3U09A

Crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg)(g92d) from vibrio cholerae
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
248
structure length
248
Chain Sequence
b'MSQFMNLEGKVALVTGASRGIGKAIAELLAERGAKVIGTATSESGAQAISDYLGDNGKGMALNVTNPESIEAVLKAITDEFGGVDILVNNADITRDNLLMRMKEEEWSDIMETNLTSIFRLSKAVLRGMMKKRQGRIINVGSVVGTMGNAGQANYAAAKAGVIGFTKSMAREVASRGVTVNTVAPGFIETDMTKALNDEQRTATLAQVPAGRLGDPREIASAVAFLASPEAAYITGETLHVNGGMYMI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-oxoacyl-[acyl-carrier-protein] reductase FabG
publication title Dissecting the Structural Elements for the Activation of beta-Ketoacyl-(Acyl Carrier Protein) Reductase from Vibrio cholerae.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Oxidoreductase
total genus 92
structure length 248
sequence length 248
chains with identical sequence B
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2011-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3u09A00
3HQ4O 4DVJA 4D46A 5L3ZA 4PG5A 2XAAA 4IDBA 1PR3A 2PV7A 3E5MA 3OQBA 3RUIA 2GN8A 4PCVA 1F0YA 5BNFA 3H9JA 4CLRB 4J9UE 4ND1A 1D3AA 3GPDG 1NP3A 5K9ZA 3SJUA 4L73A 5L4SA 3DOOA 4NZ9A 2H9IA 3W4IA 5TJ9A 3PK0A 1R4NB 1TT7A 3C3XA 4LCEA 5G4KB 4U6QA 1G6KA 1UAGA 1GUZA 4X54A 4ZQHA 2HUNA 4LRSB 4W4TA 4A26A 3GFGA 5MDHA 2PD3A 3DZGA 3WGQA 4G65A 1YXMA 1OI7A 2C54A 3Q1LA 2LDBA 3KYBA 1F8GA 3K6JA 4PVCA 3VAZA 4YT4A 4HFMA 3ZDFA 2C0CA 3C8MA 5TC4A 2CVOA 5C7LO 5JC8A 1DC5A 1PJLA 2C07A 2VHXA 4R41A 1EE9A 5B4TA 2FZWA 1UZNA 3ZNOA 2D3TA 3MJCA 3WIEA 2WYUA 5F5LA 4CM4B 4E31A 2WDZA 3D4OA 1Q2XA 2O3TA 4G2NA 4RVGA 2ZQYA 3WIDA 3P19A 2PD4A 1ENPA 4OSPA 5I9NA 4XX0A 1LLQA 4FJ2A 4L76A 2AA3A 3DHEA 4TRMA 2PNFA 3PHHA 2B4RO 1PU2A 3GMDA 3VPXA 1DBVO 1KETA 3QWAA 5I7VA 1MB4A 1NQOA 2H63A 3PIIA 2QG4A 4IDFA 1NWCA 4QECA 3GLQA 4P38A 4UUMA 3DL2A 3U0BA 3DBLB 5FI3A 4CMEC 5ILOA 3DZFA 1JVBA 5CHEA 3HN2A 2VQ3A 2HMWA 1E1NA 1SOVA 4PRKA 1WZIA 3KSZO 1LEHA 1HEUA 1TXGA 4J2HA 4K28A 5A9SB 1LBEA 2E6UX 3W8EA 1GYRA 2OORA 3NDIA 1FXSA 1HE5A 1HDXA 1WDKA 3ONEA 3ZW9A 3RROA 1NPTO 4CLXA 4KP7A 3G3EA 4WCDA 1NVTA 5C3MA 2I76A 3BMCA 3GZ4A 1O5IA 4YJFB 2AEJA 4FFNA 2VWQA 4YAKA 4CM1A 3IL2A 1HZJA 2Y1CA 3JQDA 2DT5A 3UHAA 1OMOA 3AFMA 5IXYA 1T24A 1VJ0A 4YQYA 3BYZA 3IQDB 4Q3AA 4ALNA 3RIHA 3HN7A 5L40A 1C1DB 3JQ8B 1LDNA 5TRTA 1ZW1A 3H5AA 4PVDA 4DREA 3LLSA 1HDOA 1I36A 1E3WA 1LDEA 1F8FA 1BW9A 4NH4A 2AG5A 5CEJA 3F5SA 3I9LA 3GMSA 3W6ZA 2BRUA 1YS4A 4EI2A 1ADCA 2FR1A 1TT5B 2EEZA 1Y5MA 2LDXA 2H1SA 2ZKLA 3OA2A 4IPTA 4Y98A 3H9QA 4Y8VA 4IGEA 1PSDA 4K6FA 4ND3A 1OC4A 4E2YA 3ZHZA 3GGGA 3IKTA 3E9NA 3MJ4A 4B7CA 5L95A 1V8BA 2Q2VA 3R6DA 1LDMA 2VRCA 2WSBA 3ZU3A 4A0SA 1IL0A 4ND4A 1DRWA 3INTA 1EZ4A 2OP1A 4XRRA 3RASA 1B26A 2FP4A 3WTBA 1HZZA 2ZTUA 4WOKA 2UUPA 3SEFA 4BGIA 1DAOA 4DIBA 2QRJA 2VYNA 4J4BA 2B4QA 2FN7A 1QYXA 1G0NA 3LQFA 2O50A 1PL7A 3KYDA 1ADBA 4B4OA 3K30A 2Z1NA 4BMNA 4U0KA 1H93A 1IB6A 5U4QA 2RBEA 4E2WA 5FWNA 2W2LA 3LC1O 4YBZA 5DULA 2NUAA 1CDOA 2B5VA 4ZGWA 2AQIA 3OETA 2O3SA 5H83A 3H3JA 2PD6A 5IDWA 1GY8A 1ISGA 2DBRA 3ULKA 2SCUA 3OIFA 4C4OA 5B12A 1XGKA 1ENZA 4JJGA 4P4NA 1QXSA 4W99A 5IZCC 3WFIA 3PYXA 4OHUA 2A35A 4CL3A 3DZBA 2Q1SA 3ITDA 1F12A 4EYEA 6ADHA 1R12A 3S8MA 3D3WB 5A3JA 3WJ7A 3LK7A 3OJ0A 3WDSA 2NVBA 3COSA 3FPLA 2FRDA 3WQQA 3B1FA 3PJEA 2PZJA 3TF5A 3JD2A 3F6YA 4WCFB 3RFVA 4BGUA 5IXSA 1P74A 2YV3A 3PEFA 3PP8A 4W6ZA 5IDYA 4F45A 1BRMA 4TZKA 1LU9A 4RLHA 2X0JA 4NU6A 2DBVO 4TRJA 2DAPA 3U62A 4CLRA 4Q3BA 3KTDA 4W7IA 3JYQA 3SXPA 3WSVA 3OP4A 4I5FA 3R3JA 4OQZA 4IQ0A 4OYRA 3FNGA 2B69A 4JP2A 5L4NA 1J5PA 2BI7A 5G4KA 1R4NA 2O2SA 2ZK7A 4J1TA 1N1GA 4XYBA 2DM6A 5GMOA 2Z1MA 1KVUA 2E4AA 1D8AA 4GX1A 5F1KA 3Q0EA 4CMKA 3PWSA 3ZHYA 1NFRA 4PLCA 4CM9A 1Z7EA 2BKAA 1N5DA 3OECA 1HYHA 3CZRA 1YBMA 2DC1A 4ZQBA 3CEAA 4UREA 1I8TA 5CDTA 1UP7A 4LK3A 1KVSA 2DPGA 5HA5A 1E3EA 5A9TA 4Z9FA 4XIYA 2I3AA 1TI7A 1LDBA 5C5IA 1WNTA 3BHMA 4CM4A 2V65A 4CMAA 3PDJA 4FQ8A 4MVJP 3HFGA 4U5QA 1WXDA 5I7FA 2PKQP 1GU7A 2HK7A 1V3UA 3FN4A 2G5CA 4WPGA 4E4YA 2ZB7A 3I6QA 2VZ9A 2B37A 1SMKA 2WJPA 5TJHA 3ZWOA 3PZRA 3V2HA 3QP9A 5DBFA 3FPCA 3RKRA 3RUDA 4K6CA 5DCUA 3OF2A 4Y6SA 1Q0HA 1QLJA 4RF3A 1O94A 2O48X 5HS4A 4FIZA 4YRDA 4CMBA 2PGDA 3GFBA 1GZ4A 1C3VA 3DBLA 3L9WA 4YYZA 3B70A 3TSCA 3VTFA 3WG9A 4INAA 1V3VA 4FN4A 2PKQO 5DZSA 4B3IA 2EW8A 5A9SA 1I32A 1P3DA 3H9EO 2HKIA 4P8RA 4D79A 2QYSA 3UXYA 2NSDA 3JQEA 5GZ1A 3DAFA 1VKNA 1O95A 3UAGA 1RM3A 4RPLA 2C2YA 3BHIA 2GUGA 3DBHB 4XWYA 1V0JA 4XQEA 3VH3A 4YAGA 1O6ZA 4UULA 4YJFA 2DFDA 3G49A 1YQDA 3TOZA 4EDFA 4Q9NA 1ZXBA 1BXKA 3GZNB 3VVCA 3AUUA 1D7OA 5TF4A 3TN7A 4RGBA 1YQXA 4MIOA 4YAJA 1PJ3A 9LDBA 3QLJA 1Y1PA 1NFQA 3Q6IA 4NBUA 1BTOA 1I3MA 4PZEA 3ZWXA 1ZVMA 2JAHA 4JGBA 5TNXA 4RLSA 1SCUA 3JQ8A 4CLOB 3OBBA 4KUHA 5EL0A 1MG5A 2NVWA 2YQ4A 2VHZA 5A06A 2NTJA 3S2EA 3BZUA 3GY0A 1XWFA 1ULUA 4RDIA 1XKQA 2JFGA 3ZWMA 5FI5A 4AJIA 2OZPA 2Q49A 4D3FA 4AICA 1TT5A 2BFAA 5CPFA 3VC7A 1KY5A 1Q1NA 4L4XA 2Y0EA 1V35A 2A92A 5DCYA 3DONA 1RYEA 5A5FA 1X1EA 2EIHA 4AG3A 1E3LA 2P9EA 2DPHA 4IJWA 2Z95A 4ALKA 4R4JA 4TZTA 1ZFNA 5HBRA 5I9MA 4Z0HO 3ROPA 3QJ5A 1SB8A 4UEJA 2Y1OA 3OQ1A 1K89A 5A4DA 2V6FA 2JCXA 3JSAA 1M76A 4JP3A 2OO5A 3Q2KA 4J2OA 4I8XA 2FPGA 4XB1A 3V1YA 4HADA 4EZBA 4PZCA 2AMFA 2D2IA 3DHYA 5HM8A 3AY3A 3WBBA 3TZCA 4BVAA 1GYPA 3W6UA 4Z3DA 3LF1A 3M6IA 5EN4A 3F46A 2UYYA 4TWRA 3OMLA 4D45A 4B7XA 4E2XA 4WLOA 4IMRA 3NT4A 4M55A 2JD0A 2BHLA 4RVHA 1H6DA 2GGSA 3HE3A 3Q3CA 1E1MA 3UN1A 3T7EA 1ULSA 2Y1EA 4YR9A 1UR5A 3SLKA 4A27A 3G79A 3D0OA 3X2EA 1Z75A 4DQVA 4DL9A 4O63O 5DBIA 3MTGA 1HE4A 3I1JA 1U28A 1B8UA 3WQRA 4RF4A 4LMRA 2EP5A 1LC0A 1LSSA 3ASVA 4P4GA 4NR0A 3O8QB 4BNFA 2R00A 1GV0A 5F1PA 1O9BA 3D4PA 4GLLA 5BQFA 5KJFA 3DBVO 2P2SA 3ZWPA 3D3WA 4MVJH 3MZ0A 2O7SA 4AJHA 2HLPA 4GL4A 4P22A 3L77A 4CV3A 4E6PA 1HWYA 1R0KA 5JDIA 2OOSA 4FPXA 4WCFA 4XYMA 4URFA 4XQ9A 4RV9A 3ORFA 4MO2A 3W4JA 5G0SA 4AJEA 1T2FA 3K31A 4OH1A 1CEQA 3HDHA 2B4TO 4BMSA 1GL3A 2GZ1A 3TNLA 3TDKA 5U9CA 3GN2A 2FWMX 3LC2O 3FBGA 4NK4A 3JQ9A 3FR8A 4NFYA 1GEGA 2E48A 3ETDA 3FTNA 4OKNA 3WOHA 4YJGB 2DFVA 1IZ9A 1GUYA 2PLAA 1SBYA 3RUCA 3DC2A 4PG7A 2PGLA 2YDYA 3AU8A 1KEVA 1I33A 3BMNA 5EQFA 4RVSA 5DF1A 2W2LD 4OGWA 1KOLA 1O8CA 4QUKA 3VZQA 1B8PA 5GY7A 4NHEA 4XA8A 4NK5A 5JYDA 4FC7A 5ES3A 2E82A 2Q45A 3QE3A 4IJKA 2C29D 5BNIA 2DVMA 4YT5A 1DIGA 1J6UA 1JKIA 1P0CA 3IP1A 2ZCUA 3UCEA 3DHNA 2Y1GA 1PZFA 1ML3A 4EEZA 3IP3A 1GR0A 4NG5A 4CL8A 2BD0A 1LX6A 1X0VA 3JQFA 4FFLA 1Y8QB 4IIUA 1KC3A 4GPD1 1DFIA 1YBVA 2D5AA 4OQYA 5KWEA 5JO9A 3ZWBA 4OJNA 3AU9A 1Z7BA 2Q99A 4CUKA 5JO0A 4CMCA 3PI7A 5DN9A 5L53A 5ER6A 2D8AA 2X0NA 3H5NA 1ZSVA 2QZ9A 3IIEA 4IGFA 4G81A 4FFMA 2OBYA 3PQDA 1WLYA 3WLFA 3WSWA 5BSGA 3NT5A 3IAHA 3I9NA 4NQZA 4ZVVA 1E6WA 3ZV6A 3V2GA 2GZ3A 3IUPA 1OBFO 2G76A 3JQAD 3QVXA 1BSVA 2XF8A 5DBGA 3SC4A 3H65A 1NBOA 1KC1A 3PTZA 3H2ZA 4CM6A 4I08A 3KLPX 4ROSA 1AXEA 2PFGA 4PZDA 1U7TA 3DBHA 4R3NA 1ZJYA 4RDHA 2DUWA 3FRJA 4I5GA 5FFFA 5T8KA 4HNGA 2YV2A 1ID1A 4HFRA 2JFHA 3DOJA 3GZNA 5ENDA 1IULA 2PR2A 2C5AA 4J1QA 1HSOA 5AXDA 4QX6A 2VHVA 1NHWA 1JAXA 1R0LA 1LDYA 3PFWO 2VCYA 4DGSA 5JSFA 3JD3A 3VZSA 5JXWA 4CLOA 5JMPA 5TSDA 2OBNA 2ILTA 3DBRA 4IUYA 2CDBA 2GCGA 4Z0TA 2ET6A 4HY3A 3E6AA 1YONA 4GGPA 2WYVA 1DC6A 3D5TA 4QXMA 2FMUA 3RUEA 4YTEA 3QA9A 1HYGA 1WPQA 5JE8A 1MC4A 4FCCA 5GZ6A 1DC3A 4BO3A 3DAGA 1PS9A 4L75A 4CJXA 3CMCO 3AI2A 2OUIA 2CY0A 4FFRA 4WNIA 3ICCA 1IY8A 1UXHA 4Y6PA 1U3WA 2ZB3A 2D5CA 1PGJA 1AUPA 2B35A 5LCXA 2O4UX 1FDTA 1EVZA 3B1KA 3GPIA 5EERA 1IYZA 5ENVA 1VPDA 2D4AA 1U7HA 2ZATA 4MJLA 2BELA 4NFHA 4NI5A 4R1UA 4MP3A 5LDHA 4ID9A 1FF9A 3NDRA 1CQJA 4TROA 3OJLA 1BDBA 2HJRA 5AQ1A 2BGMA 5F5NA 1VI2A 1PJBA 1RPNA 1HT0A 1NAHA 1GQ2A 1HE3A 2C82A 3RSHA 3W8DA 4WK6A 1GZ6A 1Q0QA 3L0DA 4MPDA 2BLLA 3WNVA 4A5OA 1GTMA 3I9JA 4LGVA 5LC1A 3JQ7B 2BGKA 1WVGA 5COAA 2O4CA 1ONNA 2P4QA 4LSMA 4CUZA 3Q2IA 1Y81A 4EJMA 3MOGA 1KERA 2P5YA 2OFPA 3ZNNA 3UCXA 3EZYA 2PZKA 4XKJA 2P9GA 3WLEA 1K6JA 1UDCA 3S2GA 1X1TA 5AYVA 4WLNA 1Q7GA 4J0EA 1B3RA 4CR8A 5A1TA 4DRYA 1VLLA 2C7VA 1XU9A 1U4OA 2IXAA 3AW9A 3HB5X 4GX5A 4NJOA 4LCJA 1OC2A 3LLVA 1ZMOA 2AHRA 2H6EA 3ANMA 3PHJA 3WGZA 2Y0DA 3Q9UA 1DOHA 2UV8A 4UUPA 4AJJA 3JQAB 4UVDA 3ETEA 3H9GA 4ZHSA 3MJSA 2X58A 1K5HA 4BQPA 3HADA 5EQDA 2JJYA 3INRA 4YDRA 3ZNQA 1LA2A 4JK3A 5IN5A 3ZV5A 1MP0A 4I9UA 2P91A 4UVGA 3JD4A 5JBIA 2FZEA 5KJEA 2BGLA 3BTSA 3L4BA 5KJ1A 3IJRA 3HJAA 4YJGA 4CQLB 4BOYA 3AM4A 4BMVA 1LSOA 4HFJA 1IPFA 4QFDA 5H81A 4DLLA 4R16A 3VHRA 3VH4A 4YT2A 5KVSA 4BNUA 3EY4A 2UDPA 1E7YA 3HDJA 3KZVA 3WTCA 1YL7A 3TZKA 3G17A 3WX0A 2CSUA 3PFFA 3JQBA 3UW3A 2A4KA 2BFPA 3GHHA 4II2A 2CDAA 4FJ0A 4XGNA 4BNMA 3PJFA 4CODB 1LTHR 3OICA 3QY9A 2Y1DA 1OZAA 4QEDA 2VT2A 3LSYA 1BDMA 4ALIA 2O3JA 1D1SA 4HV4A 1F17A 1C0KA 2Y0CA 1QP8A 1H9AA 4LMPA 4IDGA 5I8ZA 1M2WA 4JQCA 1Y8QA 3KSDO 5G0TA 3FTPA 3ZWVA 3RBVA 1DEHA 4IS3A 4B8ZA 2Y93A 1H9BA 1MA0A 2HK8A 4BGEA 4ZICA 4L0QA 1NHGA 4UUNA 1JA9A 3FBTA 3NDJA 3K73O 4DLBA 4WOJA 4N5MA 1LRLA 1YKFA 1E7WA 1KEUA 4YAEA 4GI2A 1M6HA 2VZ8A 4R5MA 4K9DA 1NAIA 2HCTA 3OIDA 3PJDA 3PGJA 1HE2A 1JU9A 1E3SA 2RAFA 4E5YA 1ISMA 1I30A 2HDHA 3ZU2A 2DQ4A 3OHSX 2V6MA 1J49A 2C20A 3RC7A 3LVFO 2O2YA 1PEDA 3F1LA 3ROMA 1H94A 3PJGA 4WLFA 4BKQA 1DIHA 1VRWA 4GQAA 4BO9A 2EKQA 1GDHA 3BMQA 1ZSYA 2E37A 3OJEA 3ON5A 1K0UA 4JN6B 4KQWA 4RF2A 4IDEA 4XJTA 5KKAA 4R1SA 2JKVA 2Q46A 1E5LA 5JC1A 4I9HA 4BNLA 1BHSA 3WWYA 3LT1A 5CDYA 1YBAA 5ILGA 1LQUA 1A9YA 4DIFA 1QRRA 2F00A 3GRKA 1CYDA 2NV6A 3K2EA 4GWKA 3L6OO 3TZHA 4RZHA 4O5OA 3OQ6A 4Q39A 4AJNA 1H2BA 2GN4A 2G82A 2HMSA 1TLTA 2W4QA 4PLYA 4BNYA 4JJFA 3MWEB 1ZNQO 4H16A 2X0RA 2X86A 4BO5A 1HLDA 2GNAA 1M75A 3HFSA 1A9ZA 3VDRA 3KEQA 4BB6A 5EPOA 3A06A 1VJTA 3OJOA 4JX8A 4UAGA 2PKRA 3LU1A 5KJCA 3GH3A 3RC2A 1EBUA 1EVJA 1DIRA 4CMGA 2X23A 4B4WA 3RUHA 3UCFA 2NVUB 1C0PA 3GVIA 4N7RA 4DMMA 1XR3A 5IJZA 5JYEA 4BO8A 3AM3A 4EUEA 5GZ3A 2OHXA 4Q3CA 1H2HA 1T1RA 1N7GA 3KXDA 4PLFA 3RWBA 5KVVA 3RUAA 5TLSA 2EERA 2O3QA 3D3EA 1WDMA 5C7IO 5HWSA 5EJ2A 1ZK2A 2FSVA 2C2XA 1U8FO 5I9LA 2VYVA 3K8ZA 2ZJ1A 1BXZA 3JCZA 4RZIA 2NACA 1E92A 1LC3A 3FD8A 3NTQA 1PJ2A 3JQ7A 3VKUA 1LNQA 3QWBA 4OAQA 2HRZA 1VM6A 3W4KA 2NTVA 4E0BA 2RH4A 1ZJZA 2EW2A 2FPIA 2WE8A 1UZMA 5EIOA 1NYTA 1ZO8A 2RIRA 4BNTA 3U4CA 3GGOA 1V3TA 1NWHA 4UVHA 1Y9EA 4IINA 3ENKA 4EITA 4BNKA 1ZEJA 5CAEA 1M66A 1X7GA 2JHFA 4B3HA 2DTDA 3GNQA 4CUJA 2YW9A 1D4FA 1XCBA 1YJ8A 2EJVA 3LT0A 4XD2A 4EJ0A 1BVUA 5IDXA 1GZ3A 2AW5A 5JY6A 3OFSA 1CERA 1PIWA 2YHIB 3JQAA 4WLEA 3PIDA 4AJLA 1XSEA 3GG9A 1BG6A 1HDCA 1VL0A 2DLDA 3A1NA 3L4SO 3PYMA 4DYDA 3GDGA 5T64A 1GAEO 4OSOA 1DLIA 4I5DA 4E5NA 3JQ6A 5KTKA 2B0JA 3D5QA 3NAQA 5A02A 1GQYA 5KIAA 4KQXA 4CQLA 4EW6A 2C7GA 1EUZA 4MKRA 3K92A 3PYLA 1ONOA 3HHPA 4QO8A 4DBZA 2QX7A 2IODA 1E3IA 3W1VA 3FWZA 3PQFA 3QIVA 1ZKMA 3A9WA 1Q0LA 1ZIDA 3EGOA 4J3FA 4IM7A 4E13A 2YUTA 1W6UA 2NU8A 4Z6KA 3SC6A 1HF3A 2QHXA 4LRTB 3Q9NA 4HFNA 3QRWA 3F4LA 3PRJA 3ZI0A 3ONFA 4GSLA 2X5KO 4J7XA 4S3MA 1ISIA 3VZPA 1VC2A 3O26A 1UJMA 4YJHB 1DFHA 1JDJA 2Q4BA 1IOLA 2W2KB 4PRLA 2PZMA 3E9MA 4MKXA 3TL2A 4OOFA 4WGGA 1ZXLA 3K9QO 4TVOA 3EK2A 5AXBA 3NTOA 4J90A 5F3RA 2BFMA 2FPPA 4F6CA 4Q3NA 4KOAA 3JQCA 2R00C 2ZQZA 3GF4A 4BNWA 3RBXA 3GDOA 1B3BA 2X22A 4PFJA 4O6VA 1GPJA 4PG8A 5K6AA 1T2CA 1DJNA 1JLLA 1PGQA 3JD1A 4YPOA 1I0ZA 5JDIC 5HS6A 3PVZA 3WMWA 3FWNA 4WCFC 4BKOA 3I4CA 2VOEA 3P2YA 1DFGA 1EUCA 1HRDA 3ITKA 1SOWA 3FSRA 5H82A 2Y05A 3IJPA 1JKFA 3NT2A 5CDUA 3BTVA 3JQ9C 1U2GA 1JKJA 1S7CA 1E6UA 1L7DA 1U2DA 2PA3A 3MEQA 3TPCA 3WGTA 4MVJD 1C1DA 4GBJA 3KOUA 4YWJA 4A73A 4CM8B 1NR1A 3WB9A 5MGBA 3INGA 1Y7TA 1UUFA 2X5JO 4FW8A 3R3SA 4TVBA 4LW8A 4CLDA 4I9NA 4E5KA 3WNQA 5ICSA 3KVOA 4PLPA 3GVXA 4OM8A 4XGKA 1QG6A 2VN8A 4IDDA 1G0OA 3KSUA 4XZ3A 3NJ8A 3RD5A 4R1TA 2FSSA 3N58A 1T1SA 1A4UA 2DTXA 3ZW8A 3O9ZA 3LZ6A 3DEYX 4GGOA 6LDHA 1T4DA 1ZCJA 2Y66A 3IC5A 1A4IA 1E1KA 2BFOA 1E6EA 1Y6JA 4KUGA 1LRJA 3UVEA 2VWGA 3K5PA 3JQFC 5L51A 3U09A 2I65A 4EGFA 3EZLA 2J5RA 3GUYA 3E8XA 2I5PO 5JAQA 1XA0A 4JLWA 3GDFA 4NJMB 3RFXA 1UP4A 2JFFA 1LRKA 3AY7A 4M87A 1FDSA 1KVTA 1A7AA 2BF7A 1H6AA 2AEFA 3RAJA 4AJ4A 1QYVA 4QQRA 4BHTA 3C7CB 1P1RA 5CP8A 2NVUA 1TB4A 4IXTA 5BSHA 3WWZA 4E33A 1NM5A 5B1YA 1WZEA 4LN1A 4OXYA 4DMLA 1ZEMA 4CQMD 3LF2A 3HWRA 3WGOA 1NNUA 3NYWA 2CVQA 3ENNA 3ZWAA 1KBZA 1RM4A 3O03A 1P45A 1VE9A 2GR9A 2VWHA 3E82A 5JAZA 4QFCA 5CEEA 1H5QA 5JNLA 1MX3A 5CFZA 4RPKA 2HAEA 4E5PA 4BNJA 5T8KC 4E21A 4BKPA 1NTOA 4ND2A 1PX0A 3TQHA 2YYYA 4NBWA 1I2CA 4FSHA 3RC9A 1QV6A 1XYGA 3GEDA 1W0CA 2VUSA 5JAMA 1NQTA 2Q4EA 1ZZEA 4B8WA 2HMUA 4MINA 3DZIA 3RUFA 1FMCA 3BXXA 5KCZA 1BWSA 1Y5RA 3DAPA 2OMEA 2PZLA 4FDAA 1P31A 3ANLA 4YRAA 5TT1A 4F46A 4BL5A 4FBGA 1IZ0A 2J6IA 2X9VA 1G1AA 1LSJA 2I99A 4RVDA 1PJQA 1PL6A 3WFJA 1PS8A 3ANNA 4RVUA 3ONDA 3RC1A 1YGYA 2YHIA 3VPGA 2QQ5A 4U6SA 2I9PA 4E32A 1UXIA 2ZYAA 4LISA 4RJTA 3F4BA 3M1AA 4XR4A 5KJ6A 2GF2A 4BGVA 3STHA 2XXBA 1EDOA 3CPSA 1CQIA 3ZWWA 3O38A 4ITUA 4NPCA 3T4EA 4LSWA 3RVDA 5L7TA 4ALMA 2GD1O 3NX4A 5G4LA 4YCAA 4ZQGA 4GH5A 4ZN6A 2X1HA 3GK3A 1PJCA 2CVZA 3PWZA 4Z0PA 2YQ5A 4DC0A 3CE6A 5CDSA 2VT3A 2DBZA 5TIIA 1VJ1A 4I1IA 4XEHA 3DWFA 2VYVD 1UDAA 3FF4A 3F1KA 4CV2A 4D43A 1NXQA 4II3A 5EESA 5IZ4A 1I5RA 3T7CA 4KZPA 1YWGO 5L7YA 1XELA 3RCBA 2O3UA 4F3YA 4L4SA 4KWIA 4YXFA 1J4AA 3ZH2A 5AOVA 2X6TA 1I2BA 4BNIA 3GRPA 2V6GA 3GVPA 1A5ZA 1E7RA 3WGHA 4BKRA 2AQ8A 2Y67A 3R0IA 4YJHA 4EUFA 4W9NA 5I7SA 1YRLA 2IEDA 1SB9A 2VWPA 1P1HA 2QRLA 3IDSA 2W2KA 4XJSA 4MKZA 2D1YA 1S6YA 2NNLD 1IPEA 3G1TA 1Z6ZA 1E0DA 3U4DA 2WD7B 4IBOA 4KDEA 1U3VA 1UAYA 2DU8A 3QVOA 5TQVA 2UUOA 3WJAA 1ARZA 1MGOA 2P4HX 5LDGA 3S55A 1R66A 3DZHA 3FNEA 3HUDA 2C59A 4AJKA 3W8FA 4RL6A 1IUKA 1LI4A 1DPGA 3GGPA 3NKLA 5F21A 3UFXA 2GZ2A 5AVOA 1EVIA 4CV0A 4BO6A 1YQGA 3CUKA 2FR0A 5JDCA 4CQMB 1MXFA 2RHCA 4D0SA 3D7LA 4J6FA 3E9QA 3RU7A 5B4VA 4HXYA 1XQ1A 2Y1FA 4CLHA 4GWGA 1U8XX 4L9RA 1TVEA 1BXGB 4YEDA 5IG2A 5BNTA 2WM3A 3AFNA 4B4UA 4C7JA 4E3ZA 3FHLA 4GX2A 3GOHA 2J3KA 3WMXA 3L4BC 4DPLA 7MDHA 4GX0A 3ZHXA 4R54A 4J43A 1ENOA 1LLDA 5T5QA 2YV1A 5COQA 1HL3A 4EJ6A 5IFLA 1YDWA 3HSKA 3BA1A 4CM8A 1GD1O 3CTMA 1YVEI 4CM3A 5JFOA 4NDNE 4YRBA 1EE2A 3PLRA 3I83A 2NM0A 4BO7A 2EG9A 3JQBC 1DIBA 3DO5A 4U7WA 4ZQFA 4PN3A 3TJRA 3VZRA 1L1FA 1DRUA 3P5SA 4NNJA 1XG5A 4HWKA 2EXXA 2EGHA 4J7CA 3ROKA 1T26A 3B6ZA 3FI9A 3AWDA 2IYPA 3ZCXA 2NU9A 1X13A 1JAYA 3H6KA 1JW9B 3QSGA 4K1LA 1EVYA 2HSDA 3AK4A 1R37A 4RQUA 3GEMA 2ZIZA 1P33A 4D7AA 3HZZA 4ALLA 1D1TA 1DO8A 4DQUA 5JMWA 1R15A 3AOEA 4HX5A 5ICMA 4IQGA 1HDYA 1N92A 4FC6A 1ISJA 3E03A 1HXHA 4B4VA 1N9GB 2HMTA 4DPKA 3P2OA 1L7EA 3L07A 1E5QA 2ZTVA 3GEGA 4OXKA 3GAZA 1Z45A 1SAYA 4Q3DA 3WQSB 1GEEA 1PZGA 3JYOA 3QVSA 5BSFA 1P1JA 2G1UA 3GHYA 2ZTMA 2NU7A 4OKIA 2JD1A 4CM5A 2IZZA 2JCVA 1MC5A 1MLDA 1E7QA 2J5QA 2GN6A 2X4GA 2XPCA 5DOVA 2DBQA 3OJFA 3C1AA 2ZCVA 3R1IA 4R9RA 2PWZA 2IYOA 2DKNA 2JHGA 3ZZNA 4RVFA 1DIAA 3EW7A 3ZGYA 2EHDA 5CDGA 4RCVA 2X7HA 5JPIA 3A14A 3DMTA 3O8QA 4UEKA 2ZYGA 4JROA 3EAGA 5FF9A 4MVJF 3GG2A 3OM9A 4NU5A 3SJ7A 3MCVA 2IZ1A 1VL6A 1X15A 1CETA 2JAPA 3PHGA 4PLWA 2I67A 1C0LA 1SPXA 2IEBA 4CM7A 1XIVA 2WE7A 2EWMA 1I3LA 4M54A 2GYYA 4Z3KA 1OOEA 4E30A 5C7OO 4XYLA 3M2PA 2NQ8A 4RPGA 4DXHA 4YT8A 3EUWA 3VPHA 1EFLA 2GASA 1SEPA 3UKOA 4WECA 3WGIA 1SNYA 3ETGA 1C0IA 1MFZA 4OMUA 5CPBA 4AJPA 3NTRA 4J16A 2O7QA 4Y6RA 2G17A 4IDAA 4Z9YA 4QO7A 2X5OA 4DBVO 3HNPA 2AQKA 4WJZA 3JTMA 3GR6A 2EF1A 4XDZA 2GDZA 4O1MA 4MVJA 3JV7A 4M49A 4MOWA 4F6LA 3WR5A 4UVIA 3U9LA 4MVJM 4QT0A 1U4SA 5B4UA 2YY7A 1QLHA 4M89A 2BI8A 1U9JA 2CNBA 3L6DA 3KYCB 2GERA 3FR7A 4MVJE 4HKTA 4PGFA 2Q2WA 3NGLA 4PLZA 5JS6A 4YB8A 3ZWNA 1ORRA 1Q7BA 1DRVA 2CD9A 1M6WA 3RFTA 2P9CA 4R3WA 3WYBA 2D59A 4MP6A 4XDYA 4RQTA 3KV3O 3ICPA 5B37A 1Y9AA 1LXCA 2BH9A 2HU2A 3F47A 5DP2A 3GN1A 3QWIA 4BO0A 2PY6A 1K3TA 2JCYA 4EEXA 1QMGA 1KEWA 3T4XA 5BSEA 1JVSA 1XLTA 5JLAA 5EINA 5T57A 1ADGA 2TMDA 1PGPA 3JQGB 1ZBQA 2FR8A 1XEAA 2WD7A 3AI1A 3G0OA 3WXBA 2GPTA 1WAMA 3S1LA 5COBA 1M67A 4H3VA 3OEWA 4DQXA 5DOZA 2VUUA 4FFOA 1P1FA 1QKIA 3TFOA 4TQGA 3CKYA 1ZMTA 3H9UA 3ST7A 1HDRA 4BNHA 4CQMA 1GPDG 3VH2A 1WMAA 2OGUA 3M1LA 2Y99A 4IS2A 1C1XB 1YB4A 4OOEA 3KRTA 1I3KA 3AUTA 3H7AA 4EUHA 2I66A 2GLXA 4XQGA 3AM5A 5T6BA 5C37A 3A28A 4XGIA 3QWFA 1BXGA 2VHWA 2W90A 4NMHA 4FFPA 2X9GA 3UF0A 4J1NA 4L4RA 2AG8A 3VVBA 1TA4A 2CFCA 3I6IA 1CJCA 1DB3A 1ZK3A 3DTYA 4KMSA 3EC7A 1N2SA 1HLPA 2ZB4A 4TRNA 4IQ8A 1EQUA 3M2TA 1QR6A 3BIOA 1E7SA 4WLUA 1VSUA 1YE3A 1T2AA 1CWUA 2FY8A 4W82A 5THKA 3BTUA 4IJVA 2F1KA 2ZB8A 4R69A 5I8WA 1UXJA 3GT0A 4FS3A 1LUAA 2V6BA 4ALJA 2VNSA 3RKUA 4PLGA 3MJVA 7ADHA 2AQHA 1R4MB 1P77A 4KTVE 2I3GA 3TZQA 3VKVA 4IIVA 3MJTA 3BHJA 3H8VA 4ZA2A 1HSZA 2W98A 1WDLA 3HG7A 1GQQA 3PPIA 1ZSNA 4HNHA 4N54A 4CMIB 1LDGA 3N74A 1EFKA 1NPDA 4HP8A 1YB5A 3EHEA 1RWBA 3DMYA 2HJSA 4RPJA 4PG4A 2J3JA 1EQ2A 5DCWA 4IZHA 4TRRA 4J1SA 3VDQA 2P5UA 5FEUA 2BMAA 4G5HA 4RF5A 3UICA 3QVWA 3RJ9A 3OH8A 1N9GA 3C85A 5K6AC 3C7AA 3ZNPA 3OSUA 1AXGA 1ISFA 1U3TA 3S2IA 4N18A 2B5WA 1N7HA 3E18A 4ZRNA 4J4TA 1YH3A 3QVTA 3CINA 4J7UA 1GUFA 5A3VA 3I3OA 3BMOB 3D64A 4J0FA 3PDUA 2GRAA 2O3RA 5DDIP 1WWKA 4BB5A 3CIFA 1GCOA 3RQSA 1C14A 4WEQA 3V1UA 2DTEA 1WMBA 5JCJD 1EDZA 4R5HA 4B3JA 4BNVA 3F5QA 4R1NA 4CMHA 1NPYA 2VZ0A 3N7UA 5IAAA 2PH5A 4FD3A 4GKBA 4NFSA 3NEPX 2W8ZA 3V8BA 1LQTA 2HRBA 1KYQA 1LLUA 4BKUA 1P44A 3DTTA 4R01A 1PQWA 4CMEA 5A5EA 3NUGA 1XU7A 2D0IA 3F3SA 2QYTA 1HDGO 4KWHA 1AN9A 1RM5A 4O0LA 2B36A 1ENYA 1Q7CA 5A9RA 1B15A 1MXHA 4WLVA 2EV9A 3LT4A 2POQX 1T2DA 2CMDA 2IZ0A 3AOGA 3AUAA 1MFPA 4PLVA 3DZKA 4H15A 4D42A 3HDQA 2H5LA 4GMFA 1PGNA 1UXKA 2EP7A 4GSKA 2VRBA 4W7HA 1K2WA 1OAAA 3E1KA 4DTIA 1AE1A 2X0IA 3DOCA 1CF2O 1RKXA 1T2EA 4JCOA 3PLNA 1YOVB 2YDXA 4A7PA 1NQ5A 2Q3EA 1I2ZA 2YFQA 4YAIA 2CUKA 3I52A 4QTZA 3TZ6A 3EDMA 4K26A 1BGVA 3B20A 3I5MA 3C24A 3BMNB 1AHIA 4CR7A 3O4RA 2PH3A 4DYVA 1GFSA 1I3NA 5HRUA 4YJDA 1A7KA 4DWVA 3KYCA 1GV1A 4IMPA 4OL9A 1HKUA 4R9SA 4PIVA 4JNKA 1N1EA 1P9LA 3QWHA 4AJ2A 2VNAA 1PZHA 1J0XO 1EK5A 4JBGA 3DFUA 2Q1TA 4ZD6A 5TX7A 3JYPA 3PQEA 3WYEA 1HTBA 3EMKA 4WUVA 3WS7A 5IN4A 1I10A 1HYEA 3FNFA 3WYCA 4TKLA 3U5TA 2O23A 4RORA 3KHUA 3KUXA 4GMGA 2NTNA 4JBHA 2QIOA 4ZQEA 3DDNA 1NASA 4CV1A 1B7GO 1I24A 3VTZA 4M1QA 4A03A 5DP1A 4CLEA 1KVQA 2J3IA 3JQGA 1W4ZA 1B8VA 1N8KA 5DNAA 4A2CA 3QQPA 4M86A 4AJOA 3SBOA 1MG0A 1R16A 4YQZA 2G0TA 1EK6A 2JL1A 1LJ8A 4KDFA 3LYLA 3GC6A 1LSUA 3I23A 2J3HA 2Q1WA 1FDWA 3KO8A 3NJ4A 3MOIA 3DB2A 2Z5LA 2PGJA 1W8DA 4WASA 1C1XA 3I9OA 4U0JA 1QSGA 1SO8A 4O59O 3MWDB 1PR9A 1ZK4A 3SLGA 3WGGA 3PGXA 1T4BA 4MVJI 2I6TA 2J5KA 5JW6A 2HQ1A 2QW8A 1CRWG 2YHUA 3WGYA 3P7MA 1W73A 5IZCA 3K2BA 3ZWYA 3V5NA 3AI3A 5TT0A 3V2UA 1X7HA 5L4LA 4KUEA 3E48A 3D1LA 4JXKA 3ZWCA 2FOIA 1K6IA 3DQPA 3NV9A 3IUSA 1F06A 5KVQA 4A10A 1BMDA 4I5EA 1U5CA 2V7PA 4CMJA 4FB5A 3U4IA 1PL8A 4YACA 1F14A 2WTBA 3IS3A 2PK3A 2UAGA 3OA0A 1HETA 5A04A 2IRWA 1GYQA 2Q50A 2E49A 4DUPA 1P1IA 1XQ6A 4MIYA 3UH1A 3D4NA 3DBRB 3HB4X 3ZU4A 4E2ZA 3CXRA 5BR7A 3OIGA 1DSSG 2YJZA 2ZYDA 5TGDA 3L9XA 1R4MA 2UVDA 2Q2QA 5JCXA 1AGNA 3MJEA 1FDVA 3OEYA 2JD2A 1NFFA 3ZV4A 4W9NC 2EKLA 4CMIA 1YDEA 4IXWA 1B0AA 1TEHA 1YJQA 1T25A 4TKMA 1U3UA 3KLMX 4B79A 1GADO 5A03A 2PTGA 3VH1A 1QV7A 3DFZA 3BAZA 1Y8RB 1ZUD1 5KVCA 4D3SA 4L8VA 2VOJA 1I01A 2EGGA 2GSDA 3RU9A 4BO2A 1H0KA 4ILKA 2CDCA 1KVRA 4J49A 5T67A 3KETA 3EVNA 4MIEA 4GLOA 4PLTA 1PQPA 1JN0A 4NBRA 4BO1A 5JDCC 5KKCA 3UOGA 4DC1A 4HUJA 4FGWA 2CF6A 2OL4A 4ONEA 4XYGA 1SEVA 9LDTA 2NLOA 3TL3A 3BMOA 1BVRA 4J91A 4R68A 2VHYA 4MDHA 5EMHA 4U8GA 5AXAA 4BNNA 2QZZA 3NGXA 5L7WA 5I7EA 4WEOA 4LVCA 4OXNA 4BV9A 3H3FA 3JD0A 1MUUA 1DHTA 3C7DB 3IOYA 4ZU3A 1V6AA 1NVMB 3CH6A 5KNLA 5TS3A 2RHRA 3KB6A 1U5AA 2WD8A 3TRIA 3PXXA 1U1IA 4D0RA 1SZJG 5DT9A 4XQCA 1DDOA 4L74A 4QSMA 1UZLA 3VPFA 1JWBB 2WYWA 3PHIA 4DLAA 4GVLA 3I4FA 1RJWA 5F1OA 4GKVA 2HK9A 4DPMA 2QRKA 1MV8A 1P0FA 2X8LA 1KEPA 2YZ7A 1E1LA 1FDUA 3ASUA 3LT2A 4PG6A 3UUWA 1RM0A 4AFNA 1QYCA 4YA6A 3CMMA 1FK8A 1PTJA 2WEKA 3H4VA 3JYNA 3ZHBA 3AJRA 4S1VA 1FJHA 1PJ4A 1R0SA 3NRCA 4N5NA 3C1TA 4XR9A 3F9IA 3WBFA 1O89A 4XRGA 2VRCD 4NBVA 5A05A 2AEMA 4Y67A 4AL4A 3GNTA 1JWAB 1DJQA 5CG1A 4BQRA 3B1JA 4ND5A 1E77A 3DR3A 3LDHA 4BNXA 1KS9A 4N5LA 2VYND 5CEFA 3U3XA 4H7PA 5CG2A 4IDCA 3AOEC 1RYDA 2AE1A 4Z9XA 5L45A 1YOVA 1WW8A 5JAIA 1PZEA 1OFGA 4OIMA 3MTJA 3BTOA 4WKGA 4MVJG 3PWKA 1PS0A 1DHRA 1PJSA 3GAFA 1B16A 3SVTA 3V1TC 1VL8A 2GO1A 2J8ZA 1EEHA 4R51A 1IHXA 3ADPA 1YO6A 2IXBA 3SX2A 5K0ZA 1B2LA 2Q1UA 2RCYA 5G0UA 1YL6A 4BUCA 1NVGA 2A9FA 2FHSA 3JYLA 5ER9A 3TFQA 3ZV3A 3FCOA 3ADOA 3TWOA 2WMDA 3AUSA 4IZIA 1NR7A 4TMFA 1Z82A 3AY6A 3DMTC 1ZK0A 4E12A 2AXQA 4FR5A 5JY1A 5BT9A 2NWQA 5FYDA 4FOOA 1X7DA 3G1UA 4D44A 1EBFA 1UP6A 4GVXA 3ZU5A 4BNZA 4RPHA 3ROQA 1DC4A 1VKOA 1KIFA 5G0VA 1SC6A 3GVCA 3CZMA 1DXYA 4XYEA 1GCUA 1YL5A 3IMFA 1X0XA 4P4LA 4RO0A 4NBTA 3RI3A 2R6JA 2HO5A 2EKPA 4J4HA 5G0WA 2XOXA 1PQUA 3GNSA 2TMGA 2Y68A 3BMCB 5ITWA 5IF3A 1A27A 5L9AA 3A4VA 1PJTA 3S2FA 1E7MA 8LDHA 4UVEA 3I9KA 3BMQB 3H5RA 4CPDA 5JCJA 4J9VA 3IKVA 4WNCA 3PZBA 4AVYA 4YVFA 2VTDA 1ONPA 3UGKA 3HDYA 1NX6A 1PWXA 2IDZA 3KM0A 4XB2A 1V9LA 1XDWA 4FOSA 1KY4A 1PWZA 3GA0A 3E5RA 4HBGA 4JJIA 4MP8A 5AXCA 1E3WB 1YB1A 4M8SA 1R6DA 2XXJA 4ZJUA 3FNHA 3L6EA 4CM9D 3WICA 3U49A 1JQBA 1BW9B 1IE3A 3RBZA 3Q11A 4UUOA 4JBIA 1PGOA 2R2GA 1E3JA 5KOIA 1VSVA 3QHAA 1A71A 8ADHA 5ADHA 4BS9A 5HTOA 2HMVA 2GN9A 1X14A 4IJUA 4NIMA 4XIJA 4LVUA 4B7UA 4BIIA 4GAEA 2WWRA 3GVHA 2X9NA 4XCVA 4DA9A 3QV1A 1UXGA 4OO3A 1JTVA 4NJMA 4BO4A 4E5MA 4TSKA 3GQVA 3KEOA 3ABIA 1O0SA 4WE3A 3LC7O 1QORA 3CSDA 1WP4A 3DXFA 3VPSA 1HDZA 1QYWA 3K96A 1CIVA 1DAPA 2B83A 1P1KA 1Y8RA 3KYDB 1IHYA 2CF5A 2P68A 5IDQA 2EJWA 2YFHA 4UEOA 3KBOA 2OXIA 4AJ1A 5U1PA 2C5EA 2RH8A 4PLHA 3U4HA 4BNGA 4KTTE 4Q3EA 1UDBA 4EBFA 2NU6A 1EMDA 4ESOA 1Z73A 2NQTA 3EVTA 2OP0A 1ADFA 3QW2A 3RJ5A 1LLCA 4Y9DA 4CR6A 2ZJ0A 5THQA 3TOXA 1H6CA 3GUCA 4FGSA 4IY1A 4D41A 1A72A 4BV8A 3C1OA 2NADA 4JIGA 2A94A 1NQAO 2VTEA 1B14A 3X2FA 4C7KA 3VOSA 1AHHA 4ZRMA 5J23A 2CZCA 2VUTA 1QYDA 1ZH8A 3I9MA 4D3DA 1XHLA 1ISHA 2IE0A 5G2OA 4DIOA 4FJ1A 3EYWA 3ZN2A 1H6BA 1ZK1A 1Z74A 1K6XA 3DZJA 1EUDA 5ITVA 2ZTLA 3H2SA 3PHLA 2AE2A 2DUUA 1UH5A 1DLJA
chains in the Genus database with same CATH superfamily
3HQ4O 4V0ME 4H6VA 2F8MA 3BE8A 4PG5A 3KR2A 4Q1EA 1FU7A 5DYNA 3RUIA 4PCVA 1F0YA 3TOSA 1S7GA 1IRIA 1Z6PA 2CJXA 3X1ZA 1XVAA 2QK4A 3OMXA 5CYOA 4M53A 5EMMA 1KSJA 4IFIA 3EXHC 4QFMA 2OVBA 3WA6A 3KZXA 3E5HA 1I5OA 3SJUA 3HGQA 2PANA 1GL6A 3QG5A 4XLZA 3DOOA 4KH1A 4NZ9A 1E0SA 4UFPA 2H9IA 2Q1YA 2XUAA 1NA5A 4HMPA 3KXLA 3W4IA 5G4KB 4ZXFA 3B1YA 4H7KA 3GOQA 2YN0A 1XC7A 4U6QA 1TM2A 1G6KA 4Y2TA 1XTZA 3T1TA 5A3QA 5LP1A 2Y6UA 1E3DA 1JHAA 3EVZA 5KNDD 4JUIA 4Z7NB 1TW2A 2AIRA 2ZI9A 1PJ8A 4LRSB 3J81k 4LY9A 5FBQB 2K2WA 5MDHA 3C6XA 3QTBA 4TLMB 4A1FA 3IUBA 4N01A 4G65A 3M81A 2VATA 4JJZA 3TX6A 1A9PA 2LDBA 2EX4A 1ECJA 3FPEA 5TVGA 4ZPJA 3VKFA 2DP4E 4CETA 3TSZA 2OV3A 1D2GA 1OTHA 1AQIA 1R6TA 4LOIA 4Q15A 3ZDFA 5TC4A 2KHZA 1GAWA 1YS6A 5DIFA 3VO2A 1SCQA 2FZ5A 5TPWA 1J24A 3CCBA 4R41A 1EE9A 1X86B 4R8SA 1YVPA 4OI1A 3V32A 4IIDA 3I0MA 4EKEA 2PBRA 1TYZA 3B7PA 1KKMA 3N6RA 2BONA 4CM4B 3FDZA 4MUAA 3UGQA 4OFWA 1JV2B 2B9EA 1COZA 3H2YA 2QTZA 3TKLA 4KO1S 4Z7QB 5FPYA 4YIKA 5BWMA 2ZQYA 3I1FA 2XQVA 2PD4A 4CKCB 1L5NA 2Z2JA 4OSPA 4HQOA 3A58B 1B76A 1LS1A 1Q19A 1VLVA 1W5BA 1CHDA 2J3MA 2AA3A 2Y6VA 5BMVF 1QG4A 3IXMA 3CLVA 2ASVA 3Q85A 1GP2A 2PNFA 4TRMA 2B4RO 3PR2B 1OROA 4E4RA 1VKZA 2FPPB 4CNQA 1AGXA 1NOIA 4L2IB 1QP0A 4K6GA 3VRHA 1CQXA 4MV0A 4RZXA 1DEAA 1LY1A 3DQZA 1W48A 2YZKA 2H2FA 4P38A 4Q7EA 3U0BA 2H48A 1HMPA 2AOXA 2JI7A 1ODLA 5CH5A 3B5EA 4ZALA 3E22B 5CHEA 4E1AA 3HN2A 1A1SA 3EIEA 4O2AA 1TUBA 1WZIA 4H27A 5EFOA 3E4CA 2QTRA 3NVAA 5ANRB 4BVGA 2AXEA 1DARA 3QNWA 4C21A 2PSHA 4A2WA 2NP6A 3IPRA 1WSAA 3JWJA 3NDIA 2C99A 3O7MA 4HG2A 3R9XA 3IIKA 3RROA 2YOFA 4ZVNA 5JANA 1OU0A 3P5BA 2GB4A 4WCDA 4EG3A 4NOKA 2YC2C 2Q6OA 1O5IA 1ILWA 2AEJA 4X20A 1JEOA 3WHPA 3T3HA 2VWQA 1YQQA 4YAKA 3U44A 3U7HB 1ZR4A 3NHYA 3TQRA 3IOEA 3P0FA 1HZJA 1V95A 2VPXA 2DT5A 3KG2A 4XX1A 1OB5A 3UHAA 1S4QA 4C0QC 1HC7A 2HT6A 2XDYA 4HRXA 1UJ6A 4K9SA 2D3WA 1VJ0A 1TLLA 5J58A 1GNSA 3IELA 5DPMA 3K4QA 1XO1A 1JEEA 2JPDA 2W2PA 3BYZA 2FFAA 3BREA 1IUNA 3M4ZA 1G6Q1 1ESZA 4G09A 5I9BA 2BSXA 2EAUA 5DCLA 5LD2C 3ZD6A 2J0QA 3GMIA 3FY4A 1HDOA 2AX3A 1TRHA 4M6WB 3PEWA 1LDEA 4Y2RA 3U61B 1EFTA 3BE5A 4TPKA 2FEMA 1KFBB 1VL5A 3GD5A 3FTQA 3GMSA 4QJ4A 1TJ4A 3ZE7A 3WLOA 1ADCA 1K92A 2WJ6A 1AKYA 2H1SA 4JELA 1R9NA 1Z88A 4HDCA 1NKSA 4IGEA 1PSDA 3A6DA 3EQ6A 4K6FA 3TW6A 3RT9A 2A88A 4E2YA 2PZGA 3ZHZA 5C1DA 3MHTA 2PWYA 2FQWA 3Q0TA 4YCBA 1PYOA 1V8BA 2UYQA 3R6DA 3L46A 4ENRA 5CX4A 1RAEA 2Q5LA 2QD3A 4PCLA 4A0SA 4MPJA 4P0TA 2B8EA 5KQRA 1BKYA 1NBIA 1RJDA 1X19A 2HFKA 3GDWA 4IFTA 3INTA 3WE7A 5CNIA 1B26A 2QPAA 3WTBA 1PF7E 2ZTUA 4BMDA 3O91A 3E3OA 5CTAA 4GRAA 3SEFA 1FUEA 1KIMA 4MVCA 2FN7A 1QYXA 1SUPA 4KPFC 2ZTHA 3DDWA 4TTQA 4BBAA 1L7AA 3NNDA 1KMHA 5FFMA 3KT0A 5GOTA 3AEQA 2H2GA 1PVOA 3ZTWA 3KALA 1JR3A 4TX1A 5E0KB 3MWKA 2IOFA 1H93A 1IB6A 3OE7A 1GG9A 1G20E 3JSXA 3KL4A 4WY5A 5K4HA 1RPZA 2QQGA 4X91A 2M2IA 4YRFA 4C01A 4OI0A 2QD1A 1P29A 2ZVDA 4Q19A 4DA0A 4ZI5A 2EJBA 5DULA 5IAJA 4L5JA 3EXIB 1Z16A 2IX3A 2QJOA 5JQGB 1QQ7A 2X1VA 2FRVA 4J0JA 4NC9A 4P4UA 4QBTA 1W96A 5J1SB 1HQYE 3A2KA 2O3SA 5E3HA 4PNZA 1QIJA 4V0RA 1CIPA 2XZLA 4RHTA 1PW7A 3QA3E 2OKCA 2VEOA 3U39A 3OIFA 1RI5A 4BEVA 1XGKA 1M1XB 3EC1A 4XARA 5B58C 1T4GA 5EJ6A 4W99A 3S81A 1DX4A 5D2CA 5HJ2A 1QRAA 4KVZA 1ESCA 5NLLA 3PYXA 4XWWA 3AI7A 4OHUA 2A35A 2IY8A 4O4HB 3W5JA 4CL3A 1SBZA 2AOWA 3GEBA 3TPFA 2X19A 3WZMA 1EA5A 4J7AA 1R12A 5HKOA 3D3WB 1IN1A 3LK7A 4AURA 3DTNA 2XUHA 2Z43A 2FRDA 2X40A 3CKKA 3IESA 5BQPA 4EP1A 1U0GA 2VJYA 3PJEA 4GPTA 3WMGA 1CY1A 3TF5A 5LP6A 4BGUA 3F6YA 5IXSA 4RD4A 2YV3A 3PEFA 5EAIA 1V8OA 2ZYIA 5DX1A 2KLHA 4NH0A 5HIJA 1BRMA 2Q4TA 2XQFA 4TZKA 1VL1A 3HCAA 1P8AA 5DTIA 1ZL0A 1XZHA 2X0JA 1CDEA 2H2WA 3PL5A 3LBFA 4Y2JA 4D26A 4CF6A 1P4AA 2XHZA 4ZCMA 2G07A 1PR5A 4KNWA 4URUR 4Q3BA 4ZOQI 2IHTA 4WBSA 3JYQA 3SXPA 3WSVA 2ZIUB 3OP4A 4I5FA 4I2NA 4OAPA 4OYRA 2AOUB 3GUHA 2B69A 4JP2A 1XPRA 2WQ6A 3HLTA 4HMOA 5THXA 2QG9A 4REQB 1N1GA 3QNMA 5GGYA 1U6KA 1SVMA 3QITA 5GMOA 4LF4B 4IKEA 1KFKB 3I01M 4NCJA 4F9FA 3HM9A 1CUJA 4Z4EA 1D8AA 4E4TA 1OTYA 3CTPA 1P7YA 3Q0EA 1Y4UA 4HNQA 4FHCA 2C2GA 2CHFA 2OQRA 3PUVA 3PWSA 1R6VA 4JDPA 4NDZA 5CVUA 1NFRA 1TZBA 5AKJA 4UMDA 1I4TD 3O9VA 1N5DA 3H4TA 5IKOA 2CV2A 3CZRA 3D7KA 4AUEA 3L7AA 2FW1A 4D97A 2IPOA 4QU9A 5CDTA 4LK3A 2J85A 5HA5A 2DPGA 1O2DA 1QO0D 3FDJA 3CVUA 4E46A 4LNHA 1KU0A 2NNWB 3CZAA 2HJ9A 2I3AA 4N0PA 1SURA 3II6X 3Q3EA 4PTZA 4ZOLA 3VGPA 2P27A 4JEIA 1A9OA 1RIIA 1EWQA 3ZKAA 4D8VA 1GTSA 3PDJA 1ZM4A 4DW8A 1WXDA 4K6OA 5JSUA 3OAAA 4UAVA 5HGXA 2IEZA 4MDFA 4JI2B 2A5FA 3HNOA 3LYUA 1V3UA 1G5TA 2LW7A 1JGTA 1E2PA 5FB3A 2MJLA 1SU6A 3EAQA 2XB4A 2VI5A 2XSZD 2VZ9A 5BN5B 3X1DA 2WJPA 5TJHA 1G5PA 3PZRA 1JMKC 4H9GA 1TMGE 1N57A 1ZGGA 3JU3A 3NH6A 1RQ7A 5DHSA 1NVBA 4W1SA 1OXUA 3RUDA 1Y0BA 1Q0HA 2M1XA 3B36A 4TQ9A 3VR2D 1YQ9A 3E3LA 3P9CA 4MRRA 1XX6A 1OH5A 1C3VA 2BFBB 3DBLA 2VAWA 4G84A 4J76A 3B70A 3VTFA 5FAKA 6NULA 1P18A 4FN4A 4OU4A 3ZR4B 4S1TA 2PKQO 2WSIA 2CJWA 4IIJF 4B3IA 3CJRA 3FUCA 2CDRA 4P8RA 5ALWA 1N3BA 3BMXA 1FNDA 1OE0A 1NL3A 2PVSA 3DV0B 5DNUA 4ZT7A 3UAGA 4ER3A 5GZ1A 5HUHA 2OGWA 3DBHB 3ENZA 4LVOA 4XQEA 4GI3A 1O6ZA 4YJFA 2O2DA 2OY0A 4IRUB 5KNCD 4BLWA 2Q6IA 3ZCVA 3V4OA 5C35A 4Q9NA 1CZNA 4G0VA 1BXKA 5JMTA 3A2MA 1D7OA 2WA2A 4K3VA 3TN7A 4W5OA 4J94A 4R0VA 4YAJA 9LDBA 1NI4B 3SMVA 1XZFA 2MIIA 1NP6A 1T0UA 1U2EA 1VJDA 3DTVB 3PVSA 5C9ZA 3HGMA 2BFFA 3ORRA 2I91A 5FTNA 4BLVA 1THGA 4V24A 4CLOB 2JAHA 1F5SA 5TNXA 1SCUA 2ID7A 3V9AA 2PGOA 1XPJA 3QG1A 4I9FA 4NHOA 1MG5A 2P6UA 1EEXB 1Z35A 1C30B 1Z8NA 2ZRJA 4DC9A 2RGYA 3TMYA 3AR8A 2B21A 3BSSA 1A8SA 4LRWA 1W76A 1N6LA 1UBKS 3BZUA 4Y9RA 2ONKA 5A06A 4K6KA 5CB0A 1Z29A 3T1QA 3ZK9A 1AQJA 3ISTA 4KRYA 2W11A 2C00A 4D3FA 3L8YA 5FUMA 2ZDGA 3LUCA 4L4XA 4GKAA 5JQGF 2EATA 2Y0EA 4EG1A 1WCWA 2AJLI 2Z4TA 3G2LA 1YU6A 2OV2A 3H17A 4P7GA 3DONA 4MRVA 2EIHA 1P61B 1QWOA 1Y5NA 3UAZA 3INYA 1EDDA 3S2UA 5HBRA 4TZTA 2AUTA 4KLZA 1D6SA 3UV6A 3ROPA 3QJ5A 4P3PA 4R2LA 4BX3A 5ED0A 2ZI6A 1K89A 2P6PA 2I6QA 3DVAA 4RJ2A 1TAQA 3ETLA 1AB5A 3JSAA 4FHFA 3O82A 1EVLA 3Q2KA 3F73A 1IWBB 1PR6A 2KI5A 4WY8A 3RV4A 3MT8A 1K8QA 5FHQA 3S1AB 4EZBA 3F5DA 4AZ0A 2VH2A 4PZCA 4MZXA 4L0CA 3DHYA 5HM8A 4P3KA 2CNNA 4D96A 1YA6A 3MVEA 3ZE0B 4Y9UA 2MYTA 1X1RA 3O84A 1JEJA 5DGDA 3R5TA 3FHOA 3OMLA 3A1EA 1QZUA 4IR7A 4WLOA 3EAFA 5C2JB 3CH4B 3NT4A 5IJXA 3B78A 2J6BA 3O1LA 4JIMA 5AK3A 4EABA 5CLJA 2IJGX 1KE2A 3BUSA 3RSLA 1H6DA 1AIPA 1IAVA 1D0SA 1U7WA 4BFVA 4EY5A 1FIUA 1BKDR 1E1MA 1JQ5A 1XRJA 4ZZ2A 1KAMA 3DOUA 3IO3A 4YR9A 3EJ6A 2PKYX 4A27A 4WK2B 3D3KA 3PEEA 4DL9A 5DM4A 1DKLA 1SUEA 2NV2B 1HE4A 3MTGA 3I1JA 2JCBA 1B8UA 4KXYA 3WQRA 5DLEA 4BJ5A 4MS3B 2VDMB 4MQEA 3V8EA 4Z5XA 1RYZA 3PWTA 4P4GA 2W6JA 2ON6A 2GEVA 3JPYA 5BVHA 4WMLA 4B7AA 2DPXA 4BJ1A 2NZ2A 3BH6A 2P2SA 1SPBS 2IXEA 2NVOA 2WTNA 2B9VA 3KT3A 1FDIA 3O74A 1MPTA 4OHCA 4QQNA 4CV3A 1TVCA 3HL4A 2QY6A 2OD9A 4MLZA 3DMHA 1EG2A 1H8EA 2X14A 4FPXA 4X64B 1CUUA 1P0MA 1QAQA 1T0JB 3X1MA 2QTAA 1ZAKA 2OOKA 4NBLA 4E5DA 2DERA 3E2MA 2O7NA 3LWNA 3NHSA 3KFVA 4UBLA 1NQVA 2BFEA 3I2KA 4WVFA 2BUBA 2P9ZA 4MGZR 2WQZA 5GJCA 1PSWA 1P39A 1T9BA 2FX5A 2GZ1A 1EFPB 2HEIA 1HEYA 1JDTA 4JI1B 3DYIA 4HAXA 3RSCA 5EJMA 3JQ9A 5FA5A 3FR8A 4NFYA 2R6ZA 1CHNA 4KAXA 2QGZA 1C3XA 1KA9H 1N4DA 2V7QA 3WLIA 1RQLA 1N3IA 2XJ4A 1UC9A 4BVJA 4DSAA 5D5PA 3GARA 4OY3A 3LUDA 3FUUA 3NOOA 1R8XA 3CLSC 1QVWA 3M6AA 3L0BA 4NWIA 1SBYA 5JXHA 5K6TA 4PG7A 3NCTA 2PYZA 3GLTA 4Z8XA 1X1DA 3AETB 4Z4IA 1I33A 3AF3A 4ACAA 4MB2A 2N42A 2JGKA 3F6PA 5DF1A 2W2LD 4AY2A 3CSUA 3DT6A 3FVWA 4ZC8A 3LW7A 4KW7A 1GTG1 1QHFA 4NK5A 1RDFA 4C4RA 1DAIA 3LUHA 1PJZA 3ISJA 5JAPA 2VXOA 4RABA 2PLRA 3WMEA 1RTTA 5AKZA 3UUGA 5JYCA 2C29D 1XMXA 1J6UA 1P0CA 4HWSA 3KSMA 1USGA 3DP7A 3IP1A 3OWHA 4C1NA 4AK9A 4OQ4A 4UNIA 4LDPA 4Z1OA 3BT7A 3ER9A 3PS9A 1GR0A 3I28A 3V8NA 2G40A 4XTRA 1KY3A 4NG5A 2C3OA 2QUJA 3KZNA 3NTUA 4XD7D 3RV3A 4BPRA 2BD0A 4I66A 1BN7A 2QP4A 3G23A 3ELWA 3L7YA 4GPD1 3RIEA 3EVFA 1YBVA 3BE4A 2AJCA 1WU8A 3N1UA 4HDOB 1RI2A 2WA1A 3STUA 4BAGA 1HE1C 2BGRA 4TLCA 5D86A 5C31A 2Q7DA 3C5VA 2VJLA 3R7FA 3ZWBA 5KWEA 4KL8S 3WRXA 3A9VA 3C0KA 3CX8A 3NC4A 1Z7BA 3G85A 2XXAB 5JO0A 3QF4B 3VJLA 4YCLA 2CXNA 4LYGA 2AF3C 3H5NA 4YV1A 4KO3S 3GLGA 4UAUA 3DOEA 4QLOA 3IIEA 5LQMA 3ITNA 4KFTA 2JHCA 4EAQA 2OBYA 1ADJA 1K4MA 4P2BA 4UC0A 4M1YA 3I9NA 4CIAA 4NQZA 2AN1A 3NBAA 4XI9A 3V2GA 1M54A 4WXHA 4EKGA 4RENA 2P2ZA 1R27A 2QLNA 2ZRIA 4OQDA 4Q1FA 2G28A 1FY2A 4PC1A 1BSVA 3DCNA 7MHTA 1KK3A 5B57C 1EFCA 4RHCA 1JEAA 1O6BA 5CLIA 4XFDA 4IUCS 1NRIA 3H2ZA 1J0AA 3KTFA 3EUEA 1AXEA 5KAPA 3SWWA 3CJQA 1U7TA 4R3NA 1ZJYA 4JJAA 1A8UA 1CNFA 4Q4HA 4GRIA 3B6JA 1L1RA 1M73E 4I5GA 5FFFA 5T8KA 3WIOA 2VHTA 3T7DA 2R1ZA 4HXGA 1O1YA 2I4RA 2JFHA 3GZNA 1IULA 3NKVA 1Z33A 2PR2A 4J1QA 3WBJA 3QYPA 3AEUA 2C9YA 3HB7A 4GM1A 2VCYA 3RK1A 1BNCA 2HY7A 3VZSA 1KNQA 2WTMA 1HYQA 2R8XA 2XOKA 3Q7IA 5TSDA 1T4CA 2XVXA 3CNHA 5KYYB 2ILTA 5DSZA 5HF5A 2IXGA 4IUYA 5E38A 1GLVA 3JR3A 1MAWA 2ET6A 4GGPA 4HY3A 3TVYA 1GAJA 1NLFA 5SV2A 3FIJA 3TYXA 2WYVA 5BPFA 4Z53A 2IS2A 3LCRA 1F3LA 4Q03A 4RDCA 4LRYA 3TIXB 5JE8A 1MC4A 2G63A 4QWWA 2YN2A 2RAPA 3C41J 3HDTA 3RRNA 2QL5A 1USIA 2J3QA 1FSFA 4QM7A 1NVKA 4KPUB 4XUCA 1AM4D 3L7LA 4IP0A 1Q1QA 2ZS8A 4HQFA 4KACA 5KC8A 2P1DA 3QI7A 4FFRA 3CNLA 1D5CA 4G01B 2B3DA 3M6UA 3M4XA 4U2EA 2XUGA 3SR3A 1U3WA 2ZB3A 4WBNB 1TQ4A 2QNRA 1AUPA 1O94D 3DMGA 1YFKA 1J25A 3IV9A 1NXTA 2QENA 3EIHA 2OQIA 3QPUA 3KWMA 4P83A 4HN9A 4PFSA 3RG8A 3KKOA 4D4JA 2BELA 3E9RA 2WJVA 3AO0B 3EGIA 3ZHVA 2WF7A 4UHHA 3ADCA 4ZEVA 3DLHA 3FI0A 4BEWA 6REQA 2WAXA 1DKNA 3JYHA 3NDRA 4X92A 1CQJA 4EJSC 3RTCA 3EXG1 1R1DA 3JZDA 3SHTA 4MQFA 5LQJA 1CUBA 1O95D 2CMGA 1DBIA 1DAFA 1WXXA 2KE5A 3VQTA 5AQ1A 4TYYA 3K0AA 5DM2A 5DLPA 3KAQA 1Y7HA 3EDQA 3TZBA 1PJBA 2QPLA 1H2AS 1NAHA 1GQ2A 1HE3A 3D1JA 3W8DA 3NBFA 3LDFA 5FBKA 2BLLA 3Q10A 2GFHA 1GTMA 1YTLA 1A8PA 1ZY2A 3WZ2A 4DV5B 4LOKA 4G85A 1IJFA 4LGVA 4TKVA 4LY3A 3VYTB 2AEEA 2BGKA 3VVMA 3W3AH 5EXEA 4G1MB 5SZKB 4B48A 1OI3A 4F2WA 3Q2IA 1PLLA 1MOSA 1TJYA 1MIOA 5GIOE 1RU3A 2OFPA 2PRKA 1NBMA 3EGXA 4XKJA 3VOBA 1L7XA 1BU5A 1A9XB 1WD5A 3ICWA 1QE5A 4EYQA 1UDCA 3GLIB 4IHJA 2BAGA 1X1TA 1L5KA 1MT0A 3AR7A 1I1HA 5DYIA 3HBLA 1F4VA 5CAEB 4CR8A 5HPYB 3ER8A 5KOHA 1TU3A 1PVVA 1XFDA 3C4VA 5CH3A 4DHEA 4MW0A 4L6AA 4GX5A 3DEIA 3L1VA 3LLVA 3RC3A 1ZCZA 3ANMA 3EIXA 1SBNE 4DCPA 1BX3A 2Y0DA 1X87A 2H54A 3T5MA 3JQAB 1K4YA 1RRMA 3GFSA 4K9RA 4UVDA 3UJ7A 4IUDS 2I4NA 3MJSA 1K5HA 1JQDA 1U2PA 1ZISA 2G9ZA 2ZYSA 3BGDA 3C5HA 3KL2A 4FDTA 3W2TA 3INRA 3ZNQA 1NF3A 1T9CA 4OI4A 2X9LA 1Y9JA 3OQJA 4AZTA 4EFLA 3TLCA 1H4SA 2VSQA 2J59A 4UVGA 5CCEA 2IY7A 2I7CA 3QZUA 5KX5B 1L4BA 2VTBA 3RNLA 3RYFB 4HSEA 5KJ1A 1GA4A 1OGIA 3IJRA 3MF4A 3UB3A 4YJGA 4BQNA 2WILA 2FWIA 4BMVA 4BOYA 1LSOA 3LUPA 5H81A 3H2BA 3QELA 2A5DA 3VHRA 1CB0A 2BGNA 3VH4A 1YS7A 1F8YA 3HJRA 3IEMA 2CWDA 2GCOB 3RT1A 5FOSA 2WHXA 3SYMA 1K7XB 3S2SA 4FHEA 2COKA 3HDJA 2FSPA 1YL7A 1I4WA 2OGZA 3A1WA 3G17A 3QPBA 3TZKA 3WX0A 5HKBA 5JAOA 2ZE8A 3FGOA 4RU1A 4HAOA 1KAGA 1OXSC 3TB4A 3IQFA 4CCYB 3CW2A 5E8RA 2A4KA 5LPNA 4ZT4A 3ZHRA 4BNMA 4CODB 2ORYA 4XGNA 2H8GA 1LTHR 2G80A 1UWVA 1E63A 2UVPB 3M3PA 2R4TA 821PA 3LSYA 3D8SA 1C3EA 3GIWA 3CN7A 4HYYA 1EFHA 1TUIA 3ED5A 3PBKA 4LF5B 1C0KA 1QOPB 2Y0CA 1QP8A 5L3RA 2CFIA 3SQNA 4NXMB 4IDGA 3D2AA 4XIIA 1Y8QA 4KHZA 3RBVA 3IBTA 3ZWVA 4QNMA 4A0QA 5HOQA 2N0SA 2UZ4A 5JJ5A 1MA0A 1DQPA 4NLLA 5A6SA 4L16A 2B7BA 2QTTA 2XGSA 2Q8NA 2P1RA 3NDJA 4ER0A 5HJ7A 2A9VA 1P5RA 2MSEB 4P33A 4GIBA 2EKZA 4PZ0A 4YAEA 1SVLA 5A4FS 5J43A 2HTEA 1M6HA 3RRZA 5JFGA 3NDBB 3QLEA 1FSSA 2C8JA 2ERCA 2XF2A 1VJGA 3ADBA 4Q3OA 5KPJA 4J29A 4PAWA 4N65A 2WU0A 4O4JA 4P5DA 3PGJA 4B6FA 1BJKA 4IZ6A 4ESEA 1N7IA 1SVWA 1M8GA 2R1VB 2QX4A 3EHDA 3P9SA 4KG7A 3P9XA 1NXVA 2AFHA 2C20A 2V6MA 3BSYA 4DLXA 2V7VA 2WF6A 1N1MA 3TS1A 2R2AA 2DHDA 1EUCB 5DHRA 4YP6A 3MUEA 4AY5A 5K8JB 4OJKA 5G0SA 2J33A 3IAS6 5ILQA 3PJGA 3ROMA 4Q34A 2WVGA 4BO9A 2IYRA 4XW2A 2OLEA 2E37A 3ON5A 4V2UA 2FWPA 4AXXA 4DUZB 1GT91 3ZS9A 5MGNA 3PHCA 1OYYA 2CXUA 3C3EA 1POWA 1XTKA 2WIGA 4XJTA 1IZZA 1JPVA 4DMKA 1ZVJA 2JKVA 2Q46A 5JC1A 3AL2A 1W85B 2FSHA 3L06A 3N8GA 4J1TC 5ALLA 4WBNF 2FYTA 2IYNA 5TARA 4L5CA 2CFOA 1XPOA 4FYHA 4ME6A 2ZYHA 3CUVA 4GOJA 4F4FA 4AWBA 1M8PA 2ZT6A 3EQ9A 3M8KA 4DIFA 2W43A 4EENA 4E5SA 1R0ZA 2I4IA 1XZMA 2XD4A 3GRKA 1CYDA 3RRMA 2NV6A 3PDIA 3TZHA 3ZQJA 1UMBA 4RK5A 2J0UB 2BFDA 3F90A 4RFSB 2P9BA 3SS8A 4DFDA 1JJAA 2OCDA 3AHJA 2W4QA 3HBMA 4HDMA 3NYRA 4IDNA 4KITB 4JJFA 1CJMA 3NZEA 1ZNQO 4JUAA 3P9QA 4BWVA 1U0BB 1FS5A 3O8OB 1S02A 1SXJB 1U7DA 3H1BA 3N5CA 4QPNA 2WABA 1A9ZA 1IONA 1RWKA 4QXOA 4D02A 5HQTA 2EFDB 3LWBA 5A4IS 1A2BA 5SYAA 4LFAB 1M3SA 5EPOA 4BB6A 3EUFA 3OJOA 4BQQA 4JX8A 4F2GA 3TKYA 4D80A 5KJCA 1KAEA 1DE0A 1WZNA 2FSGA 3U0VA 4TT3D 1EVJA 3V4LA 1DIRA 3R9KA 3KSAC 3WADA 2X23A 1IM5A 4O29A 4RE5A 5TPZD 4OMCA 2PX4A 3RUHA 4RD6A 2RK3A 3P2MA 3UCFA 2G6BA 2J41A 3GVIA 1Y89A 2GA8A 4GI7A 3VSBA 2OCYC 3PGMA 4WESB 4RXTA 4TV8B 4BO8A 3OEHA 3V55A 3AM3A 5H7XA 5KQGA 2Q4DA 2OHXA 1GRCA 4L8LA 1T8YA 2Q0QA 4KK3A 3WP1B 5AJUA 8MHTA 4FZVA 1N7GA 2C3PA 3UAXA 3I64A 3QVGA 3MJHA 4FCVA 5JNSA 5K0CA 2EERA 4W1QA 3D3EA 3WJ1A 1WDMA 3URMA 2JLUA 2BM9A 2NN3C 3RS9A 4AIIA 1O96B 4Q7KA 1UBRS 5FTWA 4JI4B 1GTL1 1AMOA 3EGVA 1ETHA 3E3MA 4RZIA 4JLDA 3U17A 3Q2OA 3RFFA 2QL7A 5HSGA 1WQ4A 1Y3DE 5AIAA 2BEWA 3NTQA 1PJ2A 3SZGA 3WDKA 3HCRA 3DTVD 1LNQA 2WT4A 4D9HA 4RVCA 1E62A 2HSZA 3NOVA 1HTTA 4EMUA 2DFTA 3BK1A 5KX5F 2AG1A 3TNJA 1ZJZA 1CEXA 2FPIA 4M7WA 3LG2A 2WWFA 4L7VA 1RWMA 4DXAA 1SHLA 2ZAGA 3QTTA 5EIOA 2XAUA 1ZO8A 1GRQA 2B6NA 4JHLA 4MRNA 1CNMA 4UVHA 4KVFA 1ODTC 4M98A 1GSAA 1B74A 3NAGA 4HWPA 1Y9EA 4XVRA 4ZO8A 2W42A 4K5QA 2E7ZA 2EHJA 1BMFA 1X7GA 2FWAA 3FROA 2OG2A 1JT2A 2PRSA 4QHTA 4UZFA 2DTDA 2GZMA 5KYXA 3GNQA 2C03A 3X44A 3LTEA 3QBJA 2YW9A 1U63A 5IYZA 1D4FA 1XCBA 3SZMA 4EJ0A 3A3KA 5LKRA 1AK2A 2RI0A 4NV1A 2YY5A 3B1ZA 1GDDA 3CX6A 4Y1FA 3AESB 1CERA 3H9CA 2XCQA 4TMTA 1UEXC 2D8MA 2IUYA 1V47A 2PRJA 2YHIB 2ZSEA 4WLEA 1NLMA 5K0TA 1HY3A 2C8KA 1EIZA 5HF6A 5FWYB 3W6OA 3GG9A 1BG6A 3HYTA 3W9SA 1MVNA 1G8FA 4EQZA 3K9FC 2WOJA 2CUNA 1S2NA 3L49A 2NSHA 4K8RB 3AHHA 3PYMA 4EF5A 1GTZA 1X7XA 3GDGA 4A36A 4JH0A 2JANA 4OSOA 4P7JA 1KPHA 1SH7A 2AMLA 1WG8A 3HYCA 1IHOA 4YUVA 4PC3A 4QVKA 2PR7A 4P3YA 4GC9A 4EW6A 3D7SA 1ONOA 5EKXA 1D6MA 2ACWA 4TTTS 1E3IA 3ECAA 3FWZA 2ZI4A 5JFTA 3QM1A 1PEAA 5IC6A 4MQLA 4EB0A 1JHPA 1XCMA 3F3MA 4ICIA 3GCWA 3SP1A 4I50B 1W2HA 1LF0A 1VHDA 3EGOA 1IG0A 1D9ZA 2O8VA 4UTVA 2NU8A 2GWRA 4B6RA 2FWNA 5KQLA 4NZPA 4V1CB 3F4LA 1L4EA 4DV1B 3ONFA 4FMCB 1J22A 2X5KO 4GSLA 1ZLXA 4IEFB 3ZDRA 2HIAA 2XVYA 1NG9A 3BB3A 3PPVA 4HWTA 1GPAA 1UJMA 3FSEA 1JB1A 1DFHA 3AEYA 3FWYA 4QOSA 1IOLA 2E1RA 3TMAA 2H16A 4O2LA 2PZMA 2XMQA 3AWIA 4MKXA 5G53C 1YJCA 3DAYA 3T7SA 1R5JA 2J45A 5CNJA 2HLNA 2PZEA 2JK0A 1ZXLA 2XUDA 3RLFA 3WYFA 5E3JA 4BQSA 4KMOA 2C8VA 4TVOA 5AXBA 3REGA 3C7TA 4LYAA 2BFMA 3HR7A 4F6CA 2HIGA 2OYSA 3MUOA 4CF7A 3DWGA 4BN4A 2B20A 3BDIA 3EF3A 5AJZA 1VCMA 2NYAA 5LYJA 2V4MA 4XLLA 4LXQA 4O6VA 4X0EA 3ZGXA 1MQSA 1O5OA 1T2CA 3UFXB 1JLLA 2HFJA 3NB0A 4KDRA 2CXOA 4MR8A 1VMEA 4MR9A 3UH0A 4CHGA 4POOA 1QNLA 2F17A 3EODA 5EZSA 1UFKA 3PFIA 2HWWA 2ID8A 3VSAA 3PVZA 3C74A 3WMWA 1AQLA 1WHSA 2CB0A 2L17A 3FWNA 4BKOA 2RHWA 3O8LA 4QHYA 1GGHA 1Q17A 2VOEA 3SVLA 1UAAA 1HT2E 3FNBA 1YJBA 1YC2A 3U7JA 5K20A 2V1UA 1SOWA 1YHZA 2K4MA 2Y05A 1SOAA 3IJPA 3VXKA 5HMLA 2I55A 3HRHA 4G8CA 4ARBA 4UCQA 3GBSA 1WP9A 1JKJA 3JASB 2OCPA 1Q14A 1Z8FA 2HWYA 1E6UA 1Z6TA 4B3TB 4D5EA 1W1UA 2PQ2A 2R44A 3WGTA 4IIXA 3GJTA 2PQMA 3MINA 4A73A 3EQ7A 1G3RA 4M0CA 4CM8B 2ZM5A 3SAJA 2QRVB 1Y7TA 3BRCA 3NATA 4D0GA 2HL6A 3RYIB 4TVBA 3QEAZ 2CLEB 4XQ0A 4AAYA 4WJLA 3A6PC 4I9NA 5DXFA 1NU8A 2JEYA 4C5CA 5ICSA 2LGJA 5IH3A 4F8EA 3BICA 4XGKA 4DAEA 4UU7A 3GFOA 3L7IA 5B64A 4XJXA 4BB0A 2FSSA 3N58A 1MC8A 4TTVA 5J63A 5K3FB 4CQJA 5HW0A 2QM0A 3M4YA 3DEYX 4YUXA 4EELA 2JKZA 2Z83A 4OGGA 1L4KA 4ESVA 1OHHD 4NE7A 2Y66A 1S3SA 5ALNA 1A4IA 1E1KA 2BFOA 3SS7X 5CFPA 2JLZA 1EVKA 4D4KA 1DZIA 3EZFA 3MWEA 3RREA 4QBFA 3FPKA 4UQLA 4KUGA 2NU9B 1UMDA 4AN0A 1ISSA 4KDCA 5KZMB 4B82A 5KQMA 4DRXB 2R6HA 3JQFC 2I65A 3R0VA 3EZLA 4PCUA 2GJ8A 1EWRA 2ZRGA 4B83A 2BKLA 4YRIA 4KRGA 4LFCB 3RFXA 1UP4A 2ZANA 3N86A 5HFJA 1RMQA 3AY7A 3EQ8A 2NPFA 3EIOA 1A7AA 2NZYA 3F6SA 5IM4A 2BF7A 2GSWA 3F3YA 2R86A 4AJ4A 4QQRA 1GUDA 2F1RA 2OSBA 1LPMA 1ONSA 3C7CB 1WZ2A 4IXTA 4X5OA 3KZMA 4KQ2A 4B34A 4E33A 2AR9A 3B1VA 4LN1A 4BMOB 4OXYA 1ZVVA 3T34A 2YHSA 4KLRA 4DMLA 1ZEMA 4CQMD 1FW6A 1JU3A 3NYWA 2CVQA 4N0EA 2FN9A 2QM7A 3F4KA 4YY3B 2FG5A 2VPQA 4P2GA 2DB3A 2NYVA 3J7TA 1VE9A 1AHPA 4S05A 1WCXA 3R3YA 1E9DA 5IS2A 2ABWA 2R87A 3JX9A 1PYDA 2A1UA 1H5QA 4NMLA 3D3JA 5AI5A 2OC9A 3A0RB 5B3JC 5TEVA 1L7BA 4MWZA 1E4YA 2HAEA 4E5PA 4FMBB 2GAJA 1XWIA 2JRCA 4CKBB 3O4VA 4R2JA 4E21A 3WLJA 1NTOA 1XZDA 1PX0A 1EAYA 3KVVA 4NAHA 2G9NA 5ALJA 1H22A 2CE2X 5AOCA 3ZCPA 3VKHA 2G72A 3SHWA 5CCXA 3KVYA 4O3MA 1QV6A 3CSSA 3P0EA 1XYGA 3U40A 3FZNA 1E79D 3WQHA 3K6RA 2X4IA 3Q15C 1FXUA 3ITEA 1NE2A 5D00A 4NMXB 3TKAA 5LMCA 1G4AE 3BD8A 3L04A 5K0GA 4B8WA 3JAKB 3PXEA 3OFVA 4X1YA 5JZMA 1MA3A 1VB5A 3KKEA 3G5UA 5EYPA 3V4SA 1CJVC 1Z4NA 2E9SA 4QJIA 1V16A 1W5SA 3OZSA 2KX7A 4QBHA 1U0EA 3HXKA 4MYRA 2JH9A 2PZLA 1ECGA 1SC1A 3ANLA 3DAPA 4I50F 4NQRA 4MV8A 4H6XA 4GT1A 1I1OA 4QULA 4UBNA 4F46A 1TF5A 1A9QA 1IZ0A 4FW9A 4ERNA 3V1MA 1KEEA 2OT3B 4Q3LA 1MOQA 2XA9A 1YGYA 4M1KA 3VPGA 1E9EA 4BJ3A 1GGMA 2QQ5A 3N2YA 3RAFC 4HX2A 4ND8B 4E32A 4RY0A 4N12A 1FFXA 4KLNA 3A32A 4FGJA 3TLKA 3VR4A 5B55A 1WCV1 4QARA 4WZBA 3ZCUA 4WINA 5IMSA 2H7XA 2RGXA 5FNVB 3ZGNA 4ETIA 2VHJA 3A8TA 2YNMA 4FI3F 3STHA 2XXBA 3RBAA 3TQIA 3X2SA 2IYFA 1EDOA 3CPSA 1CQIA 3IPYA 5KCMA 4AX8A 1VE1A 3K16A 1IU9A 4WADA 4MIKA 3T4EA 2VSYA 3WWPA 4MV3A 5IEBA 3RVDA 5L7TA 2JDIA 1VGRA 4B0OA 4MVWA 4ALMA 2GD1O 3O4FA 2CVHA 4UHBA 2ZSFA 2HXSA 2YQ5A 4DC0A 4G9GA 2VT3A 2DBZA 4A4DA 3K8OE 2VK2A 3DWFA 3HA3A 1UDAA 16PKA 4D43A 5IJWA 4CV2A 1NXQA 4IG4A 1NOJA 4FFVA 1CG6A 3HXQA 3RCBA 3ZY5A 4B44A 3ABZA 2W6QA 3IHTA 3JAMA 3ZH2A 4DR5B 5AOVA 4P53A 5J1TB 4KNYA 3ZDXB 1I2BA 2R68A 4BNIA 3ZOKA 2A78A 1Q3KA 3BDVA 2PUWA 5K8CA 5I7SA 4KFCA 4W9NA 3QFHA 1E96A 3EGDB 4OV6B 2QN2A 1FE8A 5FUYA 2C2OA 3OLVA 5K0NA 2QRLA 3IDSA 3QTLA 1THZA 2WJAA 1NP7A 1ZQ9A 4XJSA 2F4VB 1LNZA 1QH9A 3NBMA 2LR0A 4HEHA 3BBLA 2ZJZA 2AFIA 1HV8A 4YRZA 1VRVA 1Z6ZA 4HLUA 1E0DA 3U4DA 2PN1A 1E5VA 1Z6YA 4IBOA 1U3VA 4KDEA 4JYBA 4N7MA 3RM3A 3UK7A 3WJAA 3O6VA 4Y6GB 4XVQA 1ARZA 1QFZA 1A97A 2P4HX 3S55A 3SEAA 1L3CA 2BP7B 3HUDA 3EPKA 1Q20A 1IBMB 2C59A 3WK5A 4AJKA 3UUFA 4CIDA 3NYIA 3VR5H 4F0JA 4M1OA 4BFXA 2A5LA 4CF5A 5MN4A 3IV6A 2PPLA 1EVIA 3K05A 3LVBA 3PX3A 2ECPA 3AINA 4YI5A 4B3DA 4RSMA 3A6KA 2Z8ZA 4HTFB 3FYUC 5DU2A 4CF3A 3AR5A 4P92A 3E9QA 3T12A 2OCKA 4C06A 2HIMA 3OOHA 4IW3B 2AX4A 1TK3A 1N0HA 2DHQA 3SF8A 2Y1FA 1T9ZA 1ULTA 1ABEA 1YZQA 4L9RA 4X9XA 3R7SA 1ZD8A 4CLHA 4IX1A 4YEDA 5IG2A 4EW3A 1SC9A 3UAOA 2WM3A 3AFNA 4NZOA 4QAQA 3A1SA 3ZHCA 1B23P 1P5JA 2O6HA 4LG1A 4XM2A 2J3KA 2SICE 3FSGA 3L4BC 4QLAA 4DPLA 2E5FA 4Q9KA 4GX0A 3ZHXA 3HNRA 3AKDA 2RGUA 3C6KA 2PE5A 3DE6X 3R5HA 3UHPA 1W2WB 4LHEA 4M9XA 5T5QA 2YV1A 4IF4A 2VCEA 3IPXA 3MMNA 1YDWA 2QVYX 1UKBA 1YVEI 2HMYB 4TTJA 4ZANA 5JFOA 3U7FB 3UNXA 1J39A 2PU7A 1ST3A 4LSZA 4M0LA 2WTUA 3D4BA 2V4UA 1NUTA 1GVNB 3STXA 3A9TA 1IBKB 3JQBC 2K5UA 4RJKA 1DIBA 4DT1A 4QTYA 3CG4A 4ZQFA 3TJRA 3LBIA 2VJQA 3HLYA 3QMWA 4MK4A 3O93A 5DSTA 3WOVA 1EDBA 5JT1A 1XG5A 3WKAA 4C4YA 3G0BA 1AB6A 1T9GS 2EGHA 3SKVA 5A4AA 4DYHA 4V3BA 1ZH0A 3WDMA 4AS2A 2IWRA 2APJA