3U09A

Crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg)(g92d) from vibrio cholerae
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
248
structure length
248
Chain Sequence
MSQFMNLEGKVALVTGASRGIGKAIAELLAERGAKVIGTATSESGAQAISDYLGDNGKGMALNVTNPESIEAVLKAITDEFGGVDILVNNADITRDNLLMRMKEEEWSDIMETNLTSIFRLSKAVLRGMMKKRQGRIINVGSVVGTMGNAGQANYAAAKAGVIGFTKSMAREVASRGVTVNTVAPGFIETDMTKALNDEQRTATLAQVPAGRLGDPREIASAVAFLASPEAAYITGETLHVNGGMYMI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-oxoacyl-[acyl-carrier-protein] reductase FabG
publication title Dissecting the Structural Elements for the Activation of beta-Ketoacyl-(Acyl Carrier Protein) Reductase from Vibrio cholerae.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Oxidoreductase
total genus 92
structure length 248
sequence length 248
chains with identical sequence B
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2011-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3u09A00
5EPOA 4ALJA 4J4TA 2YYYA 2VCYA 2JD1A 3PP8A 4IZHA 1UXHA 5COBA 3TZKA 5BSGA 2J5RA 2ZCVA 5ENVA 1GYRA 1R4MA 5IF3A 1QSGA 1HWYA 4IDFA 1DIGA 5JDCA 4J16A 2YFHA 1KS9A 4WCFA 4BO4A 3BMOB 3NT4A 5FEUA 5CP8A 1SAYA 1GEEA 1IYZA 2EP5A 4YRAA 2DUUA 2O48X 1DIHA 4RLSA 3AOEA 3FCOA 3WNVA 1BXGB 2JL1A 2Y1CA 4XD2A 3WFIA 1ONOA 1JVSA 4MVJA 3I9NA 5JCJD 5F5LA 5L4LA 4IM7A 3ROKA 4XYLA 4YJFB 1DJNA 5JO0A 4YWJA 1O0SA 5L40A 4QTZA 1JW9B 3FBGA 4CV1A 4Q3DA 1YS4A 5GMOA 4OH1A 3K2BA 3FRJA 2GLXA 1UDAA 4MVJM 4Q3CA 1PL7A 2R00A 3L9WA 4HY3A 1X14A 1VKNA 3B6ZA 4P4GA 5EINA 1YDEA 2EEZA 3GF4A 5TLSA 2GO1A 1ZO8A 2X0RA 1SEPA 4NFSA 2PKQP 2V65A 1ENZA 2Y66A 4PLWA 3D0OA 3DHYA 4RORA 5FF9A 1VKOA 2BFPA 2JAHA 1C3VA 2X8LA 4YJFA 1H93A 4CLOB 4JROA 4C4OA 4KZPA 1X15A 2Q2WA 2AG8A 5JE8A 1RPNA 4AL4A 1KEPA 1FXSA 1IPFA 1DEHA 1GD1O 5F1OA 3LLSA 3OECA 4BNWA 1L7DA 2J3HA 2YV2A 4E32A 1NWCA 1EMDA 4PLGA 4YEDA 2JFHA 4XGKA 2GRAA 1N5DA 5EMHA 3DBRA 4WE3A 5DOZA 2O7SA 3M6IA 3O38A 4G2NA 4NQZA 4D42A 1BGVA 3AJRA 3ROMA 2Q46A 4MIEA 4WLNA 4EGFA 4A2CA 3TF5A 1I5RA 2GSDA 3GHHA 4IQ0A 3D3WA 1E6EA 2FMUA 2DBVO 2VUTA 3RASA 3ZNOA 5IDWA 5L7TA 3CSDA 3PTZA 4J9VA 1HLDA 4NJMA 4OKNA 3ONFA 3U0BA 2P68A 4BL5A 2X1HA 1YQDA 4OL9A 5JPIA 1EVYA 5A9RA 1U3UA 3P2YA 1S7CA 1Y5RA 5L45A 5HWSA 4AVYA 3K92A 3LC7O 2DLDA 3WBFA 4HFNA 3PJGA 3WMWA 3GC6A 4FIZA 2O50A 4B4VA 4WNIA 4Y98A 2AE1A 4XGNA 3WOHA 4JBIA 2TMGA 2IXAA 5IDYA 1V6AA 1U3TA 4CM4B 4OHUA 3KXDA 4A26A 1M2WA 3HFSA 4GI2A 3E18A 1D3AA 3RBXA 4D43A 4DGSA 5HTOA 2VUSA 3CXRA 3L4BC 4RVGA 3ZCXA 4GKVA 4XYMA 2Q50A 3RJ5A 3RUDA 3ZNPA 4ALLA 2HJSA 3DTTA 1P3DA 4CUZA 3H5AA 4RLHA 4EUFA 4CL8A 3C1AA 3TQHA 2NU9A 2BF7A 1VJ1A 3V2GA 3UW3A 3WGQA 2VHYA 4L76A 4F46A 4DA9A 3PFFA 3DOJA 2NNLD 2JFGA 1G1AA 3M2TA 3VOSA 3GEGA 3GVHA 4XDZA 2G76A 1R0LA 3FWZA 3WICA 5HS6A 5AVOA 5IJZA 4Z9YA 1KVQA 4R01A 3KM0A 4PFJA 3JQ8A 4EUHA 4MVJG 2FHSA 1ADCA 2J3JA 4J1QA 4OOEA 5L4SA 1Y8RB 2B0JA 3NJ4A 3WFJA 1DC3A 1LLDA 2HRBA 3F6YA 3GGPA 3ANNA 4PRKA 1UZNA 5CPBA 2ZB3A 4BNTA 1ADFA 4D46A 3HHPA 3L0DA 1VSVA 3DB2A 3FR8A 3BZUA 2PY6A 4W4TA 4R9SA 2NU6A 3KV3O 1GDHA 3VPGA 2VTDA 4L4XA 1I2CA 1GZ4A 4JX8A 1B7GO 4PG4A 5I7FA 1PGPA 3OJLA 1A9ZA 3LZ6A 4H16A 4K9DA 1Z73A 4DLBA 1KEWA 1YOVA 5IDXA 1ULSA 3S2GA 3K5PA 4CPDA 4NPCA 1R66A 3UN1A 4XQCA 2DBZA 3D64A 1BVRA 4UVDA 4B4OA 1MX3A 1B3RA 4M1QA 1MGOA 1YH3A 4GX0A 3JYPA 3OQ6A 3HE3A 1D7OA 1ZJYA 1ZUD1 5A3VA 4WKGA 3DZJA 2ZB7A 4TVOA 5A04A 4GBJA 4E2YA 4QO7A 2WMDA 1KEUA 3DAPA 2OBYA 3Q3CA 2W98A 3QHAA 1O8CA 1SOWA 1U8FO 1FJHA 2X5JO 4ZN6A 3BMQB 2PD6A 3D7LA 3GGOA 2ZB8A 3W1VA 3GQVA 1U2DA 3E1KA 2HU2A 2BKAA 4PCVA 2QYSA 5HRUA 2JFFA 2HK9A 1ZK3A 4YCAA 1O5IA 2HDHA 1MP0A 3HB5X 3L77A 3I9OA 4G5HA 4R3NA 4C7JA 2HMUA 4J1SA 3LQFA 1YJ8A 3HDHA 2VRCA 3WNQA 4Y67A 3VVBA 3GPDG 1BHSA 2IXBA 3KYDB 3W6ZA 1E3WA 1T2DA 2IZ1A 4WGGA 3BMQA 4B4UA 2Q1WA 4WLVA 4D79A 1NPTO 1ISFA 4GMGA 3VDRA 4UVGA 2A35A 1GYQA 4O1MA 1GQ2A 4C7KA 2W2LA 4CMGA 2YY7A 1R37A 2AEFA 5CDGA 5IXYA 4GSLA 5KIAA 3R0IA 5JS6A 2WE7A 4YDRA 1QYCA 2J5QA 5TNXA 4I5GA 2C2YA 3NGLA 3Q9NA 1PSDA 3MJVA 4BNZA 1OAAA 2RAFA 4EITA 2POQX 1YONA 2O3TA 3KHUA 2W8ZA 3ZV3A 3DZIA 1K6IA 2OP0A 3UFXA 9LDBA 1FK8A 5BSHA 4YJGA 3LT2A 2GN8A 4WEQA 4Y6SA 1E7RA 2QX7A 2OO5A 3DBHA 4JK3A 1ZK0A 2UUOA 1XA0A 1YVEI 5DBGA 2YV3A 2G17A 5FI3A 4RO0A 3RFVA 4FJ2A 1UDCA 3E82A 5TT1A 1HDOA 2JAPA 1IHXA 3BHIA 2FPGA 3KEQA 4TMFA 4CQMA 4TRMA 3NKLA 3HFGA 3WGYA 8ADHA 2IYOA 4RPHA 1GFSA 2C2XA 3OJOA 2AEJA 3WLFA 2B36A 1LSOA 3LT0A 4ND5A 1F8FA 4DRYA 3HWRA 3PWZA 2X0NA 4BKUA 5ICMA 3P5SA 4DPMA 3PHHA 4CLXA 1I36A 3OM9A 1VJTA 3EDMA 1G0OA 3SEFA 3FNFA 3NX4A 3U5TA 5F1KA 3O4RA 1ENPA 1U5AA 5GZ1A 4D41A 2VZ9A 3GNSA 4WOJA 3CIFA 2DPHA 1SNYA 1H0KA 2EKLA 3D1LA 1T24A 3C3XA 1IB6A 4XYGA 4ZA2A 4E31A 1QYWA 3JQ7B 4RCVA 4NBRA 2Q1SA 2G82A 4NU6A 5I8ZA 4AJOA 4BV8A 1MG0A 1X13A 3NV9A 3DHEA 2QZZA 1LQTA 1V8BA 3DDNA 3JQAA 4HFMA 4TRJA 4XRGA 2HRZA 2EERA 3ZZNA 1W73A 4PIVA 3AU9A 5BT9A 1SC6A 3VZQA 4Q39A 5B4VA 4G65A 3W4IA 1MB4A 1ADBA 3U62A 3HSKA 2XF8A 3D4PA 2HQ1A 1B15A 3L07A 4DIOA 1UJMA 5C3MA 1XHLA 1U8XX 4P38A 3TNLA 4ALNA 2DFDA 1Y7TA 1GPDG 1C0LA 2HMSA 3OFSA 3OJ0A 1PGOA 4HFRA 3K30A 3WQSB 3Q2IA 4WOKA 1L1FA 4BNVA 4TZTA 4DL9A 4TSKA 2BGMA 4EEXA 3DMTA 2D0IA 3OSUA 3PZBA 1J0XO 4DREA 2W90A 3ZH2A 4QFDA 1PZEA 4ZQFA 3Q0EA 3Q1LA 2FRDA 3N7UA 2W4QA 2ILTA 4HUJA 3NDRA 1C0PA 2BFAA 5DP1A 5ILOA 5ER6A 3FN4A 2G0TA 3MTJA 1ZSNA 3OIFA 2XOXA 2C07A 4ND4A 4CM8A 1TT5B 1M67A 1LDMA 1RYDA 4PG8A 4U7WA 2ZK7A 1EUCA 1U28A 1ZEMA 4RQTA 4DQVA 3RJ9A 4RPLA 4FBGA 4CM5A 3JTMA 4NMHA 4CMAA 3KRTA 5CAEA 2I76A 1SEVA 4PLHA 1LJ8A 5TS3A 3EK2A 1Q7GA 4IJVA 4E13A 3LF2A 3UOGA 1ADGA 3INTA 4J4BA 3H9QA 1GL3A 4LMPA 2J8ZA 4O0LA 3V2HA 2HMWA 2Y05A 4FGSA 4LGVA 4EEZA 2VYVA 3PEFA 4I8XA 3DFZA 3UCFA 1RYEA 3GK3A 5BQFA 4BGUA 5BSFA 2V6MA 1J5PA 2O4CA 2A92A 1EQ2A 2O3QA 3DBLB 4JP2A 4TROA 5F1PA 3ZWMA 4A73A 4D45A 4II3A 4BO5A 3HB4X 3PK0A 3GA0A 2VOEA 1MXFA 1E3IA 1QG6A 5K6AC 1QYDA 4FFOA 3ZU4A 1N1EA 1JA9A 3SJUA 4FSHA 1WWKA 2NADA 4FR5A 3LDHA 1ZIDA 4BOYA 2J5KA 1HTBA 1VC2A 3E48A 3H9EO 3MJSA 2PZMA 1B0AA 4YT5A 3S8MA 4E5NA 1EE2A 2O7QA 1YO6A 3U49A 1T2AA 1VRWA 3LU1A 3PIIA 4CMIB 4BO8A 3AUUA 1T1RA 2C5AA 1Z7EA 2OHXA 4FJ1A 4Z0TA 3H5NA 4IIVA 4FCCA 4CV0A 4E12A 1LXCA 4MIOA 1YQXA 1P1JA 5LCXA 2WTBA 1U3WA 3GR6A 1K6JA 4IQGA 1N9GB 1VI2A 2FPPA 4BNJA 2PKQO 1E7MA 4XCVA 2VHVA 4YVFA 4MVJP 4IZIA 4L74A 2B35A 1PEDA 3MOGA 1J49A 2WYVA 1R4NA 4FB5A 2VWQA 4CM9A 2CSUA 4QUKA 4W9NA 2A94A 1B3BA 1ENOA 3QV1A 4WK6A 4E2WA 3WWYA 3JQFC 1U5CA 1ZKMA 3WYCA 2C54A 4KUHA 4E6PA 3WIEA 3WYEA 4R1UA 3KEOA 4CQLA 3IC5A 1K89A 4S3MA 5TJ9A 5BR7A 3ZWXA 3FI9A 4TRRA 2B5WA 3RUEA 4E2ZA 2EGHA 3WMXA 2B4RO 2GGSA 1IE3A 1NQTA 4FN4A 4A03A 1N9GA 4O59O 1ISJA 4BVAA 4E3ZA 1GR0A 1E3LA 3ZDFA 4UEJA 3VH2A 3WS7A 2DVMA 2WD7A 2H6EA 4LSMA 3BMCA 3LLVA 1KIFA 1NFRA 3L6EA 3SLKA 1KC1A 2NVWA 1ORRA 5DN9A 4D7AA 1SZJG 1E1NA 1U7TA 1N8KA 4XB2A 3G3EA 4ND2A 1P1RA 4YBZA 4YPOA 1Z75A 3KBOA 1A27A 1YWGO 3F46A 4NR0A 2VNAA 3S1LA 4HNGA 3DWFA 1TI7A 4DUPA 1W4ZA 4OKIA 1Y81A 3TN7A 4AJPA 3BTVA 1GEGA 4BNUA 4JBGA 2DBQA 4P22A 2GYYA 2AEMA 2HMTA 1E7YA 2GNAA 4GVXA 3K96A 2ZCUA 3GLQA 5DNAA 1HL3A 4MVJH 1N7GA 5HS4A 4BNGA 4OM8A 2AHRA 4TVBA 4FFMA 1O9BA 4OGWA 4PZEA 5KTKA 1ZMOA 2QRJA 1BRMA 1YQGA 3OEWA 3RUFA 1E6UA 5HM8A 5T67A 4MVJI 2D5AA 4RF3A 3ST7A 3HNPA 2PNFA 3AFNA 5ITWA 3I83A 5JDCC 4FFNA 4GMFA 4ND1A 3VPHA 1AHHA 3IAHA 4WCFC 5DOVA 2FPIA 1HYEA 2VZ0A 1I10A 1WP4A 4BNFA 5C37A 3AOEC 3UCEA 3MJTA 4OJNA 4K1LA 1ZSYA 2PZKA 1DHTA 1PZHA 4GX2A 3BA1A 3TZHA 5JMWA 3UKOA 2FR8A 1QYVA 4B3HA 1I32A 1MFZA 5MDHA 3KOUA 3FNHA 1KEVA 4Q3NA 4BKQA 2YHUA 2BHLA 1PL8A 4BO7A 5IXSA 1XLTA 4TKMA 3ZWNA 4CLRA 4ZU3A 3PQFA 1Y8QA 1PTJA 1UDBA 5TT0A 1LRJA 3GDFA 3PGXA 4XWYA 4CMEA 2UDPA 3LC2O 3HN2A 4ONEA 1GQQA 2EJVA 4PVDA 3WDSA 4W6ZA 2PLAA 5JAQA 1EEHA 3GDOA 1Z74A 1RM4A 2DM6A 4O5OA 1D8AA 5I8WA 4I9HA 1PJTA 2AQ8A 3JD4A 3B1KA 3KSZO 4CM3A 4KWIA 2JHFA 4RPKA 1R4MB 3RC9A 4MVJF 3FD8A 3HADA 3ZNQA 4B8WA 1XQ1A 2GDZA 4WCFB 1ZH8A 1XYGA 3CMMA 3VH3A 3HUDA 3ZV6A 3IP3A 3C1TA 7MDHA 1NVMB 1ZK2A 2QHXA 3I9JA 4UVHA 4S1VA 3H7AA 3MWDB 2Q1UA 4WLEA 1OMOA 4D3DA 1ISIA 2PGJA 3OIGA 4OO3A 4AFNA 3K9QO 1B8UA 4GLLA 5CDUA 4FC6A 4J1TA 1NQ5A 1OZAA 2F00A 1PGQA 5T64A 3NT5A 4K6FA 4Q9NA 3S2EA 3B1FA 3ZI0A 3E6AA 2OGUA 3INGA 1T26A 3SJ7A 3ZHXA 4ALIA 2YV1A 4WLFA 1NQAO 3AUSA 3T7EA 1A5ZA 1C0KA 2GZ1A 4MJLA 1PWXA 3W8DA 3OP4A 4L73A 1B14A 4HP8A 4U0KA 2Q45A 3DBVO 4RPGA 3ZWPA 5A5EA 2Y67A 4ID9A 5FFFA 1IZ0A 4JQCA 4Z0PA 1M6HA 2Q4BA 1PS0A 3ABIA 4IY1A 3HZZA 3RVDA 8LDHA 4BNKA 3VDQA 3TWOA 2IE0A 2PTGA 3SC6A 1ML3A 3VKUA 1PS9A 1V0JA 3P19A 1CDOA 1ZZEA 2Z1MA 3EY4A 4BO2A 2I9PA 4EUEA 4PLTA 5BNTA 1MA0A 1K6XA 2NTJA 3DBRB 3WGZA 1OC4A 3HN7A 1T4BA 3L6DA 4U8GA 4TQGA 1I3KA 2ZTUA 5JC1A 3JQBA 1I3LA 4QEDA 1I01A 2I66A 4DC1A 3I6IA 1YRLA 3OA2A 1MG5A 3JYLA 4XX0A 1WNTA 5IG2A 3D3WB 4DC0A 1ZMTA 4UVEA 3AI2A 3B70A 4NJMB 4ND3A 1VE9A 3GZNA 3P7MA 3D5QA 3E9NA 1PJBA 1FF9A 1PWZA 3ZHYA 1AHIA 4MP3A 3U4HA 3IJRA 1DIAA 1E7WA 3CZRA 2NV6A 2OFPA 3GT0A 3HQ4O 1NASA 3NGXA 1LSSA 2HSDA 3KTDA 1E77A 1HRDA 2HJRA 1EUDA 4WASA 5GZ6A 1DRVA 4K6CA 4NBUA 4Y9DA 4PRLA 4J7CA 4GSKA 2NTNA 1OOEA 1NFFA 3WSVA 2QG4A 4XQGA 3WXBA 1YBAA 3O8QA 4WCDA 3DOOA 4EZBA 1G6KA 4O6VA 3T4XA 2C20A 2EHDA 2D1YA 1H9AA 1GUYA 3OBBA 3KZVA 1YB5A 1R12A 3AY3A 4FQ8A 3PJFA 2EJWA 2CVQA 1M75A 4LCEA 3I6QA 1YBMA 2CFCA 3I9KA 4AJNA 3AUTA 1E5LA 5GZ3A 1BDBA 4UULA 2PGDA 5H81A 1NYTA 1A71A 1FDTA 3F5QA 1XGKA 2Y1DA 2YDYA 4RVHA 4D0RA 2BFOA 1PL6A 4ZQHA 4IIUA 1CWUA 1KY5A 1RM3A 3GMSA 4N7RA 2CVOA 1DBVO 2CDAA 2JKVA 1QLHA 4GAEA 1ULUA 3VPSA 4ZICA 3AOGA 3R6DA 4H3VA 4XQ9A 4B7UA 2Q3EA 2FZEA 4BUCA 5L9AA 3WSWA 3UF0A 3KLMX 5K9ZA 5B1YA 5IZ4A 3JQ8B 1YB1A 4MVJD 1E5QA 3I52A 1YGYA 2V6GA 1ZCJA 1DFIA 5A1TA 1UH5A 4FS3A 4BKPA 4OOFA 3A28A 1QR6A 3D4NA 2CZCA 5B4UA 4OMUA 4IJWA 2PK3A 2BMAA 3FWNA 2DTXA 2JCXA 1P1KA 3I9LA 3IOYA 3ONEA 2OORA 2Y1FA 1YOVB 4NI5A 3R3SA 3ZWAA 1GCOA 4OYRA 2DKNA 4IMRA 3PYXA 4XA8A 4CMJA 2RHRA 3L6OO 4N5LA 5CDSA 1JKJA 3DXFA 1EQUA 1HDRA 4BGVA 3RFXA 2AQKA 4BNIA 3W8FA 4ROSA 1E6WA 3GOHA 4CM6A 1PJ2A 4TRNA 5KVSA 1M76A 1C1DA 2EKPA 3DZFA 2VRBA 3ITKA 4DWVA 1KC3A 1EE9A 1XELA 5U1PA 2Y0EA 4PGFA 3KUXA 1AXGA 4KDEA 1CEQA 2B69A 3RFTA 2PH5A 3EW7A 2EG9A 2DTEA 3JQ9A 2D8AA 4LRTB 4MKXA 4ALKA 3R3JA 1T2EA 2CD9A 4XYBA 1LA2A 3DAFA 5GY7A 3RBVA 4AJ2A 1NVGA 5H82A 1JU9A 2HKIA 3A14A 2A9FA 4L8VA 4QT0A 2WYWA 3WTBA 3GZ4A 4R1NA 2I6TA 3VZPA 5KJEA 1DAPA 1HF3A 5LDGA 3H9UA 3UXYA 3PHIA 1BDMA 5KWEA 3PVZA 3B20A 2GUGA 4ZQEA 2CNBA 3GVIA 3PWSA 4B4WA 1EDOA 1E3WB 4PG5A 4NK4A 3A06A 1XQ6A 1P0CA 3PYMA 4KMSA 3VH1A 1R16A 3BTUA 1UP4A 4GVLA 5U9CA 1HYGA 9LDTA 1U3VA 4QQRA 3M2PA 4YT2A 2WJPA 3PIDA 4UUPA 3VHRA 1W8DA 3EZLA 3ZWWA 5AXBA 3AM4A 3X2EA 4JCOA 1EDZA 2PGLA 4HV4A 1KVUA 5T8KA 5MGBA 3EAGA 4IPTA 5T6BA 4BO6A 3GFGA 1H6CA 3ENKA 2Z1NA 2DU8A 3LC1O 1X7DA 3G17A 5EN4A 3JYOA 1Z6ZA 4YJDA 4P4NA 2YQ4A 4MKZA 4YJGB 4D3SA 1H2HA 3K2EA 4IXWA 4E4YA 3L9XA 3DBHB 5JFOA 4EJMA 1PR9A 4E5KA 3CTMA 1NHWA 2FSVA 4ZVVA 3BTSA 1PJLA 4CQMB 1YDWA 1P1HA 2RHCA 2I67A 3B1JA 5A06A 4LK3A 4CV2A 1FDWA 4A7PA 1HZZA 1R6DA 4I9UA 3ROQA 1VPDA 1ZEJA 4OSOA 3DEYX 3ZU2A 4CLEA 2V6FA 3DMTC 3KYCA 1QV6A 4JIGA 3ROPA 3QVSA 4E33A 4OSPA 2PH3A 1WW8A 3A9WA 3KSDO 4OXNA 2WEKA 4FGWA 4B8ZA 3R1IA 3H5RA 5L7YA 1Y1PA 4FC7A 3RCBA 3TZCA 3VZSA 4A27A 4XJSA 1YB4A 3X2FA 1I0ZA 4CMBA 1GAEO 4WJZA 3CPSA 2P4HX 4WLUA 3QWHA 2X5KO 2VHXA 3GH3A 2ZQYA 4YQZA 3JQAB 1I3NA 1I2BA 1FMCA 1B8PA 5IZCA 1IULA 1UAYA 1YL7A 3JYQA 2ZYDA 4UAGA 1A4IA 5EJ2A 2Y0DA 3ASVA 4BS9A 2E48A 2OOSA 4UUMA 3GRKA 4L75A 5A5FA 1NNUA 4R16A 1E3JA 5G2OA 2EWMA 4XRRA 2E37A 1QLJA 1SO8A 1X1EA 3GRPA 3AW9A 4Y6RA 3V1YA 2DFVA 3ZN2A 5AXCA 3QRWA 1T1SA 3JD1A 5U4QA 3BYZA 2IZZA 2VWHA 4Z3KA 1A4UA 1BMDA 5KJFA 3TL3A 2ZTVA 4EJ0A 2H9IA 2VNSA 3MJ4A 4RZIA 4AJHA 3LT1A 1HLPA 2WWRA 1RJWA 4WEOA 3CUKA 4DPLA 5JDIA 2IZ0A 1GV0A 5JCXA 4M54A 4OAQA 3RI3A 2X9VA 5EESA 4BQPA 4W7HA 4CM7A 5TC4A 1JAXA 1P0FA 4JGBA 4Q3BA 4CM8B 5IFLA 2B5VA 1AGNA 3A1NA 1GUZA 5FWNA 3NTRA 2YUTA 2C5EA 3GNQA 3JD0A 3IL2A 2AXQA 4ZJUA 2CDBA 3ICCA 2V7PA 3QVTA 1LDGA 2E49A 4E2XA 4XQEA 3ZNNA 4DPKA 3IQDB 4GL4A 3CKYA 5A05A 2NTVA 2VRCD 2X4GA 4TWRA 3ZV4A 2BH9A 4K26A 1LTHR 4UUOA 4JLWA 4YAIA 4BV9A 3UHAA 3D4OA 1KOLA 5JAIA 4LW8A 2RH8A 2PV7A 2AQHA 1K2WA 1E1KA 2SCUA 1VSUA 5AQ1A 4J1NA 2PD4A 4J2OA 3WJAA 1DO8A 4OXKA 3WTCA 2EIHA 2W2LD 3TFOA 3WGTA 1F8GA 3I5MA 2RCYA 4HFJA 4MP6A 4WPGA 5G0VA 4E5MA 5A9SA 2H63A 1A7KA 4JP3A 4GGPA 4U0JA 1WXDA 4W9NC 2NACA 1IL0A 3JQGA 4CLDA 1B2LA 2O2SA 4HADA 5THKA 5DF1A 1A7AA 1OFGA 1GYPA 1KY4A 1WDLA 4XJTA 4R68A 1BXKA 4QFCA 3TJRA 4DTIA 1PIWA 4GX5A 2X9GA 3KLPX 2Y93A 1QKIA 1C1XA 2FWMX 4ALMA 1P77A 3QA9A 3UICA 1QMGA 3WGGA 1UR5A 3MOIA 1LSUA 2VUUA 1QV7A 3W8EA 1Q0HA 1NFQA 3GY0A 4RVUA 5KNLA 3JQ6A 2BFMA 1PR3A 1IOLA 2IRWA 5G4LA 1F17A 4HWKA 5TX7A 3WG9A 2B37A 4CQMD 4JJIA 4CLHA 3AWDA 4I5DA 1JQBA 2YHIA 1P1FA 2ZYAA 1GU7A 1NWHA 1HYHA 3ZU5A 2DUWA 4NU5A 3BIOA 5AXAA 1O94A 1XG5A 1R4NB 2FP4A 4U6SA 2PA3A 3PRJA 3DO5A 1IUKA 3CEAA 1H5QA 1UXIA 5B4TA 2VOJA 3DQPA 1F14A 1LUAA 4CQLB 3WQQA 2WDZA 1E3EA 1MXHA 4MKRA 3EYWA 5BNFA 4BNLA 1V3VA 2Q49A 2HK8A 2QRKA 1ZK4A 5F21A 3JQAD 3ZHBA 1WZEA 2NVUA 3UAGA 1OBFO 3INRA 3LF1A 5AYVA 3PXXA 3SXPA 1PGJA 2R6JA 1TEHA 1DRWA 2O3SA 2V6BA 2PFGA 4BGEA 1Y5MA 3H9GA 3OEYA 5KJ1A 4WLOA 1AE1A 2VWPA 2WD7B 4OQYA 2P2SA 5F3RA 3TZ6A 3IKTA 4QECA 5KJ6A 3S2FA 2X0JA 4R5MA 2YW9A 3BMCB 2GASA 4BNYA 3NRCA 5COAA 3SC4A 1ZNQO 1P1IA 2VTEA 1CYDA 3KVOA 4H7PA 4B3IA 1ARZA 4F45A 2VYNA 3RUIA 3DAGA 1WMAA 1Z82A 3IDSA 4N18A 1EUZA 1WZIA 4AG3A 1Q0QA 3RUHA 5JXWA 1XCBA 1QRRA 3OETA 3RQSA 1E1LA 3BTOA 1VL8A 4M86A 5L95A 4RGBA 4CMEC 5JO9A 5CG1A 1D4FA 4BMVA 1YE3A 1U4OA 4CJXA 4IS3A 1WLYA 2Z95A 1L7EA 4FOOA 1ZFNA 3ITDA 2OXIA 4J0FA 1EK6A 2Y0CA 4RDHA 4GWGA 1O95A 1Q2XA 4A0SA 3PHJA 4NK5A 4H15A 4JBHA 3GG9A 4LISA 3WJ7A 3CMCO 3T4EA 2C82A 4NZ9A 4O63O 4RF2A 2Y1GA 1X7GA 1PJ3A 4RJTA 4F6LA 3JQCA 1CJCA 5IN4A 4QX6A 3WGHA 2NQTA 3JCZA 1NR1A 1H6DA 1NR7A 2YFQA 4YQYA 4BO1A 3H2ZA 1C14A 1RM0A 2DTDA 4R41A 4RVDA 1DXYA 2VYVD 4RQUA 2P91A 1LU9A 4R51A 4DIBA 3MWEB 1Z45A 2YQ5A 4CLRB 4YACA 5JCJA 5LDHA 1Y8QB 4GWKA 1B16A 1HZJA 4EJ6A 1ZXBA 4F6CA 1IHYA 3U4DA 3RC1A 2UUPA 5CG2A 2CMDA 4R1SA 5A3JA 4BO0A 1DIRA 1XU9A 1M6WA 3MJCA 4IQ8A 4PLZA 2VT2A 2B4QA 4DLLA 4IDBA 3ONDA 1E3SA 3PGJA 3NDIA 5DP2A 1X0XA 2GN4A 2X7HA 1U2GA 3QWIA 4JN6B 4AJEA 4LSWA 5EQFA 2GPTA 2H1SA 1YKFA 4ITUA 3ADOA 2WD8A 1LNQA 3OJFA 4GLOA 4B7CA 4AJLA 2ZTMA 1DB3A 1UZLA 2ZIZA 4NFHA 1DLIA 4FFRA 1Y9EA 2R00C 1HSOA 2BLLA 2BELA 2CDCA 2DT5A 4CR8A 3AI3A 4IGEA 5IAAA 3GN1A 5TQVA 4ZRNA 1V9LA 3VPFA 1DC5A 3IIEA 1XKQA 5ER9A 2RIRA 3BMNB 5ADHA 4RF5A 5JNLA 3FPLA 3EUWA 3TOZA 4CM9D 1YL6A 3E9QA 3JQBC 1DFGA 2J3IA 3G49A 3NUGA 2I3GA 5AXDA 5K0ZA 1LX6A 2VYND 3DZHA 3ZWBA 5EERA 2ZJ0A 1U7HA 4M55A 4XR9A 4AJJA 3NT2A 3WB9A 1YJQA 2EGGA 3FSRA 5DCYA 3ZGYA 3OQ1A 5ITVA 1JAYA 2CF6A 2P9EA 1SBYA 2GD1O 3BMNA 3ETDA 5B12A 4XZ3A 5T5QA 1IZ9A 1BTOA 4QO8A 6LDHA 4BB5A 4MOWA 2X86A 1AUPA 2Y1EA 3RU9A 3GPIA 4PG7A 1ONPA 2FN7A 2NVBA 3U3XA 4DYDA 2GN9A 1LLQA 1LDEA 2OUIA 3QSGA 2CF5A 3TPCA 3ANMA 4YJHB 4YAKA 4PZCA 4IINA 3IS3A 4R4JA 2XXBA 1T25A 2VQ3A 3LT4A 1GTMA 4UVIA 2B4TO 1JN0A 4ZD6A 1GUFA 2B83A 2DQ4A 4LCJA 5JYEA 1DFHA 4YR9A 4J0EA 1MUUA 1HXHA 3PHLA 4D0SA 4BKRA 3FPCA 1RWBA 5C7OO 1H6BA 3GFBA 3HDJA 1TB4A 3I9MA 3RAJA 1K0UA 1HKUA 2QIOA 1E0DA 4XIJA 1AXEA 4QSMA 2X5OA 3F1KA 2RH4A 3FHLA 2EXXA 3GZNB 1J6UA 1DDOA 3ANLA 3RD5A 4YJHA 2QW8A 1EVJA 3DZGA 3F3SA 1HE5A 1V35A 2ET6A 4FOSA 4J6FA 4EDFA 2C7GA 2O4UX 3V1TC 3OIDA 5G0UA 2GCGA 1YL5A 3DZBA 5JMPA 3OJEA 4KDFA 4XR4A 3IKVA 3PJEA 3NEPX 2FR1A 5I7SA 4Z9FA 4BNHA 2UVDA 1HE4A 3ON5A 5IN5A 3U4IA 1TA4A 3I23A 3VVCA 4KQXA 5THQA 3ZV5A 3C8MA 2WSBA 2PKRA 1OC2A 2EV9A 3BMOA 5C7IO 1EFKA 1F12A 1W6UA 3PJDA 2D5CA 1H2BA 5HBRA 4W82A 1UAGA 3O8QB 1WPQA 3H3JA 4LVUA 5I9MA 1BXGA 3HG7A 1I33A 2D4AA 5DZSA 4E30A 4HXYA 3HDQA 5CEFA 3QVXA 1DHRA 3V1UA 4FDAA 5TF4A 1HDZA 4WUVA 4I5EA 2R2GA 4AJKA 1YXMA 3JD2A 4L9RA 4WNCA 2EKQA 1LLCA 3GAFA 4PG6A 4R3WA 4R54A 3V5NA 4F3YA 3V8BA 5L7WA 2CY0A 1UXJA 3GDGA 2LDXA 3IJPA 1IY8A 1GADO 2C7VA 1ZVMA 5JY6A 1LSJA 3I4FA 1LRKA 3H3FA 3SLGA 1GZ3A 2FSSA 2G5CA 3QJ5A 5DDIP 3ZWYA 3NAQA 3OICA 2X58A 4R5HA 1DSSG 3RBZA 2ZQZA 3RUCA 5I7VA 3C85A 5G0TA 3N58A 1OI7A 2I3AA 4CLOA 2X0IA 5DCUA 4JJFA 4BNNA 1LLUA 3TFQA 1QYXA 4YTEA 3DHNA 4BMNA 5EIOA 1VJ0A 1DLJA 2IEDA 1I24A 1ID1A 2W2KB 3JQ9C 1NAIA 3H8VA 4FPXA 4BO9A 7ADHA 1F06A 5L4NA 5I9LA 4YAGA 4YT8A 4CM1A 4MO2A 4PN3A 2ZJ1A 4IUYA 3C7AA 1PS8A 3VKVA 3H65A 1H6AA 2DBRA 1NAHA 4L0QA 4NG5A 1MC5A 4NBWA 2Q4EA 4KUGA 1LDBA 6ADHA 1LDYA 3WGOA 2BI8A 4PLYA 1JVBA 1U9JA 3CH6A 5JYDA 3UVEA 5KKCA 5KCZA 2OZPA 4ZRMA 2W2KA 3I3OA 1NQOA 3QWFA 4NFYA 3RC2A 1NM5A 3AY7A 3JQDA 2XPCA 4PVCA 1FDSA 1C1DB 2VHZA 3S55A 1LC0A 1G0NA 3H6KA 4CV3A 4PLVA 1R15A 4K28A 4RF4A 4IDDA 5T8KC 1ENYA 2H5LA 4KP7A 1GCUA 2PWZA 2HCTA 2O3RA 3RU7A 3TZQA 2QRLA 4RV9A 4J7UA 1KBZA 3K31A 3QY9A 4J49A 2BI7A 4CM4A 3BHMA 2P5UA 1WAMA 3K73O 1NXQA 4ZQGA 1PJSA 3KB6A 4PLFA 2VHWA 4N54A 1LRLA 3KETA 3AI1A 2WE8A 3DONA 1DIBA 3FF4A 5C7LO 1SPXA 4D44A 4BIIA 2DPGA 4RVFA 1EZ4A 1A9YA 2FR0A 2YJZA 4I1IA 4CUJA 1WDKA 2OL4A 2YDXA 3MCVA 3GG2A 1ZBQA 4B79A 5LC1A 1NTOA 1I3MA 5ES3A 1JTVA 1B8VA 4Q3EA 1E1MA 3I4CA 2PZJA 1LBEA 1LC3A 4LMRA 3AY6A 3TDKA 1UUFA 4KUEA 2OP1A 4YXFA 2QQ5A 5FI5A 3W4KA 1W0CA 1EFLA 1NPYA 1V3UA 2JHGA 2I5PO 5JBIA 4DYVA 4R69A 4M87A 3FR7A 1T2FA 4GQAA 3WLEA 3WYBA 5JAMA 3QIVA 4NHEA 4DBVO 1HE3A 1Y8RA 1GV1A 2VN8A 5IZCC 3ENNA 4OIMA 3ETEA 3N74A 4DQXA 4DIFA 2ZB4A 1U4SA 2IEBA 2Y99A 4FFLA 2E82A 3EVNA 1JKIA 3L4SO 2P9CA 3KO8A 3L4BA 3VTFA 4I9NA 2EW8A 2P9GA 4YT4A 3NTOA 1GPJA 1CRWG 4KWHA 4P4LA 3QQPA 4E21A 1I8TA 2A4KA 3QWAA 1JWBB 3G79A 3DFUA 3KYCB 2G1UA 4BNXA 1I2ZA 4J4HA 3C7DB 1KVRA 2C59A 4MINA 2I99A 1HDCA 1GY8A 1PU2A 3BAZA 3CE6A 1TLTA 4GKBA 1BSVA 4Q3AA 3MZ0A 4BHTA 2JD2A 1P74A 2JCYA 1PQWA 3OA0A 3UGKA 3W6UA 3O9ZA 5JDIC 4NDNE 2AQIA 3GGGA 1Q1NA 4UUNA 1N92A 3JV7A 3Q2KA 1CQIA 4BO3A 3LYLA 3D5TA 5DULA 3UCXA 1NPDA 2AG5A 4Z0HO 2NWQA 2OMEA 2X22A 1P31A 5ENDA 1LQUA 1QXSA 1GQYA 1V3TA 2RBEA 2AE2A 2P5YA 2EF1A 2HLPA 2GF2A 3VTZA 5CPFA 3ZW8A 3ICPA 1AN9A 1BW9B 5KKAA 3F4LA 4UREA 3UH1A 2NM0A 1UXGA 1FDVA 5CEEA 4GPD1 1BWSA 5COQA 1MLDA 1EVZA 1XWFA 1CQJA 3TL2A 3KSUA 1DC4A 4BNMA 3H9JA 3EMKA 1F0YA 1NP3A 1ZSVA 3GUCA 4XKJA 1Y6JA 1ONNA 2X23A 4YAEA 2HK7A 2JCVA 1O89A 4KOAA 3STHA 3KYDA 4ZGWA 1U1IA 4NIMA 2VZ8A 2GR9A 1C0IA 3GAZA 3PLRA 1BW9A 1DPGA 1YBVA 2HUNA 3P2OA 1WMBA 2J6IA 3PZRA 3QE3A 2Y1OA 1JKFA 4IJUA 5BNIA 1P33A 4YAJA 2FZWA 3GVPA 4QXMA 5DCWA 1TT7A 4BGIA 1PZGA 3AFMA 3RUAA 2GZ2A 4HNHA 1PJCA 3GEMA 1MFPA 3LK7A 4YYZA 4KTVE 1P9LA 3ZU3A 1O6ZA 5CDYA 3PPIA 1WVGA 4EBFA 3EHEA 1PJQA 3FTPA 2Q99A 1D1SA 2BRUA 3QW2A 1LEHA 5KOIA 3ASUA 4J9UE 1P45A 1H94A 2QYTA 3CZMA 3F1LA 3PDJA 4XEHA 3VH4A 4YRDA 2PR2A 1X0VA 1KVTA 5KVCA 3PHGA 1R0SA 1EBFA 1XDWA 3MEQA 5H83A 3MTGA 1UP7A 4J90A 5G0SA 3DOCA 3ADPA 3ZWVA 5A9SB 3AM5A 2IYPA 4TZKA 1DJQA 3M1LA 4KQWA 4U5QA 2NUAA 3F9IA 2C0CA 1EBUA 3JQGB 4M49A 1KETA 4YA6A 3EC7A 1P44A 3WQRA 3TSCA 4IJKA 4A5OA 1N2SA 2AW5A 2F1KA 4IDCA 3WX0A 1PZFA 2D59A 1C1XB 3PQEA 2XXJA 4GGOA 3WGIA 4ZQBA 4YRBA 2BGKA 3JQ7A 4PZDA 3PDUA 4PLPA 4FW8A 3GVCA 1DAOA 1TXGA 4J91A 1N1GA 4J3FA 3CINA 4IDAA 1LI4A 3HJAA 4II2A 2O23A 2Q1TA 1JWAB 1PX0A 2PZLA 5A02A 2CVZA 1SB8A 3GEDA 4XIYA 2O3UA 1VL6A 2X9NA 3Q11A 2YHIB 3NDJA 3IMFA 5JLAA 4NNJA 5TRTA 1NVTA 4RDIA 3EZYA 3PI7A 3G1TA 5JAZA 1BG6A 1HEUA 4CUKA 2NSDA 3FNEA 5A9TA 1ZJZA 1IPEA 1XEAA 3JQEA 2FY8A 3IUPA 3E03A 3F4BA 2BGLA 4KTTE 4OXYA 1T2CA 2ZKLA 3E9MA 1Q0LA 4R9RA 3VC7A 3NTQA 4CMCA 4D3FA 3H4VA 4G81A 3Q9UA 4B3JA 4DXHA 1R0KA 3Q6IA 4U6QA 3M1AA 4WECA 4JJGA 5KVVA 3C1OA 3V2UA 2NVUB 4IS2A 2P4QA 3LSYA 4Z9XA 3RC7A 1ZXLA 4DVJA 3OMLA 1PJ4A 3C24A 3GNTA 3HDYA 4DQUA 1PQUA 4AICA 4OQZA 1QORA 1TT5A 3FTNA 4GH5A 4XB1A 3SBOA 2LDBA 4IGFA 3AM3A 5ILGA 1CIVA 2ZYGA 4M8SA 5TGDA 3O03A 4RPJA 1GZ6A 3GUYA 2VWGA 2NU8A 5TJHA 3ORFA 3QP9A 5DBIA 2WM3A 2C29D 4GX1A 1HE2A 4HX5A 4IDEA 3FBTA 2OBNA 4CMKA 4I5FA 4CR7A 3OH8A 4R1TA 4IBOA 4IDGA 3SVTA 4J7XA 1X1TA 5EL0A 3ETGA 2AA3A 5G0WA 4FFPA 1B26A 1PGNA 5C5IA 1J4AA 2EW2A 3A4VA 4LN1A 4TKLA 5CFZA 1NX6A 3G0OA 4W7IA 4X54A 3RIHA 1KERA 1D1TA 2NQ8A 3LVFO 4L4RA 4CR6A 5J23A 4B7XA 3I1JA 1Q7BA 1Q7CA 1HSZA 2E6UX 3DBLA 5BSEA 5A03A 4CODB 4UEOA 4BMSA 3JYNA 1XU7A 4E5YA 4ESOA 3U09A 5EQDA 4INAA 3PFWO 2HMVA 3DMYA 3RKUA 5HA5A 3OF2A 4BQRA 2TMDA 3G1UA 3PQDA 3FNGA 3QWBA 3W4JA 2XAAA 1MC4A 1HDYA 2UV8A 5KJCA 5DT9A 1XSEA 5JC8A 2PD3A 2D3TA 3O26A 3AU8A 4HBGA 5CDTA 5F5NA 3OHSX 3EVTA 4E0BA 4M89A 2GERA 1XR3A 1T4DA 1XIVA 4DBZA 4MP8A 1E7QA 1NBOA 5JY1A 5CHEA 1UP6A 2J3KA 4CMIA 1ISHA 1RM5A 5IDQA 1VM6A 3ZW9A 2BD0A 1S6YA 3EGOA 4AJIA 2CUKA 1Y9AA 3K8ZA 5I9NA 4IXTA 4J2HA 2YZ7A 2DC1A 1ZW1A 3DL2A 4W99A 1A72A 2Z5LA 3DTYA 4URFA 3WWZA 4EI2A 3BXXA 4MVJE 3C7CB 5JSFA 3GN2A 4NH4A 1CF2O 4MIYA 4NJOA 3RROA 5L53A 1MV8A 2O3JA 5KVQA 3QVWA 3VAZA 2X6TA 3U4CA 3OQBA 3AK4A 3QLJA 3MJEA 5AOVA 4FJ0A 1HDXA 2E4AA 2NU7A 1KYQA 4Y8VA 4RZHA 3WR5A 1HT0A 3KYBA 3E5RA 5DBFA 5K6AA 1QP8A 1K5HA 1LDNA 3RSHA 3E8XA 2D2IA 3IP1A 4IMPA 3NYWA 3AUAA 2HO5A 4Y6PA 4AJ4A 3DZKA 4MDHA 5A4DA 1E7SA 2JJYA 1ISGA 1DC6A 3NJ8A 4Z3DA 4Z6KA 1BVUA 4P8RA 1Z7BA 4DMMA 4EW6A 4RVSA 4UEKA 2O2YA 3PYLA 4XGIA 2IODA 3UUWA 1WDMA 1N7HA 4A10A 1EK5A 4N5NA 2AMFA 4DLAA 1EVIA 3GHYA 4CMHA 5ICSA 1UXKA 4XDYA 2UAGA 4L4SA 1M66A 5FYDA 2NLOA 2HAEA 1CERA 3WIDA 4I08A 3D3EA 4JXKA 1VLLA 2GZ3A 3ZHZA 1H9BA 1X7HA 3F47A 3QVOA 2EP7A 2FOIA 1NHGA 3GMDA 4CL3A 4HKTA 1KVSA 1I30A 3E5MA 4RL6A 5G4KB 1ISMA 2Q2VA 3S2IA 1E92A 3JQFA 3IUSA 5L51A 2WYUA 1HDGO 2JD0A 1JDJA 5TIIA 2GN6A 1K3TA 1PQPA 3DR3A 4NBTA 1UZMA 2ZATA 3TRIA 4PLCA 4FD3A 4NBVA 4YB8A 5L3ZA 3H2SA 4BB6A 4ILKA 4JNKA 3SX2A 3WBBA 4N5MA 1SMKA 3ZWCA 3TOXA 4LVCA 1RKXA 3BHJA 2Q2QA 5I7EA 5G4KA 3U9LA 2DAPA 4E5PA 3DC2A 3PLNA 1DOHA 1JLLA 3VZRA 2Y68A 2UYYA 4ZHSA 2IDZA 3COSA 1HETA 4XYEA 5T57A 1TVEA 1SB9A 1DRUA 3GVXA 3VPXA 3K6JA 1FDUA 3T7CA 3RWBA 1SOVA 3F5SA 5CEJA 1CETA 4LRSB 1ZK1A 1VL0A 2VT3A 5B37A 4J43A 5TSDA 3RKRA 4EYEA 1SCUA 4BKOA 3JD3A 4MPDA 1BXZA 3JSAA 2QZ9A 2ZTLA 4DMLA 3PWKA 3ULKA 2I65A 4AJ1A 5JW6A 3ZWOA
chains in the Genus database with same CATH superfamily
1SCJA 3H17A 5JECA 2WVAA 3MJHA 3DLHA 4MS4A 1X8LA 5C8YB 3H5IA 2PX6A 3MK31 2J5RA 1XFAA 1PEYA 2ZCVA 2GPYA 5IJ9B 3QOFA 3CLTC 1R4MA 3KOYA 4A8JC 3G68A 1QSGA 1HWYA 1DIGA 3AFOA 3F8TA 1T3HA 2BW0A 1KS9A 3FGNA 2G7ZA 1CE8B 4IW3B 4YP9A 4BO4A 5BV1A 3THXA 1SAYA 4YLGA 3GEBA 1PV2A 3HR4A 3KR9A 5D5HA 2O48X 2AV6A 4KYVA 4B3GA 5G1PA 4LXYA 5FI0B 1BXGB 4TXNA 2JL1A 4PYIA 2EBHX 5IK2A 1EDBA 4UBJA 1JVSA 2P9FA 4MVJA 3SNKA 4KITB 5JCJD 2LP4Y 5F5LA 1YR1A 5BSTA 4XYLA 1VDZA 1X9HA 4KXFB 4YJFB 3A1VA 2LPMA 1IUOA 4N4AA 4QTZA 4RJKA 5TXGA 5DVZA 5BN4A 2NXEA 5L40A 2V0CA 1YNSA 4G85A 1RYBA 3FTCA 2JIMA 2YHBA 5CRIA 4GT1A 1E2JA 1YVUA 2V7EA 3HCAA 1EB9A 3OUUA 5DGTA 1TVKB 2NIPA 3PKIA 3SVZA 4MVJM 1E9DA 1C0EA 1E64A 2R00A 3H75A 1OT3A 1J2YA 4HY3A 1UFVA 5EINA 1DOAA 1L5LA 4P3XA 4JLPA 2PE5A 3FDIA 4IZOA 5TLSA 4JT9A 4MRMA 2GO1A 3R6WA 1NI3A 1SEPA 4ICIA 2Z6VA 5BOSA 3C39A 3H5TA 1DV1A 2HA6A 1IPHA 3IPXA 4LJ6A 1ENZA 4BP9A 4RORA 2LCFA 5FF9A 1VKOA 2JAHA 2VJQA 4ZPJA 3Q8MA 4MLPA 5E7JA 2X8LA 4BX0A 1NMEA 3FJYA 3QBTA 4EL0A 1E5VA 2Y1XA 4JROA 2BZ1A 4C4OA 4EX7A 3M6LA 5EXPA 4GS5A 1VFPA 3KL4A 1X15A 4CT0A 1NXWA 1F6DA 2Q2WA 2ZU0C 3K0FB 4D4GA 3MPUA 3FUUA 2ZBRA 5DTQA 4Z2YA 3FOCA 3U17A 4DA0A 2A1UA 4F11A 1FXSA 2O20A 1IPFA 3V9PA 5F1OA 2ZU6A 2J3HA 4E32A 4QOFA 1LQ2A 4CRWB 2J1LA 2XNCA 4PLGA 4YEDA 2JFHA 2EF0A 1EVQA 4NCKA 3P9ZA 2QQGA 2QVCA 1M6VA 2GRAA 1NNEA 5DOZA 1XPJA 3O38A 4DLKA 2ZRFA 3OZCA 5ADUS 2A59A 1NXXA 3ZHOA 3FA2A 3LM8A 2NO5A 1WF6A 3EUAA 4W1SA 1NVVQ 3FHJA 5F3DA 4EGFA 1BWRA 1JFRA 2Q46A 4MIEA 5KC8A 1QZZA 1I5RA 2PG3A 2GSDA 4Y6QA 4B45A 1ND5A 1A7UA 3W9YA 4IQ0A 5TF0A 2F4NA 5FUQA 1UAAA 2VUTA 2XZLA 1XTSA 5IDWA 4J03A 3HWSA 4ETIA 1E32A 3PTZA 1HLDA 4NJMA 3U0BA 3I2HA 2P68A 2PRSA 4KQJA 1T3LA 4OL9A 1ZJWA 2VF8A 5ISMA 1N2ZA 1E62A 2NV2B 1ST3A 1U3UA 4ZI2A 1JVNA 4S2EA 1S7CA 3PR1A 3SK0A 2PUHA 3OT5A 2HB6A 2VQEB 1ULHA 1YAHA 4HFNA 2IS1A 2BHTA 4X62B 4EYQA 2A78A 1E4EA 2H92A 1XEWY 2HLHA 3GC6A 3PSAA 3L1JA 4FIZA 4HSGA 2NT4A 4TLAA 5CYOA 1G59A 2AE1A 4OPMA 3F6BX 1H5NA 4UBMA 4R71A 1CB0A 3QVLA 4JBIA 2TMGA 3GRVA 2VK2A 3CH5A 2XCOA 1YCHA 2OC4A 3CZAA 1M2WA 4K46A 3E18A 5HEKA 4F4UA 1BCSB 2KB0A 3CF2A 3KJFA 5DNCA 3RBXA 5JFGA 2VDKB 3ZG6A 4DCJA 4KQKA 3X3HA 4JXZA 3GPBA 4DWOA 1U04A 3CXRA 4AULA 3TJZA 3GYBA 2ZBUA 2CLLB 3RUDA 4ALLA 2VSQA 2HJSA 2M9MA 5BN5A 1O57A 3HI4A 3DJFA 3KTAA 4Y2XA 2NW6A 1BA2A 2IF0A 2WIDA 1V2GA 4DG5A 5DLQC 1NATA 3IPAA 1G21A 1R0XA 3W8NA 4TUYF 3GUVA 4BLPA 4EUFA 3TQHA 3J7AC 1QE0A 4Z7QB 1JP7A 4OXIA 2NU9A 2DKFA 4L6IA 5HILA 4N0MA 5FUMA 2BIFA 2VPWA 2ZI5A 3HY4A 3DPIA 3NW9A 1RVV1 1W8IA 3PFFA 5LA6A 1ZW6A 4KE7A 4ITRC 4DBLE 5EE0A 1C8VB 4PPNA 2I80A 3GVHA 3NC0C 1VB5A 1COWD 1JS1X 3D1VA 3FWZA 6ABPA 5ED4A 4OQLA 4X3PA 3PPYA 1LI5A 3V80A 4MA4A 3JQ8A 1VGRA 4MVJG 4Q3KA 4J1QA 4F1KA 4F5WA 1KNXA 4QJBA 3R6LA 1Y8RB 2G06A 1P5HA 3I9V6 2E5WA 1VG0B 3KYJB 4PRKA 5CVCA 1UZNA 1K2VN 3K6SB 1KDVA 1SHKA 5K8CA 4OFWA 2PUAA 2C42A 2ODPA 2PY6A 3RV3A 3LYHA 3I09A 3DR5A 3WJ1A 1TO6A 1XA4A 2FEPA 2EFGA 1I2CA 4YFVA 1GZ4A 4MWCA 2E5FA 1RTKA 1Z29A 3UJ8A 4IQFA 1TE2A 2FWPA 4PG4A 5KINB 1A9ZA 5DM70 4X84A 1AU9A 4CQJA 1Z73A 1KEWA 3QU9A 4B85A 1I3CA 4BRZA 1OCEA 2RIPA 4NAVA 1TZCA 4MWTA 4JUDX 2PQ6A 3KEGA 2FJPA 1R66A 4NPCA 1KF0A 1O6GA 2OBLA 4RA9B 1J0BA 1EE1A 4UVDA 3DM5A 4GKAA 4U1RA 1NQUA 4M1QA 3ZY4A 1MGOA 3FRIA 1YH3A 4DWWA 2AZTA 2QL7A 1UBSB 3HE3A 1BGXT 1D7OA 1USGA 3NUQA 2IHVA 1SUAA 3LHKA 5BURA 1JI0A 4WKGA 2E2WA 3CCBA 4QOEA 4TVOA 2XQFA 3AO0B 4HGNA 5TV2A 3BFXA 2WMDA 5A04A 4JX9A 2OBYA 1PQ4A 2F1OA 2YJ3A 1Z5NA 3MIZA 3PNMA 1SOWA 3CPJB 3QHAA 4ISCA 2IHNA 3AKDA 3BMQB 4MV5A 4QEKA 1BS2A 2Z9DA 1GM5A 4DJTA 2JLRA 3GGOA 1KDZA 2ZB8A 3PGVA 5GWXA 1KR2A 5KOYA 3GQVA 3KFLA 1BD4A 3T34A 2BVNA 4GEGA 2RARA 5HRUA 3FFAA 4CF7A 4YUXA 1FU7A 1CUWA 3CVOA 4P3KA 1MP0A 3HB5X 4LOLA 2CEAA 5B3LA 1TMGE 1T4GA 1ESCA 3LY5A 4WXPA 4AMYA 2OWEA 3I9OA 1ECPA 2GJ9A 4GOJA 1SIOA 2A88A 2GJKA 2HMUA 1OLSB 1UINA 4UHJA 1LBTA 3L1UA 1YUMA 5AHXA 3VHLB 4F2PA 5AW6A 1XN1A 3M9WA 3WNQA 4Y67A 4CG3A 4KDRA 1JR3D 4MLZA 1XO1A 1UMDB 3GPDG 3L0SA 3THYB 2PBRA 3W6PA 4HOYA 4CKWB 4UXIA 4UHKA 4ZC1A 3TQSA 1E3WA 4B4UA 2MMCA 4HDQB 2Q1WA 1HG0A 1Y37A 2GH1A 2C1ZA 2IYAA 5EPUA 1NPTO 2OV1A 1ISFA 3VDRA 3UFXB 2Q3BA 5LOVF 4EL5A 2A35A 3S68A 4O1MA 3CCFA 4P3PA 5ALDA 1GQ2A 1TM5E 1IZ7A 3FDXA 4H7KA 1IXSB 1VGQA 4ZTUB 4RXMA 5B7GA 3SBEA 1BE0A 3PWTA 1SQ5A 1NSTA 2XXAB 2G04A 1X87A 4P5EA 4N5IX 1CTQA 3EY9A 3QW4B 2C2YA 1URPA 4I5GA 4GZ3A 4Q5IA 3G2OA 2FRVA 1OW3B 3TE6A 3K1AA 4DLUA 3HUFA 1XEWX 2I78A 2RAFA 3B9QA 3VMFA 3BGSA 3VNRA 4EITA 3KSAC 5AW3A 3B8HA 2PS9A 2R68A 4PEVA 3PEWA 1H1LA 2PT9A 3IERA 1TVCA 4Q7JB 4Z4CA 3A8TA 2OP0A 3NU1A 3SZUA 1VSTA 4PGHA 5I01A 3U7HB 1U0BB 5GONF 2OD9A 2RFLA 1FYWA 1LPAB 2PT5A 2ZRJA 4XSHA 3Q4GA 4ZTBA 3KB1A 4G37A 3DYIA 3QU5A 3P2JA 2ZR8A 1ZRSA 2WAYA 1FUUA 1JEEA 2V1XA 3PFBA 1QWSA 2FE4A 5LJIA 4BFUA 4O2LA 4OFZA 2WNSA 4KLNA 5KYWB 3HKCA 4KC0A 2BMVA 4F1JA 1PD0A 3BJRA 2ZR9A 3K72B 4YMIA 2BEUB 2JAPA 3DWGA 4L8FA 4C7OB 2HZBA 1CJTC 4X60A 2OAQ1 2AEJA 4TTIA 1ZOIA 4ER7A 1F8FA 4DRYA 3HWRA 3PWZA 5TARA 4WIAA 1W88B 2X0DA 4C0AC 3P5SA 1MHPA 4DT1B 4UOEA 3EZXA 2QK4A 1A69A 2WKRA 3OM9A 3ORYA 3VO8A 4ZYZA 4X90A 2FWIA 2FFRA 3NX4A 1H05A 1M2JA 1RRFA 4HGRA 4NU8X 4R8MA 1U5AA 2HXYA 2YWDA 1IJEA 2VZ9A 3PPXA 4WOJA 5GZ1A 3GBSA 2UYQA 1YT5A 1QHFA 2PS1A 4TKZA 1T5OA 1SNYA 4X6UA 4DM7A 5A3RA 2F1HA 3RABA 3LQYA 3QLVC 1AKUA 1EUQA 4RCVA 3AM1A 3OQIA 1GCAA 3WP0A 1CY2A 4NU6A 1WX1A 2YYSA 5I8ZA 5L3VA 3NV9A 1SH7A 2VLIA 3WYAA 1LQTA 1NQWA 4XRGA 2EFHB 4FEAA 4IGAA 3TLJA 3W34A 2HRZA 4B3BA 2AOWA 4NQRA 1CZNA 1Z13A 1U8YA 2FF5A 1SC6A 2I4NA 4EMTA 4XLLA 4G65A 2B9EA 4OMDA 2W2OA 1GSHA 2BT4A 1SULA 2Q3HA 3EMVA 3F78A 4GQBA 3TLZA 3U62A 3ZCPA 4KDCA 2ZCJA 3BOSA 4YP7A 2PXHA 3KPJA 3QKSB 5KUTA 4P38A 2WAMA 1U8EA 2ACEA 3TQOA 1S3SA 1VFNA 1PGOA 3K30A 4U2EA 3HY6A 1EK2A 4TN1A 5EHQA 1L1FA 4BNVA 4DL9A 2BGMA 2VR1A 3L4KA 4EEXA 2B1IA 2IIVA 4GC9A 2D0IA 3HKDB 2NYAA 4LDQA 5LQDA 4YCLA 1U7PA 5DYYA 1P4JA 1R9GA 3Q0EA 1G3RA 2W22A 4DCNA 2HEGA 3AJ8A 2C57A 4RXTA 4ILEA 2W4QA 3WB1A 2JLAA 1HT1E 3B6MA 1SHLA 1W4AA 3NDRA 4HVTA 4ZI5A 1QMPA 1U7OA 2WHPB 2BFAA 5FA8A 5DBHX 1U02A 4QQFA 2O2HA 5DP1A 5ILOA 1U0OC 4Y9UA 1Q74A 4M1KA 3T35A 1CEXA 1AUXA 2C07A 2CL0X 4PS1A 3DLPX 2RHMA 1M67A 2PXXA 1RYDA 1SUWA 2KBEA 1U28A 3UANA 4YJ3F 4BN5A 4E4RA 3EGXA 4RPLA 4FBGA 4JZYA 4CM5A 1KWGA 4D9FA 2XT6A 2YVUA 3QENA 1RYYA 2I76A 2ZBDA 5JPCA 3H7IA 3ORHA 5F76A 1N32B 4PLHA 3K8YA 1UK6A 4R98A 1TFRA 1O96B 4MUGA 3OQPA 4RAQA 4UFNA 1OXMA 3OCVA 1I2AA 3HJUA 1FNNA 4FMCB 1FYDA 3MG9A 4YMSA 1E2QA 4HRYA 3UOGA 4ZCRA 4E15A 3E0XA 3EIEA 4J4BA 2JGMA 4PX5A 4RD6A 3H9QA 1QCYA 2P67A 1KSJA 2JH9A 2KE5A 4EKDA 2WSMA 2Y05A 2MT9A 5JG7A 5H16A 4XGQA 4HQFA 1E5DA 3P26A 4QVGA 2FWJA 1HOXA 3OTWA 3GK3A 3UCFA 1QAMA 1W96A 1D9XA 3PUIA 4GPTA 2ZJYA 1M1NA 2V8OA 4IIBA 4TV8B 5D87A 2V6MA 5B1HA 5TVKA 4JP2A 2O3QA 3T99A 1UDRA 4TROA 1ODIA 1TL7C 1GNSA 3R5KA 5EE3A 2WRZA 5SYNA 4II3A 4BO5A 4NS1A 2HL6A 1EBBA 3C3CA 3AJDA 3FPHA 1MXFA 2XQIA 3PA8A 3TQTA 2V7UA 2PIDA 4QXPA 5I9SA 5JNTA 2P1DA 4XVCA 3KVRA 3H1PA 2NADA 2OILA 1JBKA 1MEOA 1TW2A 2X8AA 1WG8A 2OCGA 2O0LA 3MWFA 1FW8A 1ODJA 4ZK6A 3OTGA 4AG5A 4ZAVA 4YT5A 2WKQA 5KYVA 1ZIOA 1EE2A 4FQ5A 1XZEA 3X1DA 4ZHQA 3G8BA 2Q1XA 3WBJA 3AUUA 3WRXC 1T1RA 3A70A 1Z7EA 5CMLA 3VSAA 4OUKX 3ZJ4A 5B2EA 2D7DA 3REQA 3V34A 1VSQA 4Z0TA 3H5NA 3RG8A 3DC7A 4P34A 4CV0A 2PGAA 4L5YA 5EJAA 1M7GA 1GU1A 4YI5A 5HQJA 4BWVA 4E12A 4MIOA 1ACMA 1P1JA 3B1ZA 1ZH2A 2CN1A 4LOAA 3G2KA 3MD0A 4WNYA 3HV0A 1K6JA 1UM9A 3TLGB 5BV8A 1N9GB 4Q21A 5UKDA 3ROFA 1HK7A 3BWVA 2PKQO 4XCVA 4EHHA 4N6NA 1JA1A 3UBMA 3IKJA 4HLNA 1EWQA 4FB5A 3ELYA 1RP1A 4OJMX 1K6MA 2VWQA 3AB7A 4W5HA 5FWDA 2A94A 2FZ4A 3DMNA 2NU7B 1B3BA 3F98A 2BAGA 4WK6A 4EHAA 4ZYUA 5HQ3A 1U5CA 4MW5A 2QUHA 1ZGZA 1ZKMA 4D4IA 2C54A 5T4EA 4BAGA 2R4TA 4Q1FA 1XZDA 3K4PA 3KEOA 3QX8A 4S3MA 3WYEA 1SKUA 1GQOA 1NN0A 3RRNA 3C5HA 3GWGA 1GPH1 1G66A 1ECJA 3WMXA 2V7QD 1X38A 1C2TA 2B4RO 1QFJA 1IE3A 2A14A 1NQTA 2ZE7A 3KKPA 4FFDA 4KR0A 4LZNA 4O59O 5DTJA 2FQ1A 3B8EA 2QUIA 4L7QA 2GETA 4JODA 4EO4A 1JIIA 2Z58A 4LFBB 2VHQA 3T95A 2BSQA 2FH5B 1U0RA 1VBFA 3JSXA 3RWMB 3EZ7A 1G42A 3CNBA 5BSWA 2CBGA 4KLZA 2D2VA 3ZQUA 1XDSA 3WP1B 1Z9BA 2KS6A 2BI4A 1K3UB 1KO7A 1RQ7A 2VEDA 5DN9A 4D7AA 2QIPA 3OD1A 1U7TA 3UW1A 5JRZA 3E27A 4H3KB 2C7PA 2MJLA 5ALQA 2XYVA 2JIOA 5E6UA 1YRBA 1IVNA 4DIDA 3M5CA 2ERCA 3LHSA 4ACBA 4HUTA 4NR0A 2VNAA 4I55B 3CBQA 3LLUA 3IAEA 3DWFA 2QUBA 2IHKA 3OPNA 1O8BA 1Y81A 1ACLA 3LWDA 4M0EA 4YP6A 4JBGA 1WDTA 2ZWVA 1G3UA 3BBPA 3FYUB 3N8GA 2P5TB 1UWLA 5DKFA 1U99A 2QTRA 1MENA 1WUKS 2FGJA 2H1HA 2B25A 2ZCUA 3G7NA 4M9XA 3BB1A 1Q84A 1HL3A 2VP9A 5FJJA 2F62A 2I1QA 4JEUA 1LTQA 4TS1A 5EUBA 4A2WA 4TVBA 4BNGA 4LHWA 4YDQA 4CI9A 2X8WA 4KFUA 1RXVA 1ZMOA 3GFTA 1TJYA 4S1WA 4D0NA 5CUQA 2PNFA 3F49S 1Z2NX 3AFNA 3L84A 5EJFA 4I5IA 4YFYA 3I83A 3GLGB 2RGYA 4OQXA 4J16C 5JDCC 5K45A 1AHHA 1RE1A 2DE0X 2ZI4A 2JI4A 2FPIA 3V55A 3SQLA 4ND6A 5D6OA 1I10A 3O8DA 1JLLB 1WP4A 2OQIA 3EXHC 2EL9A 3DT8A 2AEEA 4QGHA 4OJNA 2QD5A 1CEEA 2JCGA 1Y5IA 3ABZA 2FR8A 5MDHA 2B8WA 3G0BA 4QUAA 1H8EA 5EJIA 2J7PA 3IV9A 3TEFA 2I2BA 4BP1A 3C7KA 3FKQA 1D0SA 3N39C 5KNDA 4U2GA 3O84A 4XWYA 2UDPA 2XCLA 1M0WA 1BAPA 2HMAA 4EZEA 2BGNA 3ID6C 1U8CB 1CNEA 2Z2IA 3QEMA 1Z5UA 4P2BA 4MUYA 3I61A 1U63A 4W6ZA 4AD8A 4HI0E 1JHQA 3B5EA 1Z74A 2RKBA 1RM4A 1MO2A 3IIKA 5IC4A 2P6UA 4OHBA 1KQOA 1MAWA 1Z08A 1VE7A 4O5OA 5I8WA 4I9HA 1U0TA 3QTTA 2CLDX 2QAJA 4MS4B 5L3RA 5IVIA 2AJLI 2CLSA 4MQLA 2JATA 4BJ3A 3FZGA 1Z5ZA 4ZALA 1R4MB 1VHQA 1QNFA 3NBYC 4GDFA 2GEJA 1QF9A 3LIPA 4KQHA 1O5OA 1CUFA 4UNSA 1XQ1A 2Q9UA 3KKMA 3ZNQA 4B8WA 4QDXA 3THXB 4E5SA 1Q20A 4J0DA 5EE5B 4H60A 1LPMA 2IPOA 1CT9A 1JQEA 2B21A 1QDUA 3O91A 3I9JA 2QHXA 4C4AA 1VB3A 1LLFA 4UVHA 1JMYA 2IOHA 3L46A 4S1VA 2XEDA 2Q1UA 1F6WA 4D3DA 4NL4H 2PGJA 1CRZA 3UH0A 5F7JA 4HQRA 5BN4B 1DJMA 4D6YA 2P78A 4FC6A 4GUAA 1G21E 1OPRA 4J1TA 1NQ5A 2CVHA 4B2LA 3F7NA 3OE4A 1PGQA 2G5GX 1S3IA 1PKXA 3ZI0A 3C0KA 4RKQA 2OGUA 1NBHA 3ZHXA 5LZ8A 2YV1A 4WLFA 2H2IA 1NQAO 3C97A 1A5ZA 1WP9A 2VSXA 2Y1KA 3MCZA 3ZQ4A 2XE4A 4MRMB 1JQLB 4KQEA 3T3PB 3W8DA 3ZDQA 3IT2A 5IJ0A 3LPMA 4O33A 3C3EA 5FT9A 2UZIR 2VP2A 2KQUA 4FWTA 4LYAA 1A3CA 1TIBA 3DBVO 2QSYA 3G7UA 4O4LF 3VKFA 2Y67A 5A5EA 1U8TA 2FGKA 2FUNB 4J07A 3TTXA 2YH2A 1EZ1A 1XBTA 4G9EA 5E3JA 4RC9A 3ANYB 2C3YA 1OBOA 1T15A 4C43A 3VPDA 2V4UA 3G9TA 8LDHA 1ZU4A 3BZWA 2O8FA 2A1UB 2PKWA 1EQAA 1ML3A 1Z83A 3IR7A 2D1FA 3H2YA 5JZMA 2ADOA 3T41A 4RAOA 1QF7A 1I1HA 2W4IA 3PFNA 4TLEA 1RR6A 3V1LA 3NVAA 4N5DA 2ASVA 5BUQA 4PLTA 3VU9A 3VDNB 1MA0A 4IDQA 1M6VB 1VHWA 1YA4A 1TEZA 1TAQA 5BMOA 4BJ1A 3KQTA 4L4UA 1CS0A 1T0JB 1HQKA 3FUTA 3HN7A 3R0ZA 3VXKA 1ONSA 4AECA 4PE5B 3HZHA 1L1EA 1O3YA 3BB3A 5JC1A 1I3KA 2YVKA 5KOJA 4P93A 1I01A 5IRCD 1QJ4A 2JGEA 3I6IA 1Z2EA 2A57A 3VR2A 4CDNA 4TTRA 6PFKA 3JYLA 2VZEA 2H2GA 5IG2A 3NOOA 3IE0A 3KLNA 2ONKA 3THWA 4UVEA 4LNAA 4NJMB 4JBYA 4KQFA 4TN5A 3P9QA 4O2BF 3GZNA 3P7MA 4N12A 3A9CA 1PJBA 1FF9A 1PWZA 4M0KA 3RSFA 5BY2A 4F9GA 2I6GA 3PPWA 16PKA 3UQYS 4OU4A 5C0OE 3IJRA 5I5GA 4Q93A 2WNIA 5HFNA 3C3PA 1E7WA 4HXGA 5K2MA 4V0OA 8ATCA 1YS1X 1W76A 3HQ4O 1T8RA 2YRXA 3DVAB 3QUTA 2OFOA 5DGCA 1QUEA 3B53X 4NENB 1XK6A 2HSDA 1W4BA 3WHLA 3RTBA 1UFRA 5A3QA 4KYIB 3GNLA 5HKLA 5J9FA 1E4EB 2RI6A 2JK0A 2QTVA 4IIJF 5AO9A 1EUDA 5GZ6A 5TR9A 2OV4A 4NBUA 3BA6A 3TQFA 3I3SR 4RD1A 3KQLA 3N5CA 2X9LA 3M33A 3KYIB 4PYOA 1ZZGA 1OOEA 1NFFA 1SKMA 4PHHA 3WSVA 3RRFA 4XQGA 1F3LA 1R6VA 2ZRPA 5D1HA 3ITNA 3RVOA 2QR5A 2FFJA 1G6KA 2IXDA 3PNVA 5ITZA 3RAFC 4P92A 4LTDA 2NO7A 2WIBA 3LUKA 4GDMA 5B3JA 1T36A 2AF3C 4DDMA 3T4XA 2C20A 1E79A 3QEJA 3SI7A 2EHDA 3TTUA 1NQXA 2IZOA 5JI2E 3H11B 3KZVA 3HL0A 3CONA 2IPXA 3AY3A 5BN5B 3KTAB 4CHGA 2EJWA 2CVQA 1S2GA 2QL6A 1HGXA 2CFCA 2Q2NA 1OY1A 3BJMA 1WLSA 5A7HA 1K75A 1J7JA 1G21B 2ONCA 2XB4A 3MB5A 1SXPA 2JFQA 4TTPA 2XMCA 5H81A 4B33A 2P6MA 3NTVA 2NU9B 3F5QA 3P2EA 2Y1DA 4IUDS 5EE1A 2XHZA 3OP1A 3GJ5A 1K7EB 4IJMA 4D3ZA 1JG7A 2BFDA 5LA6B 5KTOA 1KY5A 1X3SA 3GEIA 3L7BA 1RM3A 3W0LB 4MUAA 3L8FA 2PO5A 1DBVO 4HYEA 3VPSA 1QLHA 1D2NA 4MQ6A 2GPAA 1BXRA 1QTNA 3L7OA 1V5EA 4BUCA 4Q48A 2QN8A 3NBFA 5KYNA 3MN1A 4Q1VA 3FPFA 2X8BA 3JQ8B 1XZBA 4FMDB 3UHJA 5EJEA 5IK2D 3LBNA 5KIAA 1YB1A 2GS9A 2Q6TA 3I52A 4MVJD 4UU7A 1YGYA 1QC5A 3FW1A 4AJ9A 4WXMA 2V6GA 4K8OA 1QIMA 4C1NA 1DFIA 4E07A 4PYMA 1C3OA 2QQ0A 4FS3A 4I3GA 4OOFA 4KAXA 3WLHA 1N2CA 1WM1A 2R6HA 3PC3A 2CZCA 4XJVA 1T0IA 2WIAA 5CVJA 3R9IA 3V00A 1W94A 3PV0A 4W9MC 4IFIA 4OMUA 1J7KA 4R3UC 1Q3TA 2RGWA 3T5AA 2BMAA 5A71A 1SBHA 1J99A 2E55A 1XRLA 3RJZA 1IC6A 4QD3A 1TQ4A 4WI1A 1CZLA 4HAWA 4MEJA 3I9LA 4AY3A 3DOUA 3IOYA 3ORRA 5I9IA 1GPAA 4FUTA 3O7MA 2SHKA 3O93A 4NMWA 3SZRA 1Y6ZA 2H59A 1JB9A 4TWZA 1U3GA 3ZWAA 4TYMA 4OYRA 3KJIA 1T9BA 3ESDA 3T3IA 3MT9A 4XA8A 2RHRA 3KPWA 3R2JA 4BBAA 4N5LA 2IU6A 3ZZ0A 1S8NA 2XNSA 5CDSA 1UBHS 2P9BA 3AKZA 3SN6A 3SMQA 2HRCA 1A5TA 3SFZA 3PKZA 3B3JA 4ECAA 1A4XA 4CTMA 5C1IA 2ZJZA 1DAIA 5CVVA 4BNIA 3CQ9A 3W8FA 4ROSA 1WXWA 2D0PB 2JF0A 2RC6A 3TAHA 1PQYA 2VYQA 5LWHA 2CCGA 4M99A 4KVAA 1XAIA 3B82A 5HCIA 3FYTA 4MLDA 4NBSA 4HNTA 3LUHA 1FSGA 4DWVA 4INPA 3S7TA 2N9UA 4JKIA 4Y2YA 2R7MA 4B6RA 2I22A 1PK7A 2WWGA 4ZDIA 1E6KA 2PSFA 1CJKC 2Y0EA 5FUVA 4UQLA 5TQ2A 1CEQA 1PHPA 2L17A 2ZAIA 2CCJA 2YY6A 1K9SA 1OASA 2H17A 2DTEA 5HZGA 1T2EA 1OXSC 3DT6A 1GGVA 3IQXA 4HYTA 3RJTA 2WYIA 5GY7A 3U44A 1F5NA 1MJFA 5F3WB 1ATZA 4L8VA 3ANSA 1QP7A 1GCGA 3I62A 4R1NA 3FG9A 2YCBA 5KJEA 1KEKA 3ZVLA 4ZKEA 4TUYA 2OO5C 4ZOBA 4CL2A 2ZJOA 3UXYA 2SKCA 2H51A 2RE8A 3FI0A 3IFSA 5ENZA 4ZQEA 4MVYA 1KMCA 2ECFA 1OA1A 4B4WA 1E3WB 1AG9A 3HPQA 3BF8A 4EX6A 2MYNA 4CWAA 1T6XA 3H4MA 4NK4A 3VR6H 2I7TA 1WPXA 3DKVA 3FMIA 5EP4A 4GRAA 1R16A 2Q6VA 3BTUA 1HYGA 1L7VC 1JECA 4HH1A 4YAOA 4YX9A 1U1GA 1TEVA 2C1XA 3KIPA 3QUCA 3VNAA 4TT3A 2FX5A 2WJPA 1EJBA 1GKUB 1XJ0A 2EARA 2LCIA 3H5LA 3GEPA 3MRXA 3R3YA 4BDSA 2H7YA 4F38A 1E9BA 3V8RA 1ORIA 3UO8B 3EOZA 4MPTA 3FVRA 3ZWWA 3AM4A 1EXWA 4GPBA 3TTYA 1Z4KA 1EDZA 1XZHA 2G6BA 1S96A 3N05A 2J0EA 2QMEA 2V7WA 3GFGA 1YR2A 3K1AB 1IK4A 1N5KA 2FPXA 3AILA 4CKCA 4YY3B 2O2DA 3QKIA 1IVSA 3IUEA 3KWJA 2VJBA 1H1LB 1WSWA 1C7FA 1X7DA 2GAFA 3HWX1 3RT9A 1YZKA 3PT9A 1GLVA 3DCNA 1Y4UA 2WU1A 4L78A 2YXBA 1Y7IA 3VI4B 3E2MA 4NPAA 4MKZA 4D3SA 3NONA 3LHFA 3CUWA 4W5NA 3AIIA 1EESA 1W52X 2BFWA 3PENA 3A2LA 3D6JA 3B9PA 1FRFS 1M5TA 3L9XA 4IXWA 4OXXA 1BD3A 3UKJA 1GCIA 1R8SA 2Q8NA 4LI3X 3HKCB 1NHWA 2EYUA 3HDVA 2FSVA 3QNWA 4D9NA 1SCIA 1YDWA 1P1HA 4CNQA 3EQ2A 2WG1A 1F8UA 4A7PA 1HZZA 5FA6A 1T8YA 1VPDA 2LKDA 1L5HA 4H7FA 1NKSA 2NTEA 1U2QA 2V6FA 3DMTC 4CU5A 4F8YA 2FSUA 1VJRA 3QVGA 4WDQA 1V7QA 3ROPA 4E33A 2PJZA 5LXTA 3L82B 1RQ2A 3RSGA 2QPTA 4Z8YA 2O05A 3B1XA 1FDRA 1NW3A 2SNIE 4B8ZA 1P0PA 2J31A 3TZCA 2CSXA 1HNZB 5ALUA 1Z7WA 4HH0A 1JEDA 1XJCA 1ZVJA 2H29A 1KO1A 1YB4A 1I0ZA 4CMBA 3OQIB 4WJZA 1TU3A 3AUJB 4G0OA 2X4DA 3QWHA 4AB1A 1CDZA 2R8EA 2G70A 2VHXA 4UBOA 4UPDA 1VHLA 1I3NA 3WL8A 4JR0A 1XXLA 1FA9A 3HJGA 4DWJA 3SQWA 3ELWA 2CJPA 1U9IA 1L1QA 2NXJA 3BSWA 3GFVA 1U0EA 2XWQA 1PLJA 4D9MA 3L3BA 1A4IA 5EJ2A 1YDGA 4OFBA 4F92B 2NSLA 2QNRA 5DGXA 3RFFA 1SD5A 1IM2A 4R2LA 1QIJA 3B6JA 5JH7F 3VOBA 2JPDA 2CFSA 3LCMA 2YNMA 1M7HA 3R4VA 5A5FA 1NNUA 5BPFA 3K5IA 1NI5A 4D74A 7AT1A 2C5SA 2D3WA 3LCVB 3WKAA 5LOVA 1WIWA 1QLJA 4BKMA 5E9JA 4AK9A 4U5XA 1RKUA 3V1YA 1QVZA 1RFGE 1Z15A 4BQNA 3SVLA 3D3JA 3JD1A 5U4QA 1HE8B 1I80A 4EUKA 1HLGA 4M8KA 5ALXA 2I3DA 1A4UA 1BMDA 1WNFA 2QSJA 1OTHA 3SZGA 4AJHA 2X2EA 3N2EA 5EHZA 3TEMA 2BEVA 1SVOA 1V11A 4WA7A 5L6MB 3NBZC 3QJYA 3K0CA 4LDAA 1TQDA 4GXNA 4WEOA 4LF6B 3PEVA 3UPTA 5J1TB 1Q0RA 2H08A 4YMGA 3RI3A 2X9VA 5EESA 3R7NA 1NR5A 4CTKA 1CUUA 1UM8A 2WFZA 1ZINA 3AEYA 4TT8A 4CM7A 4IEFB 4K88A 3ME5A 2LW7A 2EJCA 4HQKA 1CR4A 4ZVUA 2IZ6A 3ZHCA 4LZPA 1P4GA 3NTRA 2QVBA 2XE8A 4D4JA 3Q7TA 2AXQA 3EGXB 2QDKA 1RLTA 3BWXA 4ZJUA 5JNRA 3FB4A 3GXBA 3COVA 1LDGA 3P4YA 3QFRA 4XQEA 2BJWA 4UQOA 3DBIA 2PMEA 2NTVA 1MF7A 4MGEA 4DKJA 1RRCA 1IN5A 2ENWA 4G4SP 3ZV4A 2BH9A 3IH5A 1DTEA 2HADA 1YR8A 3L0BA 2FPKA 1DCFA 4MW9A 1WZ2A 4BE7B 4DDVA 4M8LA 3V1KA 5CAEA 1H4TA 3NBMA 1VSUA 1OXKB 621PA 1PNVA 4FYXA 3GGSA 2IKSA 3HJTA 4FKMA 2BGWA 1QG2A 1SCKA 2EIHA 3O74A 1FBTA 4FOTA 4E70A 4N65A 1M1NB 2A5LA 3I5MA 3IVRA 2RCYA 3ROGA 1A7KA 4MI9A 2BR4A 2HNAA 4EPVA 1WXDA 4W9NC 1R5JA 4MHSA 3RB8A 2XEXA 3TKAA 1HH4A 2XRZA 1Z63A 1XYYA 2XH8A 2GEDA 3LBYA 1I13A 2QPOA 4HB0A 2PRJA 2VC2B 1BXKA 2C0PA 1NVUQ 3ZZUA 2HDWA 4DTIA 1WHTA 2Q9AA 5JJ5A 3NVKI 1V1RB 1EX7A 5CITA 4C6HA 4RK0A 5F35A 1T0UA 2A5FA 3R41A 3QA9A 3ZLUA 3S99A 1COZA 1VL1A 3ETHA 4PHCA 2WWYA 4H7EA 5E8JA 3ND8A 1LSUA 1PUXA 4ZHQB 3KOZA 1ZI9A 3D54D 3W8EA 3HJNA 3IP8A 2ONZA 1E6CA 2J6BA 1NXOA 1U1FA 1PR3A 2AN9A 3REQB 4AZ3A 1TUBA 1U11A 1VE3A 4XWOA 2VK4A 3GJ8A 3B5JA 2LE0A 4X3OA 1XQ9A 2Q5OA 3H2JA 5FQOA 3UGTA 2BKLA 3HR7A 4KEAA 1G63A 2PX3A 3AWDA 4RMGA 3VU0A 5AW7A 2ZETA 2YIDA 1JQBA 1OKKD 1UM9B 3JPWA 2GRJA 1TMKA 4IAOA 4WV3A 1NWHA 2WSIA 4UHEA 4EKGA 3OFJA 3U19A 3G2IA 4Q9DA 3F2IA 2D5LA 5IH7A 1BH2A 4ABTA 2I9KA 1R6TA 1FP6A 1I4DD 3J81A 1AZWA 1ZGBA 2F3UA 4EB6A 3AHDA 1XDUA 5JI3E 3DOEA 1NVBA 5HQ3B 2BGGA 1SU4A 2FXVA 3F6EX 3V7UA 3LPCA 3IHTA 1XTRA 3DQPA 2IOFA 1F14A 1LUAA 3R5XA 3WQQA 2WDZA 4Y2JA 4IZ6A 1J06A 3AR6A 4YRCA 2PDAA 2Q49A 3GU3A 2JNWA 3DNMA 4YJ3A 4NMMA 1WZEA 1UIRA 4N76A 3FLAA 1KAGA 2BZ0A 2XQKA 2NVUA 5EUCA 5A3SA 1Q0ZA 4PQFA 4ZOAA 3VR5D 2FEKA 1QHXA 4LYEA 4Q1AA 3SXPA 1PL0A 2O8BA 4RK1A 1N5LA 3DDHA 1N5OX 3CF6R 4RANA 2R6JA 3C87A 2RB5A 2V6BA 1YZUA 3H8WA 4R84A 3M8KA 4AP5A 3H9GA 1IEQA 2HA3A 5IVDA 3HYNA 1JIKA 2P2SA 1Y4SA 3UJ9A 4QECA 2ODNA 5KJ6A 1RFLA 5KAMA 4HLCA 1FYEA 3NRCA 1TCUA 5IT9A 4DMRA 2AD1A 1XJWA 1QX4A 2VTEA 3GGDA 3SDSA 5AW1A 2JFXA 3QLEA 4A0RA 1T9DA 4F45A 3DAGA 4WVFA 1Z82A 3IDSA 4UEWA 1E8MA 2PANA 1EUZA 4G97A 4JHLA 4N18A 4XTRA 1GARA 2B82A 4C4SA 4QIHA 3RUHA 1XCBA 5DLDA 3T0FA 1IZYA 3OETA 4EB8A 2WICA 4IICA 1E1LA 2YBEA 1U2TA 2ZTHA 4AY5A 4ZYYA 2WA1A 1TW3A 4CMEC 4Q3LA 1F0KA 3UK6A 5CG1A 1ZH0A 2ZJAA 4C6TA 1YE3A 2EFDB 3OEHA 4EO9A 3G9XA 2VJDA 1FL9A 1R8XA 2CLIB 3B3AA 1A9TA 2Q28A 3V8VA 3NHJA 4FOOA 1QH1A 4FSXA 1WXFA 1M8PA 4B2YA 3DD5A 2REOA 2IY7A 5KPJA 1RJ9B 4KJZA 2JGJA 2A67A 3F6SA 4H15A 4JBHA 3LL7A 1R2QA 3L8CA 4LISA 2VXYA 3Q9LA 3AKEA 4O63O 5C4GB 4CFYA 2FPIB 4WJLA 1YTLA 2Y1GA 3LRXA 4JYAB 4KAAA 5CHYA 4MEAA 2JANA 3WMEA 3BQ9A 5KAPA 3QU2A 2OYRA 1VJDA 5IN4A 3Q3VA 1AGRA 3JCZA 4HO1X 2VJPA 1PNQA 2YFQA 3EDRA 2X7JA 3A3OA 4JSRA 2BCJQ 2HNBA 2DQSA 4TMXA 5KTPA 4RHXA 4HEQA 1LU9A 4R51A 4DIBA 4CIYA 4K0RA 5JXJA 3EPPA 4B46A 4A0QA 2YQ5A 4AY2A 3V3KA 1JJFA 4CFSA 4GWKA 3TTVA 3WL7A 1ADJA 3OM1A 1HZJA 4MQUA 4F04A 1J8VA 4F6RB 4HJXA 1C81A 3EIWA 3LW7A 3RC1A 3QEMB 4LX0A 2UUPA 4D9EA 4QGFA 4H18A 3AZQA 4ZDJA 3EYAA 1M6WA 3MJCA 4IQ8A 1I94B 1T9CA 3NTXA 1D5CA 4DOMA 4U2CA 3LFUA 3HVKA 1P18A 1PYOA 2X6QA 1X0XA 1ZESA 4ZOEA 1R5BA 1HMYA 2BDEA 3CJTA 4F93B 1U2GA 3O21A 2XMRA 3U16A 3GUUA 5CLGA 1LJLA 4JN6B 1RXCA 1RC1A 5EZYF 5IJAA 1ULBA 4GI5A 4QZVA 1N6KA 2E4ZA 1VPEA 1ZCAA 2IV2X 2QZSA 2RHJA 1P7CA 1YKFA 1ZCZA 1NNLA 1ODLA 3H5OA 3UMYA 3AVUA 4F8EA 4WWHA 1YZHA 2DFPA 5HVNA 1NY5A 3EFOA 4IVPA 1DLIA 4IF4A 5K4AA 1B0ZA 2QN1A 5EUMA 3TRJA 5JUWA 5BQ3A 1DRJA 2AMJA 3O2NA 2NXNA 3AI3A 3BICA 2JFBA 3UMCA 2BBWA 2ZJ8A 3G59A 3OESA 4EARA 3VPFA 4ZRNA 5EG5A 4KREA 4LZJA 3ZS8A 5IUNC 2B3DA 3BMNB 1TDJA 3BD6A 4D81A 5K0BA 3PL1A 1MX5A 3ACDA 2FW0A 1WKBA 3EUWA 3TOZA 2QD1A 3EVGA 2OE2A 4JC4A 3M70A 4ADSG 1PP4A 1ESDA 2PN1A 4QUEA 3O0DA 1Z6AA 2I34A 4KKVA 3A3YA 2DB3A 5IKXA 2R7NA 3A1SA 2IX3A 3BT7A 4UMDA 1Z7YA 5IJ0B 2VYND 3A25A 1M5RA 5FBQB