3U09A

Crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg)(g92d) from vibrio cholerae
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
248
structure length
248
Chain Sequence
MSQFMNLEGKVALVTGASRGIGKAIAELLAERGAKVIGTATSESGAQAISDYLGDNGKGMALNVTNPESIEAVLKAITDEFGGVDILVNNADITRDNLLMRMKEEEWSDIMETNLTSIFRLSKAVLRGMMKKRQGRIINVGSVVGTMGNAGQANYAAAKAGVIGFTKSMAREVASRGVTVNTVAPGFIETDMTKALNDEQRTATLAQVPAGRLGDPREIASAVAFLASPEAAYITGETLHVNGGMYMI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-oxoacyl-[acyl-carrier-protein] reductase FabG
publication title Dissecting the Structural Elements for the Activation of beta-Ketoacyl-(Acyl Carrier Protein) Reductase from Vibrio cholerae.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Oxidoreductase
total genus 92
structure length 248
sequence length 248
chains with identical sequence B
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2011-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3u09A00
1DJQA 5JSFA 6ADHA 4ZRNA 2J6IA 3B1FA 3OJFA 4YEDA 3RUDA 1FDTA 4TSKA 3ONEA 3S2FA 2Y67A 4DLAA 1RM3A 4CUJA 2IYOA 1WVGA 2VRCA 2E4AA 2ZJ1A 4TRNA 3SC6A 2P4HX 4A2CA 5IJZA 2EKLA 4LVCA 1HWYA 1Z73A 3KYDB 2HSDA 1RM5A 4CM9D 3ZW8A 4CL8A 4GPD1 5T67A 4WUVA 4CMAA 3OQ1A 1JAYA 5K9ZA 4AJEA 2A94A 3BTOA 3K6JA 2O50A 1U8XX 1DFGA 3BMQB 5DZSA 4GVXA 5TNXA 3TRIA 3ZWCA 1GQYA 2B35A 1X7HA 3I4CA 4LCJA 5CEEA 3JQGB 4LN1A 4HADA 4LW8A 5JAMA 4WCFC 1LEHA 4OHUA 1M75A 1HDCA 4QQRA 4WNIA 1I01A 4ZQHA 1Y8QA 4XB1A 2GPTA 4YJFB 3DZJA 1C0PA 2XPCA 4Z9YA 2IEDA 3D4OA 4NG5A 2B5VA 5F5NA 4M87A 1EUZA 3CMMA 2VT2A 3QQPA 1E3EA 3ETGA 4F3YA 3H9UA 2O3RA 1PJ3A 2VT3A 3TL2A 3AFNA 4A27A 3V2GA 3HN2A 3WWZA 3TF5A 3KSDO 2PD6A 5DF1A 2DFVA 1XELA 1T2EA 2NSDA 1I3KA 4PLHA 4D79A 3UHAA 3TL3A 2H1SA 2HDHA 3L6EA 1Q0LA 5L4SA 4B8WA 2BKAA 5I7FA 4ALJA 1T25A 1F12A 2GN9A 1V3UA 1NPDA 1UUFA 4PRLA 1LXCA 4AJOA 4RZIA 3I1JA 4E5NA 3NUGA 1Z45A 3OECA 1X14A 4BO3A 4FGWA 1C1DA 2FZWA 3D3EA 3DTYA 5ES3A 1V3VA 2D4AA 1DIHA 1GCUA 4JN6B 4TVOA 3DBVO 4BO1A 4RVFA 1ZCJA 1BRMA 3DFUA 2NVWA 4A26A 1ADBA 5JMWA 3NJ4A 1ISGA 5B12A 1E7WA 4RJTA 1JKFA 3WWYA 1X0XA 3GZ4A 4RLHA 5CEFA 4YYZA 4DGSA 2DPHA 2NQTA 2PKQO 4NJMA 1BDMA 4IZHA 3FWZA 3VH3A 4PLGA 2Q1TA 1RJWA 3ZCXA 3AOGA 4BNWA 4YQYA 4PG6A 1NAHA 4P38A 2DAPA 1ZK3A 4IQ8A 3WFIA 1LA2A 3JYNA 1SC6A 3GVPA 3ICPA 4IDCA 4IDAA 4Q3CA 4YAKA 1NM5A 3C24A 3WICA 1I5RA 1VKOA 3H6KA 5KOIA 2C20A 4Y6RA 1HZJA 4INAA 5A5FA 3IL2A 1MFZA 1YDEA 2QHXA 2PZKA 3ZNQA 5L4LA 3LZ6A 5DP1A 4MJLA 8LDHA 5FI5A 4WCFA 3D1LA 1DOHA 1Y1PA 4DPLA 4BNXA 5KVVA 1ZO8A 2RCYA 3VKVA 3NYWA 4AJKA 4BNIA 3L4SO 3BHIA 2JD2A 4NNJA 4MVJH 1OAAA 3HNPA 4CMIA 1Z82A 1DLJA 4DRYA 4YJGA 3ZDFA 2UUPA 1DHTA 4HFMA 1XU9A 3IOYA 3DHNA 5HBRA 2YV3A 4U5QA 1UP6A 2NWQA 2HK7A 1B3BA 2WYUA 3OSUA 5C37A 3KSZO 3SLGA 5ER6A 4H3VA 3EAGA 4TROA 1SOWA 4YA6A 3UUWA 2CDBA 1Y81A 4YJHB 2X9NA 2I6TA 2O2SA 1U3TA 2NQ8A 1RYEA 3QWFA 3E5MA 3RQSA 5G2OA 4ZD6A 1HYEA 4J2OA 1B26A 1HZZA 1UJMA 4XQGA 3ROPA 3FRJA 2O4UX 3NV9A 2EG9A 3F4BA 4J0EA 4WE3A 3SJUA 4CM5A 1LSSA 1R37A 5KKAA 3GQVA 3GN2A 3E18A 3ICCA 4EYEA 4KZPA 4Q3BA 3W8DA 4AL4A 1D1SA 4HBGA 5G0VA 2SCUA 4HV4A 3A1NA 5EN4A 3VZRA 1U5CA 3QWHA 2DBRA 3ETDA 3VPXA 3L0DA 4LVUA 3QV1A 4ZN6A 2H9IA 2IZ1A 1LRKA 1MLDA 4TRRA 3CH6A 1N1GA 4KUHA 2VRCD 5GZ1A 5B37A 1P1RA 2PV7A 2VZ9A 4KTVE 2J8ZA 3L6DA 1FXSA 4MVJF 3VAZA 3CZMA 3ROKA 3T7CA 1E3WB 1K6IA 1R12A 4MIYA 1NX6A 2OBNA 2P5YA 2I5PO 5BNTA 1A4IA 2X9VA 3GVXA 2FY8A 3PLRA 3KBOA 4D7AA 3QVOA 3AU9A 4MVJG 5DN9A 1UP7A 2W2KB 4K6FA 2HK8A 3C7CB 3GDGA 3NT4A 2GASA 4HKTA 4NJOA 4HFRA 5CP8A 4ALKA 2W98A 3GAZA 1CIVA 1DDOA 1P1IA 3M2PA 1U1IA 3WGOA 1GYPA 1AN9A 1NVTA 2EKPA 3V2HA 3DHEA 3UGKA 5L7WA 4HXYA 1TLTA 3U49A 1DRWA 1IHXA 2CDCA 2CZCA 3TN7A 3ZWBA 4CM4B 1GZ6A 4L75A 1ONOA 4ITUA 3QJ5A 4R5MA 3GAFA 4E30A 4OSPA 3WMXA 2C07A 4YAGA 2P91A 4FFPA 1HDOA 3MWEB 1IUKA 4AJNA 1MUUA 3INGA 3GZNA 4FPXA 1HDXA 3DXFA 4WLVA 3K73O 2HAEA 2YDXA 1LNQA 4AJ1A 4G81A 1TA4A 2RIRA 3I4FA 3E8XA 4HWKA 2RAFA 3DB2A 2HMTA 1HETA 3OJLA 1F17A 2OOSA 2JHGA 3GVCA 3FWNA 4B79A 4J1SA 3R1IA 4QFDA 3H65A 1BGVA 2RH4A 4OOFA 1C3VA 4QEDA 3KYDA 1JKJA 3JV7A 4FC6A 1JAXA 4NFSA 4KTTE 1TT5B 1NPYA 2HLPA 4X54A 2GZ1A 1UXGA 1EBFA 1JVBA 3E1KA 1ZSVA 2V6FA 3BMQA 3O9ZA 4EBFA 2O48X 4I5EA 1NFRA 1ENZA 3RIHA 4EI2A 4UUNA 4MKXA 1XA0A 2PKQP 2BD0A 1P0CA 1YB4A 4CLRB 4WLUA 3K8ZA 4XRGA 1M66A 2VNSA 4ID9A 2JAHA 3S2GA 4IS2A 3FHLA 4S3MA 4YJFA 5TQVA 3LYLA 3NDJA 3GC6A 4MP8A 3E82A 4N7RA 2IE0A 5L53A 2C54A 3ANNA 2Z1NA 3L6OO 2FMUA 4BHTA 3RAJA 2IODA 4QO7A 1C14A 3PYLA 4J90A 4RL6A 3ZHZA 2J3HA 1D4FA 3PHJA 5I9NA 4RDHA 1QYVA 2GZ3A 2NTJA 3GDOA 1X13A 4G65A 3W4JA 5A4DA 3RFXA 1R4NB 4BV8A 1JQBA 2CVQA 3RKUA 1Z74A 4UEOA 4M55A 2JCVA 2EV9A 4XB2A 5DDIP 4UVDA 4NPCA 3W6UA 4AJIA 4DQXA 3C1AA 3EVNA 3ORFA 2EJWA 3WTBA 2QW8A 3JTMA 1T2FA 3PFWO 3G49A 2ZKLA 3RUCA 1JVSA 1LC0A 2EWMA 1KEVA 3P7MA 3IP1A 3HADA 5C7OO 5JY6A 2GYYA 3ZWXA 4BNGA 2JKVA 4DMLA 2WSBA 2RHCA 4GWGA 1LLCA 3OFSA 4UVEA 4XYBA 1M6HA 2UVDA 2GN4A 3DEYX 5AXBA 3DBLB 1KERA 4OYRA 4FN4A 4W82A 4BVAA 1DEHA 3VDRA 1LUAA 3HFSA 1GAEO 4FIZA 9LDBA 3ASVA 5DCWA 1PJQA 5A9SA 4GAEA 4U6SA 3CIFA 1GPJA 2CSUA 2OHXA 1NR7A 1P33A 4CM8B 4J16A 1K3TA 2HMVA 3ZWOA 4R1SA 3C8MA 4PLCA 1YL6A 1ML3A 2BF7A 4WECA 3ADPA 3BYZA 1DFHA 4FC7A 1VI2A 2VN8A 3HB4X 4D44A 3WSWA 1UP4A 1AUPA 4JLWA 1CDOA 3PWSA 4PN3A 5HA5A 1B14A 4ZQGA 2ZYDA 2BRUA 4NI5A 1U2DA 1H0KA 2QRLA 1ZFNA 3N7UA 4YT8A 3EHEA 1IULA 1ZNQO 2FR1A 1LDBA 4N18A 1V35A 5L7YA 2JJYA 1TB4A 2XOXA 3IC5A 1Z7BA 1UXKA 4BO8A 1N9GB 1XIVA 4RVSA 3HHPA 3WGZA 4GX0A 4MVJE 4DLLA 3G3EA 1HL3A 4RPKA 3CE6A 4I9UA 4ZQBA 5KKCA 5ITVA 1GL3A 4B7CA 4YJHA 1M76A 3BMNA 3I9OA 2J5QA 4RVHA 3H9QA 1W4ZA 3PZRA 4YAJA 2UUOA 3TZCA 4Q3NA 4IM7A 1PS0A 1N7GA 5LC1A 2VWHA 3QWBA 3FF4A 2YQ5A 2G76A 4J1TA 4FSHA 4FQ8A 1VKNA 4U8GA 3RJ9A 3WBBA 4EJMA 3DFZA 1CF2O 2ZB7A 3OIDA 5GZ6A 4XA8A 5L9AA 3RWBA 4B8ZA 3KEQA 5EIOA 4OIMA 5IN4A 2QQ5A 4BB5A 3DQPA 1LTHR 3LF2A 2JCYA 2AG8A 2P5UA 2HMUA 2OUIA 1I2CA 5TLSA 3F9IA 1GQ2A 1W73A 3DC2A 5AXDA 2JCXA 2Q2QA 3VKUA 4U0KA 5AQ1A 5BSHA 4MVJI 4DQUA 1ID1A 2Y68A 3U0BA 5KVQA 1PWZA 3TNLA 3U09A 1L7DA 2DBQA 1NAIA 1HTBA 4UUMA 5L95A 4NU6A 5COAA 2W2KA 1PJCA 5CDGA 4PVCA 3HZZA 1ENYA 5DULA 1KS9A 2PR2A 2Q3EA 3GDFA 1O5IA 1J49A 1IOLA 1ZH8A 4UUOA 4YB8A 3PRJA 4CM4A 4F6CA 5ENVA 5L3ZA 4J0FA 2ILTA 4PG7A 4RF3A 4ZRMA 4J43A 1PGQA 4Z3KA 3CEAA 2PNFA 5IN5A 1EVZA 5CDUA 2HO5A 3LT1A 1LBEA 3W4KA 2PH3A 1V3TA 4FJ2A 3PGXA 4QXMA 4IJWA 5I7EA 1C0IA 3JQ6A 4WLEA 4YT5A 1O6ZA 1VRWA 4J7XA 3TJRA 4CJXA 4XGIA 1ZK4A 4N5MA 4OXYA 1H9BA 1OMOA 1Z75A 2PD4A 3HN7A 1XEAA 3MTJA 4XQEA 3V2UA 4TKMA 2E6UX 2QYTA 3FNGA 1JKIA 2HUNA 6LDHA 5A3JA 3I9LA 3RSHA 3CTMA 1RM0A 4I5GA 3DHYA 3GH3A 1CQJA 3OBBA 4OSOA 5JNLA 3MJCA 3R3JA 3ITDA 3D4NA 1HDGO 4KDFA 5ADHA 2J3IA 5JE8A 3DOJA 3WB9A 4Y8VA 1GTMA 4K1LA 3BIOA 3RUEA 5TIIA 1TT5A 3JQAB 1DSSG 3DZFA 4WLFA 1ZXLA 2J5RA 2AA3A 4GLOA 4U0JA 3QWIA 2PZLA 1A9ZA 4JQCA 2EP5A 3W1VA 2TMDA 5HTOA 1DIGA 3W8FA 1Q2XA 2WMDA 1VL8A 4XIJA 4CLOB 4CLRA 3PJDA 3WNVA 2YV1A 4J4TA 5I8ZA 3KYCB 3MJSA 3PDJA 4O59O 3BMCB 3FD8A 4ZICA 4RGBA 5AOVA 1QV6A 4CV3A 3I3OA 3WFJA 1H93A 5IDYA 1HE4A 4JBHA 1N5DA 4LSMA 5L45A 2AW5A 1KC3A 1IY8A 3B1KA 2HRBA 1T2DA 5GZ3A 3QLJA 2H63A 5DNAA 4M8SA 4E12A 4FFOA 1NVMB 5JBIA 2A4KA 5JY1A 2Q4BA 2QIOA 1GUFA 1P45A 3MWDB 4NBWA 3ZHBA 3ZNPA 4TRMA 1KBZA 4J9UE 5I8WA 3KB6A 1R4NA 1FJHA 4XD2A 3FPLA 5LDHA 1FDWA 3OA2A 3KO8A 1IPEA 4XYEA 3M1LA 3OHSX 4DIFA 1ENPA 1UXHA 4BL5A 2ZQZA 3O8QB 4R5HA 1ISFA 1LDMA 1RKXA 1ORRA 3P2YA 3LC7O 3WNQA 2POQX 1NPTO 4B4OA 2J3JA 4OGWA 5KCZA 3D0OA 3COSA 3T4XA 2LDBA 3GR6A 3OF2A 1YBVA 2DFDA 3IIEA 2PGJA 3FI9A 2VWPA 1OI7A 4IXTA 5JPIA 5EERA 5TRTA 3RUHA 3WMWA 3GFGA 3JQCA 2JFFA 2CNBA 4CM6A 1NTOA 2C2XA 2GD1O 1IPFA 3DBLA 3UKOA 1VLLA 1NHGA 1W6UA 1B7GO 2Q1SA 3DAFA 2ZTLA 3LC2O 1GUZA 5FI3A 5BQFA 3CUKA 3G1UA 3ZH2A 4I5FA 2B37A 4CM8A 4AJPA 1Q7CA 3WGYA 3JD0A 4K6CA 1LLDA 2WD7B 1HE2A 3ZWAA 1HLPA 5BR7A 3PYMA 3GPDG 2AQ8A 2VTEA 3UFXA 1U4SA 2E82A 3KM0A 2WD8A 1X0VA 1H6CA 4WGGA 2BFOA 4B3IA 5JO0A 3UVEA 5KTKA 3W8EA 4XGKA 1GYRA 4FFLA 4E2ZA 1DAPA 4RVUA 1AHIA 1EMDA 4YDRA 2C5AA 3IAHA 1MG5A 3I5MA 5JS6A 1GV1A 3PK0A 2X86A 3O38A 4CLEA 1ZSNA 4GX5A 4L9RA 1OZAA 1YVEI 3STHA 1PJSA 4L76A 3VZSA 3M1AA 4ALNA 1N9GA 2Q1UA 4CV1A 2BI7A 4YR9A 3Q1LA 4FD3A 4GMFA 3WG9A 1NNUA 4KDEA 1K6XA 2I67A 2NNLD 3DWFA 4QX6A 3FSRA 3UCEA 4D3SA 4TZTA 3U3XA 5J23A 1A5ZA 1L1FA 1C1XB 2F1KA 3PHLA 3WQSB 3OJEA 3WGIA 4BNYA 3AK4A 1RPNA 1DIRA 5MDHA 4BNTA 3I9KA 5BT9A 1QYWA 1I3MA 4BIIA 3GUCA 3PTZA 3PLNA 2Y1GA 3TOXA 2AE2A 4CPDA 4UEJA 5C3MA 3WGGA 4CQMB 2E48A 1EE2A 1NHWA 1PU2A 3WYCA 4CMBA 2UAGA 1BTOA 1WDKA 2B4TO 5KVCA 1SCUA 3WR5A 4D41A 5C7IO 3EDMA 5DOZA 5KJFA 3QVSA 1U9JA 5H82A 4DTIA 2CD9A 2Q45A 4DL9A 1KEUA 4JGBA 1XYGA 2EW8A 4IJKA 5FF9A 2I99A 1X7DA 2IDZA 5JAQA 3TPCA 1E7MA 4M54A 2WYWA 1Q0QA 4PLPA 1ADGA 3ZN2A 4WJZA 2JD1A 2OP1A 3GEDA 4QUKA 4DYDA 2FR0A 1EVIA 4QFCA 5COBA 1A27A 4ZHSA 4TKLA 2V6MA 5A06A 2PH5A 2C59A 3L9XA 4RQUA 4R51A 4GWKA 1GQQA 1NQ5A 2JL1A 1ZK1A 2W4QA 4G2NA 4MP6A 1PWXA 4NK5A 5DCYA 4RPHA 1JDJA 2Q2WA 3Q6IA 4MVJM 3GFBA 2O3TA 1UXJA 5H83A 1ONPA 3IKTA 4WASA 1BVUA 2W8ZA 2R00C 4RV9A 4NQZA 2BHLA 1C0KA 2Q2VA 2BI8A 3H9JA 1ZMTA 3PWKA 1DC4A 1MC4A 4H7PA 4TZKA 5H81A 1EE9A 3IJRA 3GVIA 1AXGA 3GNQA 1BVRA 2D2IA 3GUYA 4GLLA 4ROSA 2GO1A 3ZU3A 4WKGA 1I3LA 4S1VA 3G79A 2P68A 2YUTA 3AU8A 3CINA 4P4GA 2X1HA 1VC2A 4FBGA 3JQEA 2X0IA 4I5DA 4OOEA 1LQTA 5MGBA 4UULA 3ZNNA 1XDWA 4BO4A 1T1SA 1B15A 2VYVA 3LT0A 1EUCA 1PJ4A 3VPHA 4ALMA 4YBZA 2NUAA 4OL9A 4UVHA 4NDNE 1KVTA 1NQAO 3IUSA 5JYEA 1NYTA 2ZJ0A 1E77A 1A71A 1Y5RA 2OXIA 4CM7A 1CETA 1E5QA 2O7SA 4XZ3A 1YL7A 2C7VA 1NVGA 1SZJG 3OIGA 2YV2A 3RC9A 1A4UA 3ULKA 2GZ2A 4BO5A 2E37A 3I9JA 2X9GA 1HRDA 1EK6A 3WQRA 3Q11A 4E13A 3IJPA 4ZQFA 5TS3A 3K2BA 2I76A 1MX3A 2X5KO 3JQAA 1KYQA 3I52A 4GSKA 1N1EA 4IDFA 3NEPX 1NFQA 4PLZA 2B4RO 3ZWPA 4D46A 2CF6A 2XAAA 3UW3A 2V6BA 4L8VA 4W99A 3FNHA 4XGNA 2F00A 1C0LA 5IZ4A 2YZ7A 4AG3A 5U9CA 4BUCA 3F1LA 2IRWA 1ZK2A 1PIWA 3CKYA 4GQAA 1ISHA 3F5SA 3SXPA 3KYCA 1NQTA 3MJEA 1KEWA 3BMCA 2OL4A 3WX0A 3PVZA 4RQTA 1I2BA 3ZV3A 3X2FA 1ZXBA 3DZGA 5I7VA 2NU9A 4YT4A 1NWHA 2D8AA 4PZDA 3OEYA 2ZTVA 1E92A 4R54A 4BGVA 3NTRA 4E33A 5THQA 3CXRA 3NT5A 4OQZA 3I23A 3WIEA 4MKRA 3TFQA 5G0TA 3WQQA 1W8DA 2AHRA 2R00A 3JD4A 2EEZA 2D59A 5ICMA 4EITA 4XDZA 1E1KA 1DAOA 2GN8A 3QY9A 2EXXA 1PL8A 3OETA 1Q1NA 1PZGA 3M2TA 4MIEA 2VHWA 2X4GA 2BFAA 3AJRA 2UYYA 1I2ZA 4E31A 3OJ0A 5BSFA 4PG5A 4PG8A 4NMHA 2FWMX 4MKZA 4DA9A 1GZ3A 2IEBA 3O8QA 1PTJA 3OA0A 3V8BA 3MEQA 3KVOA 1R0LA 4A7PA 3A06A 3E48A 4F45A 4KUGA 2W90A 2V6GA 3ZU5A 5CFZA 1B16A 4IIUA 3LSYA 1I0ZA 3MOIA 1E3IA 4R01A 2D5CA 2X0RA 1VL6A 4FOOA 3LU1A 3RFVA 5TJ9A 2O3UA 4BMVA 1IYZA 3PIDA 3WDSA 4J9VA 1E1NA 2G0TA 4UEKA 1EQUA 4D0SA 1MB4A 3LT4A 4J49A 3PPIA 3WIDA 1NWCA 5ENDA 3MJVA 3UXYA 2R6JA 4BQRA 4F6LA 4YPOA 5CDSA 1QYDA 3ENNA 5T5QA 5CDYA 3Q0EA 1YDWA 1E5LA 2WD7A 4LCEA 1IZ9A 2DVMA 5TX7A 3TOZA 1G0NA 1O94A 4D3FA 2Q50A 3W6ZA 3BMOB 1Y9EA 2OGUA 1LC3A 1UDCA 5EQDA 4Y9DA 2NVBA 4UAGA 3A4VA 2BH9A 3PJGA 4CR8A 5C7LO 2Q99A 1R6DA 2EF1A 2FR8A 3ZWMA 1EUDA 2DLDA 1GFSA 5TT0A 4CMCA 3HDYA 3ZZNA 4R4JA 3NGXA 1GUYA 3PGJA 1FMCA 2BGLA 4YACA 1QLJA 2EHDA 4I9HA 3PJFA 5FEUA 4Y98A 3JQGA 4CMHA 4HY3A 3HSKA 3NJ8A 1D1TA 1A7AA 3KUXA 4XYGA 3SJ7A 2VWGA 5FYDA 3ON5A 3Q2KA 1U3WA 4XJSA 5TT1A 4NBTA 1GCOA 3ROMA 4A0SA 4KQWA 1DRVA 2E49A 3BTVA 1O95A 3DMTC 1MC5A 3K31A 4E5KA 4CMJA 4D3DA 1T2CA 5F21A 1QRRA 5I7SA 2GSDA 3RVDA 1PSDA 5KVSA 4XEHA 1Y8RB 4Z0PA 4RVGA 1XG5A 2OO5A 1Q7GA 2PWZA 3WYBA 3AM3A 1RWBA 3EY4A 4L4XA 1GV0A 1GEEA 1VE9A 4NK4A 5TSDA 3AFMA 1BMDA 4XYLA 2FPPA 4CQMA 4CLDA 5KIAA 3O26A 3RROA 1P77A 2VYVD 4L0QA 4M86A 4QO8A 1NP3A 1T24A 3OH8A 4E3ZA 1P74A 1ZK0A 4PFJA 5IZCC 4C7KA 1LRLA 4URFA 2EGHA 3FNFA 4IMPA 2DBVO 1YJQA 1NR1A 3FTPA 3JYOA 4ZA2A 5U4QA 3IUPA 1HLDA 1MGOA 4I1IA 4EDFA 3I6QA 1YQDA 4RZHA 4N5NA 3U9LA 4DBVO 4IQ0A 4UUPA 1E3SA 3E5RA 3W4IA 5U1PA 1RM4A 2I66A 5AVOA 1E7RA 3JQAD 3FR8A 1PL7A 4BNMA 1KOLA 4YJDA 2Y99A 2Y66A 4YRDA 1EEHA 3X2EA 4TRJA 1JU9A 4GMGA 5BNIA 2VQ3A 3BTUA 2O3QA 7ADHA 4RORA 4BO2A 2NM0A 1P1FA 2X7HA 1YXMA 4GGOA 4IJUA 1GPDG 4NBUA 3EC7A 2HRZA 3E9NA 3RC1A 5T64A 4M1QA 1PGJA 3D4PA 2DBZA 3OJOA 7MDHA 1PR9A 1PQUA 3PIIA 3KLPX 3NTQA 2CVZA 3AUSA 4C7JA 2IXAA 1I10A 3GF4A 1SB9A 4Y67A 2NU7A 2AQIA 1DO8A 3PZBA 3N74A 3QVTA 5ER9A 4A5OA 4XYMA 2HJRA 3DMTA 4FJ1A 2XF8A 5KWEA 3ZI0A 4R41A 3EZLA 3CSDA 1PQWA 3JQBC 2WYVA 2AEMA 1FK8A 4ND3A 4GX1A 4W9NC 3VH1A 1XKQA 1CYDA 3V1TC 2HJSA 3BAZA 1JWAB 4NU5A 3VOSA 4P22A 3FNEA 5F5LA 1QV7A 4ND1A 1KETA 2FOIA 3BHMA 1B8UA 5JYDA 4E5PA 1W0CA 1QG6A 1WMAA 3JD3A 4H16A 3GHYA 2WE7A 2ZIZA 3KLMX 1Y8QB 5IZCA 4OM8A 3Q9UA 2AQHA 2CY0A 1Z7EA 5T8KC 2O4CA 4J4BA 1WMBA 4DPMA 3WBFA 3ST7A 4PRKA 4FS3A 1I3NA 4CQLB 1N8KA 3IDSA 4BOYA 4MOWA 3H2ZA 5C5IA 1D8AA 4FB5A 2UV8A 1VSVA 2CMDA 1H5QA 3UH1A 3JQ9C 3E9QA 4GKBA 4JXKA 1B8VA 4PLVA 5JMPA 3QA9A 1OBFO 4LSWA 1T4DA 4HFNA 1F06A 1Y6JA 3OMLA 3DZKA 2HU2A 1JA9A 1IB6A 2VUUA 2FSVA 3ONDA 2D1YA 1P9LA 1U3UA 1QSGA 1I8TA 2H6EA 1P1KA 1E3WA 1DC6A 1WP4A 5IXSA 3PI7A 4TMFA 5K6AC 3OEWA 3JQ7B 4KWIA 2EJVA 4JJFA 3IMFA 2YY7A 3PQDA 3VH2A 3GEMA 3GRKA 3WOHA 2BELA 3EGOA 4O63O 1UAGA 4RPLA 3D3WB 4B4WA 5A5EA 1LSJA 1DC3A 1NBOA 1EVYA 4LGVA 4XKJA 1YE3A 1E0DA 1YH3A 4CUKA 1IZ0A 4B3JA 1FF9A 1ULUA 3I83A 1E6UA 1ZKMA 3ADOA 4NJMB 3H8VA 1YOVB 3N58A 3WJAA 2Y1FA 5JDCC 3KYBA 4QT0A 4W7IA 5IDWA 1Z6ZA 3JQBA 1YB5A 1F8GA 2P2SA 4W9NA 1DHRA 4O5OA 3IQDB 2VYNA 1PQPA 3SBOA 4O0LA 5EQFA 1A9YA 4KP7A 4CQMD 1PGOA 2PY6A 2I3AA 3U4IA 4OMUA 3H2SA 3WLEA 1HKUA 2O3JA 5LDGA 3QP9A 1BW9B 5KJCA 1WZIA 2PZMA 4CUZA 1TXGA 1LU9A 3MOGA 4JP3A 1YWGO 1DJNA 3DMYA 1UAYA 1YS4A 2OBYA 2VOEA 2EKQA 3F46A 4AJHA 2VTDA 3U4CA 1XGKA 4U7WA 1KY5A 1UXIA 3VPGA 5T8KA 3BMOA 4PCVA 3RBXA 1T2AA 1ZSYA 3IKVA 4BNVA 5TF4A 1NASA 1G6KA 2PA3A 2QX7A 3DZBA 3EYWA 3ZHYA 4NH4A 4J91A 3JQ9A 2DU8A 2RH8A 2C82A 4P4NA 1LRJA 1XQ1A 3WLFA 4MINA 2GF2A 3PFFA 2YYYA 4IDEA 1DB3A 3B70A 1ADFA 4Q39A 3UOGA 5DOVA 3HUDA 3L77A 3SEFA 4DUPA 3UF0A 3JCZA 1WXDA 1LLUA 3R0IA 5A05A 2FPGA 3TZQA 4I8XA 1MFPA 3L9WA 1JW9B 1YJ8A 2AEFA 3ROQA 5K6AA 4NBRA 4II2A 4IGFA 5G4LA 2LDXA 1HDYA 3H3JA 4ZGWA 3O03A 1DC5A 4EEZA 2D3TA 3UICA 1SAYA 1X1TA 4IGEA 3F6YA 4P8RA 4BGIA 4IUYA 4K28A 2VRBA 2VWQA 1EK5A 3JQ8B 1U7TA 4J1NA 1OC2A 5CPBA 5JCJA 4Y6PA 3ZWVA 3BHJA 1XHLA 3S55A 4DYVA 1PX0A 3BTSA 3RFTA 1VJ1A 3MJ4A 3F5QA 1H6DA 1P1JA 1N92A 3ENKA 3PDUA 4PLWA 4PLTA 4B7XA 2IYPA 4GVLA 3GMDA 4E6PA 5IDXA 1R0SA 3S8MA 3ZU4A 1ARZA 5JDCA 2ZB3A 3OQ6A 1KVUA 4DIOA 1QP8A 4BNKA 1PZFA 1XLTA 2ZQYA 3DONA 3C1OA 1D7OA 1KIFA 1PS8A 1D3AA 4GGPA 4EUHA 2GN6A 2CUKA 4E2WA 2EGGA 1MG0A 1EBUA 1VM6A 2GCGA 3ANLA 1CQIA 4R3NA 3ASUA 4BO7A 4R9RA 3AWDA 1T4BA 1ZW1A 2Y0EA 3G17A 4FR5A 4J4HA 4NHEA 4BNZA 2PGDA 1U2GA 4TQGA 1XQ6A 2O7QA 3ZWNA 5GMOA 3D64A 1UH5A 3ETEA 3HG7A 4R1NA 2X0NA 3SLKA 2A35A 2B36A 2WTBA 4UREA 4EJ6A 5B4TA 5A9TA 1EFKA 3H7AA 3C7DB 2B83A 1B0AA 5JAIA 2FZEA 4WPGA 4BO9A 4WK6A 3PHGA 2AXQA 3DOOA 1WDMA 4WLNA 1U3VA 3EMKA 1K5HA 1WNTA 3OIFA 5G4KB 4EW6A 3I9MA 4RLSA 3P19A 2HK9A 3EUWA 2ZTUA 2G1UA 1G1AA 1I33A 2VOJA 4G5HA 4XDYA 4AJ4A 4WCDA 3P2OA 1DIAA 1R66A 2RHRA 4DBZA 3PQFA 1OC4A 3JYPA 1ISJA 3A28A 3WXBA 3U4HA 1DFIA 4NFYA 5TC4A 4EGFA 1QMGA 3ZU2A 1EQ2A 1ZMOA 4EEXA 3KTDA 1SO8A 1YRLA 3TSCA 1X7GA 1PL6A 1SB8A 3S1LA 4L4RA 1AE1A 4ONEA 1LDGA 1R0KA 2O23A 5G0WA 4Z0TA 2B4QA 2Y1DA 4IS3A 3F1KA 1IHYA 4FDAA 3RASA 3TZ6A 4AJLA 1B2LA 5JXWA 3D5QA 1E7YA 3K30A 2ET6A 1AHHA 1QLHA 3ZWWA 4BNHA 1HSZA 4BKPA 1DIBA 2Z5LA 3NDIA 4FW8A 3H9GA 4J6FA 1J6UA 4AJJA 1TVEA 1YQGA 3QVXA 4NIMA 3EZYA 3ZW9A 2X58A 2DUUA 3RUFA 1TI7A 2QZZA 1CJCA 3UCFA 3HFGA 2VYND 3C7AA 2NV6A 1OFGA 2QRJA 5BSEA 3TZHA 3HWRA 4WEQA 1OOEA 4R69A 2FHSA 2I3GA 4CQLA 1DBVO 4OO3A 3RC2A 4WLOA 1PEDA 4OAQA 1H2BA 3GT0A 3RC7A 2FPIA 4OQYA 4Z9FA 3VZQA 3GG9A 1LDEA 3KZVA 1N7HA 2BFMA 3GGPA 3ZV6A 1V9LA 2ZB4A 2X8LA 3NDRA 1JN0A 5CG2A 1U5AA 4DVJA 3RBVA 1NXQA 5B1YA 3ABIA 9LDTA 3WSVA 5JFOA 4PZCA 4MPDA 3VVCA 3VHRA 2FRDA 4IY1A 3JQ7A 4LMRA 3CZRA 1DXYA 3O4RA 3GG2A 3FBTA 3WGTA 4DREA 3INRA 1WPQA 2XXJA 1ISMA 3DBRB 3JD2A 3D3WA 4MVJP 3H5RA 4XR4A 4AFNA 3RI3A 3JYQA 8ADHA 5DBIA 3H9EO 4CV2A 3U62A 2GGSA 4D0RA 3LLVA 4I9NA 3LF1A 2IXBA 3MCVA 5EESA 1PJLA 1O9BA 1GEGA 2BGKA 3PWZA 4PVDA 3RKRA 5IF3A 1UR5A 3GPIA 1YQXA 1YOVA 3GGOA 4DIBA 1LSOA 1K89A 1M67A 1YL5A 2GRAA 3FR7A 1DRUA 3HDQA 2YJZA 3NAQA 3PHIA 3TZKA 5A9SB 5GY7A 1E7QA 3AW9A 4W7HA 1I36A 1QORA 2Z1MA 5JCJD 4LRSB 4NZ9A 1XSEA 4J7CA 4JCOA 2OP0A 1R4MB 3VVBA 5HM8A 3C85A 5EPOA 3KHUA 4JROA 3KETA 3GY0A 4GKVA 3CMCO 3ZNOA 1BW9A 5F1OA 4XJTA 1LSUA 3GNSA 4CMEC 4CR6A 5JDIC 1ISIA 4BNFA 1EDZA 2C5EA 4H15A 3Q9NA 1U4OA 2EERA 4BQPA 1WAMA 4BNLA 4CMKA 4RCVA 3OICA 2Y0CA 3ZGYA 1IE3A 3L4BC 2OMEA 4D43A 4JNKA 2NADA 1CEQA 5EJ2A 4DPKA 3A9WA 3QW2A 2G17A 4XIYA 4LMPA 1HDRA 3K5PA 1DPGA 1KVSA 4XQCA 1HT0A 2JAPA 3WJ7A 1I24A 1CWUA 1I30A 3LC1O 1HEUA 3BMNB 2PFGA 4IDBA 2PGLA 1XR3A 4XX0A 2FN7A 4RO0A 5FFFA 5BNFA 5IG2A 4R16A 4CLOA 1NQOA 3LLSA 4A73A 3B1JA 3G0OA 4E4YA 3K96A 4JBGA 1WWKA 1FDUA 5A03A 1MXHA 2C2YA 1ZEJA 5L4NA 3U4DA 3DBHB 3LK7A 2PKRA 3NRCA 1GR0A 3MJTA 3VH4A 3VDQA 5B4UA 1EZ4A 4K9DA 2ZK7A 4FOSA 3UN1A 4DQVA 3JQ8A 4FFMA 3U5TA 1YO6A 3PYXA 2P9CA 4IBOA 1HE3A 2VZ8A 3JQDA 3PXXA 3KV3O 4Q3AA 2FP4A 1P44A 1PZEA 3NX4A 4BGUA 3AI2A 5CEJA 3JQFC 2BFPA 4CM1A 3IP3A 4PG4A 4XQ9A 3ANMA 1VL0A 4PLYA 4BV9A 3GOHA 5IDQA 4UVIA 1UZMA 4CODB 4I08A 1YONA 2V65A 3Q3CA 4IIVA 5K0ZA 2NTVA 4KMSA 4BMSA 1M6WA 2NACA 4O1MA 1ZJYA 3EW7A 4JIGA 5A1TA 4Z0HO 3D7LA 3UCXA 1BDBA 1G0OA 4JBIA 4A03A 1BSVA 3WGQA 3I6IA 4CMEA 5LCXA 5JDIA 5DT9A 5KJ1A 4XRRA 4UVGA 3VTZA 1LDYA 1U8FO 1SOVA 3GN1A 4YXFA 3AI3A 4BNJA 2CFCA 1BWSA 4GI2A 1N2SA 3G1TA 4YT2A 5HWSA 2W2LA 3H3FA 5JO9A 4FGSA 3L4BA 4XR9A 1V6AA 2I9PA 1PR3A 1YBMA 3MTGA 2PLAA 2Q49A 4CLXA 2PZJA 3DO5A 4BB6A 2BMAA 5CHEA 2J3KA 1QYXA 5AXCA 5KJEA 1M2WA 5G4KA 4QSMA 4BNUA 5CDTA 1E1MA 1SNYA 1VPDA 4LISA 3VTFA 4JX8A 2AQKA 3H5AA 4U6QA 1P0FA 3GNTA 3TDKA 1CRWG 1J5PA 1K6JA 3A14A 3VC7A 3B6ZA 2DM6A 3GVHA 2P9GA 1PS9A 4HUJA 4D45A 2GERA 2OFPA 1XWFA 1BXKA 1EDOA 3GK3A 2IZZA 1BXGB 4MIOA 2HMWA 2CVOA 4CR7A 1SBYA 4OH1A 2O2YA 5AYVA 1VJ0A 1DLIA 3SC4A 2YFQA 1PJBA 1HYHA 2DC1A 4WOJA 2AE1A 5A02A 3OP4A 2GR9A 1B8PA 1UDBA 2C0CA 4K26A 1GZ4A 1C1XA 3KSUA 1GY8A 2UDPA 2GDZA 3AUUA 1YGYA 2VHYA 3RU9A 1S7CA 1QYCA 2HMSA 3BA1A 3DAGA 3JQFA 4C4OA 3GLQA 4P4LA 4BMNA 2EW2A 3B20A 3RJ5A 5A9RA 4MDHA 1UDAA 4NR0A 1ADCA 5FWNA 3FCOA 5I9LA 1LDNA 4Q3EA 4ZJUA 3AUAA 1A72A 3DAPA 4A10A 5HRUA 4R3WA 5A3VA 1X1EA 1FDSA 2VHXA 4M49A 4PGFA 4MVJA 1Q0HA 1Y9AA 4NFHA 3AM5A 3JD1A 3LT2A 2EP7A 1E7SA 4BKUA 4TVBA 4BGEA 2ZCUA 4F46A 2VZ0A 1E1LA 1E6WA 2I65A 4B4UA 1LLQA 3DZHA 3P5SA 3HJAA 5TGDA 5L7TA 3D5TA 4GBJA 1E6EA 3DZIA 1BHSA 5G0UA 4XCVA 4KWHA 2DUWA 5ILOA 1Y7TA 3FBGA 3VZPA 1K2WA 1J4AA 4M89A 2Y05A 2QG4A 2YDYA 3INTA 2Y1CA 2DPGA 3FPCA 2X22A 2HCTA 2A92A 1CERA 2NVUB 4ND5A 1SMKA 4II3A 3C3XA 1ZEMA 5DCUA 4J1QA 2NLOA 5F1KA 2VUTA 3HQ4O 3R6DA 3AY3A 3AI1A 3S2IA 2Y93A 4RF2A 5CPFA 2QYSA 2QRKA 4AJ2A 3E9MA 4YWJA 2TMGA 2YHIB 1H6BA 2OORA 4QTZA 1LX6A 3SVTA 2DT5A 2WDZA 3DBRA 2X23A 4GX2A 3LVFO 5IFLA 2X0JA 3CPSA 1P1HA 4XWYA 3LQFA 2AEJA 2C7GA 3L07A 3M6IA 5T6BA 4BNNA 1O89A 1VSUA 1WZEA 1S6YA 1ONNA 2EIHA 5THKA 3VPSA 4YTEA 4ALIA 2WM3A 3DDNA 4L4SA 1SEVA 2PD3A 1ZUD1 3RUAA 2WJPA 1JTVA 4HP8A 2B0JA 1LI4A 4BO6A 1EFLA 1HYGA 4PLFA 4OKNA 2NU8A 1VJTA 5DP2A 2GNAA 5F3RA 1KY4A 1R4MA 2G5CA 4FCCA 1YB1A 2XXBA 3GHHA 2BLLA 4R9SA 3TQHA 1LJ8A 3DTTA 3RU7A 1YKFA 4CLHA 1MV8A 2PTGA 4BS9A 4JJGA 1E3JA 1JLLA 3V1YA 1GDHA 5L40A 4YAEA 2X6TA 2ZTMA 4R1TA 4EUEA 3R3SA 4E0BA 4YQZA 1MXFA 1KVRA 3GEGA 3ZV4A 2Y0DA 1ULSA 1HSOA 4L74A 5COQA 2YHUA 5ICSA 2YQ4A 3AOEC 3QHAA 4JK3A 4E32A 2G82A 4IDGA 1B3RA 3GRPA 1JWBB 1O0SA 1ENOA 5AXAA 5I9MA 1HDZA 2AMFA 5DBFA 2OZPA 1BG6A 1ZVMA 4D42A 4KUEA 4YVFA 4GL4A 4QECA 4CV0A 5HS6A 3RCBA 3V1UA 2W2LD 3ZV5A 2C29D 1WDLA 1F0YA 4RPJA 3BZUA 1PGPA 1PZHA 2WWRA 3KXDA 5ITWA 1HXHA 3C1TA 3K9QO 1WW8A 5CG1A 5T57A 3S2EA 2B69A 3WYEA 4DWVA 3JYLA 3DBHA 1H6AA 5DBGA 3T4EA 4FFRA 3NT2A 2P4QA 5EINA 2YW9A 5EMHA 1F8FA 4N5LA 4DMMA 3QVWA 4WNCA 1UZNA 4LRTB 4OKIA 2DTEA 2ZYGA 4KQXA 1KEPA 1BXZA 3EVTA 4YRAA 2Y1OA 4PZEA 4RF4A 4HNGA 1C1DB 4OJNA 4EJ0A 4DXHA 1EVJA 3I9NA 4J3FA 3NKLA 3RUIA 4CM9A 3KEOA 2DKNA 2Q1WA 4B3HA 4FFNA 2NU6A 2FSSA 4HX5A 1QXSA 1SPXA 4CL3A 3QIVA 1A7KA 1H2HA 2J5KA 2AG5A 4IQGA 1AGNA 4E2YA 3TFOA 1U7HA 3ZWYA 1O8CA 1P3DA 4E5YA 3KOUA 3H5NA 4B7UA 1PGNA 5JAZA 4IJVA 4WOKA 1KC1A 1V8BA 4NBVA 3V5NA 1T1RA 4IMRA 3JSAA 1HF3A 4EZBA 4GH5A 2X5OA 4HFJA 3DR3A 4MVJD 1MA0A 4W4TA 3H4VA 4B4VA 4WCFB 3F4LA 4ND4A 2CF5A 3AOEA 1F14A 2NTNA 4JP2A 1YBAA 4BKQA 5KNLA 3MZ0A 1H94A 2Q46A 4YRBA 4CMIB 2VNAA 2GLXA 2A9FA 3DOCA 3OQBA 4RPGA 4YJGB 3EK2A 1TT7A 4ZU3A 3AM4A 4AICA 4AVYA 5JC1A 2GUGA 2VCYA 4BKOA 4E21A 3F47A 4ALLA 3QRWA 3WTCA 2WE8A 1GADO 5L51A 3ITKA 1QKIA 1XCBA 4PIVA 3SX2A 1Y5MA 2VUSA 5JC8A 3AUTA 3GMSA 1I32A 3BXXA 1TEHA 1BXGA 3NGLA 2QZ9A 5KJ6A 4HNHA 3F3SA 3HDJA 1V0JA 4MP3A 1MP0A 5F1PA 2ZB8A 3ONFA 4ILKA 3RD5A 4DC1A 4KOAA 1SEPA 2IZ0A 4L73A 2PK3A 4RDIA 1E3LA 4RVDA 2Y1EA 3QE3A 1XU7A 3IS3A 4JJIA 5ILGA 3GGGA 3WS7A 4MO2A 4N54A 5G0SA 3GA0A 4R1UA 3PJEA 3E6AA 4BO0A 3OM9A 5JW6A 3NTOA 1ZZEA 4Z3DA 4W6ZA 4ZQEA 3FTNA 4RF5A 3LDHA 1IL0A 1Y8RA 4FJ0A 1GYQA 5TJHA 5CAEA 4BKRA 5B4VA 4DC0A 1P31A 3PQEA 3RBZA 1PJTA 4CMGA 1U28A 3K92A 3PP8A 2WEKA 3ZHXA 1X15A 4IINA 2JD0A 2VHZA 4Q3DA 4OXKA 5JCXA 1NFFA 1KVQA 1RYDA 5IXYA 3AY6A 3QWAA 1GD1O 3HDHA 4J7UA 3K2EA 4ND2A 2H5LA 2D5AA 1HE5A 1ZBQA 2X5JO 1J0XO 2O3SA 2ZYAA 4Z9XA 1GU7A 1FDVA 3Q2IA 4IDDA 2RBEA 2DQ4A 3FN4A 3E03A 2Z95A 1Q7BA 2CDAA 4CM3A 2B5WA 3PEFA 5JLAA 2DTDA 4LK3A 5IAAA 1L7EA 1R15A 3KRTA 2HKIA 4WEOA 4IXWA 5HS4A 2HQ1A 1H9AA 3DL2A 1QR6A 2NVUA 1PJ2A 1K0UA 4OXNA 2Q4EA 1WLYA 4E2XA 4IZIA 1R16A 3VPFA 4YAIA 3TWOA 3QSGA 2ZCVA 3HE3A 1ZJZA 2JHFA 4E5MA 2YHIA 4EUFA 3WGHA 4ESOA 2BGMA 3T7EA 1ZIDA 2V7PA 4Z6KA 2D0IA 4DLBA 4YCAA 4O6VA 4ZVVA 4R68A 1LQUA 3HB5X 4J2HA 4Q9NA 3GZNB 2JFHA 2YFHA 4TWRA 4Y6SA 5EL0A 4GSLA 5BSGA 2JFGA 1AXEA 2DTXA 2P9EA 2VHVA 3UAGA 3AY7A 2ZATA 1UZLA 5A04A 3PHHA 1T26A 2R2GA 4IPTA
chains in the Genus database with same CATH superfamily
1DJQA 1MW9X 2AJTA 2C2BA 221PA 4TV9B 5FNVB 3ZXIA 6ADHA 5LL6P 3I5XA 4ZRNA 2Y1LA 1ATZA 1X74A 2G09A 3RUDA 3S2FA 5AI6A 3ONEA 4R2MA 4OATA 3M1YA 4F4CA 1RM3A 1Y80A 5A0VA 3AO0B 1CJTC 3H87A 2VRCA 2ZRCA 4JA0A 4W8GA 4QBIA 3DMFA 3IGFA 5IJZA 1I51A 1G3RA 1W9MA 2EKLA 3DVLA 1Z73A 3H84A 3KYDB 5FBHA 4JJKA 4EK9A 4EUKA 5BUSA 1FDIA 1UOPA 2GHIA 2PMFA 3A0UA 4ZHQB 3CVXA 4I4LA 1OWLA 3SSMA 1RLIA 3ZW8A 3F97A 1P3Y1 4TLCA 2FZGA 4Y1FA 1PUJA 1TGVA 3OQ1A 2E4XA 4M0DA 1NE7A 3ZJVA 2QUHA 1SURA 3K6JA 2O50A 1YRAA 1COWD 1USUA 4H3HB 1G2OA 2YS6A 4RKYA 2HLHA 3I4CA 3G1WA 3JWJA 2YJNA 4EA6A 1SJ9A 2EDCA 2I3DA 3L05A 5LD2C 3A05A 1HDCA 4QQRA 2ERYA 2PDAA 4O4JB 4WNIA 1FQOA 1OLSB 4I2VA 1GRNA 2E4YA 5IC5A 3G2MA 5ENZA 3EIEA 3LRXA 3EGXB 4C7OB 4D6XA 3ZE6A 1B8OA 4Q1VA 2J85A 2W2PA 1LPAB 3AXSA 5K7SA 1E1DA 5SZIA 3KQUA 2JIQA 3AKCA 2H8KA 4WESB 3AVOA 2FX2A 5B64A 4MV5A 2PKWA 1ANKA 3H9UA 2VT3A 4GP7A 4Y0VA 4EG8A 1GGMA 1V48A 1A9OA 2JDID 1K9VF 3PL1A 5E2IA 1NU6A 4EG6A 1SUAA 5JPDA 3UGJA 3WWZA 3TF5A 2PD6A 1GG2A 2DFVA 2WF9A 3HKDB 1B76A 2J67A 2PKYX 2YMMA 4Y1GA 3AR9A 4HPJB 5KWSA 2XBMA 3G2KA 1E8MA 2HDHA 3WLMA 1XEWY 2XMPA 1W1IA 4Q47A 2BM8A 4PYNA 4HDNA 5I7FA 3IBCA 3OTHA 3FYUC 5AK0A 1HZZC 2FSPA 5ADVA 2XBLA 1ZNYA 1QGOA 2FPMA 2IXDA 1XZEA 3RPEA 3I1JA 2BFBA 2CBZA 4G3XA 1Z45A 3OECA 3VHQA 2ZQ5A 1UF9A 4FGWA 1C1DA 5SZKB 3DTYA 5CMLA 1XKLA 2A59A 5HDQA 1MN6A 4O5AA 4F1WA 1DIHA 1TRKA 2WIFA 4MQBA 2C8KA 4TVOA 5DN6A 1BRMA 2HBRA 3KT8A 2BEVA 3PCRB 1ISGA 4RJTA 3CRRA 1F0PA 2Y8EA 3ET4A 2B9VA 5H9VA 1QU2A 1ETUA 5F78A 2BUAA 4H9GA 4N6NA 2GB4A 3SN6A 1I4LD 3MMXA 1ZUNA 1ZNZA 4ND7A 4A6XA 3DEZA 1ZU4A 2PKQO 3KUCA 2D06A 2OXRA 5AW6A 4ARCA 2Z1DA 1B0ZA 4IZHA 3UAZA 1RJWA 1L5KA 1Z35A 1CDEA 1Z0FA 3P9NA 1V8FA 4YQYA 1EFRD 4BU0A 1M2VA 1ZK3A 1Y8ZA 2H17A 3GIDA 3ICPA 1TYEB 2P79A 2Y1XA 3AEUA 3KDSE 5HF5A 2G70A 5DGIA 2O8BA 1T10A 4K6GA 3DPUA 3PNOA 2CEAA 1LTKA 4IP0A 3MAJA 3Q0TA 2JJ2A 3BWEA 2HEIA 3BCSA 3QX7A 4CEJB 2RHLA 1P17A 1Z37A 4ZI2A 3T3GA 1RXCA 1L7QA 5A5FA 3DFIA 1MFZA 1YDEA 4MSUA 2QHXA 3HMKA 2ZJOA 1XVVA 3ZNQA 5FPPA 1RTKA 1MRSA 4JVNA 2OCXA 2EX1A 2C0PA 4ZI5A 1GT6A 4H7IA 1GPUA 4JBXA 1JEYB 1Y1RA 1ZO8A 1U2PA 3VKVA 4BNIA 3L4SO 1TYAE 2XZOA 3BHIA 3N2NA 5KAPA 1XL1A 1ZGZA 4MHSA 3I76A 4LA4A 3IALA 1HUQA 2Z3VA 3DNFA 3HNPA 4MVJH 4AN1A 4EVRA 4WERA 2QP9X 1VG0B 4DRYA 4PC6A 3ZJYA 3KBBA 3WLKX 1YR7A 3ZDFA 4EM6A 4WKOA 1JSRA 3NXSA 1DHTA 4CW7A 1XU9A 3IOYA 4JS0A 4EKGA 2VAXA 2YV3A 4RVNA 4X1IA 4U5QA 3R76A 4DV5B 2MCFA 2ETVA 1NF9A 2J09A 5FEMA 3V8EA 5C37A 4IIGA 2FZVA 2A0WA 4YJ2F 2LWIA 2R3SA 4TROA 2QY6A 5CB4F 2RKWA 1Y81A 5DM4A 1P3JA 1RD4A 3QBEA 1KEEB 2LIPA 4HAZA 4G8DA 5HKKD 1XD8A 2NYVA 1H0HA 2OLEA 5ECWA 3CX4A 3QWFA 1QVVA 4HWSA 5G2OA 4PQGA 4TL8A 3FYUA 1GP2A 2IYUA 1DUIA 3UNXA 4JXXA 1B26A 1HZZA 4XQGA 3ROPA 1U9CA 3MUEA 3NV9A 1KJIA 5KYYB 2IYSA 1WIWA 2COKA 1KJWA 2IXGA 4CI0B 4I8IA 2PH7A 2NAPA 2OAGA 5SY6A 3E18A 3ICCA 3QNWA 4MW0A 4KZPA 1BNCA 2IXFA 4DAOA 4HGYA 4D8VA 1MOPA 4Q05A 3W8DA 5BWOA 1NUHA 4HBGA 1MBZA 4YJ3A 4AL4A 1I94B 2ORYA 2AFIB 3P2KA 3P20A 4JB2A 1PHRA 2WHXA 4HV4A 1V37A 3C5WP 5CX4A 5DM2A 2A0UA 3T1TA 2Z58A 4TTTS 4Y2VA 5IFKA 5AW7A 2XOKD 1RXWA 1THMA 3L0DA 4ZN6A 4CF3A 3L8FA 2PVSA 2RKBA 4BEVA 2C4UA 1Q0UA 3HB9A 1MLDA 3CH7A 3TD2A 4LG1A 1P1RA 2VZ9A 1WHSA 3RE1A 3R7DA 1VHQA 3KQQA 2ECOA 2QX6A 1L7XA 1W93A 4XE5A 5IRCD 3GUUA 3I2HA 3BIFA 4AZWA 1KQFA 4IFTA 1X1DA 2QMHA 4RMIA 5JVDA 3H2IA 4COOA 1BX0A 2ZRLA 3NIBA 1QO0A 3ZLVA 2CK3D 4YHBA 2WJWA 4Z2YA 4EPYA 3V4ZA 5FI0B 3ELWA 5BNTA 3GVXA 5JQGA 1BROA 1D7AA 1QDUA 3AU9A 2PH1A 2QAIA 3FKQA 1UP7A 2D7JA 4MVJG 2HK8A 1RZVA 3C7CB 4GKAA 1R7RA 2GBLA 3KT6A 4NJOA 3O2QB 2YCBA 4XDHA 3U17A 4RGYA 1T9ZA 2W98A 3GAZA 5TMEA 1DDOA 3MYRA 3WGOA 1GYPA 1AN9A 1IM5A 1E2HA 2I2FA 5CJPA 2PTHA 3HKCB 4QDUA 3TUZC 4G5FA 2IVFA 1CSEE 3DHEA 3HR7A 1TLTA 2HA0A 2PEYA 2CDCA 2RGBA 3M4NA 4KJXA 4P4TA 3O4JA 1L5VA 1U9IC 2I2DA 5AVSA 1GZ6A 3DUWA 3IP8A 4L75A 5FL7A 3C4QA 4TXLA 4MYSA 1K0FA 1G2IA 1ZS9A 3A4NA 2XRFA 3V33A 3FMPB 4NU0A 3WMXA 4TXMA 1DKLA 1Z2NX 2G7ZA 2P91A 3ZHTA 4HVCA 4CEHA 4D5EA 2ZRDA 2HIHA 1QIMA 3MWEB 1L7PA 3U4AA 2ZIAA 5B5SA 4IIJA 1QQ5A 2GCIA 1YZKA 2RGNA 4CTJA 1MUUA 2WUDA 3GZNA 3INGA 3FNRA 1TTPB 1Z4NA 4XIIA 3WAKA 4MUNA 3DXFA 4RMJA 1N3IA 2OHHA 3K73O 4V3CA 3SKYA 4UTVA 2R6HA 5JBNA 1ZGJA 1LNQA 3HI6A 5AM5A 2C98A 2C3MA 3PXAA 4GPAA 1C80A 3WXMA 5HIJA 1TA4A 4N4AA 3C5EA 3KHKA 1YDFA 5KEIA 2RAFA 3LXXA 3E7FA 1A77A 3EA4A 3AW8A 4XVQA 2PO5A 2G08A 2R1UA 2JHGA 2IPNA 3UMFA 3GVCA 4Q3OA 4B79A 2H1CA 1U99A 2R87A 1BGVA 5K2MA 3IEVA 3NRJA 1E6KA 3K1JA 4FILA 5EAIA 1Z2PX 1R6VA 3ER8A 3AEZA 5BW6B 3ANSA 3DE4X 4ANFA 5CLFA 3OPXA 1JAXA 3D8UA 5TEVA 1FTWA 3D9QX 4X54A 4AMVA 1A04A 2CLLB 1KEKA 4FP9A 1WF3A 3AUJB 1ZINA 3C15C 4H7EA 2TECE 4N39A 4OL0A 4RJ2A 4EBFA 2ZYTX 1N5OX 3N2EA 3I2YX 2WJGA 2PSSA 3O8BA 1XA0A 3B3FA 4N03A 3T1VA 2OHOA 2VH5R 1CUGA 2BRUC 4BMZA 1M66A 1U2DC 2VNSA 2JAHA 2UZ0A 3S2GA 4S3MA 1XDBA 5I4IA 2FWRA 4MP8A 2HF7A 3TLEA 2OEPA 2REOA 3FSEA 1AHNA 2FMUA 4BHTA 4J76A 2GJ9A 4UATA 4G63A 5A6SB 4MWZA 4MGIR 2OD2A 4PBSA 2I6QA 2J3HA 3L7YA 1D4FA 2D8MA 3UK2A 2ENUA 1BX1A 4RY9A 4RDHA 8OHMA 4BE4A 3W4JA 4G65A 4DDHA 5FPKA 3T5MA 2VNHA 1AV7A 3V7WA 1EXWA 4L8WB 1U9IA 3UMGA 2CVQA 1VE1A 3D5EA 3RKUA 3OUTA 1KP3A 4XWOA 3RSSA 3FFTA 5A71A 5KMGA 4XB2A 4M6WB 4ZEMA 4L0MA 1Y0BA 3NVDA 3QU9A 4DJTA 1R5JA 4BZPA 4E5DA 2EJWA 2HC9A 4EAQA 2IU0A 5JI2E 3LIPA 2UXBB 2GSWA 4C7BA 1LC0A 2WPNA 5KYKA 2EWMA 2YIJA 1PT7A 2H2AA 2QL9A 1Q19A 4YC7A 3ZWXA 1ESNA 3ILHA 2P6UA 4MCAA 4RM3A 3DQQA 1UKBA 1Y9JA 2E55A 3JSXA 4DMLA 5IAOA 3UUFA 5FOVA 4LJYA 3OPVA 1Y1LA 2XNCA 4JX9A 1LLCA 2ZANA 3OFSA 4R1MA 3UMYA 4JZYA 1CDZA 4YONB 2FF7A 2HV8A 4GOOD 1BHQ1 4KX5A 3GZTB 1M83A 2B2CA 3TGPA 2QTMA 3U7QB 1YASA 1W4RA 4FN4A 2BEUB 3TTXA 1Z0UA 1MX1A 2P2CA 1LUAA 3HFSA 1CUSA 2QJWA 3IUNA 2Z3ZA 5E6RB 4BX3A 4FDLA 2IYAA 3H86A 3CIFA 1GPJA 3PHBE 4QNNA 5HE8A 3KKEA 4TYWA 4NP6A 3FBWA 4F96A 3K53A 1JPJA 4DQ0A 2XE7A 4R1SA 2H06A 1N6PA 1NW3A 2YXPX 2O8EA 2XA9A 1P0MA 1VMEA 2Z04A 1OZGA 1H2FA 2RC5A 2HDNB 3ZJ5A 4BZQA 2HTEA 4JLPA 4FC7A 3UFXB 5CIQA 3BK2A 5HJ7A 4DIDA 4B6PA 2I54A 3I9V1 4NYIQ 1T9AA 3E0QA 4D44A 5JS1A 2N1BA 4JLWA 4E07A 3S27A 3C98A 5HIMA 1PRYA 2WIDA 4ESHA 2VDPB 4H2DA 4CDRA 2IP2A 3RIXA 1U7UA 1B14A 4ZQGA 2EQAA 2BRUA 3THXB 1QTIA 4OX9B 4MDFA 1U2DA 2E5FA 3TLCA 3W78A 4EW1A 2CCKA 4PQFA 4X3OA 1M33A 1XX6A 4MUXA 3OEHD 4Q48A 2HSZA 3WKCA 1FFHA 2I8LA 1XT6A 5CDFE 2JFUA 4UBLA 1XPRA 3WMRA 2JJYA 1WOYA 2XOXA 4B6FA 4N8EA 2FUCA 1XTRA 1N9GB 4EL0A 5KDLA 3WGZA 4GX0A 4A0HA 1F20A 2XA1A 3STVA 3R3UA 1XB2A 2VQ6A 2PUBA 3TG8A 3A04A 4XOUA 3TBHA 4F3CA 3QVUA 4D9NA 2GH1A 4HAUA 4NQRA 3A1TA 1EFPA 1E9FA 4ZQBA 4UHDA 3T12A 4B7CA 4HNTA 1Y4UA 2DFKB 5CCXA 3NM4A 3FLMA 5I4KA 4P0TA 3L4JA 2J5QA 1CCWA 2XVZA 3QYFA 1J2JA 4RVHA 1W4ZA 3PZRA 4ZK6A 3JVEA 3M83A 3H2HA 2Q5OA 5LC1A 1T0UA 3PUWA 4BE9A 4HTFB 5IBPA 5A2GA 3EDQA 3OQNA 2QVCA 1G41A 1UANA 1JLSA 4FIDA 1GKUB 1Z6AA 5BSTA 3CLTC 4B48A 3V1MA 4FQ8A 4Z7NB 1XFAA 3GFVA 3WBBA 4GPBA 3DNMA 4JYZA 1BDHA 4D99A 3L43A 1JJAA 4M1YA 1ECBA 2C5FA 2JZNA 4O02B 4XA8A 5FPYA 2Z4RA 3SC2A 4C0SA 2IXTA 2JJ1D 5EIOA 4TS3A 4NTZA 3RLIA 4MR8B 5IJ0A 5IN4A 1VGVA 3P9SA 5K0NA 3CVUA 2WWTA 1LTHR 3E3NA 2AG8A 2VQSA 1OJLA 3FDFA 4RAOA 5DU2A 3UENA 4X3PA 4C78A 4QG7A 5I48A 1IEVA 1O6CA 2YHBA 2ZBEA 4PWZA 4D9GA 3PX3A 1N2GA 3OSZA 2M98A 3HM9A 1W73A 2XTJA 3VKUA 2JCXA 2Q2QA 3N6XA 2B3DA 4KIWA 5AQ1A 3IUYA 3PVCA 5D7BA 1V9CA 2NXWA 1YS7A 2VT6A 2XB8A 3EW9A 3ZXYA 5CFLA 1LCIA 2IYEA 4I3HA 1NJ1A 4RTLA 2HJHA 3RFFA 3TNLA 2WWGA 4ETMA 4DXDA 4LJRA 3R8CA 4FEAA 3AFGA 2Q4DA 1ODCA 2JGKA 3BJMA 3WSTA 3E2MA 2JGDA 2HK6A 3S28A 5EHXA 4NU6A 2G5GX 5K8CA 2OYCA 2QTLA 3GRUA 1NF8A 1TK9A 2CXSA 3HA2A 4PVCA 1JE0A 4Q24A 4TTAA 4CL0A 3CSUA 2F1RA 3CV3A 3QKUA 1ENYA 1W47A 1Z2AA 3JZAA 3LDFA 1KS9A 3GDFA 3ZGLA 1XNJA 3X1JA 4G0ZA 2Y3IA 1ZH8A 1W6RA 3B8HA 3E58A 3PRJA 3DYBA 4IOKA 2PX0A 5ENVA 2B8NA 2ILTA 1NSTA 2P3QA 1YBHA 4PG7A 4ZRMA 4O8CA 3GIWA 2QVZX 3U7FB 6AT1A 4Q82A 1CR4A 2W2QA 2QP3A 1KJJA 3CEAA 1H8EA 2FOLA 4HDSB 1M1XB 4J0JA 3GYGA 3AINA 2YZKA 2J9GA 5CUQA 2WINI 2HIMA 5IN5A 3LBAA 3L0BA 1MF7A 1RKBA 2R86A 1TM5E 3PGXA 1JR3E 5EKSA 3WLNA 4AKHA 2V98A 1VRWA 4J7XA 1SQFA 4F9EA 1EGAA 2QLFA 1Q15A 3BK7A 4LHYA 3MT8A 4N5MA 3SIWA 1H9BA 4YCLA 1I7DA 3Q5DA 2PD4A 5AKEA 3MTJA 2AFHB 1BJRE 5FB3A 1PJ8A 5KYWB 3RAEC 4R6XA 1VL1A 2WILA 3S44A 2W58A 4H7DA 4YX9A 5C35A 5F2OA 5FORA 3I9LA 3EBOA 5LQUA 5AHWA 4FFBA 4I5GA 2PCLA 1KP9A 3OMWA 1QHGA 3GLSA 3QTLA 4OSOA 4EKEA 5JNLA 1G59A 1NLYA 1OBHA 1VE6A 1D2RA 1QS0A 4GDMA 4W5TA 5F4BA 5LMNB 1IN4A 1HLGA 3T3OA 4KDFA 4KAXA 5ADHA 1C3XA 1MZVA 3KOMA 2ZSBA 2ZWMA 2CLCX 1R0WA 4Y8VA 1GTMA 2WHEA 1GVNB 4ABTA 1XZQA 2OY0A 2PT7A 1TT5A 4HOYA 5TIIA 1DSSG 2ATCA 1NBEA 1L4FA 2J5RA 3D3JA 3UC5A 1UOQA 4DWOA 1ZM4A 3NBQA 1L5HB 2H31A 2PZLA 4U0JA 1A9ZA 4YP5A 1QOZA 4YALA 4JQCA 4CYMA 4FONA 3LPNA 2H0RA 3LVBA 4NE7A 5HK9A 1DIGA 5EHNA 1ZRNA 2CHFA 3ESAA 1JEDA 3CF4A 4MA0A 4XIJA 3UJCA 1KI6B 3HJHA 3WNVA 4BN5A 4CKBB 1J8FA 2YV1A 3D6MA 3UGQA 3KYCB 2VJMB 3W7VA 4ZICA 5AOVA 3PNMA 3GQBB 1HTWA 4CV3A 4MEAA 5IBQA 3WFJA 2YWGA 2Z6UA 1XZNA 3OQPA 3SD7A 2IZ5A 5IDYA 3PE6A 3WZ2A 1VJRA 1AKMA 2BM9A 2WC1A 1DO0A 3B1KA 3GFFA 3LUDA 5K0EA 1NI5A 3ZXSA 2CNKA 3C6XA 2CXPA 3C6YA 4FFOA 2DFNA 4JU8A 3U4QB 4NCBA 3QFSA 4X92A 1OB5A 2K7ZA 2QIOA 1GUFA 2WFMA 3I72A 2DWCA 3QKSA 3ZNPA 1KBZA 4J9UE 4HT3B 2CXRA 2HGSA 2KLBA 4LVNA 3FPLA 4JASB 4Y1RB 2XMSA 3KWJA 1EK1A 4UM5A 2C2HA 5TVGA 2UVPA 3CX8A 3SSOA 5LDHA 1ONSA 4B40A 1KZ4A 2HYDA 3M1LA 3OHSX 4DIFA 3ASZA 1NOKA 1UXHA 2YV4A 1NRXA 4BL5A 2ZQZA 1LDMA 1RKXA 4N01A 1ORRA 4TTPA 4Z8YA 3IP7A 2IF0A 1X3SA 4UQOA 4EEKA 4ZOQI 5JJCA 2XXAB 2VF4X 1IXZA 3UHJA 4B82A 1YC5A 2GM5A 3COSA 1GAJA 2IBTA 1ZZGA 1KIMA 3IIEA 2DFDA 3FI9A 1DOZA 4JGGA 4WN3A 1Y8AA 1G98A 2BCEA 2BFDA 4WK2B 3ZLUA 1Z6QA 3JQCA 2AMVA 3OEEA 4LUCA 4CM6A 1U2QA 4RTOA 1A9RA 1NTOA 1U0GA 4TMYA 3BPSA 1PE0A 3DBLA 3F71A 3UKOA 3OI7A 4LBVA 5C5CA 4XQ0A 1VLLA 5J4KA 1RYMA 1C3OB 2Q1SA 1MJNA 3MGKA 4ARAA 2P2LA 3NRBA 4LZWA 2Q7DA 7REQA 3LC2O 1OLUB 4LJ6A 4O2BF 5BQFA 1G5RA 4FX5A 2ATVA 4I5FA 3ZH2A 3FNQA 3CNQS 4K6CA 1SVUA 3RHTA 3GLFA 3ZWAA 2HHJA 5FWXB 2EHJA 2ZAYA 3PYMA 3SJBA 4FWIB 4YLEA 4I6JA 3GPDG 2AQ8A 2VP5A 3GOQA 4ZAZA 4EJFA 5CVTA 1V16B 4AP5A 5K8TA 1U4SA 2GK4A 2YFKA 3HM2A 5AJHA 5CITA 3U6KA 1VJCA 1XZIA 4RA9B 4RKQA 3JWEA 1IQ0A 2YWHA 4D9EA 2QQEA 3FFAA 5JRZA 2RGRA 4KMMA 1P1CA 2HWKA 3E22B 3LFHA 4CTNA 2R96A 3OPYB 5C8YA 1SHJA 1W76A 2YH2A 4PXYA 3TQSA 3HXTA 4QULA 3QEAZ 1YCGA 4O4IA 4RVUA 4Z9BA 4BFWA 2C5AA 3S70A 3IOCA 2X4LA 1EWRA 3I5MA 3IMEA 3O38A 4A8JB 3TX6A 2Z4SA 4OQPA 1ZSNA 3TNDA 1FZTA 4GX5A 4CN9A 2XCQA 1P0IA 4ZYLA 3R9XA 1SCBA 3AIKA 1C8VB 3EWNA 4P5DA 3VZSA 4DSTA 4ALNA 5IWAB 2QBYA 2Q1UA 2FPOA 4XD7D 1X92A 1UFQA 4Y2SA 2I2WA 4WT7A 3WG9A 4KDEA 4L7QA 4OQDA 1MV5A 2H7XA 4QX6A 1R3UA 1F2UA 1L1FA 3U1VA 5KBYA 4QYTA 3EWIA 5DXAA 1HFJA 1X80B 3OJEA 2W4MA 3TCKA 3ODPA 1E63A 4JYAB 1RPNA 1VKHA 1DIRA 1QYWA 5DYNA 1PF7E 4BIIA 3PTZA 5AT1A 3OE7A 2WW8A 3IXMA 2PS1A 4WXYB 2Y1GA 1RPAA 4H7JA 1SUCA 2XY4A 3A6KA 4FI3F 3A37A 5EP2A 5K0FA 1TAGA 2J08A 2FPPB 3QPWA 1EESA 3HP7A 3C87A 1PI3A 1BTOA 5KPJA 4LOKA 5JEDA 1MIOB 5JZVA 3HXLA 3OE1A 4AYWA 1SC3A 2JLQA 5ESWA 3ZCRA 5DOZA 2Y9PB 2JC3A 1KFBB 3K15A 4NYIR 3QVMA 1JZSA 1ZRMA 1U9JA 4Q34A 3FPHA 5H82A 4O08A 1GPLA 2CD9A 4H6VA 1UC9A 3GLHA 4PQRA 4JGBA 3L01A 5ERGB 2EW8A 5TQJA 5JAQA 2IDZA 3TPCA 1U7ZA 4AYXA 1E7MA 5BXQC 1LLFA 1H66A 1G20E 2BGTA 2B7LA 4LKOA 3GRZA 3N8KA 3DE5X 4RFVA 1OJ7A 4E2FA 2FZKA 2G9RA 1EVIA 5F35A 3STYA 2CHGA 2HD4A 2PVPA 4MTLA 4S1OA 2PHZA 2RC6A 4TKLA 5B3KA 1BE0A 2C59A 4CETA 4FFDA 5BSWA 4GWKA 5EP4A 1MORA 2IPLA 2Z5GA 3BCHA 1WPXA 2EFJA 1RWMA 1PD0A 1ZK1A 2YWEA 4TWZA 4WAUA 1E2NA 1PWXA 1TVMA 2PA0A 1FC0A 3CH5A 4RPHA 3MLAA 5E7MA 2YWJA 5F64A 3ZDQA 3LECA 4R81A 1V5FA 4MVJM 1DADA 2OESA 3MB8A 1GRVA 1NNLA 4MV0A 2CJWA 4WASA 5HMLA 4NQZA 4IIXA 4PSVA 4L08A 1UBGA 3IUBA 2WKPA 1RI1A 1TM7E 2K2QB 3CN9A 3OZGA 1JHPA 2A3RA 3PWKA 3TNYA 4H7PA 1A9SA 2PRZA 4JOQA 4XB6B 4ECAA 3DUFB 4K03A 2FWAA 5EWMA 1LPPA 3IJRA 4ZYZA 1E9AA 4DY4A 1X70A 3KZOA 4GE0A 4RHUA 2ZPTX 1F3OA 2GO1A 3ZS9A 2IHYA 4NV1A 4IUDS 3A9CA 4PO3X 3GRCA 3D2AA 1A97A 3P2MA 2IYFA 2XQFA 1UJBA 4NMXB 3DVAB 4URHA 2X1HA 4B3IA 4QJBA 4PU0A 1P2GA 3SHTA 2C5SA 1J7KA 1GOTA 2Q27A 4KN5A 4UULA 3W3ZB 3ZQ4A 3ZNNA 1CEXA 2PS3A 1DAEA 1IBCA 3IRUA 4PZAA 4U39A 1Z15A 2VYVA 3T4PA 4M8KA 2C94A 4BO4A 3EEOA 3D6FA 3PUYA 1QFJA 1D2MA 1U6IA 2NUAA 1WW2A 4OL9A 3IUSA 4P58A 4V0RA 5E1BA 5EE0A 2CHVA 4OHKA 4CNQA 5IVKA 4UNIA 1Y5RA 1A4XA 3QUAA 3MBIA 1RKQA 4EP1A 2VPQA 1E5QA 4TV9F 3R5TA 4IUBS 4TMKA 3LX6A 2C7VA 5IF9A 1GKKA 1WP9A 1MB2A 4DR7B 2YV2A 3RC9A 1A4UA 4YMSA 3G0BA 3ZCQA 1KH2A 2E37A 2YJ4A 4K8OA 3VYUB 2C9CA 3IOEA 4KG7A 4LDZA 4ER0A 4BWVA 5C8ZA 4S04A 4RXMA 1RJ9B 1FP7A 3D0RA 3STTA 1N1DA 2I76A 1D2EA 5E0KB 2X5KO 2QE7A 4D80A 4ZHQF 4QPDA 1QNLA 3C8DA 4YBZA 3L6CA 4DCTA 3SZRA 1T9KA 4AS1A 2B4RO 2ZRJA 2NO9A 4KXQA 1Z8NA 3U56A 4RKWA 1KI1A 1Z07A 4L8VA 4DBLE 4XGNA 5TY0A 2F00A 2IYYA 1VYVA 2AFRA 2G4VA 3EAFA 1WBBA 5E7QA 2RFLA 4JJEA 1Z16A 4MV4A 3VGJA 1TUEA 5U9CA 3R40A 4BUCA 4JR2A 5FUXA 4MWCA 1PIWA 3T7IA 2CFRA 3SXPA 3PSHA 3DLIA 1UQTA 3LCCA 2AK3A 1NQTA 3BUSA 5CNMA 2ROQA 3HJTA 1N0UA 3D4IA 3WX0A 4RQTA 4QZVA 2GAJA 4YQEA 3X2FA 3FUVA 3RS7A 5A62A 3KK0A 4FS8A 5HF9A 5JR3A 4XM1A 2NU9A 4YT4A 2I33A 3OEYA 4BJHB 2MR6A 4R54A 1FFAA 5EQJB 5FLKA 4AUNA 3D7MA 1V7CA 4EZIA 4OQZA 5JD4A 3SF0A 2V1UA 5HIKA 4AZ3B 3WQQA 2AHRA 5EZYB 3ZDXB 1O95C 3JD4A 5FOSA 2EEZA 4WI1A 1JSXA 2D59A 5FT9A 3U81A 5ICMA 5KX5B 3MWDA 1VLHA 3PQ6A 1UPXA 3UOWA 1CRPA 1L5QA 4XPZA 1PL8A 3KZXA 4KQMA 1Q1NA 2QOEA 4GO1A 2X4GA 3G5UA 3PD1A 4FYXA 1ZD2P 4NHOA 4DR1B 4X1YA 1X1RA 2IYTA 2UYYA 2YHSA 3KB1A 2ZKIA 5G40A 4BGUA 1BE8A 1UBJS 4PG5A 5EXTA 4PG8A 4DNOA 2H59A 3DV9A 2X6QA 2FWMX 1ORTA 1AKEA 4W5JA 1Y6RA 3OA0A 3V8BA 3KVOA 2P3OA 3MN1A 4ZAFA 1XL0A 2W90A 1UK8A 2V6GA 2ZT5A 3HTXA 3ORYA 4YIKA 3EVZA 1ZL0A 1XXHB 1T3HA 1SKYB 1D04A 1FDOA 2AIRA 2C31A 1S2GA 2EKZA 3LSYA 3MOIA 2W6QA 3EQZA 2ZLBA 2D1TA 5ITZB 4DHWA 5EIXA 4EELA 5K3EA 2GBGA 2O3UA 3SSNA 1BD4A 3PIDA 1QHNA 1UMCA 1QKKA 3WDSA 2LR0A 1COZA 2RK3A 2BEWA 2I2AA 2UZ3A 3G85A 5EWLB 3ZW7A 4KSBA 1G19A 3ZYZA 4EHHA 3LT4A 2RK4A 5BQXA 3OE5A 1NWCA 3LX5A 5FNVA 1M1NB 4A91A 2R6JA 3U1TA 5BNWA 1QPBA 1J21A 1N6HA 2J6CA 3ENNA 3IAM1 3P2IA 3TQQA 1DWOA 2JLVA 3FGOA 2P1RA 1YDWA 3F2VA 3PBKA 3WK9A 2WD7A 4U7DA 4X8HA 4ITRC 3KQWA 5TX7A 3TOZA 1G0NA 2CFOA 4X20B 3W6ZA 4JT8A 2KPOA 3BMOB 3MJHA 4D3FA 4CKWA 1DELA 2FZ4A 2WU3A 3KTFA 4HLNA 4ID3A 1KYTA 3PJGA 4QD3A 4H6WA 1Z5VA 2EF1A 3MINB 1RPZA 2NZYA 2IW3A 3HXMA 1OX4B 2I6SA 1KO7A 2FEOA 3I6BA 4G0XA 4CMCA 1FXWA 3F96A 1XYYA 4PYQA 5GONB 1BDIA 4LAFA 4KU4A 5AW9A 2XB9A 5K45A 2F17A 2PWBA 4BN0A 4EO9A 1WZ2A 5JCPA 2J46A 1G8PA 3GCWA 3DLBA 1LK5A 4G0WA 2FA9A 4RIEA 2E4WA 3CPHA 3U39A 4CMHA 4J0HA 2OXCA 4BZXA 2PYIA 1D1TA 3N59A 3N07A 4ZOBA 4JSYA 1NW8A 1CY6A 4XYGA 5IP5A 5LB4A 3SJ7A 4AF7A 3ON5A 3WZMA 1U02A 2A58A 2FX3A 5TT1A 2V0CA 2X5NA 1N25A 2FPGB 4KQWA 4E5KA 1JG1A 1O95A 1E4EA 2Q3DA 1HURA 4R2WA 1L4HA 3F90A 4MEJA 5ITSA 4UE3S 1LVGA 3ER9A 1XRLA 3PNSA 4Y6QA 1KDTA 1PSDA 4EL5A 4XEHA 1Y8RB 2LKDA 5JXIA 4Z0PA 4RVGA 3TXYA 3J80A 3KJEA 4KQ1A 3D8NA 3L8GA 1LVUA 6ABPA 3RYHB 5JRJA 3SDBA 1RWBA 3EY4A 5TQ0B 4MRMB 3EOZA 3GUVA 4KPFC 1AMUA 2WKWA 3FGNA 4BMCA 4CQMA 4PQEA 3MQFA 4TLDA 4WFIA 3QX9A 4KV7A 2FRXA 4KQEA 3FWKA 4E14A 5DLEA 5KIAA 2ASEA 1XRJA 2RGWA 1P77A 3VSCA 1JT2A 1Z0KA 4L0QA 4QO8A 3BXZA 4DDKA 1M2EA 4EMTA 4Z7QB 4CT0A 3K71B 3FJOA 3BWVA 3K1AB 4NMMA 2VJPA 4ZT2A 3BXPA 2PQMA 2YFYA 4IMPA 1AJEA 1WUIS 1S3SA 3HYSA 4B1FA 3V8RA 1V11A 3L7OA 3H1TA 5DRYA 3JYOA 5E8RA 4ZA2A 4HGPA 2LZ0A 3NHKA 1H05A 4RZHA 3RLFA 2OBBA 2AMYA 1UJCA 4BX2A 2ZP1A 4UUPA 1AOXA 4A6PA 5M2QA 2G9VA 1KXZA 1GQSA 2DY0A 4LSZA 5BWLA 1M73E 5J43A 3P2EA 2WBLC 4D4JA 1PL7A 2W43A 2O57A 3I28A 1KOLA 1IM2A 2Y99A 5BMVF 4FT2A 3ABZA 2NO1A 4KVFA 1DWPA 1QGDA 1JU9A 1TGYA 4GMGA 4HVLA 2A0XA 2FSVC 1SA0B 3TEFA 2HHAA 4RORA 2VBCA 1EA5A 3KQYA 2XGSA 3EEYA 3C74A 4WBXC 1FYWA 1YXMA 4GGOA 2AD5A 2P2NA 4NBUA 3I1YA 4WOBA 3TB6A 2J1LA 5KC8A 2I1VB 4M0KA 4AWAA 4CEJA 2Z30A 1O6GA 4NXMB 3KKKA 4LXIA 3D4PA 1WXGA 3QEKA 4BRZA 2X42A 3IUEA 3AFOA 3KJZA 2CE2X 3EC2A 4MS4B 3U4MA 4MW6A 2JBAA 4BZZA 3KLNA 2B98A 2CVZA 4RH3A 1JP7A 2MSWA 4O2AF 4W5OA 4B85A 1US8A 2IXAA 2PM8A 3LUBA 1SB9A 1OH8A 2FFRA 1UOOA 1L4GA 4P7JA 1XAIA 5AW3A 4EO7A 4ENRA 4RBNA 3M6XA 1IHUA 4A5OA 2HJRA 1JG4A 3U9SA 2X40A 4AMYA 2H1WA 1SCKA 4R41A 4DNFA 4IAOA 2ZR7A 5C81A 1PQWA 3WA7A 3G68A 2VK1A 3DV0A 3KOXA 1PFWA 1GRCA 2AEMA 1SC1A 3TSOA 4B3BA 4GX1A 5BVGA 1YS6A 1XBTA 4BZWA 1IK4A 4HH3C 4QBHA 3W8NA 1AGRA 1NNSA 2HIGA 4I1OA 4MW5A 1RLOA 3FNEA 3AG6A 1YU9A 3N5CA 4NU5A 4PICA 1JDBC 5KQPA 3K70D 3UJ9A 3EWSA 2HFJA 1EI9A 1QV7A 4QYIA 4YRTA 1JAIA 1F3LA 4I4CA 2C4KA 2UZAA 4MLCA 1P2TA 3JD3A 3QOWA 5HF8A 3UG6A 4E5PA 2DFPA 3GHYA 2BVNA 2D2EA 3ESQA 2WJVA 5JSKA 1W44A 4JOCA 4M2LA 3HSYA 4W1SA 3HJNA 5EJGA 3PDCA 4R2XA 1G9TA 3MGGA 1FQKA 4EBBA 4KRGA 1WMBA 5K3FA 3QF4B 1QB7A 3GLIA 2VHCA 3DKIA 3VV3A 1H4SA 2HLDA 4N0QA 3FMGA 2AFIA 4BEWA 3HR8A 3NG1A 2ATIA 3H2ZA 4MOWA 2HYIC 1G64A 4FB5A 2Q8NA 3R75A 3GU3A 4YP9A 2HO4A 3JQ9C 2W6CX 1B1CA 1UBEA 3QA9A 1OBFO 2IZOA 1Y4SA 2X1VA 3UJPA 5E1OA 5LZ2A 4KEAA 5ELMA 2ENWA 3UMSA 3ZE9A 5AICA 2J7KA 1X8XA 2ABWA 3OTIA 4XFKA 2ZSIA 3JWPA 2FSVA 3RKSA 2OCGA 2CNWD 1BA3A 5BN5A 4KBGA 3QELB 5J2TB 1SG0A 1L4EA 1I8TA 4MCIA 1RT9A 2HWXA 4HRVA 1W581 3AG5A 3NBYC 5K6AC 2D13A 3CWCA 4QBGB 3JQ7B 3OLYA 4KWIA 1IM8A 5BV8A 1YHYA 1RWVA 1V96A 4JJFA 3VH2A 4UXHA 4NS4A 3FSGD 2Z4TA 1TO6A 1GGNA 4IILA 2BELA 3EGOA 5JSUA 3UAOA 1U04A 4KJZA 4RPLA 2NXCA 4ZOLA 1LSJA 1E9DA 3T5PA 1GO2A 1KXJA 4HJRA 3HRHA 3UIEA 1CF9A 1SGWA 1FTGA 1L5SA 5INTA 1ZHFA 3OAAA 2YJ6A 1FF9A 2IPMA 5CX1A 5TVKA 3F0TA 3I83A 2Q6VA 3S1AA 3C3EA 3FTFA 2NUPB 3D7KA 4G97A 3RJTA 2SHKA 1R6UA 3H8VA 3ZH9B 4IDNA 3ZQJA 2YOHA 5CK4A 4KE8A 4GOLD 5JDCC 1RWWA 2A84A 4KR0A 4Y2TA 3SJAA 5A6VA 2ZRQA 3JASA 3REQB 2YN2A 4PWYA 1V1MB 1XLTC 1KTIA 2XIJA 4L15A 5D85A 3QU5A 3OM0A 2YY6A 1DVRA 1DHRA 4LXXA 4O2BB 2QROA 1ZN2A 3B12A 4O0LA 2FZLA 5EUBA 1A9YA 2QENA 1SXQA 1D1PA 3EY9A 2OQVA 1PGOA 2XUDA 2J7PD 1RCFA 4OMUA 2GPAA 2RG7A 2FSUA 4I3FA 1E58A 4F56A 5LDGA 3EN0A 4IV8A 1WZIA 5IABA 1OH7A 3A4YA 4LZAA 1K8RA 2KW5A 1U2GC 1MIHA 1YS4A 4ZO9A 3L4KA 1Y4DE 1GT91 1Y8CA 3TLGA 3L7KA 4Q19A 3W90A 3WIOA 4H1HA 1ZOOA 4FR2A 3AEQA 3RBXA 3TW0A 3IKVA 1E2MA 4BNVA 2G25A 3IT3A 5JMTA 3QLVA 3IPYA 1DARA 3P52A 2QX7A 3L8CA 1C8LA 2ZWOA 2I4TA 3ZHYA 2NPFA 2NZJA 2WG1A 3FI0A 3ZYCA 2BWJA 3JQ9A 1ODKA 2I7VA 4JYBA 1ABBA 3JPWA 4X41A 1EWKA 2JFXA 2R7LA 2RH8A 3DVQX 2KI5A 3WLAA 4JP5A 4X0EA 4BUZA 1CP3A 1LRJA 4GU5A 2Q0SA 3BBLA 3NWJA 1YT5A 3ZY6A 2B25A 2QUJA 3JAKB 1PT9A 1ADFA 3H5IA 4GF5A 5K99A 2O05A 1FRZA 4L02A 5ALKA 5JXHA 2XZPA 4U9IS 4X1KA 4DUPA 3UF0A 4M1MA 2WT9A 3PUIA 1QC5A 4JMLA 3OD1A 3V1KA 1UC8A 1UJNA 3C0KA 3IOBA 3IAXA 5AI8A 2VT7A 5K6AA 2XX3A 5FR2A 2LDXA 1HDYA 5F9FA 3O03A 2ON6A 1M34A 3A27A 5ALDA 5J5VA 2MDTA 1SAYA 4IH1A 4EEZA 3B2EA 4D9CA 1SD2A 4P8RA 3F6YA 4BGIA 2GARA 4YHHB 3ZEAA 1U7TA 3IMGA 1OC2A 5CPBA 1P7CA 5G1OA 5JCJA 3T54A 3BHJA 2QUZA 1XHLA 2VDKB 4GZ3A 3S55A 1CU1A 1XD2A 2GF0A 3AFHA 3BTSA 1KO4A 4C6HA 2I1WA 1MEEA 1VJ1A 4ZGGA 3MJ4A 1EUYA 2G4LA 3P9RA 2F8TA 4ZCTA 2OK8A 2QN6A 1QHHB 3EIXA 3VC1A 1GRRA 3BWDD 4DSZA 4EHNA 4PLWA 4PLTA 3PNYA 5IDXA 1JPVA 4LPSA 4V0KA 2G40A 4AU1A 3GEHA 4LC1A 1Q77A 4BTLA 3EDRA 2J0SA 3RRMA 5JDCA 1T2UA 2ZB3A 3BGDA 1G7RA 1QP8A 1ZMRA 1PZFA 1XLTA 3D6HA 3C1OA 1IONA 1D7OA 1TA9A 2PU7A 4GGPA 3AF4A 1SU6A 1HX7A 2AOVA 5DYIA 3G59A 2R0QC 5TXGA 2YRFA 1BZYA 4US1R 1EBUA