4DBLE

Crystal structure of e159q mutant of btucdf
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
245
structure length
245
Chain Sequence
b'AAPRVITLSPANTELAFAAGITPVGVSSYSDYPPQAQKIEQVSTWQGMNLERIVALKPDLVIAWRGGNAERQVDQLASLGIKVMWVDATSIEQIANALRQLAPWSPQPDKAEQAAQSLLDQYAQLKAQYADKPKKRVFLQFGINPPFTSGKESIQNQVLEVCGGENIFKDSRVPWPQVSREQVLARSPQAIVITGGPDQIPKIKQYWGEQLKIPVIPLTSDWFERASPRIILAAQQLCNALSQVD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vitamin B12 import system permease protein BtuC
publication title Asymmetric states of vitamin B12 transporter BtuCD are not discriminated by its cognate substrate binding protein BtuF.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 68
structure length 245
sequence length 245
chains with identical sequence J
ec nomenclature
pdb deposition date 2012-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4dblE01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4dblE02
1L5HB 4NNPA 3AEQB 4WZBB 5I4KA 2ETVA 5HX7A 1K0FA 2M6LA 1H1LA 2MINA 2WHYA 3K1AA 1H1LB 4WZAA 2MINB 2PHZA 4H59A 3K1AB 3ZTTA 1KAHA 2OV3A 3EIXA 4MX8A 2YNMC 1N4DA 5M34A 3MD9A 1K75A 2AFHA 4MLZA 4H0FA 2M6KA 4DBLE 3AEUA 5GGYA 5KOJA 2AFHB 3ZKAA 2OSVA 4UTPA 5KOJB 4IRMA 2PS3A 1XVLA 5M3BA 3GI1A 4UDOA 3R5SA 2XQVA 4WZBA 1FP4A 1MIOA 4WN9A 5JPDA 4B8YA 2PRSA 1FP4B 1MIOB 4UTOA 2XUZA 1G20A 3EIWA 4FILA 4WN9B 1G20B 2Q8QA 3UJPA 1QH8A 3AESB 4MDYA 3ZK9A 3LI2A 4HN9A 1L5HA 4FNAA 1K7SN 1QH8B 1ESZA 1M34A 2OV1A 3R5TA 4HMQA 1M34B 3HH8A 2QI9F 2AFIA 1PSZA 3MWFA 4GICA 1TOAA 2AFIB 1QGUA 3TEFA 4G07A 1QGUB 4HMOA 2X4LA 2R79A 4LS3A 4WNAA 4HMPA 4N01A 2RG7A 2PS0A 2OGWA 2XY4A 4WNAB 3AERA 2YNMD 3AERB 4K3VA 4XPIA 5JJ5A 1N2ZA 3AESA 1KAEA 4G09A 4XPIB 5CX1A 5BVHA 5AFSA 2R7AA 4OXRA 5CX1B 3PSAA 4TKUA 5BVHB 4M7OA 5GGXA 4OVKA 4PAGA 4TKUB 3U7QA 2Q8PA 3ZK8A 3ZK7A 3BE6A 3U7QB 1KARA 4INOA 2XDQA 3AEKA 2XV1A 5B58T 1M1YA 2XDQB 1N2CA 3AEKB 5CR9A 4FI3F 2O1EA 1K2VN 1M1YB 4WESA 1N4AA 4ND8A 1N2CB 3MFQA 3NU1A 5BVGA 1G21A 3MWGA 4WESB 4ND8B 2XH8A 3TLKA 5BVGB 1G21B 4BBPA 2WI8A 4UDNA 3G9QA 4INPA 3AETA 3CX3A 5HDQA 3PSHA 3HXPA 5KHLB 4NNOA 3AETB 4LJSA 2PS9A 4TKVA 4WZAB 4TKVB 1PQ4A 5KOHA 3HJTA 5M2QA 3PDIA 3LHSA 1EFDN 3MINA 4FKMA 5KOHB 5JOQA 5JG7A 3PDIB 1QH1A 3MINB 3AEUB 5FLYA 3TNYA 4OXQA 4PM4A 4CL2A 1QH1B 1M1NA 4MO9A 5M29A 3BE5A 1M1NB 3AEQA
chains in the Genus database with same CATH superfamily
1U8YA 1DQPA 3GCGA 2AQ8A 5U9CA 1TIPA 3IXMA 3AEQB 4ZI5A 3WYCA 3NEJA 4B3FX 4V0QA 2VDNB 4WXYB 4ZJZA 2JDID 4DAEA 1RMQA 2OG1A 3IQIX 3JQAD 1T3SA 1GPH1 3QKRB 3MMPA 1FFDA 3P19A 4LGYA 1U99A 5TMEA 3KCNA 3LOQA 3SBXA 3M6AA 3DO5A 4UUQA 3VPCA 3PQ2A 3P9YA 3D3KA 1KU0A 4DIUA 5JXJA 4RPIA 3IE2A 1XAGA 3UAOA 2BRUC 5LM3A 4J94A 1AHHA 4WL0A 4PR3A 1IONA 1E8NA 1OR8A 3M4XA 1HFJA 1XEXA 1RHQA 3DZFA 1N6KA 2WF6A 4GD3Q 4NPCA 5FUQA 1YE8A 3FTQA 4CEHB 2ZVDA 1Y5MA 1YVEI 1YC2A 2IK8A 2Y2VA 4URZR 2GPJA 5JD5A 2Q2NA 4PGMA 3MCUA 3KYDB 2CNDA 3O8QA 4UBOA 4V02A 2QTWB 3E7FA 3S2ZA 3T4PA 3GDOA 3TVDA 2SHKA 4DMLA 3QFCA 3NBAA 4YUWA 1AKTA 2XODA 2VJQA 2QSUA 4WT7A 2EGUA 5CB4F 4HGRA 1AJEA 3ICCA 1GKUB 4DDWA 1N78A 1P44A 2GXQA 1Q7RA 1GRCA 2R6CA 5L3RA 4Q3EA 2I7TA 3HZRA 4JCOA 3VV3A 1D6JA 1IOZA 1O94D 1IG3A 3MGBA 2P65A 4FT4A 2AJBA 1B42A 2GUWA 4MTCA 2PNJA 3AVPA 3STUA 5AW2A 1V9SA 3LNCA 1XKTA 2Q1YA 3IPXA 4I9HA 3VPGA 2WJHA 1T9ZA 1TUBA 2JAPA 4JOQA 4MV6A 4PQYA 4YS6A 3ZHUA 3O95A 3HDQA 1FUKA 4WXPA 1Z2NX 5AW1A 4J1SA 4MLCA 1BFUA 3G6KA 1VJ5A 4W8OA 3EH2A 5JW6A 1UOOA 2G06A 5JH7B 2I78A 2A1TR 3D6MA 3A9UA 2C5BA 4KXUA 4RHUA 3QUSA 1UR5A 4XW2A 3ZW7A 4HY3A 3AESA 3BGWA 1UC5B 1NE7A 3FPLA 2XWBF 1M6VB 1WXGA 5F12A 4C4PA 5L3QA 1SIBE 2YMLA 1RRFA 2QRPA 3B1WA 2ZB3A 1VI6A 4QARA 3E05A 3ZWVA 3CSDA 2WYVA 4LV6A 4L0QA 1KARA 1DRKA 3LT1A 4HLQB 1ODIA 4GMHA 4JZYA 4KU4A 4X0EA 1H8EA 4OKSA 4FDUA 2WSSD 3BPSA 5DZSA 2HMVA 1UBGA 4HFRA 3PFBA 1UBSB 4KIGA 2IYFA 1N4AA 3VTKA 4CDNA 1T1IA 3NHYA 4WEOA 1E5XA 4WN3A 3RM3A 2XKKA 1SHTX 2IH4A 2EJTA 3NKLA 2EKQA 4NDNE 1V9LA 4RLQA 1ELOA 3WXBA 5WRFA 1GV1A 4JBGA 1JEQB 4A8PA 4D81A 6LDHA 1VJGA 4F9FA 2OBYA 2C2WA 2PQMA 1BMDA 2G70A 3A28A 5EQTA 2ZYHA 1BWRA 4TVBA 4PLHA 5TNXA 3PLRA 3TOZA 3MYRA 5J43A 1NVVQ 3H9BA 5LP1A 5A0VA 2I34A 1A77A 5B7PA 2YJ5A 2HSDA 3B9BA 1R0YA 4XOIA 3SQOA 1SCJA 1H93A 1T91A 1NVGA 5C32A 1E6LA 2VRWA 1KHTA 4FYKA 3TF5A 3B1XA 3RSHA 1QH1B 2QVYX 4CMCA 4HDNB 3BMNA 1E3JA 4IJUA 1X7YB 4MI1A 1R6XA 3ZHBA 2I7CA 1Z74A 1OVGA 2Z5VA 3NYRA 3ND5A 2IPLA 3O4HA 5E1MA 2I6TA 2LCIA 3U6BA 4KX3A 4W99A 1NQWA 2BGGA 1GUFA 3BEDA 1J90A 1OXXK 2KJQA 1ADYA 4PYQA 4XDHA 3CPSA 4YRTA 5LU8A 1QRDA 3K6SB 1E1QA 3E8XA 2C5HA 4C0JA 2PTGA 1DIOB 4M0FA 5IKPA 3ZJ5A 3DV0B 1TYZA 4MUNA 1DXYA 1K3UB 1KYVA 5JAPA 5ILGA 2BF4A 4H35A 4AX4A 2P27A 3DTYA 1XFAA 5FFNA 3PF8A 4EA6A 1QGDA 3L46A 3L8FA 2DP4E 1XVLA 2CW5A 4KUEA 1K9SA 1XTIA 5AWFC 5FOXA 5G3ZA 3RC2A 5EKDA 3HKBA 3ROFA 1O08A 3UJCA 3NYIA 4D9CA 4DJAA 3K9GA 2FG7C 1WMSA 5TGZA 3U2QA 3ODPA 2YR0A 4B8YA 4H2DA 3BRWA 3C3KA 2MTBA 1EDDA 1NATA 1IMJA 1X1RA 2DTDA 2ZYRA 3L05A 3BL5A 1WA5A 1Z6AA 1QZ3A 1Q6YA 2C9BA 2JI4A 2PT5A 2QE7A 3QWBA 4RH0A 1R0SA 2H1RA 3Q3GE 1OFHA 3HJRA 3RK1A 3KTOA 3DS8A 2CLOB 2AQHA 1WMAA 2NIPA 4CT4B 1WB9A 3RYHA 3CUYA 1WHSA 1VMAA 3DTVA 4HX2A 4AJ2A 5LQMA 3H5IA 2DQ4A 1W44A 3QUTA 3KU4A 4QNNA 1Z3IX 1VFNA 2OV8A 4HRXA 5HCIA 4BMCA 1A71A 3Q10A 3FWZA 4LYHA 3ZW8A 1KVUA 1V8ZA 2O3SA 3WGNA 3ZU2A 2VHEA 1JSCA 2W71A 4X64B 1P2TA 4PYLA 3MS4A 4MRSA 3ETGA 2PS0A 4C4AA 2IHYA 2A86A 1UF9A 5T8KC 3T9CA 2DBVO 2IEBA 1R0ZA 2Z2JA 2QJRA 2QVBA 3JASA 1II9A 3DEHA 2HK6A 5FHQA 1CUUA 1P39A 2L18A 2UZIR 3OICA 3V4SA 3HSSA 3QJ5A 2YJNA 1EAMA 3BSWA 3SOZA 2GK6A 3TRKA 3P2KA 3T7DA 2GTIA 4QM7A 5H9WA 3AR8A 1V1MA 5FWNA 1G1AA 3GEPA 5EZ6B 3SFTA 4OI1A 3SK0A 3WMGA 4ZI7F 4P4SB 2VZ8A 4F8EA 1U0RA 2WWRA 3FUVA 4X1KA 4KHPB 5A0TA 4OKIA 1LF5A 4RENA 2HLDD 5TMDA 4I4TF 5L51A 1XVTA 3ZR4B 2FMHA 2X7JA 3VBCA 1G59A 5FWYB 3OD1A 3T6KA 1V4BA 4G86A 1QF9A 1HUQA 1PJ8A 3IXQA 3LWZA 4K9QA 4MWOA 3G9QA 1QMPA 2WF5A 3CFYA 3PHLA 3STYA 4E5NA 4R4JA 2JB9A 2BJHA 5IK2A 1P7PA 5K0SA 4C2AA 3B6JA 2R84A 1MH9A 2ET6A 2XIQA 2NYVA 2Q1XA 1OYWA 2A1IA 3VDMA 1CYEA 2ILTA 2VPQA 3QLVC 2J0UB 3GDFA 2FPMA 3QVGB 5C53B 4PLVA 2ON6A 3DH0A 1EM8A 1EFUA 2BI8A 1E1LA 2BGMA 3KKPA 3L7YA 1W4LA 3OZTA 1DV2A 4REOA 5D86A 5BN4B 4KQJA 4CMAA 3C7TA 3SYKA 4IXNA 4ZQIA 4J3FA 3WE7A 4LJRA 4IZIA 4JP5A 3H19A 2C57A 3AU8A 2UVDA 1CR4A 2BMWA 4QBTA 5F23A 1KO1A 2GYUA 4GI2A 4MDHA 4V0RA 1NZDA 5GZ6A 5BORA 3W5DA 2V7BA 3E7XA 3R23A 2YWCA 2ZZKA 2Z9BA 2GTPA 3GEDA 4YRCA 1RJWA 1TTTA 3DDWA 1VJCA 2XA2A 3MJFA 5E95A 1D8AA 5F21A 4U7GA 4LBVA 4PRZA 3I28A 2AEEA 2P9HA 4IDAA 1QVZA 3PEYA 1W581 2HGSA 1BKSB 3CNLA 3FZYA 4G4SP 1PLJA 3CX4A 4H0FA 4PCVA 1E7MA 5A4JA 5DNCA 1P2DA 1FRFS 2QLMA 5HIJA 1SVOA 3WBFA 4QOGA 2AOTB 2B7CA 1Z16A 3HA7A 4J49A 3ZHQA 1E6EA 5DLPA 4D3DA 5DI3B 5KWEA 4R40A 1KJYA 5CVVA 4LNAA 4BVGA 2D2IA 5H81A 3A6JA 2HU2A 5PNTA 3I2JA 3A6EA 2OCPA 3OF5A 5H83A 1YR7A 4FILA 3DFKA 1IN8A 3ORYA 1JJIA 5JHHB 2HMYB 4B80A 4CKBB 1SCAA 1PUIA 3SC4A 3A9VA 5FH9A 1GHTA 4R9RA 5BRJA 1MC8A 2X8JB 1MW9X 4MQ6A 3RCBA 2Q45A 4DG8A 1ZXBA 1YZUA 4RBNA 4B87A 5AUPB 4UMDA 4YRNA 1Z39A 2CLCX 3CNOA 1P1IA 2AR7A 3S7TA 4AZ0B 1YVPA 5LU9A 4Y2GA 2YXEA 1J2TA 1HT0A 1B1AA 1NBIA 1Q11A 4JMPA 4MH0R 5JDIA 1EUYA 2ZWAA 1CC1S 2D0DA 2V4MA 4DBVO 3IKMB 2YWFA 1T25A 1H22A 1ZIDA 2CHQA 4JYBA 3HB4X 3LDUA 3R3WA 1RWNA 3KYIB 4ZJUA 1Q1EA 5FBHA 4CLHA 3V2HA 1V1JA 3PHGA 5LQKA 3OIDA 3VPAA 5A9SA 5AI5A 3EVCA 4IH4A 3AUJB 1FVFA 2H57A 4NZNA 5HKKD 4AG6A 3HKCB 3SIXA 3BAFA 3MTDA 3COYA 4HVLA 1X92A 5DP2A 3I1YA 2JGFA 2Z2ZA 4FZ3A 3LQQA 5F1OA 2Q5EA 5F33A 2RONA 5DOVA 1WR8A 2GILA 2IU4A 3AG6A 6AT1A 4JC0A 2D0OB 4OIMA 3KSUA 5FO0A 1NUPA 1U2DC 3CM0A 2JGLA 4MGKR 4E1VA 2DBYA 2QLTA 1KP3A 1P1HA 3PD1A 4FTWA 4R8LA 3SFZA 5DW0A 1ZOOA 1KSJA 3ZGZA 1F2UA 3O83A 1RBYA 1RJEA 1VG8A 2ORVA 2VG8A 5E1DA 5EE1A 3SYLA 4E5MA 4JUAA 3D5QA 4UCQA 1F4VA 1QS0A 2P69A 5CM2Z 5TXGA 4P3PA 4IO1A 2YWGA 3Q41A 4NHOA 2I29A 2UXBB 1BYUA 3P94A 5KPJA 4IDEA 2HHJA 4ON9A 3UJDA 4DWJA 3WIBA 4FDMA 1T13A 2ATXA 3QQPA 1N8KA 1N5DA 3MK31 3A1SA 3MHPA 3KE9A 2CN1A 5F4ZA 1GTSA 1N3YA 3KLMX 4UULA 3WXMA 4ZHSA 3IAHA 4OMUA 1HH4A 1MTOA 2PWPA 1C3LA 2Q0HA 2YHSA 2ZPAA 3GLHA 2Q2OA 2FMFA 3LGXA 3UFXA 4ZZIA 5K3FA 4MVWA 4UAUA 1Z0UA 2D2FA 4B83A 2ZRLA 3W2HA 2G71A 3OFNA 4TWRA 4QC2A 1R1DA 1Z8FA 2V9ZA 2XMBA 3H5VA 1FE8A 1LDEA 2AD5A 1FFSA 1Z8DA 4U7JA 4XDZA 5E9WA 2CUNA 4B4KA 4ED9A 3FGZA 3SQDA 3STVA 3ZGVA 3REQA 3FDFA 3W1VA 1E3QA 4AZ3B 3G2OA 3H9CA 5T3UA 5IZCC 3DOEA 1YS9A 1C1HA 4HXEB 2ZSKA 3D3EA 4GMDA 5CURA 2AW3A 3VR4D 1T3LA 4KE6A 3UBMA 1WQ4A 4ND3A 3X1KA 1V43A 4QX6A 1SFRA 1YQQA 3QWFA 3ABZA 2FEMA 4PFQA 5B30A 4DPLA 1S1CA 5HG0A 1AA6A 2XRMA 1UDRA 1ORWA 3WFIA 1UZNA 3LY8A 3PGVA 4WA8A 1C4OA 1TADA 1W6UA 2ZE6A 2H7YA 1I9CA 1J0AA 1DLJA 1PS9A 4TYNA 1K3FA 2V6JA 3BFJA 1PQWA 1MEEA 4RA6A 2PM8A 1IHXA 1MABA 2QTVA 2ZK7A 3AJ9A 1E2HA 2F4NA 2P41A 4R3NA 1A9PA 3PKIA 3VPBA 3QPVA 1YOVB 5GIPE 3EQ6A 2OV4A 3F3SA 4HAVA 4YP6A 2EKDA 1N9GA 1ZD3A 3OQOA 2G9NA 2GQ0A 3JQ8B 3X1JA 2ZJYA 4NCNA 4RHCA 3VV2A 1L7PA 1ZCBA 2ATEA 4O29A 4FS8A 5G0VA 4HB0A 2ZJ1A 1FTNA 4BQEA 1NRJB 3C48A 3THXA 3ZGYA 2RHBA 3OOSA 2VT7A 1EGMB 1XZEA 2FZCA 4R1QA 5KNCH 4RK6A 1NJGA 1TO1E 2YQ4A 5KS2A 4B6SA 2UV8A 5NULA 4D6XA 4KIFA 4ZK6A 3THOA 1NI5A 5AM2A 3R4VA 3DHYA 3NHRA 1F1BA 4WACA 5E4YA 5EGNA 2ZCJA 3BD8A 4W82A 3ENZA 3QY0A 1OAOC 5JMTA 4G0YA 4B31A 4FLFA 3SY8A 4I1RA 4OJQA 3LIIA 4U9IS 1XAHA 3KELA 3THSA 8LDHA 1JQ3A 1NM5C 2WJGA 4UC0A 1WU7A 3D1LA 4RZXA 4I08A 2DAPA 5HSGA 1XGKA 2VJOA 4Q4JB 2VATA 2I8CA 4YUXA 4Q4AB 3JQCA 4JBLA 1K7CA 1WZCA 5DT2A 3O1JC 3HJCA 1IWPB 1N5LA 1G7RA 1L9XA 1N8TA 1P0MA 1IY9A 1Z6ZA 2IYPA 2NO5A 3BQ9A 3IBTA 4WUTA 4C1BA 4R8VA 5EKSA 1GD1O 1NY5A 2CYBA 4J0FA 1WDKA 3HI4A 2F3QA 5CU7A 5BT9A 4AF6A 5I3CA 1QRTA 2PJUA 1XHLA 1T2EA 2OK7A 4H6PA 4DZTA 2NVBA 1R2QA 4EIWA 3WWYA 3S2EA 2JLZA 3EULA 4M8KA 1MB9A 1W0JD 5CDGA 1D7OA 3NHMA 3Q85A 5KHLB 1IUKA 3KC2A 5LQDA 1ZM3A 3LX8A 4D74A 1VQ1A 4IIFA 4TSKA 3VR3A 3GA0A 1M2OB 3N6VA 3L6CA 1RD4A 4A23A 3LLUA 3DHNA 3FVWA 5HBGA 3LHSA 5BQPA 1BJKA 1PJSA 3HBFA 4XX0B 3MTIA 2R6R1 2QRHA 3G8AA 4QU8A 4FOLA 1GCAA 3HMKA 1G3QA 1Z7EA 1Q0RA 2NSJA 1E5LA 3BDVA 3PZBA 5EZYF 4WD3A 4DWOA 2JBWA 4YUVA 1JIKA 3HFSA 3HQ4O 2ZSJA 4FINA 4IUDS 1Y1TA 3W77A 4DMFA 3LUBA 5C2JB 3WAGA 4I19A 3I5XA 3COZA 4NH0A 3IQXA 2JFOA 3C3PA 3KEQA 4MEJA 4JLMA 1TVMA 4FMDB 1KOJA 1S8FA 2ZTMA 3A9SA 4XB6B 4B6EA 1W5BA 2QUZA 3THYA 1ENPA 1VHWA 4J4BA 2L0XA 1YZGA 2C58A 1Y3AA 2EF1A 2PBLA 3WSVA 4MDEA 4DLPA 1CY0A 4KLNA 4JVMA 2FJUA 2AE2A 4GLOA 2XOXA 4G81A 3BH0A 3GEEA 3R6TA 3B5JA 5L7YA 3LMKA 5TF0A 4DXAA 2IBTA 1U0TA 4I4CA 2QMYA 2O8EB 2YZMA 3PX2A 5GJBA 1J33A 2VKQA 4AIRA 4E5PA 4J9UE 2RGDA 3R7AA 3F7OA 5FOQA 1ZEMA 1S3GA 3E2IA 4G36A 2ZIFA 4LOIA 4ZGWA 1Y5IA 3B2NA 3VH1A 1Y4DE 4NVRA 2C8JA 2PGNA 1IE3A 3HEBA 4GX0A 4HO1X 4LE2A 2CYCA 4AN4A 4Z0PA 4QE3A 3L8CA 5BR4A 3HM9A 3P96A 3TCXB 4ZPJA 4G4GA 3NCHA 3OJCA 3V33A 4FNAA 1U2QA 2QAGA 3M1IA 1CUEA 2PT6A 1A7KA 3B6ZA 2YOGA 4E22A 3EF3A 3I2YX 2HBZA 4KWIA 4O33A 5F2OA 4CKEA 4X7BA 4RIFA 4U6NA 2YYAA 1RQRA 1ZN7A 1E2IA 4LXIA 5CH5A 4DIEA 3TGLA 2YJ4A 4CQMB 2CVPA 1TOAA 1BCRA 4P5DA 1JL3A 2CDCA 2A92A 3GH3A 5G4KB 3VR5A 3ZN2A 4B47A 1ISSA 1U3GA 2OHIA 3IVGA 3L7MA 1RYMA 1S3FA 2CY0A 3ESZA 3PK0A 3V8NA 4L8GA 2V0CA 2WYIA 3VPFA 3CG4A 3MRSA 3EOAI 4JLPA 4X8LA 1BX1A 2CEKA 2WYUA 1PP4A 2O7QA 3IUEA 4HAWA 4KO8A 5A4IS 1AO0A 3JR7A 4U5QA 1W36C 4OHOA 1WXEA 2HK9A 1UKAA 2I2BA 3WYEA 4O5AA 5J59A 1OV4A 1ZRMA 2CMDA 2QG6A 2IIQA 2JPDA 2IDJA 3KAPA 4PSKA 4FE4A 3RR2A 4C29A 4MV3A 3GFPA 2FN7A 2EFJA 3FPKA 3EEFA 1N77A 2PJZA 4CTNA 1BVHA 4ARCA 1A7UA 5JWOA 1W48A 3UUGA 1GPYA 1VRCA 1SKBA 3JQEA 4RF2A 3O8OA 3K8YA 3F78A 1MQ9A 3GXOA 4PC1A 5FT9A 4YCNA 1CUSA 4REQA 1GGVA 4N49A 5DGXA 5FF9A 4G23A 1REQA 2VYVD 5FL7D 1ZW1A 2WU1A 3LM8A 5YASA 3EAQA 3H9EO 1YONA 3DR5A 4X84A 3FRJA 1Z5VA 3R5KA 5BSUA 1RWBA 2WE8A 3ZVRA 4G2TA 2ICAA 3U61B 2HZBA 3ED5A 1OBOA 2C9DA 3OZ7A 5I9NA 1ECFA 1XALA 5KYUA 3H1TA 3IV7A 4ZCIA 5J5AA 4R31A 1O5TA 2HXSA 3FN4A 4IOKA 3TSCA 1P18A 3B6IA 3UMCA 3WK8A 4BGEA 1GSOA 5JTTA 2VVTA 1I6KA 3HNPA 3CUSA 5HJEA 4EJSB 2JLBA 1SCUA 2HQ1A 5AKIA 2VHWA 5G0UA 3WGZA 1WETA 1IY1A 1RS0A 4DLVA 5KSPA 4CMKA 1CETA 4LXHA 3KWJA 2WSYB 2CLIB 1UMBB 1TZBA 2GX6A 3MMSA 3L0YA 4YRMA 3EPJA 3OCZA 3GCXA 4M46A 4HXYA 3W3AD 3NLLA 4E03A 2VL7A 3W6OA 3LX6A 2O1WA 3DMDA 4K86A 2CJFA 5GZ1A 2SECE 2RD2A 1NPDA 1FEZA 4DBZA 4W5NA 3EAFA 4HLCA 3WG9A 3N7UA 4AQYB 3HR7A 1X1TA 2W4MA 4E88A 2UZAA 4DNXA 5KSOA 2Q3MA 5I7UA 4PAWA 4HB4A 1J8MF 4QAJA 1P2UA 3QBVA 1FZTA 4EVSA 1L3CA 5ESWA 4X94A 1LBEA 1XRLA 1Z8HA 3DQZA 5BSFA 1C30B 2QUIA 2EWWA 2WFAA 4G84A 1Z36A 2QTTA 4AJPA 4B75A 3W4IA 1UK9A 7REQB 3ZJTA 3EVGA 4W8GA 4RA9A 4O4LA 3RHFA 3PC6A 3E27A 1MPXA 2MYTA 1G20B 1ZQ9A 1MENA 4EVRA 4Q1EA 1O96A 3PFNA 5F52A 4CDGA 5JYDA 2Y1KA 2V5AA 3HRHA 4D9HA 1XJWA 2WB2A 2BF7A 3OZDA 1W0KA 2VQDA 4BKQA 1EWKA 3T06B 4QGAA 4H7DA 5L7TA 2WTUA 2VYNA 3TCNA 1AS0A 3BWBA 3HEAA 3OQPA 2C03A 2K7FA 2AJTA 1UBOS 4HYQA 3LQRA 4FGZA 3IXLA 3PUVA 1EGHA 2VN8A 1MIHA 1JLHA 1BXRB 4EEZA 2GJ4A 3D1VA 2AR9A 2G5TA 4HAYA 5A7HA 2WUWE 3CZ4A 3WYFA 2ZM6B 1Z75A 4ME6A 3QPAA 4LJ4A 2G4VA 4YT8A 1R0KA 1W46A 2P75A 2RAUA 3F5FA 3LP6A 1UK6A 1U2SA 3DWFA 1XNHA 3OE4A 4GC5A 1JUDA 4MQUA 5IT4A 1N5RA 4B7AA 4B4DA 3ECAA 4Y0NA 4ZKEA 3R77A 2Q3BA 3BG5A 4WJZA 3NWJA 4JENA 3ECCA 4Z0TA 4BFSA 1XC7A 4MB0A 4FSHA 5FAXA 9GPBA 3PS9A 5HKLA 4M6WB 5A03A 4U7TB 2R5FA 1FF9A 2Q41A 1Y3FE 4BOYA 2XGOA 4EPYA 1MRZA 4M1MA 3I52A 4RELA 3T9FA 3AVVA 3V1YA 2C5LA 2OAEA 4DKXA 2JJ1A 1H5QA 3HMQA 5C51B 2J4FA 2VZ0A 2ZRJA 2F9MA 1ZH6A 2EZUA 3ZZNA 1UEIA 3EXHA 2FLKA 3OMXA 4ARVA 3LP8A 1SBYA 4KAJA 3LOPA 1EUQA 5IZ4A 1BXZA 2IDMA 1MO4A 1U8TA 1CF2O 2B37A 5H59A 4KQMA 3EEOA 2VXBA 3LW8A 4QU0A 1JLLB 1SWWA 5EJFA 2Y6UA 5LIRA 5DB4A 3CZMA 1JR4A 4CIXA 3VJMA 2QPAA 3IOCA 1U7UA 2F64A 3JAMA 1XCBA 4DGSA 1Y9AA 4OG2A 3ZVNA 3QHAA 5EMLA 2H17A 4EMSA 4ZU6X 2ANBA 4M8IA 3G0GA 1RVV1 2OQRA 4A2PA 3DVQX 4A0GA 5DM60 3PXDA 2YFQA 4LHEA 5GADl 2GD6A 2KB0A 3MTEA 4Z8XA 3HR8A 5CFOA 1LDMA 2AMFA 4NJEA 1Y37A 5G0WA 3RIEA 5ILQA 4AO7A 3IYLW 5JZBA 1ECCA 2QN2A 3CLRC 4GEGA 4K8RB 4XFKA 3ZWPA 3D9QX 1RLJA 2REQB 2RAVA 3EGXA 4FYVA 4N3GA 4C4SA 1JSLA 4GPIB 3QNWA 5G1PA 1Z08A 4HB2A 1Y0BA 4CLEA 8ADHA 1PZMA 3OEEA 2HR1A 3SSOA 4CR7A 5TPWB 3FYDA 4MAMA 4L22A 4L72A 5KYVA 2JIBA 2AFHB 2GZRA 4RZUA 1FNBA 4M3NA 2DRIA 5JANA 2JFYA 4D3SA 2PX5A 2Z6VA 1ULTA 2BGWA 1P91A 2WF9A 1PWEA 3KSDO 5K2MA 2RARA 2O05A 2C04A 2NSYA 2R3SA 3CF4A 3HYRA 2E4AA 5EQJB 4C03A 2DY0A 1E9FA 2GBGA 1INLA 3DONA 1W52X 3RH0A 4A2QA 2GM9A 1IJEA 3QKWA 3CQ9A 2R1TA 5DIFA 2GXAA 1OD6A 1P1CA 3A0UA 2Z6AA 5E6SA 1IEQA 3AHCA 3QXCA 5KI6A 1K6MA 3HA5A 4EB8A 3ILSA 3IILA 3DAFA 1EEHA 2R2AA 2P9FA 3SHWA 1JT9A 1QO7A 2HNAA 2ZAYA 3H99A 5D5QA 3RBVA 1WQ1R 1XTQA 3JVIA 3NWPA 2YC2C 4Q16A 1IM8A 4HBGA 1D7AA 4M83A 3O8CA 4BNUA 2B4AA 1HZZC 1RU3A 2LCQA 1OTYA 1RAFA 1KYQA 2CFOA 1W34A 2DPLA 2E5WA 3N53A 2OKCA 1ZMXA 2PFGA 4IIBA 4LJAA 4ES6A 2XF2A 4YB8A 1U94A 2PKCA 3U1TA 3HUFA 4YA6A 3PQ3A 4CN8A 2BGRA 2V97A 4QQ8A 1P0IA 4UOQA 1VKJA 3U7QA 2IU3A 5JAHA 2ODNA 4YDQA 4CLOA 1F0YA 1VXRA 5HJ2A 3P52A 3VJRA 3O2QB 1NY6A 4MWTA 2AZMA 2WIBA 2X5NA 3PXBA 1Z2OX 3NVMB 4O08A 2WT4A 3EQ9A 1YB2A 1I30A 1LC3A 1YZTA 4RCZA 1NVKA 3JCZA 2UUPA 1JDNA 2WPDD 1EESA 5CFLA 5JY1A 4JI1B 3DULA 1J5XA 1PK7A 4P3XA 1I2DA 3V7UA 4JKYA 3C39A 3MPUA 1JEOA 1IZ9A 4JNKA 4BKMA 4B3DA 3OZSA 4ZHQB 4HTFA 3OE7A 4NDZA 1KQPA 3T15A 3B6EA 4P22A 4LYAA 1IHOA 1HF3A 1MQ8B 4ZIRA 3WGKA 5BV1A 4DUYB 1JIUA 1XQ9A 3ZIDA 3RWBA 2Q5OA 1MDFA 3FYCA 4RPGA 3FTEA 4DR2B 4UNNA 2IT1A 3EA0A 4QIHA 1TA0A 5EWJB 4JNCA 3ZWBA 1PHPA 4D9FA 3CTPA 2WD7A 4EFLA 2VSQA 1NKVA 3BRQA 5AM5A 3U37A 3VTZA 3GMIA 2X6TA 5BWLA 1Q0LA 1HDZA 1TU4A 1V96A 2POCA 3KPVA 3MM4A 4I5EA 5IEBA 5IJAA 4I6JA 3KL2A 2JCYA 5HJ5A 2QG4A 4GPEA 3OU2A 3ZZUA 1RJ9A 3WNBA 3GZ4A 3FUWA 4RIIA 4HNSA 2BV3A 1E7RA 2IZ7A 2CK3D 2QIOA 3ESCA 1Y1QA 4B35A 2Q4BA 5DN6D 3N5CA 4FKZA 3LQ4A 1GYQA 1NP7A 3TM4A 5ADVA 5M34A 2NVWA 1MJFA 3IVXA 4KFTA 4TSRA 4D6PA 3W5VA 4N7RA 4BNHA 1CRPA 2MSCB 3KQVA 3K15A 3SEFA 2ST1A 4ZZ3A 5KWJA 3G2KA 3QX8A 4P98A 4BX2A 4OQZA 3ADDA 4TVOA 3P1JA 1R9JA 1Y6RA 1YFJA 2RGEA 2BT4A 1KR2A 4DCCA 1YA6A 1KI6A 3DC2A 1LU9A 3NBXX 4IDFA 3BN3A 4PAQA 3MILA 1Q14A 5CP8A 1NR7A 2G5CA 1P80A 1ZK2A 4IO0A 1NV9A 1QH8A 4IDOA 4RS4A 3OCWA 3DZKA 3PWSA 4YP5A 2Q7OE 3U62A 3JXEA 4DV0B 2WMDA 4RPKA 2WIAA 1CJKC 1JBEA 1L4LA 1ZK0A 2B2CA 2XT0A 3H4TA 1F7VA 3W6ZA 1U6KA 2FGKA 1T5IA 2A7XA 2P9BA 2ZFUA 3MS2A 1HDRA 4B74A 4AN1A 4EAAA 4LWOA 5C35A 1WBDA 2C3UA 1ECGA 2VLBA 3AG5A 1ZRNA 3GLTA 1NZFA 3GX1A 4QODA 3S8MA 2YWBA 5B1IA 4ZARA 2ZRHA 3WLOA 1YDHA 2XUHA 2ZCVA 4AJ4A 3PRYA 1XXLA 1P4JA 2PZ8A 1OIWA 1MU0A 2XQFA 4ZCPA 1JZSA 1W76A 3ICVA 3TZCA 2Q9BA 4LVOA 2VK4A 4U00A 4ER7A 4LXGA 4XQEA 3PHIA 1U2EA 2ACVA 2Z3ZA 3HPRA 1LPPA 1YH3A 2QS9A 2V4ZA 3A06A 3KJHA 3KNZA 4QU9A 5KNDA 2P6RA 5E9AA 2XYVA 1WIWA 1QWOA 3K70B 4EEKA 1THMA 3OCVA 2FPGA 2G77B 3TXAA 4DMMA 5L4NA 3CINA 3KZXA 4PWYA 1L6RA 1VP9A 3MIIA 4FBLA 4OSEA 2OCBA 5HA5A 2P11A 4JX8A 3BWCA 1ZL0A 4X6UA 2G5GX 2V59A 3A26A 3EXEB 3LBFA 3Q4GA 4BQPA 4HJRA 3FBGA 4M1ZA 1PU2A 2MSDB 2XUQA 3FAZA 3O82A 1AQLA 4A3SA 3VI3B 1UZMA 2AWNA 2IIBA 2RGAA 3CLTC 3MT9A 2VFAA 3OO0A 3QEMA 3QKUA 4EMTA 1FU7A 3F97A 3KBOA 1VG0B 4M8LA 3UEOA 4CCSA 2X5XA 2OA0A 4KXVA 1D2NA 3CKKA 4JP3A 3W2EA 4B6OA 1QZTA 1U9IC 2V8OA 4KLRA 2Z3VA 4I46A 4ALMA 3BIOA 1JSZA 1VZ3A 3FPAA 3QVSA 1ZNZA 5CYOA 1H94A 3G2PA 3RGGA 4F84A 1PNOA 2FA9A 1VHDA 1E3MA 2CCGA 2PMDA 4M1QA 1ETHA 5I4BA 1E7QA 4FFBB 2XVXA 3ZGXA 1PR3A 3M5DA 4H1UA 1ISPA 2C2OA 2CFIA 4IIJF 4PNZA 5E7QA 3OZRA 4D9JA 3QENA 4YJHB 2HV9A 5LBTA 1WULS 4XYBA 3Q98A 3T35A 4KGZA 4QTTB 3FZQA 5IEJA 4YAJA 1UJ5A 1XSEA 2XE8A 3IRUA 3SYTA 4AJHA 4Z4QA 4TZKA 3HN6A 2PAFA 1ISIA 4G9GA 2GCOB 3B5EA 6CHYA 3EY9A 2HBRA 3WQHA 1D9XA 1M2GA 1XZCA 3OPYB 1ENOA 4K26A 4TRRA 2AX3A 1DBIA 2R8PA 4Q1VA 4Y1EA 2R5NA 1AZWA 1Q3KA 4KMMA 5B36A 3AL3A 5BMVF 1G8KA 5FV7A 4CQMD 4ZI3A 5KOIA 1W4AA 2FDXA 3DM9B 2D59A 1R8QA 1CNFA 3IC5A 4IGIA 1EGQA 4X00A 4Y9RA 2GBCA 3TZEA 5B3JC 4K9SA 5TQ0A 4H7FA 4BATA 2OAGA 4FEGA 2DUUA 3OM1A 3WLAA 5HM6A 2F1HA 1T0BA 2C2XA 1RXYA 4GAEA 2JHCA 3MCAA 1NBEA 3S2SA 1KFJB 4PZZA 2JHAA 4URFA 1JFSA 1N6PA 5D85A 4E07A 1AZTA 2BLLA 4NTZA 3TXYA 4KIUA 2WWYA 4I1YA 1MIOA 3I83A 2WR8A 4JGIA 4CFSA 1A69A 4DR3B 1M33A 3SYNA 3AF6A 4Q9IA 3ER6A 5CA1B 1OFVA 2N9UA 4OX9Y 5DGDA 3IP8A 4P0PB 3ONNA 3OIWA 4TV8B 3WLHA 3ET4A 4AG5A 2H63A 1RQ2A 2HRCA 2PNFA 1IY2A 2G72A 1IG0A 2YL2A 4MQ4A 2P90A 2WILA 1E2QA 1M34B 4C9BA 2AZXA 2YMMA 2D1RA 3EDYA 1E3WB 1GTMA 1P4RA 4NATA 4UM9B 2G88A 1BQ4A 4D9IA 3I9V6 1B0PA 4BC1A 3ZCVA 2AMYA 2DWQA 2A5YB 1MKYA 2G1UA 2QVCA 3D5TA 4HL6A 3S2GA 3LG2A 3SKYA 1O54A 4RZHA 4Q7EA 1GVNB 3QPCA 4PX3A 3UFBA 2WC1A 1Z62A 4D8TA 2EXXA 4YAUA 4WOBA 4UTRA 4G63A 2JH3A 5I8PA 4EZIA 2H07A 4X3PA 1NC3A 3L7JA 4FD2A 4MS3B 2QNBA 3V34A 3ZDCA 1G5IA 2P9QA 2ZEJA 4R0VA 1GN8A 1X9HA 2FF7A 2A67A 5G0TA 2NW6A 3ENVA 2P4HX 2J45A 4K6OA 2CEAA 4FLEA 3W8EA 4Q18A 4GMFA 2H85A 2HWWA 1C1XB 3O8LA 5AW9A 3S27A 1JKFA 2QQGA 4GKAA 4GYWA 4I4LA 4L9SA 1KSGA 3LC1O 3VR5H 3LVQE 1XIVA 2N0SA 3F8WA 4GXTA 3LCMA 4IDHA 3QFSA 3WRYC 3X0DA 3HKEA 4X54A 2QZ4A 1QOPB 4RV5A 3K4QA 1HTWA 1A9ZA 4XEUA 1KKLA 3ZH9B 2OWDA 3EODA 4F3KA 3S1SA 2FCRA 4FC7A 1G0NA 2G0AA 2R1VB 2R6GA 2IY8A 3AHIA 2WK1A 3SCZA 4RH1A 1X77A 3CH6A 3HO6A 1PZHA 2BH9A 2QRNA 3OKFA 1E8DA 2V6BA 2IEAA 4JGBA 4RZ3A 5F78A 3DOHA 1J2JA 3QYPA 1WF3A 3AM4A 2JCXA 1H85A 3K8QA 2GYYA 2FUG6 3HK2A 2EG5A 3BHJA 2DTXA 2A4MA 1NJFA 3RANA 2PKYX 4B0PA 5CFNA 4OGLA 3WTBA 4MRVA 1PG2A 5CBKA 3BB1A 1SVLA 1FS5A 2PS1A 2AI1A 5LOVA 1MPTA 4L8LA 5HTKA 1FQOA 3QXGA 1FW6A 2EP5A 4MVYA 4U2KA 4U63A 5JS8A 3WZLA 2FE1A 5KNBD 3AEUB 2KQUA 2QRKA 2Z8YA 2VHUA 3UJAA 3Q88A 5IF3A 5LMNB 1FOEB 2AJDA 5JAUA 1ZVVA 1GU7A 3PDUA 1F6BA 3K0HA 1JPJA 4KYIB 1Y7PA 2PUDA 3LK6A 3N2NA 1CJCA 5I7WA 2ZYSA 1TZMA 1H1LA 2W2VA 5ALUA 2I66A 4R0MA 3FOWA 1Q0PA 3I9NA 4EYKA 1I2CA 4QXQA 5F3WB 2BISA 4AKHA 2GK7A 4ALLA 2EZTA 3DYIA 2H00A 4N3CA 4UZEA 4H3VA 4JLNA 4F2HA 5EC8A 1S02A 1LK0A 1MEOA 4F4DA 5JH7F 4UREA 4FYIA 1QHNA 4LNUB 3GBSA 2BD0A 4DW8A 2I4IA 3HTXA 2H4WA 2PH3A 1G8PA 1WVMA 1GDHA 4PVDA 1D5WA 4V2IA 2EKPA 3H84A 5FI1B 2AVDA 2PXAA 3M1YA 1CBUA 2XQVA 3RAGA 5JSQA 3NAGA 2Y27A 2TSYB 4YRZA 1THTA 3F6YA 1GA6A 2WJPA 4GRDA 3RQSA 1XHEA 3PENA 2B36A 1RAGA 5DYWA 1ZD5A 3I64A 3OC0A 3GC6A 3AHHA 5ENZA 3VC1A 1CUHA 1M1XB 1E6WA 2A9PA 3S2YA 5C7OO 1U0NA 4Y9DA 4HV4A 2B30A 2CF6A 4DMCA 3CWZA 3KJNA 2H0RA 2ID9A 1QMGA 2AFIA 4TN1A 2BEWA 4Z7JA 2J0SA 4LYEA 1H9CA 1Z2CA 1BMFD 3LUFA 2HNBA 4JBWA 3OAAD 4RACA 2P35A 4JBYA 2XVMA 5EIBD 5BUQA 3VPSA 5JJBA 3N0TA 1JDVA 3UXYA 5A7FA 1RACA 1M5RA 5GJWC 2AOUA 2J3QA 4DLRA 3HI6A 5ALNA 1X7WA 2XMZA 3BKXA 2GTHA 4IDGA 4LMPA 1SOWA 3AO0B 3HPQA 4CG0A 5CLFA 1ZWKA 1JQDA 3QW2A 2SCUB 3T4XA 2O8DA 1II8B 4M9QA 1ZS9A 5IN5A 1S3IA 3KXPA 4KMRA 1C8BA 5BVHA 5ALJA 2IDZA 4EFMA 2RKWA 1JHUA 1VA4A 4A0FA 4KVZA 5AVRA 4D02A 5DSTA 1N5JA 2YY7A 4M60A 2R4QA 5H02A 2DHEA 1DC7A 2WOOA 1P81A 3AOGA 2XE4A 3ONWA 1NUHA 3TQSA 1HMYA 1TQ8A 5FR1A 4GX1A 5BWCA 2WU0A 1O94C 1N2CA 3ASUA 4J0EA 1RRCA 2CBXA 2NU9A 1JMYA 4E13A 2Z8ZA 4BRSA 1YR3A 3IJEB 2VSFA 5I7AA 5JH7A 4NEQA 1DE0A 5J63A 1VHLA 2H5LA 1T3GA 2JEYA 2JLWA 3L77A 4HJXA 3USES 1EFLA 1KF0A 2PSEA 3BF7A 4UUBA 1UDAA 4JC4A 1OC4A 3OA2A 1S6YA 4A4DA 4MP6A 1Z0FA 3E81A 2ZB2A 3I2HA 2OXIA 3GVPA 3I01A 5FNVB 3OOYA 2C98A 2IV7A 1IQPA 3I72A 2VJLA 3P26A 3Q72A 4ISBA 3BXXA 2AMVA 4J1NA 1SU8A 2ZIXB 2BKLA 1SQ0A 4FKBA 3WLMA 1T1EA 1WOYA 4BNYA 2OYSA 3LT4A 1JHRA 3MTQA 4JLOA 2FPWA 1E2DA 3PC8C 5JS7A 3V1UA 2VSOA 4M55A 3AUYA 2PU5A 2DZDA 2VO1A 3EUEA 1AKYA 1MB0A 4G4SO 3O38A 4XSGA 1H8HA 1G3IA 2C8LA 2VYQA 1VHQA 5LVAA 5DYNA 1IXYA 5E3HA 2EYUA 2G40A 3NM4A 4ZCQA 5K8UA 2FPSA 2NO4A 1AQNA 1KVSA 3E3OA 2XMCA 2PPLA 3B9PA 4R7TA 4D0LB 4DZRA 1YI1A 4U39A 1AHIA 3GT4A 4MQEA 5J1SB 5IARA 2IYQA 4PYIA 2OL4A 2RHLA 4AECA 3DHWC 1M2VA 4MUEA 4HI0E 4ZQHA 5AMXA 4V24A 4ZQGA 3M6MD 3GRYA 3CUUA 1P60A 1Z06A 1W75A 5GGYA 4MQLA 3R7DA 2JGMA 1YUMA 2CLFB 3PEVA 1EVIA 3NT5A 3PPVA 1W7AA 3EG9B 4G5SA 3WLSA 3H7AA 5CGZA 1VJRA 4AZTA 4NOLA 1G16A 1RXUA 2PL5A 4V0NA 5JEEA 1YZLA 4JVLA 2VHYA 4QGHA 3T3HA 3GRCA 4LHSA 1P3JA 3IUQA 1X0VA 4R1LA 2YBEA 4XGIA 2W0MA 1PNTA 1UBKS 1XTUA 1C4WA 2WF7A 3BWMA 3KZ1E 4PW0A 3TRHA 1I32A 4GLBA 3EXFA 1HYQA 5FWXB 3DV0A 3GLGA 3H2JA 1ZMOA 1VE7A 4EELA 2OB2A 1Z7BA 2W2MA 1ONBA 3V9PA 1MF7A 1LQUA 3B9RA 3EIEA 2V5UA 1N25A 2FAXA 4PRLA 2CWDA 1U1GA 1XYVA 3A3KA 1DQZA 3B1JA 2H29A 2HF8A 2XWPA 3OJXA 3RAPR 4RY2A 3BUSA 5AOBA 4L0DA 1KK1A 2P6UA 4KO2S 1NI3A 3ZD6A 2CXQA 1B16A 1PRYA 3I9JA 1Z0SA 4NCKA 1B6GA 1GNLA 2HWUA 3K2QA 4TYQA 4BFWA 4J90A 1VIVA 1YB5A 3K0FB 3SKXA 7YASA 2GRUA 1QORA 2X0NA 4XH9B 1WXDA 1BJRE 3O3OB 5AHKA 5JDCC 4HLUC 1E62A 4AYWA 1E6KA 4OXRA 1E32A 4KPEC 2R1UA 4C7OB 3MJVA 4WV3A 1QLJA 1QHEA 4U4AA 1KVTA 5JLAA 3OEYA 1L8XA 5IDYA 3VKVA 2DPXA 1EE2A 2I62A 2PH1A 3GP3A 4QDXA 1DOZA 4KXLA 3QPUA 4Y98A 5CX4A 3RAJA 1HOXA 3CCCA 4KYTA 3WOHA 2OESA 3TUJC 2RIPA 1K68A 4YWHA 5HF5A 4AMUA 2XXAB 1TA9A 4B5LA 5DULA 5LXTB 2ZRCA 3TSOA 3CXUA 4J3NA 2P79A 5TVGA 5HQ3B 2Y1LA 5LYJB 2I67A 5T64A 2G6TA 1PJCA 2W5UA 3CHYA 3T7JA 5B7QA 1DI0A 2NUPA 1CUVA 1GJRA 3I09A 4XUGB 3PFCA 5F2KA 1Y48E 5MHTA 2JIZD 3GRKA 1IBLB 2J3IA 4DCMA 4TV9B 1J42A 3W9BA 4WLEA 5ANRB 1KU6A 3KHKA 3PUYA 1DOAA 1LPOA 4P31A 3I4LA 3ZE8A 4X92A 3F8TA 5EE9A 2QTMA 1EFCA 3CLSD 3PQ4A 4X20A 5EIFA 5J4VA 3B1FA 3FTPA 4JEUA 3FYUC 2MOKA 3H5TA 3KL4A 1WW8A 4YP9A 3Q8MA 1Y7LA 2I6XA 4X24A 1SHZA 2CV0A 3EAGA 1ESCA 4OQFA 3PJGA 3A05A 3VAZA 3PX7A 1AV7A 3TIVA 4I9FA 4P4TA 5JNWA 4FJ1A 3T95A 3OURA 4KWHA 2H4ZA 4ZWNA 3WYNA 3TQRA 3D0QA 4YUYA 2HMAA 1LS1A 2DKOA 5LKRA 4F92B 4EPRA 4XR4A 4HVCA 3FJOA 1XZKA 3LV8A 4YC7A 3WGIA 3ZVMA 4E5UA 4CYMA 2XVYA 3UJ7A 3ETCA 1G5FA 2NPFA 3GPBA 3LD9A 1GXSA 2OXEA 3Q0EA 3AW8A 5AM0A 1V11A 3VR2A 3OOEA 3ZNPA 2OEPA 1C8VB 4UOEA 3TIXB 2JZNA 2MYNA 3F46A 3AFMA 3FB4A 3PB3A 4RMJA 5TT0A 3WL3A 1FX0A 3DE2X 4K5QA 5FTKA 2ZI5A 4CL8A 3E03A 1DAPA 1DEOA 1NBHA 3K70D 3MMNA 4RHFA 2BI7A 4WCFB 1P2GA 4C30A 5JPDA 3HCDA 3FSGD 2E82A 3P0HA 3ZJ4A 3ICWA 3KJZA 1VI2A 4IJQA 4WN9B 1RXWA 3OT1A 2FN8A 3UGKA 3WJAA 3GEHA 4LYJA 4RGYA 3T3MB 4QBKA 4RL6A 4F3TA 1E1RA 3STHA 5AP9A 2HUPA 4MDYA 2IW3A 4CKWA 3LI2A 1QH9A 2CNBA 2XYHA 1AKUA 3NEPX 1X39A 1E3SA 1EFRA 1FP6A 2QXUA 3ILXA 3JYHA 2W2KB 5A1TA 3WP1B 3TL6A 5E6RB 4NAVA 2JRLA 2XKJE 1SG9A 1K3TA 3DAYA 3OPNA 4HUJA 5AUNB 1DZIA 2ZT7A 3TW8B 2X22A 4HGPA 3ZTWA 1QG4A 2ZT8A 4L6IA 5KQLA 3TEFA 1H2WA 4RW0A 1H2RS 2Z98A 5KYTA 2FEAA 4WADA 4AS1A 1YL6A 1TD1A 5DE3A 1SKMA 4LBWA 1Z5GA 2RG7A 1L2TA 1NVEA 3D7RA 1IEVA 3AP3A 2Q3FA 2VRCD 3AJDA 2YNMD 1KY5A 2WM8A 2Z2IA 2WTAA 3E5MA 2H18A 1OFIA 2P9ZA 2PX8A 3G0DA 2Q0QA 3T99A 2G1AA 3UKDA 3UHFA 1V6SA 4MEBA 4BNXA 5CX1A 1CZNA 2QV0A 1BW9A 4DMKA 3ZJVA 4FE7A 4I8DA 2X8JA 3R9KA 1SUWA 4RWEA 1DTWB 1OPXA 4JQCA 5B1SA 4ZN6A 4WMLA 3WP0A 1V5IA 4PYRA 4HNTA 3GEBA 4GYKA 4MAFA 3W2TA 4E46A 1CR2A 1TVKB 3X3HA 5BPFA 3EZLA 5IH7A 5JQGB 1OH5A 2CZCA 2ZI6A 2ZBPA 3NC0C 2XDQB 2PLWA 3C3CA 1J06A 1ZM9A 3K53A 3LLVA 2ZRIA 4GP6A 3IHKA 1K2VN 4J1QA 4R01A 4EB0A 2OR3A 4L5YA 1XJ5A 4LRXA 2C7QA 5EJ9A 3LA8A 1R7RA 4V0OA 4DY6A 5KNDH 4MP3A 1AKWA 1V47A 2YWJA 5FA8A 3BXHA 1W0CA 2PA3A 3K5WA 1XD2A 4UTVA 1T0IA 2ATVA 3E70C 3KPYA 1UP6A 4CM5A 2YWRA 2ZETA 4G26A 1I0IA 3QK7A 4LWPA 4GQBA 1L7OA 1SKYB 2QLBA 2V0GA 2P1ZA 2ILVA 2R6FA 2BFMA 3AUTA 4NBRA 4EJFA 3T1VA 4HQNA 1GKIA 1H05A 1HDXA 4GNKA 3PT5A 3UGQA 1MOQA 1DAIA 2ZQZA 2YRFA 3O3NB 5KNLA 3E9CA 2KE5A 1JW9B 1QGZA 3ZWQA 4YY3B 2QGFA 4RK7A 3ZVLA 4D80A 3EOZA 4TYWA 1R9MA 3FGOA 4PLYA 3S29A 4N0QA 4WBNB 3DBIA 1CUDA 4Q19A 3VVBA 3PPYA 3JVDA 1YNSA 4G5RA 3K5PA 5K0EA 1I8TA 1E92A 1Q0HA 3HYSA 1U3UA 1T35A 2EG9A 4WY2A 3FKQA 4BYMA 3WNZA 4YRGA 3HB7A 1EI9A 3R3JA 4UM9D 1XTBA 3GQVA 3KG2A 1EJ6A 5DNAA 3N8DA 1ZMBA 3FJ1A 1ZUWA 1EA5A 2XD4A 1JR2A 1HYGA 1ODLA 3AINA 1YSCA 3U44B 1PR2A 2WWGA 1VSTA 3WRXA 4TXHA 1JQEA 1DJOA 3ROEA 1QCDA 1PJLA 3MUNA 4Q47A 4YDRA 3DMRA 5DM70 3LSTA 3E18A 4D3YA 1GPLA 5KYGA 4IV5A 4DS3A 1Z5OA 2G5PA 3AP1A 3AB3A 4GEKA 5CLHA 3HRIA 2O8BA 4UNRA 4S12A 3JQBC 4JITA 1XUOA 4RL4A 1E9VA 3FCYA 4ZKDA 4KITB 3N0XA 3O26A 4Q4DA 4UE3S 3G0BA 1OWPA 1GN9A 2RKBA 5FQNA 3S4YA 3SJZA 4H1TA 4C0LA 4YO7A 4PG8A 1GSAA 3X2FA 3PE6A 1E6UA 3CVWA 4IQ8A 2NNWB 3LLSA 5A06A 2NUBA 1W5EA 3CR3C 3FPHA 2JFQA 2GCPA 3R3SA 1A8PA 4M89A 2HU7A 4QLOA 3TLXA 2ARKA 1B8NA 1CLEA 5K6RA 5LZ8A 5BXQC 2PKWA 3H9GA 4D9KA 4WIAA 1XWWA 1JKJB 3SHTA 3RG2A 1LPAB 1HQYE 1QIHA 1XMPA 3K0CA 1CVLA 1KEPA 4F12A 3C74A 4WOKA 1KWGA 1NXSA 1Z28A 4R8MA 3I01M 4MR9B 3HU3A 3OZAA 5JWRA 3HWRA 1ZJWA 4RSRA 2DLNA 2HK8A 3KYJB 3K20A 1T5LA 3DOJA 4Q9JA 1VJTA 4NBLA 3RJ5A 1J0CA 2B7LA 3B60A 4FMDF 3T1YB 4AP5A 4W8HA 1T2VA 1ZZEA 4ALNA 1RIIA 2FR8C 4YNBA 4EB6A 3EC7A 1U80A 1O4WA 3F4BA 1N0HA 2GEDA 2QSYA 4CWAA 3USCS 3KD3A 4BMNA 2BPOA 3QG5A 5LIPA 1DWQA 1SK8A 5FA6A 2YJ3A 2BEKA 1ADFA 5I9IA 3L93A 2ZDQA 1F60A 4Z0HO 4JX9A 4MV0A 3TFQA 3UPDA 4BQNA 1VPWA 4CIBA 3GZNA 1UMCA 4WKOA 3CZ5A 1C8KA 5JCXA 1OQAA 2X86A 4ZEWA 1X13A 2X3UA 4IWYA 5A4KA 4FUQA 1OX4B 5IT0A 5A6SB 1A4UA 1Z4PX 1PL0A 4CEIB 1IN4A 2R4UA 3ICOA 5FOTA 5JG7A 3SI7A 3DJYA 3MINB 5EIXA 1AQYA 5CPBA 3BMXA 2YOHA 1EFVB 4WKNA 3I9V1 3HCBA 1FUIA 3SJUA 1OSNA 4QATA 1T26A 1L5HA 3ETJA 2PZMA 2OZLB 2HD4A 2HEIA 5GOZA 5TGDA 4ZMBA 1X19A 1Y1SA 3UYKA 1M0SA 1U2GC 4WZBB 3C97A 3VISA 4OK5A 4N3AA 3W9SA 4EW2A 5HX7A 4RTMA 3TH5A 1XD9A 1DQRA 3N2EA 3IL2A 1UODA 1YS6A 2GFHA 3CV3A 3ETEA 2MINB 3SFVA 3A9WA 3U60B 4MJ7A 3GDWA 2FYTA 1L7MA 4KXWA 5C1IA 2Y0PA 4EGAA 4DUZB 1IL0A 4JYAB 1KZ1A 4Q3NA 3NM6B 3WI7A 1RHJA 1SUIA 2GFIA 3NH6A 3CH4B 2C9CA 1PT6A 4RF3A 1EQUA 2FWMX 2NZ2A 1NAHA 2YXPX 2GKOA 3M83A 3PVSA 3C5EA 1NYRA 3JAKA 3OE5A 3O9ZA 3DG9A 4FFOA 1CIVA 1SVIA 1ZINA 3FCXA 2Q8NA 2JVJA 4M21A 5IDXA 2XZLA 3OCXA 4OJKA 2NTVA 3QSGA 3I5UA 1S89A 1W35A 2OVFA 2RC5A 2D1QA 1X8KA 1ZXXA 2VJAA 3AJEA 5LLDA 1TTHA 2J1LA 2WTXA 3JPYA 1FP4A 1WPGA 1L4UA 4HAOA 5CCDA 3H18A 4MA0A 4U0KA 1HE5A 2W6ZA 3AL2A 4RKQA 2DVMA 2XADA 3S3TA 5CT9A 4D4HA 1ECLA 4A5SA 3RROA 1LNQA 2XQGA 5LZ2A 1YA4A 2JF0A 4MYTA 5BW6B 3A3PA 4BQOA 4BX0A 5DU2A 5AK0A 2FUG1 1KNQA 3L7CA 1XCOA 4NC9A 1YZHA 1TVCA 2A94A 3BXZA 4OYHA 1N34B 4G1UC 1XLTC 4HWRA 2BFCB 5LMCA 2H0AA 5BYKA 2C54A 4D4JA 2A58A 3T7TA 3MAAC 3H6HA 2OKGA 4ZZ2A 1TD9A 3FGNA 1NIPA 3KXDA 3HCAA 1XA4A 2A78A 4PNEA 3PWTA 1KK3A 1TCCA 2OGUA 4WA7A 1VMDA 1WCV1 4Z6KA 3H5WA 1NVDA 2Z9CA 1SBTA 3WYBA 4NCHA 4I9GA 3QH4A 4XCXA 3LU1A 2IODA 2VDUE 1T1RA 3P20A 4QUHA 1N2ZA 2E4ZA 2V7TA 3PUJA 5ICFA 3FYHA 4AUKA 1LPBB 1QK4A 2HRRA 2QHXA 3R3YA 2Q6IA 4YGYA 4YJFB 1P2BA 1JHVA 5JZ9A 5THKA 1I1HA 1W4BA 2AFIE 2HKIA 2WOJA 5IJ9B 2F8SA 4YRSA 3HXKA 3N8GA 3ADOA 2ZWIA 5C5CA 4G5HA 4UAGA 3AF0A 1QCCA 2P2CA 3G7NA 2IEYA 1J9GA 5DK4A 3QBEA 1O6ZA 4KN6A 1UFKA 3LT0A 3WGOA 1NMQA 1JBKA 4MS1B 3WDSA 2RBEA 3MWYW 2G28A 1U1DA 2ODQA 1E96A 3GUUA 2F43A 1JNYA 1VHJA 3CO0S 1P6UA 4HAZA 5AVYA 2ORWA 3L0PA 4CT5A 4R1UA 3SHFA 3IEVA 5KYNA 2W8BA 4P53A 4EY8A 3T1OA 4TZ0A 3AJRA 1QHSA 1FRZA 2R8EA 4TPKA 4YAEA 3HVUA 2ZSAA 1CFJA 1HGXA 2B8JA 2XNHA 2NO7A 3OZBA 4R84A 2NTEA 3TTUA 1N2CE 3RFCA 3ZLTA 4GOJA 3OWHA 4B4WA 2UZ3A 1EK0A 1R10A 1UFOA 1ZO8A 5BRAA 3EFEA 2CXTA 3ZV5A 1M7BA 4EA8A 4I9UA 1NASA 4D57A 2NXNA 2Q5FA 3KZOA 4JR0A 5F2EA 2QXTA 1QCYA 3KT8A 4HSGA 4MW2A 4HGYA 4N1AA 4XWAA 5IANA 4BNVA 5CLJA 3CCFA 1MB3A 3BT7A 4M1YA 4O2LA 4FB4A 4XVQA 3QOFA 3IAUA 1PZGA 2LTAA 3N2LA 4NNJA 4E4RA 1MBZA 2HIMA 2CXRA 1SVSA 2OXCA 4JB8A 4TN5A 3ZGLA 2R66A 5G41A 5AM4A 3IR6A 1GTJ1 3THWB 2EFYA 3B5IA 4DMGA 3QMMA 4KTVE 4Q9HA 4RJIA 2BR5A 3JQGB 3P9NA 2XDAA 3GUVA 4FD3A 3HYCA 3JD4A 4QOIA 5FTMA 1FFHA 5HE8A 3P8ZA 2OVBA 1I2BA 3MMZA 1JA1A 3G0IA 3TL2A 2HF2A 1QVVA 2H7XA 5LWQA 3IMEA 3MB8A 1MGOA 3SD7A 3JATA 5IH3A 2MT9A 4XM2A 3AVOA 4FFMA 3CZ9A 4RD3A 5DXAA 3MNFA 4CN9A 1CS0A 4PWZA 8ATCA 1JQBA 3IOMA 4C6TB 2FNAA 2Q5IA 1MVOA 4JA2A 2W2OA 4I14A 3RYIB 3PNOA 3FCCA 2VWGA 3AZOA 3L7AA 3QLUC 4I5GA 1BMTA 5DYTA 3U4GA 1PQPA 1TLFA 1N1DA 5JJKA 1TC2A 4CM4B 1R6DA 2I4LA 1WSBA 1PT8A 2PGDA 2ZJAA 4V0LA 4I9NA 5E3JA 3RRJA 1EGAA 2GKSA 4UFNA 5JCZA 3RVPA 3UNXA 4NENA 1LDYA 5KNBA 1Z56C 2YV1A 4MV5A 3IMCA 4G1MB 5CBPA 4AJEA 7REQA 1C0EA 2G4CA 2B78A 2HJRA 2JJQA 4X95A 3RYFB 4BMZA 2G6BA 4DNOA 3JZFA 6GPBA 1ZIPA 2ZPUA 3ZIAA 4C6HA 3K30A 3G0CA 1K5HA 2OFOA 1W88B 1L8LA 4LMAA 4MPJA 5AK4A 4TLMB 4F60A 4BXOB 1USWA 1NXVA 3T12A 3GLGE 2QQ0A 5DHRA 1MOZA 4D4MA 3A04A 2QD5A 3RUPA 421PA 4Q7LA 1XV5A 3IQWA 1I2ZA 4DIFA 3P5SA 5TS2A 1IVYA 2GUGA 3B85A 4R0NA 3T7SA 1E2NA 2O2ZA 1EIZA 3O21A 4YRBA 1UEJA 2E4VA 2L82A 3AEKA 4PLFA 5IXYA 5IVHA 5LMUB 1UPUA 3GOHA 5DCLA 1C7FA 1E1NA 3HFRA 4XARA 2ZJFA 3DZJA 2QBYB 2A3NA 2JW5A 2CNWD 1S2DA 2O8FA 4HNQA 2BJWA 3VPXA 5IBCA 4INPA 3AETA 4RMIA 3RVJA 5GJVC 4II3A 1K5PA 1OA0A 2BFDA 3QELB 4PSUA 3X1MA 3TLMA 4GKJB 1JEDA 4JR1A 1V3TA 2XT9A 3KKNA 1JEAA 1HDEA 1XZBA 1Z17A 1Y5LA 1OV6A 1X1BA 4BU1A 5TQJA 2O0MA 2XZDA 1FBNA 3ORSA 5AXAA 2E4UA 1S01A 2GF0A 3DXXA 1E66A 4C7XA 1TF7A 1I33A 3AK4A 3T5CA 2J9FA 2C5SA 2ZTUA 1AHPA 4TQ9A 4XYGA 3PDIB 4EQ6B 3MT7A 1G1MA 5B1YA 5DDIP 1BG6A 5I3ZA 1I24A 1P77A 1XPJA 4YAGA 2OGSA 1BX0A 1NTOA 3I1IA 5FPHA 4AKTA 3SKVA 1C9EA 1JLMA 3TYXA 3OLQA 2XBMA 4A2CA 4MUGA 1XZMA 3LX4A 1EWYA 1BWPA 2R00A 4RDHA 5DTJA 5DYYA 1XU4A 1YE5A 3TQCA 3ZDZB 4CZ2A 1U28A 4UHDA 1JDUA 2BGLA 1TNDA 2VTVA 2FHSA 3I3OA 3QE9Y 3WLKX 1WABA 4LOJA 3NWEA 4GNRA 4XOUA 3UWKA 4LVCA 1RWVA 1XDDA 5D6OA 5JBIA 2XZTA 5HMMA 4X1IB 4C04A 2FJPA 1O03A 3AY6A 2N3ZA 1V3VA 3EY4A 1DKQA 2J33A 5K8IA 4FFWA 2WMYA 4IFBA 4HH4A 1PW5A 3LRPA 4L57A 4EG8A 5JNLA 4L3WA 5EYPA 4Q4HA 2VHCA 4ZCRA 3UA3A 1E3LA 1DJMA 2O2YA 4U2CA 5FO1A 3ZHXA 1GUZA 1RI4A 1DP4A 4RGBA 3EA5A 4ZANA 3KO8A 3MRTA 1X8LA 5CAEB 5LR6A 4XTRA 3R9XB 2H11A 2RJOA 2ZTHA 3A2LA 3CMMA 2H9YA 2H2FA 2CMKA 1JAHA 2ES4A 1WUKS 3WB2A 3UOAB 4KR2A 2ZROA 4DSAA 2FVYA 3X1ZA 1JVBA 3A9RA 2OE2A 3P4UA 4ANFA 2VUIB 1NVWQ 4G1FA 2J3DA 3EYWA 5FWAA 4RULA 1ESZA 3NNSA 4R1PA 1ZL2A 3DBRB 2F62A 3C70A 4F1KA 4BJ3A 1VBMA 3TRFA 1YRWA 5ER9A 3FPEA 4Y2XA 3I0ZA 2B1QA 4JLSA 4B3XA 1A9XB 3ZDDA 2G25A 2ZR8A 4J07A 4F4CA 2IQ5A 4OQMA 4MKGA 1J8DA 2K6GA 4MYSA 3EC1A 4MZXA 4MR8A 2VSXA 5K3EA 2ZIGA 1VG9B 3I04M 5J1TB 4IHJA 4ZHQF 3B52X 1VE9A 2V8BA 1I1OA 4K1LA 3EJWA 1W1IA 2VF7A 5CXXA 1GUBA 1KJQA 1HKHA 4DC9A 2GF2A 3AUAA 2B3TA 3QJYA 5DK6A 2D2XA 1PCXA 2O7NA 4ERXA 2NU6A 3U7JA 4RYLA 4JP8A 2PL9A 3GRVA 3WKBA 4LDQA 4RK5A 1NE2A 1A04A 3NDRA 1NMEA 5J4YA 4MUKA 2C3PA 2Q27A 2HO4A 1AIPA 2Q8PA 1XL1A 1U0BB 1HG0A 1YHNA 2QWXA 2ZQ5A 5B2FA 1J20A 2WFZA 1OREA 3BE4A 2B99A 2X9VA 1XJCA 3AKEA 4QYXA 2B9VA 5BUSA 1V4VA 3B8EA 4RZQA 1M1YA 4DA8A 1QYRA 1O95A 4JI3B 3SF8B 3VMMA 1B0UA 4LE1A 4S1PA 1T1SA 5EXEA 3FDIA 4LSGA 4DA6A 1KE1A 4KAAA 4RORA 4DQVA 4ALIA 1G18A 1KI3A 1C9KA 1R0LA 1SBIA 4KR9A 3WMFA 1G8GA 3ZDQA 1X1QA 2P5UA 1ZEJA 2FRVA 3H3JA 2GN6A 3IUMA 3C3AA 5CPFA 5FPYA 2JJ8A 4I1IA 4V0MA 4YXWD 1XLUA 1U04A 2Q3EA 3F0TA 1GL7A 2P62A 2NP6A 1BCSB 2H2AA 3G7UA 3R44A 3O7MA 4RAOA 1JEYB 3H1PA 3NATA 3CVOA 1F3OA 1KHHA 3KS9A 4MIKA 2JLXA 3AKYA 1N6LA 1C7IA 1VECA 1Y9ZA 3CBQA 2J4CA 3U4QB 1J2UA 2VP3A 5LP6B 3VNVA 1D0IA 2VNKA 3NHFA 1MA0A 3A1EA 3LKDA 1DHRA 1GPKA 1T8SA 2HCRA 1ZUHA 2ECKA 4KIWA 1U7XA 2EL9A 4N47A 3CF6R 3NRBA 2VUSA 3O0DA 1XK7A 3DE6X 1TKAA 1L1EA 2W6IA 2NVUB 4EI8A 2AQIA 2JATA 2BDTA 2G36A 5C5EA 5K4GA 1XRNA 1DRJA 4LHZA 2H1SA 2OOKA 5DHSA 4ZTBA 3H11B 2WIKA 1NNSA 1Z4QA 2H0QA 2V9PA 2W2LD 2ZVPX 1TRHA 1VB3A 2GN8A 3LBHA 1ORHA 3C3XA 4UAJA 1JQKA 1EYZA 1I5OA 1UMDB 2XTAA 4UEKA 2NV0A 3QP9A 3VR6H 3GNTA 1T4DA 4PXSA 3CLKA 2XNDA 3GJ7A 2XEXA 3V1LA 4AJJA 3N1UA 5KOJA 1BU8A 1LSSA 3OHPA 2HW8A 1VLJA 1CP2A 2CKDA 1CQZA 3QPWA 3ZY2A 1G8SA 2C07A 3KYCA 3A7EA 2XNCA 4HDRB 4O25A 1C1DA 4FDLA 4WK0B 4F38A 3H6GA 4LTNA 1AE1A 3VZRA 4CIWA 3UMYA 1NLYA 1VL5A 2CL5A 4NL4H 3E3AA 3EPPA 2W93A 4GDMA 1NUQA 4PPQA 1X7XA 2DPMA 3NTVA 4CETA 4KACA 2VBGA 1UBRS 3KJXA 5CNKA 4NCAA 1IRXA 3QKTA 4GL2A 4ZPXA 1YVRA 4GZMA 1RM4A 1IY0A 4GQAA 5CNMA 4OU5A 4YMIA 5E9JA 3TLJA 1DRUA 2A8YA 2YHBA 3GQBA 3T41A 1CUAA 5E4JA 1FL9A 2C5AA 2WHXA 3RWMB 1CQJA 3VJKA 1YDFA 1GQFA 5KYWA 1BHJA 2PR2A 4K9LA 1SM4A 1NW7A 4IHQA 2F8LA 4RM3A 5EUMA 3GLUA 3W05A 2HSEA 2C0QA 3T54A 2ERXA 1Q77A 1XBTA 2OXFA 1FP2A 3QFFA 2EIXA 1F4PA 2VBFA 5GAJA 4ZDWA 3C85A 3VKUA 4BVKA 1XVVA 3WIUA 2EIHA 1G6KA 2OXTA 2WJWA 3ICPA 4OP2A 4S0ZA 1S9DA 3IJRA 2XCOA 3DE3X 4C1NA 2XY4A 1TAHA 2ZBFA 4GF5A 2OYCA 4QNRA 4OI2A 1EFPB 3G85A 5SYAA 5FOSA 2JLUA 3M4NA 1WVGA 1Z82A 4CE6A 1IBSA 3BYZA 1VKOA 1DDIA 1VCNA 2FXVA 1VI5A 3CJRA 3L4SO 1UDCA 1NG9A 1J1UA 4RCVA 3GT3A 3X2SA 2YCBA 4W6QA 4I4NA 4WCDA 2EFGA 4FIZA 1U9YA 4NMXB 5ERXA 4O59O 4JZKA 1YTUA 2PUGA 1LD3A 5DHUA 1UBUS 3MG9A 4OEHA 1RPNA 1E5DA 1I3KA 2Q50A 2PKQO 3KE8A 2NYRA 4F3YA 4RLFA 2ZAOA 2OAQ1 5HVNA 3KQNA 2O5VA 1TQHA 1F8FA 5C8YA 3TB6A 1Q2XA 4BO8A 5KBYA 5JDIC 3NXKA 4KQEA 3MTBA 1KK0A 2J41A 1OWOA 4P7GA 2IOFA 1VJ0A 2GARA 4OJYA 5JPIA 1Q44A 2Z5FA 5KMGA 1VHTA 4QEDA 4X60A 4A36A 1A97A 4QL3A 4X8HA 1X6VA 3JQ9A 3H05A 3E9ZA 3OMWA 4MVJG 1NFFA 1DX6A 3ND9A 3PGA1 4U8GA 3H0KA 3F2IA 3VAAA 1BVUA 1WSDA 2B5VA 4N3BA 4D0SA 1M2HA 4O1HA 1N0IA 3VR6D 4BKRA 4ZEXA 3MCZA 5HYVA 2G7ZA 5CA1F 2O19A 1R6BX 2ZYTX 3LFTA 3HCPA 3Q3HA 4EBFA 1JDBC 4QQFA 1FYFA 4TV8F 2JAWA 2PMCA 3MLEA 4DWWA 3KKZA 3BB4A 3NX4A 3X1DA 5T6MA 2PUEA 4GBJA 1VJ1A 4B79A 3W2IA 2ENWA 3FVQA 4LA4A 4YRDA 2GJ8A 5I7HA 4LZOA 4MYCA 3P2OA 4ER5A 1U63A 5H5JA 1ESDA 4WZAE 3IMFA 1OGIA 2E9SA 2RC6A 4JK3A 1N2EA 2X5KO 2XGJA 1U2TA 1J2EA 4V1CA 3UF0A 1XTTA 1HYBA 1WHTA 2X4IA 2R7NA 2Q0SA 3CLUD 5A7GA 3NBQA 1ZHOA 3SXJA 4PY2A 4KR0A 3IUBA 1Z7WA 4QYMA 1ZBQA 5GONA 1AKNA 2WM3A 3WTCA 2Q07A 3P9SA 2XUOA 1TGVA 3FCUB 1SXJB 1UWLA 4DLUA 3PD0A 2QRGA 3TZHA 3O91A 2XBUA 5SYMA 1MV5A 3CO5A 1PEDA 2CJWB 1T36B 5ALQA 1EJ0A 1UIMA 4YGXB 3IBGA 1DPGA 2FWIA 3JWGA 3GVCA 3LXUX 4ZQFA 1D4ZA 3PDJA 4MW7A 2R6ZA 4B6JA 1CFZA 4LECA 1SU6A 3OIFA 3BX1A 1GV0A 4UBMA 3MWEB 3DPSA 5LQJA 4F4HA 4RPLA 4YFVA 2B1GA 5IM5A 4N0EA 4ZJYA 1TF5A 1W96A 2Q6LA 1GZ7A 1CUXA 2W2NA 4LDNA 4RJJA 2ZR0A 4A91A 3I34X 1E98A 1GFWA 3DMTC 5LB2A 4DA0A 1AC5A 2VQEB 1R8JA 2O1XA 2BR3A 3D4NA 3KDAA 3MWDA 3V80A 4QOFA 1YKSA 1I2AA 3TIGA 1SQSA 2IC5A 2X4LA 1RE0A 3TFWA 4EEXA 1HDCA 2C7GA 2P0AA 5F9HA 1DDGA 1WVIA 2B4YA 4YONB 1E6MA 1F9AA 1QE5A 3KUUA 3DMHA 1N2JA 1HTTA 2I71A 1V48A 4LNHA 1NXWA 4MRAA 3SIRA 4L2IA 2HTEA 1T5SA 3RT7A 1LSUA 2F3TA 1BDHA 2TMGA 2AWOA 3H5NA 4MUAA 1LV7A 3KOMA 3RV4A 3C15C 3IVAA 1JG4A 1BNCA 3B70A 1UQRA 4AROA 2CNKA 4QFBA 3G89A 2WWTA 5JSZA 2HM7A 4AIIA 4XR9A 2ZUEA 3A3NA 4RUKA 1CXZA 1I9GA 1X3SA 4TMVA 4FMBB 5ALIA 5BNZA 3PNKA 5JECA 2ZT6A 1MQSA 4PO3X 3HHPA 3JQ7A 3R1IA 2JZOA 5CK5A 2IIPA 3TOVA 3RS0A 5G1OA 1OFUA 4DARA 4ND8A 1QP0A 3BGSA 2B20A 4I2NA 4Q66C 2PGIA 3LZDA 1QC5B 4AUEA 5DIZA 1W94A 2A33A 1VLLA 2H4YA 3LXMA 4C3OB 3U5ZB 4CQJA 4A8JB 3F6SA 3FWYA 1GOTA 2Z2YA 3SC2B 3QMVA 2JIDA 1G4AE 2EJCA 4MP8A 4P2BA 4EQZA 1YO6A 4OYRA 3D6FA 4YMVA 4CFYA 1CLUA 1OIVA 2NV2B 4XJSA 1NR1A 2YJTD 5U4XA 2G07A 1F8UA 1QFSA 4V03A 2H5IA 4MEAA 4EJSC 1M2JA 2YCLA 2J6HA 2ZG6A 1PBTA 3T9EA 1NDUA 1OXKB 4U8HA 2NSDA 2UUOA 1BAPA 3WWEA 1ZRHA 3UYLA 3HVRA 2YX1A 1S8OA 1Z26A 4A82A 5ABPA 3W5AA 3FI0A 5EJAA 1E1CB 4H31A 2Y2UA 4FBMA 3AUXA 1ZD9A 2UZ4A 4TQGA 1XKQA 2BZSA 3GJ3A 5JADA 2AHOA 3NP9A 4MROA 5I5GA 2ZANA 2H2WA 4K2AA 3L1UA 1EDOA 2HYDA 3FRIA 3N2KB 5HCNA 3F6CA 1DRWA 3WL6A 5E2IA 5IAEA 2HF7A 2WKWA 3ZQJA 3K7EA 4LISA 4BV8A 4CU2A 2VR1A 2XGGA 5LPNA 1RIFA 4Z0NA 4KXQA 1A4RA 4P6VF 2AA3A 3TN7A 1IN5A 3WKEA 4BJ1A 1NI4A 3T3OA 3W7VA 4H4CA 3AEUA 1QUEA 3WIDA 3WK5A 2ZM5A 3DR3A 1YR1A 4P7BA 3ROTA 4PO1A 3NQ41 3CVUA 4LFAB 3A6GA 2PK3A 3W5UA 3FBTA 4ISCA 5KCMA 1EVKA 1G66A 4RX1A 3JARB 3U5TA 4DLZA 4F11A 5JY6A 3DLAA 2V3WA 4CV3A 3I8OA 3H2GA 4L6AA 4PPFA 2FWNA 4UE6A 5LQNA 2RH9B 4PRYA 3L8YA 4B0OA 4FS3A 2JLQA 5BW4A 1HDIA 3SBEA 5DHQA 1RTKA 3KTAB 1UCFA 2P2LA 2NXCA 1LJLA 5KYYB 1EE9A 4HNGA 5ETJA 1W30A 3BOSA 1ID8A 4MVCA 4XSHA 2XCLA 4MRNA 3EARA 4QGSA 3P9CA 4NU6A 1XZDA 2Y0EA 1QB8A 1H0HA 1HXHA 4B34A 2ONZA 3NGMA 4F96A 1PJ4A 3IKTA 1T9KA 2PR7A 3H16A 1X80A 1NUUA 3W8FA 1U8UA 5FNVF 1V0JA 4Q9AA 1PD1A 3PQEA 5DNDA 2ZI9A 4KQ6A 1RCFA 1JF8A 4OBWA 5A6VA 5BQOA 1Z0JA 3L43A 2IYEA 4DR1B 3L7IA 1GPWB 5LQSA 1RM5A 1AHNA 3H8WA 3LCUA 3UC9A 2BW0A 3R74A 2OORC 3I6QA 2C1EA 1ZHHA 2D5IA 2I3DA 1R9GA 3E2PA 3GIWA 4HQKA 4DA4A 2GBLA 4QDUA 3KXIA 1YBVA 3LLMA 1OZHA 2NADA 1IOVA 4IAOA 4FFDA 4H15A 4N0MA 4JJGA 1TX4B 4BLQA 1A27A 1P74A 1Z6PA 2CL7X 3D02A 1NXPA 1Q74A 1JIVA 2ISSD 4M9CA 4GR4A 3L7NA 3ZDBA 1J2RA 2EP7A 3E61A 1U90A 3ZPXA 5G1NA 1MT3A 4Z2YA 1YRHA 1D6SA 2HRZA 2GEKA 4IOLA 2BYTA 3KR1A 1YJBA 1PUXA 2W6CX 1ATIA 2GZ2A 3W1EA 1W2HA 3ENQA 4S1TA 3U48A 4MDFA 5K8LA 4BLSA 3K3PA 4CNBA 4NCIA 1EX7A 5EIBC 1PV4A 2PRYA 3CIFA 3T38A 1YJCA 1UL1X 3BBLA 1M1UA 5E9QA 1N0UA 2QR2A 3CKMA 4F21A 3EVZA 2QB5A 4TKVB 3BMQB 4RVUA 3VTFA 2DQKA 3SYMA 3OQIB 4EHFA 2VPYA 4U2FA 1FJ2A 3OJ0A 5TARA 5KOHB 4OQDA 3RC8A 1WZUA 2LZ0A 2GDZA 4BNDB 2HPZA 2E4XA 3NC4A 4I5IA 2PWZA 3ZHCA 4O4JB 3MYYA 3ND8A 2P2SA 1NW8A 2ETXA 2PX3A 4MW1A 3WR5A 3B8HA 4UM8B 4UHKA 3UCXA 5C7YA 1PLKA 1G3MA 2JFFA 3PNMA 4H6WA 4IPTA 1PNQA 1QGAA 2GESA 3DF7A 4MRPA 1TZCA 4UD2A 3P2IA 2WZQA 3VVCA 3W8DA 4YAKA 2JLAA 4CMBA 5JS2A 3IEPA 1ZLYA 4DC1A 3TR6A 3ZWXA 4IUYA 4GOXA 5MN5A 1PSDA 5NLLA 4IJVA 1T0HB 3UJNA 1M1ZA 4BHTA 5KU7A 1DOHA 2BBOA 3WMRA 1OFTA 1MO3A 4Q48A 4WDRA 1XROA 1K8RA 2XUFA 2I4NA 2I3AA 4Q21A 2PL1A 2VLIA 4YAOA 3ZG6A 1WLSA 1PZEA 2LRHA 4FNMA 4K3UA 1FA9A 5T4FA 4YV1A 1SHKA 1JR6A 4E2YA 1JG6A 3TOXA 2IUTA 3EVEA 3TJMA 4DYHA 4PV7A 1VIMA 2J9XB 4KQHA 4CQNA 1EUCA 1T5OA 1Y6JA 1TF2A 3FZGA 3NH9A 2XCRB 3AR6A 4UEQA 5TPZA 3CGGA 5IWAB 3T52A 3DOFA 2VWPA 4CI9A 2PUCA 1GIAA 3OTQA 2QSJA 3KPWA 5TQ2B 4DCTA 3B89A 5CIYA 2JFVA 4L9RA 2WHQA 2H08A 2GYWA 2J67A 3R0XA 3K09A 5C7IO 1R5OA 4BLOA 3UJPA 2J0VA 3R3XA 1Q22A 2FPIA 2P68A 1YRQA 3SF0A 1K63A 5TT1A 1KZGB 1S0UA 1KFBB 2IZ1A 2BZ0A 1Z68A 1YZVA 2GA8A 3R5TA 2O2GA 4OUDB 1SXPA 5LYJF 3HH8A 3HZOA 4ARIA 4N41A 1GM5A 3IPAA 2D8MA 2WKRA 2GHTA 3KQMA 1T5BA 3A6HA 2IYXA 1NXTA 3KWLA 1Q50A 3LC0A 3SNKA 4G0ZA 2J5XA 4TV9F 5AOAA 3Q6MA 1PTJA 5KDDA 3AHDA 1WDLA 3RTEA 3MIZA 3Q8KA 1TECE 3C7CB 1EFKA 1W85B 3KEMA 1QR2A 1OZGA 1E2FA 3UH1A 1IZYA 1R4MB 3M9XA 5CGQB 1P9NA 1WO8A 3KB8A 4ZRDA 3OTIA 3RSZA 3KCQA 4DPMA 3J80A 2IS6A 4FQ8A 1AV6A 1CHDA 5CFQA 2GPTA 2A59A 4DOMA 4EATA 1K4MA 1E2BA 2EW8A 2O2CA 4MMXB 3RODA 3EW9A 3DF9A 4O0LA 4RJTA 2ZSDA 4YCCA 2UYCA 2FMTA 2PGAA 3KTFA 2VJNA 3EPKA 1LLQA 1J0BA 3FJYA 1YU6A 1IZ7A 1YZQA 1ZI8A 2E55A 2GETA 2IITA 3NR2A 4N5NA 4IG4A 5BOVA 3KHUA 1N7IA 2BGIA 1GPAA 3QOWA 3AF5A 5AXBA 3F3MA 1BU5A 2BTQB 2Q62A 4KEAA 3OX2A 3RC1A 1HLDA 5JPCA 1ZK1A 1FP7A 1KH3A 3HCNA 3OA0A 3TZQA 3V9AA 4X62B 2I2AA 4XZ3A 4YRAA 2MWMA 3PGLA 3K8OE 2X3FA 1TM3E 1ZKDA 2RHTA 2VPXA 4RXUA 3UHJA 4DDTA 3KKOA 1JYFA 1SC4A 3PWKA 4H08A 4OB7A 4ZOEA 1KDOA 2XIJA 1LH0A 4DCPA 4ASUD 4CF5A 1BEUB 5K0JA 1ZN9A 4NABA 1KH2A 1ORRA 1GP2A 2ID7A 2IZ5A 3VU8A 1E61A 4ZAXA 4FWBA 4HXGA 3CPHA 4LV5B 1BHQ1 3ZUPA 3ZTYA 1M1YE 1FSSA 4LTDA 4HNVA 4FHEA 3ASVA 1TXGA 2C88A 4F9TA 2DHRA 2RB5A 2JGKA 1WP9A 1OU4A 4X5OA 3WOVA 3SEAA 3X44A 5FPKA 1PWZA 2OBLA 2G3YA 2J7KA 2W7TA 3QXSA 4B6GA 4P83A 3UAXA 2OFWA 1Y81A 4B3IA 4PSDA 4D0GA 5ILOA 4R9UC 3PX3A 4NMMA 3UB4A 4MQBA 1TJ5A 2IE0A 4AT1A 2QP9X 2R96A 1E59A 5KOYA 5KTMA 1H6CA 3I73A 4RH3A 3V8VA 1EDZA 4RVDA 4V0ME 3EXHC 1IATA 2QTRA 1JU9A 3LT5A 3SDBA 4HGQA 5DV9A 3TECE 3MAJA 1IVSA 4ITUA 2PMWB 1N6OA 3HUDA 1KJNA 4PX5A 3L7BA 3O0TA 4KWCA 3FPCA 3O8NA 1V41E 3IEKA 4B4OA 2WINI 1SPXA 4OQLA 4J16A 4QXPA 3IEUA 1QRSA 3L1HA 1UK8A 4POAA 5CFZA 3MF4A 3FHLA 3FZNA 2A2ZA 4E5KA 1KS9A 1KP9A 4EGJA 2YW2A 3EGCA 2WDPA 2GBIA 3S99A 3P0JA 4IYJA 5ALLA 5KJEA 2X2FA 3CLSC 2AG1A 3CVYA 3SLKA 3GJQA 2FOXA 3D4LA 4YEDA 5JQGF 4HDMB 3K72B 4L02A 2WJYA 2ODAA 2C4KA 4D43A 3K9WA 2XVZA 3EQ2A 2VTDA 3BMOB 5GTDA 4U02A 3SJCA