3U09A

Crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg)(g92d) from vibrio cholerae
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
248
structure length
248
Chain Sequence
MSQFMNLEGKVALVTGASRGIGKAIAELLAERGAKVIGTATSESGAQAISDYLGDNGKGMALNVTNPESIEAVLKAITDEFGGVDILVNNADITRDNLLMRMKEEEWSDIMETNLTSIFRLSKAVLRGMMKKRQGRIINVGSVVGTMGNAGQANYAAAKAGVIGFTKSMAREVASRGVTVNTVAPGFIETDMTKALNDEQRTATLAQVPAGRLGDPREIASAVAFLASPEAAYITGETLHVNGGMYMI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 3-oxoacyl-[acyl-carrier-protein] reductase FabG
publication title Dissecting the Structural Elements for the Activation of beta-Ketoacyl-(Acyl Carrier Protein) Reductase from Vibrio cholerae.
pubmed doi rcsb
source organism Vibrio cholerae
total genus 92
structure length 248
sequence length 248
chains with identical sequence B
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2011-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3u09A00
3BMQA 1PZHA 1P44A 3GFBA 1GUYA 3WBBA 3GVHA 1W73A 3KTDA 4DL9A 3QP9A 1ZZEA 1PJBA 2J3HA 4WOJA 5L4SA 2IODA 4MP3A 5L45A 4J3FA 4KTTE 2YFQA 3INTA 5JYDA 1D8AA 3ZWOA 1IB6A 5TRTA 3C1TA 4GKVA 1IZ0A 3OQ1A 2CF6A 2Q4BA 1ZSYA 4D41A 1NXQA 3BTOA 5DULA 4CMKA 1WAMA 3H7AA 4YT8A 1WDMA 2AEFA 2OL4A 2A4KA 3H9QA 1UDAA 3LT2A 3C85A 2CFCA 1E1LA 1EZ4A 4IXWA 1YO6A 3RSHA 2RHRA 4H7PA 4YTEA 1W8DA 3L0DA 4BMNA 4DMLA 2RCYA 5BNFA 3BMQB 4LMPA 1DB3A 3OEWA 2I3AA 2YY7A 4QO8A 2PTGA 4NG5A 2VUUA 3GEGA 1ZK0A 4J49A 5CHEA 1F06A 3RBXA 2YQ4A 2FN7A 3RFVA 5CFZA 2YUTA 5G0SA 2PGJA 3TNLA 1QP8A 2D4AA 4BO0A 1DFGA 2NLOA 4FN4A 3B1KA 3KSUA 1K0UA 3O26A 4DPKA 4DQXA 4J0EA 5KVQA 4MINA 2PH3A 1ONNA 1SEVA 4WGGA 1R0SA 2AA3A 4JJGA 4XKJA 2E6UX 5JMPA 3ABIA 3UH1A 3SLKA 3BXXA 1HDGO 2C2XA 3QWFA 3VH4A 4W7IA 1HL3A 3KYDA 1ADFA 1QYDA 2DPHA 4W7HA 1ONPA 4TZKA 1R15A 4J6FA 3RWBA 2IYPA 1HLDA 1BDMA 4BNYA 3DBHA 3GVPA 4NIMA 1N5DA 1RYEA 1LDMA 1NFQA 3PQDA 3NEPX 4ZRNA 4NNJA 3UF0A 2Y1GA 4IJVA 1PTJA 1FDSA 4XRRA 1C0PA 4FR5A 2Q3EA 2SCUA 3E9QA 2C29D 2G0TA 1GYQA 3ASUA 3DZKA 2OHXA 3PDJA 1YOVB 1NASA 4GAEA 2HO5A 4LSMA 4PLWA 4YJFA 2NVWA 1FMCA 2BRUA 1IYZA 1G1AA 1NAHA 5CDSA 5LDGA 2IZ0A 4ID9A 1DRWA 3ON5A 1DC6A 4BGEA 5LC1A 4PZEA 1B3RA 2VTDA 1PS9A 3DBRA 3KYDB 1BVRA 3AI2A 1H6AA 4L75A 4BL5A 2QIOA 2X86A 2EKLA 3GNSA 3IAHA 1LXCA 3H8VA 3P7MA 4FGSA 3DBHB 3Q3CA 1NP3A 5EN4A 4F6LA 3HDQA 2GLXA 3VH1A 3WGGA 2EG9A 4F3YA 5TX7A 4I9NA 1B2LA 3PIDA 2ZYDA 3D0OA 1QXSA 2CD9A 1HETA 5HWSA 4FS3A 4MVJG 4XB2A 1ZMOA 3DZBA 3JSAA 5F1KA 2PGLA 3O9ZA 2YYYA 4YJFB 4OSOA 3B1FA 5CDGA 1Q2XA 3K8ZA 1FXSA 3DAFA 1M76A 1LRLA 3NT5A 3F9IA 1V6AA 2QRLA 1LDGA 1YBMA 3STHA 3I5MA 5IAAA 1P1RA 2Y93A 2EW2A 2ZJ0A 4DUPA 2LDXA 3VTZA 4LCEA 3PJEA 1C1XB 4E4YA 1FJHA 1YL6A 2OZPA 4FD3A 2FSSA 4GGOA 1S6YA 3DBRB 3WWYA 2O3QA 3DMTC 1XCBA 3ORFA 1HKUA 1C3VA 2VHWA 3CIFA 2ZTVA 2PA3A 4A2CA 3DXFA 5CG1A 1XELA 3UW3A 4BKQA 3V2UA 1PU2A 5DP2A 4GWGA 2QZZA 2IE0A 3W8DA 1MC4A 1VLLA 3JQ7A 2G17A 4CV1A 3QSGA 4WLOA 5CEEA 1LQTA 3GH3A 2Y99A 2C0CA 4B7XA 2GGSA 4JCOA 5C3MA 2WYWA 3WOHA 1C0IA 5GMOA 3TFOA 4LVCA 3ROMA 5BSFA 9LDBA 2I66A 4BO5A 4N18A 4XIJA 4NJMA 4IZIA 2O7QA 1E0DA 2YZ7A 3KLPX 1E1NA 2EEZA 4UUMA 3D5TA 1LC0A 1PJQA 2P9EA 2JFHA 3HE3A 1SNYA 2EHDA 3U4CA 2O50A 4E2ZA 1I3NA 5JC1A 4IPTA 4BGVA 3AU8A 1XWFA 1IPEA 1ARZA 2Y0EA 1K6XA 2Q99A 1DIAA 1PJ2A 5ER6A 1E7QA 4H15A 4CM5A 1R66A 4FOOA 4RO0A 5KTKA 3WQQA 3H5NA 1LSJA 1LEHA 1LLDA 1FDTA 3V1YA 4YAJA 4FFLA 1JN0A 3A14A 2Y68A 1KBZA 4E33A 2O3RA 3H2ZA 1B14A 2UAGA 4TKLA 4TKMA 3CH6A 4ND5A 3I9NA 2BFPA 1MFPA 3RC7A 3BHJA 2OP0A 3DQPA 4Y8VA 2C20A 5K6AA 4NJMB 1J4AA 2YW9A 4AJIA 3TJRA 1NPYA 2FZWA 3OM9A 4KWIA 2J6IA 2QQ5A 2J5QA 1H9AA 3KB6A 4WASA 3WYEA 2X9GA 3H4VA 2B69A 3RUDA 4CL3A 3CUKA 4PRLA 3TSCA 4R3WA 3AK4A 1XGKA 3DWFA 2WTBA 3E9MA 1KETA 3I9KA 4AJLA 4EBFA 4BGIA 3IDSA 3DFUA 2X9NA 3QHAA 4CM4A 3QVTA 3B1JA 2JCVA 3G1TA 1QR6A 3WGZA 2HMTA 3PI7A 4E5NA 2DFDA 1SAYA 5DP1A 4A27A 5I9MA 4DXHA 3CE6A 1ZK1A 3TZQA 4GX0A 3RVDA 1C14A 4B4UA 3ICPA 2X9VA 2DFVA 1GZ3A 3CPSA 1KEVA 4WCFA 3QV1A 3GY0A 4LN1A 2VZ9A 1F12A 1NHWA 2WD7A 2VHZA 1XQ1A 3PWKA 3JQBC 3QLJA 2ILTA 1PL7A 1X13A 2VN8A 4XD2A 4F46A 1E3IA 2WDZA 5HBRA 3RKRA 3LT4A 1FF9A 4B4OA 4JBIA 4BS9A 2NU8A 1SOVA 2OXIA 3ZV4A 3DOJA 3RUAA 2NV6A 3R3SA 1E3LA 2AMFA 2JD2A 4CM9D 1B8UA 1Q0LA 3JD3A 2NM0A 1UP6A 4CM4B 5T8KC 2X6TA 2PR2A 4IS2A 2D0IA 2X1HA 1H5QA 2XPCA 3UVEA 4E5KA 3LF1A 5F5LA 2D5CA 1ZSNA 4L4RA 1T4DA 3VPGA 3WNVA 3GR6A 1I2BA 5IFLA 2HAEA 4J1TA 4B3JA 4IDEA 3WTBA 4GX2A 2DBRA 3OIFA 4WCFB 1U5CA 3WTCA 3X2FA 5ICSA 2YQ5A 4PLVA 2UV8A 5T64A 5F1OA 2AG5A 3IOYA 4XYMA 1XQ6A 4MOWA 3OMLA 4RPJA 3WQSB 4BNTA 5JAIA 5JCJA 3WGYA 1E7SA 4MDHA 3AM4A 4DYVA 3SBOA 1NVMB 3PZBA 3ETDA 4PLYA 3WJAA 2YV2A 5HA5A 1VSUA 3KM0A 1HE3A 1A4UA 2FZEA 3E48A 4CQMB 1MX3A 3ONDA 1K6JA 2YV3A 3PGXA 2EWMA 4J9VA 1OBFO 3SEFA 1ENOA 4CMCA 5I7EA 1M75A 4OXKA 4DQUA 2ZQZA 4YB8A 1XLTA 4YYZA 1CDOA 1CQJA 4FC6A 1ZSVA 4P22A 1DLIA 3F6YA 5U1PA 5CDYA 1ZXBA 1PJTA 3KRTA 4J90A 2ZYGA 1T1RA 4E32A 4J43A 4ZA2A 1P45A 1XR3A 1HYHA 4U7WA 4RQUA 4RVSA 1YB5A 4PLHA 1P33A 3BHMA 3GC6A 2D3TA 1LRKA 3TOXA 2DM6A 4NBVA 4E6PA 2G5CA 5JW6A 4D45A 1Y8RA 3JQBA 3JQ6A 4AJPA 1LQUA 1DXYA 3RBVA 1BXZA 2NADA 4GPD1 4NU5A 3GAZA 4PLGA 5KJ6A 1ML3A 1V35A 2IXBA 5TGDA 1HE5A 4JN6B 3SJ7A 1IULA 4URFA 4ZQGA 5GZ1A 4GLLA 1TA4A 1EUDA 4HUJA 1OI7A 3BTVA 3F4BA 5T8KA 3O38A 2VZ0A 3GUCA 2CY0A 5TNXA 4R1SA 3ZW9A 1GV0A 1DSSG 4Z9XA 1I0ZA 1ZMTA 4FC7A 4R1UA 1GAEO 4BO1A 5TT0A 3IS3A 4MO2A 4MIOA 2C7GA 4R1NA 3ZV3A 1R0LA 3RU9A 2X0RA 3OQBA 1PJLA 4HKTA 4O0LA 3KHUA 3K2BA 1LSUA 4FCCA 5JPIA 3AW9A 5A06A 5CDUA 2WWRA 5L95A 2O3UA 4PIVA 1SEPA 1Y8RB 4TMFA 2AW5A 3VOSA 5KVVA 1PQPA 1H2BA 2B83A 4ALLA 4DA9A 1ORRA 3VPFA 1YVEI 2PKQP 3DHNA 3D7LA 4O5OA 5CP8A 1IHXA 2YDXA 4Q3EA 2PD4A 4RZIA 1I8TA 3KV3O 2BF7A 3W4IA 3PIIA 3FR8A 3UCEA 3Q1LA 3EHEA 4XR9A 5H83A 2XOXA 1ZK3A 4YVFA 1QMGA 4ILKA 4LVUA 2J5RA 4UUNA 4RPLA 3P5SA 2GN6A 4QEDA 3GRPA 4PG5A 1N7GA 4YJDA 1ZXLA 2POQX 4DQVA 4WOKA 2O48X 4HNGA 3RI3A 3V1TC 2NNLD 2DPGA 4IS3A 4EUEA 2WYVA 3G0OA 4NU6A 2PZMA 3KVOA 4GLOA 3ZV5A 1QV7A 4DC0A 1DPGA 5ITWA 5ENDA 4A7PA 4CQMD 4ND4A 4U6SA 5ES3A 5KNLA 4XJSA 3OJOA 1OC2A 3JYNA 3KO8A 4XGIA 3VVCA 1JAYA 2ZCUA 5C5IA 3EYWA 1M66A 3S8MA 5KKCA 1JVBA 1JKIA 1PGPA 4Y67A 3U3XA 3VHRA 3RUCA 2V6BA 4BNUA 4E0BA 4R51A 2FSVA 2RIRA 1MV8A 4JROA 4YA6A 4WLUA 3L9WA 1JU9A 4IIVA 4BKOA 1LSOA 4G5HA 4I5FA 3RCBA 5BT9A 4OOEA 4ITUA 1UJMA 1MB4A 1UZMA 3I9LA 3RJ5A 2QHXA 5BNIA 3U62A 1AXEA 3H9JA 4K28A 4RDHA 1F8FA 1TEHA 4CMIB 1YQDA 4TRRA 3WICA 2UUPA 1A9ZA 4AJ2A 5B4UA 2W2LA 3CINA 4RLHA 3UCFA 2Y1FA 2Z95A 3EK2A 3JD4A 4BNVA 2DT5A 3VKVA 3P19A 1ZCJA 5JS6A 2R2GA 2Q1SA 4XRGA 4NBTA 4EJ6A 4FJ0A 3I4CA 4AJJA 1HDYA 1H6BA 4IMPA 2E4AA 2DTXA 1GZ4A 3AUAA 1MUUA 4GMFA 3DO5A 4I1IA 3ZU4A 1R37A 4KMSA 2VHVA 1B0AA 2IEDA 4J9UE 4JQCA 4RVGA 4JBHA 2EERA 2CF5A 5COBA 1XIVA 3RC1A 4WLNA 4FSHA 3WXBA 3PJGA 2D5AA 5IN5A 1VC2A 4J16A 4D3FA 1ADBA 1G6KA 1X14A 3ULKA 5JAQA 3AM5A 4R5HA 2ZB8A 4IQ0A 2VQ3A 1W6UA 4DIFA 1SZJG 2J3JA 3K96A 8LDHA 3PRJA 1KVRA 1VJ1A 3E6AA 4OQYA 2NACA 3D5QA 4E2XA 1OZAA 2WMDA 2OORA 2QW8A 4XR4A 3FN4A 2TMGA 3BMCA 4I8XA 4PG6A 2HK8A 2I76A 3G3EA 4CM7A 3IJRA 4BV9A 4IQGA 3PXXA 5T67A 4OH1A 5MGBA 1QYXA 3S55A 1E1KA 4L4XA 4MPDA 4S3MA 3ZU2A 4MKRA 3ANMA 4L8VA 3OSUA 2C7VA 5EERA 3ZZNA 1ID1A 1I32A 4U0JA 4I5DA 1UR5A 1WLYA 1N9GB 2HMVA 2Q2QA 1DFHA 3RUFA 2Q1TA 1PGQA 1EE2A 3H5RA 1Y1PA 4NDNE 1EEHA 1X1EA 3ANNA 2BFOA 2HRZA 4DLBA 3KETA 3ETGA 3GVIA 1D4FA 1A27A 2FR0A 4IBOA 4PG8A 3I9JA 4J4BA 1M6WA 2QYSA 3SJUA 3TPCA 1J6UA 4PZDA 4YPOA 2WSBA 3X2EA 1I24A 4MVJM 4ZN6A 2P68A 4I08A 4CPDA 3NYWA 1E3JA 4E31A 5TJHA 1T26A 2JD0A 3BMCB 5A4DA 3PQFA 2YJZA 3MTJA 3OA0A 3SC6A 2JCYA 3F1KA 4RPGA 1RPNA 4Y6PA 1PS8A 1I3KA 1LDNA 4MVJP 2HDHA 1PGNA 2C07A 5EQDA 3TZHA 1OC4A 3FHLA 4CUKA 3C1AA 4TZTA 3U4IA 4QTZA 5EQFA 4P8RA 1ZIDA 1PQWA 1LDEA 1MFZA 4W99A 4QXMA 5TQVA 4DYDA 4BO9A 3MWEB 3GDGA 4J1NA 5TIIA 2FOIA 2G76A 1ZFNA 1U2GA 2IYOA 1D1SA 4E3ZA 2HMUA 5T57A 2PGDA 1GR0A 2VT3A 3DR3A 4FFPA 4GI2A 1T4BA 4EJMA 3DONA 4RZHA 3ZU3A 1U8FO 1LC3A 4YJHA 3FPCA 4IGEA 4NK4A 2AEMA 2R6JA 2WYUA 1QORA 1QYWA 3HB4X 4WUVA 1UP7A 1E1MA 4GMGA 4M49A 4GL4A 3N74A 4CLHA 5A9TA 3KSDO 3DZFA 4JJFA 4RVHA 1DHRA 3GVXA 4EI2A 5I9LA 3WFJA 4A5OA 3VZQA 3O03A 4L73A 2EP7A 4N5MA 1J49A 1VKNA 4GKBA 4J7CA 2PKRA 2B4QA 1EVIA 2NQ8A 1NQTA 1GADO 3F46A 1RWBA 4A26A 3GK3A 1F8GA 2H5LA 1UZLA 3OH8A 4ALKA 3PHJA 1Y6JA 3IP3A 2W2LD 4ZQFA 3ETEA 1BXGA 1EVYA 2NUAA 3D4PA 4GBJA 1TT7A 1LX6A 2BD0A 1SCUA 1PS0A 3PZRA 4AJ1A 1A5ZA 1RJWA 4PZCA 1TLTA 1I3LA 1WVGA 2GCGA 3H5AA 4U5QA 3AFNA 4YQZA 1JA9A 4YJHB 3I1JA 1GY8A 1O6ZA 3I6QA 4YACA 4D3DA 3LYLA 2Y1OA 1AXGA 3GNTA 5BSEA 3QVOA 4HFJA 5H81A 4BO2A 1ZUD1 4GVXA 3U4DA 1YOVA 3Q0EA 1KS9A 5DBIA 1ZEJA 4M89A 1UDCA 4AJKA 3RAJA 1ISMA 4KZPA 3GPDG 4FQ8A 5I7SA 5AVOA 2X7HA 4C7JA 5L4NA 2HK9A 3LDHA 3ZDFA 2X23A 3WB9A 5HRUA 2ZTUA 3VAZA 3FBGA 3WSWA 4NPCA 2F00A 5CPFA 2Q2WA 4XDYA 5C7OO 2C54A 1BXGB 4Q3DA 4XGNA 2RHCA 4N5NA 3NX4A 5ILOA 3HG7A 4C4OA 3QW2A 2DVMA 1UXGA 2VWQA 3BAZA 1DOHA 5LCXA 4I5GA 2AXQA 3WWZA 3AUUA 3AOGA 1D3AA 2G1UA 4CMEA 2EKQA 3CZRA 4Z9YA 4BB6A 4G2NA 2A9FA 3QVWA 1Y5MA 3T7CA 4B8ZA 2UDPA 1FDUA 3HFGA 4JK3A 2H9IA 4H16A 1GTMA 2GZ3A 4QSMA 5LDHA 4R01A 2V6GA 2JFFA 1C1XA 4XA8A 3HZZA 2E37A 3AY7A 1E6UA 4DPMA 4CM6A 4PFJA 1WP4A 3A1NA 4FOSA 1X7HA 3HUDA 3IJPA 1HYGA 2E48A 3GAFA 1E7YA 2FR8A 3VZRA 1DO8A 1CYDA 4CV2A 4DBVO 3D3EA 1P1HA 5F3RA 4AJNA 2EGGA 1WZIA 1PEDA 3Q2IA 2FP4A 1T2DA 4J2OA 2VHXA 5TJ9A 3S2FA 1Z73A 2HK7A 3GNQA 1OAAA 1UAYA 2PWZA 1LLUA 3VH3A 1LSSA 3D4NA 4OOFA 4CM9A 3NDJA 5K6AC 4NFYA 2R00C 2HJRA 3BMOA 4WEQA 2VWGA 3NGLA 2DQ4A 2CDBA 2OUIA 4YQYA 3QY9A 1GU7A 3HJAA 1GCUA 5G0VA 4QECA 1GUZA 4LSWA 4WLVA 4WKGA 4R16A 1U3WA 1Z75A 1LUAA 4LRSB 2DU8A 3BIOA 4Z3KA 1BVUA 3EDMA 2HKIA 3IMFA 1YL5A 2GUGA 1YE3A 3DTYA 2JAPA 4KOAA 3ZI0A 4F45A 1E77A 4QFCA 3WGTA 3LC2O 3AY3A 2J3IA 6LDHA 4ZICA 4EUFA 1Y5RA 4K6FA 3I23A 4IJKA 4RCVA 4GGPA 1ZK2A 2C59A 2OBNA 1NQOA 2OBYA 5I8WA 5DZSA 2JFGA 2CVZA 4IXTA 4UEKA 2VHYA 3D3WA 1UXJA 3JQAD 4WCFC 3SX2A 5FFFA 2CDAA 3U09A 4YJGA 3BMOB 3SXPA 3FRJA 1XU9A 3U9LA 1B3BA 1HDZA 1EFKA 2O2SA 2B35A 3HN7A 3INRA 4ZHSA 3H3FA 2HU2A 3GMDA 3TOZA 4Q3CA 1BDBA 2WM3A 1JW9B 2BI7A 5BNTA 3QA9A 4DVJA 1B26A 3AI3A 4FFMA 2X5OA 4K1LA 1KVTA 2Y0CA 1CIVA 3C1OA 4BNNA 2EKPA 4J91A 4FFNA 3QJ5A 1U7TA 3L77A 3H2SA 3RUIA 1I30A 4YDRA 1KEWA 3KXDA 1K89A 2YV1A 3ZWMA 3ITKA 1XA0A 4BIIA 2W98A 1MXFA 1YH3A 2NTJA 5THKA 3V1UA 1DJQA 4YR9A 4YT4A 2FY8A 5JYEA 4Z6KA 2Q50A 3D3WB 4OYRA 3VDQA 2VWPA 4R69A 3RFTA 5K0ZA 1Y9AA 1I2ZA 4YJGB 4QX6A 2D59A 5COQA 2R00A 4P4NA 4L0QA 5EPOA 1JVSA 3ZNNA 5JY1A 4CMJA 1VL0A 4FIZA 4DIBA 3OJLA 1ISGA 3ZGYA 2QRJA 3JYLA 2BH9A 3GLQA 1PZEA 3GMSA 1B7GO 2H63A 5L9AA 3VPXA 5EINA 2XF8A 2OO5A 1Y7TA 3B20A 1BW9A 4E12A 4F6CA 4HP8A 5EIOA 3U49A 2V7PA 5TS3A 3C24A 1MLDA 3JQGA 1VSVA 3ST7A 3QIVA 3BZUA 1ULSA 1NAIA 4EITA 2PNFA 4OGWA 5IF3A 4RF2A 3A4VA 4IIUA 4WK6A 2ZTLA 3FCOA 2Y0DA 1H0KA 3EUWA 3DOCA 4IINA 4KDFA 7ADHA 5I8ZA 1V3TA 1A71A 1V8BA 3BTSA 1XDWA 1U3TA 1V9LA 5JO0A 1U28A 1IPFA 2AQHA 2DC1A 1KC1A 1P1IA 4NFHA 1DLJA 4FFOA 4HFRA 4CMHA 4D42A 3ENKA 2I5PO 3GDFA 4GWKA 1HXHA 5B1YA 5JAMA 4LISA 1R16A 3DDNA 4IDAA 3CEAA 3WBFA 3ICCA 3R6DA 5C7LO 2IZ1A 2AHRA 4ND3A 2GDZA 2I65A 3FBTA 5HS4A 3MWDB 1BW9B 3I9OA 4ZRMA 1KERA 2P4QA 1FDWA 3IIEA 1HLPA 3AJRA 4MVJE 1PWZA 1BMDA 3QRWA 4KDEA 1VRWA 3JQGB 4CQMA 2GR9A 2O2YA 4XDZA 1EQ2A 4NZ9A 3HQ4O 5EMHA 1LNQA 4HADA 5JLAA 1B8PA 4EDFA 5B4VA 4PLPA 3ADPA 1E6EA 2VRBA 2XXJA 4IZHA 2O3JA 1Y81A 1VL8A 3EAGA 3WDSA 4Q3AA 4IDGA 2AG8A 4WEOA 2DKNA 1L7EA 1GCOA 4OMUA 4NHEA 4YBZA 2OP1A 4CMGA 3WFIA 4BGUA 1YL7A 2ZB3A 3T4XA 3TQHA 1U5AA 4P4LA 2DTEA 3SLGA 4IDFA 4YEDA 4BQRA 1VI2A 2DBZA 4INAA 3TL3A 3M2TA 3NDIA 4NFSA 1Q7GA 4B79A 2O4CA 2FRDA 3B6ZA 4UVEA 3GDOA 4CR6A 3GN2A 4AJEA 4BO3A 5IN4A 1O89A 1LTHR 3TZKA 3RUHA 3F5QA 4OKNA 2QZ9A 3O8QA 4BKPA 3DL2A 3L4BA 2EP5A 3K5PA 4CLEA 1VKOA 4JXKA 5DOZA 5BQFA 4JLWA 4O63O 4R5MA 5U9CA 2HQ1A 1HZZA 3ZWNA 4OHUA 4ZGWA 2AQ8A 1KYQA 4B4WA 1Q7CA 1NYTA 1PZGA 4JP3A 4BNFA 1IUKA 1T24A 1M6HA 1UZNA 1XSEA 4MVJI 4XYBA 2DLDA 5THQA 4D0RA 5A9SB 2O3SA 1GQYA 1DIGA 1DJNA 3PHLA 4Q3NA 5DF1A 4PRKA 1EBUA 1GFSA 1ISFA 4EZBA 3W1VA 3WMWA 4ZJUA 2WJPA 4J4TA 4MVJH 1CETA 3WIEA 4A10A 3ZW8A 2IXAA 1VM6A 4NH4A 1BG6A 4W6ZA 3ANLA 2IZZA 5L53A 4UVGA 1U9JA 3E8XA 3SVTA 3O8QB 4NI5A 1RYDA 2DUUA 1BXKA 2ZYAA 3LF2A 4E2YA 1XKQA 3JYOA 2VOJA 3BHIA 1PGOA 4W9NC 1ISIA 4L9RA 1QLJA 1DHTA 1NVGA 5JNLA 4XYEA 2Q1UA 3R1IA 1P74A 4E13A 1IZ9A 2OFPA 3U4HA 2Z5LA 1W4ZA 5IZ4A 2A92A 2Y1DA 4LCJA 4BO8A 1H2HA 2HLPA 4ALJA 5IDQA 3ZWXA 4O6VA 1PR3A 4RF5A 4DLLA 3I83A 4HXYA 3E18A 1ZBQA 4K26A 1N1GA 4OKIA 1DIRA 3GGGA 1NWHA 2EGHA 3ASVA 4BNJA 1T25A 2X5JO 4A03A 4AJOA 3T4EA 3MOIA 1ENYA 1T1SA 3R3JA 3WGOA 5AOVA 1T2CA 4N7RA 1C1DB 1WNTA 3FF4A 1N92A 4Q9NA 3IKTA 3BTUA 5FF9A 1I01A 3ZCXA 4H3VA 1SC6A 1K3TA 4PGFA 5TF4A 5BSGA 1EE9A 4BMVA 4RDIA 3ZWPA 1U8XX 1RKXA 1GQ2A 2QG4A 4RVUA 3FNFA 5A5FA 2ZB4A 1PZFA 4BNXA 3K9QO 3O4RA 2Q49A 5G0WA 1N8KA 4CMIA 1SPXA 1L1FA 4LGVA 4UEJA 1LU9A 4C7KA 3A06A 3WGIA 5G2OA 2A94A 4GSKA 3AI1A 5JAZA 3JQFC 1MA0A 3KZVA 5DT9A 1V3VA 4DIOA 5JY6A 2Y1EA 3MCVA 1CF2O 5JO9A 3ZU5A 2B5WA 4PN3A 3TL2A 1PJ4A 4J2HA 1AGNA 5KKAA 1RM0A 3DFZA 1O9BA 3JQEA 4PCVA 3K30A 1PX0A 3ENNA 3FNHA 4D46A 1GYPA 2OGUA 4OQZA 4XYLA 2ZCVA 1Z74A 3NTRA 1D7OA 1ENZA 2F1KA 2HMWA 1JDJA 4FW8A 4OJNA 3JYPA 1MC5A 2PD6A 1XU7A 4CODB 2NU6A 4PLFA 4WPGA 5FEUA 3DTTA 4DC1A 3TWOA 2AQIA 4W9NA 4BQPA 3QE3A 4MKZA 1TI7A 4XGKA 1HWYA 3D64A 1ADCA 3HWRA 1QV6A 4R9SA 3VH2A 5IXSA 3EZLA 2IDZA 4XYGA 3WQRA 4NBUA 4CM3A 1YKFA 5JDIC 4Z9FA 3KEOA 3KBOA 5GZ6A 1DFIA 1LI4A 1BHSA 4YWJA 2NSDA 4J0FA 3TZ6A 2EIHA 1SMKA 4MIEA 4BV8A 3KEQA 2OMEA 2B5VA 3GEMA 3UKOA 1N9GA 4OSPA 2PD3A 2JHFA 3I9MA 4CLOB 4EUHA 1EFLA 1SBYA 3V2GA 3ITDA 4YCAA 3TF5A 2BGMA 3A28A 3LLSA 3OBBA 4MKXA 5A3JA 2YFHA 4BNZA 4BVAA 5K9ZA 2B4TO 1E3WB 3FPLA 3FTPA 3L6EA 2YHIB 3FWNA 3P2YA 3HADA 5L40A 1I36A 1DAPA 4OXNA 2PH5A 4GSLA 3ZV6A 1DDOA 1Y8QA 5C37A 2XXBA 2B0JA 1EVZA 4AJ4A 2Y1CA 1Y9EA 5J23A 3L07A 5DN9A 3L9XA 4CLRB 1HEUA 3VPHA 3PHIA 3PHGA 1WDKA 3JQFA 4Q3BA 1WZEA 4JNKA 4W82A 4B7UA 3ADOA 4BNHA 3W6UA 4RVDA 4R54A 5GY7A 2CMDA 3WX0A 1YDWA 4R3NA 2WD8A 4ZU3A 2Y05A 3MZ0A 2BLLA 2JKVA 3NAQA 1KIFA 1SOWA 1NTOA 3HHPA 4J7UA 1HE4A 3EZYA 5EJ2A 3MTGA 3ZHXA 1KEUA 4KP7A 1NBOA 3WIDA 2W2KA 3PQEA 3PYLA 3VZSA 3BA1A 5A04A 3DBLA 4UEOA 1H6DA 1P1JA 3GFGA 3K31A 1BSVA 2X0NA 1Y8QB 3V5NA 3PFWO 4CQLB 3Q2KA 1N2SA 2NU7A 4J1QA 3EVNA 3WR5A 4BKUA 4Z0PA 2JJYA 2VUTA 2O23A 1GEEA 1A7KA 1KVUA 2NQTA 3GZ4A 3Q6IA 2Z1MA 4XIYA 4NJOA 3NUGA 3JQ9C 1RM3A 2EJVA 5JDIA 4S1VA 4MIYA 1U4SA 2RH4A 1T2FA 2J8ZA 3R0IA 2ZATA 4IJUA 3ONFA 4CR8A 3PEFA 1AE1A 1MG0A 1P1KA 1EVJA 3K2EA 1DBVO 3AY6A 4HFMA 4BHTA 5ILGA 3ZNPA 1P0CA 1IE3A 3A9WA 3FR7A 4XCVA 3GVCA 3JYQA 2YHUA 2JAHA 3WGHA 5DOVA 3QWHA 4BMSA 2W2KB 4JBGA 4PG7A 4QT0A 4XEHA 1W0CA 5B12A 1JAXA 1X15A 3QQPA 4RQTA 1T2AA 3CMCO 3DBLB 5G0UA 3ZHBA 3NJ4A 4BNLA 3EMKA 4UAGA 4CMEC 2RH8A 1NQ5A 2I99A 3C7AA 3M2PA 4YAGA 2X0IA 1MP0A 1ISHA 3C7DB 4QQRA 1DIHA 2EF1A 2VYVD 3RFXA 1E5QA 3VPSA 2FMUA 3ZWAA 1A72A 4JGBA 4TSKA 2ZTMA 5KVSA 2VYND 4IGFA 4RORA 4YAIA 1QKIA 1HRDA 1V3UA 4CL8A 4BNGA 3JD0A 4RVFA 3OJFA 4N54A 2VNAA 3WLEA 4Y6RA 3N7UA 5L3ZA 2BMAA 4PG4A 2D8AA 1F17A 1UUFA 3DZGA 1ZK4A 5AXDA 4R41A 3IP1A 1K5HA 4MVJD 4AICA 2ZKLA 1E7MA 3KYCA 3JQAA 1U2DA 1I33A 4RPKA 5ENVA 3ZWWA 3PWSA 1P31A 4YRDA 3CMMA 1E92A 1A7AA 5JDCC 1CJCA 1Q0HA 1C0KA 2FPPA 3CKYA 3UFXA 4P38A 5F21A 1LJ8A 1H94A 3EC7A 4XQ9A 1BTOA 1X0XA 3UCXA 2C5EA 3RKUA 3LT1A 1P0FA 3ROPA 4UULA 2I9PA 2Z1NA 4G81A 2PV7A 4Q39A 5G4LA 1ULUA 1X7DA 2VRCD 4BUCA 3JQ9A 3SC4A 5ICMA 1PJ3A 1QG6A 2Y66A 2I67A 3CXRA 3RIHA 1JWBB 3T7EA 2FHSA 2V6FA 1GEGA 4TVBA 4CUZA 1HE2A 2Q46A 1MG5A 4E5PA 5KWEA 1YDEA 4BNMA 5G0TA 4ALMA 3AFMA 4FBGA 4D0SA 3I52A 3KYCB 1GV1A 4RF3A 1J5PA 3JQAB 5IDYA 5A1TA 1PWXA 3VC7A 1I2CA 1YS4A 2PZLA 3U0BA 5L4LA 1LRJA 4DBZA 3RD5A 4NBRA 4IY1A 1NNUA 2CVQA 4L4SA 1C0LA 1K2WA 4Z3DA 4ND2A 3OHSX 1CERA 4RPHA 5DBFA 1ZKMA 1NX6A 1PIWA 1KY4A 5JMWA 1E6WA 1PL8A 4KQXA 3V2HA 3HB5X 1JKJA 3INGA 2GZ1A 3E5MA 1YBAA 3BMNA 1R6DA 1U3VA 3G79A 4DMMA 4XX0A 3UUWA 2CNBA 1Q1NA 2D2IA 1XYGA 2BELA 4E30A 3GUYA 2X22A 4LW8A 3RC9A 4UVHA 1B15A 4CJXA 2J3KA 2X4GA 3MJVA 1BRMA 3ZWCA 1YQXA 3WGQA 4CR7A 4GX1A 4WCDA 2Q2VA 2HCTA 3QVSA 5DBGA 2IRWA 3CZMA 4M86A 3KOUA 2GZ2A 3WG9A 5KJEA 3F47A 1Q0QA 4JJIA 3GHHA 1YB4A 3GF4A 1NM5A 3NRCA 3LQFA 3ZN2A 5A3VA 2D1YA 2BI8A 3ROKA 5JDCA 3H3JA 3RUEA 2GRAA 3EGOA 1YJQA 4KWHA 3W8FA 2VWHA 4RL6A 5EL0A 4IDBA 2UUOA 1KOLA 3F5SA 4WLEA 3JV7A 1CQIA 1WMBA 4WNCA 3DHEA 3HDHA 3OECA 4A0SA 2NU9A 3L6OO 1ZEMA 4YT5A 1ZNQO 4E5YA 4MJLA 3BMNB 4I5EA 1XHLA 4IDCA 1NFRA 2DBQA 4IQ8A 5CEJA 4DLAA 4D79A 3TFQA 4OXYA 3NJ8A 1ADGA 2QRKA 3MEQA 4U0KA 1X7GA 4B3IA 1P3DA 4PLCA 3GGPA 4I9UA 3CSDA 1O0SA 1OMOA 1VL6A 2BGLA 2O7SA 2NWQA 4PLTA 1GQQA 3FNGA 1LDYA 5AXCA 5I9NA 1UH5A 1YB1A 4K6CA 1YRLA 5A03A 2VUSA 3QWAA 2HJSA 3EY4A 4KQWA 1CRWG 1I3MA 1HZJA 3DZIA 3KYBA 1DC5A 4GH5A 3LC7O 1JQBA 3NTOA 1E7WA 1M2WA 1UDBA 1IHYA 5JC8A 1EK5A 3F4LA 3GEDA 3HSKA 1NR7A 4YAEA 5IZCC 2PKQO 2VCYA 1LA2A 3WSVA 4DTIA 3OQ6A 1VJ0A 4LK3A 4IM7A 4WLFA 1NHGA 3VKUA 5KJ1A 1HYEA 4AVYA 3AM3A 3PLRA 1AHHA 2X0JA 2GF2A 4I9HA 5DNAA 3OF2A 4YRAA 4YAKA 3PP8A 5DCYA 1R0KA 3HNPA 3RASA 4DWVA 3ZWBA 3AOEC 1HSOA 3B70A 4MP6A 1GL3A 5CPBA 1PQUA 4ALIA 2GASA 4GX5A 4BOYA 1A4IA 4CUJA 1YWGO 1QSGA 1KC3A 2O3TA 1I5RA 4L74A 3HDJA 5I7VA 5DCUA 4EEZA 1WXDA 4HWKA 1LBEA 3DMYA 5IJZA 1EUZA 3V8BA 1TXGA 2FWMX 1T2EA 2FPGA 4D3SA 2BHLA 5DDIP 4GQAA 3FD8A 1DC3A 3G17A 2Q1WA 3NKLA 3LC1O 4M54A 1EK6A 3IUPA 1L7DA 3BYZA 1GPDG 4OL9A 1HDOA 2PLAA 1E5LA 4HX5A 1DRUA 3DAPA 3NDRA 2DBVO 4CM1A 2ZIZA 3UOGA 4M55A 3I3OA 3JQ7B 2HUNA 4WNIA 4BO4A 1NVTA 4ZVVA 3TZCA 3AUTA 1UXIA 2EW8A 3MJCA 5L51A 1CWUA 2B4RO 5BSHA 5L7TA 5FI3A 1ZH8A 1DRVA 3L4BC 3F3SA 1GYRA 2H1SA 1WDLA 4M87A 3WLFA 2ET6A 4Y9DA 1A9YA 1KVSA 4HFNA 2P2SA 1OOEA 2BGKA 3JCZA 3RU7A 1NR1A 2TMDA 4N5LA 3PGJA 1H9BA 4BB5A 1PJCA 1PSDA 4RF4A 4YXFA 4EW6A 2GO1A 1HDRA 3DMTA 2VZ8A 4E5MA 3PWZA 3GA0A 1Q7BA 4ROSA 1DEHA 5FI5A 5IZCA 5ADHA 1ISJA 1B16A 5KJCA 5I7FA 1TVEA 3EVTA 4L76A 3S1LA 1OFGA 3H9UA 2I6TA 1KEPA 4R4JA 4BNKA 3IC5A 2V65A 4M1QA 2GERA 2VTEA 1UXKA 1SB8A 2Q4EA 1O94A 1UAGA 4ESOA 1E3SA 3EW7A 3JD2A 7MDHA 4JX8A 1NWCA 1TT5A 2AE1A 1HTBA 3AOEA 2C2YA 3H6KA 3ONEA 4B4VA 4RJTA 2Y67A 1WPQA 3FI9A 3RC2A 4CMAA 5JXWA 2EJWA 4IUYA 3C3XA 3DC2A 1NPTO 3OEYA 4ND1A 2A35A 2CVOA 4CV3A 3IL2A 3GT0A 1GD1O 3HFSA 2QX7A 2P91A 3PFFA 3GPIA 5A05A 5IG2A 5KIAA 1EUCA 4PVCA 2W90A 2AQKA 3PPIA 4EJ0A 5A9SA 3VTFA 2PFGA 4X54A 4ZD6A 4PVDA 4OIMA 4FFRA 3ZHZA 2AE2A 4EYEA 1JWAB 5ITVA 3L4SO 3C7CB 3HN2A 3MJTA 3TDKA 3GGOA 4OM8A 2X58A 3AUSA 4B8WA 5GZ3A 5HM8A 2P5UA 3RQSA 1P1FA 4E21A 4OO3A 1TT5B 1HF3A 2GPTA 4YRBA 4NBWA 3U5TA 4TRNA 1M67A 5FYDA 1DIBA 3JQ8A 3VDRA 5TC4A 4ZQHA 4CLDA 5A9RA 1H6CA 4U8GA 4J4HA 3OIDA 2NVUA 5ER9A 2HMSA 3K92A 3JQDA 4Z0TA 3DOOA 3GZNA 1YGYA 2WD7B 3DHYA 3PK0A 3I4FA 4ZQBA 3JTMA 1QLHA 3MJSA 3W8EA 4U6QA 2RAFA 1AUPA 5IDXA 1F0YA 5KJFA 3D1LA 4BO7A 4D44A 3K6JA 5IXYA 4II3A 4B3HA 3ZH2A 5A5EA 4M8SA 1UP4A 4FJ2A 2C5AA 1PR9A 1UXHA 3RJ9A 2NTVA 3DZJA 4XZ3A 1HDXA 3UICA 4UVDA 4Z0HO 3ZWVA 4E2WA 4NR0A 2FPIA 2X5KO 4BNWA 3IKVA 4II2A 4TRMA 1NPDA 1O8CA 2B36A 2E49A 3PJFA 2IEBA 3NT4A 4QO7A 2V6MA 4UUPA 1C1DA 3JQ8B 1BGVA 6ADHA 5AXAA 4Y98A 4TROA 1LLCA 1EDZA 2NVUB 2P9GA 3GZNB 1QYCA 3DB2A 3JQCA 3TN7A 2OOSA 1F14A 2JCXA 2PZJA 3PLNA 3PVZA 3W6ZA 1GUFA 3AWDA 4TQGA 4XJTA 1GPJA 1D1TA 2GD1O 3M6IA 2DTDA 2UVDA 4DPLA 2EXXA 2JD1A 3FWZA 1SO8A 4RV9A 1R4MA 1HSZA 3GG2A 4ONEA 5H82A 1QYVA 1VPDA 3PDUA 2ZB7A 1N7HA 4XWYA 2UYYA 3M1LA 1YJ8A 2GYYA 1FK8A 1U4OA 3D4OA 3LU1A 3Q9UA 4MVJF 1ONOA 1U7HA 4R9RA 3S2GA 3LLVA 4ALNA 3DZHA 4KTVE 1Z45A 3OETA 4IJWA 2ZQYA 4XQCA 3LK7A 3ROQA 1AHIA 1KY5A 2ZK7A 3S2IA 4CV0A 3P2OA 1RM5A 3ZWYA 1EQUA 1NFFA 2E82A 1KVQA 3LT0A 2CZCA 4TRJA 3WMXA 1X1TA 4CM8A 1ZJYA 5U4QA 1O5IA 1XG5A 5FWNA 1RM4A 1XEAA 1IL0A 2QYTA 4TWRA 2W4QA 3OICA 3PHHA 3QVXA 4EEXA 3WS7A 1PGJA 1S7CA 3FTNA 4LRTB 3DAGA 3L6DA 4J1SA 4G65A 1U1IA 3UGKA 1R4MB 2WE8A 1J0XO 3VVBA 4WECA 1HT0A 2WE7A 2X8LA 1GDHA 3KUXA 3PJDA 2PY6A 3C8MA 3ZNOA 1JTVA 2I3GA 4FDAA 4LMRA 5JCXA 4D7AA 3AU9A 3OJ0A 1QRRA 3GQVA 2HRBA 5JSFA 3JD1A 4AG3A 4NMHA 2JHGA 4CLOA 2VYVA 3GOHA 3ZNQA 3G49A 2B37A 2VT2A 2YDYA 4YT2A 3COSA 5IDWA 4CM8B 1JKFA 4DGSA 4RLSA 2VYNA 2DUWA 2Q45A 5DCWA 1ZJZA 5JFOA 1IY8A 1MXHA 3G1UA 3H65A 1E3WA 2RBEA 5B37A 1SB9A 2YHIA 4FB5A 3WYBA 3OA2A 1MGOA 4NQZA 3WJ7A 1WWKA 4KUGA 1R4NA 3E9NA 1PJSA 1R12A 1Z6ZA 5B4TA 5G4KA 1HDCA 2PK3A 5CEFA 3M1AA 4MVJA 4CLRA 2C82A 5CAEA 3UAGA 5T6BA 2GN8A 1EMDA 2FR1A 4J7XA 4JP2A 4P4GA 3TRIA 3GHYA 1TB4A 1N1EA 5F1PA 1Z7BA 3FSRA 2JL1A 1BWSA 3PTZA 2W8ZA 5JCJD 3UN1A 4JIGA 3E5RA 2BFAA 2GN4A 2ZJ1A 1IOLA 1YXMA 3GG9A 4ZQEA 3W4JA 4O59O 4TVOA 2CSUA 3VZPA 1G0NA 1ZVMA 2GSDA 3KLMX 4NK5A 5KCZA 3H9EO 5HS6A 1CEQA 2VRCA 1ENPA 3OP4A 3LZ6A 5BR7A 4W4TA 2HSDA 3N58A 4FGWA 2LDBA 4FJ1A 4GVLA 4B7CA 3E1KA 1EBFA 1Z7EA 4UUOA 3MJEA 4RGBA 4DREA 2CUKA 2GNAA 1FDVA 3PYXA 1VJTA 4D43A 5JE8A 5KOIA 1H93A 2NVBA 3S2EA 2BFMA 5L7WA 1R4NB 4CQLA 3RBZA 3FNEA 4PLZA 5G4KB 4HNHA 4AJHA 5HTOA 1YONA 2P9CA 3NGXA 3OFSA 3DEYX 1P9LA 1ZW1A 3QWBA 2NTNA 5EESA 4MP8A 1WW8A 4KUHA 3UXYA 1GZ6A 3HDYA 3F1LA 3OIGA 1V0JA 1DC4A 5L7YA 2VNSA 5TLSA 2CDCA 5JBIA 3GRKA 5CG2A 4HV4A 4QUKA 4R68A 5TT1A 3IUSA 4O1MA 3QWIA 5MDHA 3E03A 3RROA 4R1TA 3H9GA 1EDOA 4AL4A 1U3UA 4XQGA 3ZHYA 5AYVA 2GN9A 4EGFA 5CDTA 3IQDB 3MJ4A 4QFDA 1LDBA 2XAAA 3DBVO 3MOGA 4HY3A 5COAA 5A02A 8ADHA 4BKRA 4BO6A 4K9DA 4CLXA 9LDTA 4DRYA 3Q11A 2DAPA 4UREA 4XB1A 1VE9A 3NV9A 4FPXA 2G82A 4WE3A 4XQEA 2J5KA 1DAOA 1JLLA 4Y6SA 4CMBA 1ZO8A 4OAQA 4AFNA 3LVFO 4IMRA 5AQ1A 1AN9A 3WYCA 1K6IA 1PL6A 3KSZO 3E82A 3WNQA 3NT2A 3Q9NA 1O95A 1NQAO 1B8VA 4HBGA 3OJEA 3K73O 5T5QA 2EV9A 1YQGA 5F5NA 3GN1A 4UVIA 1X0VA 3UHAA 4A73A 2O4UX 2P4HX 3NTQA 3PYMA 5AXBA 3I6IA 2AEJA 4WJZA 1I10A 2PZKA 4KUEA 5KVCA 2H6EA 2P5YA 1E7RA 3W4KA 1WMAA 1LLQA 5C7IO 3LSYA 1G0OA 1E3EA 2WEKA 4BNIA 1Z82A 2VOEA 1P77A 4IDDA 5TSDA 1YBVA 2BKAA 3CTMA
chains in the Genus database with same CATH superfamily
2XT9A 4RK4A 3UGQA 3ILVA 3V4RA 4BX2A 2H4HA 3TSAA 1QX3A 1U3DA 2HU5A 1I9GA 4OHZA 3Q5DA 3WHPA 2FFQA 3PA8A 3UWDA 4PYJA 2ZT6A 2Q8NA 3KTDA 4Q6BA 2AK3A 1Q14A 1HTWA 1OBOA 1ZZEA 4DL9A 1OWOA 4YCMA 4BV3A 2J3HA 3OZDA 2IODA 1VA4A 3IE0A 3DBIA 5AJVB 2R11A 1J8DA 1R7RA 1W94A 2C57A 4QJBA 5FA8A 4K9PA 5JYDA 1TUEA 1ZS9A 3KQUA 1IB6A 1TK9A 4GKVA 2OHGA 2BRUC 5ARBA 4J76A 4JDUA 1TM5E 4M9UA 2OBLA 2ZM6B 2BMVA 4BFYA 1KGDA 1T8UA 3EMVA 3V97A 2AEFA 2JJ1D 4NP6A 4YRJA 4YT8A 4NZPA 3JQQA 1XEXA 1JQJC 2X7JA 4Z53A 3IXLA 5HJ5A 3C85A 2W43A 4MLPA 3GPBA 3GJ4A 1ZN9A 4CNQA 2AJCA 3GUHA 4F4DA 2GN0A 3A6HA 4IXWA 4J0HA 1G8FA 4OPMA 4WKOA 1JF8A 2ECPA 4LYDA 3UMMA 3L0DA 3EJWA 4KR9A 4TS4A 3MAAC 1PBTA 3HVHA 2AOUA 4MSUA 1CIJA 5K8UA 4I4NA 4NZZA 1HE1C 4LMPA 3UAXA 3OEWA 2XOEA 3L46A 2JF0A 4OGGA 4PCAA 4NG5A 3CZPA 1ZK0A 4NC9A 1QGED 2V0CA 4B6GA 1FTSA 5EJ8A 2HXGA 4DSOA 1GP2A 2R1UA 2YQ4A 2DQZA 2BFFB 2QGZA 4V0RA 5LLDA 1Z37A 4UNIA 5CFZA 4X90A 4OLAA 3PSAA 4FK8A 3TNLA 1QP8A 2D4AA 4CBVA 3C8DA 2R6ZA 2Z3VA 1JV2B 3KZNA 4KYIB 2VTKA 2NLOA 1AK2A 4Y1FA 1NRJB 4FYKA 4FN4A 3ZDXB 1BYIA 1F1BA 1K0UA 1DADA 2XADA 1WP9A 1AS0A 1S4MA 1YR7A 2P7IA 3AVPA 4TOIA 5B2ZA 2IOHA 5AW7A 2PH3A 3CB4A 2G04A 3OZ7A 2XCIA 4OH7A 5TARA 5KYYA 5LNK6 2RK3A 3ABIA 5HIAA 3PC8C 1CUZA 2FB9A 4JAVC 3ZIDA 3EVFA 4KXYA 5D3QA 4CG2A 2JI6A 3I39X 4DANA 4RGQA 3KYDA 1P39A 1PK7A 4LOHA 3RWMB 2OECA 4TZKA 4J6FA 4ZEOA 3CW9A 2IYPA 1HLDA 5H5JA 1M1YB 4BMYA 4WOCA 2KX7A 3GCXA 1FTQA 4PS1A 1N5DA 1Y4AE 1MN6A 5ARDA 3W77A 2J07A 2EZ9A 2IXGA 3NEPX 4NNJA 4ZRDA 5BN3A 3ZBPA 3GFPA 2XE4A 4QJ3A 1L7MA 1FDSA 4FR5A 1WSAA 5LWHA 1BOOA 1IK6A 2G0TA 5BN5B 2XUQA 3DZKA 5AUQA 4TT3D 3PDJA 4OI0A 3UAZA 1GRRA 2HO5A 2J0UA 2N1MA 5E4FA 3FNQA 3MQ4A 1FMCA 4ICIA 1X70A 1UMBB 4AKHA 4E51A 3TNYA 4JXJA 4NV3A 1FBTA 2H2GA 1ZVJA 1G1AA 4U3JB 1SHKA 2NX2A 4BE7B 3BGSA 3RRYA 2C4UA 2JNWA 1IMOA 5LDGA 2HHHB 5K09A 4GZLA 5KDLA 5AW9A 4RH1A 2IEYA 4JVNA 4LZPA 2VTDA 2ODWA 1YUBA 3DBRA 2GBCA 3I42A 1C9DB 1H6AA 3O8RA 2QQFA 2OHIA 1Q0RA 1QVWA 1WCIB 3GNSA 1EWKA 2EKLA 3UW3A 1EDDA 3FNIA 1JJVA 3H8VA 3PFCA 4MH0R 3OOEA 3IJ5A 5ELMA 2JAWA 5EN4A 1C4XA 1P7VA 2W11A 1H2YA 3OLQA 3HCCA 2EG9A 3U4AA 3ZY5A 4DDMA 2B1GA 5AVVA 3RDPA 4RK0A 3CF4G 2ZRBA 4MS1B 2SCUB 2CD9A 1Y3CE 2A3NA 5KOJB 1NRIA 4FS3A 1Q1GA 3GRZA 2X6QA 3B1XA 3JSAA 2QI9F 3NHRA 5F1KA 3CSUA 3KQOA 1SUSA 3FOFC 4M0CA 3KPYA 2Q5CA 4NMWA 5CDGA 3K8ZA 3O3NB 1FXSA 3N6VA 1M76A 2JFWA 3G2OA 3ZTWA 1BS2A 2WIJA 4X3CA 1V6AA 2Q9BA 2Y93A 2LDXA 1T43A 4MGHA 4EMSA 1C1XB 4O33A 3VSEA 5JHHB 3MELA 4JSRA 4JBXA 5DX8A 1S6YA 4L08A 5AHOA 4BFTA 2WWYA 1NI3A 3GBPA 3WWYA 3FE2A 4EHHA 1G7TA 2HPAA 6REQB 1V4VA 4A2CA 3DXFA 2VJLA 1Y82A 4B7AA 1U0HC 4Q12A 5AKXA 7ABPA 1L5HB 2BGRA 2B1QA 3QVVA 1GTSA 1KYIA 4WOBA 2FXIA 1QU3A 5LB4A 1W48A 4M6WA 2NO6A 3LCRA 2RC6A 3PCTA 4TUYB 3VPCA 4LDPA 2OXCA 3EEBA 4JI0B 3JQ7A 5I4CA 4WLOA 2A1UB 1IN7A 5CEEA 1ID8A 2WG1A 5GV7A 2ZIWB 4XPIB 3E4DA 4QTUB 1AK1A 2BEJA 1YR3A 3VO9A 5C3MA 4WK4B 1X8XA 1JHRA 1VBFA 3N53A 1YBFA 3VR6D 4E4RA 1GGNA 3TFOA 1NNEA 3Q88A 2J09A 1BX0A 2NT3A 3NW9A 4R2XA 5BSUA 1ZOOA 1CB0A 1W0KA 2GARA 2X7XA 3BF7A 3QF4B 4XIJA 5D7NA 1I7QB 3EDRA 5CMLA 4NE2A 2JAXA 3WLKX 2YZ7A 3KLPX 4QL3A 1GVNB 1JRLA 2WHXA 1LS6A 3QEMB 5CA1A 3CVUA 1OLXA 5FL7A 3BVPA 3WV4A 2C8VA 3AHDA 3T38A 2BMFA 2FOLA 4HLCA 4LUCA 3V1KA 5FI1B 5C53B 2WINI 1G9XA 4OL0A 1FDOA 3KQNA 3WWPA 2ZJ4A 1IPEA 3NIGB 4CTNA 3WRXC 1QC5B 4NONA 1E7QA 2HIAA 2Q6LA 5LZ8A 3ESXA 2WMNB 3BBPA 3GEHA 3LUDA 2P69A 4U2CA 3RJZA 4X66B 2VDQB 2ZP1A 4JR2A 4JZKA 4MV1A 5D5PA 5KTKA 1LLDA 1C9MA 2OQ2A 1FLNA 4DLUA 1MBZA 4YJ3F 3V1YA 4FFLA 1PZNA 1JN0A 1U8ZA 1VHJA 3O4VA 4POAA 3UUEA 1NV8A 2Y68A 3KKLA 3LO8A 4DKXA 4EZEA 4KFCA 4NCBA 3ERCA 1VJCA 3EUAA 3D1JA 4OGFA 3DD1A 1HR0B 3H3XA 3I9NA 1K7YA 3PT9A 3RC7A 2C1ZA 3MFYA 1KRWA 2OP0A 3DQPA 4IIDA 4NDAA 2HJVA 3DE3X 2YJTD 3NU1A 2YW9A 3N76A 5T7BA 1ZG3A 5HZKA 4AJIA 2JLVA 3TJRA 1KYXA 4KPEC 2HF2A 2QSYA 3Q41A 1Z06A 1GJRA 2QTWB 4LZWA 1VCOA 2J5QA 4FMCF 3WYEA 2N1BA 1T9CA 4G3XA 2ZKIA 2C5LA 1BVHA 1NQVA 1X38A 1BDHA 2D2EA 4BY9E 3UJ7A 2VPXA 4R3WA 2XQIA 4XUEA 3O4FA 4EG6A 2BTQA 1BFDA 3OM0A 3ESBA 4KFSA 3RSGA 3IQIX 3V9PA 2Z1DA 5IMSA 2IH5A 4XM0A 1B0PA 4EBFA 2G77B 3KP1A 4FU0A 1QPZA 3IDSA 3CX6A 3DFUA 2B92A 2ZIFA 2P2GA 3QHAA 4BRUA 4IQFA 3A05A 3MRXA 4KR2A 1L4BA 3K5WA 2RAUA 1QR6A 1KFCB 3WGZA 1M2EA 2HMTA 4ENQA 1GSOA 5A6SB 3E9EA 2CXTA 3B2NA 2DFDA 3NTXA 2QMZA 1VPEA 3DG9A 4A27A 4N3AA 5I9MA 4DXHA 5F2EA 1AT1A 2I55A 1ZK1A 4GX0A 1BEEA 5B1DA 2X9VA 2DFVA 3A8TA 4GEGA 5SZJA 3CPSA 1NTRA 2EZTA 3O94A 1KE1A 3GY0A 4LN1A 1USIA 5EXTA 3WA7A 2VHZA 1JYEA 1S2NA 5AW1A 4KH0A 1XQ9A 2ODBA 1HEYA 4XD2A 3WHIA 5HIKA 1E3IA 3PFNA 4FFVA 4QNRA 4ZPJA 1RQPA 5FNVB 3P2JA 4B4OA 2A9KA 3IAXA 4UATA 4BS9A 3LTNC 3KIPA 3J81k 1X1AA 2ID4A 3DOJA 4DT1B 2OC4A 5JJCA 1ZH4A 2Q3BA 2H3HA 5FQNA 4BLWA 4PAMA 2DCMA 2DF8A 5DEOA 1TQHA 5KDDA 2NM0A 3U3OA 1GL6A 4CM4B 4IS2A 3UJHA 3VYWA 1EWRA 3MMPA 3IVCA 1XZPA 3EXIA 4EA8A 1IBKB 2C4VA 4TWIA 2TRSB 1U8YA 5DWVA 4A2PA 3VPGA 2AFHE 3ANTA 5E8JA 4Q01A 3SLRA 6YASA 5DISB 4K3UA 3WLHA 4B3JA 3SZ3A 2JJ2D 1QLWA 3O4HA 4KVZA 4EA7A 1EA7A 2EFHB 3B82A 2DBRA 4OJKA 1SHZA 3GGJA 4WCFB 5FNZA 2VXYA 4WK2B 5G40A 4B75A 1FUIA 3QQ5A 1NKSA 3X2FA 1Q57A 4PLVA 4F4UA 3WGUA 1KNXA 1XQ6A 4ZEMA 3IUYA 1SKUA 2XZPA 2QPTA 4RPJA 4COKA 1SJ9A 3VZBA 5JAIA 5JCJA 3PBKA 1E7SA 3HCWA 3C16C 1JDBB 2P9FA 4KQ6A 4DYVA 1SVKA 4RK6A 3TZBA 3PZBA 4FFBA 5F3WB 2F48A 2YV2A 3TIGA 3FYTA 3FVVA 4ZYZA 4IWXA 4KQHA 2IQIA 3NEYA 2W4MA 4TYWA 3ETJA 3IP8A 3UMSA 1CVIA 1V2HE 2GD0A 1UBLS 4GZ3A 4LFBB 3QNMA 4Y2SA 2NYRA 3EXAA 1ENOA 1U7XA 1X1QA 4P7GA 1M75A 5I7EA 5JV5A 3Q3HA 3DJYA 3JU3A 1GLGA 4DQUA 2ZQZA 3F5FA 4OAPA 4EATA 5C2JB 1JDNA 1SURA 1CDOA 4F8YA 4FM9A 4P22A 4LXXA 4MCHA 2VK2A 2RHLA 3BCUA 3QOYA 4DSZA 3FSGA 3PQ4A 4ZA2A 1P45A 2EFGA 4WERA 4W5RA 4AKTA 2QP9X 2QQGA 4U2DA 4UZSA 3IBSA 4M99A 2OCXA 4XFDA 4PLHA 5DTRA 3FBWA 1WO8A 1A76A 3BHMA 3KU1A 3W3ZB 2I1QA 3GC6A 2D3TA 4QATA 2CGEA 5IEBA 3RIYA 3TAHA 3ZTTA 3EGVA 3W5BA 2QN9A 1Z2OX 1Z0DA 4D45A 3JQBA 3JQ6A 4AJPA 3AZOA 2WAOA 4G26A 1BXZA 4NU5A 3RFUA 3RRBA 1PE0A 2Z58A 4B3DA 3K5HA 5KNBD 4TTAA 4JT9A 1UL1X 1V1MB 2IXBA 2PKYX 5H8WA 4YRCA 5AM2A 4JN6B 2CYBA 3SJ7A 4AKSA 1M5TA 2B78A 5G1OA 4GLLA 1W1IA 4QGFA 1EUDA 5FFNA 3TQCA 3CT4A 2QJWA 1SRRA 1N5KA 2IPAB 3PC3A 4EZIA 1OI7A 1MX9A 3F4BA 4KQJA 1Z25A 3EIFA 2HHAA 3O38A 1VG9B 1X1BA 1T3TA 5TNXA 3S0JA 4L4UA 4YP0A 3TLBA 3O1HB 1I0ZA 3UMFA 4CN8A 4EQ6A 5TT0A 3IS3A 4DXDA 3MK31 2OSBA 2PWBA 2R6R1 2H5IA 2C7GA 2JVIA 2P40A 1RLMA 1Z2CA 3I04M 3JZDA 3I58A 3ORYA 4R1NA 5JNRA 1T13A 2KHZA 2X0RA 4DR2B 4G5XA 4K86A 4O2LA 1D6MA 4O0LA 3NWOA 2GH1A 4UXJA 1NN1A 5FPTA 1P0MA 1USWA 2ODAA 3IOCA 3DLHA 3AW9A 4PQYA 1UPUA 2WWRA 4O8ZA 4CF3A 1Y8RB 5KTYA 2Q4DA 2TSYB 4CG0A 3STUA 3CVOA 1PQPA 4WTOA 1H2BA 1Q15A 2B83A 4M88A 3VPFA 3ZIUA 1YVEI 2PKQP 3FCCA 3LNCA 2R6FA 4O5OA 5CP8A 5HDBB 1IHXA 4Q3EA 4IWYA 3TTWA 2QUJA 3F3MA 2BF7A 4K3VA 3O31A 1PR1A 2X4DA 1IATA 3OI7A 1E2EA 3FR8A 1CEEA 3UCEA 2FSGA 2J08A 4Y6OA 2HLDD 1WOMA 2QGFA 3LUAA 2R1TA 4XR9A 3WBKA 4EHNA 5JPCA 4HVTA 2WP8J 2XOXA 4A8PA 2XUKA 1I2DA 1S8NA 1VBMA 1ZITA 4UUNA 1DEXA 3IBYA 3QH4A 4WL0A 3CVVA 4QEDA 5J59A 3NBKA 5DI3A 4AS3A 1GITA 1FXWA 1ZXLA 3AKZA 3NHWA 3A4MA 4DQVA 2O9JA 2JS7A 2WUFA 3QLUA 3UUGA 4EEKA 1CSEE 2O1SA 1LK0A 2VL7A 3L3BA 1ZW6A 2NNLD 2OV4A 2DPGA 2X77A 3SBXA 2NP7A 3LBNA 4ZGGA 3UT0A 2WYVA 4KLRA 1H1TA 1YB6A 4WFJA 2X3UA 4YMWA 2G1JA 4Z51A 2XNJA 2YZGA 2WUGA 1R6VA 5ES3A 3LVRE 3HKEB 4NU0A 3CCFA 3TVYA 1DQZA 4DEXA 4QDUA 3BREA 4NENB 2KPOA 3EPRA 2IL1A 1GL7A 4N6GA 2D13A 5DYIA 5KAMA 3TUJC 3ZK8A 1JAYA 2G9VA 2FFBA 3M6AA 3R5KA 3ZE8A 1R6BX 1M66A 3S8MA 5JWRA 4C6TB 1JEJA 1JKIA 2XTNA 3WYDA 3ETNA 1IEQA 3BT7A 2UYGA 4BNUA 4E0BA 4R51A 1DKMA 2CB9A 3G0CA 2CHFA 5IBQA 3IAUA 3SR0A 3L9WA 1DINA 4CVNA 3F5MA 1IK4A 1Q5PA 5T3UA 4C43A 2P6OA 1L6IA 2V03A 3CNHA 3P2KA 4B74A 3QXCA 4CF5A 3M4XA 4MV9A 1U5BA 3CH5A 1QAMA 2AN5A 1UJMA 2JJ1A 2PL3A 6GPBA 3I9LA 1UZMA 2X3YA 3DF9A 3DDWA 3HVUA 3WLJA 2HX1A 2O6LA 4RDHA 1QNLA 1JQEA 2G83A 2R0QC 1TEHA 3L0BA 2AMLA 3WJ1A 4FNOA 1YQDA 3GRUA 1HG1A 2VBCA 2UUPA 1GPYA 5B4UA 3V00A 3EOBI 4DFDA 3HRKA 2HO4A 2Y1FA 1RT9A 2FK7A 3EK2A 3CEHA 4TMYA 2H31A 4F9EA 2FWAA 4EUKA 1KORA 4UCWA 2A1TS 4DARA 2R2GA 4RDCA 5JS6A 1SHLA 2Q1SA 2QL9A 4INZA 6NULA 3L02A 4EJ6A 3TR0A 4QDOA 5KOHA 2ZJFA 1TAGA 3I4CA 4FJ0A 1HDYA 1N2HA 2YL2A 1JZSA 3H5IA 3NBZC 4AJJA 4RULA 3H97A 3H5TA 2E4AA 3SC2B 4C20A 1W5TA 1X3SA 5IF9A 1GGKA 3ZU4A 3SR3A 4DAOA 3VYTB 4CTOA 2VHVA 1MAHA 4G0PA 1PNQA 5K7SA 2OENG 4JBHA 1V7ZA 1FFEA 4D92A 3RTBA 5BMVF 4WLNA 5EOVA 1QCZA 4QPCA 2XNDD 2X8BA 5GGXA 2CXRA 4OI2A 3VGJA 4BN0A 2WDPA 5BSVA 4EY3A 4D3FA 4ETMA 1QJCA 2NZVG 5JAQA 4R5HA 1PFKA 4N5IX 1TEZA 1N4DA 1TCCA 2B34A 3SM3A 2OG2A 4C9BA 4M1ZA 4MGEA 3G9UA 1VJ1A 1XZNA 4OQYA 2CW5A 4ZTBA 3D5QA 1UDRA 4IX1A 4EF5A 3N28A 3DTVB 2OORA 1S3IA 2QW8A 3ZCSA 1R0ZA 2P0EA 4XUGB 3A4IA 1RI5A 3ILHA 4XX1A 3G3EA 1R10A 4BV9A 2EFEB 2GJKA 2GVNA 4IQGA 3J7AC 1MTZA 2P7HA 5DW3A 2JIQA 4L4XA 1SOUA 4S3MA 3O47A 1U7ZA 4KSCA 2YZKA 5FR1A 3TQSA 3OSUA 2ZRJA 4UZEA 5AOBA 5FOUA 4CIWA 3O6VA 3OCWA 2KW5A 1WVMA 3HXPA 5ABPA 4U0JA 4MB6A 3R7SA 1Y37A 2IDJA 5DLQC 2HU8A 2ZRAA 1DFHA 1Z34A 2I80A 3TOVA 3R6GA 3FVWA 4MR8A 4BLTA 2BZ0A 1MD9A 1NG1A 3G2QA 4TT3A 4V0QA 2FWNA 3MWEA 1X1EA 4NDNE 4LYHA 4DCPA 2B7BA 3EEIA 2E85A 2FZ5A 1E2BA 1Z2EA 1U3FA 4RXUA 3EBPA 4L0CA 3H1FA 4YXWA 3KETA 4PGMA 3NLLA 4Q66C 3I0MA 1CW2B 1L7AA 1O3YA 5DYNA 2FR0A 2J7PA 1VCMA 3ZQJA 4RZSA 2W42A 1UPBA 4GD3Q 2YYZA 5EKSA 2NO1A 2OTCA 4BJ5A 4IGKA 4KNWA 4PZDA 5ALRA 1XMQB 4YPOA 1OXUA 3COYA 2XZTA 1TIPA 4ZN6A 3Q3GE 2IWHA 3T9BA 4E31A 3VMMA 4QEZA 1J9GA 2PAAA 4ZVNA 4FONA 4L9AA 2ZUEA 1ESZA 5K2OA 1XRJA 1XZBA 3DCIA 2BKVA 3JTEA 2FMXA 2HA7A 3F1KA 3L7BA 3PL1A 4K9MA 4Y6PA 4AKEA 5JD6A 1HQYE 1LDNA 2PKXA 1OY1A 5BQOA 4MRNA 4NEGA 4ZU1X 2VAXA 1PGNA 5EQDA 3TZHA 5IXJA 1DCFA 1OC4A 4KI0A 3FHLA 3UMYA 4CUKA 1RXWA 1E63A 1FIUA 4IICA 1YBHA 3RU3A 5KVAA 4QTZA 5LXTA 4P8RA 1RWQA 1PQWA 1MFZA 4QLAA 4W99A 1J70A 2G36A 2R8RA 3DZCA 5JSHA 5IUNC 5TIIA 1UCFA 1Y6GA 3OJXA 1GKLA 1CR1A 1SXJC 2OILA 2VT6A 1Z8NA 2BKLA 1XCJA 2C2BA 2YV5A 5T57A 3G2JA 1WLSA 2CBXA 4GI2A 1O58A 2QTNA 5CK4A 1T4BA 5IULC 2DMRA 4MUGA 4RZHA 5D1HA 1WZCA 2BOVA 2HA5A 4R9VA 5BSMA 1LC3A 1FFHA 1PJ8A 2HPZA 4YJHA 5JZVA 3EFOB 4IGEA 2YC4C 3DZDA 2R6JA 2JZOA 1QORA 4QFBA 3MOSA 1ZWLA 2PHZA 1XZFA 3HB4X 4WUVA 1P3JA 3BB3A 1QF6A 3A1DA 3N74A 3NASA 2UXCB 3TLKA 2A7QA 3H05A 1E60A 2HTEA 4P34A 1BIFA 3CIOA 3OY2A 5FWXB 5DLDA 4WCVA 4OK5A 3GDHA 4L73A 4N5MA 4ND8A 3X2SA 3T7JA 1VKNA 3U1VA 4GBED 2NQ8A 3T9DA 5AK6A 2M1ZA 1J23A 1U6JA 1RHUA 1F8GA 1X7XA 2C83A 3HXTA 3GFVA 4JMLA 3OH8A 4YUXA 4OHBA 3W5SA 2ZUFA 2IA5A 3G02A 521PA 3VR6A 1UKEA 4N49A 1LX6A 3EQ2A 1VMDA 4M8KA 2W70A 1T36B 3PZRA 1AD2A 3REFA 1JB9A 5FV7A 4ZXPA 4AG6A 4ZCRA 1XTIA 2IIVA 4Q4DA 1TLTA 2CLOB 1WVGA 4DUGA 1DOAA 3H5AA 5F77A 3RGGA 3T5TA 1JA9A 4PBTA 1O6ZA 1D7AA 1DDIA 1OWNA 3T4UA 1AXGA 5BSEA 5KDOA 3EXHC 4EJSA 1IM8A 5M34A 3FDXA 4JJZA 4M76B 3SHWA 2WJ3A 2ZPTX 2C7PA 3UA3A 2Q5HA 2Q29A 1OB5A 2OCKA 3AEQB 4KCGA 3X1XA 2O7RA 4R84A 2XGSA 3V34A 1Q22A 1ISMA 3MXTA 4HYYA 4E09A 2CXQA 2QUBA 2ST1A 3BC1A 4KZPA 4E1BA 1YHNA 4YV0A 4DV0B 3X43A 1EGAA 1OVMA 4NECA 4F2DA 2XVAA 3WB9A 2JARA 3Q72A 1I9CA 1W1WA 4J94A 4BVGA 5KOYA 4U2GA 5JEDA 2ZTUA 2AFIE 2C78A 1JLSA 3BRWD 2C3OA 3QGMA 4NPCA 3ZBTA 1T4CB 2F00A 1BXGB 1XZAA 2ECOA 5EGNA 4AO8A 4CT4B 4EHAA 1TA0A 5ADWA 4WXYB 3EASA 4XGNA 4B3BA 3GGDA 2GKOA 3NX4A 4NMMA 4ZOLA 4RD4A 3FYUB 1UXGA 1AVTA 1RRFA 5KYNA 4LWPA 5LCXA 1R6AA 4IOJA 3I61A 3LX8A 1CB7A 5C8YF 5KKAA 4RTKA 2C42A 3H4IA 2G1UA 4OHRA 3V9AA 2F17A 3BCHA 4CMEA 3FH0A 1MO4A 4NNPA 1Q0PA 2CLMB 3N05A 4Q4HB 2PL9A 4KNVA 1XTTA 4XVQA 5PNTA 5DNEA 3R9XA 2HQOA 4EKDA 3GJ8A 2XEXA 3QVWA 3KZKA 3T7CA 4IIEA 3HU3A 2PSJA 2JIZD 2UDPA 2DSTA 1M5RA 5AVUA 4GZMA 1AS3A 2Q0XA 2WHYA 3DOEA 4PSAA 1GTMA 2C2GA 2IOFK 4QSMA 4R01A 5DGIA 4E03A 4PZUA 2YN4A 3PFKA 3RRMA 2AUNA 1C1XA 2C9ZA 3HZZA 5CVVA 4L27A 1RYBA 3FB4A 1AV7A 1E6UA 2BEWB 4DPMA 1WP4A 2C2WA 4Q1EA 3TQOA 3HUDA 2CZGA 1N0IA 4FW9A 1G6HA 5EJIA 4ZARA 4DDUA 6REQA 3LD9A 4K0KB 2E48A 1ZICA 4XW2A 2H7YA 4KX5A 4RJKA 1L5HA 5JARA 3RANA 4W8HA 1CYDA 2BFEA 4DBVO 1E2QA 1WF3A 3KWJA 4K9NA 1OTHA 4OLHA 3ER8A 2EGGA 1E2GA 1PEDA 1P4SA 1YS7A 4N7JA 4JGGA 3PPVA 4D9FA 4XVRA 1N2BA 2BKXA 2FP4A 3WI7A 2VHXA 1CTQA 2HJ9A 3S2FA 2ZZKA 5B7QA 3CRZA 4X3OA 2FG7C 2PWZA 4LFCB 3VH3A 1MVLA 2DG2A 2O0LA 5D00A 1KWKA 4HLNA 4OOFA 3D4NA 2ZWVA 4DN6A 1ULZA 4O29A 3KL2A 3RT1A 3BMOA 2C9MA 2W2TA 1D8TA 1GILA 2RI0A 1A3CA 3I34X 2DQ4A 5EMLA 1F6WA 3C4JA 5K4AA 3QEMA 5G0VA 1GCUA 4ML3A 4MARA 4QUHA 1VB3A 4LSWA 4QVIA 1CUDA 1UJ5A 1U3WA 3C6ZA 3GBSA 1IZYA 4D97A 4TTTS 4PYRA 3HO1A 4BAGA 3TEJA 4Z3KA 1BVUA 2JJ2A 3EDMA 4P53A 5FOVA 1RFLA 1Z0IA 2WWWA 1ABEA 3WVNA 1FNDA 1P9OA 1TPZA 2JAPA 4FGLA 3E1SA 2FJ0A 4DLTA 3ZI0A 3R8FA 2XBUA 5HUQA 5L3QA 1MB2A 1EFPB 2AK2A 2PRKA 4D02A 4WNAA 3MCUA 4K6GA 3K0CC 4CIVA 3E1GA 4YV2A 4RCVA 3NPMA 2OCPA 3QYFA 1W36D 2OBNA 3VTAA 1F8YA 1NQOA 3CF2A 1UBKS 2JFGA 3BL6A 3ENZA 3BK1A 4UEKA 1JVNA 1X9HA 3WNBA 3B6EA 1AY0A 4O4IB 3EWAA 1X7WB 4BBZA 3U09A 4KQ2A 1ZGCA 3KLBA 2GZSA 4XB6B 3KK0A 5ILQA 1FYWA 4L7VA 1IBCA 1Z68A 1EFKA 3OM8A 2B35A 3IPAA 3T5PA 1JSRA 1XC7A 4BNDA 1WXQA 2O05A 3JASB 4ERNA 5JPDA 5LZ4A 1YU9A 3V8NA 1Z29A 1N7IA 1BJTA 1Q44A 1B26A 4UM5A 2R79A 1EX9A 2WV9A 4FFMA 5C8YB 3RV3A 2X5OA 4K1LA 2MMGA 2Y0CA 4XUDA 2VC2B 4BNNA 2EKPA 1XWWA 4YCJA 2ZJAA 4QAJA 5BO5A 3ELWA 5F7OA 1AHPA 4HB3A 3TR5A 1UPAA 4LNUB 1W46A 2Q3DA 1K89A 2OEPA 1UQRA 3TSYA 4OBBA 2ZR8A 4IR7A 1P4GA 1EXNA 4BIIA 2W98A 1MXFA 2O52A 5D8DA 3K70D 2RFLA 1MHPA 2CHVA 4KN9S 2CKMA 4P83A 3OPYB 3E23A 4YRZA 2H18A 1UPXA 1NMSA 1JEDA 5GADl 2FY8A 2H1RA 1YR1A 2J3LA 3LFTA 4FZ3A 1U1EA 5JYEA 4OYRA 4EPRA 5JJKA 2OK7A 4R69A 1GG9A 1E4EB 1FRZA 4GXTA 4HDMA 1Y9AA 4QX6A 3HACA 4HOYA 1CG6A 4W5WA 3M6MD 5COQA 4MYSA 2N47A 3GZTB 4Q7EA 5KO2A 2X9QA 3DFIA 3TW8B 5A5DA 3EISA 3ZJUA 1RU3A 1BOFA 1VL0A 1J99A 2E5WA 4DIBA 3OJLA 3L8FA 3VOTA 1QUFA 3QVLA 2FRDC 4JASB 4TTPA 2BH9A 5BQPA 1W2HA 1PZEA 3MG9A 3STXA 5LWQA 1YK0A 2XUOA 3C4VA 2OO5A 1G4AE 3RNLA 4E12A 4F6CA 1VGQA 4HAYA 5MGNA 2PSDA 4HP8A 5CB4A 2V7PA 5TS3A 2V3VA 3DEIA 1VSVA 3P0HA 1E1QD 3EZ7A 2A0WA 5JZ9A 2PNFA 2CLEB 3EG9B 3IQWA 4NULA 2XKBA 2LV8A 4P7FA 4R1LA 4BFVA 1RRKA 1UJBA 1SXQA 3B2EA 3M6UA 5EGSA 3A2KA 4WK6A 1PFVA 3W1WA 4TS3A 3FLBA 2ETVA 2WB4A 3NRJA 3DOCA 4AQYB 3PEYA 5LMUB 2HLDA 1POXA 3FMVA 3CRNA 4WN3A 5JZMA 1CJUC 1IPFA 2K5UA 2WWGA 2GYVA 3M8KA 1P1IA 4EF4A 1DLJA 4ND6A 4CMHA 2XZOA 1B23P 1V2GA 3ZHOA 2I5PO 1CUXA 5J2UF 5B1YA 5LD2C 2XQJA 3DNPA 3UQYS 3ZDEA 3DDNA 5HKKD 3B9BA 3CEAA 5IFKA 3NJRA 1OI4A 2IZ1A 1G42A 1ZONA 3D43A 3KJQA 2OYCA 2GDZA 3O9VA 3MWDB 1NT2A 1JG2A 1V8DA 1TIKA 2QLTA 3V4OA 3B48A 2ODEA 1D4ZA 2JJMA 1BMDA 1NXTA 2KBFA 3EF1A 3K0HA 3QRWA 4KDEA 4R3UC 3H18A 3VC1A 3N2LA 1YTUA 1I7NA 5BSRA 2QWXA 4CIXA 1SG9A 2G09A 2O2YA 4KLZA 1T8RA 3L4KA 5EMHA 3LGSA 4IIXA 4QZVA 4PLPA 1Y4SA 3C3KA 3GEPA 4L78A 2ABWA 3AHCA 1WY7A 2OCDA 2WQ7A 2O3JA 4JHLA 2GD6A 3E27A 3EAGA 5EC8A 5J4LA 2G0NA 3QEKA 1M1NA 2FKAA 3G0GA 3IUEA 3QBDA 2DKNA 2M6SA 5F2NA 5FAKA 3DHWC 3TTSA 3A6FA 4FZVA 4UPEA 3A0RB 3G0IA 2PZ8A 1RAAA 2QAGC 1U2QA 3L1VA 1IUPA 2P5TB 3AIMA 3C6KA 3TQHA 4P4LA 3HA2A 3AEZA 4IDFA 1WMSA 5LMNB 5D86A 4ZEWA 3ISJA 1JG7A 3EVGA 3VC2A 1RQNA 1LNSA 3MRVA 3W5IA 2EYQA 3QX8A 4MGYR 3GFTA 3HJRA 2C03A 5A6VA 1GPNA 3B6ZA 4BVHA 1IHUA 2FKNA 3BILA 4URZR 1C80A 1V1MA 2DCUA 1L8XA 3CN9A 4WBXC 4AJEA 3F7OA 1IONA 2RBKA 3RLFA 4F5YA 3U4MA 1Q1QA 1WXIA 3LT5A 2WFLB 2QZ9A 2QRMA 3JVIA 4XVHA 3DL2A 3L4BA 1TJ3A 3TMAA 3FW1A 4CLEA 1ZA1A 2GX6A 4BBPA 4JXKA 2AXEA 2GNOA 4ILEA 2B61A 3HRHA 4JLWA 4O63O 5DOZA 3T15A 1RBZA 2PX8A 1WKCA 5DHPA 3MSCA 1HZZA 3IBCA 1II0A 1KPGA 4GU5A 2QLLA 1Z5VA 1NYTA 3DMGA 3IBTA 1RMQA 4LE1A 6PFKA 4UTOA 1P2FA 4EG7A 3RVKA 1YRBA 1IUKA 1T24A 1UZNA 1FXWF 2B30A 2D00A 2POCA 3FCUB 1JU4A 4XYBA 5A9SB 1SVWA 1GQYA 3G0BA 3H9CA 1CY7A 3PL5A 4LV6A 1UMDA 3ETCA 3PHLA 1A9SA 3G2LA 4HDKB 5KTNA 2ZRDA 2BUCA 1GFSA 2XNDA 3LUGA 1YJ5A 1NW9B 1K6EA 2WICA 3R7LA 1F6BA 4OUDA 1T6YA 2ZBQA 3OTGA 4DV5B 1Q20A 3SYLA 1TK2A 1O9GA 2MTBA 4LDNA 4QOFA 1H85A 3E53A 1UBJS 4EWLA 2RB5A 2F4VB 4A10A 3ZW8A 2IXAA 4KPUA 4NH4A 4B8YA 2FSVC 3LHFA 4W6ZA 4ARVA 5L53A 4L8GA 4X7BA 3SZRA 2DPXA 3HYLA 3E8XA 3U3MA 2YMMA 3SVTA 4G1MB 4LY3A 4V02A 4NMLA 1RYDA 3AR5A 3CLRD 2IYWA 3LF2A 4XLZA 3LYUA 5TQ0B 2GEBA 4W9NC 2YXDA 3KKNA 3OZXA 1MIOA 1DHTA 1NVGA 1CJSA 1Y4ZA 3R0JA 2RHJA 3RS3A 4JI7B 3X0DA 4QG3A 2N3ZA 1KH3A 3EZNA 2AOTB 2PIAA 2GM5A 3QFHA 4KN6A 3NATA 4G8DA 3SS8A 4E08A 3FM9A 3TIXB 3KTFA 3PXBA 3RRFA 10MHA 2V6IA 1SA0A 4GUDA 4KRXA 1Y80A 5J2UB 1T0JB 2Y1DA 2H7XA 4OFWA 1MABB 4BO8A 2QD2A 1H2HA 4J75A 4ALJA 5IDQA 3FHOA 3HM9A 2RGRA 4ROTA 4O6VA 4UBKA 4DLLA 3AF0A 5EG5A 5EJFA 1EFHA 1S4QA 1YRYE 4I1RA 2IU3A 2D4HA 2PRJA 1BCRB 3LO5A 5CJJA 1L5VA 2OD7A 1DIRA 1OAOA 3GGGA 3GJYA 4ZO9A 2X5JO 1P29A 5DHRA 3E5HA 2A9PA 4ZCTA 1J2RA 1KMHA 4I6EA 3WGOA 3UK7A 4JC8A 1G7RA 1V5FA 3USZA 4C6TA 3E9ZA 4F86A 3L4EA 1QCYA 3R2JA 1N92A 4HSEA 5HCNA 1J09A 2QX6A 1TQDA 3R3XA 3T3PB 3ZCPA 1TFRA 1VMEA 1K63A 3BKWA 1SY7A 4H6XA 4JITA 3W6OA 1YIOA 1V8FA 4MMYB 2Z98A 3QUQA 5HTKA 2OLKA 3ZWKA 1WETA 4J16C 5J1SB 1S3FA 1MDBA 1XZQA 1YKSA 3TGLA 4DR1B 2JI9A 1U8XX 4PFSA 1US8A 3D6HA 2QG4A 4ZVMA 1YC2A 3IV7A 4FUQA 4B2LA 3K9QO 3O4RA 4MQFB 3SFTA 1SIWA 4NV1A 1N8KA 2P62A 1H42A 1ZKDA 4K9QA 4IIJA 4HEJA 1K8XB 4LKOA 4QPPA 2IUTA 3AI1A 3IESA 2WK1A 5JAZA 1S8OA 3EFBA 3EZ6A 1HL7A 3GX1A 4IVRA 3QI2A 3MRTA 1JNXX 3DEHA 3WYAA 3TL2A 1E1YA 1Y98A 1DEKA 2MSLA 1V16B 1XRQA 3DFZA 3JQEA 4KJZA 3TX6A 1W93A 2WNIA 3T54A 1KP3A 4DG9A 3WK6A 1R00A 1GYPA 4IG9A 2R87A 1YCHA 4XYLA 2IX3A 3LY9A 4UKDA 4X3PA 3LYHA 3U26A 2MIIA 2AXPA 2BEVB 2BBWA 5DT2A 4CKEB 3E2PA 4LV8B 1RCFA 3ZGXA 4RDXA 2F1KA 1DOZA 1YVRA 2HMWA 1IIBA 2EJBA 4FW8A 1GTL1 3RS7A 2ZM5A 2PSHA 4MMZB 4B83A 1L5OA 3DE5X 5CNIA 4C6SA 3TGPA 2BR4A 4O8CA 5DIFA 3DTTA 3KPWA 4ER7A 3TWOA 1TAUA 4H27A 2D8MA 4EI7A 1CLEA 1ODJA 4MKZA 3UXEA 2JCSA 4XGKA 5CIQA 1DAIA 3OCJA 4EUNA 1NBMD 3OG9A 4OYLA 5EPEA 2VZLA 4UNRA 2DY0A 3GEBA 1QV6A 1AV6A 3CA8A 3BRSA 5GONA 1L3BA 5IXSA 2CSXA 3J7TA 4XYGA 5CW2A 3GEEA 3H2KA 2P9BA 3KE9A 3QPVA 3GAAA 3DCYA 4DUYB 1ZA2A 1L1RA 4G97A 1NDUA 2JGRA 4XVCA 5JDIC 5LUBA 4DR5B 2A84A 4ZJYA 4LZJA 1BHSA 2PBRA 1UJ4A 3QOXA 4V2IA 1RJEA 2LCQA 3RYCB 3SU8A 1C3EA 4LF5B 1HQDA 4CG3A 2WVHA 2Y0BA 3TZ6A 4TXNA 4BVKA 2IDKA 5H02A 5J1TB 3KEQA 2TYSB 2QDKA 2R5WA 1CR2A 4IQ4A 2JBAB 4FGKA 1JIJA 4OSPA 2MMCA 1E1DA 2FG5A 1A04A 1EVQA 1XXHB 2FJUA 2XBLA 5IAGA 3PNMA 1U2GC 2JFXA 3G2IA 1ECJA 3QU4A 4PWYA 4YCAA 3TD2A 2Z6VA 4YI5A 4N39A 5HIMA 5F98A 1UT5A 1VGVA 1DAKA 1NLYA 3L8EA 4D25A 2NU6B 3M4JA 4A2QA 1YIAA 3D7NA 2PSEA 1XZGA 5LYJB 2HFKA 1E3WB 4P4TA 5KU7A 3T0GA 4PZPA 3CEPB 3P9CA 1LTKA 1IY2A 1Q2UA 2QVCA 2YHIB 4JP5A 3V8EA 3P2YA 3BRWA 3HADA 4IV5A 3ZV6A 2VTBB 2PH5A 3ET4A 5BW6B 1DDOA 2WUWE 4WFIA 4L02A 4HDRA 4AJ4A 4OB7A 1Y9EA 5A7HA 3SXJA 3RM3A 4DMHA 5JFGA 4BXOB 1HEUA 2ZUDA 1U99A 4K87A 3F7MA 5AUNB 3UPTA 4CIDA 4Q3BA 2G7ZA 4W7SA 1GAWA 4BB0A 1WZEA 3S28A 3M7IA 4W82A 4EKIA 2ERYA 2WHQA 4BNHA 3WRWA 2AVDA 2BHTA 4R54A 3NNNA 2G08A 5E9AA 3IIMA 1YQEA 4RFVA 3S2ZA 2WD8A 4F5DA 5B1EA 3GP8A 3MZ0A 4NX2A 4RABA 1XA4A 2JKVA 4PU0A 1SG0A 4NF2A 1QFMA 3WJ2A 1KIFA 2JH3A 3SQOA 2QRUA 3CLKA 4X93A 3U3DA 1EFDN 3ELBA 4LJ4A 4JSTA 3MTGA 4FZ5A 1YVPA 1ST3A 3KQWA 2R8ZA 2TMKA 4YDSA 4OXQA 4EG4A 3PQEA 2V59A 3PYLA 3QELA 3BA1A 1Z8HA 1THTA 4PZ0A 5EZ6B 1OYVA 4UEOA 3ZDAA 1NVUQ 1H6DA 3T41A 5F9MA 1C7QA 2EHJA 1LW7A 1KBOA 1S1CA 3GIWA 4DCCA 3EFOA 4G8CA 5JS7A 5K3SA 4KQ9A 1J8MF 4R0VA 1TLFA