4DBLE

Crystal structure of e159q mutant of btucdf
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
245
structure length
245
Chain Sequence
AAPRVITLSPANTELAFAAGITPVGVSSYSDYPPQAQKIEQVSTWQGMNLERIVALKPDLVIAWRGGNAERQVDQLASLGIKVMWVDATSIEQIANALRQLAPWSPQPDKAEQAAQSLLDQYAQLKAQYADKPKKRVFLQFGINPPFTSGKESIQNQVLEVCGGENIFKDSRVPWPQVSREQVLARSPQAIVITGGPDQIPKIKQYWGEQLKIPVIPLTSDWFERASPRIILAAQQLCNALSQVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Asymmetric states of vitamin B12 transporter BtuCD are not discriminated by its cognate substrate binding protein BtuF.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords Vitamin B12 import system permease protein BtuC
total genus 68
structure length 245
sequence length 245
chains with identical sequence J
ec nomenclature
pdb deposition date 2012-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4dblE01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4dblE02
2MINB 1G21A 5CX1B 3K1AA 4ND8B 1G21B 5CX1A 2AFHB 3AEUB 3MWGA 3EIWA 4MDYA 4HMPA 3PDIA 4OXRA 1M1YB 3U7QA 5M34A 2OSVA 3TEFA 4OVKA 4UDNA 4BBPA 5HX7A 3K1AB 2PRSA 2XV1A 3AESA 3AESB 2AFIA 2XQVA 4INPA 1TOAA 3MWFA 4H0FA 5JG7A 1M1YA 3TLKA 1M34B 2XUZA 1L5HA 2PS3A 2ETVA 4G09A 2Q8QA 3AEQB 5JPDA 1QGUB 1QH8A 3AETB 1ESZA 1QGUA 3AETA 1N2ZA 1K75A 3MD9A 1KARA 1N4AA 4WZAA 3CX3A 1K7SN 1M1NB 3BE5A 3HJTA 2M6KA 4WN9A 5KOJA 3R5SA 4MO9A 3AERA 1N2CA 2PHZA 1N2CB 2OGWA 2WI8A 4CL2A 5KOHB 4FKMA 4WZBA 1G20B 3GI1A 5I4KA 1H1LA 3LI2A 2PS9A 2XDQB 4INOA 2XDQA 2QI9F 5KOJB 3AEKB 4MLZA 3AEUA 3EIXA 3AEKA 2R7AA 1N4DA 3MFQA 4PM4A 2YNMD 3PDIB 4UDOA 3BE6A 2M6LA 3MINA 3ZK8A 5GGXA 5BVHA 5BVHB 4XPIA 3HXPA 1G20A 5JOQA 5M29A 2X4LA 1H1LB 2RG7A 5AFSA 3G9QA 1KAEA 4TKVB 3TNYA 1MIOB 4ND8A 4WNAB 3ZK9A 2AFIB 4WNAA 2YNMC 3ZKAA 4HN9A 2OV3A 1K0FA 3PSHA 1KAHA 4UTOA 2MINA 4IRMA 4MX8A 3PSAA 2AFHA 1QH8B 4UTPA 1PSZA 4LJSA 4NNOA 1L5HB 1M34A 3AEQA 1QH1A 4WN9B 3AERB 3ZTTA 4FI3F 1FP4A 4G07A 1FP4B 2XH8A 5JJ5A 5KOHA 4HMQA 4OXQA 2OV1A 4FNAA 4B8YA 3LHSA 5HDQA 5CR9A 4DBLE 4LS3A 5FLYA 1M1NA 4WZAB 5B58T 1QH1B 4NNPA 4PAGA 4WESA 1XVLA 4GICA 4K3VA 4TKUA 4WESB 4TKUB 5GGYA 4M7OA 2Q8PA 4HMOA 3ZK7A 2WHYA 4WZBB 1EFDN 5M3BA 3UJPA 5KHLB 5BVGB 2XY4A 5BVGA 3R5TA 4N01A 4TKVA 2R79A 1MIOA 1K2VN 4FILA 1PQ4A 4XPIB 3NU1A 3HH8A 3MINB 3U7QB 5M2QA 2PS0A 4H59A 2O1EA
chains in the Genus database with same CATH superfamily
1NAIA 1M8FA 2HWXA 1ZW1A 1D5CA 4KQCA 4URVR 5KOYA 4RQUA 4DCGA 3P26A 4O4LF 1I7LA 2QZ4A 2P1DA 3BXOA 3EIWA 2GAJA 1WXXA 2V45A 4G0ZA 4HNHA 4IR7A 5L6MB 1FDVA 4UMVA 2QVGA 4MHSA 1P4AA 3PFKA 5TGDA 4ZHSA 3NC1C 4B6PA 2ZWMA 1P3DA 4FZRA 1DAFA 2QTCA 3EDCA 3GAMA 1EUCA 3K1AB 1EESA 5JAPA 4XJVA 3CRNA 4NAVA 1DV1A 1ADCA 3NH9A 3C24A 5DTIA 3GJZA 1OZHA 4D3XA 3A9VA 2EOAA 4B0PA 1A9RA 3QHPA 3DMHA 4L95C 3UMVA 1KC1A 2E18A 2ETVA 3HWWA 4N9QA 4XX1A 1G7SA 4KEAA 3SC4A 3OJCA 2IXDA 4RVCA 3AETB 1GDDA 5CFQA 1VPTA 2JPDA 4LFCB 3K1JA 1V9SA 2D74A 5T3YA 1Z73A 3C1UA 2PXXA 1KS2A 3PYLA 4LRSB 1MX9A 2CY0A 2RGNC 1V1RB 3RUDA 3T7KA 3K2IA 1AGRA 1ESNA 1KDRA 1M8JA 1O6CA 1NFFA 1S2OA 2BEVB 3ETNA 3S27A 1PGPA 2BFCB 2HTFA 3E9RA 5FBLB 4HS4A 1N2CB 3IELA 2C20A 4XX0A 4OMUA 1KYWA 1TLFA 1NBAA 3L7BA 5AVJA 2JLSA 4NZ9A 3ZHOA 4ZCIA 2VXCA 3AEKB 2AN1A 3IEVA 4CBVA 4JUBA 1E98A 1RAGA 2WIDA 5M5BA 1NUPA 2P9FA 3ZGVA 3IR6A 4TXHA 2QNBA 1AHNA 5HF5A 5CBPB 4OQEA 4BMCA 3SKVA 2YOFA 4U9IS 2QPLA 2ASEA 3B53X 2XADA 2YVLA 1ICIA 1AURA 1ZJ5A 4MKRA 5ALNA 4WV3A 1GTMA 2C4MA 1U65A 1WBBA 4MRMB 3PQ8A 5C51B 3HXMA 3NAGA 5FI0B 1U0TA 5EIBC 3BF7A 4KITB 1GARA 3CNNA 3OQIB 4KDRA 4UHDA 3UUWA 3V9PA 1QOPB 1Y8AA 1N5OX 1QYWA 4RV9A 3MT8A 1TM2A 3EFOB 3MT0A 4OEHA 4LXHA 2NU8B 1J0XO 2E4UA 1EE2A 1T2EA 4NBUA 4EUKA 3FPBA 3HCCA 2PGNA 2W6JD 5AM1A 5F7ZA 1P1KA 4YBZA 3AW8A 1R8SA 4MZDA 3NR2A 3SSAA 3TOCA 4CCAA 4JL5A 4MKZA 3SDSA 3V4PB 4L4ZA 4AKEA 3SX0A 3DG9A 3FIUA 5DK4A 3KDSE 4NFSA 1H2FA 4DIDA 4WLOA 2FUEA 4RLHA 1CLUA 5E6RB 3UJDA 3NP9A 1ZD5A 1NVBA 3WDLA 1CJTC 1GVNB 3L18A 4Z2YA 2BFFB 1W9MA 1NP3A 3AR7A 3GMDA 5U9CA 1CHDA 1ESDA 3WYDA 2QAGB 3U9TA 3D3WA 2GCEA 3KV1A 3NATA 4QOGA 3L4JA 1GKUB 2K87A 3A9RA 4FJ2A 2YJTD 1ZGZA 1JJAA 1OFIA 1UPAA 3K53A 3S81A 3SP1A 4ENPA 5CD9A 2Y0BA 1SC3A 5AOVA 3IVGA 3OIVA 1NDHA 2HRQA 2QYTA 4XARA 4OQZA 1Z8HA 4ZDWA 1XRPA 3MOSA 5BWMA 3H5OA 1II0A 3KBOA 3HH8A 4OV6B 4CQMA 4E11A 5L8VA 2BE7A 2ZVDA 3QFRA 4R05A 1GIAA 3LOUA 3VU8A 5JADA 5JJCA 4BLPA 2WABA 4FFPA 5I51A 2V7VA 4P22A 4QOFA 4EKGA 4W99A 3P4YA 5G53C 3PNPA 2GM5A 1SD5A 3SF0A 4DC1A 1NI4A 1WF6A 1WR8A 5H83A 4GZ3A 4OMDA 2O8DA 4FEAA 2R8YA 3THOA 1NZJA 1NLFA 2AOVA 1NBMD 2P5SA 5ALUA 4F8JA 4G56A 3ZGXA 3DLAA 3BOSA 3L06A 4GNKA 3TSCA 1J49A 1PR9A 1KR5A 1U7ZA 2DQ4A 1FX0B 4QTTB 1QVZA 2ZANA 1NMQA 2WMOB 2OCLA 3L5KA 5BMVA 5AHOA 3LCCA 4LQDA 3SSNA 4JOSA 4HLUA 4QG3A 1URPA 3SK0A 5A4FS 3N05A 3R6TA 1XXHB 5L3ZA 4UE6A 3D7MA 4QNNA 5AJUA 4NHOA 3HDQA 4QPJC 1SCIA 5D51S 3ZHZA 3LX4A 2QD3A 3MPUA 3IE0A 4IDBA 1V41E 3C16C 5DOVA 1YAJA 4HLNA 4GMHA 4HB3A 1LU9A 4WFIA 2WUVA 1PQPA 2A9OA 1KZ1A 2D1TA 4RZQA 4B3MB 3IURA 3ICOA 1A04A 2XDYA 3II6X 3SC2A 1D2EA 3GDOA 4LDZA 4CR6A 3MG9A 2GCGA 5KOIA 5LP6F 2EL7A 3W79A 2JGRA 1LNSA 2E0IA 4LZWA 4NYIR 4BO4A 3USES 3IUBA 1DKLA 2IYSA 3ORFA 2QTWB 3OCVA 1DTWB 4MRPA 5EMKA 3CRW1 3EMVA 5EXSA 4LK2A 5HZMA 2QOEA 1R6BX 3I28A 4L5CA 1ZSYA 2GUWA 3NIWA 2AFIB 2HF2A 1RDFA 2CWWA 2WA1A 3N86A 5E2IA 4F12A 4HVLA 4QPNA 1FJXA 1COWA 1P1FA 2NZUG 1GLVA 5DBIA 1Q3KA 1BEUB 4XGKA 3HXKA 5HOEA 3EGIA 4X92A 2MSDB 1XX6A 2VQ6A 4GXRA 2YV3A 2C1ZA 1G8HA 5EHIA 1UR5A 3V8EA 2GCOA 2OHJA 4W5QA 3WB9A 5BN4B 1KEWA 2Q4RA 3V4RA 3U17A 4BFUA 5JLJA 5KYKA 2DQSA 1LDGA 3OOHA 3UVEA 2YMLA 4ZIRB 3WL3A 3WFJA 4QDTA 4GMFA 4B6SA 3N75A 4MZXA 4AS2A 2OCAA 5DBHX 2QYSA 4IVPA 4Q47A 2XH8A 3VU9B 2BRUA 2F67A 1DJLA 1GT91 3EK2A 3EXFA 3PFCA 5FQOA 5FO0A 1S3FA 1HY3A 1T3TA 3ODPA 4KSCA 3RB8A 5KVVA 5JU6A 2ZBPA 5HILA 5ANRB 2O06A 4L5YA 3B1XA 2P9JA 4CR7A 5FBHA 4LE1A 3ZW7A 4BO8A 1LFAA 4FZ3A 4BE9A 4RTRA 3H5RA 4NQRA 2C83A 2GKGA 3MRXA 3EVTA 4RIFA 1T2NA 2FMFA 3HS3A 4N01A 5CDUA 2GJ4A 3AINA 4CCWA 3OCUA 3QVLA 3O4RA 2VCEA 1OA1A 3H1AA 3ZPXA 1RWKA 3V1UA 3CZAA 2ZRCA 3E9QA 4QEZA 3CWQA 2Z4RA 3LWDA 3P8ZA 4PCVA 4XYGA 4XVQA 2IH2A 4F7WA 4FEEA 1FY2A 1Y8CA 3H83A 3SI7A 4FN4A 4DLNA 2E1PA 3L8EA 4DLXA 3ZD6A 3F2VA 3FJYA 2AFHB 1FYWA 3O8OB 3R75A 2C9ZA 3FZGA 3GZJA 1LDNA 1WTAA 1E2JA 2P9YA 3BMCB 4RUKA 4UEWA 2REBA 5CDHA 4JP3A 4KUGA 2J6HA 3IBFA 3PYMA 4F46A 2Q99A 3KOOA 5DHQA 3ZBUA 1OLUB 1JHUA 1PF7E 5EAIA 4O2LA 1L5KA 3KETA 2JVJA 2Q6KA 2YXLA 3KT6A 4XCXA 4A3SA 5DM4A 4UU7A 4AG6A 4BB6A 4YRCA 4ZT3A 1U3GA 4P35A 3HGMA 3RI3A 3N8GA 1ZD4A 4UUAA 2KBEA 4HWPA 5JRJA 1VP3A 1YMVA 2Q7XA 1PL7A 3NWOA 4QTXA 4EWLA 4YRRA 2FXIA 1GOTA 2Z5FA 4PFQA 4BCCA 4PW0A 3PWZA 4XE5A 1SCKA 4JI1B 2AKEA 1K75A 2YXNA 3UH0A 3LLCA 5G0VA 4EJ0A 3ZQUA 3GLIE 3JQ7B 4PGGA 4MYCA 3DBHB 1FU7A 4NR0A 2H2HA 2FLVA 4PHCA 4UEOA 5LLSA 5C80A 3U4MA 5CT5A 4X8LA 5EY5B 2M6KA 4WN9A 2RK3A 4GRIA 1WOMA 1FP1D 1HC7A 2IY9A 3OKFA 3NNDA 3PRYA 2F6RA 3MQ4A 4B6QA 4BUJA 4CL2A 4K81B 4F38A 2E21A 3N39C 1IBSA 1NOKA 2WNHA 1QF9A 1Z2EA 2R00A 3OJWA 4JBXA 1G5QA 4PC6A 3VXKA 5A6SA 1OXVA 2YWEA 2DU8A 2JCXA 1QAOA 3AF1A 1L4LA 3DXZA 2BFMA 4G5YA 4DSNA 5CIWA 1Y7TA 1XSEA 4Y1FA 1C1HA 1SKYE 2Q4OA 3GLSA 3I39X 4GPEA 4G67A 4OFZA 1NQWA 1UKZA 5F21A 2IYVA 3LLVA 1RWOA 2D2XA 2Y1EA 1K3TA 4XPIA 2J5RA 4BRZA 3PXXA 4AZ0A 1FOEB 1FUIA 2JVIA 1FVOA 3OTIA 1SHLA 2C7OA 3ZIAD 4MRMA 1WHTB 1M2EA 1TGVA 1ZMOA 1AK2A 1HL3A 4O08A 1C9YA 1NP7A 2YZKA 3AY3A 1YD7A 4PO3X 4WNAA 5FWXA 3PQFA 4KP7A 3VOSA 4XPZA 4B8WA 4BMYA 1W0JD 4DW8A 3QFFA 4XIGS 2XXBA 2ODQA 3FIJA 2WFLB 2ZKLA 1VLQA 4C5BA 2YNMA 1RQNA 5ALIA 1IOZA 4CKEB 4BFXA 2LUOA 4DY4A 1ACMA 4QVIA 2GHQA 2IUSA 2JGEA 4H0CA 2W6MA 3RS8A 1WCXA 2EP7A 4CFZA 2EGHA 4FBMA 4HYTA 3HXLA 5DGDA 1BDMA 1A4XA 1ICEA 4J0HA 1PNOA 3SBXA 2DBZA 3WGMA 2IW1A 4DSZA 2BCGY 1PEAA 4QJ4A 1KK1A 1CR4A 5DI3A 4ZT2A 3VR2D 4ER6A 4OREX 1B8VA 1O94A 5KKNB 2ZSHA 5GONF 4KFTA 1ZHHA 2I4MA 2FE1A 3PENA 2JIBA 4HH3C 5HCIA 3WRVA 1DINA 1RBMA 4FZVA 1CS0B 5F7XA 3UMRA 1DWUA 1Z39A 3VA7A 4AZVA 2FWIA 1N3BA 2NT4A 2YASA 1N36B 1MORA 4UVGA 2VSYA 4RXTA 1CY4A 1PDWA 2WHYA 2Q3MA 1I8TA 3VOAA 1EK5A 1E1QD 1KMCA 1GL3A 4N0EA 3ZDRA 2II6A 2VTVA 1XQYA 3K72B 3OWHA 1SUAA 1U0JA 3UWDA 5K0BA 5LXTB 5C1DA 3W3AH 1AGYA 2DZDA 1G8AA 1JDJA 3F6CA 3IIMA 2PRYA 4JUDX 4NMMA 3VTAA 4DCCA 4TVSA 2DC1A 2X76A 2Q3DA 2IUEA 1XRLA 1EG7A 2QRGA 3M7IA 1N33B 4C07A 1CT9A 1L5MA 4XOIA 3WRXC 4EUEA 4JXKA 4ZPJA 5EZYA 4BATA 2XGJA 1GNTA 4J3FA 4JH0A 4X20B 1AS2A 5AK3A 4F3KA 2PE5A 4IKEA 1GUBA 2EZUA 1TU3A 2J9YB 3RFVA 3UCEA 2B9VA 2WF7A 1CHNA 1ZUD1 3OZCA 3E23A 3L77A 1RLTA 3ROZA 2RMKA 1LA2A 3G1TA 3KV3O 4JIMA 3RH0A 3WL5A 5A4IS 2CCJA 1F20A 1LW7A 4KXLA 1MEEA 4Z1MD 2R6ZA 1ACLA 1NXSA 4BVEA 4M1SA 2VP9A 2YWRA 2FB9A 1EQ2A 2APJA 2VP0A 2DH5A 3ITDA 4MYRA 4ZOLB 1V3VA 5G41A 5DRTA 1CR0A 2CXUA 2VOJA 3GJ7A 1GRQA 2EIXA 5KTOA 5K5EA 3A11A 4YAUA 1I01A 2HRRA 1EP3B 3L02A 4PZ0A 2NU9B 1H1TA 1QHHB 2JDID 1HDGO 1KS9A 5KOJA 2EW2A 1RKXA 1H65A 1X7WA 2V6JA 1BW9A 3QPAA 4CG2A 2PJRA 1XO1A 2F8LA 2Q62A 2OQVA 3GVPA 4BO1A 2GOYA 5LBIA 5LWQA 2P79A 1KKLA 1AO3A 1LS6A 2H0QA 4U4AA 3T7AA 3VOTA 4Y98A 5JC1A 1U8YA 1CQIB 4JJZA 4MPPA 2O7RA 4WEOA 3DWGA 3B7WA 4UDOA 4A6PA 1O0SA 5ECYA 5K2MA 2GX6A 2AG1A 2YIJA 3LBAA 1W2WB 2J1LA 4JGIA 2O0HA 3O2JA 1JTVA 1N25A 4RKQA 2VKQA 3KQNA 1D1SA 1FA9A 1OTYA 2WJJA 2BMFA 3F3YA 2E5LB 4KXFB 1L4EA 1HF3A 3GRPA 3O9VA 2R00C 4KN5A 5FUXA 1HKUA 3UEOA 4FYPA 3V46A 4C6SA 1E1KA 3A1EA 1BZYA 3L0SA 4HLQB 3EJ6A 1EB8A 3A7EA 3OCYA 2LIVA 4F92B 1XN4A 2WQZA 5TPWA 4IJKA 1SMKA 3T7CA 2YJ4A 3GCGA 1BHSA 2NP6A 1KZ4A 1JIIA 2AX4A 4HAIA 3RVLA 1JQJC 1MH1A 3ZXSA 5AM2A 1NMSA 1T4DA 1OXMA 1PHRA 4D3ZA 3C2QA 4GPD1 2C4KA 1G9TA 3L79A 1WHSA 3RVQA 4OX9Y 3PNSA 4CU2A 2H17A 3RT1A 4C0LA 4ACBA 1ZIXA 2WUEA 2XR1A 3QE0A 1CEQA 2ISSD 5SZKB 1J23A 3ZD9A 2A0WA 2LDXA 2ZQ5A 4ER5A 2J6BA 1DKRA 1Z2PX 3OT5A 4JB2A 4W4TA 1K7YA 3U49A 4DM3A 5LZ4A 3CLKA 2F2TA 4DABA 3CO0S 3LVRE 4FUTA 4GMDA 5DNWA 1X38A 3QLJA 4HDCA 3W34A 3ZV7A 1FRFS 3R0QA 1PUIA 4TKUA 4YP7A 4KE7A 1PS0A 2ZLBA 1C0KA 2C2OA 1I1HA 2MSCB 2Q41A 1WMAA 2GHIA 2JHPA 1P4JA 1ULSA 1XTUA 4BXOB 4HFNA 1QFJA 1ISGA 1R16A 1UQTA 4XYBA 3GLFA 2XMRA 1I6WA 3ICWA 1E1MA 1M0SA 1PW7A 1UT8A 2NNLD 4IIYA 2XAUA 5HF6A 5AVVA 2HA5A 1U7DA 3DMGA 3G9TA 1WWKA 4X60A 1Y98A 1L8LA 1TMGE 4Z4CA 3ET4A 1JQ3A 3DAGA 5C37A 3WIUA 4LZLA 1S1MA 4UNQA 2V7PA 4OYYA 3GZTB 2XB8A 3OCJA 3ZWOA 2I7TA 1WZ2A 1YZKA 2IPMA 1UPXA 2JI7A 2Q49A 3I9JA 3O0TA 4IX1A 4PGAA 1K68A 4UBNA 3T5TA 1K8RA 1RAHA 4Q7JB 2Q3BA 3O8QA 4R31A 3DBIA 4LYHA 4DADA 3IS3A 4JXXA 4RDHA 1ZAKA 3E8SA 1VL8A 2G9VA 3TZEA 2NQ2C 4KX5A 5EJIA 4EKEA 4MUFA 2I8AA 4JX8A 4YYEA 4AY4A 3DNFA 3KD2A 4BO3A 4S1OA 4JL8A 2HYDA 1B4DA 1JG4A 3ONNA 4F71A 1WKVA 2NYVA 1RADA 1PFKA 4MAMA 4MS1A 4GX2A 4TMXA 2NXNA 5TSDA 1M2OA 3T38A 4CF4A 5IPFA 2F1JA 4PSUA 1T6XA 4LC0A 1EUDB 2XTJA 2PWZA 2WG0A 3ZOKA 3DMTA 3QUSA 5L3SA 4I46A 4TXNA 4DGQA 1U7XA 1DAHA 4XWGA 2QVLA 4KIUA 2GJKA 4HN4B 3HDHA 3TGPA 4XIYA 2ZSDA 4I6EA 2C97A 4DLPA 2R84A 2XOEA 1WEKA 2PH1A 3I09A 4YRIA 5BWCA 5M7EA 5K99A 4IFEA 5T4HA 4YRTA 5A6SB 5HR5A 4MNTA 1C4OA 2ZJ8A 4TMKA 3OZDA 1NT4A 1R15A 1U0OC 2KWIA 1PZFA 2QVXX 3M9LA 4Y2VA 5T64A 2H52A 4J9UE 4ZXPA 3ZLJA 3IT2A 4DNOA 4NCJA 1HR0B 2NZJA 3AJ8A 3DFIA 4F1JA 3HEMA 3A3NA 2NSLA 2I2BA 3CN7A 4IOKA 1Q15A 1RTTA 1ABFA 2QW0X 4WINA 4TN5A 2H1OA 4NBTA 4IJMA 5L95A 4XDGA 4GZ5A 1VECA 2P7HA 2XCRB 1USIA 5MHTA 1LLDA 2FCAA 2XUHA 1NATA 1JP7A 4FYVA 4PRLA 1QZZA 2XWPA 4S0XA 3W8EA 2W6ZA 2X0FA 1DU4A 3D59A 3QXCA 4XTCS 3VR4A 2GB4A 2Q6VA 2ZQYA 4A7PA 4M36A 4FN5A 3V2IA 1EUCB 3G8DA 1SUPA 2FMKA 3QVWA 5A02A 3CEPB 4JGGA 2B2CA 2CVPA 1U3FA 1I7QB 4HDRB 5TIIA 4RPLA 1Y89A 2WWIA 4DRXA 1CR1A 1MQ9A 1JEEA 2XZDA 4QYIA 2E55A 4L57A 4QFCA 1O6BA 1ZOIA 3CVXA 3CW9A 1AGPA 2FF5A 2DFDA 3R8XA 3P0FA 4G23A 1J5XA 2W2VA 4P4UA 3VKWA 3WYGA 3I1YA 4R8VA 5TXGA 3EQ8A 1UEXC 4OHVA 2BDUA 3Q6NA 4NJEB 1IHDA 4KXUA 4RMHA 5E6UA 4QLBA 1BN6A 3CV3A 4KQKA 5GOZA 4DJTA 2ZEJA 5SV2A 5HE9A 1AVTA 1VSQA 2IA5A 3CH4B 3FFWA 4GP7A 4IIXA 4R8MA 4NCAA 3DTTA 4QYMA 5JRZA 1B0UA 4MVJE 5TQ0A 4B3XA 1CUAA 1Q2UA 4Q4LA 4C08A 2JGNA 4X7RA 3V9AA 1PJTA 3T9DA 5IC4A 1D9XA 3DXXA 3ZD7A 3REOA 3GDFA 1TT5B 4M1ZA 5B6IA 2V7BA 5BN3A 1JQDA 4E4RA 1PR4A 4P4SB 2WPDD 5KYVA 4G8BA 3KVRA 4MW0A 4NPHA 1B1CA 2IL1A 2XTZA 4FILA 3O4FA 3OC0A 2DUNA 2ORED 5AW6A 1D6SA 1UBRS 3JRWA 3C6ZA 4L6IA 4OQYA 5A3VA 3OEYA 5D6NA 4Y0AA 1YZQA 4DREA 3T7SA 5BURA 4CTMA 2WLSA 1UPCA 4M1OA 2KPOA 1BNCA 2HSJA 2IV2X 1B3RA 3CZMA 4H7JA 3V1YA 1M7GA 4QKQA 1PTJA 3GZNB 4H3KB 4CE6A 2C9CA 1SBIA 5H7XA 3T12A 1JKJA 1VP9A 4MI1A 1IUKA 4Z53A 2WYIA 2PXCA 4HADA 1V96A 4WKCA 3H18A 4RIIA 5JUWA 1TEZA 1PR3A 1KE2A 2QPOA 1B41A 2C9DA 2CNLA 2I54A 2H7YA 3JVVA 5BP7A 1JXAA 1CD5A 4X9XA 3F9IA 2GPWA 1FTWA 3AEQB 4C04A 4MW2A 2WKWA 3WYNA 4WZBE 1G3UA 2VPYA 3WGYA 3NP7A 5FBKA 4E5KA 4R83A 4J1QA 1N1EA 4FQ8A 4QYXA 2BSQA 4YRSA 3UMJA 5KO2A 4D6PA 1ES9A 3PGLA 4EY4A 5FX2A 5JSZA 4DUPA 3R5SA 3ZWBA 1Z18A 2FRDA 1RFGE 4FXPA 5FL3A 2QMOA 1E2EA 1OZ0A 4IVNA 5HKAA 4OK6A 4Z7QB 1N7GA 1Z16A 1ITZA 5AH0A 1ORRA 1EIZA 1TL7C 2CMKA 2GI4A 2YW9A 2G5GX 2VYVA 1VL0A 1QLHA 3F7NA 3QTLA 3P2OA 1TQDA 2XW6A 4PGFA 3SQDA 1W4ZA 1YVEI 3M1IA 2GN4A 3AUJB 4UQPA 3UW3A 4D8WA 1J8VA 5CA0F 3RE1A 1G66A 2R2GA 2AGVA 3Q7EA 2BEJA 4QDJA 4B80A 1TK9A 1ATIA 2HQBA 3DOJA 2Z56A 1NQUA 1OGIA 1TCCA 5IKMA 3ESYA 3UFXB 2SCUA 3C48A 1ZXXA 3BXPA 4G37A 4LQ4A 1P80A 1BCSB 1F6WA 4RHXA 1I9CA 3OEHA 3T94A 3JQEA 3KSUA 2Q1TA 1T34A 1RWQA 3F5SA 4CQMD 1NF3A 4N48A 1GL7A 3HU5A 4F21A 4PINA 3FFTA 3PF8A 4XB1A 1TCUA 5BWOA 5MFPA 2C8JA 2R1VB 3KEMA 4MVCA 5EWMB 3LYHA 4QYSA 1PSWA 3M6IA 3ROTA 4BE7B 4OJKA 3D81A 1IXYA 3BN3A 3P9CA 1FP4B 4RKWA 1R18A 3VR3A 4LWQA 2IU3A 3SR4A 4BP1A 4C6RA 4LFAB 5C8XA 2G06A 3MGAA 1X1SA 3SWWA 4V0SA 3DMRA 4JI7B 1U2TA 1E0JA 3SZGA 1M1NA 1EHYA 3GRKA 3IE1A 2JIZD 3HABA 2EVWX 2G8NA 4G0VA 1BE6A 5CRIA 3U9SA 2NZVG 1HFKA 4UUBA 2AOUA 2W22A 4RPKA 4CUKA 1UXHA 3VZQA 2G1UA 2Q8NA 3OUUA 3EVEA 3RHZA 2YMMA 4EX7A 2R8RA 1IZZA 3SC2B 3HBAA 1N2GA 3EIQA 5D86A 2HFKA 3L6DA 1RPAA 2G9NA 2HA7A 3ST7A 4P4NA 1KTIA 1YJBA 4DLRA 1KEEA 3A0RB 1OTHA 1E2NA 2FWAA 1S8FA 5IF3A 3H5VA 3AI2A 1LZLA 4KPEC 1HBJA 3L7IA 2Z5VA 4MQMA 2D8MA 4WNYA 2NU8A 3AL3A 3FFAA 4KWCA 3EQ9A 3U4GA 1DQYA 3GHYA 3LRPA 3IV9A 4FSDA 3LT2A 4CGYA 2IYUA 4KREA 1TO1E 1XYYA 2OMKA 1QZ3A 3GVCA 2XJ9A 1G16A 1X7DA 4PAMA 3MW8A 4LF7B 3MWDA 3TXAA 1EX1A 1XD9A 3P0RA 1D07A 3W2EA 2XDWA 1SQ6A 3DW1X 4JJ6A 5AM3A 3KHTA 2R6R1 5E4TA 3TTYA 2YUIA 4G09A 4V0OA 1B16A 3ZXXA 3U7RA 1K7CA 1RQ7A 3OZWA 3VSDA 4PC3A 3MCTA 4WKNA 3BKWA 4DLSA 3M3HA 1GU7A 4PWZA 1VPEA 3DTVB 3VO8A 2JFPA 3DDNA 3HR4A 3SIWA 1WUJS 4E09A 1FFCA 4LRXA 4H7PA 2DCUA 1N5RA 1FUKA 1CUFA 2VVTA 2FK8A 4JI4B 1JLRA 3CX3A 1Y9ZA 4GMGA 4NMXB 5JCJA 1RI3A 3TTTA 1D6MA 2J32A 4B7XA 2G80A 4OLAA 4LV6A 1L8AA 1NE7A 2ZUDA 2ZDGA 3WJ1A 1C8KA 1MRNA 3KWLA 3A06A 4IWXA 1GFZA 1NUQA 2OK7A 2UZIR 1SULA 2E5WA 3TKLA 3VYTB 1H1LA 3CKMA 2VJMB 2Z4SA 3UENA 4DPMA 3C6XA 3NO4A 3ZKWA 2XCSB 2VATA 3X1XA 1M75A 2UUPA 4GPBA 4OIMA 4CMBA 3MF4A 3VTKA 4FMDB 4EPXA 3MINA 2JGDA 5HQ3B 1GA6A 5EIBD 4E7OA 3C43A 4QC2A 4B47A 3ZJVA 2D6FA 5IMBA 4EEZA 1R00A 1YGYA 1P7WA 4LDQA 4PZUA 4KGDA 3BMCA 2VL7A 2J5KA 1UJ2A 4IEEA 3ZY5A 4DWWA 2HCRA 4RTNA 5EFOA 4GLBA 1NM5A 2Y0EA 3L04A 4ADSG 1CJCA 1DG9A 2CE7A 4LRQA 4M8IA 4F9EA 4DA9A 4N5HX 5IAGA 2B8JA 2ZI3A 4LNUA 4WT7A 1I1NA 1L5OA 2A0FA 3T1YB 3VUEA 4HRYA 4Z4IA 1CC1S 5DNDA 1KP3A 3GNLA 2EL9A 3DOCA 1NQTA 3VDNB 3C7AA 4HTAA 3PXGA 4UEJA 3CG4A 3E0QA 2PBZA 3NBAA 3OETA 4D0LB 3TR6A 3ACDA 4L22A 3FSEA 2OCPA 3MB5A 4R9RA 2NPFA 4MVJP 1M2VB 2P5YA 2ZRMA 4KPUA 3H87A 3V34A 5F64A 3BIFA 1ZVKA 3PC2A 1XWWA 1LPBB 2Q8PA 2WA2A 2VQFB 5F77A 3R7BA 3RAPR 4CTNA 1UBFA 4H15A 3RJZA 4JQZA 1WD5A 3P9KA 4YRFA 1I0LA 1U5BA 1EUYA 4BTVA 5IJ0B 3INGA 2PVSA 5JQGF 4KBYA 2QT0A 4I1RA 2R62A 2JAXA 5KPDA 3TLMA 2OD7A 2RD2A 3HNRA 1BGWA 1MFZA 4J07A 5K8TA 3OZUA 1DOHA 2DSTA 2Y77A 2O3UA 1NXOA 3H2KA 2MSEB 1KI2A 2E4YA 2OQ2A 5CLGA 5DNVA 3LBNA 4EKNB 4IGIA 3AUKA 1USGA 2QG6A 4XUCA 4OI4A 4YAIA 5DHTA 1D03A 3G5LA 1QQBA 3FWZA 3IVXA 2EDAA 3I9V1 4X3CA 4DCMA 1DQSA 4P1ZA 4RV5A 4GYYA 1YFLA 2F62A 2Y3IA 2O5CA 2O5VA 5CIQA 3A6EA 4YJGA 3RR2A 1LTHR 1GQYA 2HMAA 2JJ2A 3KQTA 1V5EA 3LM8A 5HCNA 3WZ2A 4QO7A 3T8YA 1J8FA 1JKIA 4Q9HA 2IPOA 2OEPA 2HNKA 4RADA 4JEHA 1MAUA 3B2NA 4NBWA 3O1JC 1QSGA 2FRDC 4JT9A 4RA9B 3L0DA 1ABBA 4QSHA 4I55F 2DCMA 5HK9A 1IU9A 1XR3A 4YJ2F 2Q9BA 1F6DA 2FGKA 5G0SA 1ESCA 2QTAA 2PR2A 5DIZA 3EF3A 2P2YA 5EHNA 5AXDA 5C7IO 4BQFA 1OC4A 4XWWA 1LDEA 4KRXA 3IBTA 1NW6A 2FFAA 4E88A 2QM0A 3DZJA 1VKHA 3QMWA 2C5HA 4LWPA 3E3AA 3QOYA 5T7BA 3RSZA 3FTEA 4Q4JA 3GUUA 4CNQA 3UGQA 3ZHTA 2XB4A 2XOKD 4N0PA 5I01A 1EFAA 1PGNA 1BHO1 2YJ3A 2YY7A 3OZEA 5FPYA 1RKBA 2XZTA 3LUBA 3LWZA 3I0MA 3NOOA 3PL5A 3Q1LA 4IDNA 2AR0A 1KOLA 3WDKA 4DCOA 3B2EA 3DYIA 3ZDQA 4DA0A 4QTYA 4NBSA 3AFIA 5DXAA 4MOWA 3AM3A 1Z68A 2OM2A 1BQEA 1U2GC 3KHSA 3N5CA 1T3HA 2XI4A 2AB0A 5REQA 2I6SA 2PKQO 4QA9A 4C3VA 2I76A 4H7KA 1HETA 1TJPB 2B0CA 5K6RA 3L7JA 3N0RA 4U9UA 1ADFA 1J9EA 1ZKMA 3N5KA 3STHA 3W7BA 1REQA 4FS3A 4J7UA 3D7LA 2EEZA 4B5LA 1U8XX 3SS9X 4JI8B 3WLJA 3M2TA 2JI9A 3BJIC 3K71B 2XVAA 1IXSB 5B3KA 1N6LA 2IOHA 3LXXA 3NJ8A 1GNPA 3E22A 4DUGD 3F5DA 3IXMA 4I9UA 1ZM9A 3GDGA 4TTVA 4URFA 2QDKA 2O7QA 3P5SA 2G1JA 5EGNA 2NTJA 2C8LA 4AUNA 5K8IA 2XUIA 5KQSA 2CV1A 3NALA 5H4GA 3U4DA 4RABA 3OE5A 5CLLA 2LE0A 1A69A 1XTZA 1YO6A 2YR0A 4YCLA 2V8OA 3VV2A 5JSFA 1QGAA 3E3LA 2RAPA 4PG4A 3AC0A 4KDEA 2JD2A 5JQGA 4PTLA 2QTRA 1I4DD 4QXOA 1VHDA 5JNLA 3OIDA 4MVYA 1AC5A 3GLQA 5FH9A 4IJUA 2BKLA 3A32A 3ZU4A 5L7WA 1YZUA 4L2IB 4C5AA 4U9HS 3ZV5A 3BK7A 2YFHA 1I3CA 2HT6A 2Z30A 2ZITA 2QDXA 2Z95A 2NUAB 4EY7A 5JANA 3I04A 4NY1A 3VI3B 1D1TA 2PSFA 4FNMA 2Y99A 4XW2A 4LE2A 5CH3A 3RF6A 2HJWA 3TRJA 3K9NA 4WEQA 1Y34E 2KBFA 3CGWA 4KK4A 1RQPA 1M6VA 1RLUA 3BYZA 1GJRA 3NUQA 4KSBA 1MA0A 3F97A 1QZXA 3SS8A 3GFOA 4ZCTA 2JBWA 1JLMA 2K2QB 2QRPA 4MKHA 1QIGA 1X87A 3E70C 4ZO8A 4RD2A 1AMUA 3OJXA 2HY7A 1B00A 3EBPA 4KZPA 4JBYA 5DBFA 4CQLB 1AS0A 2EATA 2Q3EA 5H5JA 3PNVA 4A8HA 4EJSB 4LF4B 1DAPA 2HBQA 3SLRA 4HG2A 2ZB8A 1T9KA 2B3DA 3CUKA 4C03A 4CPDA 4LPKA 1P0PA 3PDHA 3URMA 4CUJA 5J4KA 5IU6A 1XEWY 1ONPA 1V11A 5F5LA 4UOQA 5ALXA 1KFEB 3AOEA 1DJNA 3E81A 4UTXA 3HYNA 5F7OA 4K7JA 1MC8A 1PR1A 4LGYA 3USCS 2QENA 1IHPA 2HMYB 2R6HA 2WSSD 4P3XA 2CE2X 4UC0A 3QGMA 1CS0A 2I4RA 3CWCA 4FUQA 3BHMA 5IVDA 1YRHA 2WB4A 3P32A 4MULA 5KB3A 1SB9A 3C3KA 1PT7A 1T5DX 4CF5A 3AWDA 3AOGA 3W6OA 3L40A 3K1TA 2EG9A 4UM7A 3WZMA 2BFNA 2A5LA 2J3IA 2P65A 2CUTA 2ZTSA 2ZSBA 3NTVA 3I32A 2GRUA 5I9NA 2V9CA 1LKZA 1SVNA 4FWBA 4GSLA 4I9HA 4OH1A 4BXOA 2C82A 1HMPA 3BMNA 5REQB 3SZUA 1GITA 5DCUA 2ONCA 2J31A 1ZOPA 2H63A 2JJYA 2G4VA 2QTHA 4G5FA 1E5XA 1KTVA 2PGLA 1C0LA 2DF8A 4LF9B 5IJZA 4HWRA 1K92A 4YRKA 4Y6SA 3MMPA 1QMPA 2YN0A 3RFCA 3KQLA 4GP6A 4EGFA 2FQWA 4YCDA 4R81A 3MUOA 3HPQA 1YKSA 4KNYA 1ZPDA 5DB4A 1JHXA 4AB1A 3JD0A 4J2OA 2VNJA 1WHTA 4TZTA 2CLHB 1UM9B 2IHTA 4J75A 3NXSA 4DJDC 3Q87B 2RE8A 1M5UA 3GPDG 4O3MA 2ID4A 5DGHA 5F76A 4C4OA 5AJHA 3ZVKA 2F7SA 1I3KA 3H1EA 2EFCB 2ZRIA 1OXBB 4B09A 1R4MB 2CF5A 5CVUA 2FGJA 3QWHA 2XODA 1YACA 4LV5B 3RTEA 3HI6A 2P2GA 3AUTA 1JIVA 1LLFA 1UBOS 3B13B 4LNUB 1K7FB 3UJ7A 1DV2A 4MW4A 4F2WA 1M2JA 1T25A 3QLVC 2QT9A 2IVFA 3KIPA 5DLEA 3TTWA 3UA4A 3PPYA 4OQFA 2PSSA 2VRCD 4L7VA 4UU8A 1FQJA 1M2HA 2WJVA 4FE7A 3SJZA 1BW9B 4BBAA 5JQWA 1BAPA 3WKEA 1ZK0A 3O8CA 1P2FA 5E2BA 1N0IA 2W2LA 3V4LA 5AWFC 4D8TA 4GMXA 3NAQA 1CQIA 3BMOB 4M37A 3VAAA 4P0TA 1X8JA 3N2KA 1P7ZA 1BKDR 2Q21A 3O7WA 3WLPA 1E66A 3GA0A 3MTIA 4WVFA 3I45A 2AOTB 3L92A 2GLUA 3G85A 1EK1A 4LJKA 1J2YA 5HCUA 4XVUA 5EHZA 2O8FA 2X0EA 4RKYA 1HX7A 1I13A 2VXBA 2R85A 1K4YA 1XCOA 1ZMXA 4F60A 3TNDA 1P5FA 1R9JA 2HJVA 4FB4A 4S1PA 1JLLB 2QR2A 5F2EA 3TE7A 4B84A 2DY0A 3KKZA 5ALHA 1VE7A 4DKJA 3OZ7A 4YP9A 2A9QA 4ND1A 1EX9A 4IICA 4NXMB 3A6KA 2WQ6A 3A2MA 1C9NA 2D2IA 1P7VA 1E32A 1AF4A 3HCFA 4QM6A 2J41A 1Q6ZA 4CM5A 4HQRA 3U5TA 3EHEA 1V35A 1PX0A 1TIKA 4DUYB 1P5HA 3AESA 3RRJA 1CF9A 4HJXA 1TAQA 3JR7A 1AV6A 5JARA 2FAXA 1PQUA 2YHUA 3CZ9A 3EGDB 3L6RA 2H4ZA 2G77B 2JLAA 4JWTA 5ALPA 4Q3LA 1QV9A 2C0CA 1R5JA 5I8WA 1PUJA 3HHPA 1Q1GA 3HACA 5SYNA 4ALMA 3ZHBA 2ZUFA 2XE4A 13PKA 1H42A 2X9LA 1F4VA 4NJEA 5E6UB 2ACEA 2C4WA 1A9ZA 4DHWA 1FZTA 4YMLA 4MP8A 5TLSA 4MYSA 4O4HB 1BCRB 3ENVA 4D46A 1E2HA 1A8UA 1MEOA 3BRCA 3HZOA 1O96A 4MWGA 2FY8A 3ABQB 5DI3B 3RHSA 3PUYA 1Z7WA 4AFNA 2VQEB 3E7FA 4ILKA 4U8GA 1QX4A 3BCRA 1SFRA 3JQGB 2Q6OA 2VJCA 1E7WA 3TOZA 4LOJA 1XXLA 2Q45A 2YVQA 4WN3A 2JASA 3ROKA 3VDQA 2BMAA 4LBZA 4YUVA 1XF9A 1V45E 1U2ZA 2R7AA 3DE2X 4BV2A 4CVNA 1KY3A 4HEHA 4X85A 1N57A 2IC5A 3RT7A 1ZHOA 4YJKA 4B2IA 4HPXB 1I6LA 1SC1A 4Y1RB 5FTJA 3TLCA 2QV0A 2P67A 1SBCA 2JGMA 4CEJB 3TEMA 5K3SA 5JCJD 4MS1B 1P6QA 2OPHA 1BS1A 3PUZA 4LMBA 3MBKA 3GX1A 4D3YA 2D2EA 5C8ZA 3WWYA 1Z0KA 2C96A 1T36A 1S2GA 1UFKA 3ZCSA 1K6EA 5AHWA 2UZ3A 2RONA 1VSVA 4JL6A 3OOYA 3FRHA 4L73A 3A2LA 3SHFA 3WTBA 1U2RA 1YRBA 3HA5A 5DSXA 1AN9A 5FNVA 2DHDA 3MOIA 1XMSA 3RIGA 1MIHA 2QPAA 2A35A 2XCUA 5LD2C 3CW8X 2BGUA 4L4YA 1KFJB 4ZP1A 4NG4A 5TB5A 1VDZA 2E9SA 3QTBA 4OXKA 2R6GA 1ISRA 3WK8A 1I7PA 3MXOA 3PTLA 3THXB 2CV0A 5HQTA 1FK8A 3FKSD 4W82A 1NN1A 3FWHA 2FFBA 4R9SA 1G7TA 3GQVA 4BC0A 4EYQA 1QRAA 1IOVA 2FWBA 4TTAA 1FFYA 2Y0PA 1H05A 1E2PA 5E6SB 4YROA 5KJ1A 4CTJA 4RGQA 2VSOA 2IS2A 4BBZA 3K4HA 4CLDA 5ICEA 1U9IC 2DPLA 1LSSA 3HCAA 3KDPA 3M4YA 3P4UA 4OP1A 5JBIA 2OE2A 4MI6A 3IT3A 3LPDA 1IHUA 1B6RA 3VPFA 2GWHA 4EY6A 5LL6P 1E7SA 1O87A 2G6BA 4R1NA 2EERA 3CLHA 3IAXA 4C9BA 1JZTA 3RBAA 4DV0B 2HSGA 1L1EA 2UYOA 1EM8B 3E9EA 5JZBA 2PMDA 3V3KA 3UUGA 5AM0A 1JIXA 3PC4A 3IOYA 4J0IA 4M8KA 4P7BA 4H59A 1DO2A 2R47A 2DOKA 4A6DA 1H5UA 4N7BA 4O63O 4CDMA 2JIZA 3FPEA 5A1TA 1DKQA 5JH7A 1NM5C 2P7IA 3PQEA 3GMTA 1MOPA 4X1YB 2EDCA 4GUAA 1OH5A 3GGSA 1RXYA 3PNBA 1D3AA 1ZRNA 3OPXA 1R64A 3Q0EA 2AC4A 2GEJA 1MPTA 4MEAA 1TA4A 1WV1A 4PG5A 3IVRA 5HRAA 1G21E 5CEEA 4TVOA 1KL7A 1KK2A 3PFWO 3R2JA 5JAOA 3AKEA 4L4XA 3TKAA 4EVSA 3PL1A 1TJ3A 4JODA 1JKMA 2V5UA 1MX5A 1NVXQ 2E4WA 2PZKA 4DLUA 5I8ZA 4BFCA 2OB1A 1FFHA 2XE8A 3WAJA 4Q9AA 3AF2A 2DP4E 3SFTA 4BRSA 1JWBB 2ES4A 4PVDA 3W5JA 2E4ZA 4JAVC 1IY8A 4EGJA 5ADWA 2VK1A 1T8PA 1RZRA 2ZZKA 4PLPA 4J1SA 1P5RA 2F43B 1SCAA 2J9XB 2PVPA 3H8VA 5CEFA 3NMUF 3S0JA 2YIVX 1NC3A 4OU5A 4YGYA 3QLUA 3TSOA 1SC6A 1DUIA 1P1RA 1Q11A 1NULA 1YL7A 2M6SA 4PR0A 4TL7A 1BVYF 4AN0A 1GR1A 1RCTE 1J42A 5DBEX 5HIAA 1THMA 5I4KA 4K9QA 4KFRA 2VYVD 3LD9A 3TSYA 1Q0HA 3Q11A 5ICSA 1K6MA 1CKEA 3DFUA 3PITA 4KAJA 1R5BA 3CS3A 3ETHA 4BNZA 4WMLA 4DJ5X 1OV4A 2XXJA 4Y2YA 2D0IA 16PKA 5K0EA 3GN2A 3C4JA 2HDOA 3H1PA 3M8KA 3K8QA 3GLHB 4J2HA 2CZCA 4R0VA 1TTTA 1P77A 3IKVA 2OBXA 4G1CA 3OPNA 3DONA 1RE1A 4BHTA 4G8CA 1VE6A 2IPNA 4IEIA 4IIGA 3I0ZA 2PNJA 2EFEB 4PICA 3V5NA 2GPYA 4XJTA 5FD8A 1L8OA 4UNPA 1LZKA 3NBKA 2AVNA 1NTRA 4KN9S 1B8UA 3JTEA 2C94A 2Z98A 1KI3A 2B25A 3I23A 1RI1A 4GBJA 1LK7A 4IIFA 1T3LA 5DNEA 1YVDA 5NLLA 3LW8A 3CFYA 2PDAA 1TB4A 1IEQA 3WGGA 1L4YA 5BNZA 1X42A 2J7KA 1CW2B 3AFMA 3HM2A 1X92A 3RODA 1G8FA 5I6DA 4HDSB 4KR3A 3IP9A 1AK1A 3KXKA 3Q8XB 1H2EA 2XMDA 3HKEB 2VNIA 5EP3A 5UKDA 3ZLTA 5IDXA 4LF5B 3DDHA 4FHDA 4M89A 3LWNA 2O2IA 5CLFA 3ZDZB 1MAWA 1N5LA 2FZLA 3L2OB 3T4UA 2Z6UA 4URUR 1ZJ6A 5FFFA 5BUCA 4PLVA 5C0OE 2AD1A 4XDZA 3QVGB 5IC5A 3ENWA 3FPKA 2QT1A 3S4YA 3WRYC 4AX4A 4BFZA 1IUNA 2MTBA 1RWMA 2VA8A 3D3JA 4NBNA 3K5WA 4QJBA 5TPZD 2ZJYA 2Q50A 3TVYA 1I7NA 3UMFA 4ZWNA 2G0NA 5BYBA 1NF8A 2CXOA 3FHJA 1USWA 4YGXB 1WULS 4EB3A 5FBQB 3O21A 3U44A 1KEZA 1RKQA 2GWRA 4BRUA 2VJNA 2G7MC 1C8LA 1YR1A 1Z8DA 2ABWA 2W6IA 2WLTA 2AG8A 3F8WA 5G1PA 3GFPA 3LY9A 3A8TA 1ESEA 3VZRA 4C4AA 4JASB 3CNQS 4B6EA 3UV6A 4CM1A 1QP0A 3NWJA 4GLFA 1QJ4A 2WJZB 2E3JA 3C3YA 5ENDA 3RSGA 2ZRDA 3C7DB 4JU9A 2D7DA 4PPGA 1G8SA 2B0JA 3ZBPA 2X0NA 1XZLA 4PYOA 2GARA 2ONJA 1NVTA 2Q5JA 3MCAA 4P32A 3TBHA 1O58A 3VYWA 2A8YA 4MCJA 4EEKA 4WBNB 4FM9A 4O3FA 2I8LA 1X80B 3IO5A 4M8LA 8ATCA 1FEZA 2D1YA 3GDWA 4Q9KA 1DP4A 2JBHA 2BH9A 2WHRA 3TUZC 1NMXA 3WOHA 1IN1A 3CURA 4JLBA 1EFVA 2XCQA 1QIMA 3IXQA 4O1IA 4P5EA 5ESRA 4BO9A 1GGJA 2AOUB 1N8TA 4J90A 1OPXA 1HFWA 1E4EA 2ANCA 1FX1A 1YQDA 5AKYA 1QLWA 5EJ2A 3UK6A 5BT9A 4PV7A 3C6YA 2VAWA 3E9ZA 4RGVA 2XXAB 4R8RA 5KJCA 1WZEA 1DRKA 1KGDA 2VNSA 2JANA 4WXRA 1JQ5A 3DM5A 2C77A 5GWXA 1RM3A 4K86A 2EKDA 1MPXA 4FINA 2ZT8A 1PFGA 4BFWA 2JJ8A 3KZXA 2RGNA 3OG9A 3QWFA 4Q9IA 5HQJA 2H9IA 3ZVLA 4EY5A 5BW8A 1IH8A 1XKLA 2I0FA 2KLBA 5D84A 2I71A 3DBHA 3MWEA 1U5BB 1GEGA 3AR6A 1OFGA 5J58A 3BDAA 5TNXA 1VBFA 4I99A 4UPVA 3TLXA 1FSSA 3L4EA 1Q83A 2V3CC 2DHEA 3LQYA 2X7HA 1VE5A 3D3WB 3MFQA 4BS9A 4ZVRA 3EH2A 1YIAA 2V4ZA 4MQFB 4GMKA 7REQA 1A5SB 3IKMB 4IW3B 2V7TA 3HRHA 3WI7A 4EMUA 1DWQA 3COZA 5FF9A 5I3CA 1PWHA 1VOTA 3RD5A 2QI9C 3SQWA 4BUCA 1CIPA 1SOUA 1SBYA 4HN9A 4Q1DA 3B60A 5IABA 3NWPA 5ECDA 1TJNA 3T3MB 2DETA 1WNTA 4IRMA 2XMPA 3S44A 3ZHRA 5IJWA 1RCFA 1W0CA 2B94A 3DFFA 4EJMA 2EGUA 5EUQB 3ZR4B 1QV6A 2LP4Y 5ILQA 4CTOA 4Y6LA 3S8MA 5C53B 3H2GA 3UTDA 3QSGA 4AJHA 3RG2A 1QK4A 2O5EA 4EHDA 5KYXB 2A9FA 3DMDA 1CPYA 1HZZC 2O8DB 3LUPA 3THXA 5LOVF 2BZ1A 1AXGA 2WF6A 3R09A 2X5JO 4NZNA 2PUGA 1J99A 4LVUA 4P82A 1G55A 1HE1C 5G2OA 4NCBA 4HFMA 4XZ3A 2DBVO 2ZSFA 2QRNA 4Q7QA 1M6WA 5U4XA 4DRYA 5BMVB 1U3TA 1CERA 1F51E 1TT7A 1PCXA 3EVGA 3M6UA 3D0RA 4LRTB 1FLAA 1QUFA 3O83A 3QYJA 1AUPA 2G72A 2V8BA 3IPRA 4MWZA 5AK5A 1KAOA 4HQKA 5EIAA 3FPLA 4UM8B 1Y4ZA 3DOHA 1SCUA 1RHUA 2W8ZA 2W4IA 4ITRC 4G9EA 2C3MA 1M54A 1MVOA 1I5EA 1Q0SA 2OWDA 1WG8A 4QT4A 2OCGA 1E9SA 1RT9A 1Y5NA 4M0CA 4I1PA 5JXIA 1T5TA 2WYUA 3OIGA 2G1PA 1SXGA 2KM1A 4DQDA 2LZ0A 2K2WA 3OE7A 3AU8A 2PX6A 3M81A 4B0OA 3K6RA 3TLGB 2PYDA 2LBPA 1ISIA 3EWSA 3F71A 4GOXA 1JSRA 2R60A 3R44A 2Q5EA 3AUXA 1DXHA 5BRJA 1TD1A 3NNSA 1GG5A 4AG3A 2FDXA 1UK6A 1Z17A 3JQAA 3V97A 1BD4A 3GNQA 4M9UA 2GJSA 3G2LA 1RVV1 2DFVA 3H86A 3DNMA 4GYJA 4PAQA 2YV4A 4F5ZA 2B8TA 1KY4A 3O4VA 3BERA 2BGRA 3OFKA 4X8HA 2BTOA 2AFIA 5L3RA 4L0CA 2F4NA 2EBWA 4L9SA 4WKBA 2QL5A 2EKBA 2SHKA 2IWHA 3VZBA 4ALNA 5LYJA 1NNEA 3FDIA 2RH8A 2G71A 2JD1A 1G4UR 2XQFA 3BMXA 2O59A 1IHOA 4MLDA 6ABPA 3A1FA 1AIPA 1XKTA 3M4JA 4PE5B 1FW6A 3LUGA 3D7SA 4N39A 3MGCA 1ZIYA 4U7JA 3PXCX 5JQGB 5CITA 1PG2A 2C8KA 3CBGA 2O8VA 1N0VC 3S99A 1WJGA 1Z6YA 2BE9A 4NDNE 3TQSA 3GG2A 4R69A 3R4CA 2CKDA 5AXCA 5A2GA 2BH2A 2QRJA 3S6JA 5C5IA 4PZYA 3BWBA 5EKSA 1NXXA 2O2XA 2G63A 4WWHA 4MV4A 5J63A 3IP5A 3GPCA 2FZGA 3QKTA 5LZ2A 1DB3A 3DZBA 5KOJB 5A4JA 3SJCA 4YLEA 2AIRA 4YRQA 5EZSA 4H0NA 4LXXA 3D8UA 1DS6A 1TFUA 2W4MA 4Y2PA 3M3PA 2X4DA 4MINA 7MHTA 4IS3A 1AF7A 1PG0A 3HXPA 4PZ9A 4DMLA 2IXBA 2JLXA 3JCZA 1HDOA 4RXMA 3GGCA 3RSQA 1I7SB 5ED0A 3L7DA 1IZ8A 4PNPA 4AJ1A 1CULC 1VRVA 2YV1A 1PJ3A 4ZO4A 5HDBB 5P21A 5JYBA 3HK2A 1KE1A 5LJLA 1I2ZA 2J9ZB 2NYUA 1SKYB 2IIVA 2KE5A 2VRNA 2XA9A 1A8QA 1Q0PA 2NADA 3CH6A 3FDZB 4GF5A 2ZZNA 4PXSA 4YJ2B 4YV2A 2HGZA 5DLPA 5EOVA 3RS4A 3G1WA 3B7PA 4D9EA 3MRSA 2D54A 2X1LA 2R1ZA 4CLRA 3P9YA 3LKZA 3GOHA 2W48A 4LJSA 4UJ5A 1SVSA 2OG2A 3DAYA 4NH0A 4QD3A 4UVHA 3NAZA 2WNIA 4IL5A 1CNMA 1T1RA 4BEVA 4XWOA 4NCIA 1OWMA 2ZPUA 3GUVA 4I4TF 3GD7A 4JQSA 5C4GB 5K0FA 1A4IA 4CT4B 1Z7YA 4J43A 2AWNA 3RUIA 2DG2A 3WNQA 4EJ2A 2IH5A 3B7GA 4Y9SA 1L6RA 3LLSA 4KXXA 4Z4HA 2JHAA 1ZNQO 3TXXA 2A92A 1UMBA 1WF3A 2FXVA 4Z8XA 2BISA 4CZ2A 4ZXFA 1Q7RA 1Y6RA 1XT6A 3OZFA 4FLFA 3HJCA 4E4TA 1EEXB 2VSFA 1DBWA 1QAMA 3FFXA 3QU7A 3FSGD 3PJFA 4NS4A 3RVNA 4KZKA 2E2WA 1MW8X 3K6JA 5KHLB 1NG1A 1I3LA 1KKMA 3F3KA 3CLUC 3EQ6A 3QVXA 3DPIA 4O25A 1LCIA 3ZHQA 2W7TA 4J0KA 1D7AA 4MPRA 2VKTA 3S3TA 3WA6A 5LXTA 3F4LA 1VL6A 3TRIA 4OQXA 5DSTA 2VDJA 3EULA 3NIBA 1BJTA 5IW8A 2QSZA 2Z9DA 3GG9A 4PC7A 3HB7A 3TGWA 3FOAA 1UOQA 4DKXA 1G21A 1SBTA 1GPH1 3CLUD 5BWLA 2CDCA 4PONA 4Q4AA 4L75A 3LBFA 2QRQA 1M34E 1IMOA 1ZCFA 2R8OA 2ZBVA 3DOEA 3HGTA 3O2NA 4OXRA 2HRCA 1QO9A 1R4MA 5HQ3A 2X7JA 1HYGA 3H7IA 2CHQA 1KK0A 4N6NA 5JZOA 1AB6A 2BDTA 1O97C 3TQRA 4EKIA 3WX0A 4MDEA 4L8GA 1M76A 1S8OA 3RVDA 1XFAA 1AHIA 1YGPA 2VJAA 5AHRA 1II8B 1GVHA 2Q5QA 1LC0A 4UCWA 5FP0A 3PGVA 2AMYA 4FNOA 3SHQA 1X80A 3VJMA 1VPVA 3MCUA 4BQSA 5K9ZA 4Q1AA 1DG1G 4OYLA 3SVZA 3I2YX 1PJRA 4RHYA 3I30X 3S29A 4DC9A 2PH7A 1IIRA 3D6VA 4IJQA 1XFDA 4IDQA 1N7JA 3U62A 3PLRA 2FWMX 5HBRA 4PBTA 1YDWA 4EBBA 1EX6A 5LP6A 2C5BA 3REQA 1CY1A 5BQPA 4BKUA 1TYBE 2I2FA 1U5CA 2J0UB 3TIGA 1EGMB 2WNSA 3GU3A 5BO5A 4LNHA 2C3PA 2FPRA 5JZMA 5E4JA 3F5MA 3CC8A 1RYDA 4BP9A 4D9MA 4ZI7F 5D3KA 3STVA 1L4BA 1BJRE 1X74A 3O4HA 5CBKA 1XZPA 1QCCA 1SN7A 2A86A 4RAQA 4V38A 5GP1A 2H18A 1ZIDA 3ZDBA 1P73A 5DT2A 1UMKA 5EERA 3PPIA 4TLEA 4UVEA 3THRA 4D45A 4Z7JA 3G6KA 3N0WA 4C0SA 3ZZNA 1NWCA 1OQAA 2W2KB 1F9EA 2CDRA 2C0PA 1MX1A 2FA9A 3P9NA 2Y1OA 4AWBA 1EYZA 3NI2A 3I1FA 1A96A 3FTCA 4O8ZA 4KHPB 1R0RE 1JA0A 2HV9A 2P4UA 4GOKA 4HAVA 3X1DA 2X8BA 3K73O 3SFVA 3OM0A 4DDTA 1UP7A 3PIIA 3SMQA 4DTIA 4JJEA 4DNFA 4PU0A 2B5OA 1Q57A 3O31A 1GQSA 1FYXA 3DWIA 4XM1A 4UULA 5EI5A 1ZQ1A 2X5NA 3KU4A 4MGIR 1IUPA 1TZJA 2CMGA 2QRKA 2WR8A 4TMVA 4OKIA 5BQ5A 2XCTB 1MTZA 2D00A 4M53A 3LFTA 4B8ZA 3LCRA 2J0QA 2O1WA 4UNRA 3S1LA 5JJ5A 4G8DA 3NC4A 3LT4A 1ZONA 1XQ1A 3T1NA 1B2LA 4RY2A 4AYTA 4GLOA 3WV4A 3ISTA 4RWEA 4XLZA 4R98A 3GFTA 3R7LA 1QF6A 1L1FA 1KBZA 2P0YA 5K7SA 2EKLA 2IY7A 4I5FA 5AW0A 6NULA 3JD2A 4L2IA 4UXJA 5I3ZA 1VG1A 1K7XB 2XGOA 1UMDB 2WU4A 3KDAA 421PA 5C35A 3PVZA 1BHJA 1IIBA 4X66B 5L45A 3KJEA 1ZZEA 5LDGA 1W30A 1Z0FA 3AHIA 1T8RA 3FYUB 3SR3A 4GM1A 4MQLA 2W8BB 4PQYA 2ON6A 4I2VA 1G8KA 3Q5DA 2QV7A 1ZK2A 1FSPA 2O0JA 3FCUB 3IBGA 3QWIA 1O95D 5JROA 3JAKB 4NF2A 3NDJA 3I9V6 2FN9A 1TT5A 4RSHA 1QIJA 3M33A 4Y1RA 3QVJA 1ZN7A 2I62A 2OHFA 2UYQA 3KT8A 4D8YA 4EYKA 4L27A 4B9EA 2YZMA 4A15A 1L9KA 2HZBA 4RL6A 3RUPA 1MAHA 1XQ6A 4I50A 5JRDS 2NOAA 3JQAB 4B7ZA 4RXUA 4WKOA 2LVBA 2R68A 1M1YB 2EF0A 2DQZA 5A1JA 1QP4A 1PWXA 3D02A 3WVNA 4D2IA 3PK0A 5A3SA 4H4EA 4RORA 1NR1A 1RXSA 2GYVA 3DXYA 3LBIA 4R2HA 4UDYX 4DYDA 2WG1A 5LR6A 1E3QA 4TMZA 1DLIA 1H4TA 4ABTA 2Z1DA 2BR3A 2QAGC 1D2HA 3LRTA 3PXUA 1LI7A 5JG7A 3OLQA 721PA 4WY5A 5CW2A 5A3QA 4IEFB 4MLCA 3PGJA 1EZZA 4G9GA 1YZVA 3UK1A 3WB1A 3K6SB 4MS4A 3IUPA 3OMWA 2VDRB 2X0RA 4LZPA 3ND7A 2ZB4A 3VVCA 1BE8A 3AVTA 1C1YA 3WK9A 3RC3A 4YP5A 1Z5PA 2BLNA 3SZ3A 4ZYLA 3C5VA 5DE3A 4NATA 1Z4IA 3PQ4A 1Y1RA 1H8ED 2FEWB 1D5WA 1BS9A 5DX1A 3ML1A 1XALA 1UJ5A 4JVMA 4EY8A 4TLBA 5B7PA 1Z6TA 4CI0B 4INOA 4I9NA 4UE3S 4UFNA 4GE0A 5AUPB 1YTUA 4IQFA 5I7VA 1WXQA 4ZPXA 4R8LA 1C30A 1E6LA 1V8BA 4FGZA 4RGBA 4CCYB 4LF6B 4XXHA 1BHQ1 4DLVA 3IL2A 2W58A 3C3BA 3DYVA 4JEMA 4WW0A 4BP8A 1Z3CA 1NF2A 4W1PA 4P36A 1P8JA 1UINA 2VDUE 4TS3A 3MWJA 4TKLA 2DUMA 3UXYA 1EI9A 4MUIA 1SG6A 3K31A 4A8PA 1YQGA 1P44A 3D6AA 4XWTA 2AE2A 4S1TA 3P71T 4YFYA 5CG1A 2O7SA 5DWQA 4WA8A 2NXJA 2I7DA 3E2PA 3HDTA 3LOPA 1QXSA 2B35A 3F5QA 3HC7A 2ZUTA 1NX6A 1DELA 4UQLA 3DZ8A 2QZPA 3NG1A 5AI9A 5A0TA 1MJFA 3HJNA 5JNTA 3BREA 2XB2A 1VIDA 1W4BA 1XMXA 2HIAA 3B9PA 4QU9A 5H1YA 3BZUA 3LV8A 5FPSA 3TQHA 1N3IA 2W42A 3G5UA 3OU7A 4FEYA 2NSDA 4F97A 2HHJA 3KHUA 4I8XA 3U37A 5BN5A 4TPKA 2I3DA 5MN5A 3R24A 1XNRB 1Q0TA 3RVKA 2BHSA 1RLIA 4P0QB 1EGVB 1J7KA 1NDUA 3O47A 3C4VA 3W2TA 3NCTA 2G3YA 2HU7A 4IGAA 5CDSA 3UGJA 1H4QA 1SU6A 3H17A 2YHIB 4LZZA 4DSUA 1PJCA 1TKCA 2HLHA 2VJYA 5B1HA 4MIEA 3RGGA 3UJPA 4TXLA 2PX4A 2OOKA 4RY8A 1ND5A 4QIHA 2C78A 1VLHA 2OQRA 1HDRA 3WC4A 1GA4A 5JW6A 1I5OA 2ZUVA 2FFRA 3E05A 4XGRA 3PVCA 4Q1CA 3HO8A 2VZEA 1G64A 2DTEA 3IOEA 1CEXA 1Y42X 4RFSA 1DC4A 3WLEA 4Z6KA 2XEXA 2AZDA 4B6JA 5C1BA 3R77A 4WL0A 4OI0A 4PZEA 2W0MA 1N1MA 4LJLA 5EE0A 4DCNA 3IBYA 5CFNA 1EVZA 3DSRA 3RREA 3A2KA 1TYAE 4NMWA 3FTQA 2J9FA 1E1DA 4J76A 3QX7A 3CBQA 2X15A 2W93A 3E3NA 3TLZA 5CJPA 3MJEA 2OCBA 4X63A 4BNNA 4N47A 1B8NA 1HQKA 3ZWAA 3E3OA 4M0EA 3U16A 3L41A 1YUBA 3FMGA 5HUJA 2Y9MB 4Q1BA 4FC6A 1TECE 2B7LA 1I3NA 4B45A 1KRWA 3GFGA 2HMSA 3MD9A 3TINA 2P8SA 2SECE 3L0OA 3E9NA 5JNWA 4Q9DA 1G8PA 1KJJA 4HRAA 3CU5A 3HQ4O 1FDIA 2OB2A 2RHJA 4CODB 4PQEA 3MSXA 1K88A 4UM5A 4REQB 1V7PC 5C31A 4YWHA 2P2NA 2AUNA 3UWKA 4ZK2A 5HM8A 3V4SA 5AVRA 2B4TO 5F7JA 3V7WA 4MUMA 3T1TA 4IDPA 3WGIA 3AVOA 2CXSA 1CUXA 4N5DA 1BU5A 5I4IA 1CJMA 5DYYA 2QL7A 4GO1A 3RRYA 3WXMA 3E7XA 2KX7A 5AKIA 4JHLA 1O03A 3UV3A 2WFMA 4NSNA 3COJA 1WSWA 3PQDA 1L7RA 1W36D 4IYRA 1W47A 5FADA 4RKEA 5FBVB 2IYTA 1E2MA 3OLZA 3ZCPA 2ZIXB 3D6HA 4Q48A 5AUOB 1F2DA 4I1UA 5G40A 4MV9A 3TQCA 4EOGA 5A5VA 2IEBA 1QK3A 3L8CA 3ZXUB 1W8IA 3HBNA 1Y3DE 1ML3A 1XZKA 4URHA 5EINA 2QZJA 4PGHA 3GVIA 2XCOA 3L84A 9ATCA 3RFTA 4A4DA 2W9XA 3QVSA 4H31A 3RVPA 3WQBA 1PWYE 1BA3A 3BAZA 5CCEA 4CDRA 4Y2SA 2HCTA 1UQRA 4YAFA 4TYWA 2NM0A 5AI8A 1N5KA 5CLQA 4DV4B 4RK4A 1GG8A 1PGJA 3PHHA 1UOPA 1FFXB 1GPJA 1QE3A 1WCV1 2XYRA 4S1WA 3JALA 4KIFA 3ZV6A 1XCBA 4ARUA 2HM7A 4RELA 5FO1A 3NIFB 4WXYB 3K9FC 4WH0A 4OGFA 3ZDAA 3N7UA 2PQ2A 3PUXA 4V1CA 2PVCA 4AJJA 2ONKA 5B3AA 3VTFA 2XXAA 4Y2HA 2H4XA 1JBQA 4YUYA 4KDFA 4W63A 2O4CA 1R12A 3CZ5A 4UHEA 4TT3A 5H9VA 3SM3A 3VNQA 3GELA 5C5EA 2X6TA 1I7DA 1A98A 3FZEA 2PQ0A 1QE0A 1KQNA 5JSHA 4DMMA 1IOWA 3LBHA 3W5VA 3T0GA 1ZNZA 1FDWA 1NVAA 3G13A 2VYQA 4B2YA 1M2VA 1JXOA 2JD0A 3PHCA 4KPUB 2AH5A 1X7YB 1KJWA 4LGVA 3W7AA 4C5CA 3L8YA 1O96B 3GFSA 1QGDA 4R9NA 4HDNB 4F86A 3BD6A 1XJWA 3GEIA 1L4GA 1Z36A 4J7XA 5M2QA 5KZMB 1USVA 2GILA 1XXHE 5A4MS 2HSEA 2GXAA 2HH9A 1B15A 3FOBA 4U1RA 4DEYA 2K6GA 4DR5B 1JDNA 2QXUA 3O2SB 3ZI0A 3EW7A 1XK7A 5ARCA 1P45A 1UBGA 1T3ZA 3URKA 1UXGA 3I64A 1MCZA 4ZO6A 4JLMA 5DEIA 3LT5A 2WMDA 4D81A 3QKUA 2JB9A 4H2DA 4JK3A 4EF4A 4J0CA 3EC2A 4MVJG 1KAQA 4DM7A 4JLDA 3BHIA 3MWDB 1OXTA 1V47A 3UPUA 4DLAA 3GLIB 2B30A 4OHPA 2OTCA 2A33A 3WWPA 3DEZA 5EXEA 3HYLA 3DDUA 4ASUA 1B43A 2GESA 1JEAA 4TS4A 2IS1A 3EF0A 3ENKA 4OJYA 3BRWA 1XRSB 4TSFA 4YJGB 4ZAWA 3UMSA 1YDHA 5BNFA 3BC1A 1JT2A 1NI5A 1F2UB 4TXJA 3HR8A 5JPDA 3IP6A 3W4IA 1OH6A 1FMJA 1FLDA 1GUYA 1L5QA 5GADl 2YWBA 3A3KA 1Y48E 3PLNA 4PHFA 1JSLA 2ZAMA 4MWCA 1SVMA 4DV7B 3DCYA 3CUSA 2ZPAA 3DV0B 1WOYA 1G60A 1JN0A 1RWWA 4GX0A 1NFQA 2VZ0A 2VC2B 1CE8B 4IH1A 4DWVA 4Q1FA 2JLYA 2GN0A 1SCUB 3BGDA 4CDNA 4DDHA 1L3CA 4BECA 2H06A 1QOQB 3RVOA 3LO8A 1EGHA 4KTTE 5BSMA 1TVKB 2R44A 1WIWA 5FA8A 5SZHB 3TX2A 2PFGA 3ZZ0A 1CRPA 1RJEA 3WBBA 1ZGBA 4PZLA 4GI5A 4LCEA 5DO9A 3D7KA 2FPPB 5EIHA 5ICFA 4OOFA 3BB4A 4BQEA 5KDLA 3UAVA 1Z3IX 3WIVA 5CURA 2ZTMA 4RTSA 2JCBA 1NVEA 2O3SA 3ZU5A 2P3QA 2OHOA 2X77A 3OEEA 5DKFA 1V48A 1Q7CA 2WJ4A 1U81A 3TOVA 2RCNA 3GXOA 4UTRA 2R66A 1DPFA 1P3JA 5FJIA 2NWQA 1C9JA 2NUBA 2J08A 3MAJA 3NYIA 1HFEL 2VHCA 4LY3A 1XPJA 1YS6A 3KE8A 2PAAA 1EDBA 3PFIA 4LGMA 4MV8A 4N49A 1TTHA 2IXAA 2V59A 4EG4A 3R9XB 4WSOA 1Q12A 1CY0A 4CIDA 4YAOA 2CZGA 2C3YA 2M1XA 4NHEA 1G7RA 3NVAA 2PZLA 5GAJA 1E63A 4ROSA 5F1PA 2YW2A 5KUTA 1QYRA 4QOSA 5H81A 3SYTA 5BSGA 3G2HA 1P81A 3K32A 2C84A 1W0KA 4P86A 2XTAA 1ODLA 1TC1A 5JFOA 2HPAA 3C3PA 4H7EA 1WB5A 2NYAA 1OI3A 1JGTA 3I6QA 1UXKA 1Y1PA 1G6OA 3EGOA 4RZSA 4CMAA 3EPJA 2OV8A 2AYZA 3H8SA 3DV2A 4MYDA 1VRWA 1TKRA 4MUXA 4RH3A 2XY4A 4ZAFA 1BA2A 1OE0A 3BM5A 3TMKA 2QUBA 3RUEA 3SQLA 2PLFA 5IJ0A 1WXEA 4WFKA 3FUWA 2FZEA 2QW1A 1CDOA 1N9GA 4CM8A 1XZHA 5EMNA 5GJCA 2HIHA 3EARA 4CMJA 3DT6A 4OHCA 3BILA 3V55A 3B8HA 2ZRKA 5ALQA 2PD4A 2RCYA 1PT8A 1Z2CA 3DZDA 3LVQE 4DYVA 1YVRA 4K6GA 2V7QD 1DCKA 1FU8A 2J5XA 1SZDA 3ACCA 3P2IA 3MTAA 1QB7A 1EDZA 1DEHA 2Y0CA 4TQGA 4QJ3A 1YKGA 4B3DA 4DMHA 1YR8A 5JNUA 5CB0A 3CE6A 4IFBA 1E62A 3GRYA 2MYTA 2Q1WA 3G59A 3OICA 2P2DA 3A6FA 3G1UA 3H5NA 3QNMA 3DKVA 1L7VC 4KE8A 1PJ4A 4X54A 2DR0A 1ZCZA 3IHTA 3QBEA 4LZNA 3TQQA 5JCZA 3UJNA 2ODPA 2G0TA 1W29A 2P0AA 2WHQA 1A8HA 2AQIA 1O6GA 2C03A 2VQSA 1CYDA 4H6VA 1FW8A 1GUZA 2P75A 5AXAA 4JP1A 4RK7A 1MO2A 2V7QA 3JRNA 3I2HA 3RYFA 2R7LA 1QTNA 1DIBA 1UXJA 3K0FA 3ZD8A 1UMBB 4JLWA 1T6ZA 4UDXX 4QX6A 4CEIA 2YC4C 3H4IA 1RU3A 2AMLA 1PGOA 3CSUA 2VDWB 4FCCA 1DQNA 1J2EA 1L4FA 3L0CA 4YACA 2YZGA 1GKIA 5DOZA 1NXTA 4BN5A 5ILGA 4MRNA 3GLTA 1OAAA 1YJXA 2Q5CA 2FPSA 1OAOC 4RAOA 3GH3A 4AF8A 5KWSA 1KETA 3H5TA 3FUTA 2FP4B 3FHCB 1J6UA 3CIOA 4JITA 3NTUA 1NU8A 4XQ9A 2R1TB 3M83A 1ONSA 1P2VA 1CETA 1X13A 1C3EA 2AK3A 2DPGA 2G07A 3DL2A 2INGX 3H4VA 3NHWA 4FX5A 3D4PA 3O94A 3LGXA 2G5PA 4XCVA 1RWXA 4KUEA 4YRBA 2Z6QA 1H5NA 4HH4A 2GEDA 4IDEA 1G3IA 3B3FA 2DJIA 1OOEA 4L9RA 5IDQA 4Q9JA 3QOWA 4YRMA 4YDSA 2YWFA 3E3MA 2G9RA 3E8MA 2CXQA 3NJRA 1NG9A 2QUAA 4IMJB 3DE0X 3WYEA 2IE0A 3QFTA 1AT1A 1DX4A 5LZ9A 5G3ZA 3RUFA 1R0WA 1NXQA 1EQAA 3T7RA 4BNMA 4ZI3A 1DDGA 1Y3IA 3QPVA 2YV2A 4H6WA 3OF5A 4WOBA 1ZD9A 1CUZA 1QONA 3NRBA 2B1RA 1GDHA 4V0LA 2LKCA 3GQBB 2WM3A 2R65A 1E79A 1NRIA 2M1ZA 4XB6B 1P4SA 2ZJ6A 1P5JA 4WK4B 4QARA 1WUYA 3BSSA 4E21A 1OSNA 3FCYA 4MGZR 4YMGA 1P1JA 2PA0A 2R4TA 4DIEA 2C2BA 4OB6A 4CHGA 5K0SA 4XD2A 2AC7A 1IJEA 2CLEB 4HFJA 4GICA 5FB3A 3PRKE 4GEGA 4E1AA 2WICA 4CV0A 3TW8A 2VNAA 4Q3NA 3AFHA 3KLNA 2NGRA 3UBTA 1UBTS 5IK2A 1NY6A 1M67A 1GG9A 3GGPA 3INTA 1XTRA 1T43A 3GLUA 1EAMA 2O3TA 1P9NA 2P9TA 4YUZA 4YI5A 2BGKA 2WKRA 1D4AA 4EO7A 1NBME 4YB8A 3A05A 3KOWA 3ERCA 4M1TA 1FXWA 2AKYA 3HBJA 2Y1DA 1DBRA 1E96A 4GRAA 4JSYA 3DE3X 5CX1B 3U2QA 2K5UA 4FOOA 5DYWA 3SG0A 4Z4EA 4UNIA 1EWTA 3FDXA 2XYPA 3L7LA 5HIIA 2QQFA 3BZBA 3D5EA 3E35A 3W3AD 5BPFA 3WQQA 3KAPA 1HDEA 4I55B 2BBSA 4C4TA 3B6KA 3NHSA 4QDKA 3TWOA 4B75A 2YN2A 4YREA 1KOFA 1HSOA 1W4CA 4P4LA 2FMTA 3HUUA 4U7WA 4COOA 4F2HA 3PT5A 4G01B 4DMGA 3EUWA 4C78A 1LBHA 3RVJA 1J56A 3JS5A 5IARA 1H3EA 1GZ3A 1MRSA 1FLVA 2WT4A 3P9RA 4QL3A 2BI4A 3BHJA 3JPYA 4P3KA 2XMCA 1KJ9A 1MFPA 2BSAA 2ATIA 1SVIA 5FYDA 3RV3A 1WPQA 4WCFA 3DOFA 4A27A 4J94A 3WTCA 3ONEA 2MOKA 4P81A 2X5KO 5ADVA 3O4IA 1P2SA 1QGED 4IIJF 4JI0B 3IESA 4QYTA 1Q91A 3GJTA 4FMCB 2PSEA 1XRNA 1C4XA 1YT5A 1EFLA 4G41A 5KOHB 2VF5X 3LZCA 2RFLA 3ASZA 5FUMA 1ZICA 2W6JA 1V43A 3WLOA 2JI6A 1PJBA 1DT3A 4R5MA 3Q72A 1ZC3A 2A0XA 1NBHA 1V7ZA 3EIXA 2QSJA 2OT3B 4KWIA 5DP2A 1US8A 4F11A 2GUGA 4ZZ1A 3X1JA 5KYWA 2IGTA 2JAHA 2QW8A 4M8NE 4TTRA 2JG3A 1JQAA 1GV0A 1H66A 2BM9A 2V5AA 3SPXA 3KC2A 4PPFA 4J1TA 4J7CA 3VPSA 4KOAA 5AJVB 1YIDA 4KAXA 1UM9A 3X1WA 1WRBA 5KJFA 2COEA 1XHLA 4ZI5A 2IV7A 4ITUA 2P4HX 4HTFB 1Z4MA 2HWKA 4A6XA 4A8JB 4YDRA 3DUFB 1KEUA 2OV3A 1RLMA 3SJ7A 1FMFA 5IHXA 1OLUA 1DKNA 5K6AC 1UANA 3RCBA 4HVCA 3R3JA 2Q6LA 4IYJA 3ELUA 3I4FA 4I1IA 4CLRB 4D9IA 5CFLA 1FP6A 4G63A 3W2GA 5LIRA 1L6IA 4DDKA 4C2TA 1HKHA 1Q1NA 3V7YA 3HJBA 5B12A 2WM8A 4TMWA 3CCCA 4ZVMA 5A5EA 3TH5A 2BPOA 4Z4QA 3OQ6A 3SC3A 3PV0A 5B3LA 1EFKA 4QHTA 3GJ6A 1KSFX 1DBSA 4MUAA 4BAUA 1JBEA 2DB3A 3IAM1 4JKOA 1WZNA 4TSRA 2HI0A 4H4CA 3EGXA 5CR9A 2ALJA 1KO5A 5B55A 3TCKA 4DG9A 4KPYA 1X0VA 1V5WA 1OJ7A 3DKIA 3N2KB 4M7WA 3JQDA 4OMCA 5KTNA 4X91A 5EA2A 2EX0A 3H9EO 3IT0A 4E7PA 4EHLA 4TS9A 4G5RA 5L4SA 4WE3A 1EVQA 1R1DA 1XNGA 2H5JA 2ZBGA 3OE1A 4WACA 3U3OA 3OQNA 4U2GA 3WRYA 3PFFA 1PQ4A 1NX9A 4XPIB 4D5GA 1F0NA 3TAHA 1VYUA 3DO6A 3IQDB 3OTHA 3BMNB 4GPAA 2CKMA 3A3YA 2JIOA 4FYWA 2VAMA 4O4LA 1U0LA 2C5FA 2J7PA 4P54A 4DDWA 3KQWA 4QQNA 1VQ1A 1VB3A 3AEUB 3P1JA 2FQ1A 4UM9D 3KKPA 4N5MA 1YTLA 2OR3A 1NHWA 1QO0A 2WZCA 5CB4B 4I1SA 1KWKA 4YJ3F 3Q3HA 1M2FA 1Q7EA 2YWCA 3AESB 4KHZA 5EG5A 2C61A 4Y6OA 4HZGA 1HA3A 2XVZA 2CLCX 2CXRA 2R6FA 2VT7A 1ISFA 2XE7A 4G0XA 3UNXA 1Z4LA 3A4LA 4DIOA 4DILA 5A4AA 5KX5B 4ZCSA 4Q00A 5MDHA 2VTDA 3B52X 3QKIA 1G3MA 2H6EA 2YZ2A 1PFYA 4NBKA 5FTLA 4JNKA 3RTCA 4JC0A 2PD6A 1R74A 1KARA 1QF7A 1QORA 1XNHA 1QIIA 2B6HA 4PG7A 5A5FA 1BX1A 3NPMA 1AJEA 3PC3A 1N2IA 2WHEA 1ANKA 2NUPA 3FNHA 3LUJA 1DIRA 4HDQB 4NENA 1WQ4A 5E3JA 3VSCA 1JL3A 2PSDA 2OXIA 4NU6A 2A3NA 4KNWA 3ZWVA 2YHIA 2OP1A 1G20B 4FKZA 4RD4A 4AVYA 2CBZA 2R8PA 5CHEA 2XA2A 2W70A 4MS3B 3L1HA 1HQDA 3OCCA 2RC6A 4HDOB 4M6WA 1NDQA 2XDQA 1ISMA 5BW4A 1CYEA 5AJZA 5H0IA 4ZOCA 1PT6A 2HSZA 3LQKA 4YO8A 5FUBA 4BFYA 5DX0A 5JZVA 3R3WA 1OX4A 2E87A 3UMCA 4BMZA 4P98A 1TCBA 5B4TA 2Z0MA 4R3NA 4YRDA 1YRLA 5AOCA 1DRWA 1TTQB 1TW2A 3AJ9A 4ZQFA 1QU2A 2W2LD 4NECA 1XZEA 5JS2A 5KSWB 1D0VA 2JFZA 5HA5A 2O8CB 3GRFA 4DV2B 1XEXB 3P0JA 4OL0A 3D8BA 5C4IA 1Z7BA 4RY9A 2W2OA 3Q98A 1X1EA 2H1CA 5HS6A 1KMHA 5CT9A 1TCVA 1FNSA 2RHLA 1XD2A 1D1PA 4DF3A 1TF2A 2QE7D 1NBWB 1W6RA 4PNHA 5ALEA 5KKAA 2R9VA 4ZALA 1M34A 2OV4A 4URXR 4YT8A 2X0DA 3PCRB 4R01A 4FE3A 3OP1A 4IG9A 4WZ6A 2XT9A 5F2NA 1R6UA 4MKIA 3D1JA 1AUOA 5DXJA 2ZE8A 4N0QA 3CSSA 1UWCA 3IKJA 4E5DA 4RGYA 3S2SA 1TADA 2L82A 5JD3A 1X7WB 4AYXA 3ZJTA 1ZXLA 3ZG6A 2WMYA 4C0BA 4EG3A 1T2AA 3HNPA 3KYJB 4CW7A 1D2RA 3TG2A 4Q3BA 3NBFA 4GAEA 4MAFA 4FFBA 5JNRA 4BFTA 2PX0A 3QFCA 2VPWA 4HEA6 4MW1A 5IT4A 1W1IA 4RMIA 3EMKA 1O54A 3UF0A 1YS2X 2AA3A 4DOMA 4FDUA 1FTQA 4H60A 1HT2E 1XTBA 5C7YA 1XHEA 4Z9FA 4PZCA 4ZVLA 4B17A 4OHKA 2GZDA 4BWVA 5FPKA 2H1WA 4OM8A 3CW2A 2HPZA 4MI3A 1N1DA 2HDNB 1I80A 1MNAA 5FWDA 2QN9A 5DHRA 4YRLA 5DPMA 4YLYA 4ZYVA 4B46A 4UBIA 1LUAA 4C87A 1TX4B 1W5EA 2UZ0A 3GR6A 1T91A 3MGGA 4M9CA 3O91A 1E3TA 2H3EA 5EZ6B 5MGNA 3EEBA 1SQ0A 3FYSA 2A1UB 3JYNA 2W6OA 4C4SA 2FV8A 2WSSA 4M7RA 4BMOB 5HX7A 3ND5A 1Q1QA 3HV2A 4A82A 4BNXA 3W6ZA 4ZMRA 4H0FA 3NTOA 1GFIA 1J2RA 4ZI7B 3NVKI 1ENYA 2ZT6A 3N28A 4U7HA 2QMUA 4B35A 1U28A 2O4UX 3PRJA 5FIUA 5DJ5A 3KUKA 2PFSA 3MS2A 3A1TA 1ZRHA 1XDUA 2WJGA 4WCFB 5HFAA 3G88A 1A7AA 3THWA 4Z86A 4D0GA 4HGPA 2OXEA 4Z8YA 4FNGA 1WNFA 3V3TA 4LHEA 3EDYA 1O95A 3V8MA 3FKQA 3IRVA 3X2FA 3V1NA 3VSEA 2GPBA 4XQEA 4M9QA 1GN9A 4LW8A 2NVWA 5IH3A 4Q3DA 4BDSA 4EO9A 4PBRA 1PJ2A 2W2TA 3H1TA 2REOA 3ZHUA 3L8ZA 1LVHA 3IPLA 1DEOA 2HF7A 4CJXA 2G04A 2FW7A 4K9DA 2RGEA 5E6SA 5FFNA 1ID8A 4MEBA 1KJIA 1CQXA 2FPIA 2WIBA 1V8ZA 2CEKA 3MJCA 4COKA 3I61A 1JQEA 5E4YA 4REOA 1O89A 2OLEA 1E3IA 1MX3A 2PBLA 2QLLA 2PXHA 2XSZD 1W5FA 1O4VA 3V7FA 4HNUA 1RRVA 3RFXA 2RG7A 5MFZA 2HRBA 3AG6A 1U0SY 2ZE6A 3AQIA 3ZHSA 2XRMA 2VP4A 5A4DA 3KLBA 4ZHQF 3AF5A 1R88A 1YIOA 3K15A 5FHQA 2ZRLA 3AHDA 3CIFA 4D3FA 2A67A 3DLTA 1IFXA 3G2NA 3ZVMA 4KX3A 1T4MA 5DYGA 2PUFA