4DBLE

Crystal structure of e159q mutant of btucdf
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
245
structure length
245
Chain Sequence
AAPRVITLSPANTELAFAAGITPVGVSSYSDYPPQAQKIEQVSTWQGMNLERIVALKPDLVIAWRGGNAERQVDQLASLGIKVMWVDATSIEQIANALRQLAPWSPQPDKAEQAAQSLLDQYAQLKAQYADKPKKRVFLQFGINPPFTSGKESIQNQVLEVCGGENIFKDSRVPWPQVSREQVLARSPQAIVITGGPDQIPKIKQYWGEQLKIPVIPLTSDWFERASPRIILAAQQLCNALSQVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vitamin B12 import system permease protein BtuC
publication title Asymmetric states of vitamin B12 transporter BtuCD are not discriminated by its cognate substrate binding protein BtuF.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 68
structure length 245
sequence length 245
chains with identical sequence J
ec nomenclature
pdb deposition date 2012-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4dblE01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4dblE02
5M29A 1QH8B 2MINA 2OGWA 2PS9A 4WZBB 2X4LA 5M3BA 1L5HB 2OV3A 4G07A 1G20A 4DBLE 1FP4B 3AETB 3AEUA 4M7OA 4WNAB 4HMOA 3TLKA 4WESB 1K7SN 5KOJB 4ND8A 1M1YB 2Q8PA 3ZKAA 1KARA 2RG7A 4IRMA 4UTPA 3TEFA 3K1AA 5KOHA 1PQ4A 1N2CB 2YNMD 5BVHB 5CR9A 2XDQA 3U7QB 3BE5A 1N4DA 4INOA 1MIOB 4BBPA 4MO9A 3G9QA 4OXQA 5JG7A 3BE6A 4WN9B 4MLZA 4XPIA 2YNMC 1KAHA 3ZK8A 3EIWA 4NNPA 1N2ZA 4WZBA 2PS0A 1L5HA 2XQVA 3AEQB 3R5SA 3TNYA 5HDQA 1QGUB 3HXPA 3NU1A 3AEKA 2PHZA 5CX1B 1M1NA 4TKVB 1ESZA 1G21A 4PM4A 2OV1A 2OSVA 4N01A 1QH1B 2AFIB 4HN9A 5BVGA 2PRSA 4CL2A 4MX8A 1H1LB 2AFHB 3PDIB 4WN9A 2XV1A 2XUZA 4NNOA 3GI1A 3R5TA 4H0FA 1EFDN 1XVLA 1K75A 1QH8A 3MFQA 4UDNA 3PSHA 2PS3A 4OXRA 3MINB 5B58T 1QGUA 4LJSA 1FP4A 3AETA 2MINB 5GGXA 5KOJA 4WNAA 3MWGA 4WESA 2R79A 4GICA 2XY4A 5I4KA 3LHSA 4FNAA 3AERB 1M1YA 4FI3F 5JOQA 1QH1A 2ETVA 2R7AA 4WZAB 4FKMA 3LI2A 1N2CA 4H59A 5BVHA 4INPA 1K0FA 3MWFA 3U7QA 1M34B 5AFSA 1MIOA 1KAEA 3AESB 4PAGA 4TKUB 4HMPA 1N4AA 3HJTA 5JJ5A 4UDOA 2XDQB 1TOAA 3HH8A 4UTOA 1PSZA 3MINA 4B8YA 4MDYA 3AEQA 4XPIB 2O1EA 2Q8QA 2M6KA 3EIXA 3AERA 3UJPA 4K3VA 5M34A 4HMQA 4FILA 5CX1A 4WZAA 4TKVA 5GGYA 2XH8A 5HX7A 2M6LA 5KHLB 1M34A 2AFIA 1G20B 3AESA 3AEKB 1H1LA 1M1NB 3AEUB 2AFHA 3PDIA 4OVKA 4TKUA 1G21B 3MD9A 2WHYA 5JPDA 4ND8B 5M2QA 5FLYA 3ZK9A 3ZTTA 5BVGB 3ZK7A 2QI9F 3K1AB 5KOHB 4G09A 2WI8A 1K2VN 3PSAA 4LS3A 3CX3A
chains in the Genus database with same CATH superfamily
2JLAA 4ARSA 2AD1A 2OBFA 3WG9A 1JQ5A 1ZGAA 2OILA 2V0CA 2ZSJA 3BM5A 3IUEA 5CLHA 1ES9A 2PNFA 1ONBA 1N6IA 2VTBB 1HT1E 3T4EA 1ZD2P 3S2FA 3WMFA 3FOEC 4H18A 5FOXA 4OI4A 1P0FA 3CWQA 5JXIA 2Z9CA 4WXHA 4A2QA 1V4VA 1TYZA 3IODA 4KGZA 4ND8A 1KU0A 5HIJA 5EERA 4NH0A 1K6XA 4G4IA 1CDZA 3QBDA 3PFCA 5IDWA 5AYVA 2ZBUA 2VYVA 2P3OA 3H6HA 4LYFA 4RPHA 3U4QA 2C2GA 4TLMB 3CS3A 1UMDA 4O02B 3L41A 5L3QA 2C9ZA 1ZQ9A 4JS0A 1P6UA 4Y1FA 1Y63A 4IEEA 3BC1A 2YVLA 3BXEA 1BCRB 5KPDA 2OFWA 4OK5A 2GM4A 5GONA 1UMCB 1GZHB 2XSZA 5AHKA 5YASA 2F17A 3DC2A 3K4PA 5JCXA 2ADOA 1P1HA 3TOCA 3ZWYA 3BGDA 3CF4A 2WSLA 1DCTA 1Z0JA 3FMPB 4OP3A 4PYRA 1MUUA 2B37A 2VUTA 5D7BA 1G9SA 5AW5A 5SZIA 3CCCA 1SRRA 3AJRA 4J91A 4PSCA 4PLPA 4H1WA 2Y0EA 3HUFA 3WL7A 2DKNA 1Z35A 3EC7A 2AFIB 3FHLA 3ZXUB 5TDHA 4X1OA 2C2XA 5MN5A 4JN6B 4KFSA 4TQ9A 3PUWA 5LMUB 1DAEA 3PK0A 4KR2A 4OYLA 5JSFA 3RYCA 1JQLB 3ACCA 5NLLA 2IDKA 3VZBA 5JTTA 4HFMA 3DVLA 1Y7PA 2AK2A 4INJA 4G4GA 5GMOA 2JGJA 2AG6A 4RK1A 4RULA 1W87A 1YZUA 4KR3A 1UC9A 1MQ9A 3DVRX 3I6MA 3RT9A 2GVDC 1QV6A 1GQYA 3B5EA 1YZKA 4BMZA 4HWSA 2BFFA 4Q66C 2ZSEA 2HMSA 1RQ2A 1SZPA 4LG1A 4NG4A 1X70A 5CYGA 4KHPB 4OQLA 1LCIA 5DGIA 1F0PA 2MTBA 1HG1A 1QRDA 3WGNA 2HWUA 3ZU2A 5BWBA 1KDVA 5E8JA 1B8PA 1HGXA 4HEA1 1N5KA 2WWGA 4DR6B 3U4QB 2VUIB 4IDDA 4C76A 5FT9A 1JU9A 4BMPB 1UMDB 3KYJB 1ZINA 5BV0A 3O73A 2VNKA 5GVRA 3FR7A 1DRJA 3AY0A 3GF4A 4H7HA 3BIWA 3GQVA 1IXYA 4FMDF 4RGVA 2NSYA 1VHLA 3UMFA 1OXSC 3HB0A 2WWFA 3HB4X 3LPLA 5GONB 5JS8A 1A98A 1KYYA 1ZU5A 3M3HA 4JUBA 2R6DA 3BKWA 3R6TA 1AZSC 2UXCB 5CNMA 1W52X 3OKCA 3T7IA 4KQXA 2X58A 1K5GA 3T3OA 4YHHB 3GGJA 1IXZA 1RWXA 3KJIA 4E46A 1G8GA 2F9FA 1K6JA 1N0UA 1T1SA 2AG0A 2ENWA 2ZW9A 4CV0A 2PBZA 5KUTA 5LQUA 3GRYA 1R3UA 3SD7A 5D85A 4K6KA 4R7GA 1GG9A 2HAEA 2QX6A 1AIPA 2E7ZA 4TTIA 4ZVMA 5B7PA 1PT5A 3EZXA 1H93A 3U4DA 5KQPA 1C9EA 1KC3A 4ZVOA 5E6UA 4AU1A 4MB0A 4CFSA 4PQYA 3RYCB 4PFJA 2NUAA 4KR7A 4PQEA 3EDQA 3GGSA 4JT2A 4N54A 4R2LA 1K0UA 3SZUA 1R5BA 3G9XA 5BRJA 5DTJA 4IXNA 4F46A 1K7FB 3GRRA 4ZI2A 1A76A 1UM9A 4F1KA 3UY4A 3E7DA 4JV5B 3K9LA 1LPOA 2QE7D 2HJ9A 3GC6A 4PC3A 1QJCA 5B1HA 2EW8A 3LPCA 1EJ0A 4BVAA 5I7UA 2B8EA 5ESRA 5TPZD 1KMIY 5DNUA 1Q74A 4D4KA 1OCEA 2NXEA 3GRVA 1MJGA 3DCYA 2PUJA 3HKCB 3TAHA 1XDSA 4L75A 3RTAA 2R751 5MF6A 3I39X 3DEAA 5D84A 2G7ZA 2JFBA 3KCNA 1Z3CA 2PYDA 4M89A 4AYWA 3DTNA 1RLMA 5JEEA 3M49A 4AL4A 1EM8B 1HFKA 2I76A 4IIJF 4TL8A 5C51B 4EY6A 3SBOA 1PGOA 2IUYA 4BX9A 2OXRA 2A92A 4BQEA 2QORA 3ICPA 1S9DA 4TMFA 5AW6A 4KK4A 4ZQCB 5H70A 1DWQA 1RQPA 2QRUA 3T7DA 3TM5A 2ICAA 1D6MA 1TLTA 3RJZA 1VC2A 3CXUA 3IESA 3I9NA 1A71A 1BHQ1 1UBOS 3R0IA 2QF7A 1K6MA 1CBUA 2LVBA 3WJAA 3BGVA 5B4TA 3K8OE 4DA8A 3KVOA 3MZ0A 4J75A 3I76A 4E08A 4LCJA 4XDHA 2QZJA 5F4ZA 1T3TA 1WLSA 2QGZA 3RYFA 1FFCA 5E6UB 1TZ2A 3G8YA 2OQIA 1LS1A 2I7VA 4QO8A 4LV8B 2NUAB 4F86A 1DJOA 2GF9A 3AVTA 4EJ2A 3H8SA 1U7DA 4LVOA 3GPLA 2CYCA 1II8A 1T0BA 4N82A 3RK1A 1VRCA 1AQUA 2IYNA 2R79A 2JCBA 3O94A 1QRRA 3X0DA 1QGZA 1P7CA 3Q7PA 1M8GA 4BQFA 1UM9B 4N5NA 4X91A 3LCRA 2AVNA 3N0WA 2N46A 4Q7JB 3HUUA 3JQPA 4MRAA 3SM3A 1QIJA 2A5DA 1ZNQO 1EVEA 3BXXA 4I5FA 3U1BA 4FZ5A 5A0VA 4Z3DA 2IFTA 5JJ5A 1GUAA 2QE7A 1XTTA 1VYVA 4QFMA 2A0KA 3R7SA 4XQEA 2GEJA 4JT9A 2GCEA 1KORA 1KOLA 5TPZA 1M2EA 2NTYC 3MJCA 4JVLA 2F43A 2BGTA 4LYGA 4P3KA 5JNLA 2W6JD 3QY0A 4XUCA 2EBHX 3TIXB 5I9NA 3ZHRA 1XDGA 1MENA 1DEAA 3EGEA 1TCBA 2AHOA 3GCDA 3NBMA 3NQ41 4PQGA 1AGXA 2IOFA 3V6LA 5DGTA 5G3YA 1UXJA 3LQKA 4OATA 3ZY2A 2H2FA 2GYVA 3QZUA 1T0UA 2QXUA 1J9ZA 4N5IX 2R4UA 2XTJA 3HU3A 2G5GX 2HMAA 3LPMA 4UZSA 1W581 1K7EB 3VPHA 4CM3A 2P6OA 4C06A 3B85A 3A2KA 4EG5A 2H8GA 4BX3A 4PZCA 3D43A 5FFNA 4QKQA 5BSWA 4RTRA 4D97A 4YRBA 2X8AA 3MYRA 1RLTA 4K7JA 4JI6B 4BLWA 3RYFB 1PYDA 1KZYC 3VDNB 3RC8A 1BN6A 1GNSA 4HNRA 5DSTA 1OLUA 4I5EA 3BF8A 1AXRA 3OD1A 4M22A 4XOIA 1S2NA 4Z3KA 2MR6A 1U80A 2IPMA 1U3VA 3BMNA 4PO8A 4PU0A 5FUXA 5DV9A 1ULHA 4HZIA 1NDUA 2MMGA 2PKRA 3TLXA 4DDKA 1TRKA 3K5PA 5EZQA 4BWYA 3GGPA 4R2KA 1EP9A 2DUWA 2R4TA 5AW9A 3TSYA 5JLJA 2ZYRA 2HO4A 1XLUA 4IJ6A 2B1GA 5CD1A 4QPPA 1QH9A 5I6DA 2ZIAA 5AO9A 2YASA 4JYPA 2Q4BA 3TMKA 5JYCA 1ZXBA 2B21A 4QGBA 3CO0S 1U0JA 2WD7A 4I9HA 2C4KA 4MQFB 2B1RA 1E6UA 2C07A 4CCYA 4W7SA 2OORC 2HY7A 3DEFA 2OBBA 5DN6D 1T0IA 4WZBA 4CWAA 1PUIA 2J5BA 1LDNA 4IXTA 5KYUA 4DL9A 1P0IA 4EMBA 1MZVA 1YR9A 2NZ2A 1QG4A 3BQ9A 4N40A 2YVAA 3H6GA 3HYTA 1KFBB 1ZJ4A 2FVXA 4P7BA 3TB6A 2VLIA 2J3QA 1GILA 5KYKA 4MRRA 1BHSA 1NUAA 4LDQA 3RVPA 3R74A 1UC5B 1Y48E 3U7RA 3ML1A 1JHQA 4X6UA 2W6JA 4I5IA 1VLMA 4EEXA 2VSQA 4Q4JA 4B48A 5IDXA 1DPFA 4KO2S 3ANLA 3MQ2A 3ZDZB 4O0LA 2FWIA 3AB3A 2BGRA 3LQ4A 1U6KA 2CJWA 5AJWA 4EZIA 4EYEA 4Z53A 3KS9A 2V58A 1LW6E 3ZX5A 1UDAA 3I9LA 1XKQA 2ZWMA 2H00A 4PAWA 5L3SB 4LVUA 4G1EB 3B1JA 1ECJA 1JN0A 2JD2A 5JAUA 2FX5A 4D26A 1AX9A 3FAKA 4QUKA 3WRWA 1OYOA 1NIJA 2VF4X 2YWDA 4BZWA 5AKYA 2ZI4A 3N5KA 4B5KA 2VNJA 3OZSA 2PRIA 4AJKA 4NL4H 4OB8A 5AESA 4GG1A 4C05A 1OLUB 3SCZA 4BMSA 4RYDA 1O6FA 3R7NA 1VA4A 1X3SA 3ZWCA 3A1TA 1KE2A 2G1KA 5B1IA 1BVRA 2OSBA 4EG0A 5FPHA 5FBVB 1RCUA 4I3GA 3IEVA 4B35A 2FPLA 3FTDA 1E92A 3R7WB 5CLIA 3CH4B 1USUA 2ZIWB 4HNVA 3L6BA 1TMYA 2F59A 3GFFA 4C5AA 5I7FA 5C2JB 5CIYA 4RCYA 3C97A 5AXCA 1D1QA 1H69A 1RLUA 2HT6A 5CHYA 5LQRA 1NQTA 3JQFA 3K0CC 1SG6A 2WD7B 4BJHB 1QPZA 3NXKA 5TIIA 2Q4OA 4FVTA 2G28A 4GBGA 3TPFA 1N8TA 4MWBA 1KSHA 2F2TA 3V8BA 4DSOA 4QM7A 3NBXX 1LPNA 2FN8A 2QMHA 3R4CA 4AO8A 3OIVA 5DN6A 2QTNA 5KYUB 1TCCA 3ETJA 4ZRMA 2F3QA 1V4BA 1DEXA 1EVKA 1M6VA 2C2BA 1I24A 4HDSA 4NDAA 4PSDA 4B4OA 5IH7A 3I58A 2V4UA 3UJ3X 2Y8EA 3M5DA 2W8ZA 1FSFA 1KEEA 3JZDA 3PF9A 3ADCA 2RARA 5LDDC 3A1VA 1SD2A 2IUFA 2J8ZA 2V7GA 1U3GA 3Q5DA 1QCZA 2EJUA 4DMGA 1FEZA 1FFHA 4LTMA 2XNCA 2B0CA 5AT1A 1WETA 1J0AA 2DMRA 1NVVR 2O6LA 5DDIP 2CLDX 2JLXA 1JR2A 4UATA 2IX3A 2Q99A 1UWKA 3LPAA 5TT1A 4QJ4A 4PSAA 2IS1A 1I6MA 3TGPA 1P9RA 1ADYA 2NZ8A 1VYTA 3TKYA 3DDNA 3PFKA 2IHZA 3MXTA 8GPBA 2R1ZA 3H05A 3N8KA 4L15A 2P4QA 4LXYA 2XUQA 1RXUA 4OGGA 4BCCA 4YASA 2ID8A 3K31A 3HKDA 3E9CA 1L7BA 1AQ6A 4LY6A 4M7OA 4QOGA 5BO5A 2P77A 4EK9A 1KVRA 2A0WA 3ZE1B 1BS9A 1UQTA 2BZ1A 5H81A 3EX7C 1EUDA 2RHCA 4ZO4A 3WLNA 4LF9B 4E51A 4BO6A 3N59A 4RY8A 4DMHA 4PW0A 3W4KA 1FIUA 4KYTA 2Q4DA 1F8FA 3P2JA 4MYSA 3W0LB 3C3XA 4HH4A 2DHEA 2Q3DA 5CH5A 5EGSA 3OO1A 4BB0A 4BNZA 1V5GA 2KYRA 4IHJF 3MCTA 4IL5A 3PS9A 5KOIA 1SXJE 4TKZA 3TMYA 3E2MA 5KTYA 2A86A 2PXCA 1HDGO 1BJKA 1P7ZA 3C3JA 3NHJA 3M3PA 4FXPA 1E9VA 3O47A 1K4KA 1P2BA 3PTAA 2OZEA 3CPHA 3KHUA 2O7NA 4IIEA 3C4QA 1QYWA 1M6VB 4HDSB 1RYMA 2IYWA 4WOKA 1I51A 2XUKA 2BF4A 1NBMD 2FG5A 4L74A 1YDEA 2CD7A 3L4SO 3V1NA 3NDPA 5BP7A 3R5TA 4NSNA 5BWOA 4IDPA 2HKIA 4QYMA 1E3JA 2OORA 3L84A 3DEYX 1KVSA 2MWMA 4Q05A 1JA1A 3UF0A 1FJGB 2PKWA 3OTIA 2CV2A 1G8YA 1TAHA 1LZLA 3DKRA 1FDRA 3FZGA 4O8ZA 5AXBA 3WGMA 2VFAA 2WUFA 3L1UA 1VL0A 2C5AA 2ZRPA 1DADA 3RYIA 1GNPA 3WHIA 1V1MA 5IJ0B 5ED4A 4Z4EA 3V5NA 3O3NB 4KLZA 4TWZA 2ETVA 2O14A 3NAQA 5CVDA 5JT1A 1L5RA 3UAWA 3VFDA 1YZLA 3HKDB 3PVZA 4MIKA 1CP2A 1OWNA 4FT2A 3MC1A 1G4HA 1IZ7A 3U49A 2QDKA 4YB8A 5EPEA 1DRKA 2PGNA 2Y0PA 4PAGA 2NMVA 1MU0A 2XZTA 4RHTA 5LR6A 5LVAA 3AP1A 4DV3B 3PZBA 3OIDA 1X1AA 2GR9A 3PJRA 4F2WA 1RIFA 5FAXA 4ZALA 2GDJA 4GMGA 5U4XA 1JSCA 1JKMA 3TTXA 3X2SA 4RF2A 2FW0A 2O1EA 4F5ZA 1LI4A 1ZOLA 4GRAA 2FETA 1QP7A 1EXDA 2ANCA 3O6VA 3KTAB 4MUJA 1AF4A 4KYIB 4ZGWA 2QT0A 2WIAA 4KXYA 4QJ5A 1ZVJA 4MVJM 3SQXA 2EFGA 5IJ9A 5JCPA 2YJNA 3AHDA 3A31A 2BUBA 4ESOA 4Q4AA 2V59A 4C6RA 4FDLA 1UAAA 1XDBA 1YXMA 1BS1A 2CMDA 1Y6ZA 2GXUA 3T8YA 4Q18A 4QLOA 3N8GA 1C0KA 1GNLA 3F5DA 1Z0ZA 3LH5A 1HL3A 1IBRA 1KEKA 1U3FA 2Z56A 1XRLA 4IUYA 1NBMA 1U0SY 3HB7A 4FCTA 3K0CA 4RYLA 2O54A 3BBPA 1FYWA 4F4DA 2Q3HA 4MIOA 3B6IA 1GLVA 4ZICA 3ZI0A 1A2QA 3DMYA 1G8FA 1F20A 1GPYA 4LSWA 1NE2A 1SHJA 2IE0A 3NV7A 1A9OA 1SC6A 5AI4A 3RYIB 4EYQA 1XMQB 3U3JA 4BXOB 5FWYB 1V1MB 3IP8A 3VNSA 1WG8A 3TSZA 4MCIA 4D80A 4RA9A 2P9JA 1MX9A 3QW2A 4NMHA 1OGJA 8AT1A 4YECA 1YTLA 1DBWA 4XIFA 5AMXA 3V6MA 3LRTA 4JMLA 5ALDA 4J2OA 4A8PA 4CF5A 3IVRA 3WI7A 2UXDB 2WSBA 1E3IA 1K27A 2GKOA 3IR6A 2CSXA 3ST7A 3LYHA 4OI1A 5J4LA 4WDRA 2OHVA 3EARA 3AM4A 4XX0B 3K09C 5FO0A 4EO9A 3H9CA 4HQFA 4TN5A 4HC4A 2VTKA 1AQYA 1Y98A 2GPYA 3G6KA 2IW3A 3CRNA 3QVSA 4FP9A 3IUBA 4UHHA 2Q3CA 3UMRA 3ZTYA 2PUVA 4C43A 4LX8A 3HLKA 5ARBA 2CLCX 2QL6A 3BZWA 2G5TA 2NO6A 3W9SA 3ZNNA 3RS9A 2AKEA 1GTJ1 4MMXB 5IJ9B 2VQ3A 1LPBB 2B4KA 4JKYA 2OO3A 4RGQA 5E1MA 2R1TA 3V8QA 3ZE2B 4D81A 1MT3A 1TAGA 1GKIA 4MW6A 4L5JA 1E5VA 4QREA 2XNKA 1B41A 1E1YA 2WYUA 5JPCA 4GNKA 3U3OA 2YBEA 2OHHA 4ZN6A 4YJDA 2XMZA 2Z30A 3BCHA 4E94A 1BVYF 3KEQA 1U5AA 4FWTA 1V41E 1SUEA 2B36A 4NARA 1L5VA 3CU5A 2R6AA 3LL4A 4XDGA 4Y98A 4KFCA 5KOJA 3G0IA 2WRZA 3R5FA 2BT4A 3FMIA 1PR2A 3FVRA 2FX2A 2I2DA 1Q3HA 4FFWA 4G8CA 4YUZA 2GHIA 4ZQHA 4US1R 2YVKA 1NY5A 5BUCA 4K86A 1Y8AA 4RA9B 4RV5A 4F97A 1K8XB 3HN7A 4QDJA 2WA1A 1PDWA 1ULZA 2ZQZA 1YR3A 1G8AA 1NI4A 3FPCA 1BSVA 3M1YA 3TLKA 3GVIA 1KR5A 3D9QX 3B78A 3RS2A 3SBEA 1QC5A 2NU8A 1WDTA 3K2BA 4L1KA 4DLKA 4BATA 3QPVA 3EIUA 4RC9A 4YXWD 1Q1ZA 4D7AA 2MSNA 5AK0A 1YB2A 3BWVA 4HMQA 4B84A 3Q0TA 1W36C 1K3FA 4EL5A 1AURA 1EVYA 1ZNWA 2IXTA 5I5EA 2AMJA 1EJ2A 2HO5A 2IZ5A 5FA8A 2R87A 1RYZA 2VPIA 3INRA 2HRQA 3S8MA 4UVIA 2WTBA 3MAAC 4M1EA 4NZNA 3MMNA 1SZCA 3ICOA 2R1TB 3KZ1E 2AQHA 2W48A 4PS1A 2PX2A 2ZRMA 5GP1A 5LM3A 2G06A 2I1QA 2W83A 2BGWA 2W9XA 1IY2A 4IDEA 1E0AA 3VPCA 3VTZA 1MT0A 4EF5A 4LDZA 4JJ8A 1OVGA 1XYYA 2I29A 2Y99A 3ANMA 4NKRA 3REGA 4ND4A 1L4NA 1J42A 1THMA 2GD0A 1CJKC 2I62A 2QMZA 3LWDA 1W0CA 1EA5A 5H16A 5I9BA 3LDUA 3L7KA 1YS4A 4P81A 1JDSA 2A35A 4EY3A 1GFSA 4J0GA 1RJDA 3GUUA 1DT5A 4GOOD 4ZXFA 3S4YA 1U11A 6AT1A 5KOJB 2VHYA 1Z0KA 3IXQA 1EVJA 1T5OA 1QHFA 1PVDA 3K7EA 1A9SA 3NEJA 4C4PA 1TYCA 3CJTA 1IXRC 3GBSA 3QKWA 3RO7A 1GSOA 3L6CA 4OHYA 3I01A 3LG2A 1TPYA 2CDBA 1K1EA 2IT1A 1V3TA 3TRJA 4YYEA 3ZWBA 3S2IA 4NNPA 4AXBA 1DC5A 1PJLA 4IXDA 3P2OA 4C0JA 3A9VA 3MNFA 2LWIA 1U0FA 2WD8A 3VX3A 1J23A 1QC5B 2NU8B 1YC2A 2HB6A 5FA6A 1XU9A 1PBNA 2DLDA 1EP1B 3EQ2A 3N05A 5FR2A 4YXWA 2DULA 3DG9A 2VQEB 1JL3A 2CNBA 3HZHA 1S5PA 4Y2QA 1A2OA 4G1CA 1TQ4A 4KFTA 4AUEA 4YYZA 2V3CC 1YDGA 1P4GA 4DYHA 4MI1A 3GA0A 3W06A 5CM2Z 3OZUA 5LWQA 1LS6A 1ZU4A 3I04A 2NV0A 1C2TA 3QPUA 4LZLA 4REOA 4ZC1A 2Q1TA 2DH6A 4WJZA 2CUTA 1CZUA 1FU4A 1EGAA 4KE8A 1WXWA 4RUKA 3KWFA 5SZJA 3RKUA 2DWOA 4AN4A 5I7EA 3FTEA 2BONA 4L8WB 3KLBA 2ZTVA 1FSGA 1KTIA 4FOSA 3D31A 4OXRA 2PZEA 4EHHA 1T8TA 4K6MA 4GLLA 5H68A 1ND6A 3PXEA 5C8DA 4GZLA 3IPYA 4Q1DA 2KPOA 1D7AA 3QIAA 3JZFA 3R3SA 2FXVA 1ZSVA 1ZSNA 4JLNA 1QU3A 4MVWA 2V5VA 3V55A 4ZVTA 3K1TA 5LL6P 2OHIA 4V03A 4GWKA 1YR7A 2AOXA 1KHTA 1YCGA 4FKMA 3V3TA 5BYAA 1L7VC 1E9RA 5HTOA 4IO0A 3WHKA 1ZIPA 3KJHA 2JKYA 3OQ1A 2ZDHA 1UJ5A 1O5TA 3D3JA 2WWTA 2NAFA 3EMBA 1PKEA 4XSHA 1XPRA 1H8ED 2JIMA 1KZ7B 3NCHA 1OFUX 3TEMA 5AJHA 2XVAA 3J80A 4FW8A 1XAIA 3RVBA 4YRIA 3KV1A 4EH1A 1NMQA 3CUSA 1UBCA 5IN4A 1VB5A 1ZDMA 1HNNA 1JU4A 5LYJA 1PZFA 3IKMB 4NBKA 3AOEA 3KPWA 2G80A 4RJLA 2B7CA 3FI9A 4RD0A 4RA6A 3ERCA 3BB4A 2QLTA 4MKGA 1XQ1A 3E2IA 4M36A 5JMOA 1D5CA 2DCUA 3FGZA 1PZNA 5C52B 2OLJA 5A6SB 2PUGA 1E99A 1ML3A 1TYDE 4OJKA 2QE6A 1F0KA 2AC7A 2YC4C 3C16C 1OYYA 2FW6A 4NK4A 1JIVA 4UBJA 4X6LA 3UFXA 4PXAA 3MCWA 3PUKA 2V98A 1E2IA 1P60A 4LJ8A 6LDHA 5JYEA 3HJHA 4OHCA 4GKBA 4QXRA 2XHEA 2IQ5A 1IRIA 3S2UA 2FW1A 3E6AA 1NN3A 1H42A 2HTEA 3RIEA 1P80A 2PS9A 3NH9A 1RCTE 1NLMA 2YOFA 4GYJA 1O87A 3CH6A 4JVMA 4G07A 5F64A 2WPNA 1QDUA 2OGZA 4WK4B 5AVQA 2FI1A 4JY7A 3LIIA 2VBGA 5DHSA 2UZ3A 4GZ6A 2ZU6A 3EUFA 4X1YA 5IZCA 2I54A 1GP2A 4RGYA 5KOHA 3L93A 1USVA 5GM1A 5C9ZA 1AJEA 3RTGA 1K6EA 5B4VA 1IM5A 3H2BA 3VOAA 5DGXA 1K7XB 3EAGA 4FIZA 4ZVSA 2WDZA 5GONF 1UDBA 1Z34A 3U9SA 1UPTA 4FBLA 3ZLTA 1Z8NA 3DMGA 2GA9A 4BN5A 3SFTA 2DPGA 4TUYA 4MKRA 1EZZA 4HVCA 1S2DA 3LDFA 2EKBA 2J0UB 4S1VA 4JR1A 1RAGA 1GKKA 2HD4A 3K1YA 1H8EA 3NZEA 4JSYA 4MA5A 2MOKA 1Z0UA 1MC4A 2NTEA 2LGJA 5EIWA 3W5IA 4KI7A 3V7UA 5C5EA 1ZK1A 2AGVA 5A03A 1KI9A 1OB5A 1X0XA 3WDLA 2O5EA 3IAS1 3OZIA 5KWJA 3I6ZA 1L7QA 4NFLA 4QT4A 5ITZB 2D1SA 4R31A 3VM6A 3W5HA 1E1LA 1Q5PA 1Y5IA 1SUSA 2ZDQA 1V8FA 4BP8A 2K5UA 4E09A 4NEHB 3WMXA 1F5NA 3ASUA 3LXRA 3W77A 1JDBC 3EAQA 1H0SA 3HDVA 3QMPA 4LRQA 1ZD9A 2IWHA 1RBQA 3L92A 1S2MA 1F14A 1VP9A 3UFXB 4UD2A 2FK8A 1JG6A 1OBFO 2D5BA 5REQB 3U3MA 2I91A 1SOVA 4OYHA 1JG3A 1A7UA 3DNPA 4MUIA 3NO4A 3IMKA 1XTZA 3ELDA 5DNCA 3G6WA 4BNFA 3NTVA 3OCWA 4NJMB 3BILA 3H8JA 1SQ5A 3L05A 5KYGA 3TEJA 4GR9A 3W5VA 1TM3E 5EHXA 7MHTA 2DU8A 1IBMB 1RM4A 1NURA 1H4SA 3RNOA 3LCCA 2JBAA 1JDPA 2GPTA 3C5CA 2G72A 3C8UA 3Q0IA 4MW1A 1RQLA 4PZPA 4YQYA 3EF1A 2HJRA 3RT7A 2R66A 4L76A 3KOWA 2LKCA 3UGJA 2B4TO 3EDRA 4E5YA 1X8KA 1VL2A 1QRAA 4IH4A 1V71A 4TMYA 3KLOA 3EZ7A 3TXAA 2VK8A 5AJYA 4KDEA 1M54A 5FBWB 3ZTWA 5CFMA 4ILEA 5D87A 1RDFA 3RS7A 3L7IA 1QGED 3H2HA 3Q8WA 4TUYB 2X8LA 1TYAE 4AW9A 3F4KA 2B4RO 4ZVQA 2VG8A 4CUZA 4NPCA 4DC9A 1YB7A 3C45A 1CJTC 2RC5A 3C8HA 2VHEA 1I10A 1ZX1A 4YMIA 2Q4TA 1O6BA 1XXHB 2P30A 3U7EB 1U90A 1CU1A 2JGIA 1M34E 3CJRA 1NVFA 2D74A 3PC3A 2N1BA 3PD7A 3RSCA 1N8KA 1SR8A 4KSBA 3SNKA 5T4HA 5GZ6A 2FFQA 1UWCA 3D8TA 2PGLA 4D8XA 3B1XA 3L0SA 4FEGA 1GT6A 1ZA1A 3EIEA 4PFQA 1CV2A 3U6BA 2PO7A 4FGUA 3LWBA 5BPHA 3NGMA 3U13A 5K0SA 2QTRA 3X1JA 3T1QA 4HVAA 4MPDA 5J2UB 1NA5A 4EY8A 1BC5A 1OFHA 3M33A 2I2FA 2Q07A 3R23A 1S3IA 1GPLA 5COAA 1C3LA 1FL9A 1YRBA 2Z95A 3DZCA 4OQ4A 3TMAA 1U3CA 3RRFA 1QMPA 3CNOA 4KQHA 4ERNA 1OTXA 3QMMA 4WX2B 1LU9A 1IJFA 4GX5A 3QVUA 4KUGA 2JBAB 2JZNA 1YU6A 1PJCA 5C80A 4JSTA 1VBNA 4BMCA 4J0HA 4BDSA 1P8JA 3S2SA 4CF7A 3F78A 4I4NA 4RWEA 4D9GA 4HH0A 2ZRBA 4ZFNA 1NUQA 3VISA 2R97A 2IUTA 5H02A 1UZMA 2QW1A 4JU8A 4YK7A 5C7IO 1CW2B 4PX2A 2GTHA 3ANSA 3AHGA 3SR4A 1I1NA 1TK9A 2RD2A 3IL2A 3B48A 4M6WA 3EIOA 1A7JA 2EAUA 1ZNZA 4M0LA 5B1DA 1QQ6A 4G63A 4F3YA 4QBFA 3A6KA 4YCNA 1S8OA 2R7NA 2ZGVA 2DT5A 3AYZB 1DUIA 3WA7A 4FOPA 2B94A 2PUHA 4N5DA 1XQ6A 5FX2A 3C3AA 1L4FA 2FWPA 1KS9A 3K2EA 2VHWA 1IHYA 2FU5C 1K75A 2VHTA 2X2EA 3AINA 5HFNA 5BSMA 4HX2A 4PLFA 2HGZA 2OWDA 4ZT5A 1QDLB 2IHBA 1JBQA 1PJZA 1X87A 2EJTA 4F84A 2VJDA 4RSGA 2YUIA 4C3UA 1GFIA 4HRXA 4TYWA 5KNDH 2C5LA 1SKQA 4G5QA 2CFTA 2QLJA 3VGJA 3ZGLA 2VDRB 4U02A 4KPFC 4O63O 1QHNA 3GPBA 5CG2A 4G0QA 1TUBA 5AR1A 4TWBA 1RI3A 1F7UA 2BOVA 2FN7A 3OBIA 1P0PA 3JQDA 5G53C 1K8ZB 2A5YB 4EB8A 2XJ4A 4QDOA 2E1PA 2B4AA 4KLRA 2V45A 3AW8A 5DM70 3V7NA 1SXJD 1R50A 4WNYA 1SUFA 1VL1A 1NBAA 2XRZA 1SUAA 2IH5A 4HQKA 3PICA 2YV2A 5JPIA 4F7DA 2JVKA 1VL8A 3T94A 2P40A 1OASA 3I52A 3N75A 1E2UA 3HE3A 4HX5A 4A92A 3QYJA 1HY3A 3NJ4A 1NU8A 2AMVA 2PZ8A 3DCJA 2I7CA 4RZHA 5F5NA 3PGMA 1JAHA 3ADDA 3FPHA 2WMOB 5D1NA 2OV4A 3QTBA 5JAQA 3V32A 1GUDA 2PRYA 1ZR2A 1YZNA 1J22A 1XP5A 4GPEA 4QYWA 4I36A 1HXHA 2C3UA 1LLCA 4UUAA 1BX1A 4G26A 4KW7A 3A04A 4ATNA 3I5YA 4XGIA 2ZVJA 1MX3A 2W4QA 4M6WB 2B1QA 4NNJA 4I6EA 5CFRA 1FPMA 3T5TA 1YAJA 2DFKB 2JBHA 1CXZA 3RRYA 3ZX4A 4CG2A 4U7DA 3T9AA 3OQMA 1Q7GA 1IK4A 3I9OA 4M54A 2XKKA 4N0DA 4V3BA 2VJQA 4JELA 3ZWNA 5DLQC 5K8VA 4DQUA 3QEBZ 1I2MA 2XUAA 3IOBA 3BWDD 1AV6A 5F98A 3RRJA 1LRKA 4BYMA 4D0LB 3VDXA 3ENVA 5JXWA 3KWMA 1UAGA 4C0KA 4RS3A 5DNWA 1S1CA 3VYRB 3VZPA 2XBUA 2CNKA 4J1NA 4UE2A 1WQ3A 3NMUF 1HF3A 2A4MA 3JYPA 3AM5A 3GJSA 5ICCA 4E5DA 1E64A 3BICA 2H7YA 3G88A 4QC2A 1YNOA 2GJKA 1ODFA 1M1ZA 3LY5A 3PJGA 4FDUA 3U40A 1GGEA 1WXEA 4H9GA 1JYSA 2ZETA 1TCAA 4HNGA 5CA0A 3IBTA 2VK2A 3ZBTA 1VJCA 2D2FA 2Y2UA 4XLTA 1SXJA 1BWPA 3I5XA 3L18A 4IAOA 2X42A 3EYAA 1YD7A 4D92A 1AKEA 2NWQA 2BDTA 3DH0A 4FYWA 4QVGA 3ZGVA 1ZM3A 3FCOA 4F85A 5I3CA 1BYIA 2BSAA 1K98A 1WS6A 4Y2VA 4LFAB 4DR4B 4YRMA 3L6DA 3NALA 4X90A 3ZVLA 1CIJA 4BO9A 1SKYE 3C3YA 3D8BA 4AKSA 4C6TA 2DR2A 3ELBA 4WUTA 1CZRA 1E79A 1C3XA 2GPSA 2V9ZA 3G1UA 3TLZA 1U3TA 3B1WA 4KXQA 3IAM6 3FNEA 2M32A 2HWWA 1YS6A 4PF1A 4OA8A 1KL7A 1KERA 2OXEA 2QT9A 2J9GA 2H4HA 1D1PA 4LAFA 1JEQA 3L4EA 2OPHA 3BRQA 2IK8A 5HCUA 4EPXA 1QK5A 4A8JB 2JFZA 3KV3O 3KZMA 5DT9A 2HMWA 5FOWA 1XHLA 2K7ZA 2IODA 1QTNA 4Q7LA 3CIOA 4UCFA 3U1VA 1JT2A 3D2BA 2X1LA 4NECA 4UHBA 1FFDA 2YZKA 4DANA 4D3DA 3G59A 2QUHA 3AHIA 1N6PA 4C2AA 4DG5A 2YIDA 3HDGA 3WV5A 4QATA 3ZKWA 2VNIA 2HQOA 3E4DA 1RKQA 3ZE6A 4KRXA 1XK6A 4FUTA 2DZDA 4DLAA 2XCLA 4KPYA 2IPLA 2R60A 1DC3A 4GL2A 3B38A 3ER6A 1QHHA 2LRHA 3QELA 4EA8A 4ZAGA 1XZGA 1Q3TA 1XL1A 2WOOA 2G08A 4ZTBA 1KAQA 3TQRA 2GM5A 4B6OA 4CKBA 1WW2A 3B6KA 2V7TA 4NCNA 3ZS9A 1U0HC 2Y1GA 5CA0B 2H2DA 2R6ZA 2XCRB 1WVGA 3X43A 4OI0A 5K0FA 1SXJB 5CLJA 3G2LA 2IYOA 2ZE8A 4GRIA 4IF4A 5EMJA 3RU2A 2XPCA 2Z43A 3D6UA 2ZYAA 4GI7A 4HGRA 1YQWA 2CXRA 2GF0A 3DMPA 2P2YA 2AK3A 1M2JA 4NZ9A 2M6LA 5LP6C 3F9CA 4FYHA 4KN9S 2CLEB 2PX4A 5FNZA 3FX2A 4DCNA 2HPVA 1WSAA 1S0UA 1BWSA 2DGDA 3MUFA 3O4IA 4P54A 4DGSA 1AKUA 2GESA 4C6TB 1FQWA 5BV2P 5HJEA 4FOOA 1OJLA 1RQNA 1GR1A 2Q3JA 2YQ4A 4HQLA 4V24A 3NKFA 1TFRA 4M7WA 4R1MA 4HDOB 1C0IA 4NWIA 4E30A 5EN4A 1P74A 2HLDA 4WY5A 1J7JA 5DMXA 1Q1BA 4KJZA 4GW3A 1JEQB 2MHCA 1TTQB 1ORTA 4YEDA 1HYQA 5WRFA 4RH0A 4IX9A 1T26A 2R8PA 1GZDA 2NO7A 3PXXA 5BV1A 5HOEA 2Q45A 2CN1A 4TRJA 5ICGA 3D0QA 3DFKA 2XDYA 2VC2B 5DTEA 4KP7A 3B8HA 1E6MA 4MLPA 3U5ZB 1X2BA 3ZKWB 4D4IA 2Y1WA 1CQIA 4ZRNA 2RHRA 1YO6A 2VXOA 4U9IS 3O1LA 3KQMA 1X1EA 2HQBA 3A4TA 4DCCA 6PFKA 4ENQA 1B4DA 3DVQX 3HDQA 3T9BA 4NPHA 1XROA 3AH8A 3I9MA 1QHHB 1VA5A 3KU1A 3P0FA 2H85A 4IJ5A 4HGYA 1OBHA 1TF2A 3ITDA 2UUBB 3IP9A 1YQQA 1MFPA 2WF8A 3LUDA 1V95A 2YKGA 3GOQA 5LQMA 3LKZA 3UMSA 1JXQA 1DXYA 1GDHA 3ZH2A 1SWVA 4EQZA 3DNFA 5FTJA 2VRCD 4PNPA 1O8CA 3B13B 3L0PA 4YUAA 5DHUA 3IVGA 3W9BA 1NN0A 5G0SA 3C6QA 4C1BA 4DDTA 2WR8A 1A9XA 1RVDA 2NGRA 4GC5A 3HXLA 2A9VA 1TXGA 4HN9A 4N0PA 1Z8FA 2XUDA 2ZUUA 3B2QA 2QUKA 3K9QO 3QBJA 4JYMA 3JAMA 3DLAA 4ZGBA 4H7KA 3JAKA 4GP6A 1LSUA 4RCVA 3L0BA 4B3IA 2BFCA 2WM2A 3A9WA 1I3LA 5IAEA 1HT2E 2LIVA 2VZ8A 4IJUA 4LDNA 4TN1A 1DUVG 4LE0A 2DSTA 2AOTA 2EG9A 1N6KA 2HV8A 1G66A 2IHKA 4ZCMA 3CZAA 5B3LA 1JYFA 2Z9DA 3MWGA 2HU8A 1PEKE 1L4YA 2IVZA 2Z3WA 3CO5A 3DV0A 2ZI7A 1G8JA 3FCXA 3OWHA 3VAYA 5EJ5A 1ISJA 1JHAA 4JI5B 2VJBA 3C3PA 3NHPA 3IEXA 1KBZA 4EPRA 3RVKA 3DMDA 4L4XA 4EY7A 4E07A 1MO3A 2HF8A 1I2CA 2XR1A 4I7EA 3WB9A 4JI1B 2UZ4A 3G23A 3QFCA 4KV9A 3RJMA 5AI9A 4JLMA 1PRYA 5L7TA 2F55A 2ZDGA 5JDCC 1R0WA 2R44A 3H2SA 1IEQA 1ZJZA 5FOUA 5C4GB 4XWKA 1DJLA 1SOUA 2BF7A 3ZOZA 1VDZA 5HKOA 5DU2A 4WFJA 2PVSA 3NATA 4N6OA 1QVWA 3VGPA 3GB9A 1EMDA 4N49A 1UXIA 2ODNA 3A1DA 2RHWA 1QCYA 2HIMA 2VRCA 1A9XB 2J5XA 4HAYA 3WZ2A 2BKAA 1YR6A 1WBBA 4CDRA 2FX3A 3A1SA 1EDZA 3G2KA 1FVHA 4HRVA 3VTKA 4CM9D 4NI5A 3CVUA 1KI6A 3AXSA 1HO3A 3IPRA 3JAKB 3QV1A 1FFEA 3BTUA 2GEFA 5BPFA 4PPYA 1BWQA 2VBIA 2FEAA 2WJWA 3AR4A 1T6YA 4J7AA 1WB6A 1ZN7A 3KP1A 4IDHA 3KJXA 3W8DA 3TF5A 1HR0B 2BE9A 3FDXA 1P75A 1UXKA 1GGNA 1VMIA 2GPNA 3FZNA 4LXTA 2WY2D 2EVWX 3RGWS 1HNWB 4BVBA 5FOVA 3MUEA 4I3HA 1IATA 3C48A 5LP6A 2VPTA 1BVUA 1YZHA 2B98A 3DV0B 2OGSA 4TXMA 2X5KO 4MUXA 2FSFA 2QWXA 1R12A 4MMYB 1S4MA 4GLFA 1JEYA 3FRIA 1VDMA 1YS2X 2RCNA 2IEIA 1IXKA 2MYPA 3UTDA 3AZOA 1DC7A 3G9QA 5BNIA 5GAJA 2J6BA 2VP9A 4LJLA 4X71A 2D00A 3MB5A 3BL6A 2AN3A 2II6A 3KAQA 1SVOA 3M6MD 5EP4A 3M3DA 4NCXA 2ZJ6A 1VL6A 2ZWVA 4G4JA 3RU9A 3DO5A 4O4LA 2GZ1A 3TQHA 2R1UA 3P0RA 3MJEA 3FFXA 3K4HA 4MEJA 4Q5IA 1R18A 1VXRA 4BZQA 1YBVA 3HBNA 3KKEA 2DETA 4EYSA 2ZR0A 1KRXA 1BROA 1R0BA 1DJNA 1KK0A 3GLGB 3PR3A 2B1IA 4L2IA 1JZSA 4U7GA 1NR5A 1GN8A 3TIFA 3UV7A 4DSAA 4WKGA 3R9WA 3EFBA 3DHYA 4F06A 2BFOA 5CLQA 3W5JA 3I2KA 4ZQGA 4L5CA 1H2ZA 3AL3A 3UV3A 1XMPA 3DBLA 1VJ1A 1CB7A 1Z15A 2NSDA 1VKHA 1VCHA 3PNSA 5FBRB 2VSOA 2ZB7A 3H42B 3MFQA 1QB7A 3KE9A 4PYNA 1SVLA 2PMWB 2R6R1 2YY7A 2D5AA 3G1WA 4WADA 3FJ1A 4CM9A 3MWLA 1LX7A 3DULA 4OEHA 5ERYA 1NI5A 2HCBA 3ROKA 3KT0A 1G41A 1SQ6A 1MTOA 3AY6A 3C3BA 1IHPA 1AKWA 1DQSA 1L2TA 4RENA 4DLWA 1XNGA 3CBQA 5H3CA 1JFRA 1V5EA 1JEOA 1XO1A 1C9YA 2OYSA 2WJIA 4KEAA 2BM1A 2ZROA 5DN9A 4B47A 5LP6B 2VXBA 4RZ3A 4WXRA 5BWMA 3B7WA 1WCV1 2O3UA 4HH1A 3BEOA 5TX7A 1ENZA 2OQ2A 5FWNA 4HB4A 2X0KA 5JALA 1BKYA 4MPPA 3WYAA 1JEYB 2OMEA 2DEUA 4GXRA 1TZMA 5LZ4A 1EBBA 8ADHA 5DNVA 3H5AA 2ZI6A 1TYBE 4ZKDA 1GZ6A 4IGIA 1AGNA 4JEUA 3BD7A 4ROTA 5HOQA 4ZO7A 3BF7A 4MKZA 1EK0A 2PT5A 2J3EA 3H19A 1YB1A 2VHJA 1ILWA 1MW9X 2JEYA 3G2OA 2H7CA 3HY4A 1GJRA 2CHGA 2JKZA 4JP5A 1CE8A 1V0JA 4GLOA 1GPNA 4QEZA 4TTTS 4D43A 3SVTA 4PNZA 1DINA 2JGFA 5AUQA 1UBJS 2DQYA 2PLNA 2Z8YA 5IBRA 1FYDA 1OR8A 3SG0A 2CCJA 4YROA 1ZJYA 4LJAA 3W4IA 2J08A 2YWRA 4IDNA 3LP6A 3FOWA 2B61A 4R5MA 1N25A 4OGFA 3RAGA 2N1MA 3S6JA 4L2IB 2GSDA 3ZJ5A 2CXQA 1OBVA 3L0CA 4CODB 3LRPA 1G8PA 4PCAA 1L4BA 3HJUA 4L4ZA 1R9NA 1W5SA 1XD9A 1O9BA 2HRZA 2WZDA 2YZNA 4IXMA 4X5OA 4B9EA 2NIPA 1F4VA 3DBLB 4Y9DA 1J99A 1F6BA 2R8RA 4BOYA 5HM8A 5JDCA 4P4LA 4Y2TA 1F8GA 4IYJA 3JW8A 1T4CA 1YCFA 3NHYA 5KJFA 1DZ3A 4M1SA 1RXCA 3MHTA 3M7IA 1YE3A 5E9WA 4XIGS 3NHMA 3MOIA 8OHMA 1ZKDA 4YWHA 5IVHA 1GA6A 2DFPA 4B3TB 4HAIA 4XIYA 3ZWDA 4PLCA 1C7IA 4B8ZA 4B4DA 5KYTA 3VOTA 1N5IA 1G21E 1BYUA 3JY6A 1KDOA 5LLTA 4KFRA 4LQLA 2G4LA 2LW7A 3P0IA 3WYCA 1E9CA 1SHTX 4MPRA 3TK1A 2VRBA 1ZUWA 4AM8A 2A3RA 3BSYA 2P6NA 2YXLA 2CL7X 4GAEA 4PZYA 3DLPX 3RPEA 3TCXB 4EJSC 4B34A 2IS6A 1FDWA 2O2HA 4FGLA 4MV1A 1ECBA 1WL8A 1T0HB 1EP3B 5C31A 3DE1X 2BJVA 4I1IA 3UMYA 3W1VA 2ZRJA 1NUPA 1PR4A 1KJQA 4G1UC 5EP2A 3A6PC 1VECA 2A1IA 1QF6A 4EB0A 5ENZA 1PSDA 1U2EA 1WZIA 2VHXA 4A91A 2GFHA 2IHYA 3STVA 5KJEA 1HDXA 1DL5A 4CFYA 2WIBA 3NBKA 1ECLA 3GXBA 5KNCH 1J20A 4Q3NA 1XTPA 2J09A 4ZREA 1ZRSA 4MX8A 3CRMA 1BD4A 4OHWA 2P3LA 3BIJA 4JKIA 1YOBA 4KXLA 3MTJA 4YO7A 3KAPA 2OYCA 2ONJA 5E9JA 4XE5A 5JCJD 2Q5JA 3WIEA 1IJBA 3ED5A 1A97A 3Q11A 1XVLA 4WVLA 5AH0A 2XZLA 2R7MA 3AP3A 1P31A 4O25A 5AVKA 2F1JA 1T4BA 1FX0A 4HHEA 2E1RA 5KSPA 5KJCA 1VKJA 3HYCA 3ROFA 3VR5H 3EA5A 5KI6A 2P9CA 4GVLA 3RBZA 1T4CB 1V6SA 3QE4A 2V65A 1J2JA 3R75A 3DDZX 1VJGA 5I7AA 4YMUA 2AWOA 4QHSA 4F71A 3RIHA 1V39A 3AKCA 3WK7A 5B5SA 5H0IA 2CXOA 3FNIA 4X7RA 3O95A 5TARA 4KWCA 3RNLA 3UOAB 3UOGA 2BMFA 1AH2A 3G02A 5EHNA 1JAXA 1QQ5A 1Z4KA 1NFQA 5ALRA 4B3XA 1M9NA 1W19A 2FTKE 1TYEB 1ZUD1 3NI2A 2GN4A 3Q7RA 2OOSA 1CPYA 4M0FA 2CZQA 2WAAA 4D57A 3L77A 1Y1TA 3BSFA 3CX7A 5JS7A 5LYJF 1I33A 4XM2A 1DV1A 4X6YA 4K5QA 5C4MA 2DWCA 3CKYA 3Q88A 3OO0A 1KJIA 3GD5A 1ULUA 4MUBA 1AKRA 2PXHA 1UIRA 3CFYA 1B00A 1QHYA 3QVJA 4UNIA 4YA6A 5CHEA 4DJEC 4PCVA 5KNCD 5BSTA 1ADCA 4D1YA 4TWIA 1I30A 2F7SA 3SM9A 4MAMA 2BCEA 4QJ3A 3TLGA 2DTDA 1ZGJA 2OCBA 2RGXA 2ZI5A 2C31A 3IQDB 4PV7A 5E7JA 4KQ9A 1M34A 4AJ2A 3B70A 4UTRA 1Z5UA 1J8YF 4XVUA 1MC5A 3UAOA 4YAOA 3PKZA 4GVPA 3U3KA 2J67A 3QKSA 1I0ZA 1L9KA 3DHNA 3LGXA 2AR0A 4JDPA 4LXQA 3DE6X 4HAOA 3T5CA 1VTKA 2FZLA 4P1ZA 2HOQA 1EVIA 2OQRA 4ML3A 4NDZA 2VNSA 3TTYA 2QRNA 2WE8A 1MJGM 3KO8A 4QQNA 4Q7EA 1UBLS 3EFOA 3IX7A 1FYXA 4FTWA 4M8IA 4MOWA 3VC1A 3ZUGA 4GMXA 2IEYA 3EWSA 1KEWA 5ALUA 5CFOA 1N3YA 1ZZEA 2IL1A 3QHAA 1C3JA 3K6JA 1T3GA 5M3BA 2ADFA 5KIAA 2WBLC 4FGSA 1L4KA 1US8A 1P2FA 2FSGA 3GGOA 4RJKA 5GOTA 5BQPA 3T99A 3WK6A 3M6LA 1JPUA 3C1OA 4QRDA 3L02A 4I50A 4LNUB 1NQVA 1T6BY 3PTZA 2QU7A 5FNVB 4GPTA 4AUKA 1B0AA 3PDWA 1RXWA 1A0OA 2R6CA 3DDOA 3GP3A 4DGQA 5K6AC 4H35A 5FPPA 2P9EA 1RS0A 4PGFA 4S2EA 4PGAA 1DU4A 4TUYF 1IXSB 3I37X 2C7BA 3MS7A 2GO1A 4LSMA 4N9QA 1CIPA 1VLJA 4WOCA 4XVRA 1O96A 2FGKA 5F3DA 4PIMA 3RIYA 1KMMA 2KI5A 2V9CA 3AI3A 5BSGA 1SCKA 1JI0A 1I1QB 2Z4SA 4JLUA 3U31A 5EPUA 4UTZA 1NX6A 3VAZA 3O3OB 5G1OA 1J07A 2TMYA 4IIBA 1Y6GA 1TCVA 1T3LA 4P7JA 5PNTA 3AT1A 3O2SB 5HJ5A 1OFGA 3FFTA 5E6SB 1YQUA 1YR2A 2Z2YA 5G2OA 5KNCA 5DNDA 1H05A 4YIKA 4ZT3A 2DWQA 2Z08A 1L5GB 4QFDA 1Q0LA 3TLGB 4H77A 5KKCA 4P8RA 2FJ0A 5CP8A 3T1TA 1WD7A 1DGQA 3WLLA 1GYPA 5ABPA 2B5OA 1J09A 2PJDA 3CYFA 1XTRA 3HLTA 3QKSB 2D1TA 1AGPA 5J2UF 2QTBA 1OGYA 3HABA 4K87A 2AKAB 1FDVA 1ZGHA 4WGGA 4YRJA 4ZT6A 3MBOA 4CF6A 2Z2ZA 4Q1AA 1CR1A 1GAJA 4FFVA 1E3EA 1QUEA 3ENQA 3TVYA 5C1OA 2BFWA 4LBYA 4EUNA 3EFOB 4RK0A 1PNRA 1XEXA 3GNSA 1JQAA 4BNLA 3VNAA 1YL5A 2WFLA 3QEMB 3A9CA 4H31A 5CIWA 2FF5A 1LGYA 4JB0A 4LOIA 1RI4A 5A3SA 1Z0FA 2GAJA 3W7VA 1US8B 3GLSA 4M9CA 4IPTA 2WJPA 4JL8A 4KXXA 1M2OA 2GX6A 4O2RA 4MGKR 4I50B 3GEIA 4Q34A 1IM2A 2XGJA 2JAHA 2XHZA 4NONA 4FX2A 4DV4B 2J41A 1U9ZA 4FQ7A 1JE1A 1NZJA 3DFFA 4LYJA 4DC1A 2OVBA 3CGWA 4DY4A 2EFHB 1SD5A 3QQ5A 1SHUX 4UJ5A 3O92A 2CFCA 4BRUA 1X80A 4A26A 721PA 1MAWA 3TNJA 4EJ0A 1ETUA 4RABA 1KKMA 2BBOA 1O96B 3UAGA 1T1IA 2IWRA 3MF4A 4FT4A 4MCAA 5GZ3A 2H3EA 3AERA 5IT5A 4WBXC 4K6FA 4C6SA 1VJRA 2YWGA 3DPUA 4F93B 5F5LA 1ZK0A 5DNYB 1VG1A 2OKCA 4YDHB 2AI2A 2OLEA 2OWEA 3HCOA 4J3NA 1KMHA 4PO1A 3QX3A 4KMOA 1OI2A 2FW8A 4KGDA 3ITKA 3MWYW 1L4HA 4D42A 4HTAA 3SKXA 4LF4B 3KD2A 2IIQA 5A5FA 1V11A 4DQDA 3GJ3A 1BO6A 1E98A 3OFNA 3VX4A 4EUHA 4PAMA 4OV6B 3QFTA 4EO7A 5I8ZA 2I4MA 1T9BA 3IBFA 2WI8A 1BDMA 4FGKA 1L0BA 2AJTA 5DI3A 3CM0A 2JI6A 1ZIXA 2JW5A 2RGUA 3R5HA 2W71A 3NS7A 1FF9A 4OXKA 4RZQA 1NLYA 4GPAA 1U8CB 3KCQA 1CEXA 1VRWA 2HU2A 3O83A 3HNOA 1GO2A 4KQMA 1ZH2A 3QLJA 5KVQA 3W2GA 1L7XA 2EERA 1XEXB 4BFUA 2JH9A 2CJXA 4B3GA 2JJ2D 3TZ6A 2WFLB 3LZDA 2BH9A 1KH2A 1NOIA 3KQYA 4Q15A 5F1YA 1K7SN 4OL9A 3E7PA 2FDCA 4BX8A 4MQEA 1ESCA 1X7YA 2Z98A 4UHJA 3Q7IA 2G76A 2R65A 3PRKE 2VH5R 1QKIA 5HQ3A 2ODPA 4W9NC 1W4LA 2Y1KA 1J5EB 4OXQA 1U8YA 3LUHA 4A2PA 1LJLA 2YNMC 1KJJA 1RZVA 5KJ6A 1GCGA 3A11A 1ZAYA 1Z4OA 1KP9A 3ND8A 3EZFA 4MI3A 1GRNA 1H2AS 4AF6A 5JASA 1RAHA 2ZQYA 4TPKA 5B1SA 1MVLA 1HZJA 2ERCA 2J0VA 1U1EA 2BC9A 4O29A 3EC1A 1WVMA 3N2EA 2AOWA 3ZI4A 5CDGA 3LQQA 4Z2YA 4IVPA 1A4UA 3VU9B 4MVYA 2JANA 2PHZA 4XB2A 2C3YA 4FSDA 2C88A 4B6RA 4MAFA 3ZY4A 5HCIA 3ZWAA 1KMHB 2DPHA 1IUOA 3LCVB 1G63A 3A9RA 4L4UA 1LBSA 1V45E 4NVRA 5K6AA 3LK7A 4JFRA 1XJ5A 3CNQS 1PSWA 1V11B 4WKOA 5HILA 1SQSA 4TOIA 1H3EA 2AJCA 1FUEA 1Q16A 4GXNA 3HACA 4HATA 4HWKA 4D8VA 2EZUA 2OESA 1E2QA 2D6FA 4JK3A 1A77A 3FSGD 5DI3B 1BE6A 1P1CA 3WQRA 5AKJA 4EI7A 4ZT4A 3ZWVA 1IQ0A 3AETA 1IUKA 3EGXA 1E6LA 2YMQA 4S3MA 4EM6A 4UUPA 1YASA 3PQ4A 3IT2A 1D2NA 4WZAB 1MCZA 4LRTB 4Y67A 4E1BA 2QU8A 3JQ7A 4N9WA 2ZCJA 5A0TA 2JJ2A 1ZC3A 4MH0R 4RORA 4Y18A 3ITEA 1ZRHA 2LR0A 4GMFA 1TC2A 4S24A 2AN5A 3H5IA 4EP1A 3OAAD 3FOZA 1D07A 1HPLA 3BIOA 5HQ3B 1Q19A 1F4LA 2XRMA 3BFXA 1W0KA 4ZEOA 5FUMA 5TT0A 4X9XA 2OBNA 4TS9A 5L3VA 2HM7A 1B42A 2VJNA 5B55A 3F7NA 3VUFA 1DKLA 1EFRD 5DTMA 4QHTA 5D5QA 4EHLA 1NOKA 3KSBC 4ESEA 2ONZA 1DVRA 3FNRA 1BHO1 3N9IA 3A37A 3PC6A 1L5ZA 4XQCA 4AJIA 2FSPA 4FHDA 2PWBA 1N33B 1UWLA 4RXUA 5BV7A 2XVZA 1N3LA 3BJRA 1P62B 2VHQA 4L0QA 2ZBGA 4UZEA 3TKAA 1YQXA 2QLMA 4CTOA 1GUFA 5JSUA 5HXAA 3S81A 1FTWA 1H3FA 1HFJA 1SHKA 1VKRA 4RL6A 2I9KA 3HO1A 3R5JA 3IAHA 1MPXA 4FYKA 4YFYA 4YONB 1JUDA 2Z6AA 1X8LA 2O05A 3NRCA 3JWEA 3P5BA 4C30A 1R8JA 5K8LA 1EEHA 3VVLA 3WO1A 3FSRA 3MS2A 3KVYA 1ZM9A 3WLHA 4K81B 3PYXA 3DZHA 1J00A 4FYMA 4GMHA 1SPBS 4NFSA 1RYFA 3SS8A 5KNLA 3FFWA 2MDTA 2I4LA 3H1GA 5JHHB 1QGOA 2D7CA 3S1LA 4KVZA 2DUNA 1YQ9A 4MW9A 4R1OA 4BZZA 4F2HA 3FSGA 1DE0A 3AETB 4OYYA 1E6CA 1ZMOA 3EGXB 4F2DA 3COWA 3LF2A 3FKJA 4GLJA 5JI2E 3CWCA 2Q1UA 3HN2A 3P45A 4LRSB 3ZJUA 3OJCA 1O9GA 5CK4A 5EVJA 3ZNPA 4DUZB 1GR0A 4K9QA 5A3RA 4KXNA 5CA0F 1EVLA 4FINA 3JQ7B 5KVAA 3PTLA 3FVVA 4PYLA 5BN4B 1QPGA 2HQRA 2ZYSA 2NZYA 2QJFA 1FS4A 3ECCA 2P1ZA 3TAUA 1E9BA 3QJ5A 4ITUA 3OAAA 2Z2IA 2YN2A 5A5GA 4HF7A 1U8AA 1F48A 2GOYA 2XE6A 3OCYA 4MEBA 1GL3A 2VHZA 4KXFB 4TXNA 3TNYA 3PEEA 3U4GA 2IV2X 2PKQO 3SQLA 4P86A 1CFZA 1LX6A 3RG8A 4R68A 3L1HA 4RMIA 4MRMA 4P3PA 1EFRA 1NVVQ 3NPAA 3MA0A 3DE0X 3OTGA 4P2GA 1NPYA 3VU0A 2BHRA 2BHNA 3RAEC 1YBFA 4G67A 2OY0A 1M0SA 1OW3B 4W9NA 3WMEA 4V0SA 4P3XA 1U5BB 4RPKA 1YJCA 4P93A 1I4TD 2AR9A 3OLWA 4M0DA 4G0OA 3SQDA 2J6CA 3WYGA 3LLVA 1TLFA 4DTCA 3H9BA 5HBRA 1RMYA 3DZGA 1AGYA 4XA8A 5ECWA 1ZRNA 2OB2A 4IJWA 3ODGA 3HI6A 4K9LA 1JWBB 5CTJA 4X20A 4G4SO 2ONCA 5AVTA 5FPKA 3QWFA 5JANA 5AW4A 2IBSA 1U7HA 2NZJA 3L0IB 4LDPA 1P9NA 2Q1XA 5FP0A 3OETA 2Q2OA 1SUBA 2NLOA 3NHAA 1CVLA 3AKDA 3L8DA 3GEMA 1D1SA 3A4IA 1JGTA 3AESB 4GYWA 1NJ5A 4KIFA 4EHAA 3PDJA 2D2XA 3O31A 1DFGA 1AU9A 3G9ZA 3JYHA 1YNSA 4IH1A 2DBVO 5IBQA 3LQRA 4J16C 4I2NA 3G2NA 4JROA 2OHFA 4H4DA 3PC2A 5TY0A 5K3DA 2F1OA 2W98A 8MHTA 2QNRA 1OT3A 4LOLA 4Y2XA 2P9HA 4QOIA 1HTBA 4B40A 5L4LA 4F45A 5IT0A 1D09A 2W0MA 1OAOC 4IXWA 2ZBRA 1QGAA 2C4HA 1B15A 2GWHA 3UWPA 3ROEA 1IEWA 2ZBPA 1EXVA 4LRXA 5JC8A 1LQ2A 3H65A 3K9BA 1M2VA 2VXCA 3KHKA 1J70A 1RWPA 4NBVA 3K72B 2GQ0A 3W5UA 4DDHA 2G1PA 3HG7A 3CKLA 4FD2A 4Z0HO 5LQJA 3GRAA 2GAOA 4ZWNA 4CYMA 3FUWA 3CCBA 4UM9D 1HLGA 2GVZC 3DR5A 2P6PA 2XA9A 3L7NA 3QU9A 2H52A 4BN0A 3QNMA 4BMDA 2NSHA 4Q9IA 4B3RB 2LTAA 3Q3EA 3HA3A 1WY7A 4WE3A 3PXUA 3GZJA 3OEHD 3ILHA 3GJYA 4HGOA 3PNLA 4P0TA 1MH1A 4MJ3A 3EEQA 3WGTA 3DL0A 1IVSA 1EFVA 3STUA 3PNQA 2ONKA 2QUAA 4MGEA 4K2HA 2NVOA 5AK3A 4M38A 3SFVA 1CEQA 3QEKA 2PUAA 5KWEA 2H31A 2AT1A 5LKRA 4J7XA 2R1VA 1QTRA 3NVMB 3HBAA 4B6JA 2WUVA 4E6PA 2WNHA 3NGXA 4JZYA 2ODAA 6NULA 3WNQA 2YIJA 1BE0A 4FSXA 3G2PA 3KUKA 1T4GA 2KB0A 4M0KA 4YMGA 1MO5A 2WVGA 1Q0QA 3P4YA 4EEZA 4EVQA 2FRVA 3AFIA 4V1CI 3QE2A 5HP4A 1JMVA 3I0NA 2DHCA 2LP4Y 3DOOA 4WLOA 3IP3A 2VRNA 3NU1A 1R6DA 2OHJA 4GXQA 1RPJA 1BA3A 4WOPA 2O1XA 1N2CE 1C9NA 1OSNA 2VDUE 3C8MA 1M2VB 2IEAA 4QXPA 2O7SA 5I9IA 3ETLA 3IBSA 4FLMA 1ESNA 3QWAA 5ALGA 2ZSDA 4MTLA 2SKDA 4YGYA 5DM2A 4RPIA 3EY9A 2ZIVB 1JT9A 2QG9A 3DZDA 1Q57A 4FS3A 3TE7A 2TS1A 3KAKA 1KYXA 3FPFA 2P9FA 3N6RA 3TTTA 3L7LA 4JP3A 1VCNA 2ZBEA 1QZXA 3IEKA 2PLFA 3RVQA 4CIVA 4BLPA 4EPTA 1ZM7A 3NM6B 4WNAA 3D3NA 3BGSA 3ETHA 4MRPA 1Z6PA 4ZJZA 1W59A 3DHVA 3RDPA 2IHNA 1EE2A 2ECPA 1W4RA 4BBJA 5I48A 1RQXA 3OEHA 2GN2A 3ZBPA 3ZR4B 3K53A 5EG5A 2CT8A 2V0NA 2JAUA 1ZY2A 3NM5A 4B2IA 2XTAA 3AVWA 4YUVA 2QIPA 4CZ2A 2JRLA 1GADO 4ZYVA 4NU0A 4PN3A 1PV2A 2XBMA 1FUKA 3PQ3A 4YT4A 2B35A 1FJHA 1W94A 1XTVA 2R1VB 4BN4A 2FVYA 3G89A 5ALWA 1D7OA 1W1WA 3KQSA 4PIPA 4KITB 1W4ZA 3K9FC 1KOGA 2H1SA 1HE8B 2YRFA 4M0PA 2F1HA 2QPAA 3KZCA 1AZLA 4E2WA 3B6MA 3TNDA 4RACA 1CERA 3KJZA 3VZDA 2XGSA 4JJKA 5AI5A 4F5YA 4ZYTA 2GAAA 3SSNA 2YIVX 3BH0A 1ZFNA 2QTLA 2ACWA 1FX1A 2C8LA 3EF0A 2ZPAA 3FLMA 1SM4A 4GUDA 4OMDA 4R01A 3ZXXA 3I5AA 2JFFA 1Z7EA 3JD3A 4G85A 4IGFA 4I5DA 1NJ2A 3B53X 2PKCA 3TD2A 4MWDA 2RIRA 1X19A 2ZR9A 1C50A 2FA9A 2PSHA 1QHIA 1Y6RA 2Z4RA 4WKNA 4Z8XA 2G9NA 1CNFA 1FBTA 3GFQA 1CJBA 2HRBA 4TMTA 5THKA 3RAFC 1LUAA 1LEHA 1PHRA 2I55A 2PL3A 2WLTA 3I01M 4C0WA 3HXOA 2E5LB 4CTNA 4J16A 4ZCRA 3O2QB 4TSKA 4NR0A 5B2EA 5M29A 4UU0A 2YX1A 1O94C 2VAVA 3SSOA 3W3AD 3QJGA 2VF5X 3W5CA 2V7PA 3MIZA 1B0UA 1N8NA 5LP6F 1J0EA 4GM0A 4RY9A 1OH8A 4L5AA 2Z9BA 4WNAB 4CTJA 2D06A 3GNLA 5IYZA 2HA0A 4HWOA 4C4YA 1ZGBA 4FI3C 1TZJA 3TEFA 5E3HA 3R2JA 3ZCQA 1DKQA 2G25A 1JPVA 1R00A 3C43A 3ONEA 3FSEA 4L3VA 5F4BA 4O08A 4QODA 4AP6A 2JLRA 5I7WA 1P2TA 2HGSA 5CDYA 2JHAA 5TJHA 4R2JA 4OHZA 4YCCA 3B8EA 1JQ3A 2PS1A 2Y93A 3LMKA 2H8KA 5F1KA 4IFTA 1QS0A 4LI0A 3M70A 4DJAA 3DTVD 1UBGA 1U7WA 4ZMSA 3RC9A 2IUEA 2B25A 5IUKC 4GDFA 3AF6A 1QQBA 1N6LA 1P4AA 1FP2A 3V4RA 4G41A 1E0DA 1OA0A 2EJVA 2J45A 1OLSB 4DF3A 3ILXA 1CG6A 3TJRA 4G37A 1D4ZA 4XEHA 4NYJR 4C87A 1EGMB 2CCGA 3H75A 5D51S 1MEJA 1CQWA 3I23A 3L82B 2R5FA 3AIKA 2V3WA 3HSKA 3Q8MA 4LXXA 5LQDA 3VC2A 1EXWA 3BBLA 2TRSB 4GT1A 1NJFA 4CQNA 1T6NA 3B5IA 3DOCA 4J0CA 4JUAA 4KSCA 4XIJA 3DKPA 3DFUA 3OT5A 5CFLA 4XGNA 1WDWB 4KLNA 3WNBA 2BFBA 1OYWA 3EWAA 1E3DA 2B3DA 4L51A 1N2IA 3DBRA 1SC1A 2DBYA 3EK2A 3GFRA 4OH7A 5DLEA 5AWFC 5CFPA 4Q3DA 5LJLA 3BFJA 1WRBA 1NQXA 5A4AA 4G9EA 2OCYC 1TKCA 2AXNA 3BMOA 1X77A 2AJLI 3EEYA 2J1LA 2OTCA 3I2JA 3W3AA 4O4JA 4X93A 4D6PA 5LKAA 4CF3A 4X65B 4JI0B 1PJTA 4UM8B 1L7MA 1M2WA 2FPPA 2YCLA 4YUXA 2EKDA 5EIFA 2BAGA 2X5OA 5IYZB 5KYYA 4BFXA 3JX9A 2A9PA 5L95A 4DIBA 4DLNA 1O94D 4KR6A 3T15A 4WK0B 3IILA 4L78A 5BR8B 2DY0A 5TMPA 5CB6A 3RC1A 4GMKA 1TB4A 5I4BA 3AHCA 3MBIA 4DCUA 3P7MA 1D2RA 3HP1A 3NEPX 4G89A 5L7YA 2R00C 5BWCA 3BJIC 5JISA 1SU8A 3W9UA 4N7MA 1P5FA 4QG7A 4IDQA 2WFZA 1R88A 4Z4GA 1SBHA 2QQEA 3DTVA 3MILA 3ZY5A 3PHHA 1Y3IA 1S02A 1U9IA 2HMTA 4N6GA 3U2QA 4DV1B 2C9YA 5K0CA 5EKUA 2OZKA 1YONA 1E7QA 3G0BA 4FJ1A 3EG5A 4RK5A 4DA4A 3A3YA 5AIAA 5JHGB 5IKEA 3PXAA 4OLJA 5J5VA 1STOA 3PYLA 4G1VA 3OT1A 1RLOA 4UQPA 5GJWC 2OP0A 4YPFA 1Q11A 3Q5GA 3R3UA 4JBGA 3EVNA 1MKYA 5DIFA 1EG2A 2P90A 2ASVA 2XYRA 2IPOA 5ALKA 4ARUA 2BFBB 1LPPA 4DIKA 4DLVA 1L4GA 1R9GA 4RMHA 4TXJA 4CTMA 1FDTA 4IF6A 2AYXA 3H2YA 3HJGA 5T6MA 4IQGA 3RB8A 1Y5MA 3BMOB 4O4JB 4F6CA 1HT0A 3QK7A 1GQQA 2CFRA 2GZRA 1QAOA 3MPOA 1IOWA 1NXPA 1VHTA 4I3FA 4LCEA 4MP6A 4P7GA 4WNCA 4YHBA 4ZV7A 5TS2A 1KE1A 2FPPB 5J4YA 3LCJA 1MNAA 1FPQA 3NHRA 3TQOA 4U2DA 3NC0C 3MFYA 3V1MA 4IRUB 3CLUD 3EVFA 4P4GA 4HVTA 3ESRA 4MRNA 3X2EA 3FYSA 4B85A 1P81A 1QKKA 4YAWA 3PKJA 1LI5A 1GAEO 3H2IA 4OFBA 5TQVA 4BB6A 3R7LA 1O94A 2OHXA 2PTHA 2WIGA 5HGJA 1UMBA 2QLFA 1XWFA 4GI5A 3KR0A 1JG1A 4Y0AA 1T8UA 2X8JA 3UAYA 2IC5A 5G3ZA 2YN4A 2R85A 2GJ8A 4BTLA 4AJJA 5B57C 3DOFA 4LF5B 3L8YA 5HRCA 1A9PA 2PM8A 4K3UA 3OQOA 2XT0A 1T6XA 3VV3A 3UOWA 1GD1O 2L2QA 5H4GA 1A3CA 2EKLA 5CPFA 5DP2A 1IN8A 2WA2A 3WYBA 3NBZC 3T7EA 5LFAA 3IUMA 5TGZA 3WFIA 1U8ZA 3P2KA 1X7ZA 1KH1A 2XUZA 5HKLA 3OZDA 3GEHA 4MR7B 3TZHA 2EOAA 1WU7A 3QVWA 3WIOA 3EWIA 2GCIA 3H1AA 3LUCA 3OT1B 2HJVA 3ORRA 2J87A 1UP7A 4JJZA 2PX8A 3KT8A 1JI3A 4CG1A 2JA2A 3D6FA 3DBHA 4L6IA 1VL5A 2FLKA 2C3PA 4Q3AA 4LJYA 3GUYA 3DZKA 3PC4A 2ON6A 4DPLA 1K8QA 1OJ7A 2PNJA 1VE5A 1SG9A 4YUWA 5KX5B 1FP1D 4EA7A 4ETNA 2VR1A 4YMVA 5HWSA 3ACBA 4WFKA 4MVJP 4A1FA 2FW7A 3LT2A 3RW9A 3VZSA 4GX2A 2FFHA 5DFAA 5J63A 4LV6A 4DKJA 4BQIA 4WY8A 1RLJA 4RQUA 5BMOA 1D8TA 1O5OA 1SHZA 1VYUA 1O58A 1TL7C 2A5LA 3DEKA 1EQAA 4NMXB 2DR0A 2V7VA 3WP1B 1WXQA 2AOVA 4JUIA 3ISJA 4OA5A 3KQVA 2C04A 3WWZA 2JIDA 4OFXA 1C4WA 4FUQA 4Z7QB 2BL4A 3H6KA 1UMBB 2A58A 4Q00A 4PQFA 1Y6QA 2RAFA 2X8JB 2SICE 3KXIA 4M49A 4HY3A 3H84A 3THXB 1NC3A 2IHVA 4J90A 3UMJA 1N9GA 5F78A 3SVLA 1Y3FE 3BX1A 3GHHA 3UK1A 2OGUA 4DQVA 4KDCA 1XDWA 5JXGA 4EHIA 3HFJA 3PDIA 3WNZA 3IUNA 3H8WA 5IC4A 2R0QC 1P72A 2BR4A 2HK9A 2O59A 3KLMX 1TPZA 4H15A 1BXKA 1M2GA 4TMWA 1DRVA 2FMKA 1DG1G 1YH3A 2QJOA 5IT4A 3ZW9A 5HW0A 2BMEA 1X7ZB 2JCGA 2BMDA 1MO2A 3K3PA 3M2PA 1K2VN 4JENA 1M6WA 3CEJA 2ACEA 2J7PD 5C5DA 5K0BA 2GXAA 1AN9A 2C9BA 4KE6A 4MINA 3VVBA 4B73A 2V4MA 2VCEA 4PLZA 3EEIA 3PUHA 4MI6A 1P9WA 2R00A 4DR7B 3U4IA 1TZKA 2WIJA 3DBHB 4RDCA 3GZNA 3KE8A 1GQRA 3MMSA 4I50F 3ND5A 4RZUA 5FPQA 2F8MA 3LOQA 1UOEA 3T3NA 3IQIX 4LJ6A 4L22A 1OF1A 1G20E 2OVFA 2X76A 5T8KA 1OH6A 3TBHA 1O5IA 4ME6A 3WJ2A 4RM3A 4TVBA 3PQ5A 3QLEA 1N2JA 3TOSA 4UTPA 5A02A 4YCSA 1K9SA 2C84A 3ADPA 3QHPA 3KL2A 4H6WA 4JJFA 2CL5A 2H65A 3ZZNA 2OQVA 2JLZA 1JIIA 3KPVA 5LA6A 1ISHA 3FWNA 3ABRB 4LHZA 4CMHA 4ENVA 2BUCA 5MHTA 4Z6KA 2ZS8A 1M8KA 2GXQA 1MW8X 4MLZA 3PFFA 3CA8A 1QIKA 1NF9A 4UOQA 3LC0A 1M0EA 5AVVA 3BAFA 3EY4A 1WSDA 2PD4A 3C6MA 5JECA 3VHXA 1RC1A 1UJBA 1V1JA 4Q7QA 1ZKMA 3P4UA 2P5UA 1PWYE 1QIMA 1IN5A 3V4ZA 2GZDA 1QGUB 1KQNA 4IILA 4AKEA 1O6CA 4R41A 3T54A 2J3MA 1XMVA 3C6BA 5FUQA 3VU8A 4HSGA 3VO9A 2JASA 4QBIA 4DHEA 2I6TA 1K92A 3EXAA 3NYIA 1N9GB 2SCUA 3PHLA 3W8FA 2Y66A 3PDIB 4NESA 4X3OA 1F8YA 4LXGA 5CNIA 2C2HA 4CUJA 3QVLA 4JEMA 1U31A 1ZITA 1XFDA 2OPBA 5AHOA 1XEAA 3PUIA 4IICA 9LDBA 3THWB 1KP2A 1T9ZA 4RHXA 1MAAA 1L3CA 2GH1A 5I4CA 3BUSA 5FKJA 3B9BA 2XEXA 4QPNA 1C4KA 3A7EA 1OZFA 2EKZA 3OT4A 5C8VA 3NP7A 4ZVVA 2J7PA 4D9HA 3GRUA 3A2NA 1C4OA 1NTRA 1SCIA 4RKEA 5DXFA 2RGRA 3GZNB 5HMMA 5IUNC 3AVXA 2BDUA 2FOLA 3O21A 3I6BA 3WYEA 5I45A 4IUCS 1G5IA 2DAPA 2HUPA 4QJIA 3BYZA 1U7ZA 3I73A 1F8UA 2EIHA 1QV7A 2BFAA 3L0OA 4BFWA 3HYLA 1VKNA 3HI4A 2X13A 5KBYA 1ENPA 1CUUA 2G1UA 3LP8A 3MUOA 3GVXA 5JYBA 3OLQA 4RVGA 4V2UA 5AW3A 1ABEA 3Q85A 1L7PA 5LA6B 4D02A 2O8EA 4ZEVA 1SH7A 3QX9A 3LLSA 3I30X 2FWBA 4MDYA 4B3MB 3JZAA 2RC6A 2PIAA 3EZ9A 1OZ0A 2YCBA 2FLWA 3OZAA 4C3ZA 1ZMXA 1IEXA 1RC8A 1WMFA 1OX4B 4LYDA 1RRFA 3B7GA 1U0EA 4NHOA 4CMEC 2WJYA 1XN1A 3JALA 1V8DA 3TOXA 2OC9A 1XKLA 1RP7A 4NYMQ 4QARA 1JFLA 1PL0A 1G1AA 4AQDA 1T5IA 1ZN2A 5I01A 5KYXA 3UV6A 5IEBA 1U5CA 3RRNA 4P83A 2QG6A 1WZNA 1WR8A 4LZJA 2NOAA 1U8EA 3HKEA 3GDOA 4R9SA 3ZK7A 3OZCA 1BXGB 1T1GA 1KIFA 1YB5A 3G9TA 4Z3OA 2UUAB 1L6IA 3LECA 2HSWA 1OLOA 4CR7A 1CRZA 4D44A 4HWPA 4F92B 3ZV5A 2JZOA 3OMWA 4CM5A 1NKSA 1WZUA 2PFGA 3D59A 3F3SA 3OF2A 4Y9TA 3UN1A 1NAHA 3NIBA 3NHZA 1YJXA 5BT8A 4Y7CA 1S3FA 4C88A 2PSFA 5J3JA 2AJDA 5EUCA 4W1QA 2CBGA 4ZCTA 2E49A 2O23A 1MNQA 4ALIA 3MXOA 1O89A 1TUIA 1T34A 4ES6A 2H2HA 2WYVA 4JIMA 3ZCRA 1XZEA 5EAIA 3OCUA 4RFVA 3PIIA 1ISPA 3QNUA 4NYIQ 3ZV4A 2DX7A 1IWBB 1Y3AA 3NHKA 3QTLA 4R8RA 5BQ3A 4KDRA 3MRSA 4H6XA 1J4AA 4KZPA 4XDYA 3MSXA 4ZJYA 3DMNA 3OTOB 1M7HA 3L7OA 3TI7A 2DFDA 3TR5A 2FRXA 2VSNA 3RT1A 1GRCA 3D3WB 2F8TA 2OZLA 4U2GA 4QU5A 3SZMA 3GLIA 2O8EB 1AA6A 3IOYA 3D6VA 4TX1A 3OH8A 1XMIA 3A70A 3RUIA 5MDHA 2FZ5A 2ZM6B 4K46A 5FRDA 1TMGE 2FNAA 2WTAA 3CW9A 1RZRD 1I3NA 3QPAA 1TO2E 5F7XA 4LCBA 3AZQA 3JALB 3GJ0A 1IN4A 2EG5A 1KS2A 3RS5A 4EMUA 4TV9A 1O6GA 2QRKA 4FDVA 4PSUA 3UIEA 2QLLA 3UVEA 4DFDA 1EWRA 1OBOA 5CXUA 1S7CA 5KYXB 1OMOA 1P77A 3R1IA 5EFOA 3U39A 2R62A 4JYZA 1DOZA 4ZVPA 3HFGA 2V6JA 2PZFA 2EQ5A 4YREA 3W2HA 2AVDA 2JLUA 2EZ8A 3IHKA 1CP3A 3IAAA 2WWHA 1I2DA 1ODTC 1FE8A 2OEPA 3G7NA 1XMXA 3HKEB 3SYNA 4AJ4A 1DXOA 3IQXA 4Q7MB 1KZ9A 4BVLA 1Z26A 3PGKA 1SVUA 5JRJA 4Z9XA 3UMGA 3WBFA 1GZSA 4A8HA 1OE0A 3LAWA 1T3ZA 3U3ZA 1H2BA 1M6HA 2AHRA 3F1LA 4GYYA 2FRDC 5DISB 1RHQA 3N28A 4CIWA 3LT1A 5EWMA 5T4BA 1KBOA 3DD5A 5EHIA 2DHDA 4P0QB 3ZEIA 2XRFA 5JDIA 2JLQA 1J97A 1J21A 2P2ZA 4BRZA 3BB1A 3O8NA 1QVVA 2VDPB 2VH1A 3RVRA 2Z1NA 4U2BA 3WBKA 2HHHB 1Z4NA 2D62A 1B93A 1E7RA 4EVSA 4RTQA 1KRHA 4IDAA 5EA2A 3EZ2A 3VR4D 4DSZA 4LF7B 3F90A 3F8WA 4HGNA 4IS2A 1XSEA 4N39A 3W6UA 1QIDA 4RIHA 3RS8A 3W79A 2H08A 2WICA 4Y2HA 2OZLB 3GLIB 3SDSA 2JD0A 2YV1A 4LQ4A 2WAXA 2VUSA 2XT6A 5TQJA 2XB4A 3GU3A 5LDGA 1ATIA 4BFLA 5E95A 5IJAA 3EXG1 3VOBA 1T5BA 4GPBA 2HQ1A 2WHRA 5C0OE 4M4SA 1WXGA 3QXGA 2HU5A 1FJ2A 4GQBA 3P9PA 4OQEA 3EE6A 1T2CA 2ZRDA 4GEGA 4EFDA 4ENUA 1KIMA 1RZRA 4TV9B 2JFXA 3WNVA 4WACA 3QF4B 2O6HA 3AL0C 2V6BA 5JD6A 1S9HA 3ELWA 2EATA 4ESVA 2E4XA 1O97D 4KWIA 1PLKA 1P3Y1 4PSVA 4JOQA 4J9VA 1VE7A 4CMEA 2GARA 3G8BA 5BQFA 4BQOA 1ECGA 4EKGA 3THSA 2JB9A 3P26A 1PAUA 3FOAA 3URKA 1FNSA 2HC9A 1YULA 3ZPXA 2ATEA 4NZOA 4KRGA 4ONEA 5EWMB 3FKQA 3M5PA 1RAEA 4TLDA 1CDDA 3LC2O 1FRVA 5CLGA 3WBJA 1JHVA 1OV4A 4RQAA 3U81A 2WFAA 2VBFA 1XPOA 3ROTA 2VNHA 1N7GA 3F3MA 4JA2A 1H66A 5CPBA 3T9EA 1DBQA 4Q3LA 1WF3A 4OKIA 4OK6A 5I4IA 2BY4A 5A5VA 1V7CA 3PE6A 1X86B 3KJNA 2Q0HA 3LDAA 4Y6LA 3TG8A 5CNJA 4DVGA 3F97A 3JZMA 2ZWPA 4RE5A 1XAJA 2BGUA 3VR4A 4EVIA 4DQKA 4HUJA 4BFVA 1JHMA 2PUFA 3DDHA 1L5LA 4FEEA 3M6XA 3R5XA 2PJUA 3O8OA 4KXWA 3CKMA 3WDSA 2FXIA 4I08A 2J9RA 1MRSA 1E2NA 2BZ0A 2XTNA 3OJOA 2V03A 2R2GA 2WUWE 3QXJA 4HL6A 4R3NA 1T9GS 1IZ8A 1HK7A 3UC9A 4DEVA 2CK3D 1MRNA 4GGPA 3EF3A 5BWLA 5K5EA 1GZUA 1ZP6A 4CU2A 3O8RA 3P1JA 3F5SA 3FJYA 4AQ7A 4OXNA 1G19A 2XYQA 3GARA 1ZCAA 1T2DA 1N5OX 1YJ5A 3BXOA 3P9SA 4QNMA 4YDRA 3R3WA 2CZGA 1Y7TA 3AO0B 2HHAA 4JT4A 2QMUA 3B2EA 3MCZA 4URZR 5FF9A 2CF5A 3D4NA 1VMAA 1OWPA 2XUPA 3HGTA 3I6QA 3IO5A 3T5MA 9ATCA 5HRUA 4MUAA 1W1IA 2FJPA 5BSRA 1OH7A 1EFUA 1NQOA 3GFBA 3GNQA 1G0NA 4CM4A 3R8CA 4F56A 3B1ZA 1WY5A 3HBJA 3ND6A 4IBOA 4NJOA 4QSMA 3IAM1 4JBXA 3THOA 2JGNA 3A1WA 5JIBA 1TMKA 2XE8A 3KFVA 2ODTX 2R7AA 5MFZA 3H9UA 5CYOA 4BTVA 3PXDA 1YS1X 3D1JA 3LBNA 1VRVA 4N18A 3ZHQA 2QBYA 4COOA 2VJAA 2YW2A 5K0LA 3KR9A 5IC5A