3U09A

Crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg)(g92d) from vibrio cholerae
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
248
structure length
248
Chain Sequence
MSQFMNLEGKVALVTGASRGIGKAIAELLAERGAKVIGTATSESGAQAISDYLGDNGKGMALNVTNPESIEAVLKAITDEFGGVDILVNNADITRDNLLMRMKEEEWSDIMETNLTSIFRLSKAVLRGMMKKRQGRIINVGSVVGTMGNAGQANYAAAKAGVIGFTKSMAREVASRGVTVNTVAPGFIETDMTKALNDEQRTATLAQVPAGRLGDPREIASAVAFLASPEAAYITGETLHVNGGMYMI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dissecting the Structural Elements for the Activation of beta-Ketoacyl-(Acyl Carrier Protein) Reductase from Vibrio cholerae.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Oxidoreductase
molecule keywords 3-oxoacyl-[acyl-carrier-protein] reductase FabG
total genus 92
structure length 248
sequence length 248
chains with identical sequence B
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2011-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3u09A00
3BAZA 1Q0HA 5TLSA 1Z73A 4UVHA 2W4QA 1LA2A 2VHXA 4AJLA 5JDCA 1HDCA 2YQ4A 3TDKA 2VWGA 3GVHA 5T57A 3KYCA 4XKJA 2HMSA 4GSKA 1ISFA 4KQXA 5A05A 8LDHA 1LX6A 1Q0QA 2VZ8A 5CDGA 3OHSX 2AA3A 3F5SA 5TX7A 2WD7A 5ILGA 4BNUA 1U2DA 3RKUA 1NYTA 4NIMA 3ZNQA 3BTOA 1NX6A 4D45A 3RC1A 3VH4A 1P33A 1ZW1A 1FDUA 3LK7A 1BXGB 1BVRA 3VZPA 4FQ8A 3Q3CA 1PGPA 4KUHA 4RQUA 3VOSA 4XZ3A 4F46A 3DMTA 3DOJA 3F3SA 1ZK4A 3ZU2A 3O38A 4PVCA 1T2AA 4IMPA 4B4WA 4CM3A 1TEHA 4ZA2A 4F6CA 1NASA 4RVSA 4P22A 1IYZA 4WLOA 1HDRA 3DZBA 1SCUA 5JY6A 1KYQA 1ZMTA 4AJOA 4C4OA 1Q2XA 3SJUA 2DTEA 3AU9A 4GWKA 3JYQA 1DAPA 1IOLA 1HWYA 3ZU5A 4NG5A 3GVIA 3VHRA 1DIGA 3KVOA 5DDIP 3VAZA 3WLEA 4YBZA 5IN4A 3PEFA 4MVJI 4RVGA 1KOLA 3HB4X 2DBVO 3Q2KA 1MUUA 4ALKA 1CYDA 3I3OA 4N5MA 3WGZA 4XD2A 4JBHA 3RASA 4U6QA 5TGDA 2HK9A 3CUKA 3GH3A 3LC7O 4WJZA 4TVOA 2J5KA 1GUZA 4Y67A 2NQ8A 1LLCA 1T25A 1Y81A 1ZJZA 2B0JA 1RM3A 4KOAA 4IUYA 4Q39A 5JDIA 1DHTA 4KMSA 3G49A 1T2CA 2QZ9A 4M8SA 4TSKA 3AUSA 3MEQA 4MVJD 1EZ4A 5KKCA 4W82A 5COAA 3OA2A 4EITA 4RCVA 1R4MB 4PLHA 3HDYA 3E5RA 3IJRA 4M86A 2HRBA 4Y9DA 3HWRA 2VNAA 1A4IA 1GZ4A 4JGBA 3RUCA 5ES3A 3AY7A 3I9JA 3HG7A 1HDYA 4DLBA 3AM3A 4RZHA 3A4VA 4K28A 3KO8A 3E48A 4LSMA 4B3IA 3S1LA 1DJQA 1IZ9A 3ANLA 4DIFA 2IE0A 5CDSA 4WLUA 3GZNB 3TSCA 1KC1A 4HBGA 3CMCO 3DHYA 5AQ1A 1R4NA 4X54A 4YJGA 3M1LA 3VPSA 4BV8A 1LSOA 3ZNPA 4I1IA 4N5NA 3RFXA 1EUZA 1K5HA 1MLDA 1UZNA 3GUCA 3H8VA 1LDMA 5L7YA 4YB8A 4FB5A 4BNVA 1K6JA 2OO5A 3H7AA 3NJ8A 3NV9A 1T1SA 2B5WA 3GLQA 4FFOA 1I3LA 3NDJA 3QVOA 1BRMA 2NSDA 1JWBB 1BMDA 1I8TA 4LCJA 4CV1A 3TJRA 4ZQFA 2WMDA 3SLGA 5KJ6A 2SCUA 2B4TO 4KUEA 1JKFA 2UYYA 1DOHA 1P3DA 1KVRA 4NBUA 4CMIB 4RVFA 4ROSA 3AJRA 3VH2A 4I5EA 4TRRA 5CPFA 1LLQA 3L6OO 1GCOA 3NTOA 3EHEA 4G65A 5EIOA 4E33A 3Q2IA 3F9IA 5A02A 3GK3A 3HDQA 5F1OA 2C54A 3C1AA 3OEWA 4D3FA 4WECA 3WFIA 4E30A 5FEUA 9LDTA 2V7PA 3VTFA 4Q3EA 3P2OA 3U09A 3I9OA 4OH1A 3G3EA 4BNXA 3RUHA 1ENYA 3QWFA 4O59O 2PZLA 3WNQA 1ENOA 3WR5A 5ENDA 3OIFA 1HLPA 2QYSA 3OIGA 2CZCA 1W0CA 1A7KA 1W8DA 2AQKA 1AHHA 1B3BA 3TF5A 1OC2A 3F4BA 1K0UA 2CVQA 1RM5A 3NDRA 4XYMA 1Z7EA 1H5QA 1LRLA 3TN7A 3VH3A 4IDDA 1F0YA 1O6ZA 1A72A 2O3QA 2P91A 4CLRA 4MPDA 1XGKA 1EE9A 1R15A 2Q45A 4BO2A 4L8VA 1M76A 4NJOA 1CJCA 2UAGA 2DM6A 2WYVA 1SC6A 4CM9D 2VHWA 1E5QA 1YONA 5JAQA 3WYCA 2QYTA 2X9VA 1F8FA 4E2ZA 1I32A 3ASUA 3NTQA 5DF1A 3H9GA 1NFFA 4FC7A 3LQFA 4MIEA 3TPCA 4RZIA 3PWKA 2GZ3A 1H2HA 5B12A 2B4RO 3O4RA 1NP3A 1VL8A 3MOIA 3PQDA 2P4HX 1PZHA 4ND1A 4Z0PA 2VHZA 3WGHA 4XYLA 4BO1A 3MJ4A 1NQOA 4HFRA 4DQXA 2ZB7A 1NAIA 2QG4A 1X1TA 5IZCA 3TQHA 1KS9A 1DC4A 3K9QO 4LISA 4FFPA 3WFJA 4BV9A 3WBBA 1BTOA 1CQIA 1G0OA 1ZUD1 1N92A 2VZ9A 4JJIA 1HE3A 4II3A 3E1KA 4FGWA 3QWBA 4PLWA 1EBUA 1PIWA 2Z1NA 3SLKA 2EW2A 5JAZA 1R6DA 3O8QA 1KC3A 3UAGA 1LU9A 2DVMA 3DZFA 3INRA 4A26A 4WLEA 1L7DA 4AJKA 3P7MA 1I3MA 5ILOA 3PHIA 3Q9NA 4RVDA 4ZRNA 2DUUA 2PY6A 4NBWA 3ADPA 3RSHA 4B79A 5CEFA 4CLDA 1BHSA 4Z3KA 3WX0A 1Z6ZA 1ADGA 4CMHA 1IY8A 5IXSA 3UKOA 3VDQA 4ILKA 1ZMOA 2BH9A 7ADHA 3AOEC 4G2NA 2PD6A 3D5QA 3UCFA 2Q1UA 1Y9EA 4QQRA 1P77A 3SX2A 4DC0A 3JQEA 3LT0A 2YV3A 2X58A 4GSLA 4AJ1A 4E32A 4NFSA 1GCUA 4ZN6A 4KTVE 1Y8QA 4WNCA 2RHCA 4PVDA 1U2GA 4BKUA 4NNJA 4OOEA 2YY7A 2DBZA 2O4UX 3AWDA 3QRWA 4Y98A 4LRTB 1NXQA 1E6WA 2TMGA 5CDTA 3N74A 3ZU4A 4ND5A 4RF2A 1QRRA 1GQYA 4WLNA 5G0TA 1GZ3A 2NWQA 3IAHA 4DTIA 4E2YA 2JD2A 4H3VA 2VN8A 4PLVA 3KYDB 1LRJA 4PLCA 1LQTA 1HYEA 2R00A 5FF9A 4GVLA 4I9NA 2Z95A 1E92A 2R2GA 1VJ0A 5B4UA 4PZCA 5EMHA 1VE9A 3RUDA 1I2BA 1ZXBA 3KV3O 1R37A 4CQMD 4I9HA 4DUPA 4NDNE 5A5FA 2P2SA 1WDLA 2VWPA 1Z82A 4WOJA 3QWIA 5BNIA 4IS2A 5HWSA 2VWHA 1E7YA 1EFKA 5L9AA 5AXCA 1JW9B 1O8CA 4TRNA 2C7GA 4ZGWA 2P9GA 4ITUA 5TF4A 3GN1A 3KLMX 1WMBA 4CMEC 3CXRA 2FMUA 1ADBA 1LDGA 1LC0A 2XAAA 5A03A 3CKYA 3V2UA 2FPIA 5GZ6A 3NJ4A 4AVYA 3TFQA 2NVUA 2O2YA 3VKUA 5DCUA 2ZTUA 3I9NA 4CQLA 4PCVA 1W73A 4KDEA 5A3JA 3LF2A 5T8KA 3JQAD 3BMQB 4EGFA 3EUWA 1NQAO 1HLDA 3W8DA 5HA5A 1C1DB 4L4XA 3E03A 4CQLB 1GYRA 4QX6A 1GY8A 1E7RA 3QW2A 2A92A 2PH3A 2C29D 3JQ9A 4XB1A 1U5CA 2E48A 1P0FA 2XF8A 4R1NA 2Q99A 2ZB4A 2DU8A 1A27A 3DQPA 5JCJD 2X23A 4IQ8A 3DTTA 1DIHA 4K6CA 1VI2A 1Y9AA 3H3FA 2PK3A 1B14A 2NACA 2BRUA 1E3EA 2I65A 4K6FA 1UXHA 1NHWA 2HUNA 1R12A 2ET6A 3UICA 1OAAA 2C0CA 2X0RA 3G0OA 3G79A 4J1NA 3FHLA 5CFZA 5DBIA 4MO2A 4CMJA 1F06A 3V2HA 1B8PA 3K6JA 2HMUA 2P5YA 1U3WA 3PJGA 5A9TA 2CY0A 2I5PO 4E5KA 2NU6A 3CE6A 3E6AA 2D1YA 2ZYAA 2VUSA 2FPPA 2B37A 1PJ3A 4WCFB 4UEJA 3E8XA 4BKQA 3B6ZA 4J9UE 3FTNA 3JYNA 1XLTA 2FRDA 1YKFA 1EUCA 5A04A 4DMMA 3RBZA 1PJ4A 4XIYA 4R9RA 1B15A 3ANMA 4B4VA 2DTXA 5KVSA 1IULA 4M1QA 3LDHA 4NK4A 2A35A 4B7XA 4RF3A 4IIUA 4JCOA 3ZH2A 3AY6A 3BTUA 5G4KA 3O26A 3TZHA 5CAEA 3TWOA 1F8GA 3NKLA 4DQUA 4IGFA 5DOVA 2O3UA 2W98A 5I9NA 4ALIA 4ALJA 3H9UA 3H5AA 2QZZA 4YWJA 3OJFA 3Q6IA 5JC8A 4GBJA 2VRCD 1YGYA 3ZWOA 5AVOA 4BQPA 3GRPA 2Y1EA 4FR5A 1M2WA 1KEVA 2WTBA 1SEPA 2VHYA 4CR7A 4R54A 3SC4A 1XG5A 1PZEA 2J3KA 1NPTO 5THQA 2H6EA 3IUPA 3L9XA 3S8MA 3NT4A 5CDUA 3W4KA 4CM4A 4F3YA 1SBYA 4PIVA 5TRTA 5F21A 2OL4A 3DBVO 3S55A 4E0BA 1C1DA 1P1HA 1S7CA 2FY8A 1X7DA 1PJBA 2FSSA 2QRJA 3CPSA 4B3JA 4RPHA 4TVBA 1FDWA 2B5VA 2OBYA 4W4TA 4NZ9A 2F1KA 1SB9A 4D3DA 1B8VA 4J0FA 5KCZA 4XX0A 5KNLA 3GEGA 5G0UA 2CDBA 1ZVMA 3TZQA 1QYWA 4CM9A 4BO6A 4BNGA 4R41A 3WLFA 4G5HA 3RUIA 3E9QA 2PZMA 5C7IO 2AE1A 1DAOA 4EUFA 2W2LA 4KDFA 3G1TA 2E49A 1CQJA 4YCAA 1HE5A 3IMFA 1I2ZA 4MINA 4IXWA 2HMWA 3PHGA 3GQVA 4XYEA 2B83A 1BVUA 4AJJA 3A14A 4L73A 1YL6A 2EJVA 1FJHA 3JD0A 2E4AA 5G0SA 9LDBA 1IB6A 2IXAA 1ZEMA 5C7LO 3JQGA 4XEHA 3H9EO 2D2IA 2YQ5A 4DPMA 3E9MA 4LGVA 1GZ6A 3RI3A 2O4CA 3BZUA 4YEDA 1E3WB 1EBFA 2O3RA 2Y05A 4GX0A 1DPGA 3K31A 4L9RA 3AI2A 4DYVA 1OZAA 2NLOA 3DBLA 3H6KA 3LU1A 1IUKA 4HADA 2EERA 4P4NA 4NBTA 2ZKLA 3SXPA 4HFJA 3HZZA 2JFFA 4NBRA 4PLGA 2A9FA 1KEUA 3ONEA 1WNTA 4R16A 5T5QA 3FNHA 3FPCA 4BOYA 2JD1A 3ZV5A 5BSGA 4JROA 3M2TA 2PKRA 3I9MA 2FR8A 3PI7A 3OF2A 4XGNA 4PZDA 3TL2A 1BWSA 1NVTA 2BGKA 3NT2A 5T64A 2Z5LA 3LSYA 1NQ5A 1SNYA 1ZK2A 3BXXA 2Y93A 3PDUA 1Y8RB 1YQXA 2JCXA 3KB6A 1KERA 3U5TA 4GKVA 2AEJA 3HNPA 2V65A 4FJ0A 2DKNA 3PWZA 1BXKA 1X0XA 3JD1A 4U8GA 2PGDA 4PGFA 1VRWA 4W7HA 4DLAA 1LI4A 5DCWA 3DWFA 3OQ1A 1Z7BA 2NU7A 3GR6A 2AQHA 3LF1A 3LVFO 3D7LA 1O0SA 3DDNA 2HMTA 3FF4A 4MP6A 1U5AA 2VTEA 1Z75A 3NEPX 3COSA 3C24A 3ZZNA 5FI3A 5DCYA 3MJVA 1L7EA 2PKQP 1CEQA 4MP3A 2WE7A 3T7CA 3SBOA 4CQMB 1AXGA 2DBRA 4KQWA 4CUJA 2QQ5A 4HXYA 2CNBA 3AI3A 5TJ9A 5ER6A 1B8UA 5JBIA 3HSKA 4J4BA 1GL3A 1LLUA 1GAEO 1U7HA 4PFJA 3WGYA 3PK0A 3V2GA 3GMDA 3K8ZA 3O8QB 1VC2A 1ZZEA 3PTZA 5TQVA 1T2FA 3I6QA 3IIEA 3U9LA 3WJ7A 3P2YA 1BDMA 4BNNA 1FK8A 3H4VA 1T1RA 1WP4A 2VWQA 5JAMA 2PD4A 4HFNA 4TMFA 1RWBA 5GY7A 3CIFA 5DOZA 1CWUA 4IJKA 1C0LA 2WSBA 3DBHA 4RDIA 4O1MA 4WE3A 1TLTA 1E1NA 4QXMA 2YV2A 3AY3A 1M75A 1DFHA 1TI7A 2OBNA 1DRUA 2JL1A 1NR1A 2B4QA 3BMCA 4P4LA 1CIVA 3QE3A 3WB9A 5ADHA 4D43A 1ZXLA 4RVUA 3U4CA 3V5NA 3ORFA 3MOGA 3H9QA 4GPD1 4XDYA 1KVSA 2PR2A 4Q3AA 1NVMB 3T4EA 4OXYA 1FDSA 4D79A 4Z0TA 1HDGO 1I0ZA 2ZTVA 3GN2A 2XXJA 4FN4A 1HEUA 3DZKA 2PZJA 1HF3A 3RVDA 2BFMA 4UAGA 4FFRA 4CM8A 4CPDA 1N9GB 4D0RA 5B4VA 5C37A 1T2DA 2PD3A 3T7EA 3AUTA 1GR0A 2VOEA 1ULSA 3HE3A 2GYYA 3QVXA 3EC7A 3B1FA 5T8KC 2B36A 3GHHA 3Q9UA 3AM5A 1H6BA 4PG8A 2O3JA 4PG5A 3BHJA 4NJMB 4TZTA 2X0IA 3TOXA 1K89A 1IHYA 1B3RA 2WE8A 3WSWA 5B1YA 2E82A 4W7IA 1A9ZA 1JVSA 5KWEA 3IP3A 2IRWA 3BMNA 3WGQA 3WSVA 2V6FA 1GYPA 2O23A 4CMEA 4YAGA 3KM0A 1GD1O 1RM0A 2VRBA 1X14A 1PJQA 5J23A 4I5FA 3IL2A 3RQSA 2D3TA 4YJHA 3EAGA 2P68A 3QSGA 1ZCJA 1ONNA 4Z9XA 4Q3BA 4BGVA 4BNLA 2VZ0A 2B69A 1UR5A 2GO1A 1ZEJA 1C3VA 2NNLD 4AL4A 5EERA 5IDYA 5L95A 1ZJYA 1YE3A 1WPQA 1T24A 3G1UA 3GNQA 3PHLA 5FYDA 1Q0LA 3ZNOA 4FJ2A 1O5IA 3RAJA 3MTJA 4RPJA 3D4OA 1NM5A 2OHXA 2Q2QA 3ZWMA 4XJTA 3A06A 3JD3A 4LRSB 4ZD6A 3QJ5A 4CLXA 3SC6A 3JTMA 4A27A 1ZSNA 5GZ1A 4QFDA 5JW6A 4DYDA 5CEJA 3A28A 4BNHA 2J6IA 2C5EA 3PQFA 3OBBA 5TJHA 3PDJA 2ZYDA 1FXSA 4DQVA 1PZFA 1NFQA 1NR7A 2GF2A 1UUFA 3N58A 4E5MA 2I9PA 4GLLA 3L4BA 3RFVA 3PFWO 3L4SO 3GEMA 3AFMA 3DB2A 1DHRA 3PYLA 4MVJE 3F1KA 3PHJA 2GERA 3GNTA 5C3MA 4WLVA 3JQDA 4CUKA 3JSAA 2CVOA 1ENPA 4Y6SA 2V6GA 5A5EA 4OSPA 2WWRA 3AOEA 4A73A 1F17A 3U4HA 3ZHZA 1ULUA 4GKBA 1EDOA 2EP5A 4CV0A 3OJ0A 3UUWA 3VH1A 1TA4A 3F47A 3C1OA 4Q3NA 5COBA 1IPEA 3K2BA 1ZK3A 4PLZA 4KWHA 4XQEA 4CLRB 4WGGA 1VM6A 3WS7A 5BR7A 1KBZA 1ONPA 3JD4A 2A94A 5LC1A 1D1TA 1LSSA 1XR3A 1R16A 5KJCA 4GVXA 4DWVA 1WZEA 2OXIA 3ENKA 3WQQA 2V6BA 1C0KA 4LVUA 2LDBA 1I33A 2EKQA 2Y99A 1M67A 4MVJA 4J43A 4GI2A 5JPIA 2X5KO 1DIAA 4ID9A 2NVWA 1NHGA 1JDJA 4YYZA 4FPXA 3HB5X 4J2HA 4UVDA 4Z0HO 2CF6A 2VUUA 4DPKA 1XDWA 4OQZA 2G82A 3ZWVA 3BYZA 3ITDA 3CZRA 5T67A 1VPDA 5KJFA 4QO8A 4GL4A 2P9EA 3GVXA 1PJLA 3BMOA 4NJMA 3JCZA 4URFA 1E7WA 3R3SA 3Q0EA 2DTDA 3JQGB 5TC4A 3L77A 1UZLA 1DC3A 1DBVO 4HUJA 1HDOA 1DIBA 2NUAA 4UUNA 3UF0A 3M6IA 5F5LA 4BO4A 4EUEA 3RBXA 3ROPA 3VZQA 1SZJG 1ZK1A 4R1SA 3C3XA 4O0LA 5L4SA 2YJZA 4TKMA 4IQGA 4D3SA 4JLWA 1E3WA 1EK5A 4UEOA 3E82A 5A9SB 3AFNA 1BW9A 2YHIA 4BQRA 1Y8QB 1X1EA 4DVJA 3QVWA 5C5IA 2JJYA 1A4UA 2X1HA 1EVJA 4MKXA 2J5RA 2TMDA 3RWBA 1YQGA 1D1SA 2RHRA 4BGUA 1IPFA 3NGLA 4PZEA 4IDGA 4R5MA 3OFSA 3DMYA 4BB5A 1WLYA 2JHGA 2G1UA 2X4GA 5B4TA 1EVZA 4JBGA 3L9WA 4FS3A 1WVGA 2AXQA 4QUKA 2IXBA 2BF7A 1UP7A 1UJMA 3DL2A 1E6EA 4BKRA 3H2ZA 3L4BC 3QWHA 3ZWXA 4MVJM 4EEZA 1MFZA 1YB1A 1O89A 1OMOA 2ZCUA 3INGA 3AUAA 1TT5B 3B1KA 2DT5A 3IDSA 1E7MA 5KJEA 2GUGA 4FW8A 1QV6A 1XU9A 4OM8A 4MVJP 3LYLA 1FMCA 3CSDA 5F1KA 4RF4A 4GQAA 1PQWA 2ZQZA 1N9GA 3PZBA 1CERA 2D59A 4Q3CA 2EEZA 3D4PA 1PS9A 5MDHA 5TT1A 5I7EA 1EVIA 5AXDA 3A9WA 2X9NA 3VDRA 3GHYA 4FIZA 1N5DA 2CVZA 4CMCA 2HLPA 2DPHA 3KLPX 4TRMA 2EP7A 2X5JO 4IZHA 5KVQA 4ZICA 2ZCVA 2Y0DA 3JQAA 1QSGA 4NU6A 4ZQEA 2YFQA 3EK2A 1YL7A 2OORA 1JKIA 1AGNA 3U4IA 5ER9A 2G0TA 4RJTA 3VPXA 1U1IA 1YS4A 1UXGA 3DBHB 3I4CA 3VZRA 2D4AA 4IDCA 1MP0A 1DB3A 5IDXA 3B1JA 1A71A 3DXFA 4J7CA 3RU9A 2O50A 2O3TA 2EIHA 2P5UA 1MB4A 2O3SA 2Y0CA 3W8FA 3ICCA 3ZNNA 1UZMA 3P5SA 1P74A 2P4QA 3ON5A 3GAZA 4ZQBA 1CDOA 2EKLA 2C2YA 3UOGA 4GH5A 4D42A 5TNXA 4EI2A 2WEKA 2C7VA 4JX8A 5A9SA 3OA0A 4II2A 4OKNA 4XYBA 3P19A 1R0LA 1HTBA 3D3EA 3K30A 1NWCA 1MX3A 2GR9A 4IINA 3STHA 4E13A 3ADOA 3DZJA 2DC1A 3GA0A 3IOYA 2PV7A 4J91A 4XGIA 3UXYA 1JVBA 1HZZA 4KUGA 3KSUA 1HYHA 5KKAA 5F3RA 2Y1DA 1LDYA 3ZW9A 5K0ZA 4R01A 2HQ1A 3SVTA 1YOVA 5U1PA 1D4FA 4BNFA 4RO0A 3BA1A 5JLAA 3S2GA 3ROQA 2YUTA 1I3KA 3S2FA 4DPLA 3EW7A 3U3XA 3ZWPA 3AUUA 1PGOA 2Q49A 3ZI0A 4PRLA 3IS3A 1MGOA 1E3LA 1O94A 1E77A 2WYWA 4RPKA 2UUOA 4LCEA 1T4DA 4WCDA 1V35A 4BNKA 3LC1O 1PQUA 2E37A 2GGSA 1YRLA 3OM9A 3MWDB 1E1LA 4KZPA 4CUZA 4PLYA 3E18A 4D44A 3DAGA 5DBFA 3AI1A 2Y1OA 4IXTA 1I2CA 1IHXA 1V3VA 2NM0A 3JYLA 5GMOA 5JAIA 3D0OA 3PGJA 3TOZA 4UEKA 4B4OA 3WQSB 4EYEA 1PS0A 2GN9A 2QRLA 3OSUA 4TWRA 1E0DA 3UN1A 4A10A 3FNFA 2CMDA 5A3VA 5JCXA 1I36A 5IDWA 2EKPA 4IBOA 2AG5A 2Z1MA 3JQAB 5BQFA 2NU9A 1OOEA 3OJOA 2BD0A 2CD9A 4EJ6A 4D0SA 2VT2A 4PG6A 4JBIA 3ZN2A 5A4DA 5IXYA 1PR3A 2I99A 3KBOA 4FFMA 4XGKA 1DSSG 2VNSA 3QIVA 3C85A 4QTZA 4BNYA 3PYXA 4ZJUA 2X0NA 4RORA 4N5LA 2GLXA 1GV1A 1G0NA 1XQ6A 3AM4A 1HDZA 1TT5A 5ICMA 2O7SA 2VOJA 1IZ0A 4W99A 3GEDA 1UXJA 2UDPA 2UUPA 2CDAA 3RKRA 3UW3A 1X0VA 2X5OA 4L4RA 1K2WA 3R6DA 2FP4A 1BSVA 2NVBA 2JD0A 3WGGA 1VJTA 5U9CA 3I9LA 1JA9A 2DFDA 2ZJ0A 1GU7A 4IQ0A 5IG2A 2FZEA 1BXGA 3ZWBA 2EF1A 3M1AA 1BW9B 3U0BA 4UVGA 1I24A 5AOVA 4EJ0A 1ISJA 3ULKA 2IDZA 3BHMA 1L1FA 4BMVA 1P1RA 2OP1A 4OAQA 1HRDA 3RC9A 3WTCA 3NT5A 2C59A 4BS9A 3KEOA 3E9NA 5I7VA 3WMXA 5IAAA 4UVIA 4YAJA 1XWFA 3KXDA 1A7AA 3EVNA 1R0SA 2Q4BA 4YQZA 4DMLA 4TKLA 4AJNA 3H3JA 5A06A 1GPJA 1N8KA 2DPGA 1EQUA 4HFMA 5IJZA 1YJ8A 1G6KA 4FGSA 1U3UA 3ENNA 1DJNA 1ORRA 5L53A 2GDZA 3ZWYA 4CMBA 4RLHA 2HJRA 4W9NC 1YB4A 3BMOB 3JQFC 4WNIA 5HRUA 3BTVA 4M89A 1PR9A 2HJSA 5COQA 4MVJF 4GX2A 4LVCA 4YVFA 4A0SA 1PL6A 1U28A 4PLFA 4HV4A 1DC6A 1EQ2A 1MG5A 1EUDA 3PPIA 5DT9A 5ENVA 3UCEA 1HETA 3WIEA 4P38A 1QV7A 3FD8A 3JQ8A 2QX7A 2J8ZA 4M54A 1IL0A 1B26A 4D7AA 1LSJA 1LNQA 2FHSA 2RBEA 3HDJA 1ZNQO 1JAXA 2BI8A 1NPDA 1PZGA 1HSZA 4J16A 1LQUA 2AE2A 7MDHA 1ADFA 1B2LA 1XEAA 3ONDA 5H82A 5K6AC 5L45A 2ZYGA 2O7QA 4CMAA 2JAHA 4OYRA 4HKTA 5JMPA 1UAYA 2WM3A 2VYVA 4E31A 3ZU3A 1QP8A 4E5NA 4BUCA 4CQMA 5I9MA 4H7PA 4OMUA 1LJ8A 1V3TA 3EMKA 1WMAA 2FWMX 2Q1WA 1AE1A 4DXHA 2PH5A 2VTDA 5HS4A 1E6UA 2YZ7A 4ND3A 3DO5A 1MXHA 3ETGA 3GPIA 2ZK7A 2GN8A 1P9LA 3GG9A 3SJ7A 5DZSA 2AEMA 4G81A 3WICA 4Q3DA 1U9JA 5EINA 1U4SA 2PGJA 5ICSA 3FNGA 1V6AA 5JSFA 2D5AA 3KYDA 3V1UA 4NPCA 1R4NB 5JY1A 2IYOA 2X7HA 4J4TA 5BNTA 4GLOA 4BGIA 1PJ2A 2AG8A 1Y8RA 2VYVD 3GG2A 4RPGA 3VPFA 5EJ2A 3H5RA 3JYPA 4BO5A 3Q11A 1F14A 3DAFA 3OP4A 4FJ1A 3F46A 4J1QA 3FBTA 3I23A 1DLJA 4HX5A 3GT0A 4J1TA 3RROA 4F45A 5TS3A 5KJ1A 1P44A 1IE3A 3FTPA 1TB4A 2D8AA 2VYNA 1KY4A 3DBLB 4R51A 1YBVA 4MIOA 1PWXA 2I76A 1V0JA 5A9RA 4PG7A 4NH4A 4FOSA 4L4SA 4BO3A 1XKQA 1P31A 4CODB 1SEVA 2DUWA 5G0WA 4IIVA 1UP4A 3CZMA 1KEPA 1HE2A 2AW5A 3VPGA 1LUAA 1ADCA 1U7TA 2NTJA 3BMNB 3MJSA 2GCGA 3QWAA 5G2OA 5CEEA 2JHFA 3JQ9C 3BTSA 4L0QA 3U49A 4QECA 2Y67A 4DA9A 4JNKA 3GZNA 4YJHB 2HK7A 4O5OA 1I5RA 4NK5A 1YQDA 3HUDA 4MP8A 3ANNA 3K2EA 3ZHYA 4BO9A 3UFXA 2RCYA 2OMEA 4LK3A 3FCOA 4J1SA 3H5NA 4BMNA 4XYGA 1ZSYA 1J6UA 2PTGA 4GX5A 4RPLA 4XRGA 3M2PA 1NFRA 4EDFA 4E6PA 2RIRA 4B4UA 4A2CA 4CJXA 3KZVA 4HNHA 2Q2WA 3NYWA 4GMFA 1K3TA 3WGOA 4HWKA 4R3WA 3I6IA 3K92A 4XQGA 2BFPA 5CHEA 1JWAB 4NHEA 1LTHR 2UVDA 5FWNA 3HN7A 1C1XA 2DAPA 4YACA 2HK8A 3LT2A 4WASA 3PHHA 3PFFA 3KEQA 4E5PA 1NAHA 2I3AA 3BMCB 3D64A 4J49A 5JMWA 2AMFA 4Z9YA 2GASA 3DEYX 3OQ6A 3DOCA 1NNUA 3RBVA 4JN6B 3F4LA 3K5PA 4WUVA 1PL8A 4IGEA 5F1PA 1VL0A 3KOUA 4QEDA 2C2XA 1ZO8A 2H1SA 3C7AA 5KTKA 3AU8A 3V8BA 1P0CA 1UDAA 3O03A 4BO8A 3QY9A 1Z45A 4AJ4A 2R00C 4KTTE 1JAYA 4AJHA 2HCTA 5FFFA 4D46A 3R0IA 1CETA 1LBEA 1GPDG 3OIDA 1NWHA 4DGSA 1OFGA 2QRKA 4J7UA 4U7WA 5F5NA 5HBRA 3TRIA 5L4NA 2FPGA 4WEQA 4CLOA 1P1JA 4LMRA 5H83A 3RJ5A 3BHIA 4K1LA 3OEYA 4YDRA 2Y0EA 3WYBA 1XSEA 1SO8A 4Y6RA 1YH3A 3SEFA 5B37A 2G76A 5EQDA 5LDGA 1XELA 4IJWA 4BNZA 6LDHA 4Y8VA 3VPHA 2OGUA 4B3HA 4U5QA 3PVZA 4E2WA 3TFOA 3GGOA 4YRDA 3ABIA 3NRCA 3JQBA 1RYEA 3NTRA 4LW8A 4B7CA 2Q2VA 3FPLA 3GGPA 4P4GA 2H9IA 1ISHA 3MZ0A 3NGXA 1ONOA 4RGBA 3OICA 4NI5A 4QFCA 3GDFA 3W4IA 5BSFA 4NBVA 3FWNA 3GDGA 3CEAA 3R3JA 4BO7A 5G0VA 1LDEA 1XCBA 4AJPA 4CLEA 3BIOA 1S6YA 1HDXA 1QLJA 4RVHA 1E7QA 3RC2A 4CLHA 2LDXA 4XCVA 4J6FA 1Q1NA 1XQ1A 3KYBA 2OOSA 3RCBA 1EFLA 1H9AA 2CF5A 4R69A 4DL9A 3PLNA 4J2OA 1ZBQA 4YXFA 2BHLA 5I8WA 5EN4A 2Y1CA 4I08A 4I8XA 2C5AA 2RH8A 1OI7A 4OHUA 3ZCXA 3RJ9A 2W2KB 4WCFA 1U8XX 4MOWA 1QORA 1LXCA 2OUIA 2GPTA 5CP8A 2ZIZA 4IDEA 4IJUA 2FZWA 5JCJA 1P1IA 5IZCC 5KVCA 1P1KA 3HN2A 5KVVA 3HFSA 2YFHA 2BELA 3PRJA 4R68A 1MV8A 1BXZA 2AQ8A 3IP1A 4CR8A 3H65A 3D3WA 1H6DA 2WJPA 1KETA 3WGTA 2B35A 4BNWA 2BI7A 4OSOA 1ID1A 3HJAA 3PXXA 2PA3A 2BKAA 1LSUA 4RQTA 4NFHA 1TXGA 2NV6A 2X9GA 1GYQA 1XIVA 4CM1A 3D5TA 2J3IA 5IN5A 1EMDA 1JKJA 2IEBA 1C1XB 2BFOA 3HQ4O 4LN1A 2HSDA 4PRKA 3ST7A 3IQDB 4KP7A 3QLJA 1RPNA 1KEWA 4CL3A 4MDHA 1JTVA 3C7CB 5DP2A 5TIIA 3NUGA 2FOIA 2BMAA 3VZSA 4FBGA 1HKUA 4R1TA 3RFTA 4IJVA 1SMKA 1GUYA 3GF4A 4E4YA 5CG2A 3DFZA 2QIOA 4A7PA 4OO3A 4R1UA 3PJDA 4K9DA 1YWGO 5IZ4A 2PNFA 2W90A 1C0IA 1WXDA 4CL8A 5C7OO 2DQ4A 4XR4A 4L75A 3IKTA 4ND2A 4N7RA 2C82A 1RKXA 3PYMA 2D0IA 2JKVA 1EVYA 1B7GO 3VTZA 5BT9A 3D4NA 1QYXA 1JLLA 4BB6A 2W2LD 3FI9A 2X8LA 3MJEA 2EXXA 1B16A 1ISGA 3H2SA 4YAIA 1D3AA 3CTMA 4Z9FA 5I8ZA 5GZ3A 3KSDO 4DBVO 1I30A 1O9BA 1RJWA 1N7HA 3NDIA 3KETA 2VQ3A 3D1LA 1PWZA 3L07A 4CM4B 4BNMA 4OXNA 4Y6PA 4ZU3A 4YPOA 1EEHA 3IJPA 3I52A 1GV0A 2JFHA 5BSEA 3ETDA 2NQTA 3B70A 4DRYA 1A5ZA 4OKIA 2IZZA 2X22A 3WNVA 2CUKA 4XA8A 1MFPA 4OJNA 3UH1A 4BKPA 2EWMA 1F12A 3GAFA 4ZHSA 4JQCA 1UXKA 1I01A 1NPYA 4XRRA 4BHTA 4B8WA 4IDFA 5A1TA 2F00A 1GEEA 3PJEA 1Y7TA 1BG6A 4YJFA 5G4KB 4C7KA 5I9LA 3IUSA 3X2FA 3GGGA 3RU7A 1U8FO 3QVTA 1GQQA 3DC2A 3EYWA 4LMPA 2NTNA 4Z3DA 3OETA 4NQZA 3OJLA 3OECA 1E1KA 1MC5A 3U62A 3EVTA 5HM8A 1Z74A 3DZGA 4IM7A 1RM4A 3DBRB 1XHLA 2FSVA 4FCCA 5CG1A 4E2XA 3JQ7A 1NQTA 3FSRA 3RIHA 4DLLA 2J3HA 1PJCA 2Q50A 2OZPA 2VUTA 3LT4A 1GQ2A 4UREA 1KIFA 1XU7A 3CMMA 5DNAA 5JS6A 4CMGA 4JXKA 1JN0A 4NMHA 3ZV6A 4CM5A 3IC5A 4FSHA 5JDIC 1UH5A 1MA0A 4AJEA 1DO8A 1J5PA 1VSUA 4YJDA 4S1VA 2EHDA 2Y1GA 1EK6A 4EW6A 4PLPA 2I3GA 4FOOA 1QXSA 4D41A 3MJTA 1HE4A 3R1IA 1P45A 1VKNA 3N7UA 5JYEA 4U6SA 5IFLA 2VHVA 1H2BA 3OH8A 5DBGA 1E1MA 2WYUA 3GC6A 2FR1A 4OGWA 2Q1SA 1PSDA 1D7OA 4NFYA 4EEXA 2VT3A 2P9CA 4E21A 2DBQA 3ZW8A 3ZHXA 2J3JA 4CMIA 2Q3EA 1K6IA 1PJSA 4IY1A 3GUYA 1DDOA 4XDZA 3VC7A 3WDSA 4GGOA 1UXIA 1YO6A 3DFUA 5L7TA 4UULA 3QVSA 4WLFA 1GFSA 3GMSA 3HADA 4AICA 3QV1A 3GRKA 1GEGA 3DMTC 2Y66A 4WOKA 1TVEA 1H94A 1UAGA 2VCYA 2HAEA 4R4JA 2HMVA 2FR0A 4AFNA 4HP8A 2Q1TA 2WDZA 3KHUA 2ILTA 1ZKMA 2H5LA 4PLTA 4BKOA 5EL0A 1GDHA 1SB8A 1VSVA 2GSDA 4MKZA 3JQ8B 4JK3A 3ZWAA 4NR0A 4BO0A 2PGLA 3WTBA 2H63A 1LRKA 4OXKA 1V8BA 2Q46A 1MXFA 4YR9A 4ALMA 4WPGA 2XOXA 1Y6JA 3KRTA 4J7XA 1MG0A 1DRVA 5JDCC 4N18A 3ROKA 3QQPA 2ZB8A 1H6AA 5JO9A 2QW8A 1R4MA 4NU5A 1NBOA 1DFIA 1WAMA 4AJ2A 4GAEA 4L74A 1FF9A 4P8RA 4ALLA 5ITWA 3KUXA 4UUMA 3GPDG 3U4DA 5IDQA 2IODA 3DZIA 3CH6A 3WYEA 4JP2A 1N7GA 2O48X 1YDWA 4KWIA 3WWYA 2NADA 3WBFA 4XQCA 1LLDA 1XYGA 2D5CA 3S2IA 1VKOA 1Q7GA 2ZQYA 3I83A 1JU9A 4YT4A 4FFLA 3GNSA 5DN9A 3FR7A 3LLVA 4U0JA 4XJSA 3F1LA 4ZVVA 3O9ZA 2HKIA 4YAEA 3JQ7B 1DRWA 1U3TA 1ZK0A 2PWZA 5EPOA 5THKA 2VRCA 4WK6A 1QR6A 1KVQA 5EESA 4MIYA 1YJQA 1EDZA 1HYGA 3Q1LA 2IZ1A 3LT1A 1PJTA 3L6EA 4RF5A 3VKVA 4RV9A 1E3JA 1XA0A 3GFGA 3RUFA 5AYVA 2ZJ1A 3OJEA 1PQPA 2GD1O 4E3ZA 1ZIDA 2Q4EA 1LC3A 3WG9A 3ASVA 4UUPA 5FI5A 5T6BA 5AXBA 3FRJA 4WCFC 1I10A 1UDCA 2X6TA 2C07A 4I5GA 1QG6A 3JQCA 1HSOA 3ETEA 3RC7A 4CM6A 4CM8B 4DIOA 1YDEA 2EGHA 3KTDA 1FDTA 2YDXA 3HFGA 3MTGA 5DULA 4YAKA 4ESOA 2G17A 3WJAA 1PTJA 3KSZO 4TROA 4ZRMA 1V9LA 1ISMA 4CV3A 1QMGA 4R9SA 2GN6A 4PN3A 2IYPA 1ZH8A 3ZV3A 1Q7BA 3TNLA 1E7SA 1J4AA 5HS6A 3WXBA 2ZTMA 1R66A 1SOVA 5BNFA 4GMGA 1MC4A 3DZHA 6ADHA 4C7JA 2Y1FA 2JFGA 4TQGA 3I9KA 5DP1A 3GVPA 2ZTLA 4H15A 1TT7A 1H9BA 2WD8A 3JQBC 3MWEB 2RH4A 3PP8A 4EBFA 3V1YA 1X13A 3RUEA 4IDAA 3FN4A 3DR3A 4PG4A 1VL6A 2IZ0A 2X86A 4OQYA 4FD3A 2YDYA 4XB2A 2DFVA 3L0DA 3LLSA 3WWZA 2WD7B 3I1JA 2V6MA 3C8MA 3L6DA 3HHPA 4W6ZA 4RDHA 4WKGA 1U4OA 2ZATA 4R3NA 1NTOA 3BMQA 2UV8A 3JQ6A 5TSDA 8ADHA 1PS8A 1Y5MA 3ITKA 1CF2O 1SOWA 3H9JA 1DLIA 3K73O 4MVJG 1QYVA 4JIGA 1PL7A 1V3UA 3PLRA 3PZRA 5L40A 4GX1A 4WEOA 2QHXA 3EGOA 2X0JA 4TZKA 3W1VA 4INAA 2AQIA 2GZ1A 5CDYA 1PU2A 1KY5A 3OQBA 4YT2A 3DOOA 5BSHA 2XPCA 5JXWA 2AHRA 3UHAA 2BGLA 5LDHA 4AJIA 3VVCA 4UUOA 1NVGA 1CRWG 1YVEI 4BIIA 4UVEA 5K9ZA 4I9UA 1J0XO 1X7GA 1PGJA 1WDKA 4XR9A 2J5QA 1C14A 3AK4A 3CINA 4M87A 1O95A 5KOIA 1I3NA 4DIBA 3TL3A 1E3SA 3GOHA 2CSUA 1QLHA 2FN7A 3DHEA 3DTYA 4BNTA 1U3VA 1YBAA 4DREA 4EZBA 3DBRA 1DC5A 1N1EA 3DONA 1SPXA 1VJ1A 4BVAA 4E12A 2GNAA 2EV9A 4H16A 2GN4A 1QYDA 3W6ZA 2PKQO 4RLSA 4J4HA 3WGIA 3PIIA 3EY4A 2EG9A 4O63O 2EJWA 5JO0A 1G1AA 1Q7CA 5L51A 4CLOB 3AOGA 4U0KA 1PGQA 3F6YA 1AN9A 4YJFB 4Q9NA 1BDBA 2YYYA 2EW8A 1ARZA 3V1TC 1E3IA 1Y5RA 1QKIA 2AEFA 3INTA 2I66A 2I67A 4FC6A 4YA6A 4BMSA 5JC1A 5HTOA 1GTMA 3HDHA 1E5LA 4J3FA 1PEDA 2HU2A 3GY0A 3E5MA 4E5YA 3WOHA 2BLLA 3QA9A 2PLAA 2NVUB 3ZWWA 3I4FA 3RD5A 1AHIA 3ROMA 1BGVA 2CFCA 3MJCA 4J90A 4O6VA 3FR8A 4DBZA 5L3ZA 4IDBA 5JE8A 3MCVA 3W8EA 4FDAA 1LDBA 1T26A 4HY3A 1ENZA 1ISIA 2ZB3A 4YQYA 3VVBA 2A4KA 3EZLA 4IZIA 4M55A 1HT0A 2Y68A 3ZWNA 1HZJA 1X7HA 4L76A 1PX0A 3ZDFA 1KVUA 1X15A 3WQRA 1LDNA 4B7UA 5L4LA 1QYCA 1KVTA 3I5MA 1H6CA 3PJFA 4YJGB 3UCXA 4YT8A 3DAPA 3JD2A 1R0KA 4TRJA 3PGXA 1C0PA 4CMKA 1J49A 1T4BA 1UDBA 5G4LA 2OFPA 5CPBA 2PZKA 1ZSVA 4MKRA 4LSWA 3ZGYA 3JV7A 4MVJH 5ITVA 1DXYA 3GDOA 4BL5A 3GFBA 1M66A 2C20A 3JYOA 4BGEA 4R5HA 4J9VA 5TT0A 3PWSA 1SAYA 3K96A 4M49A 3X2EA 5IF3A 1HL3A 2HO5A 4I5DA 3ONFA 3PQEA 2XXBA 4IPTA 2NU8A 4A03A 3B20A 1N2SA 2R6JA 1A9YA 1HXHA 2YHIB 4BNJA 1AXEA 4XQ9A 5JFOA 3FNEA 2EGGA 4HNGA 3TZKA 3ZV4A 1YL5A 4N54A 1YBMA 4YTEA 2VYND 1M6WA 3AW9A 2YV1A 1VLLA 3EDMA 3FWZA 4JP3A 2CDCA 2GZ2A 4ALNA 1K6XA 5U4QA 1UP6A 3C1TA 1EE2A 4IMRA 2HRZA 3NX4A 5LCXA 1ML3A 3NAQA 2JCYA 4ND4A 5K6AA 3WMWA 1W6UA 3F5QA 1H93A 3OMLA 4DC1A 1DEHA 5I7SA 3LZ6A 4BNIA 1OC4A 4IS3A 4FFNA 5KIAA 1Y1PA 3EZYA 2POQX 2W2KA 1YOVB 4XIJA 1JQBA 1M6HA 4QO7A 3DHNA 1AUPA 1B0AA 2W8ZA 1DIRA 3C7DB 2I6TA 3D3WB 3S2EA 1YB5A 2OP0A 1WW8A 4GGPA 5MGBA 3JQFA 2JAPA 5JNLA 4F6LA 4W9NA 4ZQHA 3PIDA 1WZIA 2BFAA 5AXAA 3UVEA 1LEHA 2JCVA 2E6UX 4OIMA 5EQFA 5JYDA 1PGNA 3ZWCA 3G17A 2GRAA 1WWKA 1FDVA 4GWGA 3WIDA 3ICPA 1N1GA 4OOFA 4EJMA 3TZ6A 5I7FA 4CM7A 3LC2O 3A1NA 1OBFO 4OL9A 3IKVA 4MJLA 1GUFA 4JJGA 3ZHBA 1P1FA 2YW9A 4YRAA 4A5OA 4J0EA 3UGKA 3RUAA 4YT5A 2RAFA 3W6UA 4S3MA 4QT0A 3KYCB 3GZ4A 3QHAA 4AG3A 2HDHA 4K26A 1H0KA 3FBGA 1D8AA 3GVCA 3QP9A 2G5CA 4QSMA 1ZFNA 5L7WA 4EUHA 1T2EA 4Z6KA 4ONEA 2NTVA 3W4JA 1W4ZA 1WDMA 2PFGA 4JJFA 5H81A 3T4XA 4B8ZA 4CR6A 1RYDA 4CV2A 2IEDA 4XWYA 2O2SA 4RL6A 4ZQGA 4YRBA 2YHUA 1GADO 1DFGA 2DLDA 3TZCA 2BGMA 1YXMA
chains in the Genus database with same CATH superfamily
1XNGA 2Q3CA 4K1XA 3VISA 3HEAA 4BLPA 2WKSA 2YBDA 3SX4A 1C30B 1Y1LA 1YJCA 3OIUA 2JFQA 5HZHA 3IPAA 3DE1X 1HDCA 2YQ4A 1F48A 3TDKA 2VJQA 5T57A 3FDZB 2HMSA 1ISFA 4KQXA 5A05A 1D2GA 4GICA 3Q10A 4AIRA 1JXQA 2I6XA 5CDGA 2J1LA 2AA3A 4RWEA 5GGXA 2R44A 3EH2A 1U6IA 2WD7A 4PWZA 3WV5A 3F73A 3Q4GA 4L8GA 1SXQA 3KAJA 1NVBA 1E9AA 1E9CA 3I1IA 3DGFC 2D0DA 3NAMA 2IUYA 4OHCA 3WNCA 3ZNQA 1NX6A 1CFZA 1QO0D 3EA5A 5K3DA 4AF8A 4E15A 3T5AA 3VGJA 1P33A 1NY6A 2HO4A 4LIPD 1HNWB 2OV2A 1RZRA 1B23P 3FYTA 1S7GA 1JV2B 2AJ8A 3OTGA 4HGQA 2JA1A 1DKRA 2VHQA 2NZWA 4KUHA 3G9QA 2J7KA 4EW1A 3DMTA 2NIPA 3A1UA 3DOJA 3AVWA 1ABFA 1MX5A 2RJOA 3Q3JB 2PBLA 5B1IA 4B4WA 2NO6A 1TK2A 4PGMA 2YL2A 3L1JA 4UEQA 1YCHA 3B6KA 3HXLA 4JMPA 3QPAA 3GGDA 2PT5A 1HDRA 4G1CA 2XV1A 3H04A 3FPFA 1DKUA 1LBHA 2HDOA 4C4OA 1RTKA 1CC1S 1T29A 2DTEA 5E9WA 2WQ6A 1KR5A 4MS3B 2H0AA 4L6CA 3IGFA 3WZ2A 4UXJA 2OZLA 2GESA 5C2JB 3ICOA 4UATA 1XXHA 5CNMA 2QTVB 3THWB 5UKDA 4PYRA 2G77B 1K8QA 3GRVA 1YRAA 4QXPA 3PEFA 4YBZA 3AEZA 3F0TA 2PA0A 2G1PA 4Y7CA 1W35A 5ALKA 2XQJA 3IPYA 2FW7A 3FLEA 3MXOA 4M7OA 1CYDA 1MN6A 4URHA 2NU9B 2M6KA 5K3SA 5CFLA 3IAAA 4XD2A 2VHCA 2D7CA 3L0BA 1AG9A 3RASA 4KREA 5DN6A 1C1HA 1UDXA 3GH3A 2WHPB 1KI8A 2M1ZA 2SKDA 3P9KA 4RHFA 3K0CC 4TVOA 1GUZA 5CIWA 2WC1A 2NQ8A 2G1JA 5ALWA 5JAPA 3VQTA 1V5FA 4A0GA 4RTLA 5T7BA 3KQUA 4JI0B 3LRTA 3PGMA 4RANA 3TJZA 3UY4A 1XJCA 1ZJZA 3MIZA 4IUYA 4LXHA 4KMSA 1D5WA 2WMNB 4M8SA 4E5UA 3AUSA 5KKCA 1EZ4A 4IOKA 1X80B 2CVHA 2FXIA 5K0FA 1NF3A 1J23A 1BE8A 4RCVA 1SUSA 1FFYA 4PLHA 2CLOB 1FUUA 1NNEA 4LF9B 2RGBA 2PEYA 3IJRA 2C5FA 1Q0ZA 2C2ZA 2VNAA 3DOUA 3NBUA 2JH8A 2WIKA 4KFSA 1GZ4A 3SHQA 3TRKA 3U48A 4L95C 3AY7A 5FBZA 3HG7A 1HDYA 3NRBA 4DLBA 3AM3A 1QPZA 4FONA 4M76B 4LDQA 3E48A 3FSJX 1OXUA 2XVYA 3S1LA 3GMTA 3BSSA 3C3CA 2Q2NA 2I4TA 1T2VA 2AK3A 1L4BA 4DA0A 1PBTA 5BWNA 4LZOA 3TSCA 1R74A 1KC1A 2PQ2A 3P52A 1OH5A 3FKJA 4GMXA 1EG7A 1B76A 3A9CA 3AILA 3M1LA 4S24A 1XLVA 5K0TA 4YRNA 1LSOA 3HJBA 4I1IA 3ZNPA 1EVEA 5G41A 4TMYA 2X0KA 3KUDA 3MUNA 3C5WP 3AX6A 3ODPA 1NJ1A 4YB8A 5AM3A 3N1UA 4BNVA 4DN6A 3NV9A 1SXGA 2P6NA 4EJ2A 5M04A 1TZMA 3C5HA 1BRMA 2QEQA 2WJ4A 2ZWIA 2B2XA 4JC0A 4H08A 4ZQFA 1DEXA 4I46A 5FOSA 4OLAA 4LZZA 2FQQA 2IOYA 1KVRA 5EFZA 2BYTA 1JR3A 1CTQA 1U5BB 3PA8A 1RI1A 4TYMA 3VH2A 2DJ5A 1LLQA 1MJFA 3L6OO 1RAAA 3DDSA 3NTOA 5EIOA 4UMFA 3I5XA 4FYIA 4QGFA 4X1KB 1EE1A 2P2NA 3H13A 3CUEF 2R7NA 3MGGA 2FWAA 3TXYA 3PQCA 1F9EA 3L04A 2RAPA 3CZ4A 2I4IA 3A0UA 1F5NA 3GK3A 3HDQA 1R4ZA 2C54A 4UARA 1EHIA 1IHUA 5F1OA 5I45A 2EFCB 3FVRA 2EYUA 2VQEB 1OE0A 3MXTA 3V7FA 1GXSA 1UANA 4E30A 5FEUA 2O59A 5DGTA 3QEOA 3DAHA 4DANA 1GQRA 4MXDA 2HT1A 3ESXA 2EJTA 3W9BA 3U09A 2CFSA 2Q5HA 4LYGA 3G3EA 1TW2A 4AC9A 4O59O 1FYVA 3QWFA 4JI2B 1AS3A 1AN0A 3MJHA 1A4XA 1ENOA 3WR5A 1YUBA 2CEKA 5ENDA 2C88A 4LF5B 2X6QA 3AL2A 1XA3A 2ZRHA 4FHZA 5CLFA 4E88A 1N3LA 2CZCA 3KYIB 1TKCA 1A7KA 3H1EA 2PDAA 4RK0A 3HM9A 1W8DA 1G9SA 2IHJA 5JI2E 1XJQA 3F4BA 3EVFA 3L7DA 2CVPA 1RM5A 3NDRA 4XYMA 1Z7EA 1SRQA 4GZ5A 3AVYA 4RABA 3MBOA 4PRYA 4E1AA 1UBHS 1A95A 4TVKA 3DE7X 4MV6A 5EP2A 4QELA 2CSXA 5JZBA 2Y71A 3R9IA 2JI6A 4MPDA 1W36D 4BO2A 2NX2A 4F4FA 3BH7A 3CNBA 2CLMB 2RHWA 4DM3A 2GM4A 2NGRA 4ACBA 3C5CA 1X9HA 2VSXA 1X6VA 3RAFC 1QP7A 4ARSA 4GPBA 2A30A 5ERXA 1RKUA 4C4RA 1JPUA 2JS7A 1ODCA 1KI9A 3G85A 3RHSA 1NSFA 5LQRA 3AXSA 4KSCA 3AERB 3L84A 1WCV1 1N8NA 5H3CA 4C6RA 4OA5A 2NTEA 2DWCA 4I8IA 4F38A 1E2JA 1SELA 4AX8A 5KDLA 1H2HA 5HOQA 4HQ0A 3D2BA 3H1TA 2FZKA 1NP3A 3SFVA 4WY2A 3MOIA 4KWTA 3NHFA 1PZHA 3KKZA 4I14A 4Z0PA 2VHZA 2JA2A 2NVOA 4XYLA 1RQLA 4ZI2A 3ICQB 2ERCA 1N3IA 1NAIA 4YYEA 1X1TA 1YAJA 4QDTA 3JQPA 1KS9A 4HMQA 4P9NA 1DC4A 4RC9A 4Y2RA 5CLQA 5JS2A 3VZDA 4NXMB 3OCVA 1BTOA 1TKBA 4A2PA 3QLEA 5EVCA 3EGVA 3FYSA 1N92A 4DIMA 2GBLA 1VL5A 5LA6F 5JNUA 4H3KB 4PLWA 1GG8A 1KFKB 2HQSA 3PICA 1QZ3A 4FNAA 5TVGA 1B0ZA 1HT1E 4YMGA 3S8EA 1J2UA 5B5SA 1S5PA 3MTBA 3O8QA 2ONZA 1NATA 5A6SA 2DVMA 2XGOA 1J0AA 2D5IA 3NHYA 4NH0A 1KYWA 2YWXA 1WY7A 3INRA 1Z3CA 4M4SA 4QULA 4WLEA 1WTAA 4A26A 5AW5A 4EF6A 5IJ0A 2A5LA 1BCRB 4EPRA 2WMYA 3P7MA 4G1UC 3FDFA 1NZFA 3PHIA 1MF7A 2JBWA 2VLIA 1AKEA 2OD7A 1G8SA 3SQLA 5L3RA 4O2AF 2F8SA 2V5UA 1O57A 1BHSA 1XN4A 3D4LA 1RWXA 1RYYA 4Z3KA 5BVHB 5HR5A 1Z6ZA 2GJ8A 2YRWA 4CT0A 1HLFA 4ZFNA 2PMCA 1Z13A 2RE8A 3VR4H 2C8KA 2WHPA 3MS7A 1GAJA 2HGZA 2X3FA 1OKKD 1JDUA 3NOOA 1A4RA 2BH9A 3DO8A 4KVAA 4YCMA 1VE1A 1OT3A 2A88A 1I1OA 3UCFA 3VNAA 1A76A 2GPSA 3SX2A 3REGA 3JQEA 4GMDA 2FUG1 3LT0A 4DC0A 3WGVA 4EKNB 1PDWA 3G6KA 4AJ1A 4LDNA 2V7XA 2QR3A 2ZYHA 5G3ZA 4KTVE 4B80A 1Q7EA 2E1RA 3L6CA 3L7BA 1QQBA 2RHCA 4H1WA 1OIVA 4Q9IA 4BKUA 2HPVA 4OOEA 5FUXA 1APBA 4D4KA 1CY1A 4EA6A 1QX4A 1ABEA 4YPVA 2XT0A 3JRWA 2GZSA 4G8BA 3BE4A 4PX3A 4JLAA 1E6WA 2TMGA 3KJQA 4YC7A 1PK7A 3LT5A 4EJSA 4ZK2A 1QGZA 1BEUB 2IVZA 3DF7A 4ND5A 1WX1A 4RF2A 1QRRA 4WLNA 1NVFA 4XPIB 5AK4A 1NMEA 1PTKA 1V1RA 1YDFA 4RTJA 3ZQKA 4PFQA 1JHXA 3EEYA 2VNIA 4K9NA 3CGWA 1UIRA 2Y1LA 4HUQB 3ZR4B 1UQTA 2B3TA 1LQTA 2R6R1 2R00A 5ICGA 2PQ0A 4GVLA 4I9NA 2Z95A 1U0LA 2JFXA 3ZLTA 4CHTA 4X3CA 3ENZA 3MT8A 1WUTA 4UOQA 1T8PA 1A8SA 3N8NA 5EMNA 4TYPA 1F2UB 3SC3A 1UBGA 4CFSA 3IUBA 4NYMQ 5AVTA 3D0KA 1I2BA 4I4CA 1JU4A 3KV3O 2AMJA 1R37A 4QOGA 5F76A 3WK4A 4CQMD 3EPPA 2MINA 4OPMA 4NDNE 4DUPA 5SYAA 5LD2B 2P2SA 1QZTA 4BV3A 1BS9A 3FZEA 5AO9A 3C7TA 5AUOB 1ZY2A 1J9EA 2YWRA 1I2AA 3HB9A 4HN4B 5HWSA 3ZVRA 2BTQB 1EFKA 5AXCA 1JW9B 1O8CA 1Y6RA 1ZICA 4Q4JA 1QM5A 4TRNA 3NO4A 1WPXA 2C7GA 4H17A 4ITUA 3SG0A 3FHTA 1QBKC 2JFOA 3WL5A 3P45A 4DA6A 4CMEC 4MRMA 3VR4A 2RGNC 4RU1A 1ADBA 1M2VB 3IP9A 5FD8A 3QF4B 4X24A 5CH3A 5EHNA 2XDYA 5DHUA 3NJ4A 4AVYA 4CCWA 1TZBA 3ZY6A 3L1IA 3HWX1 2FFBA 2O2YA 1SXPA 4UDOA 3VKUA 5ED4A 2ZTUA 4CQLA 1U7XA 2OXEA 3VDXA 2BI4A 4DUGA 4WA8A 4F91B 3EEQA 5A3JA 4QRIA 1D4OA 1FXWF 2SHKA 1GL6A 2OECA 1ZNXA 3NYRA 2GPNA 5T8KA 2JLRA 4MV4A 3EUWA 5EUCA 1RD4A 2DT8A 2G28A 4XVHA 1NQAO 2B4YA 2W2MA 1KZ7B 2XTAA 1Q3TA 2XWSA 4LXTA 5JAHA 1C1DB 2GYVA 3H2BA 4L4XA 5TQ0A 5HK8A 2D62A 3E03A 4ZC8A 5JXHA 1JKXA 1GY8A 2WV9A 2Q62A 3ABZA 3KVYA 3O3OB 4DHWA 3QW2A 2PH3A 1MQ9A 3DWEX 2C29D 4OLBA 4CBVA 1U5CA 1IZ8A 3B3FA 4II7A 3U7JA 3I1FA 3NFYA 2DU8A 3DQPA 4YV1A 1V4NA 3S8YA 4YFVA 2XOKD 4EHFA 3DBIA 1NKSA 2Z8XA 4JJKA 3VVMA 2YN2A 1BAPA 3OZGA 4J7AA 2OHVA 2PT7A 5JOQA 1TQ6A 1W48A 3RVNA 1E3EA 2I65A 1YSCA 2CUTA 4GEKA 1UXHA 4K6FA 3T4PA 3VHQA 3TECE 1NHWA 3ZK8A 1UBJS 2Q3HA 2GEKA 3KXIA 5A0TA 1A9QA 3EG5A 4YX9A 2C0CA 4QUIA 1D2AA 4N9WA 4A6XA 1ZM7A 1E2MA 2JJ8A 4G67A 3JY6A 5DBIA 5IABA 3OCCA 1WPRA 1AO0A 3TI9A 2WJVA 2P5YA 5A9TA 2CY0A 1GCGA 1N5LA 4E5KA 1ULTA 2NU6A 4KAFA 5EWMB 1DX6A 3OX3A 1PJ3A 1C81A 1YHNA 2JC3A 4UEJA 4D6XA 5LXTF 2VG8A 1SCAA 3LWZA 4Z86A 3L82B 3QXGA 2XVMA 3X1DA 3ELWA 5JH7A 5AKZA 2XWQA 1IVSA 1WIWA 2VHEA 2W00A 1X7XB 4EB0A 3ES9A 4IRUB 4PSUA 2XUHA 5BUZA 3RT1A 3VPBA 5ALMA 1YACA 5T4FA 2ADFA 5JZ9A 1D4AA 2AJLI 4ZVNA 2RI6A 4PTLA 4XIYA 1RVV1 5IT9A 2Q9CA 3CB4A 3E7PA 1B15A 3ANMA 4B4VA 4MDYA 4ND8B 1EIZA 3VU9B 4CKEA 4M1QA 3LDHA 4NK4A 1GZVA 4B7XA 4M1WA 1XAHA 2ZWPA 3A1EA 4HL6A 4I6EA 3ZH2A 3O4VA 3ED1A 3GROA 2ZLBA 1L5OA 2OV4A 2HH9A 4ZOBA 2ZXEA 2V7VA 3TGPA 3TZHA 3O26A 1SBIA 2Z3ZA 3T94A 4MUIA 1S8OA 1F8GA 3NKLA 4NBKA 1IOZA 1YCDA 4DQUA 1W52X 4IGFA 1Z6XA 5DOVA 4JT8A 4JELA 1M1YB 3D31A 3PEWA 1JG4A 1KI4A 5HMLA 2VK1A 2RB5A 1OI3A 4FMCF 1EK2A 2QZZA 3HWSA 1N7JA 4QUDA 5EIFA 4EMTA 3OJFA 4LZNA 3VO9A 1ZISA 2R66A 3AB7A 5KTRA 4AQ7A 3JVVA 1FSSA 1Q3KA 1BU8A 2PH1A 5K0NA 4AXXA 3CF6R 2VJLA 1F2TB 4AZ3B 2IIVA 4QUEA 4X5OA 3WL4A 1DAKA 1E79A 1PZEA 1NPTO 2BOVA 5THQA 5CURA 3IUPA 1D4ZA 2ROQA 3W4KA 1VB5A 2JIZA 4CM4A 1Z0IA 4PIVA 1TCCA 3M0EA 4QTYA 1H2AS 2WUFA 4I7EA 4IQ4A 3SBEA 3IQFA 4HGYA 1NT2A 1W30A 1X7DA 1FP1D 2FSSA 3F74A 3HGQA 1R9GA 4TVBA 3FTEA 2B5VA 2O2IA 1XEWY 4W4TA 5T4HA 3BEDA 4GXRA 3Q3HA 4ZDIA 1SB9A 3WLIA 3P26A 1JDSA 5DM70 5B57C 5CXQA 4NDZA 3TZQA 4JWKA 3M1IA 4BO6A 3UJPA 4O4IA 4KFCA 4R41A 2OD9A 3RUIA 3E9QA 3H5IA 2VXYA 3GLHB 5D84A 2OAEA 1DAOA 4EFMA 2W2LA 4WJKB 2GB4A 1DKPA 1VA4A 1B00A 2OO3A 4UMVA 3K1AA 3O8OB 1ZVJA 3K35A 4IXWA 5JQGB 2HMWA 4MI3A 3GQVA 4RH3A 3B38A 3QEBZ 2RMKA 5B3LA 1BVUA 4DV4B 2QSJA 1SC1A 5KYUB 1KQNA 4MAFA 3K0BA 2ZSBA 4HYTA 1E79D 5JSYA 5KQSA 1FQKA 4LZLA 5JXGA 2Y1XA 1IBCA 1GPWB 1KJQA 4FMDF 2GCPA 5FTLA 4GBED 4DPMA 2CWDA 3BK7A 1XL1A 4JCCA 4LGVA 1GZ6A 4NBSA 1IMJA 1FS5A 2VJMA 3RTAA 3G5TA 3OE4A 1DPGA 3K31A 4BATA 1FBTA 1OZAA 5BW5A 5HJ5A 2GKOA 3GJ7A 3NP7A 4UHJA 3BJMA 3RVSA 2O8DB 1NBME 3MCTA 2WFLB 2CC2A 2W6MA 4AO8A 1JBEA 2JLXA 5JD6A 4C6TB 5JZOA 3SXPA 4NS1A 2H07A 1RWMA 3HZZA 1HDIA 4R16A 3AF4A 4JXZA 2XB4A 4WKBA 3UJ6A 4IO1A 2JLWA 2JD1A 4D98A 1V2HE 1MZPA 3M2TA 4LJSA 1X2BA 4OFZA 3D6MA 1NOIA 3I9MA 2FR8A 3RV3A 4FFBA 1YUMA 4D8YA 1QJCA 2ZITA 4PRZA 5CXUA 2GXUA 1Y1SA 2ZIVB 4H1TA 3RUPA 1Z2OX 4QD3A 4EHDA 2ZVDA 2C2KA 1KZYC 4FHFA 5T64A 1XL0A 3A1CA 1SNYA 1N0UA 4X1OA 4LYHA 3TCNA 1T5SA 2XDQA 5MGNA 2C7RA 5LUBA 3OX4A 4OK3A 1Y8RB 1YQXA 2JCXA 2ATEA 4B76A 2AEJA 3E8SA 4Q4DA 1F7VA 4PAMA 4WTOA 1Y3AA 3RRMA 4U8GA 2D2FA 3G59A 4YRCA 2IV7A 2AEEA 2YASA 4PGFA 4H1HA 3CNHA 4MRMB 4YASA 2EL7A 2Z43A 3KCQA 5BXQC 1TEZA 5E95A 1ZONA 3LUFA 4RGVA 4C01A 1TOAA 3OIWA 3LVFO 2XUPA 3D7LA 2SKCA 3MAJA 4YO7A 3VSBA 5KYXB 4RTPA 1Z88A 1ATZA 2HSWA 4G56A 2JH3A 2AD1A 3GD7A 2QL7A 1DG9A 4KHZA 5KI6A 4X65B 3C24A 3ZZNA 5FI3A 4IKOA 3C0KA 4TKZA 1T9DA 2I1QA 2WAAA 1GPYA 2ZS8A 4GZLA 4A8PA 1WETA 4CQMB 5A62A 1YULA 2AXNA 4KACA 1Q11A 3AI3A 5TJ9A 1J2TA 1WHTB 2H0QA 5B55A 3KKKA 5CB4F 4CLOA 4MVWA 5JBIA 1XLTC 2X40A 4YRZA 3E70C 4IJ6A 4ZJPA 1U7HA 3O8NA 3I8SA 2XX3A 3PT5A 1K27A 3PK0A 3BB1A 1VC2A 1ZZEA 3PTZA 4LQDA 1T2FA 2OYSA 2RH5A 3I6QA 3IIEA 3U9LA 3UJ3X 4BMZA 5I9IA 4WGFA 3CWZA 1FK8A 3G88A 1H22A 1T1RA 1WP4A 3I5UA 4L6IA 3VJKA 1T8WA 4B74A 2W5UA 5KMGB 3PNYA 2FPIB 3BL6A 1NJ6A 5EYPA 2Y9MB 5GY7A 1XE3A 3GJZA 2QBYB 1WVIA 3VOBA 1ORHA 2JATA 5DNYB 4KDRA 1EUDB 4RDIA 3MD9A 4WE3A 4FN5A 4ZTZB 5AW6A 2IH4A 1C41A 3T38A 2I2CA 4RELA 1XEXB 1Y1TA 2PT9A 3AY3A 3PRHA 4C4YA 1DFHA 4E1VA 1JBKA 2KQUA 1NR1A 4I1UA 1RP7A 2B4QA 3BMCA 3OWXA 4P4LA 4YV7A 4C2UA 5ADHA 1SN7A 4YP6A 2OD2A 3CU5A 2DB3A 4RLFA 3FKSA 5ALXA 3UHOA 3ORFA 3NQ41 4WADA 1Q77A 2YZKA 4GPD1 1NYLA 1KVSA 1XTZA 2JIBA 3F7TA 3ID6C 4NTZA 5JSKA 2NW6A 4DLXA 4KGDA 3AHGA 4Q19A 1ECCA 2C92A 2CLKB 4X8LA 4GF5A 4OXYA 4I55A 1FDSA 4M1MA 1OILA 4KFUA 4UQOA 1HDGO 1I0ZA 3GUUA 5KOYA 1ZAKA 3BJIC 4IRXA 2BMJA 3DZKA 4NMMA 4QRDA 4PYIA 1U04A 1T5HX 4HRXA 4XFDA 5LQAA 4UAGA 4B33A 2P2ZA 2BFFB 5FTNA 5J2UF 1N5JA 5DTQA 2PD3A 4LS3A 3W6PA 4JLBA 4JI3B 5B2FA 2EYQA 2REBA 3DH0A 1Z25A 4YLYA 4JKOA 4MYDA 2ZUFA 2A1TS 2B61A 4G0OA 5F12A 4DSNA 3EC7A 1IY0A 3KB1A 3CGGA 1MOQA 1NU8A 3B1FA 4NU0A 1GTVA 3T95A 3AM5A 1UAAA 3V8VA 4DWOA 1ZN9A 3AG5A 1FFBA 2O3JA 3OCZA 1U2PA 1OAOA 3AM1A 4ZVTA 4TZTA 1CQWA 3OO0A 4I55F 1IUPA 1B3RA 2WE8A 2J32A 2PSFA 5IMSA 1QVAA 2H4FA 5E4JA 2IRWA 3BMNA 2XCQA 3KSMA 4ZCSA 4I2VA 1YCFA 3WGQA 5BRNA 4DCCA 5KC8A 3WSVA 2V6FA 5TE9A 4YAGA 3ZDBA 4N0EA 1YK1A 1GD1O 2ZDHA 3GQBA 2SECE 1J7JA 4LOIA 3WB1A 3LVBA 3EAGA 4LYAA 3TGWA 1GILA 1X2EA 3A10A 2H1CA 4EA8A 4ER7A 2XCIA 1AO3A 3GPBA 4PYMA 3HJCA 3M4NA 3LUGA 5D3MA 3R7LA 3UYLA 3KKOA 1KYYA 1OA0A 3NONA 2YHAA 2V7TA 3R76A 2WG1A 3EBOA 5L95A 1USUA 2HM7A 1IB0A 2EWWA 2G9ZA 3G1UA 3GEBA 3GNQA 3IEXA 3PHLA 4IHAA 4B0OA 1KPGA 4G07A 1TIBA 2FVXA 4DM4A 1SVUA 4IWYA 3ZNOA 1O5IA 4QQFA 2N47A 4FDTA 1MB0A 1VYVA 3F3YA 2GFIA 2J0SA 2CCGA 1GOTA 2HMAA 2OHXA 4PAGA 4RY2A 4TT8A 5JCOC 1WDTA 1ZJJA 3BGIA 4PQFA 3BFVA 4I1VA 1PR6A 3JD3A 1R8YA 3QJ5A 4J03A 2EIXA 3JTMA 3A9VA 4ZT5A 1N0HA 4IX9A 1RFLA 4TVSA 2F8LA 4OKSA 3PFHA 721PA 3ZVMA 4BNHA 4U00A 4OLJA 2JZCA 2QL6A 3PDJA 4F0JA 1FUKA 3O7MA 4COOA 4DNQA 2P1ZA 4U3JA 1XJ0A 4IYJA 4CTJA 1L8OA 3N58A 2EJCA 4FGLA 2WOOA 2IHKA 3NNNA 4E5MA 3NEYA 4B3GA 3L4BA 3AXTA 4L0CA 2LPMA 2NV2B 4I1OA 4Q6WA 3A1VA 3DB2A 5TMPA 1J7KA 3PYLA 5I3CA 4RY8A 3LUAA 2W6ZA 1OB2A 1YZVA 1CUIA 3PHJA 2GERA 5D8DA 3H75A 4WLVA 3CURA 3OJCA 4HQRA 4CUKA 2N1BA 1WCWA 1ZESA 2JJ1D 2FLWA 4D5EA 2H5JA 1NVVR 4TTVA 4C1BA 1JEYA 3EBPA 5GVSA 5EWLA 2V6GA 1NJ2A 4A8JC 4A73A 5LQCA 4JFAA 3T52A 1U5BA 1M2FA 1ULUA 1YZTA 4GKBA 2EP5A 3GO4A 4JUAA 1PFKA 1TZ2A 2V6IA 1JDVA 3IAXA 3OJ0A 4CV0A 2I33A 4EENA 2NUBA 3FJ1A 3DEAA 3FKQA 4ZP1A 1P73A 4CXMA 1FS6A 1NUHA 3QTTA 4Q3NA 3KL4A 3TNFA 3K2BA 4QUHA 4CU5A 1NDQA 1ZK3A 5BQPA 4KWHA 4L6AA 1G291 5AIBA 3WS7A 1XXHE 1ONPA 3G89A 2ZJ7A 1CJSA 4NE7A 4NLLA 1FTNA 2HYDA 4DY6A 2CB9A 1H0HA 1QS0B 2WSSD 3CRW1 4WBXC 3KQMA 1ZC3A 4O4JF 1PR0A 1XP8A 1I33A 2XZDA 1VFPA 1CUUA 3NI2A 5D6OA 3OE5A 5JLJA 1VE6A 1MU0A 1ORVA 3M89A 1RXEA 3DLIA 3DJYA 1FSFA 3SKXA 4DR2B 1PLLA 2H3EA 2ZB2A 4BLSA 3TAUA 2Y27A 3KXLA 4YYZA 4GOXA 3L02A 3VKGA 3OCYA 4BTLA 3EXFB 1PX2A 1Z39A 4DPKA 4V1CB 1XDWA 3A9UA 2G82A 2VSQA 4W9RA 3U40A 4C0WA 1KH1A 1SIUA 3K6RA 4MUKA 2FLKA 5F35A 3RRYA 1DARA 1RPJA 3TIGA 2P9EA 1H1DA 3GVXA 1PJLA 3N6VA 3PFGA 5FOTA 1EFVB 1E7WA 2FG5A 2X4IA 3G8BA 3JASA 3R3SA 1R6BX 3N2EA 3JQGB 1R88A 4WY8A 5BV1A 4P0QB 4P3OA 1UZLA 2ZBRA 4LBYA 5IUJC 6Q21A 3N3BC 4QWWA 5KQLA 2Z3WA 1IQ0A 1Q20A 1RWNA 2HF2A 4M0KA 1MHTA 1CR0A 1XTQA 1M8GA 1HOTA 1R3UA 1ZI8A 1AK2A 3PUJA 2CVFA 4EFDA 4MQ5A 2P0YA 4I2NA 1QIGA 3K6SA 2D0PB 2YJZA 5L4SA 3SHWA 5CBPA 3ECSA 2YUIA 1AU9A 4EGSA 5REQB 4WVLA 1S9DA 2NYUA 4OUKX 3H18A 1VP9A 2VP4A 3SIPA 3AFNA 4BQRA 1XQXA 2GKSA 1XEXA 3CG4A 1G3MA 3KU1A 1PDVA 3KE8A 4OH7A 4TUYB 2EW1A 1UK6A 2IV3A 3RWBA 3M4YA 3B9RA 4WINA 5AM4A 4JJAA 4LV5B 4OGKA 5EXPA 3AHJA 5GPBA 3AVVA 4G8DA 4PO9A 4WSOA 1IEQA 4JEHA 5SZJA 2J3EA 5CA1A 2HF9A 3BWEA 5MHTA 1TC1A 4YJKA 1D2HA 1YJXA 3U3JA 3GT3A 3NHBA 4NHOA 4S1PA 4MI6A 1VE3A 3L9WA 5LN1A 2HCJB 2XZOA 1CHDA 2YVLA 2DHDA 5DHSA 3KT8A 1NF8A 4MQ6A 1JDZA 4QUKA 4Z7NB 1L5HB 2UU9B 2O57A 4GI3A 1A9RA 2DSTA 1XZLA 1BCRA 1H4TA 2QIPA 3H2ZA 3OD1A 4UE6A 4EEZA 4F2WA 1U1EA 4UTOA 4D56A 4NU8X 2PO5A 1UT8A 3AUAA 5BSUA 3EIHA 2Q5CA 3HYLA 5CVUA 2GEVA 1H1LA 1E7MA 1G4AE 5KJEA 1FXWA 1XU9A 4OM8A 5D1HA 1VRCA 3AKCA 4ND6A 1AIPA 1CDZA 2YQZA 3FAZA 2VAXA 3R0XA 4ZT2A 4EPTA 1YFJA 4BRWA 3G2MA 4RXTA 4GQAA 2PM8A 1IK4A 1NONA 2ZQZA 3FOZA 2A9QA 1CERA 1IZYA 3AVQA 5AI9A 2WT8A 4C3UA 3AQIA 3AIIA 1BMFD 3SYMA 4YUZA 4M7WA 2XUQA 2IYLD 4M9CA 1Z3IX 4Q3CA 1Z5NA 2EEZA 3B60A 3GYGA 3MTEA 5E7MA 3OZCA 3HKDB 8GPBA 5MDHA 5TT1A 5IVKA 1EVIA 1Z4MA 1T9CA 3IILA 1Z0JA 4JD5A 2OM2A 3CJRA 2Q7DA 2X9NA 5KQPA 2W48A 2F3PA 5LXTA 2YZMA 3N2KA 1NJFA 4ZU1X 1ZAYA 2GK7A 2DPHA 4RY0A 4XSVA 3S99A 1PVDA 1VLMA 4RM3A 2XMDA 1QSGA 3SWWA 1ZUNA 1SCQA 3EK2A 1V96A 1AGNA 2QQGA 2XDWA 2G0TA 3W9SA 3VPXA 3DEHA 4XOUA 1CEXA 5IMBA 1KWKA 3I4CA 3KQLA 1A2QA 1KKLA 1AUOA 2C9CA 1NRWA 2WFZA 4CIXA 5IDXA 2GPJA 2IY7A 2FCAA 5M34A 1BH2A 2D5BA 3B1JA 4HATA 1KPIA 4ZHQB 4CIAA 1MT0A 5JS7A 4QM7A 4HZUA 2EWVA 2YRFA 3NIBA 3QF4A 1N3BA 1W96A 2EIHA 1RPTA 5ICFA 4NXNB 1CY2A 3WGNA 1EWRA 3CRVA 2BSAA 2VJNA 4K6GA 5J2UB 2JF0A 3P5SA 5FI1B 3F7NA 1TUGA 5AOCA 3ON5A 4HLNA 5H1YA 3D1VA 4DIEA 2EKLA 1XZMA 1Z4JA 2C2YA 1HLGA 4G1BA 3I6MA 4GH5A 3OJWA 5TNXA 3UOGA 3CLUD 5CW2A 4DLTA 1FYDA 1X86B 2WEKA 3GGCA 3I76A 1V5EA 4JX8A 3SYTA 2DFNA 1JR6A 3TG8A 4ETNA 1BQ4A 2ZVJA 3GA7A 4DMGA 1MQ8B 4XYBA 3P19A 1QRUA 3DCJA 4H0FA 2TSYB 1QS0A 2ISSD 1NWCA 3DVSX 2EC5A 3CNOA 3STHA 3F7MA 3PT9A 4JB3A 3DZJA 3WK6A 4EEKA 5HIKA 4MK4A 3RNOA 3GA0A 4J29A 4FUQA 3LA8A 3UGTA 4J91A 3PENA 1JVBA 2WNIA 5ERYA 1HYHA 4E5DA 5EE5B 3T9CA 5KVAA 1GPH1 4FYWA 4JR1A 4C0BA 4K8RB 3FSGA 4H4DA 1G20B 2F1OA 2I4MA 2K7ZA 2J0UA 3H8WA 3NOQA 3RODA 1CF4A 4PC2A 5LDDC 2HSEA 4RIHA 4RO0A 2YVQA 2P65A 2HPAA 2YUTA 5ABPA 2A57A 1I3KA 3R0QA 5CU7A 4MVCA 5LBIA 3LQRA 3UZUA 1JFVA 1GA4A 1GGVA 2ERYA 5LMUB 2BSXA 1C3XA 5TXGA 4DPLA 2Q4RA 4DDKA 5TMEA 3HP1A 1PGOA 2H2HA 3N2GB 2ACKA 2A0FA 1OU4A 1SZCA 1IBMB 1O94A 4R2MA 1P0PA 3QFRA 4ZAFA 3QYJA 5F33A 4HH1A 3Q7QA 3UTDA 4BC0A 1E77A 2JKYA 2G0NA 2OENG 2WILA 4HMPA 1KJ9A 2VAWA 5K8JB 4DR1B 1V5WA 1WU7A 3P0IA 1P80A 1WW2A 1G3IA 2FE4A 2GGSA 3TLGB 1OF1A 3UENA 2XRYA 4KIWA 3KWFA 4PLYA 3E18A 3KUUA 1QFZA 4ARVA 3AI1A 4KPGA 3QKSB 5GMOA 1V3VA 1V26A 1V8PA 3LP8A 1OLXA 3PCXA 4MHOA 2G4VA 3D0OA 4Q34A 3RSCA 3TOZA 3U7QB 1PS0A 4TWRA 5IPFA 3MILA 5EEGA 4B83A 1E0DA 3L7OA 2WOJA 1D1QA 1SC4A 1DG1G 1I36A 2EKPA 2WZDA 3N2LA 4DLNA 5IDWA 2BZGA 2Z1MA 3LUKA 1L7NA 5CITA 1N1MA 1XEFA 3DL7A 1FYEA 2XCUA 2NU9A 3OJOA 1ILEA 1HORA 2PRSA 2YJGA 2F1JA 1DX9A 1EWVA 2HWUA 3DFMA 4JUDX 4DR3B 2W71A 3ZXIA 4ETWA 1ZCZA 4IL5A 2PRIA 3L2OB 1XCLA 5A4DA 1CJTC 4TPKA 1T0IA 3KBOA 5AVJA 1DSSG 3S7ZA 1KAGA 1ST2A 3I0MA 4QTZA 1E2KA 2RHLA 5F2EA 1SC3A 4B71A 4D74A 6AT1A 5JEEA 1QZUA 2J3DA 4KVZA 4U2DA 5EXTA 4N5LA 1CZHA 2QTWB 1D6JA 1G0NA 5CT4A 2A8YA 2ZAIA 4NICA 3ROXA 1Z5GA 4AKSA 3KB2A 1E9EA 1M7GA 5SYMA 1F38A 2HQRA 3MRTA 5FPHA 4Z7QB 4DR7B 2ZAOA 1RWKA 1WA5A 4QQKA 3DPIA 5AKIA 2X5OA 4L4RA 1Z4KA 1GITA 2XNJA 3I32A 3UW3A 1UFQA 3VR6A 3FI0A 3H16A 3A1FA 3SQOA 3WMFA 2O8BB 5JIBA 1VJTA 1W94A 4HTFB 1LPBB 3IHTA 4JB2A 2WSYB 4BLTA 2PXCA 2JGEA 2EF1A 3M1AA 4IO0A 5ALTA 3BDAA 1YQWA 4WXPA 1SBHA 5HF8A 2OHIA 4B4DA 3NBFA 4EHBA 1V9CA 3E4CA 3ORHA 5D86A 3VFDA 4OAQA 3RC9A 3HYRA 2RG7A 4OP3A 2G5GX 3NT5A 1WCIA 2YH2A 2J87A 4JLSA 3KEOA 3O1JC 4BS9A 2PVPA 4W1QA 1OXVA 2YYZA 2FPLA 3E9NA 3AIOA 3S2ZA 3WMXA 3MUOA 2KWIA 4AO7A 3KXDA 5J1TB 1R0SA 3S4YA 2CZQA 2Q4BA 2R1VA 1AQYA 2BF4A 4E94A 1YI0A 2Y6UA 4X94A 2Q4OA 1A2OA 1VIVA 3L7AA 3QYFA 4AJNA 1N8KA 4YCDA 4C89A 5A06A 1TQ4A 2ZI5A 3K9NA 4QNRA 3IOBA 5IJZA 1G6KA 2XCRB 2PWYA 4FGSA 2OXCA 1CKEA 4DCGA 1HE8B 1DJNA 3AQ4A 4R81A 3HUEA 3PSAA 4CMBA 2GD0A 2VYQA 2B1QA 2F48A 1YB4A 3BMOB 4F9EA 3UV3A 4WNIA 3DDOA 1RJ9A 4JI6B 1PR9A 4F9FA 1YJAA 4MVJF 4LVCA 4YVFA 3TLKA 1PL6A 3IPRA 4HV4A 1REQB 1EUDA 1GJRA 4OI4A 4DCSA 1HETA 1U8UA 1NVKA 3SR0A 1TAQA 3MLBA 2R7MA 3FZNA 5JHGB 1KY2A 3T7KA 5BN3B 1SKMA 1B26A 3E3MA 1LSJA 4JOCA 1JMKC 3AHHA 4D7AA 2JAQA 1TRKA 1XALA 2QD4A 4QGGA 2DUJA 1IWOA 1NKTA 3QFFA 4DCNA 3ESAA 2YW2A 2XZPA 4LHWA 3OM8A 4KU4A 1FCJA 1NN3A 3EGIA 1LQUA 2QNIA 1M3SA 1XEAA 1ZLXA 3G68A 3ONDA 4R83A 3I5AA 4QTTB 5BQ5A 2O7QA 4A0HA 3ZVKA 3LWDA 5HRCA 1JE0A 4OYRA 4W8OA 2WM3A 1P7VA 1F6WA 5DYTA 2H0RA 2PYIA 2EX0A 1KSGA 4IV5A 4EFNA 1G98A 3LECA 3THOA 2A1TR 4BUCA 421PA 2ZJ5A 2X0EA 1J22A 2YY5A 4CQMA 5AUPB 1WP9A 2NZYA 3KKEA 1LJ8A 1V3TA 1Y9ZA 2QRVA 1KOFA 3S1AB 4WZ6A 5K0BA 1Z5ZA 3K09C 3N0VA 4PYOA 5DXFA 2FWMX 2XUFA 2GH1A 4TT3A 2IUSA 4TV9F 4HAOA 3O8BA 1U2EA 4ZODA 5ALYA 5L3QB 3CNNA 3BRWD 3KR0A 4I4IA 3A4IA 2YZ7A 2J85A 2ZSEA 3KQTA 1MXHA 3ETGA 4KQ1A 1XHEA 13PKA 3GG9A 3GJ3A 3KDSE 3NORA 5DZSA 3SJ7A 2QBYA 2OR3A 2QT1A 3B13B 3OX2A 3HO1A 3LO8A 3PA6A 1HX7A 2ID7A 4ZVOA 4HAUA 1TQDA 3EJWA 1Z2EA 3KYDA 3WNBA 2TRSB 4F1KA 4HX9A 3W90A 1EM8B 1GKIA 2IJGX 3U6BA 2ABWA 3NHPA 5FR1A 2W8BB 4W5QA 1BNCA 1TA9A 2AX4A 1EXVA 4P3KA 2AG8A 1M1UA 1Y8RA 4UHCA 3A3PA 3GEIA 4BQPA 4HB4A 3VPFA 3DT6A 5CLJA 4W8GA 1AH2A 4BO5A 3GLIB 2VJDA 4X1IB 5ULLA 2LRHA 5FBVB 4J1QA 4QOEA 3I23A 1DLJA 3GT0A 3RROA 2FMIA 1FNDA 1N3YA 1W0KD 1IE3A 1MB9A 1QK4A 2BFFA 2CHVA 2D1RA 2D8AA 2M9MA 4L2IA 5KYXA 4MCIA 5EJ5A 4R0NA 2O1XA 5LU8A 4L8WB 1NQWA 1YBVA 4QYMA 4PPNA 1L7OA 3O84A 1PWXA 4IXNA 5FWYB 2I76A 1DCFA 3HU3A 4FOSA 1U0OC 4L4SA 4TSFD 4AUKA 4EM6A 2D4HA 4JXJA 4KGZA 4KR9A 4O2LA 1XKQA 1P31A 1P81A 4AUMA 4HAIA 4C4SA 3ZCTA 1HNXB 1L5FA 1UPXA 3FPJA 3U7RA 4LE2A 1CBUA 3M4JA 2V97A 5BV2P 2BCEA 1OWOA 1CUCA 3UJNA 4RHEA 3MWYW 1TJYA 3U26A 5IC6A 3UW1A 1KEPA 3HY6A 1ADCA 1U7TA 2H1IA 2XAUA 1RQNA 3G9XA 3PPVA 3QWAA 2VPYA 2GEFA 4Z51A 3LKVA 3PC8C 3R0ZA 2ARKA 1Z68A 3QBJA 1HNZB 2BTEA 4JNKA 3V3TA 3GZNA 4YJHB 1YUNA 1I5RA 4NK5A 4QDXA 1YQDA 2F67A 4EUKA 5JYBA 2OHGA 3RABA 2VXOA 4EG7A 4J94A 1QCDA 4KQCA 4LK3A 3VZBA 5FUVA 4PN7A 3FCOA