA 4FZJA 1LFAA 2E82A 1QCCA 1WY5A 4GI1A 4UE3S 2J59A 4A6PA 4XIIA 5JFTA 4RTMA 3KT8A 5BSEA 3UT5A 4N0PA 4E5MA 1SVUA 1RWBA 2QR2A 5CXXA 5DNUA 3CNOA 2H2GA 1I7PA 1SB9A 4TVKA 1PNTA 1V96A 3GU3A 3PQCA 4PZUA 2ZM5A 5EA2A 3GFPA 1OH6A 1KQGA 4UUBA 4KRXA 1R9JA 1XR3A 3AJRA 4HADA 5ARCA 4RLSA 3KZVA 2ATIA 3X2EA 3L1HA 4UAVA 1NF2A 2AL7A 1M6NA 2ZRKA 3V1KA 4QFCA 4GZMA 4DCSA 3THYB 2QOEA 1ZU4A 2D7JA 2L42A 2XUPA 4HRVA 3STUA 2GHQA 3CPJB 1IHYA 3TINA 2P79A 2CHQA 4JLBA 1E3IA 4KE9A 4P5EA 1OTHA 1QFJA 2FPIB 2UDPA 3PC4A 4QU9A 4RD0A 3T1QA 1RXCA 1FOEB 1Y7TA 2QRLA 3A1NA 3LQYA 3I58A 1G4AE 4FZ3A 4WFQA 3WGOA 2WYUA 3QMMA 4EYEA 1DC3A 4F3KA 1S9DA 3DZFA 3FIUA 1EFRA 2QN8A 3PIDA 3I9NA 3OLVA 3TDMA 4YT8A 2G70A 3FCXA 3EVDA 3GNTA 2MIIA 2DQYA 2LZ0A 3DZIA 3ETGA 4GYJA 3WRXC 2VDUE 3DPSA 1X7ZA 1B2LA 3H05A 3DCJA 3N6RA 3DWEX 3G9XA 4GBMA 1I3CA 3GEMA 4K8OA 4HNUA 1J7KA 1GG5A 2C2WA 3UK7A 1OX6A 3R5JA 1F3LA 3FKSD 4EARA 2DKNA 3FPKA 5B3AA 3LJKA 3Q3HA 3PGA1 4ZREA 3OU7A 1CY6A 1NJSA 2B8WA 1WPRA 2BFOA 5DGXA 3SHTA 1J24A 1P7WA 4QOFA 4PGHA 3VR0A 5TJ9A 4EF5A 4EX7A 1OBVA 2DZDA 3R6TA 3IUMA 1M6VA 4AN1A 4PZ0A 4YAGA 3ZVNA 1W96A 3KJIA 5DP2A 2HWWA 1TECE 5CIYA 1CUYA 3GUCA 5F52A 3CRW1 4CFZA 1IY2A 2WIJA 4G1BA 3U7HB 3RS2A 3SK0A 2DRIA 4JOSA 1BC5A 3M6FA 2IPMA 4HZUA 1I6MA 1S96A 4BMOB 1BOOA 3M4YA 5JSZA 1FSFA 2ONJA 3VKVA 4M9CA 4BNTA 2BGKA 3FHOA 4V24A 1XPOA 3HJGA 4HWOA 4E6PA 1E9DA 4TUYB 3UYKA 2HYIC 1E1MA 1N7HA 4HAXA 4ZGGA 4TTTS 2HWYA 4M9QA 5FBWB 5T7BA 3SICE 2GJ4A 4GU5A 1IWBB 1Z75A 4XWTA 4KPFC 3DMTA 1GPMA 1MQAA 2VH5R 5GP1A 3Q7EA 2H1IA 1KA9H 4F12A 1FA9A 1A97A 4RKRA 2QKYA 1SVOA 3VR3A 2C84A 3CLTD 4BC1A 1R8SA 2FWNA 3AIKA 3MLAA 4IIYA 4UU8A 1KGDA 2X14A 3SR3A 1D2NA 5E4FA 1ZOPA 2R8ZA 3ADBA 1BGVA 1ST3A 2ZG6A 3VZDA 2IEAA 2IXAA 1OYYA 4Q16A 2FPLA 3U1BA 1LD3A 1E2LA 2HX1A 1DAKA 1QF7A 1J2TA 1CW2B 1QHSA 3KXLA 4HV4A 2FN3A 1CFJA 1GQ2A 3KXIA 4MWZA 4KQMA 4IFEA 3INNA 4AZVA 5JXWA 2O7RA 4LOHA 3MTJA 1IHPA 1LCIA 2GRJA 2M98A 3BC1A 3Q8LA 4I9HA 1IDN1 3N7TA 4HWTA 5H5JA 4DUGD 4Z0PA 2J9XB 1WJGA 3HFSA 1XQ1A 3DFUA 1PT7A 1H4VB 3KVOA 4WINA 4CQMA 1NVKA 4YEDA 4TTQA 5J2UB 4AWAA 4RMHA 3B2EA 4XIYA 3LX6A 4XB1A 2I4NA 2ZZKA 2HH9A 1WPGA 1XD8A 2E85A 1II9A 1JQDA 2AEMA 2OV2A 2PJUA 3WHKA 1AQYA 1Y3DE 1ZD4A 5C80A 3SX4A 5CDYA 1A82A 1K6IA 3E7DA 4Z51A 3RVLA 4W1QA 2P6NA 4XIJA 5T8KA 1N9ZA 4OL0A 1IHDA 1TMOA 1VL2A 1GZ5A 1BDMA 2WZCA 4ZT4A 2VSFA 1PJQA 1CR0A 3GJ3A 3OMXA 2GUGA 3F97A 1Z7WA 1E7MA 3GJZA 3TGWA 3TLYA 1C7ZA 1MV5A 1LBIA 3V33A 4XVCA 5IJ9A 5ECWA 1KYTA 1ES9A 2XF8A 3N2KB 1Z06A 2XNDA 1UXIA 1NXXA 3NBMA 1P91A 4WMLA 1BSVA 4UPEA 2C9DA 4QQNA 3IPRA 1PJAA 2DWQA 3W2GA 1OU4A 5AM2A 2Q9CA 2RGNC 1LLQA 2O7SA 3CBGA 3FFTA 3GUVA 3ZWDA 3E5MA 3RRZA 4A6EA 1YI0A 3EXIA 2NV2B 5BR4A 3EC7A 5FPSA 2QE6A 4B8WA 3UNXA 9ABPA 1POXA 4IDDA 3BJZA 3I1YA 4TSFA 3B6KA 4C6SA 2G6BA 2Z08A 2AA3A 4JUIA 3RC2A 2GCEA 1QX3A 2WI8A 5G4LA 4TTJA 2HMTA 3TX6A 3UGKA 1J8QA 2IHYA 2P7IA 2WTXA 3K1YA 3EHDA 1JYSA 3IC5A 1QP7A 1NP7A 4I8IA 5LUAA 1L1FA 4BTLA 3CZ5A 2YHSA 3CVOA 4Y98A 2LVBA 4G0MA 1N2BA 3G2LA 4HEJA 4ZVUA 2OORA 4NU0A 5JO9A 3HCCA 5TQ2B 3CPHA 4ZQCB 3GLIA 2PX2A 2I2BA 4NONA 3FPBA 3A6KA 4AS2A 1VIVA 3UUGA 5L53A 4FMDB 1G6HA 4LGVA 3RFFA 2Q2QA 4Y2QA 2BGLA 2X2PA 2ZI6A 2JBAA 3HYSA 1X7WA 4ZAWA 1GRCA 2XDYA 3STTA 4JVSB 4WK0B 3WIBA 1ISRA 1DKLA 5A4KA 4FJ2A 3LT1A 5DTIA 2IGTA 1SULA 3HCEA 3CHYA 1VHQA 2PL1A 5E1DA 4LRWA 5GY7A 4MRMA 2I6QA 3HR4A 1HFJA 1ZH2A 2AXNA 3EOAI 4YREA 3T35A 4JQOA 4J0GA 5ALMA 1AKVA 3AZPA 1GZUA 1XYGA 5FTNA 3VBEA 1HTTA 5I7VA 4V38A 3FXAA 2CMHA 2RKBA 3M3PA 3W6OA 4CBVA 3OQOA 1HY3A 2ZR7A 3BHIA 3REFA 3R3ZA 3NNNA 3S2FA 3DE2X 1SIBE 1DEAA 1BE8A 1OY1A 2OBBA 1EIZA 1OYWA 1R8YA 1YBFA 3NHBA 3QUCA 4PAGA 3MWFA 4GAEA 5CJJA 4E5UA 4EHKA 3S2IA 1C3EA 1QQ5A 1SHKA 2A1TR 4QREA 4S0ZA 1VB5A 4RPGA 3ZU3A 1QMPA 4BO9A 4CTJA 4BNMA 1ZGZA 4DCMA 4E2YA 2NO7A 3ECCA 4YUYA 5JZ9A 3WLEA 2P90A 3LX4A 3F74A 5AHXA 3VC7A 1KKLA 3ZU2A 2PMBA 3CVWA 1X1TA 2VZ0A 3HY3A 3LO5A 4G56A 1VLHA 2Q29A 1AT1A 2YWHA 3P9CA 4G5GA 2G4CA 2F62A 2Y1XA 1Z6XA 2GAFA 4ZDWA 4OMFG 1X94A 2IEBA 4LPKA 4PXYA 4IFBA 1E1QA 3W5AA 2DR0A 2OGTA 1HE4A 1JDJA 5ER6A 1M67A 1K3UB 3OJOA 4ZT6A 5JYDA 1KWGA 4QUBA 2PX4A 1CT9A 2B8JA 1O0SA 4H1WA 3PUIA 2WYHA 2EG5A 1NXTA 1BCSA 1JSLA 2X6QA 3E1SA 4MVJI 1NW6A 1ZM7A 4PLGA 4N5HX 4TROA 5DASA 3UOAB 3JRNA 4BLRA 4OK6A 3R7WA 1O87A 1RP7A 2VDMB 3UIEA 1DPGA 2QXYA 2FWMX 3FMVA 2Z2JA 3C1OA 2WR8A 3KJNA 4ITVA 3QENA 4MS1B 3UT5B 4DR1B 5JJIA 1AQNA 3LLUA 2YFHA 4FP9A 1UWLA 4Z9YA 3CW9A 3ECSA 3R4CA 3SDZA 3UAYA 4C22A 2B92A 4CF4A 1VHLA 4AX4A 5K0BA 4YJFA 5AXCA 2EP7A 1I14A 3UAZA 1A7JA 3LLSA 5HNKA 3RFVA 3KKPA 1ZK1A 1EP2B 3BMNA 1LY1A 1CJVC 4CU5A 1CJKC 4G09A 1C0PA 4GZ6A 3H9JA 2VNKA 4ZCLA 1YFKA 4JX8A 1EX6A 2XMSA 3LFHA 3I32A 3TNDA 1YRLA 1BDIA 1N2CA 2HCBA 2ZROA 1YQWA 2HA3A 2NXNA 4DLSA 1NVAA 2RK3A 3CW2A 3MAAC 3NTUA 3D0KA 4FNMA 4ZO4A 2C7RA 3BIFA 1WXDA 1SZPA 5HKOA 1FRVA 4TTIA 3I64A 5LN1A 2NNLD 1B16A 2W93A 3JZFA 4HDSA 2ODPA 2A78A 1JQAA 1MRSA 2O1EA 1YSCA 2EC5A 1X7ZB 1XCGB 1XFDA 3EBOA 2BTOA 3O3NB 4IGFA 4P3KA 4MITA 4RDIA 4EGQA 4ZYTA 1JE0A 1EPUA 5JJLA 2M2IA 2E1PA 3O1IC 2VHWA 4RQUA 1P73A 3KV1A 5AYVA 1JEYA 1CC1S 4HJXA 5LP1A 2ZOSA 3D6UA 4OHXA 1SUIA 3UC5A 3IP3A 4IAOA 3RIYA 1BX3A 3M2PA 1RI1A 4IBOA 1TAUA 4YAKA 1E3SA 4XD7A 3M6WA 4FLFA 1G2IA 3JZAA 5JALA 1M6VB 2ZJAA 3LXUX 1YK0A 4F56A 3ZLJA 4BGEA 1XTQA 1SXJA 1TE2A 2V7TA 1E6WA 3WLSA 5IUJC 3MM4A 3IESA 1Y80A 3TSWA 2V7BA 1J2EA 2OYRA 3IYLW 1C7QA 1XZJA 4Y2HA 1ZFNA 1Z0JA 1A0OA 2G67A 3RU3A 4XDZA 2BGGA 1U3VA 4NWIA 2BBTA 4HZUB 4QXQA 4ZEWA 5JSZB 4YRKA 1TC1A 3LWBA 1CY8A 2W6JD 3GK3A 4L22A 3VPGA 3DOFA 3ZK9A 1N1DA 3NOOA 1XOIA 4Z8XA 3UGQA 1ZI6A 4HXEB 1EFUA 2X0EA 2Y68A 4L7VA 4AS1A 1CRPA 2ALJA 4RA9B 4URWR 1EJ6A 3ZG6A 2EQAA 1XEAA 1X87A 3CUVA 4P4GA 4J0JA 3DXYA 1XL0A 3FYUC 3RYIA 1IQUA 1KR2A 3CF6R 4TUYF 2AKEA 3IDAA 3D43A 3CRZA 5F73A 3H75A 3N07A 3E7PA 1FMFA 2HEGA 1T0PA 1D2CA 2W6QA 3G88A 1L7NA 3DZ8A 4Y30A 4DA4A 4FSHA 4YAWA 1CUDA 2XRZA 3NHYA 1WD7A 3LC2O 4BX0A 3PBKA 2H3EA 2GXQA 2LBPA 4JBIA 2NO4A 4DZTA 1GN9A 1E2MA 3HVHA 2EGGA 3GIDA 4PO3X 4KWHA 3Q2KA 3A11A 1JDSA 1QLHA 1SA0A 1C1XB 1TLTA 3C6QA 3OCXA 1H6AA 5M34A 3DD1A 2XKKA 3QVLA 3ZS8A 5HFJA 2HQBA 4A8JC 1SU6A 4NMHA 4UBIA 3O1LA 1UBLS 4TZTA 1H66A 4LV8B 3ND5A 1TZBA 2V9ZA 3A3PA 4JJKA 4MXDA 2JHAA 3RIMA 4CQMB 2UU9B 1G60A 3NHLA 2CJYA 2PUFA 2VWHA 3HBLA 5FTJA 4IO1A 2ZW9A 2FF7A 3P2JA 5DLEA 2PGAA 3A9VA 5E3JA 4N76A 1EK1A 1EJ0A 1DWQA 1UBTS 3LBNA 4Q4LA 3Q5EA 2FQYA 3ZD8A 5U9CA 4DV1B 2A9VA 1SKYB 3Q3IA 2BHLA 4HLCA 1NAIA 3TOSA 3U37A 2OG2A 3WBBA 5HKAA 3QVGA 2XNCA 2ERYA 4R2IA 3C0KA 3QMPA 3W6NA 5J2UF 4L4RA 3HO1A 4Y0VA 1NX9A 4K26A 2BKEA 3A10A 3AERA 3DUFA 4DMCA 2Q3JA 1ZQ1A 4UHJA 2ZS9A 5IJ9B 1H0HA 1NAHA 1R8JA 1EWRA 2JC3A 2QNBA 2XIQA 4HWGA 4D9IA 3VC1A 1F0NA 4P83A 3CLSD 4MCAA 4BZXA 3CJRA 1X8XA 3DHEA 3E9EA 3TG2A 4Z4QA 4JI0B 3HFGA 1EP9A 3ID6C 1BD3A 2HIHA 2J48A 3W5JA 3EXIB 3LQKA 1PZXA 1O9HA 3OCCA 2R4QA 2PRKA 1QO0A 2O2HA 4Q6BA 3SZGA 4D4KA 2CE2X 3W4JA 4KXVA 1RCFA 1Y6RA 4QPDA 1JZSA 5DBGA 4ICIA 2YVKA 4EGFA 2OCIA 2XTZA 3E6AA 3E3MA 4KQHA 4UTVA 4ACAA 5DBHX 1QGUB 1DAMA 2Q4BA 5EIOA 3C3WA 4M0KA 3V1NA 3CLRC 4DB4A 1CJMA 4AF8A 1XAHA 1GADO 2RHTA 1ORHA 3L0YA 3JQGA 4L50A 2G9ZA 4K6HA 4BBZA 5CDFA 1VZ3A 4RPIA 5KYKA 3HWWA 1L2TA 3KEMA 2JH9A 1BA2A 5GOZA 1VCIA 2EL9A 1UDBA 1TAHA 1T5TA 3OEHD 3GLIB 1GNQA 3VOSA 4DADA 3THWA 5AI8A 1D5CA 5AVXA 2CT8A 4MYTA 3W2EA 3G2NA 2W2NA 2X7JA 2QUHA 3OZEA 4DIKA 3ZDYB 4IZOA 2JBAB 3IAXA 4HEHA 4RK6A 3B9BA 1FFCA 2EL7A 1VFPA 2VTKA 3C5EA 2P6OA 4MQ4A 4NAUA 1ZGGA 2G72A 4PX5A 3DMTC 1QRRA 4A6XA 2CNKA 4CKXA 4KPEC 1MOZA 2IDKA 2ZBEA 1E6CA 3I5YA 2VRBA 4DEXA 2D8AA 3HB7A 4HAUA 3A1WA 4MRMB 1L7OA 1UL1X 2VPXA 2JFUA 4FMDF 3PU6A 1I4OA 4KVGA 4YAFA 1O0BA 1G41A 1K27A 1L1RA 1Q3KA 1P6XA 4FOSA 4M87A 1W0JA 3CNLA 2OESA 3FZEA 4HPWA 5GV7A 1F2TA 2BJHA 1SBZA 2AI3A 2OFOA 1CQIA 3QNWA 4XASA 4YRPA 4E4RA 3OCVA 4ZT3A 4RFSA 5JC8A 4J3FA 3MCZA 1U65A 1NBHA 1VFNA 4L0MA 2VBCA 1C3OA 1FJGB 4OXRA 4MYUA 3AKYA 2R9VA 2JFBA 3OLQA 5C7IO 1ODJA 2HSEA 3GGGA 3Q15C 4G01B 3WXBA 1E3MA 2D0PB 3AOEC 1XZKA 2D2IA 3CUWA 4IGKA 3N7AA 3ONDA 4ZTUB 4Q9IA 1JR4A 2VZLA 1WSAA 1QO7A 1I7LA 1T4DA 4K86A 3D3EA 4H59A 2BM8A 5REQB 1I2BA 4F4FA 1WXHA 1PT6A 3MSXA 1WCXA 3DM5A 2P68A 3ZR4B 1JIKA 2HY7A 4Q48A 4BUCA 4DT1A 4MVJH 4YP9A 5FPYA 1K8RA 4OFZA 5IANA 3JRWA 3UK1A 3QMWA 4CM9A 4U2FA 4MA0A 1YKFA 1II0A 1RBMA 3IUEA 1BCSB 3MB8A 621PA 3SQXA 1SQSA 2H7YA 3BIWA 4JOCA 5AW4A 4EZBA 3HVRA 1ZEJA 1X39A 5SYNA 4B6RA 3H13A 1CP3A 1N2SA 2IYQA 3COWA 3B1ZA 4RIHA 3L8ZA 4DR4B 3RU9A 2VAWA 1R5JA 1UK7A 3IEIA 4ZD6A 5CYGA 2EFCB 2PNFA 2Z3VA 3TMKA 1FDIA 1E59A 3PVZA 2HXGA 4KQJA 4YJFB 1ZKMA 2Q62A 4IVPA 4EBFA 3FFWA 2QD1A 3DLPX 5IZ4A 3HCPA 2CNWD 4YRGA 3BMNB 2P7HA 2ZUBA 1ZBQA 1DXQA 4J0DA 5AVYA 3Q87B 3CNQS 1CETA 3JQBA 5DBIA 1SO8A 1KPIA 1YQEA 2JHCA 1T3TA 1ZY2A 2OD7A 3NHMA 4QU8A 1B4DA 2ZUFA 4Q18A 5J4LA 5HJ5A 4GEGA 1R4AA 3NWBA 1C8KA 2QF7A 4X1KA 2DHRA 1N2CB 2CL5A 3IDSA 3W78A 1LK5A 2OVBA 3WAKA 4CI0B 3A6ZA 1CJTC 1MJGA 3T6KA 2HRZA 1MB0A 3QLEA 5J9FA 5HPYB 1FSZA 1DEKA 2OORC 4K9PA 3RRNA 3S2YA 3L06A 3SJAA 4EH1A 1G2PA 2UZ3A 4HDSB 3UMMA 3OIVA 3H2IA 4YCSA 3H6KA 1N6RA 5JASA 5LJLA 1OC4A 4NNPA 4XJXA 3PLRA 4EFMA 5A0VA 3EZ6A 5ALOA 1KVQA 1ABBA 1P29A 1MC8A 1PFQA 1JEYB 2Y2VA 1U8AA 2ODTX 2ZZMA 3DWGA 1Z5NA 1ZD5A 3B85A 3DZBA 2C3UA 5GV8A 3TZCA 3UJ8A 4BMXA 2H08A 3BXXA 1A8PA 2XLCA 3SS9X 1G66A 2R6GA 5LLSA 4COOA 3Q3VA 1KAQA 5ENVA 4M8IA 3R3HA 1R4NA 5A7HA 1JJBA 3D1JA 4QGSA 1P6UA 4X8MA 2WAXA 3C3DA 4P7KA 6ADHA 3ET4A 1QU3A 3UGJA 3PTZA 1DBVO 1TOAA 2FWAA 2E48A 1PZFA 2EFJA 3P8ZA 4IG4A 4PYOA 2DBRA 2NU6A 3KJEA 1UWVA 4PLTA 2H29A 1SQGA 2JI9A 1NULA 3H1PA 5D87A 1N77A 4JMPA 1FFDA 3EXG1 2DULA 3M81A 3KYBA 3FMIA 4LPSA 5AJYA 5BUSA 2WKQA 4QJ5A 5D3KA 4BQRA 5ECDA 5CFMA 1FNSA 2BC9A 4QDUA 1F6BA 2ZE8A 5IKOA 3KHTA 2OK8A 4X91A 2HOQA 5F23A 3E35A 1W5AA 1O4VA 2G6TA 1SOAA 1E6KA 4KDCA 1HLFA 1ZK3A 2Q8PA 4Z6KA 1V4VA 3LO8A 5JO0A 1OIXA 1O97C 2WT9A 3HP1A 1DQRA 3LNCA 4MR8B 3TCKA 3ZDRA 2E7ZA 3U3MA 5HIIA 2DFPA 1KBQA 2VJDA 3BFXA 1ZRMA 1F4PA 4QELA 3RANA 2VJNA 3QLVA 3TZBA 5B30A 5JJCA 4DDVA 5MN4A 2GHTA 3C14C 1YRAA 3HWSA 1J5XA 4LF8B 4WNCA 1Z08A 1KO4A 1XTUA 3F4KA 1IM5A 2VJYA 2WQ6A 1AS2A 2AMLA 2ZREA 5KKNB 3F3KA 3UOWA 3K1AA 1U0RA 1EXDA 2XITA 5EHXA 1CEXA 1FC0A 2C2OA 4F1JA 4H1HA 5HM8A 2C2BA 2FN8A 1EB8A 3OE7D 4FDMA 4B5KA 3H4VA 1SA0B 3NHPA 3PNSA 1KK0A 4YRCA 1NW5A 3DCIA 5CNMA 4V0NA 4UJ3A 4U63A 5JY6A 4JBYA 5A0FA 3RUCA 1XT6A 4RTLA 1JI0A 3MBIA 4RV4A 5AI9A 4E5SA 2PUVA 3ESCA 1R9MA 3ZE1B 1TM1E 1WV0A 3H2HA 5F5LA 2AOUA 4AKSA 1HT0A 4EY3A 2F67A 3RK1A 4ESVA 3KTAA 2ZRIA 1BO6A 3GFSA 2YOGA 3TKLA 1KR5A 3ZS9A 4BGIA 4DREA 2ORVA 3GRVA 3QVGB 3DOCA 5IN5A 4C30A 2PX6A 4LW8A 4NATA 1FJXA 1J7JA 1NA5A 5JVDA 1XDDA 2X0KA 2I7XA 3I9FA 4H35A 1JAXA 5BT9A 3VC3A 4JCOA 1F5SA 4MVCA 1MGPA 1ZH4A 4UMVA 5HJEA 5IDXA 2WD9A 1IRIA 1ZICA 3CN7A 5CK5A 5ALZA 3ZGZA 1IZ7A 3K6KA 1TZJA 1IIBA 3N0WA 1HFWA 4NZMA 3SYMA 5KUTA 2WT8A 3ZI4A 1QR2A 1ZM9A 2XJ4A 3PFGA 1UBJS 3OO1A 3W8DA 4JI4B 3K9NA 2X7HA 1NW8A 2EKBA 2VVTA 1LC0A 1TX4B 2HYDA 3AF1A 3TVTA 1MIOA 2VP4A 1M34E 2VPZA 3U9LA 1ZK0A 4EVRA 1TAGA 2BCJQ 2VDQB 4ZO7A 3AC0A 4YJHA 3Q85A 2X13A 1UKAA 2VYQA 4OQZA 1HE1C 3I4CA 3NTQA 1ZP6A 1OBCA 2CMFA 1PEDA 4YDSA 5AIBA 3EX7C 2JI6A 1UBUS 3RFCA 3PUVA 1UBOS 3IEPA 4DG8A 4QUGA 3BTUA 1ZC4A 1ADYA 1L5RA 3EH2A 5CX4A 2WFMA 4MA4A 3IUBA 1RXEA 1JI3A 1II8A 1Y42X 2W83A 3IIEA 4I1IA 3JQGB 4RKWA 4YH1A 5DBEX 5KYVA 1WKVA 1COZA 2WUWE 5F21A 5HGJA 2CCGA 4US2R 4D26A 1Y9JA 7MHTA 2JLYA 4MTCA 1BQEA 1LNSA 3T3OA 2V4ZA 1SG0A 3OKAA 4RTSA 3FD8A 2C0QA 4R71A 1PLJA 1QTRA 2V7EA 1QNLA 2DM6A 2H1OA 2FPOA 1TT5A 4G4JA 2YYYA 1B0UA 1X6VA 2AN3A 2NUPA 3AFIA 4QWWA 2WYVA 4I50A 5K8VA 1VP9A 1L7XA 4C7OA 4PM4A 2CUKA 2YYZA 3LBFA 5CH8A 4ZZ2A 4CMIB 4X8HA 2DGDA 2I7VA 1NC1A 1ZK4A 2YVUA 3P0EA 4XZ3A 2ZT8A 3I1JA 4GOMD 3SQWA 1WM1A 3BILA 3ROXA 4QDJA 3OY7A 1ULAA 2GO7A 3O94A 4XPZA 2QN3A 3FNGA 4H4EA 2BR4A 1VPTA 2IPAB 1F2TB 3SX2A 5LD2B 2V7QA 4GSYA 1CQIB 4BAUA 1NOIA 1Q15A 1XVIA 3CU5A 4FGUA 4Q7MB 2XUDA 4W1RA 4BYMA 4RFSB 1EVJA 3BWMA 3IBGA 4LZWA 1HDXA 2F1KA 4JP5A 1XU9A 1C3OB 3LA6A 2ZWAA 3I76A 1RJDA 4MHSA 1W7AA 3S5UA 1NN0A 2HPAA 2MSCB 3MCTA 3D1LA 3PT9A 5G1PA 3OF3A 2B1RA 5HKLA 1F20A 2AMVA 1RBQA 3WBJA 2EDCA 2N75A 1O03A 4JLWA 1THTA 5C8YF 2V7UA 3BK2A 5FI1B 1Z83A 3KSAC 1I2AA 3L4BA 3S2UA 5CURA 2ZXEA 3WGKA 4UUNA 2AI1A 4DT1B 2JJQA 5DM0A 4AN4A 4BP3A 1NLYA 3T7RA 4CIWA 5LWQA 1TCAA 3R41A 5IVPA 1ZWLA 5EKUA 1R27A 2IOHA 3LUJA 4WQMA 1VDMA 2P77A 5BSRA 2GK7A 1VKHA 2VS1A 5F12A 4L5IA 2EZ9A 1QIIA 1Y7PA 1P4SA 3BWCA 5B58T 1L5SA 3ZIUA 2QIPA 2OXCA 5FWAA 1M9NA 3N2YA 4U7DA 2H4YA 3QUAA 4HUQA 3TE6A 1ZJ5A 3LYHA 1QG6A 4X66B 1A5TA 4ALLA 4YJ2A 3PKZA 1HXHA 1QLWA 4UW9A 3ZV7A 2C8VA 4I5GA 2F8SA 2TMGA 2P35A 2YNMA 5DYGA 4DA8A 2ZBDA 4CKBA 1GPH1 4BB6A 4M46A 5K6AA 4E22A 3SM9A 3T7SA 8ADHA 5KTYA 4DUZB 3N8NA 1QTIA 4QJIA 1SOVA 1ZK2A 1WOMA 4LKOA 1LLDA 4GOND 4ZOAA 3LSYA 1VHDA 3T41A 1MXHA 4LBWA 1XRJA 1WAMA 4Y18A 5A4FS 5JMTA 2XKJE 4RLHA 4QO8A 4N5DA 1V95A 4V39A 3C4JA 5JNTA 4X1KB 3AUJB 1W48A 2HWUA 5K3BA 2WB4A 1HE3A 1E2JA 4WJKB 3O8NA 3WLKX 3SD7A 4YAUA 1Q7CA 1F9AA 4PYKA 5D1HA 3N39C 3OQBA 1YDMA 1KMMA 1G16A 3MPOA 4R3UC 4N0DA 1RZVA 1R16A 5TC4A 3T38A 1CDDA 1XZCA 2ONCA 3K2IA 1IJKA 3F2VA 4DDKA 1CQZA 1YHYA 3AR3A 3KO8A 2AC7A 2WRZA 3AKZA 1RYFA 4HNQA 2VTVA 3EDMA 3IJRA 5JZVA 4Y67A 4QFDA 2SNIE 4QQFA 4ZODA 5H80A 3GLVA 1OC2A 2E4UA 4C4ZA 2H7CA 3AVPA 1I1HA 5K2OA 3DULA 3KZ1E 3WLLA 4AUNA 1MEEA 2IPNA 4TT3A 1EFRD 1FPMA 2AK3A 3BFKA 3JYPA 2DWCA 2OFXA 4HY3A 3QQ5A 1S5PA 4JNKA 4MQEA 3TLBA 3NAZA 2GKGA 1OD6A 1ZJ6A 2YOFA 1R4NB 4G84A 3BREA 1CE8A 1KBZA 1Q1NA 1U3GA 3QTLA 3VZQA 2BMAA 5LD2C 4RELA 5ESDA 3MA0A 2EKQA 4H6PA 5B4UA 3TB6A 1P1BA 1NJ1A 1P3Y1 4KLCA 1I5RA 5LQCA 1IBCA 4QPZA 1D7OA 3D1VA 2BEKA 2CEAA 3TIFA 1OB2A 2BMEA 2NU6B 3RK4A 2VHJA 4IOJA 1TA0A 3BXEA 3FOCA 3M9WA 4KQ9A 3F7OA 4R9SA 1PBTA 1HR0B 4U2EA 4DMLA 3OZWA 2WIBA 3IAM6 4WXHA 3QE2A 1FLAA 4MLCA 2IZZA 4TYWA 2VA9A 4NF2A 5CMLA 3VNBA 1SHZA 2HK8A 1RE1A 4TS4A 1F48A 1PSWA 3DGEC 4I9NA 1VSQA 3ADCA 2W98A 4U00A 4Z8YA 4PGFA 4XGNA 3A26A 1K8XB 1SQ5A 2Z98A 3T5CA 3X1ZA 5ERYA 1XA4A 3AVWA 5HYVA 2ZWIA 3KWJA 3RSGA 4MCIA 1T8WA 5JROA 3NOQA 3CJQA 2VAMA 3K1AB 2Q3EA 4DR7B 5K0SA 4QSMA 1S2OA 2AF3C 3PWZA 5L9AA 3N53A 3ZV5A 4JKOA 3VR3D 3CZ9A 4E5DA 2RMKA 1XDWA 1E2KA 3JQFC 1IN7A 3AU8A 2CE7A 2UYGA 3DBIA 2GHRA 2V0NA 4Q24A 2ZUSA 3FZGA 2WWIA 1L6RA 4BO0A 3A1TA 1I0ZA 2ZGVA 4TVBA 1MN6A 4C0JA 5K4HA 1EEXB 1OLSA 1U2TA 3JQBC 4I8XA 5CGZA 1V3QE 1NMYA 3LRPA 4D4JA 3VKHA 1Q1GA 2NV6A 3EGDA 3L77A 4YP6A 1QH8A 2Q3HA 3QHAA 4BNHA 2H17A 4H77A 3RAEC 1X1AA 4CGYA 2VEOA 1RP1A 2I33A 4W9MC 4IHQA 1JQLB 1TIBA 2WWRA 2ZYGA 3KTAB 2O4CA 1N6IA 4RMJA 1HDOA 5EJ4A 4EI2A 1MU0A 2G0AA 4CDRA 2KW5A 1SQFA 2YWJA 1H42A 2VQ6A 4JT4A 1V3VA 1ISIA 3UHPA 1GFIA 4P86A 2DWUA 5JVDB 1WVGA 3PXGA 4CQMD 2J3EA 3MILA 5JQWA 1HNZB 3VAYA 2Q7OE 4Z4GA 3QBDA 2VQSA 4DAOA 3ILYA 3GRPA 4DHWA 3ESRA 1BVRA 3G8AA 3GD5A 2JBWA 4Z2YA 4BMSA 1PR3A 1UJCA 2GA8A 3BGSA 4G41A 4YT4A 1H0KA 4WLOA 4DBLC 1X92A 3PICA 1QP0A 4OB7A 5CYFA 3WC4A 1MIOB 2C5EA 2Z6UA 4YJHB 3GA0A 4P4LA 1YFJA 1JAZA 2PZGA 3H87A 1TK9A 2VDVE 4MYSA 2XNDD 4LCJA 2R7KA 3PPWA 4JY7A 5FF9A 3CISA 5EJ7A 2QLTA 1NKVA 3C74A 3R76A 1QGDA 1Q6ZA 1YZFA 4IFIA 4R2LA 1MHTA 1USWA 1II8B 3HS3A 2PH5A 2ZWOA 1NOJA 4A9AA 1L5NA 1E7QA 4RFVA 1KPGA 4WVLA 2EARA 5D8DA 5CDTA 4Q4CA 1Y1QA 1AKMA 4EJ2A 4XKJA 2HTEA 2GN4A 3MTAA 1FEZA 1UKBA 4HQLA 2O1SA 4MDYA 4TSFD 1MAWA 4XWAA 1MX1A 4OGKA 4JOQA 4RHXA 1AA6A 3KETA 3RSLA 3B5EA 2NWQA 3LT2A 1TT5B 1U9YA 4P80A 4TWRA 5FBRB 2DR3A 4WESA 2VXYA 2NUPB 4J7XA 4I50B 4RZ3A 4X7BA 5IHPA 4DR3B 3B6ZA 4C7OB 1IEQA 3AXTA 1LW6E 1RQLA 3HRHA 5C31A 5AVTA 1DXHA 1TI7A 1SMKA 1CUCA 1E20A 1F8UA 2CJWA 4GYKA 4ZU3A 1R50A 3H0KA 1QYCA 2F1OA 4PRLA 3QLVC 1W19A 1Z6YA 4I4IA 5JS6A 4DJJA 3A9UA 1IBMB 1FUIA 4HN9A 3KT3A 1YOBA 4OYLA 3T9CA 1E0SA 3R9WA 4KQ6A 4YP7A 4WZBE 2Q6KA 5GINE 3I2KA 2H4JA 3DTTA 3GARA 3R3JA 2VIIA 4F38A 4H4CA 4LRUA 1WLYA 3DOIA 1N33B 4J07A 2G9NA 4XYEA 4C4AA 2WOJA 1IL0A 2FPMA 3JVEA 1VE1A 3AVXA 3FWZA 2J5BA 4OHPA 4XGQA 3LT4A 3K70B 4IX1A 3BFVA 4CDGA 5LKRA 3R0XA 2QD3A 2XWQA 3TIXB 3NBZC 2XUAA 4H2DA 1O6CA 2GVNA 4E51A 1PW5A 3DV0A 1Z15A 1SQ0A 1ZA2A 1JJIA 1SQ6A 2YWDA 3HP7A 3A0UA 1KEVA 2ZT5A 3UWDA 4B3SB 3BXHA 3Q40A 4KWEA 1L1QA 4LCBA 1USVA 4AG5A 5DM70 5ALYA 2BMDA 3CXUA 3P20A 5E0KB 4L51A 1R0KA 1E6LA 1J8DA 4MJLA 2Z1DA 4WX2B 2F8TA 1VJ1A 3C3KA 3IMCA 4OKIA 2CCJA 4HUQB 5CIQA 5LC1A 3AY3A 4F46A 4AP6A 1F2DA 2JJ8A 1BGXT 1U02A 2P6PA 4HRAA 1E1QD 1CRLA 2CL0X 1O97D 2HHLA 4TZKA 4YJ2B 1R88A 4AMYA 1N3YA 4C7BA 4Z4IA 1NTRA 1YR2A 3QX7A 1FYEA 4JUDX 1F8XA 1NLMA 4CKBB 1M2GA 2PZ8A 2YHAA 3KELA 5H02A 1PT9A 3GH3A 4NS4A 1EK2A 3HRKA 3QY0A 1N6LA 2P8SA 5CPFA 1E0DA 4ZT7A 1BWQA 1T8RA 1Y37A 1C9NA 1GG2A 1YS2X 3NBKA 4MRNA 4GW3A 1O9GA 4BDTA 4MRRA 5KNDA 4NH0A 2R6CA 2ZIXA 3RAPR 4Q21A 3ABZA 5F7ZA 4ZPJA 4ZAFA 2NYVA 3G59A 1GDTA 1RC8A 1M74A 2AQHA 3TNYA 1J23A 2X6RA 3KT0A 3OLZA 4UTRA 2OZEA 3UA3A 2ODEA 3ZNOA 5FWYA 3IMKA 3IP8A 2YOHA 4DC0A 2IL1A 4GECA 3BRCA 4JFRA 3OURA 5FO0A 2CXTA 3MMPA 1U80A 3THRA 3ETLA 2PH1A 2NSHA 3LHSA 4BNKA 4YXWA 4GR9A 221PA 4S3MA 1ORVA 1YJBA 4RD4A 4MOWA 4A4DA 5DTRA 4Y9UA 1EXWA 1Z17A 5LLTA 3GUZA 4IJVA 1HGXA 1JDNA 4PO9A 4D0RA 5EEGA 4RTNA 2XEDA 1KI3A 3ZBUA 2B6NA 4NMLA 3KFVA 4J3JA 3ZWVA 4K9NA 1BMDA 4DXDA 1WCYA 1TRHA 2W6MA 5DNDA 3ZCQA 2P40A 2ZUTA 2HNKA 2VDKB 1XZLA 4MQEB 2ORED 4FHEA 1KWKA 3WB1A 1YDHA 1UF9A 2Y4NA 1VMKA 3DOOA 3LGSA 3U3ZA 1YV9A 3BJEA 2GH1A 2G1UA 1CE8B 2VSOA 3SJ7A 1FQWA 2MR5A 4WD3A 4G0UA 2PV0A 2WTMA 4YRZA 2D6FA 1EXNA 4DWVA 3KPWA 4WWHA 1FCJA 3KB8A 4F3TA 1ZNZA 3MXTA 4N6OA 2RH4A 1NN3A 2IYPA 3O83A 3QE4A 1E5XA 3A6FA 3C6MA 4MJXA 4RENA 3D8SA 4XD7D 3RADC 4URHA 5CVJA 3GLGB 1LFDB 1ODIA 2QUZA 1XCMA 2QUBA 4NI5A 2O5EA 1JQKA 1AHNA 1SXJD 3K70C 1W2GA 1H2FA 2B35A 1E7SA 4NDZA 1QCYA 2TSYB 4RF5A 4RCZA 3DT9A 3GNQA 3L4BC 1U1GA 2CLDX 3EQ9A 4PX9A 5KWEA 4OBWA 1V8BA 2ONYA 4Z49A 3IRUA 1KEKA 3A31A 1U0EA 3AP3A 2JB9A 1SVNA 1NKTA 1T29A 3DDOA 1PQPA 1FMTA 2FDXA 2PH3A 3O31A 3S5JA 5I4IA 2RB4A 3AILA 3N59A 5AI0A 1FBTA 3C3PA 4C08A 3K6RA 3UT6A 2ZJOA 3GUYA 3PNPA 2NO1A 4X1YA 1P45A 1J2RA 2QT0A 3R2JA 1L4BA 1XHFA 2Y3IA 4L4UA 4DUYB 2D1FA 3B8HA 5CB4A 5AM3A 2NXJA 3W5IA 2QW1A 2IZ5A 2YNMC 4OJNA 1VJGA 3AM5A 3QFHA 4NZZA 2ZIVB 1XI2A 1FK8A 2PZBA 4MGEA 4EJSA 3MJVA 4WPGA 3JR7A 1I1OA 4XM2A 1YZQA 3SBXA 2Z43A 4JU8A 2WLSA 5LBIA 2AC2A 5KPDA 2D62A 1N3BA 3AHDA 3F5MA 3PUXA 1OLSB 1NATA 2DHQA 2AYYA 4M1MA 2J32A 4WDQA 3O2SB 4TKVA 4N5NA 1WVMA 2P8JA 1QH8B 2E0IA 3KEFA 3PGJA 2G4LA 3CPSA 4RHFA 5ILQA 5MN5A 5B3JA 2FPUA 1VE3A 4QUJA 2PTGA 5CLQA 4FFWA 4MQBA 1U5BA 3FCYA 1Y7HA 2HZBA 3IELA 4DJEC 4LJKA 5AW6A 3TRHA 3KXKA 4HS9A 1U7UA 1F1BA 5JDCC 1URPA 3G5TA 5AVSA 1V35A 3NUGA 1J21A 1TTPB 2QUIA 3V4RA 3C3EA 2XXJA 2WIGA 1YVUA 1ZDMA 1NXQA 3OX4A 1TUGA 3PWTA 3AOGA 3IAFA 2EX1A 4GUDA 1YB4A 3U7EB 4EHAA 4DV5B 2LKCA 4EPVA 2QR3A 1XMXA 1JKFA 2YXNA 5JVDF 2J5QA 1D04A 3OQ6A 1JT9A 4JLNA 1VSTA 3E9CA 4PC2A 4ZQIA 3H7IA 2AYXA 4FR2A 4LZJA 2I03A 3C1AA 3ESDA 5ADHA 2JGEA 1DRUA 2DHDA 1I01A 2OUKA 3V97A 2MT9A 1N34B 1XCLA 3C8HA 4XVRA 2C5GA 4GI3A 2XKBA 3F47A 1UZMA 4M21A 1OSNA 4JEHA 2VNIA 2AG6A 3KLBA 1TAQA 1NUTA 3TLXA 4AO6A 2XE4A 4Q9KA 1Y6JA 1QO0D 2QD2A 4UVEA 4AMZA 2JJ1A 1PFVA 3EPLA 2JFGA 3G5AA 3IO3A 1IZ0A 1RHMA 3JYLA 4RVOA 4UM8B 3ROPA 5BW4A 2L17A 2CXSA 5HZHA 4KNYA 1A1VA 1E0JA 3NYWA 4KODA 4CXMA 1CKEA 1E99A 3PGXA 4HMOA 2FWPA 4AD8A 1KRWA 4GXRA 3JD2A 1UDRA 3LD9A 2PFGA 3NEJA 1T2NA 2OKGA 2IW1A 4WESB 2KSQA 1FPQA 1ESEA 1RPNA 3I5MA 1ZIYA 1DBPA 3L1KA 2XZPA 1OGJA 2CD9A 2F43A 3EARA 3LCMA 3QXSA 4FD2A 4FZRA 3SEZA 3M4JA 1U0OC 2VNSA 1R5NA 1X1SA 4TMVA 3K5WA 3NEYA 3ZJ4A 5JCOC 2CJWB 2B2XA 4FQ5A 3ECAA 3PDWA 2Q7DA 4A1OA 4ZA2A 5M7EA 2XZOA 2GN8A 3O4VA 1QBKC 2HF8A 3I8OA 3KVNA 2XRMA 3OOHA 4HH3C 2PO7A 3FUTA 4GPIB 1NF9A 1PHRA 3CRQA 4GI2A 2JFVA 1Z0SA 3CW8X 4UUOA 1XVLA 1V9SA 3QUSA 2WQ7A 4FM9A 5ISMA 5EZSA 1US8A 2EJVA 3H5RA 3EDRA 3HKDA 1RC1A 4YGXB 1STOA 5G0SA 1UOOA 3WNBA 3OLWA 1QH1A 1N75A 1FYVA 2P1RA 2GJSA 1W0JD 4G0PA 2Q3CA 5LBTA 1ADFA 5LMCA 3R8XA 2FWBA 4OQEA 3WHIA 2FX2A 3LP5A 5BUQA 1UM8A 1KORA 4BXOA 3DV0B 3CX7A 4LJ9A 5JNWA 1N5DA 1OCEA 1NDQA 2YY5A 1EMDA 3DZHA 3GRRA 3RJMA 5AVQA 3T3IA 2GZAA 2WSMA 3KD3A 2J3LA 4EZEA 3AKEA 4MS4A 4ZVRA 4YUAA 1RI3A 2QU7A 3TM4A 3K8QA 4YAJA 5JZSA 3PUWA 4NX2A 3DEYX 3H2GA 4LJ7A 5LOVB 4D92A 1P4JA 3JALA 3M6XA 5SZIA 1YXMA 2BFMA 4JKIA 4E03A 9LDBA 3CH4B 4DDHA 1TA9A 3ABSB 3F9RA 3HY6A 4BAZA 3HCWA 4HGQA 4B3GA 4HXFB 4CM9D 3R6WA 1OAOA 1B8NA 1C1HA 1GZ7A 1QDLB 2WUVA 4YI3A 5KSPA 1RM4A 4BMZA 3CLKA 1U7PA 3E15A 2ZFUA 2XZLA 2W6PA 1NJGA 3U48A 4YJ2F 2Y1CA 1H3FA 2AR9A 1RJEA 2D0DA 1HPLA 3CV3A 4GMKA 4KPUA 3EVZA 2YXDA 3EGOA 3NOVA 4AYXA 1V6AA 2F9FA 4R2JA 4BLSA 1D6SA 1NW4A 1XZGA 2QJRA 1LB1B 3KQHA 5HJ2A 3T7AA 1JG2A 3NHZA 4XCXA 2H9AA 3VPSA 1OTYA 1YR7A 1UFRA 4H7EA 1XMPA 1DAPA 1BHJA 2GZRA 1NDUA 3LUKA 5AOAA 1WR8A 3BDAA 1XKXA 4PYJA 2CC2A 4AZ0B 3GPLA 3ZQUA 5BUZA 8ABPA 3N3AC 1F06A 1QRSA 1RE0A 3A9CA 5LQKA 3P0IA 2H1FA 4WZBA 4E2FA 4B48A 3LIIA 5C8DA 5A7GA 4FI3C 1IDOA 3ULKA 1NJ8A 4CTNA 1WP9A 1MX9A 3O3OB 1JMKC 2OXIA 1OFTA 4ILEA 4LN1A 3W1VA 1P0IA 3N3BC 4OYYA 3QFTA 4BNXA 2RC5A 2ZBFA 5KJEA 2OZLA 2E2WA 5ESXA 3PXDA 2HXSA 2VT3A 4JI3B 1E9BA 2XCUA 3S40A 1U8CB 1K7SN 4BFXA 4OAOA 1K8YB 2Q3MA 4FGJA 3P97A 2AF4C 2X2OA 3QVKA 1E3QA 1NTOA 1ODFA 2N9UA 3VZSA 2BFEB 2CLKB 2WP0A 3JQAA 3LGXA 4ER6A 4I3GA 1VG1A 2IJGX 4X3OA 1DCTA 1ULHA 2GAOA 1EZZA 2ZJYA 4O4LA 1JSXA 1RKBA 4GD3Q 4MKHA 3AR4A 4XLZA 2HA0A 3UBTA 4Y9RA 4J0HA 3NHAA 4FGKA 1NBME 4M1TA 3PFNA 1Y81A 4NDNE 3V2IA 1U63A 2G5CA 1CSEE 4PSDA 2NTNA 4KL8S 5EJEA 5EMLA 1LX6A 3OHSX 4NCHA 2JLUA 3X2SA 4Y6SA 2VZ9A 1FLVA 1HYHA 2JAHA 2XVYA 1QH0A 3TKYA 3V4SA 3DF9A 3E58A 1J6UA 1PNVA 4NC9A 4YJGB 1CVLA 5FEMA 4Q1EA 1U1EA 1ZGJA 2J31A 4PFQA 1A76A 2R1ZA 4XLTA 2QLFA 3OLXA 4LYHA 2PEYA 4ARVA 5G02A 2QTTA 2JZCA 3MELA 3SYKA 3IXQA 4DIDA 1SCDA 3EISA 2ZSDA 3A9SA 4TGLA 3X1MA 2XODA 3AUKA 5EE9A 2JZOA 1SGWA 4ZYZA 3KPYA 2A94A 3LCUA 3HGMA 4JHLA 2IPOA 2BFWA 4Y1EA 3DEJA 4BV9A 1ACLA 3VDQA 3ANNA 4XYMA 4LDRA 2NP6A 3BXPA 2O8VA 4FHZA 2XMCA 1FU7A 4X1YB 2OPHA 2JLBA 4DCGA 5HOEA 5FO1A 5CXQA 5CB4B 5ALKA 3D6NB 3LM8A 3D59A 2J07A 4DB2A 1ZLYA 4UTXA 3RABA 2QTWB 2QZPA 2VQ3A 4DW8A 4EJSB 1XHEA 3VYWA 4XYBA 3H65A 3MS7A 2MCFA 3STYA 1IONA 1M2VA 4DEYA 2CXRA 2OEPA 1GFZA 1NQVA 2C82A 1AX9A 3DE1X 1V5EA 4LG1A 4R5HA 4OD0A 1NMSA 4U6SA 1G19A 5A9TA 4TKVB 4D96A 5P8WA 4ZZIA 1FXWA 4JJAA 1DXYA 1RPAA 2GFQA 2Q1YA 3E3NA 1OKKA 4Q5IA 1BA3A 4EK9A 3Q2OA 3RF6A 2RI6A 4OGGA 4XGIA 5J1SB 2I3GA 2QY6A 2O6LA 5HZMA 1U5BB 4ARIA 2FVYA 1R5BA 2IYAA 2PRJA 3KSDO 4POAA 5E7QA 1EWTA 4NFYA 3VU9A 1YHNA 4ALKA 2ZXUA 1XNRB 1A7AA 5AKYA 2IXTA 1VG8A 4RMNA 3IT2A 2B2CA 3HV2A 4II3A 1FYXA 4O63O 1ZAYA 1NVBA 1JWLA 3I2IA 4ISCA 4L6AA 2V7XA 3BA6A 1XKQA 3EASA 2XUIA 3PLNA 2VOEA 3D8RA 3HGTA 3IP6A 4OAQA 3GLFE 1K8ZB 1Z2CA 1XIVA 4M76B 1U2GC 4EGJA 4F6LA 4KFRA 4POOA 3UJBA 5HP4A 3RUIA 1A88A 4C4OA 4K1XA 4QOHA 1Z4LA 1SRRA 3F8WA 2F9LA 2P91A 1MP0A 1ZRSA 4OUDA 4CL0A 1LV7A 2BBSA 4X00A 2AXQA 1UMBB 3VX4A 5BV0A 3T4EA 3IT0A 1NG1A 3KQPA 1FDSA 1X1QA 4CNBA 5C7LO 1YA6A 2J0QA 3MGBA 2JD2A 4AYTA 4HDRA 4QATA 3C98A 4XB6B 5F35A 3UZUA 3U3KA 4D9GA 4QDTA 1IEWA 2C7OA 2C58A 2PPLA 1CVRA 2F9MA 4TSRA 3U4QA 3SF0A 4MB2A 1JSRA 2ZWMA 2H2FA 3DYVA 4W9NC 1H1LA 2GFHA 1XYYA 2P5TB 3VPBA 5F98A 1GGFA 4OSPA 4NBWA 4R8LA 3WVNA 1DIAA 4PZLA 1PQ4A 2R8RA 3IP9A 3DOUA 5AW0A 5G0TA 5DFAA 4BGUA 2P4HX 2ZJ6A 4DSAA 4WRRA 3DEZA 5AVJA 3V8MA 4N18A 2XUQA 1WXQA 3HVJA 1KZ7B 1Z2AA 1ZD1A 3BCHA 4GXQA 2Y1FA 2R7AA 3AF5A 1D6JA 4LJYA 4FI3F 3TLKA 1QZ3A 2C97A 1N0HA 1Z36A 3MT7A 1UBCA 1C3JA 3IT3A 3BDVA 1T9BA 3AV3A 1DU4A 2RONA 2XSZA 1N1MA 2R5NA 1P0CA 2ETVA 4N1AA 3WL4A 1P5HA 4ETWA 4LF4B 4PLZA 4XE5A 2ZPAA 4EG5A 3EAFA 1VXOA 3G0BA 1U8ZA 3AL3A 1BEEA 4JOBA 3S2GA 4YDRA 5IFLA 1US8B 3HKDB 4IUDS 3ZHRA 3ORSA 1NT4A 3M5WA 1E92A 4EJSC 1QH1B 1M3SA 5D7BA 1N92A 4R8SA 4QTZA 4YWHA 1NNUA 2EZ4A 2G1JA 1A4UA 2V7QD 1N2IA 3HNPA 3G2PA 3UFXA 5F9FA 1KO5A 5J4KA 4BXOB 4BE7B 1WWKA 4K40A 1UIMA 4C0WA 1RXVA 5KAMA 3CF0A 3RS5A 2VCYA 1I3KA 5EHNA 4JBXA 3W2HA 1V2HE 4KAAA 3HXMA 4JJEA 3V5NA 2JFOA 1ZONA 2AQKA 4I6JA 4RE5A 4ID9A 1DLJA 5TGDA 2GXUA 5KX5B 4PLYA 3F71A 3LF1A 3RU2A 4X62B 3MCVA 4N8DA 3K70D 1P31A 1VA4A 2HK6A 2XYRA 3FDFA 1DL5A 1F3OA 4H7JA 4KXFB 2VFAA 1MTOA 3SYNA 4MWCA 3G13A 3COJA 1JBEA 1Y5MA 4R7GA 2D5LA 1FDVA 1SCQA 1V5GA 1XF9A 1FS4A 4D4MA 4DCUA 4HD8A 1QE5A 1C1DA 5IT9A 2J9FA 3E70C 4LNAA 5LZ5A 1SD1A 3ORFA 2X3UA 2FZLA 2IFTA 3EOBI 4M1ZA 5AIAA 1U8YA 3KYIB 1GOTA 2IHVA 2O0MA 2W8BA 2CSUA 2FW9A 4ZVKA 4YCJA 2WWXA 5IMSA 4RXMA 4KPUB 2VPQA 4IEEA 4WNAA 1A69A 4MVJP 2WTBA 1Y8RA 1BD4A 2CHGA 4K81B 1W4CA 1JV2B 2YNMD 5AXBA 4RE6A 4H0CA 1DC8A 3WBFA 4K0KB 2CN1A 4ID3A 2L19A 2Q0XA 3QG5A 5H9VA 1TM4E 3SN6A 1KTIA 2GPYA 2FTKE 3G9ZA 4YRIA 4DIOA 2JRLA 1XCOA 4PX3A 4W63A 3WO0A 2BTQA 5K0NA 2BZ0A 3AH8A 3BWYA 4BTEA 1VYUA 2AZTA 4FIDA 4G4GA 3GXBA 4WZBB 2HT1A 1CYDA 5AKEA 1TJ5A 2HF2A 2EBWA 5FPKA 4GNRA 1RI4A 2LR0A 2QRPA 3I45A 1CY2A 1JXAA 2FPGA 1SZCA 4YA6A 1JTFA 4ZRNA 4AFNA 5TPWA 3BMOB 2JCSA 5K8JB 2OZLB 3JYHA 4FYYA 2A6PA 5CVDA 3CZ4A 3T7JA 1DB3A 3VO8A 2BELA 1KOJA 4AJOA 5IX8A 3IGFA 3ITEA 2CJPA 3Q3JB 2BM1A 2R79A 8ATCA 3OMLA 2Y8EA 2BGUA 3RM3A 3GEBA 3H1FA 3IRVA 5C3MA 1YBMA 1GLNA 2QX8A 3JQAB 5LB2A 2GX6A 1JRLA 3PENA 2F8LA 4O4LB 4DR6B 3ROEA 4C3OB 3UMSA 3HRIA 4DL9A 2AKYA 1GT91 2C9CA 4H4DA 5MDHA 4W1PA 2W2LA 3CE6A 3ZW9A 1E2UA 2CXXA 4UOQA 4XYLA 1PGOA 2BRUA 1IBRA 3KR1A 3L8DA 4ND3A 4TT3D 4WY8A 3K0SA 5KYUB 3JAMA 5CH5A 3R7BA 4G37A 3BK1A 1FRNA 2XBMA 3HH8A 4LDZA 3CLVA 2K7ZA 3A3NA 3A4MA 3OPXA 1COWA 2D3WA 4V0LA 2UVPB 2DMRA 3P9KA 5HIJA 4QLOA 4I1SA 3L4EA 2ONKA 1O7JA 4NJMA 3TXAA 4C07A 3GJTA 2F3TA 1EBFA 1MXFA 1XX6A 3RF7A 4C4YA 3Q5DA 4YMWA 2D0IA 1ISHA 1N32B 5KNCA 2E6KA 2DSNA 2FI1A 3UTCA 2VP2A 4BV2A 2VTBA 1BN6A 2H5IA 3UGTA 2QL6A 4P3PA 5EJIA 1QR6A 1R6TA 4J0KA 4FDTA 4XRGA 1L4YA 3BBLA 2CLCX 3GLQA 5IN4A 2BFFA 3URKA 5AUPB 2PQ2A 1MCZA 2WJ4A 3QVOA 4UBNA 3H6GA 3MLEA 3OPYA 5K3CA 1EIWA 1U0BB 1ZISA 1DO2A 3WWZA 2Q4DA 3FVQA 1XU4A 3OJ0A 1ZNXA 2YC2C 1OAOC 1R0YA 2I34A 5EIAA 2WW8A 3E3AA 2Z9BA 4FD3A 4EQZA 4B4DA 2PL5A 3KTDA 4W5QA 2FOXA 1GQSA 3ES9A 1PR1A 4B75A 4OMCA 4PBTA 4RS4A 2ZJ3A 5CB4F 4ZV4A 3HDGA 1KJWA 4ZIRA 3DPUA 3HB0A 3LNTA 3ENKA 3KUDA 3OWXA 3PTAA 3QV1A 1NSYA 1W44A 3MT0A 3ZQ6A 4MIYA 1VSVA 1O95C 2H5EA 2P0YA 4NEQA 3Q7SA 4MKIA 1YVDA 4O2LA 5ULLA 4CEHB 2VSYA 3CH7A 3CVJA 2ZQYA 1TKCA 3KQUA 1BJTA 4RK4A 4FILA 2W9XA 3PUHA 4XOUA 2HMAA 3QPAA 1GZHB 4NCJA 3WYEA 2B3TA 4AY6A 4PQYA 3F90A 2OGWA 2UUOA 3RJTA 2PHZA 3T3PB 3DOEA 1J2UA 3GDWA 1OILA 1ZO8A 5D84A 2BJWA 3SM3A 1WMEA 2FW6A 5CHEA 4NPAA 4WLVA 4AP9A 4H31A 5BXQC 2Q0QA 2PM8A 1VYVA 3B3FA 3GLKA 3H7AA 3KOOA 1S4MA 4GFDA 5CFLA 1PQUA 2BYTA 2AXEA 2B0JA 3UMFA 4QVGA 5AI5A 2GPAA 4CT4B 3M6UA 4LDNA 1UJ2A 4OUDB 2EJCA 2P75A 3R23A 4LMAA 4HQ0A 4MRAA 2MYUA 3T99A 6GPBA 4C4RA 3NFYA 4A6DA 2QYOA 3UKDA 5E1MA 1DTEA 1EP3B 2J4DA 2MSNA 3TOCA 3ZQJA 2WJPA 4IX9A 1VL6A 1S02A 5KQMA 3BM5A 1ZGCA 1B0PA 3FCAA 2G9QA 2WIDA 4G0OA 3U4QB 1U98A 3OC0A 1DJLA 3O84A 4QRIA 1FDUA 1H1LB 2FN9A 2BZSA 2W2VA 4PF1A 5AK0A 1DO8A 5F1PA 3HUEA 4EVSA 2RKWA 2AJTA 2ORWA 3BJRA 2FUCA 4BMYA 2I6FA 3IVMA 4TRJA 3CZMA 4YHBA 4IOLA 1G3RA 2MSDB 3D0OA 1AZLA 1L7PA 2XBUA 3L1JA 2HQ1A 2ZUDA 3TTWA 1Z4QA 5A3RA 1P5RA 2RGAA 4MK4A 4RD2A 4TZ6A 1UJ5A 2OBLA 4DG5A 3D6JA 2X7XA 1DJMA 1VHWA 2KWIA 4RTPA 1DFIA 4FX5A 2H2AA 5E4JA 4UNQA 3ZJVA 2PD6A 3QVVA 1Q1AA 2O2ZA 3FNRA 1FYWA 1E32A 3IHWA 4ZFNA 4G4IA 3CZAA 1M7GA 2GASA 1XE3A 1YO6A 4JIGA 5DNAA 3UEOA 4B9AA 4BO5A 1MC4A 3IR7A 4IXNA 5IUNC 3GZJA 4IIBA 2WM2A 2VHYA 5CB0A 1HNWB 1CZUA 1PF7E 2E21A 4ZEMA 3HA2A 3DBRA 4HNVA 5B7QA 2VAPA 4R51A 9ATCA 4MRSA 4HDKA 3GL9A 4FT4A 4KIUA 3MYRA 5AT1A 3ZWCA 4J91A 4BB9A 4OSEA 4NBSA 4Y3UA 3LCRA 2GESA 1X8KA 2GYVA 4FVTA 2QX7A 4JROA 4Q00A 1YFLA 1HMPA 1T34A 4ZQGA 3VQTA 1CIVA 4ZICA 3EEQA 3VGPA 3FTPA 3KOZA 3PQFA 5AOBA 3E82A 2FA9A 2RDMA 4Y7DA 3UFXB 3LFTA 4FMCB 3VYUB 3S3TA 5JECA 2C00A 4R01A 3C24A 2VSQA 3EULA 1TGVA 3GRAA 4HVTA 4NJEA 5CFOA 5MGNA 1P2UA 2WOOA 3NDPA 2JJMA 4MDHA 4OAPA 3TOZA 5BW5A 1W94A 2A9FA 3AEXA 5JG7A 5DSTA 3TFQA 4R1SA 1I94B 5C34B 5F64A 2IHBA 1KXJA 4TQAA 1T0HB 5LYJA 2XYHA 5ESWA 1THZA 1PDVA 2Z2KA 3JQDA 4X85A 5JTUA 2IIPA 1RQ2A 4GYYA 4DNXA 5KTOA 1FS6A 1L3BA 1UK6A 4D3YA 3F6RA 1P1RA 4Q3OA 2M6RA 3K8ZA 4B4WA 4BFCA 3O93A 5KX5F 1HORA 3FFBA 5KQPA 2J9FB 5DT9A 1ZN2A 1MGOA 2AKAB 4HDNB 1RRGA 4RPCA 5IF9A 3PJDA 4IDCA 3S27A 3RB8A 3PXBA 2G88A 3F6EX 1KDRA 4CCSA 5I9MA 1SXPA 4YHHB 2JGMA 3W8EA 3F7MA 3O8CA 1CZOA 1NBOA 3DA8A 1DOAA 1I3MA 4RM3A 4MICA 4WNAB 1Y8RB 4WNYA 1P7YA 1T0BA 2DUUA 3OU2A 4KE8A 1S9HA 4ROTA 5EEHA 4CR6A 4U7WA 3O8OA 2BSQA 2OOSA 2FG7C 1AKQA 2AC4A 2AVDA 4FCCA 4DLPA 3W5SA 5IDVA 4PPNA 3BGDA 4XUDA 4O8CA 5CLJA 3KTFA 2AZXA 2P9GA 2CL6X 4M0EA 5I7AA 4A26A 4Q3KA 2I80A 1I9CA 1IJBA 5CT5A 1LDNA 2Q4OA 5BOSA 5KNDD 4YPFA 3H6HA 2BBWA 2FOLA 5JFGA 2IS4A 4Q9AA 2AEEA 1CQPA 3UH0A 1TQDA 2H1RA 1SC6A 3DMPA 3EPJA 3DT8A 1RFGE 2FPGB 5KNBH 2HWKA 4M98A 5TPWB 1E9SA 2VTDA 2WU4A 4AY5A 1IEXA 1QVZA 1IIRA 3FFAA 5GVSA 3MMXA 5B2EA 2OK7A 1QVAA 4FIZA 4AY3A 1YJQA 2OTCA 4DLXA 2GJ9A 4XUCA 1M2WA 1EDDA 4PZYA 1L8AA 4YXWD 5AUOB 3KKLA 1Z6QA 2LCQA 1W73A 4EJFA 1SHJA 2ZRDA 4HH1A 2VOJA 3U7GA 1FL9A 1WEKA 3W3AA 5IVKA 1VB3A 4MVJE 3CB4A 2XB8A 3N0VA 2C7BA 1S6YA 3BERA 4BQPA 1GKIA 3F4BA 5LA6A 3ZV6A 1XMOB 2BUCA 4KC0A 3OEEA 1NP3A 3UJPA 2QG4A 1IVSA 3U26A 5NLLA 1GA1A 2HMSA 5DW3A 4CTKA 4ARAA 2DUWA 4PWYA 2WPNA 3SEAA 1E2GA 1USIA 4IUBS 3UOGA 2PKQO 4DQ0A 3CVUA 3FVTA 3VO1A 4CG1A 4F1KA 4XPIA 1NXPA 4OKSA 2PSJA 2P3LA 1KJ8A 2E55A 2WG0A 2QQ5A 3AQIA 2CDNA 1J39A 2GF0A 4MGYR 4PS1A 1K5HA 4NJMB 5I9TA 4GF5A 5HILA 2PO5A 5FT9A 2FEOA 3FCEA 4ZOLA 2HLNA 1JALA 4UMEA 1XALA 3MAJA 3PE3A 1F4LA 3O90A 4KO4S 4B45A 4F72A 5LP6C 2WYIA 2VTBB 2IEZA 2H2DA 4H1UA 4B3TB 1E5TA 2GGSA 4DDUA 1RM3A 1DJOA 1UQTA 2DFLA 1UBFA 5DM2A 5EWLA 4HDQB 3T5DA 4YRTA 2BFFB 3MSCA 3ZDFA 1U3CA 4PYIA 4WXPA 3C85A 3PKJA 5DIZA 1DO0A 1RQGA 1V45E 3GEDA 3B6JA 2QQFA 3H8WA 4LA4A 3QU9A 4Q34A 3E84A 3D4OA 4RGYA 4B4VA 4EB0A 4ESEA 2DH6A 1G5RA 4NAHA 5JAZA 1XZFA 1WZNA 1JBQA 3MIIA 2COEA 2VAVA 4RZSA 2GD2A 1H0SA 4ALIA 2XA2A 2H07A 2YVAA 1C4OA 3AB7A 1HK7A 1U99A 3PEFA 5IBPA 1MG0A 1XJWA 3UVEA 4NRDA 1F0KA 3BB1A 3IQEA 3ROMA 4HX9A 4RH3A 5C4IA 1KYYA 3RIGA 5IVDA 4G1EB 4TLEA 1EHIA 1JU4A 4L9SA 4NYJQ 1I5EA 3A1DA 3LC1O 5KYNA 1AE1A 4ZIRB 1G21E 3A70A 3CUKA 5KKAA 2BFPA 1GPJA 2QU8A 5CCBA 6AT1A 3BCRA 1J4AA 1QCZA 4OHBA 5AO9A 4LSWA 3PA6A 1E1DA 2C3OA 4DJDC 2IS6A 2G5TA 4P3NA 4BFLA 1OWOA 3E23A 3EMVA 3GRFA 4NHEA 3BQ9A 4EA8A 2PFKA 1OF1A 2DPHA 3ZLVA 2DFKB 3L1UA 1AGXA 1CQXA 4DLKA 5DBFA 3WLNA 4BVFA 3BWVA 5E8RA 1Z39A 5K8UA 1FXWF 1GR1A 3OZCA 4EATA 2WHRA 3AT1A 3MGAA 4HFNA 4KP7A 4MO9A 2BL4A 1PAUA 2JDIA 4AJ9A 2QV0A 5K99A 1LBQA 3DAOA 3K0EA 4JC4A 5B6JA 1ISSA 2W4IA 2XMGA 1BVHA 1YS7A 4DLAA 2C4HA 5BNTA 3PD0A 3BF7A 2X0FA 4BIMA 1TD1A 2C83A 3K15A 1CY1A 4KDEA 2X1VA 2O19A 2ZSIA 2F1JA 3EUAA 4HQFA 1QIKA 2B8TA 4D02A 2IXFA 3LX8A 2IYRA 2CHEA 3KR9A 1U4OA 2C77A 4BNJA 1NYRA 2HW8A 4YRMA 1VI5A 4C04A 1JILA 1X7HA 1ZX1A 2REXB 3LQ2A 3R5FA 5AHRA 2OBMA 5AI4A 5LB4A 3UK6A 1ULBA 3BZUA 3OSUA 3PR1A 1C29B 4Y2JA 2KI5A 2I8CA 3V55A 4TYNA 2I2XB 4JV5B 3JQ7A 4DRZA 5CT4A 2BRUC 2IYWA 1B8PA 1T5LA 3HG7A 3NKVA 1KZ1A 4PGAA 4Z99A 1N4AA 1IAQA 1DEHA 2GDJA 2RHHA 3MTEA 5ICFA 4EMBA 1E89A 2ZE6A 5ARDA 3WP1B 5JY1A 4AG3A 2IRWA 3T9AA 4P3XA 5IWAB 1OBFO 2OECA 4GOXA 5KVSA 1B3BA 4LXUA 3PGLA 2EFDB 1INLA 3VFDA 3LPAA 4HXGA 3GP3A 2B83A 4GZLA 1Z34A 1KMCA 4AZ3A 1Z4NA 1TZMA 2C9ZA 2JJ1D 4DYDA 3GPBA 1M54A 3ZDXB 1Z38A 2DQZA 3DZGA 2QGZA 1N6OA 3SG0A 4NBVA 4B0OA 5EPOA 3JY6A 4PC1A 4FHCA 2CMGA 1FMCA 1OV6A 4DWWA 3N28A 3ISVA 3U7QB 3C6XA 4EA6A 4MUAA 3PFFA 4P36A 4HDKB 4BO8A 2ZBGA 1V41E 2JGJA 1Y9DA 2Z04A 3JWPA 4CLRA 1UR5A 1Z35A 2PJZA 3P9IA 1HT1E 2OP1A 3FPLA 5DNWA 3KQYA 5H83A 4E21A 1JHUA 3AJ9A 3L02A 1RRFA 1R64A 3FBWA 4YQYA 1KSJA 4X44A 1LBTA 3SHOA 2GN1A 3LG2A 1HTWA 2YJZA 4A16A 4GI5A 3EIUA 4J7CA 1SXGA 1NIPA 1QPBA 1KVTA 4X7MA 2ZAGA 3JPYA 3I2HA 3OJEA 5DEIA 3DV2A 2B7LA 3R6DA 1DC5A 3PT5A 4C0SA 5HVNA 3TNLA 4BUZA 2VR1A 4HR7A 2B94A 4NJEB 1YASA 1DQPA 5AR1A 1XTPA 5TXGA 2C3PA 5EIBC 3FM9A 1Z6ZA 2XE7A 1QGAA 3A1CA 4B2IA 4FFNA 1QIFA 1UXJA 3C7TA 5IAKA 5DLPA 3LU1A 5LYJB 4C9BA 4PLPA 3CNHA 5BN5A 1M1UA 2WG1A 3DHWC 3T52A 1GTZA 3V8VA 3FI9A 2GCPA 1YCFA 1R7RA 5LP6F 5BR7A 3OOYA 4F7WA 1HQKA 2RGEA 1Q74A 2BGWA 4NKRA 1NUPA 2FSGA 3BL8A 4LOIA 1D2AA 4L4SA 5DTQA 3VTFA 1SUAA 1C7FA 3F5QA 4UU7A 1MABB 1HBJA 2C54A 2WUFA 4I9GA 4PGGA 2P11A 3ZVRA 1GQYA 3T7EA 4II2A 1EDOA 3D3JA 2VWPA 1RYDA 2Q8NA 2B8NA 3I3OA 1TM7E 3TJMA 2XAAA 1J1UA 1WDTA 2WJJA 4H18A 1B1CA 1XB2A 2MDTA 1PT8A 3O8OB 4OL9A 4V02A 1AQJA 3R5XA 1WV1A 1A96A 1GTL1 4WOBA 3EY9A 3D3QA 1KXZA 2OAGA 2GR9A 4UM7A 4EG7A 1Z33A 1OT5A 1ZR4A 3LZ6A 5KBYA 2IS2A 1O8CA 1W0CA 4UFOA 1P18A 3OJLA 4GL4A 4YRLA 3BMCA 2DG2A 4P9NA 4PXAA 1YL5A 3WMRA 4LFCB 2IUYA 1Y34E 4PU0A 2JCVA 3WRVA 2PXXA 4DMRA 1UMCA 3UB3A 2VEDA 2HPVA 1ZJ4A 2IEGA 3DFIA 3I9LA 1KJNA 5F51A 3IBTA 5HR5A 3BS4A 1MT0A 3RT1A 2C5AA 2PL9A 1Q16A 2R00A 1JHYA 5HG0A 3I42A 2WMNB 3U39A 2H48A 1AGYA 5L7YA 4ZZ0A 4CG0A 4W5JA 1RIFA 5F78A 1T1EA 3SIWA 2YHUA 1ZCFA 1RQ7A 2OO7A 4RUKA 4ROSA 4NENA 1SVIA 2OG1A 3SU8A 4ZI7A 5AW2A 5C5DA 2VDOB 2D5BA 1FLDA 2O06A 2DTDA 2PX8A 2HRDA 2RBGA 3J7TA 3N70A 1H5UA 4KQ1A 4MI3A 2AR7A 5JRZA 4FE3A 4B3FX 3ZVMA 1NW9B 2WNSA 2C4MA 3CC8A 1PJCA 5LA6B 1MC1A 3WLIA 1CK4A 3G2MA 1XD2A 3E8MA 1FU8A 4KPYA 1GEGA 1Y1SA 2Y1KA 4KUGA 4MINA 3EZYA 4BRZA 4ZN6A 3OQMA 3KQVA 2OHFA 1HLGA 3R3XA 4UBOA 5GGYA 3PITA 4DLUA 2QX9A 5K8IA 5DSXA 1AC5A 4OHCA 4AJIA 4DRYA 3UWOA 2Q5OA 4E5KA 1UXOA 1X7DA 3JQAD 3A25A 4XPIB 2G1KA 1FX0A 1JEEA 3EVTA 1Z4KA 1I0IA 1IH8A 2JVIA 4UHCA 5B12A 4K3UA 3ZGOA 4OIFA 1UZNA 3PPIA 1KY2A 2W4MA 1XEWX 3QBTA 5BVHA 2F4VB 4ZOLB 5KPJA 1MD9A 4RVUA 1HKUA 5JAIA 3UB4A 3IIIA 5KB3A 1UKYA 2RHBA 4ZEOA 1DQSA 4IS3A 4J0FA 3U9TA 3PQ2A 4PZPA 5EWLB 1H6CA 3EF0A 5K2MA 1XCPA 3C8DA 3UCEA 5JANA 3IQFA 5DEOA 3Q8MA 1LDGA 2VHCA 1IU9A 1QZZA 5BMVF 3V1TC 5LDDC 1J56A 4F3NA 4P08A 5DHPA 4OXNA 3KNZA 1OFIA 3HCDA 3ZTTA 1FFEA 2O3SA 4G1FA 5H68A 2EVWX 2XVAA 1MJ5A 1WZUA 4YXFA 3A1VA 3IEVA 2CXNA 3L8CA 4DLWA 1G20E 3AUAA 4DMMA 3EBPA 5CM8B 3OZVA 4CKWA 1ESNA 2ZE5A 4B80A 3RARA 4E5VA 4HQRA 4ENSA 5GM2A 5JQGB 5FR1A 1RM5A 1ABFA 2BFNA 2JZNA 5DLYA 2VKTA 5FFFA 4FK8A 5IC6A 2CVQA 3SGLA 1NVWQ 4E88A 2A5DA 1EFLA 4M1EA 3LDHA 2RBKA 2QVXX 1Z74A 2CLOB 4Y9DA 5KCMA 4FCTA 1WS6A 2QTNA 4BLQA 1QHXA 2H51A 2GA9A 2CYAA 1NYLA 4J9UE 4MVJA 4KZPA 4XWOA 2ATXA 4G2NA 4X8OA 2OFWA 4C3VA 5C8XA 2IWHA 4G9BA 5JYCA 5A4MS 2QRUA 1OKKD 4RABA 1FMJA 2PGXA 1B6SA 4Q02A 1FP4A 1K7EB 4O25A 3ANSA 1PUJA 3ZD9A 4J75A 2QUJA 4Q1CA 4YCAA 2Y6UA 4JBNA 1EVYA 3RFTA 2AOXA 3OT4A 3OWOA 2CGEA 1FLNA 1N6PA 4RJ2A 4E1BA 1RDFA 3A1EA 3PUYA 3SE0A 3UB2A 3EQ6A 4BFWA 4BVGA 4PN7A 3W9SA 1WU8A 1D09A 4OYHA 4MQMA 1DX9A 1JQBA 1L5HA 1U7ZA 4WEOA 3TZEA 4HUJA 3VU8A 2REOA 2C4KA 4C01A 1FW8A 3STVA 5AH0A 4B3JA 4FFBA 4D6YA 4Y1FA 4JEMA 4EP1A 1SC4A 3JQ7B 4Q6WA 4EZIA 1Z25A 4GVPA 4U2BA 1YHZA 1YRWA 4A5SA 1BQ4A 5AVRA 5ICSA 4XXHA 1L7VC 5TS2A 2PS9A 5AHWA 3T3EA 4JP1A 3D54D 1AUQA 1PEYA 3C4QA 5EUMA 3STXA 2XZDA 5EJ9A 3HFRA 3NYQA 5EHIA 1NJ6A 2AFHA 5FUMA 1A5BB 2BEJA 3HYNA 2ZJZA 5JS7A 4GLOA 5FA6A 3MC1A 4MYCA 1HOXA 3GOHA 3E2PA 1U11A 4WECA 2GEDA 3JSAA 4A2QA 3UJ3X 3O4RA 2G04A 2R2AA 2H2HA 3NP7A 5FX2A 1JIVA 2Q4TA 3A6LA 5BYJA 3I28A 1Q50A 2RJOA 4DARA 3M34A 2PMDA 4KV7A 2LUOA 2XNSA 3ZDBA 5H4HA 4BNIA 3AF4A 3DSRA 3P19A 5H59A 2EW1A 3A05A 4KJXA 3I12A 4CLRB 4H15A 3BYZA 1BRMA 1PG5A 1P62B 2RJ3A 4JLUA 2HBZA 1ORWA 1EA7A 3L8MA 3TRJA 5JH7A 4J7AA 3THOA 3FAZA 3F73A 1NVVQ 2Y1WA 2R6FA 4DIFA 2XSZD 4LE2A 1QGYA 4J76A 2VAXA 3PCTA 1NE2A 1TCBA 3KUCA 4MZXA 1P72A 5HZGA 3W1EA 1UJNA 3CX8A 4PE5B 4G1UC 3O4HA 1B6GA 1C7RA 3H86A 3QF4A 4G0NA 5IK2A 3B12A 4LJLA 3EIQA 2DECA 2RARA 4CN8A