1FVXA

Clostridium beijerinckii flavodoxin mutant: g57n oxidized
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
138
structure length
138
Chain Sequence
MKIVYWSGTGNTEKMAELIAKGIIESGKDVNTINVSDVNIDELLNEDILILGCSAMNDEVLEESEFEPFIEEISTKISGKKVALFGSYGWGDGKWMRDFEERMNGYGCVVVETPLIVQNEPDEAEQDCIEFGKKIANI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords FLAVODOXIN
publication title Control of oxidation-reduction potentials in flavodoxin from Clostridium beijerinckii: the role of conformation changes.
pubmed doi rcsb
source organism Clostridium beijerinckii
total genus 50
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 1996-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1fvxA00
1SQSA 1AKWA 4NLLA 1TIKA 4R81A 4FGJA 1XI2A 3NFRA 4DY4A 1FVXA 3ESYA 2OHIA 1QR2A 1ZX1A 2MOKA 4Y9RA 3B6IA 3OJWA 5LBTA 1XYYA 3KAQA 4C0XA 1NNI1 3NHWA 2Q9UA 3NHYA 3OWXA 5EMNA 1YCHA 2BZSA 4ZVMA 1RTTA 4LTDA 2QWXA 1YOBA 3GFSA 4NULA 4S24A 4ZVKA 3QE2A 1SG0A 1FLDA 3GAMA 4C14A 3U7RA 3NHFA 1H66A 4YAOA 1AKQA 2QMYA 2QX9A 1KBOA 4BMPB 4LTNA 3HA2A 2MTBA 3N3BC 1T0IA 3R6WA 4HS4A 1FTGA 3EDOA 3F6RA 4ZVLA 2X2OA 2BN4A 4YAFA 4Y7CA 1RLIA 4YQEA 1JA1A 2N1MA 2OHHA 3NHLA 1OBOA 4LA4A 1AMOA 4J8PA 1C7FA 2FCRA 4U7FA 4M0CA 3N39C 2M6RA 2KLBA 1V4BA 4QOFA 3NHKA 5NULA 2QMZA 4HEQA 2MT9A 4FX2A 1RCFA 5FA6A 1DXOA 1AHNA 5B3LA 3HLYA 2AMJA 1KBQA 4F8YA 3OX2A 3F2VA 5NLLA 4FGKA 1JA0A 5EAIA 2QX6A 3L9XA 1RLJA 4YALA 2ZKIA 4QODA 4GQIA 3B6MA 1QBGA 1BVYF 3NLLA 2OHJA 1AZLA 2V5UA 3NHJA 5LLDA 1YRHA 1VMEA 3ZHOA 3D7NA 4QOIA 2XOEA 1FLNA 2KQUA 5LBUA 1C7EA 2V9CA 1CZNA 1WSBA 4GR9A 4LAFA 1YKGA 3OVMA 1J9GA 1DX9A 4QOGA 4U7HA 2Q62A 4FGLA 2FLVA 1QRDA 4ZVNA 2FZ5A 2W5UA 3FVWA 4N9QA 4CETA 1H69A 1D04A 2XODA 3W78A 1YCFA 3KAPA 3TE7A 2MWMA 4LTMA 6NULA 4H2DA 2Z9BA 1ZWKA 1CZLA 3QFCA 5LVAA 3TZBA 5LJIA 5FX2A 4C76A 1DXQA 1T5BA 4H6PA 2HNAA 1WSWA 3ESXA 4DILA 5BUCA 3QFRA 5A4KA 2FX2A 3F6SA 4PU0A 2QX4A 1ZWLA 3NHRA 1CZHA 2HNBA 1YCGA 2RG1A 1OFVA 1XYVA 3LT5A 4CF6A 4YAWA 1FLAA 1I1OA 4XDHA 4PTZA 1J9EA 1CZKA 2V5VA 3B6JA 2D5IA 2R96A 1AKVA 3UXHA 2Z98A 2BPOA 3NHSA 4Y9UA 1OBVA 2WC1A 1CZUA 5B3KA 3NHUA 2X2PA 3OX3A 3KLBA 4OXXA 1E5DA 2QX8A 2Z9CA 2GSWA 1CZRA 5F51A 2ARKA 1FUEA 5ULLA 5LJLA 3RPEA 5JROA 3O2NA 3JSXA 1AG9A 1YDGA 3EYWA 3ESZA 1F4PA 3TEMA 2FZVA 3FW1A 1QHEA 1J8QA 3ES9A 3W7AA 2M6SA 2QR2A 3HR4A 3N3AC 4ICIA 3G5MA 3W77A 1GG5A 3FNIA 1TLLA 1AKUA 3K1YA 1CZOA 3NHPA 2OYSA 2FVXA 3L9WA 4BMOB 3FJOA 2BMVA 4XDGA 4PTYA 4YAUA 3W79A 1D03A 3OWHA 4C0WA 4DIKA 1AKTA 3UXEA 3GFRA 3FX2A 4N65A 3B6KA 1B1CA 2B3DA 5F4BA 5LMCA 5F12A 3LCMA 2R97A 3K20A 2BF4A 1D4AA 5EA2A 3F90A 3OX1A 4D02A 1FX1A 5TGZA 3O73A 2FDXA 1J9ZA 1BU5A 3SVLA 2A5LA 2FOXA 4N82A 3KEGA 4U7GA 1FLVA 3S2YA 3OJXA 3P0RA 1XT6A 3GFQA 4QOJA 3U7IA 2F1OA 4GI5A 1X77A 1AKRA 2Z9DA 4QOEA 2HPVA 5FUQA 4QOHA 2FAXA 4ESEA
chains in the Genus database with same CATH superfamily
5KVSA 3AR4A 1TYEB 3N6RA 2J45A 3RS2A 4B73A 4INAA 1K4YA 2PX8A 3KFLA 2WSIA 5EFOA 2F62A 4E4TA 5B36A 3Q15C 4NLLA 4TV9F 1E0AA 3E9QA 3ND7A 5KVVA 3EH2A 3MFYA 5HCIA 1ZCBA 1RW4A 5DYGA 1X7XA 1KI9A 5L4LA 1K27A 2P2GA 3RVOA 1C3OB 2IBMA 3CT4A 1DHRA 1EVLA 1JW9B 2M2IA 4LPKA 4QEDA 4AUEA 5KNCD 2RK3A 5IKOA 4ID3A 2ERYA 3OJWA 4GQBA 3FKSD 3ZDBA 1XRRA 1TEVA 2IYPA 3TPFA 4QTZA 2WY2D 1BH2A 3FY4A 1NUAA 1P73A 5DN6A 4ERXA 2VQ3A 1F1BA 2J09A 4G0NA 3JZDA 1OQAA 3RYFB 1JSRA 4ZQBA 1GY8A 1W5TA 3E18A 4FYKA 3L0SA 2Q9UA 1RM5A 5AIAA 4QGHA 4XLTA 2YTZA 5IJAA 1P7PA 2GUWA 3A6EA 4YONB 3SQNA 2HIHA 4PN3A 2HDHA 4Q9KA 2P0YA 4B71A 1PI3A 3NNSA 1JMYA 1QVAA 5I9LA 3QBTA 1ADCA 1VG1A 3N28A 2NMVA 2RARA 3OHMA 4CMHA 2HNKA 4RTPA 1NONA 1EK6A 1Y48E 2DWCA 2P9BA 4WHMA 3ECCA 3FGNA 3UB2A 5FWXA 1RFGE 4NJEA 2G40A 4BJ1A 3GLKA 3SKYA 2YJ6A 1NBME 1AV6A 4BUZA 4KJXA 4MTLA 2P27A 1W4ZA 1E5LA 4BN5A 4C0JA 3HXMA 4OATA 1Y6FA 1AA6A 5C5EA 3CJTA 2YV5A 1PLKA 4GEKA 2AL7A 4ZC8A 1YDFA 3U2QA 3KXLA 1V11A 4WESB 1JQJC 3NRCA 2B7LA 1UC8A 2B7CA 3EWAA 4MS1A 3AW8A 3AF0A 2P11A 3U62A 4YAOA 1TK2A 3S99A 3ZDQA 3JATB 5AJVB 3QPBA 2JGFA 1QDLB 1H2AS 2Q1SA 3ZHYA 2OGTA 3LECA 2GAIA 3D0QA 3DS8A 3RUCA 4CM7A 1GM5A 3FWKA 1G0NA 1YMQA 1FP6A 4LSMA 2NWQA 2H57A 3P9IA 1R0BA 1TJPB 1TZBA 2IZ5A 3OWOA 1S4MA 1YACA 1Q14A 1CUZA 2O7NA 3WGZA 1VE5A 2PZGA 4AJJA 3E3MA 3EDOA 4GPD1 3MEQA 2V4UA 4AT1A 3PCRB 1NLYA 4AJKA 2D8MA 1JG3A 4EG0A 5JEDA 1DPFA 3WFJA 2QPLA 1E2DA 1F0NA 3D8NA 3O74A 3PHGA 4KJZA 5K0SA 4F4FA 5IHPA 1Z6AA 4EPWA 1M8JA 2LPMA 2Q49A 4ZYYA 2WFMA 3L49A 1G8HA 4P3KA 4YJKA 4AO6A 4CODB 1PL6A 1HYQA 4R5MA 4MJXA 4W6QA 1LLFA 3AVVA 2AQHA 4RDCA 2H3HA 2IYLD 4IRMA 2CF6A 4KQXA 4LYFA 1COWD 2C96A 3QM1A 2WPDD 4PE5B 2V7XA 3NIFB 3C4VA 5I9IA 4ZI7B 2WVAA 1CX9B 1T35A 3IOYA 3G0CA 1C7FA 1KA9H 3PFWO 2PIDA 1KBZA 2ZUBA 5HSGA 3PUVA 5DN9A 4DPMA 5BO5A 5JS8A 3GLGA 4E07A 2HJ9A 1T2AA 4IH9A 1A8HA 1ZSYA 3FWHA 3KU1A 3LC2O 4GKVA 4B87A 1RYFA 4NZYA 2FK7A 1QQBA 1VPWA 3LCVB 1QTIA 3WHLA 4QBIA 3GA0A 3BHNA 3L0DA 3DULA 1MQAA 1XTTA 4UEOA 2I2WA 3LZDA 3WC4A 2BR3A 3TR6A 1NJFA 2PA0A 4XDYA 1PQUA 2I6XA 1V2HE 1PP4A 4DB2A 4IRXA 4CQNA 2FKAA 1M1XB 1NT2A 4W9NC 3OQ1A 3WL7A 2FJ0A 3OFJA 2PWAA 3RSHA 4BXOB 4Q3EA 1DG9A 4XSVA 1ZSNA 1ODIA 4JVOA 5LOVA 3GFFA 4S3MA 3TGWA 4EUEA 4UBNA 2QYTA 2XDQA 4D5GA 2NM0A 1BXGA 2HSDA 4BWVA 5B7NA 1HL3A 3MCTA 3BUSA 3PKJA 3C4JA 4CIWA 2C7PA 5AM2A 1KY5A 1ONNA 1SXHA 2E1RA 2HJSA 3RSSA 2PBFA 2P9JA 1AGNA 3RQSA 3DDHA 5REQA 4C7XA 2UXBB 1LLCA 2AFHA 1NQTA 5IN5A 3P0JA 1Z47A 1QSGA 2R6R1 4FHEA 3LLUA 4KN8A 3QVJA 3A1EA 3DHYA 3AEUA 2CHQA 2HQ1A 1J8VA 1BVYF 4DLSA 2OO5A 3BL5A 5DW3A 1Z5PA 1V5WA 3CCFA 1RDFA 4OP2A 1NXTA 1FEZA 2V5UA 3CO0S 4RL6A 5BXQC 4GOOD 4WUVA 1VL1A 3CCCA 1Z45A 3NHJA 2Q6LA 1PT8A 4TKZA 4OSEA 1HC7A 1ZGHA 4GDMA 4RFSB 5H82A 4H3SA 4Q3LA 5ED0A 1JL3A 1VFNA 1L5OA 3U44A 3THXA 1FPQA 2YNMD 4FE7A 1UP6A 4PZCA 1JF8A 1USUA 4BE4A 1CEYA 3MJRA 1CEEA 4Y2JA 2ZE6A 2O06A 2IH2A 4H0NA 3M34A 5IVPA 1YBAA 4H7HA 4BFSA 4EYOA 1HOTA 5LLSA 3HCOA 3RVJA 3QQ5A 1TM3E 2WWWA 1AF7A 1P91A 1QZZA 1US8B 3RCBA 3T4EA 2CDCA 3W0LB 5KQRA 2UKDA 3PX2A 2F43B 1ZONA 4NPCA 3H3FA 1RHMA 1XZLA 1USKA 3RHTA 4MWSA 3QE0A 1RHQA 3G8CA 4LRTB 4BLSA 2FXIA 2QX7A 3PX3A 3QFFA 4IDBA 2Q62A 2FI1A 4RZQA 4FGLA 1RCUA 3GP3A 3U61B 4X94A 3ZDCA 1X1BA 2DQSA 1GPMA 3O94A 3VX4A 4EMSA 2YDXA 3UWSA 2AQ8A 3RUDA 1OU4A 3LT0A 4PTLA 1OJLA 2HBZA 3L84A 3IIMA 1ZPDA 3CLTC 3DPSA 1CJVC 5ITZA 2JKVA 1ZVMA 4BAUA 3GRRA 2GF0A 5FB3A 3OZEA 1LBQA 2HGZA 1G8KA 1MEOA 1VSTA 1X8LA 3L8MA 1YRYE 4LHSA 4WEQA 3BHJA 3HCAA 5F78A 3V7NA 2YVAA 4CIVA 4YJDA 2XODA 5DF1A 2WNHA 5TMPA 1V43A 2DFLA 3GO4A 1ZM4A 5KREA 1GPDG 4TVSA 1CE8A 1XZQA 4B3DA 4Q9IA 4PZ9A 2IEZA 4OHMA 4DLKA 3F96A 1ZD5A 3A9UA 3MAAC 4B3IA 1H23A 1TU3A 4ISBA 4G3XA 5FPPA 1QIIA 3MMSA 4LYJA 4DDMA 3ENVA 4F1WA 2ZRNA 2JFXA 3O1IC 1P5ZB 2YN2A 3E1SA 2QYSA 5CYOA 1PCXA 4O2BA 4ZO8A 3OI7A 4Q3NA 5B7GA 2MDTA 1AM4D 1AN0A 2XB9A 3T5MA 3ESXA 3KXIA 4GLLA 5ERYA 2ERXA 4HQ6A 1O94D 1TM1E 1JN0A 3ZS9A 3AFMA 1GP2A 4LZJA 5DZSA 4LCEA 5A3QA 3GARA 1GEGA 3HPRA 3LK7A 2BFBA 4L9WA 1MR3F 2C9YA 5DE3A 5KYUA 2AFIE 2ECKA 3VPBA 2Q27A 3C24A 4B33A 5E0KB 3QMPA 3EGOA 5C1BA 3VR6H 2QUHA 3D3EA 4I55B 3IBSA 4ER0A 4LDPA 4OH7A 4DGQA 5FTWA 4EFDA 2JGDA 4TQUS 5CVJA 2CXOA 4ND7A 5IT5A 3KJIA 1L4GA 2Q5IA 4L22A 2HUNA 2KJQA 2EZUA 2AFVA 3AHHA 2AV6A 1GNQA 2AQKA 3LBNA 3BFJA 4D4GA 4KYTA 4A0SA 4BN0A 4PVCA 4HLDA 5ABPA 2Q3LA 3ZQUA 5LWHA 1XYVA 2NXEA 3AT1A 2YJ3A 4QX6A 3ZKAA 2VP9A 4COOA 3F71A 1ILEA 2IBSA 4OVKA 1FOEB 2Q3BA 5EIBD 4AKHA 2VJOA 1YTUA 2VQSA 3BPSA 2Q3EA 4BB9A 2PPLA 3G5TA 3I32A 3F7OA 1XVTA 3F7NA 1KQ3A 1SXQA 2I1LA 1KK2A 3C1UA 3LLCA 5SV2A 5SY4A 3RHSA 3H19A 3T8YA 4AWAA 2E4ZA 3DE5X 3AY6A 1DNPA 1NXOA 2ZP1A 3B3FA 3BFPA 3IQXA 3KYBA 2XQVA 3KOZA 3OLCX 4H16A 1EIWA 4IMJB 4XOUA 5FQNA 3CZPA 3ELUA 1KQNA 1VG9B 3EVEA 4HFJA 5FA5A 3BJEA 4ETWA 4IXNA 4MPJA 5I7OA 1ZK3A 3FG9A 3K0CA 3R40A 4UXHA 4C43A 1I6KA 4QBKA 1YUMA 4DSNA 3UJAA 4C0HA 5BNIA 3BXXA 4WKGA 4NX2A 3S28A 3QWFA 1SUCA 2VIIA 3GPDG 4J0EA 4TKVB 4C7VA 4P31A 1KYIA 5J2UB 4KWTA 1ZGGA 1QCZA 1JFLA 1LF0A 3PQEA 1SHUX 1OH6A 3R6TA 1FUUA 2IYSA 4F2WA 3STTA 3HV2A 1TFUA 4YMIA 1F12A 1A72A 3QVTA 2R68A 3SSMA 4ZPJA 4OJKA 2UDPA 3E3OA 4RY0A 3IUYA 1YRBA 2Z2YA 4PBRA 5LP6A 2WD9A 1XROA 3IP3A 3ZBTA 5GJBA 4IS3A 3C2QA 1WRBA 1Y81A 3RVNA 3A28A 3GDFA 2GKGA 2HRCA 1SKYB 1CB0A 2W8ZA 1A76A 1N9GA 1WX1A 1Z5NA 3LHSA 4IV0A 5KOJA 2VCYA 1RI4A 3DTTA 2RI6A 3F5QA 2O20A 2R60A 2UZ3A 4RA9A 4EB3A 3MGGA 2VDLB 3RANA 1LBHA 3C5VA 3IVAA 4HWTA 5E7MA 2VF8A 2WU3A 1IRIA 4Y18A 4JVLA 2OLJA 1I13A 1C2TA 2AC2A 4RK7A 2I67A 4LMPA 4S0ZA 2PD3A 3UB3A 3PGA1 2GXSA 2D1QA 2PANA 4C1NA 4E15A 1TM7E 3WGQA 2EG9A 4ARCA 1PSDA 2GN0A 4Q05A 1UZNA 1VJGA 2ZI3A 2WUWE 3CFYA 2QRQA 1K0UA 2HBYA 3F49S 3KZCA 2YQ4A 4UUQA 3JQFC 3U7FB 1N32B 1JVBA 3HYNA 3AHFA 2GZ3A 4B3HA 5A0FA 4LGYA 5K4AA 1SUEA 3W77A 5BSUA 3O4IA 5CFRA 4NAHA 2ES4A 2WUFA 1SU8A 3IE2A 4UC0A 3X1MA 3RI3A 4RELA 4KKVA 4ERNA 2FWIA 2XW6A 2ALJA 1KVSA 3S40A 5FL3A 1Q0QA 3FYUB 5KIAA 3BQMB 4JYZA 3DT9A 3QV1A 2OYSA 2PKRA 2LKCA 3MBOA 2ZXFA 4FFDA 5I9NA 1AJEA 4FJ2A 2BGRA 3FKQA 4MINA 2JFUA 1Z2DA 2D2EA 2G1AA 2WKSA 2XADA 2XMSA 5E9AA 3ZGOA 3WAJA 2R25B 1MGPA 2KSQA 1DQRA 3U3KA 3X1KA 2EEZA 3K9WA 2I6SA 2PYDA 1B2LA 3DUFA 3VTFA 2XTAA 3WMEA 3X43A 5JALA 2XRZA 3UF0A 3OWHA 2V8OA 4INZA 3OFNA 5JAQA 5K2MA 2O1EA 3DVSX 3I28A 1YONA 4UHBA 2ZWPA 3J81k 4EKNB 1VOTA 3VR5D 3W3AH 4B74A 4YP5A 3ICQB 1T5HX 3T7EA 3WGYA 2H2IA 4D6PA 1ODSA 1VMAA 1XD2A 2AN9A 2FMXA 4FZ3A 4WNYA 1KI8A 1VI6A 1XSEA 2NO7A 4KOEC 1QYVA 3ROFA 3U0VA 1EP3B 2XNJA 2AW3A 5CCXA 4LZNA 4ZMRA 3LAWA 5FV7A 3T38A 2ACVA 2QRMA 3RC2A 1NVXQ 3R0VA 2AG5A 4UBMA 3T1NA 3WLHA 1QGYA 4HXGA 5FI3A 4U9HS 2CD9A 2XWQA 1TT5B 3ROTA 3AHEA 3AVXA 4QPPA 3NDPA 3UVEA 3X44A 2AYZA 1HYGA 1RP7A 4EHKA 3C45A 3RF6A 4BP9A 1IPHA 3S55A 1DOHA 1KP3A 2H16A 5CBPA 3D8HA 1ZJZA 4PHFA 2X6QA 1CQWA 2GTPA 1Z4KA 4A8TA 4GXQA 3HKCA 4A91A 4PZDA 1HOXA 4C89A 4G07A 4OHPA 1F0YA 1TE2A 2AB0A 1NGSA 4WZAE 3DLBA 3VR2A 1TTPB 3R5KA 3TAHA 4HB0A 1TU0A 5AK5A 1KVUA 1Z12A 5KYGA 4XYBA 5ARCA 4RM2A 3HKBB 2YV3A 1IN7A 1KYWA 2ZI5A 3OJEA 1XU9A 3ZXYA 2Z5VA 1UOOA 3IBTA 4AROA 4F4IA 4XD2A 4ZU1X 1CULC 1VP9A 2QRUA 2DLDA 1KE1A 4F93B 5AR1A 5JMTA 4A36A 3KL2A 3SZOA 3FA2A 4FOLA 1JLKA 1HTTA 3CWQA 4XGKA 3W7BA 3WTBA 1VFPA 3HCRA 1TJ3A 4IINA 2XT6A 4JK3A 1YI8A 4OHBA 1QPZA 3N0XA 2Y1WA 4B6PA 4K6FA 3FOWA 5CB4B 5I47A 4U00A 3ZD6A 3HA3A 3SHOA 1ZCZA 2OCDA 3LBHA 3ER9A 3FLAA 2O5VA 4MB6A 4MYRA 4FC7A 2JJ1D 1L4MA 3K0HA 4QOEA 3W5CA 5TQJA 4XKJA 3NBQA 4ETNA 4OG2A 3B7PA 3C14C 3SPXA 4QOHA 4CEHA 1B8UA 3IE1A 4KODA 3L4EA 3NDJA 4OUDB 5AI6A 1KYZA 1SEVA 2HW8A 4NMHA 2G5PA 2GYYA 3VPGA 3AVUA 1KL7A 2GNAA 3HCCA 4GEGA 4EW6A 2ZYIA 5E6RB 2MSLA 3GEEA 4M1SA 3B1YA 4M0MA 1ICEA 5FOXA 4RJIA 3DL7A 2E9SA 3ZNNA 1XXHB 2QBYB 2V6MA 1Y3IA 5KNCA 4IJWA 4ZT6A 2Q9BA 1KYXA 3G2PA 3N7TA 5TVGA 3W90A 1U1EA 1FPMA 2REXB 3EBPA 2A1TR 1NKTA 3FKSA 1WG8A 3H9JA 4DBLC 5IABA 4ILKA 4KX3A 1U8UA 1KSGA 2VTBB 5H8WA 1ORIA 2YDYA 3JWJA 1JA9A 4J0QA 1XRPA 3MWFA 1NYRA 2JJ2D 1JHVA 1VHQA 5DTMA 5C1OA 4WBNA 4US0R 3HDVA 2HZ7A 4HWKA 1C14A 3TH5A 1JR4A 2K4MA 2YMPA 2Y6VA 3O9VA 5AKYA 1H2RS 2V03A 3WLQA 4A5SA 4DG5A 5K8VA 3A3PA 3HVKA 1QQAA 3R20A 1YS6A 4IG4A 2O05A 2B98A 1DT3A 4JYAB 3FDXA 1REQB 2AXNA 4QBTA 4R8MA 3GT7A 5B1HA 4X20B 421PA 1R2QA 3COSA 4GOXA 4WVLA 1EXDA 5AVJA 3D0KA 2X6RA 1ZH0A 2IHVA 3L4JA 4U7WA 5B64A 3LFHA 1A4IA 4F1KA 4JBNA 4FTWA 1RYHA 4XJVA 4V2UA 3ZHCA 2C3UA 1RACA 4ZQHA 4HQOA 4YJHA 1OOEA 2AFRA 2GFQA 4M0FA 3WLOA 5A3SA 1JQBA 1KFCB 3GLSA 2A78A 4XCQA 5BOSB 2K5UA 3KSAC 2GM4A 5FCDA 1RVDA 4YXFA 3M70A 1PEAA 4J9UE 4NL4H 1YVDA 4LYGA 1ISMA 2MMGA 5JCOC 2WVHA 1Y63A 1K5GA 1Y89A 1ZP6A 2JLSA 4M36A 2CB0A 4UNSA 3GR6A 1VHTA 1EINA 4GSLA 3A04A 3FDZB 4RL4A 2Y67A 3QLEA 3R5SA 2BGGA 4MMXB 3QVOA 1DTWA 2UYCA 1H42A 3LWZA 2ORED 5KYXB 1TA4A 1VL6A 3ZBUA 5GADl 1MU0A 5FBWB 4M7OA 1NRXA 2OD9A 1Y9EA 1BIFA 5EZ5A 1H0HA 4A8JB 4LOKA 5L51A 3TOVA 4ALIA 1P0MA 2Q45A 2Z1DA 5J43A 3GLIE 4UNQA 2V0GA 3HEAA 3L1UA 4D3FA 3GF4A 3EZ9A 1G0OA 5JECA 5L4SA 4BGDA 1JAYA 4JL6A 1HZJA 5T7BA 2IV2X 3TGPA 1DAPA 4V0ME 5G2OA 1GEEA 4EO7A 2E49A 2PBRA 4MKRA 1U8XX 3HABA 2X2OA 1W94A 1TAQA 1X6VA 1P4RA 4B85A 2VPYA 1KK1A 4TUYB 2XIQA 3G5AA 2VXCA 1QHIA 3BAFA 2I2BA 3D3NA 3D5QA 3BM5A 3ESCA 1KIAA 1O8BA 3GC6A 1COWA 3LOUA 3OF5A 2WPDA 4GX2A 1ZVJA 3ZD9A 5K8TA 1JQKA 5K01A 1U2ZA 5AQ1A 2WIFA 2J3JA 5D00A 2J3QA 5KPDA 2B0CA 5ADHA 2GK3A 1MHPA 4AX8A 3U6KA 2NPFA 2LNDA 1BO6A 1SM4A 4QLOA 4LA4A 4LVNA 4US1R 5DI3B 1L3BA 2AUTA 3PDWA 2P1RA 1U4NA 1AE1A 2OAEA 1JLSA 1RKBA 3A0UA 1Z6PA 1MRNA 2YQ5A 1TF7A 3DTYA 3I5XA 1GA4A 2IITA 2C8KA 1OB5A 2Q1TA 1G6HA 1YDHA 3D2BA 1N2BA 2BEVB 3KJHA 4M1TA 2KLBA 1MO5A 3AILA 1WUKS 1V1MA 2CJWA 2OQRA 3HNRA 3Q98A 4RDHA 4WCFC 2GJ9A 3RS5A 5AM3A 4M9XA 2FQ1A 2GERA 2ZPAA 4PINA 5SYMA 3BIWA 5IW8A 4HEQA 5F76A 5FPTA 3WWYA 4U6QA 4UHKA 3SD7A 4D92A 1RC8A 4U8GA 1CUCA 1XQ6A 2P4UA 3OKFA 4XRRA 3PPVA 4QVKA 1OT5A 1WNTA 4M99A 2E82A 5B3LA 3NANA 5J3JA 4Z7QB 1EM6A 1GLNA 2I4MA 3RGGA 4TPKA 1FDOA 1NRIA 2WPNA 2X3YA 3TQTA 1NW8A 5ESXA 1V5EA 3WLKX 4BNUA 2XCUA 2A92A 5IKPA 5J4HA 4RTKA 1PT5A 3QXHA 4P5EA 5FO1A 2WLSA 4IXTA 2A7QA 3RODA 3UHAA 5A06A 5AVRA 1MN6A 3H7AA 3TDKA 1CQIB 2WWFA 3A9VA 5E7JA 4LFCB 4XPIA 1Y3HA 5JBIA 3G1TA 1KNQA 3OLXA 3STYA 4BTLA 3C7AA 3FMOB 5AM5A 1W8IA 5FTLA 3OPYB 1E2LA 1FZQA 3E9CA 3M3HA 3QKRB 2BHTA 2O2DA 2D4HA 2W98A 3K5HA 1CNFA 1N5LA 1SBIA 2VAVA 3BHMA 2AOVA 3FI0A 4BGIA 4UZFA 5DCYA 4ER3A 1EM8A 3B6ZA 4YFVA 4DM3A 5BMVB 1E1QD 4GQIA 4QTUB 2BMAA 2Y0BA 3ZX4A 4OJQA 3OQMA 1NVWQ 4RH3A 3TTTA 1C30B 3T7KA 2A1UB 4IF6A 1TA9A 1K89A 1TD9A 1TW2A 2YYZA 4PPNA 3W6ZA 3M1AA 4BL5A 3LUJA 4Q02A 1JDZA 2Q3HA 2BI4A 4ZRMA 1ZN8A 1P4SA 6ADHA 1DEKA 1GA6A 1K92A 2D3WA 4MEAA 1XPUA 1YB5A 3LBIA 4MV5A 2EJWA 5HOEA 2G1UA 4OMCA 2RHHA 3ZZMA 3KQLA 3IL2A 4YTEA 4CMAA 4KRGA 1JDBB 2AMYA 4JJ6A 4J91A 4EF4A 3M81A 1P9LA 2KYRA 4QYIA 4NKRA 5LBUA 5CEFA 3AF5A 3NG1A 2ZVQX 3H2JA 3PQ5A 3U48A 4EG3A 1T6XA 3LUKA 2M32A 2WSMA 3GROA 3H13A 4IEIA 4OEHA 3I09A 1LD3A 1H2XA 1EB8A 1MV8A 5AKKA 3V00A 2VJBA 3OLYA 4GR9A 4LAFA 4MUHA 3M82A 1W59A 2SICE 3PEUA 1GPH1 1RWKA 4JP5A 2A5JA 4O4JF 1BS9A 1BJRE 3JZFA 1DAOA 2HF2A 4WA8A 3ESAA 2LCIA 3DQPA 4EY5A 3S5UA 3UYKA 4BDTA 4BVHA 1A8PA 4X45A 5JAPA 3NIBA 4C2BA 2YIJA 2YYAA 4UU1A 4E0BA 1FIUA 1T91A 2I29A 5CX4A 4XFJA 4REQB 1U5BB 5F7ZA 2FR8A 1QRDA 4NCKA 4Y8VA 3JARB 4AJ4A 1PEDA 1JKFA 1Z39A 4I36A 2F3SA 4RV4A 5DP1A 4B82A 4ETMA 2ZSJA 2YY5A 1P8JA 2H11A 2RAPA 2YBEA 3EG9A 3F9IA 3G2MA 1NI4A 1XTSA 5ALNA 3WIOA 4CUJA 5F7OA 2A9PA 2H29A 3A6JA 4J43A 1WUYA 2W4IA 3Q8MA 2VAMA 4LTMA 1EFHA 3IR5A 3LCCA 4PO9A 3FYDA 4EQZA 2IY7A 1ZHFA 3O75A 3REQB 2YS6A 3U17A 5ANRB 4C6TB 5CP8A 4C6SA 1LLDA 4JBLA 3C70A 3OZSA 3FE2A 3KQYA 5FX2A 3G7UA 1O94A 2H2DA 3H2YA 1GL9B 2GGSA 2HNAA 4UFNA 3E48A 2BM1A 2ZTLA 2IOFA 3VZRA 1XMQB 1HNZB 1CS0A 1FJGB 3R9IA 3Q6MA 2V55B 4JI1B 3ZCVA 4Q4DA 1P75A 3QFSA 4C7JA 2EVWX 2HADA 3L7YA 4KXYA 1I80A 1DKNA 2EL9A 4QYWA 1APBA 2YWRA 3H1FA 1XRJA 4OH1A 3WMGA 2ZOSA 2PDAA 2C07A 3TSYA 3W5IA 4UM5A 3A6KA 4G0QA 4L85A 4ZVRA 4HFNA 4BKRA 4FYIA 3ZI4A 5F2KA 3IA7A 5BVHB 1NY5A 2EKPA 3EZYA 4TQGA 2LKDA 3L93A 4D4HA 4D8YA 4YMWA 2VSXA 2RG1A 2P8SA 3L5KA 1O9BA 3BIJA 4Q03A 4BEBA 1OCEA 3F7TA 2IOFK 3PK0A 3RNLA 5CDGA 5F5XA 1W4LA 1OFVA 5C0OE 1PT6A 3FPGA 3M8KA 1J0EA 4QE3A 2YFHA 3LT5A 5ICCA 4AP5A 2H17A 4GH5A 2AD5A 4EA7A 3TTUA 4EMBA 3TCXB 5KWSA 5BNZA 2V65A 5J5CA 1S3FA 4NE9A 3L0YA 4ZQFA 2O2GA 4TYPA 4A27A 2NTJA 5CDUA 2M9MA 1EA5A 3G59A 5L6MB 2QMUA 2DTXA 3WBKA 1J4AA 1EVJA 2OBXA 4MR8B 2G17A 4UE6A 2N3ZA 5KS2A 5CA1A 1RMTA 3M4YA 5CHEA 1E5TA 2B9VA 4FDVA 1RXIA 3IKLA 1JFSA 1Z8DA 2P65A 4UHHA 1WJGA 4EBFA 5LDDC 4NBTA 1BQEA 3NIGB 1AKNA 5ECGC 9ABPA 4X85A 4Y9SA 5CLHA 1LS6A 3BCSA 2VNKA 4ITUA 4D44A 1GSOA 2X58A 4NBUA 4UCQA 2PSHA 1VTKA 1E1CA 1AV7A 1ZGCA 3P71T 5F2EA 2A5GA 3W8RA 1I2ZA 1TMOA 2H7YA 4IAOA 2G9NA 2PBZA 4Q82A 4KNWA 3HCPA 1J5PA 2O1SA 1WETA 1DOAA 4F72A 5ELMA 5B6JA 1SCNE 4EYGA 1NF2A 2V7QD 3IP7A 1YR7A 5B3KA 3W5UA 1JQDA 1G3QA 1YQWA 1VE3A 1OVGA 2JGJA 3IT2A 3HBFA 4UUPA 1KE2A 2BW0A 2Q07A 3QPUA 3DCYA 1AGYA 5AOCA 4AY5A 4DVGA 1SUWA 1CZRA 4LDAA 2QDXA 4JZYA 4Q5IA 5DJ5A 2FPUA 2GAAA 5F51A 3REOA 3W6UA 1TO6A 1OXSC 2XLCA 2O2YA 3RYHA 3RNOA 4MV1A 3Q9UA 4R9NA 2IHTA 2YJTD 3K70B 3CE6A 3L02A 3QKIA 1RRGA 1IZ0A 2ORVA 1LBSA 2EARA 4NICA 2WWVD 3LUGA 4DIEA 4PQGA 4DRZA 4PLYA 1E7WA 3F4KA 1WMDA 3WNVA 2WTMA 2EF1A 3M4ZA 4H1HA 2QSZA 2SBTA 3FDIA 4U6SA 2EIHA 3NS7A 1F9EA 1L0BA 2VHWA 4N03A 1CRWG 1HKUA 2I87A 3R7BA 4CQMB 1K08A 4RGVA 1X1CA 3NGMA 1IXZA 2BGKA 3H4TA 3NTLA 1JDNA 3BTSA 2OILA 2H1IA 3HO1A 9MHTA 1V6SA 4YUVA 2C4TA 5FF9A 1GILA 4CKBB 1L4UA 1W73A 2Z6QA 4N8EA 1G17A 3GJ6A 3N70A 1UK9A 5AJZA 5BUQA 1NVMB 4LHEA 5HCNA 3QVGB 2GN6A 4CIAA 2XHEA 1X39A 1CV2A 3ANTA 1RQPA 3I92A 3PUJA 3K6JA 1VRWA 1ZW1A 4KREA 3RSFA 1WBDA 5DYNA 1LW7A 1EHIA 3VO8A 1FA9A 3HXLA 3RTEA 3OJCA 2BJHA 2FW6A 3FOBA 4HB4A 4JXKA 3GZNB 2QE6A 3AY0A 4B45A 4CIXA 4YV2A 3P9SA 3A4MA 4KQGA 4RTLA 3ANYB 5L53A 1FL9A 4EA6A 4L08A 1P7YA 4MI9A 1S4QA 4XLZA 1QFSA 3GU3A 5LZ4A 3NGXA 4MLCA 4HYYA 1ZJ4A 4ZYXA 3KKKA 3JSAA 3W8EA 3VR5A 4IIEA 3WL8A 4C0WA 4HEA1 4DIKA 5FLEX 3VNUA 1QYWA 1XQVA 2ZRPA 3EA5A 4FHCA 4K9SA 2XUQA 2YS7A 1RS0A 2OORA 3LBYA 3KG2A 1IVSA 3SQMA 1H4QA 2AYXA 3HZHA 1I14A 2ZJOA 1AY0A 2PWYA 1KO8A 5B58C 1V16B 4OGKA 2Z8YA 3B48A 1T10A 2Q5JA 1HFKA 1W88A 1GZHB 2Q5OA 4MCHA 4Q9LA 3TLYA 5LU8A 1ZOPA 4TSFD 5I7FA 4F3NA 3U31A 1MA0A 1KAOA 2PM8A 3MCWA 4UTZA 2P6OA 4OB7A 4PSKA 5C7OO 3V46A 1JFRA 4WXYB 1ZM7A 4EI2A 1N3IA 4I46A 5H68A 5A7FA 3D2CA 2ZJ5A 1NDHA 3HVUA 4ITVA 3HL4A 4KFCA 1E7SA 1CJTC 2FFQA 4INPA 1G55A 1NMSA 1ZW6A 1G1MA 3Q85A 4A9AA 2ECOA 3G0IA 1FQWA 4MVJG 4ROSA 3WLJA 5A4JA 1XHLA 2OWDA 1U7PA 3EGVA 3OT1B 2Q7XA 5HQTA 2IXGA 5LQUA 1HE5A 4ND8A 1JECA 1X8JA 2JF0A 3KEMA 2ZSFA 3DVAB 3IKTA 2CSXA 1NPTO 1SEPA 4PLZA 2ZRCA 1BU5A 3AUKA 1U99A 3D02A 4PPYA 5CW2A 4AXBA 1VPDA 4H9GA 1RRCA 4B3SB 3VJRA 2FOXA 1L5FA 5CMLA 1QS0A 3L6BA 3LM8A 4B4VA 5F52A 4KXUA 1P4GA 4GHWA 4QOJA 3TW4A 5JW6A 4H0CA 4EHJA 3JQFA 1E2UA 5FPQA 3O8BA 3CNBA 1T3GA 4QQRA 4XPZA 2JJ1A 3W05A 4FP9A 4H7IA 5IUKC 1C1DB 1V8DA 3HRHA 4ALNA 5CBKA 5IXYA 1B6RA 2EFDB 3CSSA 2IP2A 4HX5A 5DMHA 1UZLA 1JHXA 1PFWA 3DZ8A 4AF8A 5JPIA 2WG0A 1C7JA 1WA5A 1Z2PX 4YR7A 4ID9A 1FFXB 3J81A 2G9QA 4IXDA 2XUKA 4RENA 1RKVA 2ZRFA 2C3PA 3HBJA 1FTSA 1QGOA 3CX6A 1YZFA 5GJVC 5ILGA 2PRZA 1YL6A 2ASVA 4AYXA 3CEPB 2CHUA 3EK2A 4OQPA 2C3OA 3MPUA 2OY0A 1WUTA 3FCUB 3CQ9A 1ZJJA 2CJFA 1AKWA 4NXMB 2XXAA 2DT8A 1N8NA 2MSWA 4MJLA 5AVXA 4D7AA 3VAZA 1GPJA 3UMVA 4P53A 1XI2A 3TL3A 2KMLA 1WQ4A 1XAJA 2V7TA 3NFRA 2O0HA 2JJ2A 2A6PA 1PZNA 3HU5A 2NVUB 4BAGA 1PG5A 5IYZF 4JBGA 1QAMA 3DEIA 5A5VA 1E59A 2WZBA 2EOAA 1ZK1A 5T64A 2MOKA 3IPYA 2XCRB 3B6IA 3Q7SA 2JHGA 4XA8A 1ZJYA 1QXSA 3CSUA 1QFYA 3ENNA 4YBRA 3L6UA 4PAQA 4BUCA 1DWUA 3SGLA 1W6RA 1M8FA 3HFJA 3OQ6A 1MXFA 1SO8A 1YS2X 2W93A 1NQOA 3L01A 4S1VA 3EPJA 2FN7A 2HRDA 2C1XA 2EKZA 1DI0A 4Q18A 3F8TA 2VC2B 1CUSA 1T9GS 3DOOA 3NHYA 4RW0A 5HKKD 2WQZA 1EFAA 3Q88A 4LZWA 2QXYA 1K4MA 2XZOA 3SG0A 4E2XA 1T5DX 1VQ1A 2O0LA 5J1SB 1Y8RA 1G1AA 2FCAA 1W4BA 2VVTA 4B8ZA 4Z4QA 1R12A 2WHXA 4BASA 2FWRA 1CLUA 1SBZA 2HMVA 1BWQA 2W2XA 4BNIA 3QI2A 1USGA 1G8MA 1VPTA 5FPKA 1CDOA 1WZIA 3MA0A 3LHKA 1Z0KA 1V8OA 2QN9A 2VKTA 1MJFA 2L0XA 2QT0A 2X1LA 2XBLA 4EH1A 3AJDA 3LUDA 1IXKA 1GZDA 5AVTA 1PR4A 3GAMA 3IS3A 4IJ6A 4Q15A 4I4IA 1O77A 1NVVR 5A03A 1EBFA 2OZLB 3MGKA 5COQA 1DKRA 1FRQA 1VLLA 2FZGA 3BERA 3K6KA 5CNIA 5THKA 5FH9A 1EBUA 2XMPA 3NTUA 3VJMA 3ILYA 2J9FB 4FOSA 3AM4A 1HQCA 1OAOC 1VPLA 4HBZA 4YQYA 1R74A 4GNRA 2IVZA 2Y9PB 3JRNA 4DIFA 3FTDA 3UQZA 5ENVA 3VGJA 4EJSB 4XSGA 2XYVA 3C43A 3OOEA 3K1JA 5CFNA 3ZGLA 4Q6WA 3OA2A 3L7KA 3PNBA 3R6WA 1ZI6A 4JU9A 4LF6B 2WB4A 4KP7A 1YA6A 5KNCH 4YAIA 2NTEA 3ZK9A 5J9FA 1U8AA 1U2RA 4NEGA 1DARA 1G9SA 2F48A 3DFMA 2CD7A 3G0OA 4XQEA 1XVUA 1VRCA 1XYGA 1YH3A 4OJYA 4UHCA 4KNYA 4XXHA 2VA8A 1N2OA 4PFKA 4KACA 2IV7A 3WXMA 4GC5A 2XVYA 4DNPA 1LNZA 1QGUB 1W46A 1OSNA 2ZIXA 1YBHA 4H59A 4LBYA 4F7DA 3C3EA 2BD0A 1P6QA 4AZSA 4LMAA 5GQSA 3NWBA 1XLWA 3MC1A 5F9HA 5FLXA 1Y1TA 3W1WA 1W5EA 2WK1A 2E5LB 1WWKA 2EFCB 2J9GA 2FWNA 4Q37A 1JYSA 1LRKA 1M2HA 4GLFA 3QJGA 3AONB 3ADBA 3H11B 4O4LF 3AV3A 2H31A 1O87A 1WXIA 4HJRA 4JBXA 3TQHA 3N2EA 4B3FX 4D8VA 2P4SA 4ZD6A 1TCCA 1JBKA 1NW4A 4DV4B 2QE7D 1A7KA 4OTZA 3H87A 1IZ7A 3CNNA 1F17A 3AI2A 1KAQA 3D54D 2P35A 4Q3KA 1H3NA 3W9SA 3O83A 4DE5A 5IZCA 3E8XA 4XWTA 3MCUA 5E6UB 1CETA 1F8YA 1NWCA 1E9DA 2CHVA 2PGNA 3NWJA 2WFLB 1ZH2A 1WW8A 5GONA 3GLRA 4WDQA 2VNHA 3AESB 2RGCA 4UJ5A 2GXQA 4ZJUA 3T5CA 2AMJA 4IDDA 3VYSB 2VYFA 4WOPA 5A4MS 1WQ1R 2H65A 3AY3A 1IN4A 2I4LA 5KO2A 2JDID 2YZ2A 4IUCS 4KRXA 3C6BA 3O92A 4L8FA 3GLTA 3VOBA 5EUMA 1C3LA 2R85A 3C6ZA 2WAYA 3SZUA 3TZEA 4XRGA 1NU8A 4MYDA 4II7A 4ZPXA 1JA0A 2VJMA 3MTEA 4RBNA 1TUBA 1PJ3A 3K35A 4J1QA 2EATA 4XUEA 3G3EA 2VK2A 3HB4X 1E1QA 2XGSA 3VVCA 3G9TA 1E8DA 4DM4A 4ZI5A 3BILA 1OV4A 4ZZ1A 1NY6A 1G5PA 1Z74A 2WJ4A 3WP1B 2B36A 1SRRA 2EEPA 5LA6B 5AK3A 2WUVA 1C8LA 3QSGA 5KVQA 3UPTA 2R1UA 3F9CA 5L3SB 2CMDA 5AD1A 5I9MA 5BQFA 1G8YA 4OGFA 2YR0A 3U6BA 4FMCF 4YMHA 5BQXA 4RULA 2EZ9A 3EVCA 2RH8A 4C7KA 2HHLA 1KTVA 3AHCA 4EWLA 2R44A 1ZN2A 4RQBA 4HNGA 4QYXA 1BWRA 1G9XA 1B0PA 2R7KA 3C5HA 1BVRA 3HVIA 1SUBA 4RY9A 3KJNA 3TB6A 2NUTB 2OV1A 5LL6P 2XOEA 4BWYA 3RC1A 3O91A 1KOLA 2EFEB 2QJFA 4RVHA 3OP4A 2C4HA 4A1FA 1KMQA 4H7JA 2E55A 2V9CA 3PITA 5KYYB 3HCBA 4C4XA 2IYOA 2DUMA 5ALWA 4BPBA 4NE2A 1FRVA 5IT9A 1LUAA 1ECBA 1NKSA 3CPHA 2VJYA 2ZB3A 2ZI6A 1WMEA 5KNLA 2HHHB 5CT5A 1VYVA 5L3ZA 3OVMA 3BF8A 2DFKB 4EW1A 1KZ9A 1J70A 1YQDA 3DWEX 3K2EA 3K2IA 5K3CA 2CFTA 4M3NA 4D3SA 5L3QB 4LYAA 4MVJM 1UBMS 3TNDA 1NQUA 3ZLTA 4NECA 3VA7A 1DKMA 2FSIA 4A7PA 1JMKC 4G81A 4E33A 4B3TB 5HE8A 4AS1A 4WCFA 2GCGA 2QL7A 2GDJA 2XAAA 3CRRA 1L7RA 4L8YA 2XZDA 1RE1A 1YFLA 2R1TA 1OIXA 4PFJA 5FPHA 3GEPA 3O8DA 5D86A 5CJ2A 1UJCA 3JZIA 2H7VA 3UHOA 1P6XA 4TTJA 4BNTA 1PE0A 1XDDA 1H69A 2ODAA 2E4XA 1WDKA 2R87A 2Z04A 3KEFA 1J0XO 5ALOA 3ZWNA 3GL9A 1E1LA 2CNLA 1IN8A 2WJVA 2HJRA 2ZW9A 2HOQA 1VXRA 3DLPX 3PEEA 1EX7A 3AI3A 4IDNA 4YJ3A 1L5GB 3WLSA 4KR7A 2CYCA 3QXCA 2IU0A 1Q0UA 2Z9BA 3U7QA 1HEIA 5IS2A 4AJ1A 1PFUA 3H0EA 3WQHA 4OP3A 4LWOA 3OICA 1K7CA 2WFAA 4QA9A 3WGHA 1MTZA 3RG8A 1H6AA 3O4GA 4DLYA 5IVKA 2AG0A 2C4UA 2DWPA 2OV3A 3VPFA 3Q6NA 3Q8KA 1QFJA 2VNAA 1RWVA 2Y93A 3A14A 1I7PA 1XZAA 1QH1B 4GF5A 4BEJA 1KOFA 3IPAA 5IXSA 1AKYA 3V8VA 1MC8A 1Z83A 3GJZA 2HU7A 4IDAA 4ZTBA 4IIJF 3AIIA 2CLKB 2QRKA 1C9YA 1R6XA 1TLFA 5A4KA 1IEXA 3M89A 1CR0A 1SC3A 2A0UA 1JKJA 3GJ5A 2L18A 4UMEA 5D7NA 2XJ4A 2IYZA 3C7CB 2P6NA 2R8BA 3VX3A 1XKQA 1YZVA 4KFRA 5M5BA 3NHRA 4QXRA 1NNSA 1DLIA 2HNBA 3WB1A 2X41A 1M67A 1HLPA 1RQLA 4ZVQA 1KEUA 5CXXA 3SC3A 2RHJA 4X60A 3RSGA 3VU9A 1DP4A 1KKUA 5KKNB 1OLXA 2G83A 1MXHA 4YPFA 4A8JC 5CFQA 1Y8CA 1W2WB 2ZROA 3KLNA 2VH1A 3PXBA 4HDRB 1D1TA 3OQNA 1EUCA 2C0QA 2O8VA 1I1OA 3K8ZA 4PTZA 4BCBA 3F1KA 3HDGA 2WHEA 1U2TA 3ZKWB 5IUJC 4HXFB 1U7DA 1CUGA 1MD9A 1P2BA 5H80A 1XTQA 2QL5A 3PWZA 4FFVA 2JFHA 1F5NA 2WSSA 3C6XA 5DGTA 1KKLA 2AEMA 2KW5A 2QW1A 4HDCA 2OXEA 2OCIA 2Q2NA 2WE7A 3D6VA 4L6CA 3BWYA 1P62B 4TWBA 2MINA 2R1VA 4EG7A 2GLXA 5DM60 3GMTA 5DULA 1IJFA 4YA6A 4CM8B 1H22A 2ODPA 4KI7A 5JQGF 4ZQGA 2DT5A 3CF6R 2IV3A 2PUTA 3V1KA 1C3OA 4J1NA 3EUFA 5FAKA 5KTTA 1MH1A 3L8EA 5KAPA 3SBEA 2YJNA 3ZW9A 3UMBA 2IUSA 3NJRA 1RLOA 5FWNA 3KQQA 2QZ4A 1D0IA 2O2XA 3SC4A 2XWPA 4ZC1A 3OX3A 4UVGA 4FX5A 4EPTA 3DVQX 2JB9A 2YC4C 1ZDMA 1SCIA 1XX6A 1ZESA 1Q16A 1JJVA 3WK9A 4V1CB 2A59A 3U4QB 4GL2A 3LRPA 5IUNC 3LO5A 1KTIA 4P34A 4GUAA 1C1XB 2A0FA 2FG7C 1P2SA 5BSKA 1I1HA 1S3GA 4RLQA 4JOBA 3LDFA 3K1ZA 1WS6A 2ADFA 3AP2A 3QLUA 2ZUUA 1XB2A 3AFIA 5A4FS 4ZCLA 4L51A 3DQZA 1QO7A 1ML4A 1H5QA 3NTXA 1N33B 4OQLA 1QIHA 2NU8B 1Z13A 3P2IA 4KLRA 1GKUB 1QIMA 1S2LA 3G8DA 1L7DA 4TV9B 4KUEA 3D8TA 4WKOA 2WJZB 4YC7A 1HNWB 2C2WA 1ZK4A 2ZQZA 4JVMA 4OUKX 5ENDA 5F7XA 8GPBA 1TTHA 3VNRA 2J3KA 5JWOA 3IO5A 4PRKA 4OL0A 3SXUB 5K3FB 2I3GA 1UK6A 3BWVA 3OEHD 3OSZA 4EL5A 4JB8A 2V7UA 5CR9A 2CMKA 1FDIA 1ZUNB 2QUIA 1D09A 1T5LA 3AR5A 3B9PA 3H2IA 3NEYA 4TM7A 5EMLA 5JCPA 1SOAA 2A2ZA 1J1UA 1JU4A 3O84A 3WRYA 1KMHA 4WESA 1R16A 2J4CA 3TO5A 1RYBA 2ZJBA 3N7UA 4EFMA 4B2LA 1E9BA 4MW2A 3RHFA 4BPRA 2C5AA 3IIKA 2C98A 2XE8A 3JATA 3KCQA 2BMEA 1EEHA 4GPZA 2ZRLA 1DT5A 1S9HA 2GARA 3EXIA 2XNHA 4CL3A 1A9QA 1BQ3A 1GQSA 1SBYA 3BAZA 5DPMA 1YOVA 1M6WA 3A1TA 3JQAD 2EWMA 2VWGA 1TMKA 3QA9A 4M9UA 1B7GO 3TECE 1D07A 2BJWA 3LGSA 3LMKA 5GAJA 1K0FA 1FYVA 1LFAA 1FRNA 1S2OA 4GMGA 2EJCA 2D5AA 4H15A 4HQRA 4JELA 3VPSA 3FN4A 3W06A 3FFTA 5C4MA 1ZICA 2VDPB 4TLAA 3S7TA 2GEUA 2FLKA 1WXFA 4RDIA 3DM9B 3ORRA 4K6GA 4YRRA 3E5HA 4PQEA 3EPHA 2QD1A 2CV2A 5FHRA 4F8EA 1N1GA 1XLUA 4FQ5A 3GQVA 5C18A 1KZYC 1JDBC 2IQ5A 4HDSA 3WYFA 3M3PA 3P0HA 2QTNA 4O02B 1DAFA 1SUSA 1ULSA 2HU5A 4LQ4A 4TSFA 4XWKA 3CEMA 1IOZA 2HPZA 1ZITA 2BDTA 1ZUWA 4BX2A 2HR1A 3KZKA 3NKLA 4KPFC 1L5ZA 1YJ5A 3DL4A 1W0KA 3NNDA 1XTUA 1UKZA 4GMFA 3RIYA 2HJGA 4ANFA 5DNDA 4G5OA 1L7AA 1H9BA 3NC4A 3SC2A 4F04A 2FP3A 2AC4A 2WLTA 3W5BA 3W5HA 1T0JB 1D1QA 2DWQA 4Q6BA 2XPCA 2QVXX 2G8LA 3GEMA 1KR2A 1R0SA 2J30A 3B3JA 3BMXA 3GUHA 4MQFB 4UBJA 4WZBA 4B46A 1XRMA 4B4UA 1XJCA 3K20A 5ALYA 3KWJA 3JALA 1NBMD 1QAOA 3V4SA 2Y66A 1SVUA 2QNRA 2WHQA 3F5MA 2I2XB 3HJTA 5EA2A 5TQ2A 3RU2A 4PVDA 2JCBA 3UH1A 3X1DA 5EUCA 4Z7OB 3BSSA 3P45A 2C5LA 1OWMA 5TGZA 4R1LA 1DCMA 2BBSA 3KQKA 2FDXA 3NBZC 1NUQA 4G0OA 2VQEB 3D6MA 1SAYA 4V2IA 5AWFC 3P7MA 3FOEC 1XZDA 3CNHA 4TVKA 3K16A 2A9OA 2NYVA 5EJ9A 3ZBPA 1E9FA 3IRUA 4AZ3B 4U0KA 3UEOA 1IWPB 4US2R 2CLOB 2G28A 4GRIA 3K1AB 4JEIA 2Q8PA 3P0RA 3TCNA 4Z9AA 3RTGA 1W49A 1PQWA 1YJAA 3IXMA 4KU4A 4AYWA 2YASA 4D8XA 3I9KA 5K0TA 3VUFA 2Z2IA 1PGOA 1OXKB 2C9ZA 1V7PC 3K0AB 2FPPB 1ZD3A 3K0EA 4R05A 4WK0B 4DIDA 3X1WA 1OBHA 3DEYX 5IH7A 3QEOA 3NYWA 1IUOA 3OZ7A 2D54A 3NB0A 2D3TA 4QYSA 1WV1A 1XMSA 1QC5B 4PLTA 1RBZA 4AB1A 3B5JA 3EDCA 1N2HA 2IU3A 2PRJA 1Z36A 3OE1A 3TJRA 1DC8A 1DRJA 1PYDA 4OMUA 2FWBA 4TV8F 2HU8A 4ZXPA 1U1CA 3VR5H 2B34A 4HWGA 4NEQA 4LDRA 4B44A 5C53B 2H6EA 2PTHA 3MVEA 1HBJA 3Q2KA 5JZMA 2Y1LA 3PUWA 2XYGA 5SZKB 4BRSA 4C4OA 3LTNC 2CL7X 2ZBVA 4OX9B 1LPNA 5IJ0B 1TIKA 5DMXA 1MT3A 2QTAA 2HXGA 3CLRC 2EZ8A 3LYLA 4F86A 1X7WB 5J59A 3A7DA 2HLHA 4Z0PA 3TLXA 3TRIA 1ZR2A 3RYIA 1GU1A 1CQZA 3DFFA 4EG1A 2HPAA 3D0OA 1UMDB 3OQOA 4ZJYA 1BS2A 4UHJA 2NV0A 1XLVA 3DBHB 3DDWA 2JGNA 1V4VA 3EY4A 5DYIA 1SZJG 4L07A 1LLQA 1K7XB 2D0DA 2BEWB 1SBQA 2JD2A 3FPJA 1HR0B 4NR0A 1X7HA 3IPRA 3KAQA 4ZCQA 1RHKA 3BQ9A 2E1PA 4FS8A 2GF2A 5ELXA 2W42A 1R7RA 4MLZA 4QLAA 4TS4A 2YICA 4D8TA 3CN7A 1NNI1 3NHWA 4QPDA 3D1LA 1SCBA 4IFTA 3FRJA 3Q12A 4G5FA 5KQMA 2NPIA 4IF4A 2WKRA 1Z56C 1VMDA 2ZZMA 7GPBA 2P1DA 1USIA 1OMOA 2AXEA 3IP5A 1V7CA 3AKZA 1CUDA 4RD4A 5KC8A 2J0QA 1PK9A 2Q4RA 1EFPB 2DJ5A 4FBGA 3UOAB 2AZTA 4RKWA 4RK4A 2EAUA 1Z17A 3LLSA 3UK1A 3BXZA 3CONA 3LLVA 5FWDA 1U02A 5EZYB 5I5EA 2FUG1 2XTZA 3KTOA 3TS1A 1MJNA 4H18A 4ZYZA 3IIIA 2I0FA 1MIOA 3HM2A 1KPIA 1UIRA 1XZMA 4DIMA 1FP1D 3K15A 3FPEA 1B15A 5HS6A 4OIFA 4LISA 5ARDA 2R62A 2GZHA 1XCLA 2YINC 3OOSA 2KPOA 3GNLA 3ONFA 3QITA 4MQLA 4NZZA 3ZDZB 3BRSA 4LWZA 5GZ1A 4BVEA 1JWAB 4X6UA 2V1XA 4CR7A 5CD1A 1YA4A 2Q1UA 2NTVA 5CITA 4PGFA 1EYZA 2VHEA 5L8VA 4ZHQB 2TMKA 1VCHA 3SQLA 4DAEA 4HXEB 2GBPA 1XEAA 5J1TB 3ZG6A 2QB5A 4R71A 2DUJA 5DW0A 3WOVA 5BNWA 2IU6A 1A2BA 1XZHA 1E9VA 5DRYA 3K70C 1J5EB 4MRNA 1YRQA 2DSTA 3I0MA 2I7TA 4NH0A 4Q19A 4G8DA 4MW5A 2VWPA 1F2TB 2PUWA 4QEKA 4YMVA 4L2IB 1MX5A 4M9ZA 3SM3A 5C8VA 1YFZA 3T54A 1Y6QA 4DNFA 5K45A 4DKJA 2OWEA 4RTSA 1WCWA 3DONA 4X64B 5IJ9A 4I1PA 1IXSB 4LWPA 1T1EA 5IMBA 4KLNA 5CFLA 1JJFA 4PR3A 4PZ0A 4I55A 1I24A 3UANA 3AUUA 1ZC4A 3EYAA 3G6WA 4Q7QA 3FB1A 5L95A 4CKCB 2GM5A 2CW5A 2VP2A 4NATA 4G1BA 5DM2A 5FNVB 4UEQA 3WADA 5T6MA 4B2YA 4DCNA 5A3RA 4N3NA 5CFMA 4UDNA 2JVIA 2NVWA 3GVHA 3GRAA 3AP3A 1QTQA 1J7KA 1W0JA 1FUYB 3HNPA 4EJMA 4PGGA 1P2DA 3WL3A 5K3OA 1FFBA 1SQFA 1GL6A 1CR2A 1KDTA 1J1ZA 3CE9A 3QH4A 2W7TA 4R6WA 4D9CA 3NDBB 4ZZ3A 4HUQA 2I99A 4OB6A 2QE7A 2FCRA 3WK4A 4U7FA 4M0CA 4QFDA 3MOIA 3S44A 5BW8A 3AG5A 1E60A 3D4LA 3LE8A 4EHFA 5KOIA 1E1NA 1HRKA 1NVGA 4DDHA 4AY2A 2C2BA 3SSAA 3IKVA 3QFHA 3Q9NA 3IELA 3AUJB 4BRWA 1P4JA 3HXTA 1Y3BE 3PNVA 4MA4A 3AWIA 2YIVX 5IDWA 2P8JA 1FYFA 1Y7PA 3HKDB 4URFA 1DSSG 1YHNA 1PGQA 3O2SB 2YWCA 3T9EA 2JDIA 2ZGVA 3TZ6A 1HNNA 4MHOA 1Y7LA 1KK3A 2EWWA 2GHIA 4JLKA 1DQPA 3DD1A 3UFXA 4D5EA 4HDQB 5HHTA 5LN1A 5EIWA 2GPWA 2AWNA 1PJTA 2XBUA 5IN4A 4IOJA 4QHSA 3OO1A 1PR3A 3JQRA 1ZN7A 3QKSA 3P2YA 1YIAA 5NLLA 2H7CA 3K09C 2G5GX 5CAEB 3HR7A 3LNCA 3NOVA 4UD2A 4K86A 1CW2B 4G0VA 2VBIA 4M8KA 1N6PA 5IH3A 3RLFA 1NNEA 4QG7A 1BN6A 3L9XA 1LBTA 3GJTA 4PRLA 2ZQYA 3KJFA 5BW6B 3WFIA 2OBNA 4LSGA 4DNXA 1RLJA 2JASA 8ADHA 4TMYA 3TQQA 4F9GA 4EJ0A 3FVVA 3CXRA 2CUNA 2HK8A 4N39A 4ZANA 3UKOA 3ZTWA 1ZIXA 4WXEA 4MA5A 3B6MA 3KZVA 4IQ4A 1KI3A 4LWQA 3EIUA 3ITNA 1DBVO 1CUJA 2I78A 1PW5A 4IMPA 4XYGA 4CM4A 3R3VA 4URHA 1HX7A 2FMFA 3OQIB 1OROA 2ZIWB 1AS0A 2OCAA 2Z09A 4FXOA 5CH5A 4EVQA 2O0MA 4CT5A 4XE5A 3AF6A 1XOIA 3T5DA 1VJDA 5LLDA 3SVZA 1JZSA 1NM5C 2LCFA 1D2NA 2H5IA 3MJHA 3GNTA 5D01A 3P52A 3TRKA 5B1YA 2HCJB 2I4NA 1ECFA 4W1QA 1YC5A 3O38A 4B76A 5DX1A 4DCUA 5ALKA 1X7ZA 4L9AA 4EKGA 2CV1A 2D5BA 3R5TA 4QRDA 2GCNA 1NYTA 2JEZA 3INTA 2CWDA 3NNNA 5FA8A 2AXPA 3DHVA 5DTEA 4WJKB 2E7ZA 5CEEA 4Z49A 2H18A 5JDCA 2EP5A 4NCJA 5FJJA 3G89A 3LO8A 4IPTA 4C5AA 4YY3B 5HRCA 2VS1A 4KOAA 5DXFA 3BRQA 3CR7A 5TB5A 4R5HA 4W5HA 5EJMA 2QD3A 4Z4GA 2B4YA 2ZI7A 5BV1A 2BLLA 3GCXA 3AZOA 3R8XA 3FPBA 3NI2A 3EFEA 4NFYA 1W19A 4GBJA 3RFTA 3TG8A 1YCDA 1C0KA 3WV4A 4B0OA 2ZUCA 3PVZA 4I9GA 1K06A 1UAYA 1K5DA 3RSOA 4G4GA 4HMQA 4DSAA 4YRIA 3KWLA 1IEVA 2GH1A 2D13A 2JARA 2PKWA 3CH7A 4RZSA 4N9QA 4YCDA 4CETA 2XCIA 3BK1A 1E3SA 2WA1A 1A95A 4QFMA 4XVCA 5I7EA 2GEFA 3QPCA 2PBLA 3GRUA 2G6TA 1JAIA 3E03A 1M8PA 3MHPA 2Q50A 4JC4A 4P2GA 1KJ8A 2ZJAA 4F3CA 4FKMA 1H3FA 4ZEXA 1CNMA 1Y9JA 4ND6A 4BO4A 1TOAA 1U94A 1VSVA 3GA5A 6NULA 3ZV3A 1ESDA 1SBTA 1Z06A 3OLZA 4RLSA 1ODLA 2H1WA 1SIOA 3LKZA 4HL6A 3HYSA 5LJIA 2ZJ4A 5LD2B 2D6FA 3V8QA 3A36A 3QI7A 1OPXA 1SD5A 3IFSA 1WU7A 5I6DA 2I6GA 2GDZA 1S0UA 2B1QA 1Q7RA 3MN1A 5BNFA 2V3CC 1EEXB 5JATA 5DSXA 3EHDA 5AH0A 2YHIB 3K6SB 1T1IA 3LUBA 1RI1A 1UXHA 4ZDWA 3JWPA 1ZMRA 1Z63A 4DFDA 1MC1A 2HLDD 4K6KA 1UFQA 3ZLUA 2WU1A 2QMEA 4HGPA 1N6NA 4F96A 4IQGA 2PKCA 3WXBA 2XMBA 3I04M 3KUXA 4B7UA 2FX2A 2FX5A 2Y2VA 4E22A 3FNFA 1XZNA 2TRSB 4IDHA 3VSDA 4N01A 1LRLA 2QDKA 2JJQA 3G85A 1Q1NA 2PD6A 1VIVA 3DLCA 1Y5LA 5H83A 4IV8A 3NORA 2R7MA 3LQFA 4V02A 4F9TA 4Q1AA 4BV3A 4UTNA 3G5LA 2BKUA 1RYZA 4XH9B 2XEDA 4AICA 1C2YA 2PFGA 4YRDA 3GRZA 4ZT3A 5JWHA 1XP5A 3EXFB 3A11A 4E1BA 4EJSC 1PNTA 2BVNA 2J9XB 3SHQA 1K2VN 3TIIA 3RU3A 4NBWA 4J7UA 2P30A 4ALJA 5BN5A 3U3RA 3VPCA 2G9VA 3V4OA 2Y05A 1R5OA 2QROA 1J00A 2QG4A 2YFKA 3B6JA 4JP3A 4YI3A 3TMKA 4BZXA 4JLMA 1TU4A 5JIBA 5F1OA 1YVRA 2B8EA 4KN9S 3MOGA 4F97A 1HYHA 2I91A 1Z0SA 3WZLA 5KWVA 3A9TA 4HOYA 4DSOA 2JBHA 4JOCA 3FPKA 3V9PA 5K51A 1LV8A 3X3HA 2ZRHA 4HQKA 4GZ3A 1FSSA 1QPBA 3A7EA 1CQJA 3DWIA 4AP6A 2DE0X 4X62B 2BPOA 3NHSA 4BFXA 1BN7A 2CXUA 3LPMA 1KYQA 4FOTA 3JYHA 4I4TF 5A0TA 2I4TA 1PNRA 4Y9UA 5M2QA 4YP0A 4J0GA 1WPXA 3H8VA 3WKAA 3PXDA 3K5WA 4AZ0B 1OXTA 1N2XA 4CV3A 3PGKA 5IC5A 1ZMXA 3UJHA 4BNDB 4JGIA 1F2VA 2CUTA 2VK4A 3P0IA 2IEGA 5J2TF 1ZMTA 3WWDA 1BTOA 2WI8A 1FP2A 1OI2A 1P6UA 3KPUA 4HI0E 3AB3A 1VE7A 2REOA 2FNAA 4EGFA 1TAGA 5EIEA 2YJGA 1HUQA 3EWNA 4TWZA 4DC0A 5AVWA 2CLEB 3M1LA 3HWX1 5B57C 3GVIA 4P4GA 4WW0A 3RASA 4D2IA 4KC0A 3JV7A 3RPEA 1WHTB 1ONOA 1GPLA 3OECA 2C7GA 5D2CA 2UUPA 3K30A 1TX4B 2QG9A 4R8SA 4BATA 3TEMA 4FBLA 1BFUA 1QHEA 2AIRA 3OEHA 4F46A 5FEUA 1Q0TA 1J8QA 2FPKA 2XT0A 1O9HA 2YQZA 4JKIA 2PUGA 4WNAB 3GGOA 1XA3A 1GGEA 1J7JA 1H8HD 1Z34A 3FTPA 5JSHA 2NSDA 3U3DA 1CVLA 5BT8A 1N2SA 1AMNA 3E2IA 4OLHA 1GO2A 1WZEA 2ZT8A 3AOGA 1LH0A 2CYAA 4EHAA 2ESRA 2DTEA 3G2JA 1ZQ1A 2PWPA 1O3YA 4JA2A 5LYYA 5TPWB 5BRAA 5IF3A 1Y8QA 1ZSVA 2XUOA 4HNSA 4ND2A 1HG0A 4E5SA 2J46A 1PQYA 4NQRA 1UDCA 2JK1A 3WQBA 5KYXA 4V38A 4TWAA 4AQDA 1OYVA 1AKUA 1FFSA 3L7OA 1CZOA 3JQAA 1SKUA 2B30A 4WK6A 1EU1A 8AT1A 4A8JA 3QEAZ 4FW8A 4FYPA 4HCJA 3ZZ1A 3G0HA 2VP3A 2ZKLA 4NY1A 1CJCA 1AHIA 1N2CE 4UPEA 3G49A 3I42A 4Z7JA 1NUHA 5HWSA 3TSAA 4OHXA 4KIGA 4XDGA 3BEDA 4AY3A 1FK8A 1G8JA 4JGGA 5CGZA 2HA4A 4F3RA 2RK4A 2Q5EA 2NACA 5L9AA 5E4TA 4OM8A 3NAQA 2ZBDA 3LJKA 4G8JA 1RADA 4Q4LA 3JWHA 4K9OA 3OMXA 3R77A 4DMGA 2JAOA 4JBYA 2NU7B 1R37A 1ACLA 1PEKE 1H6BA 3G23A 5KYNA 3RYCB 2V3VA 4L8GA 2Y0DA 2E4UA 1EFTA 3HHPA 1WZNA 4HGOA 5EIXA 1QKJA 4R3UC 1E0JA 2FGJA 2IYXA 2JGKA 5JUWA 3PD1A 4JXZA 2Z6UA 1KH2A 2PZFA 1G20E 2ZIFA 3IAFA 3DV9A 4IDEA 1I2BA 3CRW1 3V6LA 1XHFA 2VF5X 3DHEA 2RI1A 4IEFB 4BC0A 3RUPA 1NBMA 1QVZA 2R11A 3JYLA 4CG0A 2DR3A 2YWGA 3T4XA 3MCZA 4KN5A 3MTDA 5ALEA 2G76A 1X13A 3CPEA 4MQUA 3TUZC 5CIYA 3IQFA 4GGMX 3ZVMA 3G9XA 1P77A 1T1RA 5K4GA 1L2TA 1THTA 2YMMA 3G0GA 1P60A 4O5AA 3TJMA 4R2WA 3ZJUA 4QASA 3WV5A 3P26A 4TXHA 3WLFA 5K4HA 2AZXA 1AUOA 1D9ZA 2D1TA 3EXG1 1J9ZA 5JI2E 3H8SA 2JK0A 4AZWA 2CCJA 1RNLA 2YWBA 4D9GA 3KWMA 1M1YB 4U7GA 1ISJA 5LXTA 1Q19A 2ATIA 3ACDA 4IKEA 4CU2A 5DX8A 1W85A 3E3AA 4BLRA 5KTRA 1QNLA 4KXVA 5KBYA 2MSNA 4ZOLF 5B7QA 2FOIA 4E2ZA 4E5YA 1TYBE 4KXMA 3WMFA 4FCTA 5FDFA 4GI5A 1U2DC 3MLBA 3RUAA 3SF8A 1NN3A 1I0LA 3HA7A 3KHTA 2ABWA 2CHFA 2AH5A 3FZQA 5JYBA 3V2GA 1F6BA 2OB1A 5LMZA 1N9ZA 2WWIA 4ND3A 4H7KA 1N0UA 2ZYVX 1TK3A 3S5JA 5BMVA 1GKYA 1MOPA 2JAQA 2PIAA 2B2CA 5CVUA 4OQDA 2QQEA 2ZJFA 4XJSA 2E0IA 3TSWA 4OU5A 5JR3A 2IELA 1WW3A 3JZAA 4MQ4A 4R1TA 4W7IA 4KPUA 3NCHA 1X1DA 3OM8A 5BOVA 4RA6A 3WIVA 4I50B 1E2IA 4H7FA 4EGJA 3A9CA 2ATCA 4URYR 2N9UA 5BSGA 1E58A 3DR5A 2IH5A 2QZ9A 2H1VA 3VYWA 3S4YA 4L6IA 4OB8A 2PR7A 4W8HA 3TKAA 7ADHA 4MGKR 5KU1A 2DETA 3T3OA 1NC3A 2PQMA 4L57A 4BE7B 3RAFC 5LBTA 1QHSA 5LCXA 621PA 3QHQA 1ODTC 1UZMA 4L9SA 4OYLA 3PPXA 3RVLA 3ZV7A 5KTMA 5GIOE 2QQ0A 5KZMB 3UUGA 1VJTA 2FE4A 3TEJA 3AQIA 3K71B 1LTKA 2QL9A 3ICPA 2RJNA 3TMAA 2I7VA 3DEJA 3DZIA 1ETHA 3NPAA 3OWXA 1M1NB 1YCHA 2JEOA 4FFLA 4LMRA 2C9OA 3MPOA 1SMKA 1QFMA 2C5SA 1T5OA 2GNPA 2PO7A 2XGMA 3MWYW 3U4DA 1POWA 4BBAA 3JCZA 4O08A 4YMUA 1PD0A 1V3UA 3B5IA 3IBGA 3PKIA 3RRYA 3J7AC 3QWIA 1VKNA 1NBOA 1B93A 2Q8NA 3MTGA 2VUIB 1RZUA 3MUNA 3GRYA 4HPJB 5E1OA 5F1KA 1ZGBA 3DO6A 4KKXB 5LZ7A 1IBLB 5FPYA 1NR7A 1QIDA 2O2ZA 4UASA 4BX0A 1N5RA 1S1MA 1JJBA 2QLLA 5K3BA 1SK8A 1E4EA 1SUDA 2N75A 4I9HA 4JJ4A 1GDHA 1UANA 2XR1A 4UATA 1VGQA 2JLAA 1SQ6A 3B13B 5AOVA 1B0ZA 2HMTA 2ZR8A 4ZOEA 1W6UA 1XIVA 4KZPA 5JSYA 2A30A 1FBNA 4JI5B 4BWGA 3ICWA 5LP1A 3FOAA 1JX6A 1ZGJA 2JHCA 3OCXA 4KBYA 3REQA 3TTSA 3PDIA 4EI7A 2AR7A 3AFOA 4C6TA 1EP9A 1SCUB 1I94B 1B6GA 2I1WA 1PUJA 1BMDA 1Q91A 3QJYA 4I6JA 4J6EA 4NYMR 2BR4A 4P81A 2NXNA 2V9ZA 2LE0A 4HSGA 4OL9A 2RMKA 3PEYA 5LDGA 3JWIA 1E2QA 1NATA 2X5JO 3KQSA 1XA0A 3MOSA 2O5CA 4YXWD 3BMCB 3ECAA 3ACBA 4KBFA 3IP8A 1NPYA 2PMFA 3LC0A 4BNYA 2O57A 4LE0A 5SICE 2ZUTA 3QW2A 1O0SA 2ENUA 3FMGA 3I73A 4DCGA 4JDPA 4DLXA 3NIDB 3RO7A 1Z22A 5KCMA 1N2IA 1A77A 3RWBA 4DA9A 4P98A 1KP9A 2YN0A 1NMXA 2W37A 4A82A 2IA5A 2PXCA 4C4SA 4ZGGA 4RZ3A 5BVHA 5IDXA 1J2TA 2PG3A 3LPAA 5HF9A 3ZZNA 1D2AA 1RI2A 3BWMA 3PQ7A 2OUIA 2Z3WA 1L4FA 4WAUA 1QX4A 2HU2A 4BVJA 2WJPA 4JLUA 5T4HA 1QRTA 2PRIA 1RYDA 3EOBI 2VDWB 1CJSA 1EVQA 1D2MA 3OPXA 3R3SA 4RHEA 4RESA 2BEKA 5GWXA 5A3JA 1UF9A 4Z9XA 2A5DA 4LYYA 1HURA 1Q11A 1BA2A 2BBTA 4FWIB 4KR0A 4RLHA 3TLGB 3U9SA 3EGIA 3WL6A 3ZI7A 1EFRD 3NHLA 2M6KA 3LG2A 3M83A 4B43A 4GE0A 2H1FA 3U4CA 2HX1A 3DPIA 1XMPA 3LRXA 5AJUA 4KYIB 1MNAA 2ODBA 1L4NA 2XYQA 1HSOA 2QP9X 1UJ4A 3N39C 4K9QA 3U09A 5LOVF 5F3WB 1G5IA 4MR8A 5I3ZA 2FP4B 4MR7B 3BGSA 3CLVA 1RQ2A 3P9CA 1EVKA 3JRXA 5KYWB 4FYHA 2VPWA 2GKOA 3GAZA 4GLBA 4L7VA 1IM8A 4NNPA 4OHUA 1SCKA 4BDSA 4G56A 3O93A 5FO0A 2FX3A 1ZS9A 4FUQA 1AHNA 2B2NA 3K0KA 4LECA 1ZY2A 4AJLA 1QIGA 1C50A 1VLQA 1KEVA 1R10A 2ZB8A 3Q7QA 1HQKA 4RPIA 3D6NB 5M04A 4QVGA 3ETLA 1LPPA 3FCXA 2FZKA 4ZYUA 5MFZA 1M1UA 3F2VA 3OX2A 1WXGA 3PI7A 3KHSA 2AFIA 2Q2WA 2YN4A 3E7PA 3KXKA 3EAGA 3LQ1A 2VZ9A 1L4EA 2RHOA 3GCZA 1YASA 1JR6A 3VOAA 4U9IS 4A6DA 5HP4A 3JVVA 2X22A 4QNMA 3OIVA 3KX2A 4R98A 4E3ZA 2BFWA 1TVKA 2WTUA 2IXBA 3Q3CA 4OHWA 2QUBA 3DWGA 3RM3A 1N3LA 5COAA 1A8SA 4FMBB 1PZEA 2BFDB 3JR3A 3PA6A 4CMBA 1F4VA 1DIRA 2Z08A 3FOZA 3UKDA 1TKRA 2ID8A 1BCSB 1QRSA 1JXOA 1RHRA 5JZSA 2JIQA 1PSZA 4F3YA 2GZRA 2WKPA 4IFEA 1Z0FA 5A0VA 4JT4A 1SOVA 1YB2A 1QF6A 4HNRA 4AFNA 4B34A 4MUXA 2PL3A 3DE7X 3EQ6A 2OPHA 3WQRA 4B7CA 1IBCA 1RIFA 1VMEA 2TMDA 3FNEA 3UPDA 1K86A 2IYRA 3MTQA 4AMGA 3WGMA 3SEZA 1QTRA 2QT1A 3L6EA 1T3HA 3VYRB 4RTQA 4CMIB 3T7TA 4QDZA 5DHSA 1KETA 2A0XA 1NJGA 2PX2A 1T25A 1Q3KA 3BSFA 2JIMA 3KO8A 4YCJA 4K6MA 4UXJA 1TCUA 1XJQA 1V26A 3ICEA 4KE9A 4O0MA 4Y6GB 3QVGA 4UZEA 3CH6A 4TROA 1DJQA 1W7AA 4ND1A 4PAWA 1I10A 3MYRA 4LUCA 5E1MA 1XDGA 3E58A 4OSPA 2OFXA 1Q3HA 1U9ZA 1WO8A 1I36A 4RKYA 2PRKA 1UIMA 2IUUA 4CTMA 2PJRA 3NVKI 1DX9A 5JAIA 4NC9A 2QMQA 3Q7EA 4OHYA 5LQRA 3QPAA 1L8XA 1Y7TA 4FFWA 1PTJC 2XSZD 1LI5A 2OESA 2JIBA 2AG6A 1JU3A 1C29B 1W44A 1XUOA 1LV7A 2CK3A 2XOXA 4FYWA 1VC2A 4YEDA 3VI3B 2QNIA 4XWGA 4G0UA 3MMPA 2C7RA 5KJCA 1AU9A 4R8LA 2DYKA 2WR8A 1WVMA 1U80A 4O2BF 1P5FA 4QO8A 4MZXA 3IMGA 3VV3A 4MKHA 1NA5A 4ENRA 2GCIA 5LYJB 3WY9A 1LZLA 1XF1A 4X1YB 5CVEA 1MA3A 4MV7A 5TGDA 1QBKC 1SFRA 1V16A 2R4QA 3SLKA 4DJFC 1FUIA 3TE7A 2W00A 2ZPUA 3V7WA 4DRXA 4F5WA 1V2GA 3GA7A 1U3WA 1SR8A 2P62A 1ZIPA 4IJ5A 1ZCFA 4KXLA 2BMDA 4M21A 3BJIC 3KQTA 2IPOA 4LSZA 3SICE 5CDYA 4AJPA 5LDHA 2I8AA 2WMDA 4RKEA 3F78A 4IFIA 2FPIB 2HLDA 4P7BA 2COUA 5IVHA 2OZPA 1I5OA 1TM5E 1Z6YA 4LJ6A 3DLHA 3UBMA 4U2FA 3WIDA 3K92A 1X80A 2NUPB 4OA8A 4IZHA 3RK4A 4DILA 4KO2S 1EZ4A 3JY6A 1YHZA 3FCYA 3OT1A 2SECE 3TRHA 3QFRA 1V1RB 2WV7A 1VG8A 3AFNA 1EA7A 3R6DA 1NLUA 5L40A 2C1EA 1ZGAA 4K03A 3DAFA 3DOIA 3PWSA 1C9MA 1PDWA 1P2UA 4YK7A 1NF8A 4C4RA 1RYEA 4I1SA 2HLPA 3O03A 3D6AA 4AKSA 1Z2EA 4FDLA 3WYDA 2ZYTX 1NM5A 3FOCA 3KB1A 3PC8C 4CQLB 4YMGA 5C8YB 1BDBA 2QRGA 3ZJVA 1CJUC 1QO0D 5HTOA 1V9LA 4F4JA 2FSSA 3MXTA 5L3RA 2RDMA 4B3XA 2CT8A 4IUBS 1P1IA 4C0LA 1J2RA 2D74A 4XQGA 4A73A 1ETUA 1OGYA 4UAVA 3KDSE 4D46A 4UFPA 3QVLA 4PAGA 1A5AB 4LYDA 3TBFA 4P5PA 4EPRA 2XQJA 2ZVPX 3L1KA 2E89A 4QDUA 2QUJA 4WXRA 4PQRA 1G5TA 4LYHA 1QB8A 2Q6IA 3DMTC 3R7DA 1FFXA 1H2ZA 1XGKA 3DNPA 4TVOA 5CNJA 5TSDA 3GV0A 3ZE0B 4ZICA 2I7DA 3IUEA 3MB5A 1E79D 4HQ0A 1MO2A 2AEFA 1SELA 1JFVA 4O4IB 5BQPA 3UJ6A 1TCBA 3KL4A 1QQTA 3GCDA 3LHIA 4LOLA 4W82A 4KHZA 3CX8A 1O89A 4LJ4A 5CXUA 3BRWA 4XCVA 4OA5A 4M1KA 2NSJA 2GFIA 3LQ4A 1G3MA 3LZCA 2VPIA 3D6TB 4JROA 2VK8A 1BYUA 1T1GA 2EJTA 4YAJA 5T4BA 1DKPA 1W9HA 2OAGA 2NVUA 1NBWB 1X9IA 2IIBA 2Q3CA 5FXMA 5KYKA 3E2PA 5EXPA 4EELA 2XQKA 3AMVA 1IXYA 1GUZA 3P27A 4E88A 1IHDA 1QR6A 2Q5LA 2R6JA 1LDBA 3EAQA 4N5MA 2ZWIA 3FH0A 4KXFB 1WMSA 3VFDA 4CIBA 1DDIA 4OHZA 3BXEA 4V0OA 3ZC3A 5EFZA 1OJ7A 1BEZA 2HMWA 2K7ZA 2MHCA 3OOWA 4GR4A 3ITEA 1X38A 5ALRA 1ZM3A 2PMWB 2HZBA 3HG7A 1CS4C 1EDZA 5C7IO 1FP4B 1LS1A 5B3AA 2P6MA 4E6EA 3QY0A 2G4VA 1M1ZA 1LDGA 2NT3A 2D5LA 2FZWA 3MWDB 1X70A 1L5YA 2AJ8A 4LBVA 1PL7A 2WAOA 1AIPA 2AMLA 3R23A 2RB4A 4KO8A 1KO1A 1YIDA 1IE3A 3ESZA 1VKOA 3W2HA 3C8MA 1QB7A 3M0EA 1H8HA 3LQ2A 2JFGA 1UK7A 4B4OA 4BEWA 1MORA 2QVYX 2VDUE 2W6OA 4FU0A 2RONA 4NYJQ 4Y2HA 4LZZA 5DCWA 4GBMA 4BVGA 3C3DA 3LSTA 4GFDA 4QGSA 2Q3JA 3IIEA 4JHLA 3QXXA 5LKAA 1OGJA 5IYZA 4CG3A 2ZEJA 1VHJA 2GEBA 4AS3A 3FKJA 3IEPA 1ID8A 2BKAA 2OZLA 3W4IA 3OU7A 4ICIA 3RSQA 4AK9A 1FFYA 2EGHA 1BGWA 3FR8A 4AP9A 5JSUA 2YFQA 4RHFA 3LDAA 5F2OA 2FPRA 4PZYA 2N42A 4QC2A 1R4ZA 3Q6IA 1KDYA 1BXKA 1XAHA 4KGXA 3OG9A 1DEAA 3A3KA 2IXEA 4MJ7A 1N2EA 5E2AA 4IILA 2FH5B 4EJSA 1T8UA 2DH6A 3L7AA 3E27A 1G8PA 4B6GA 3ZK7A 1RPAA 3H84A 2ENWA 3JQ9C 1UXJA 4Q3DA 3BWBA 1AT1A 3HYCA 3QKWA 4JHXA 4JLJA 4LOHA 4EJFA 2NPOA 4NMLA 4I9NA 4KGZA 4WACA 1YB6A 2O2SA 2XQFA 1SC9A 4IGIA 4L4SA 3RRZA 3UH0A 1N4AA 2I65A 1R6BX 2JL1A 1GPAA 4BBPA 4KQKA 1J22A 2PS3A 1QGUA 4D4KA 1KOGA 4QU0A 3W04A 5CJJA 3B1FA 4MQ6A 3UN1A 4FQ7A 3DDZX 3RSLA 1S8OA 4M9RA 1DO8A 5A02A 3IAHA 3KLMX 3MSCA 1WD7A 3HJCA 4OFXA 3UMYA 2OECA 3P2EA 3U4AA 3LLMA 4OQEA 2Y1DA 4LVCA 1J2EA 3FF1A 1LPBB 1IQ0A 2G25A 2IXTA 2PN1A 1NLMA 2QUAA 3JQDA 1B1CA 1OLSA 3AW9A 3VR0A 2JGRA 5U4XA 3K8YA 4CV0A 3EFHA 4OFBA 1P8AA 1QO9A 1E5VA 1QLHA 3T3IA 3UV3A 4BTVA 5HZGA 1MZPA 4DLRA 1P39A 1SUIA 4H77A 1VRVA 4UTOA 1C3JA 1EK2A 2A0WA 3IAXA 4WWHA 3B7GA 2FSVC 3WX0A 2IHJA 4BECA 1E0KA 5E6UA 1BHSA 3HXKA 3HXQA 3L07A 4A3SA 3MHTA 2DFDA 2Q46A 3WJAA 1UMKA 3E70C 4HEHA 4RS4A 1VE6A 2VPXA 2VT7A 4YACA 1EUYA 4M6WA 4PAOA 3COWA 3C6KA 1A7AA 1VHDA 3F8WA 2A3RA 3IR6A 4G89A 3F7MA 1GJRA 2FPGB 2H2WA 1IG0A 4BOYA 1BEUB 4QU9A 3GFQA 1UT6A 5KSPA 1CRQA 2EGGA 5LD2C 2Y1EA 4V0MA 3OIYA 1L1RA 4OXQA 3H9GA 3OM9A 4OQQA 2AOUB 2PUAA 3ZCTA 5ALUA 2F64A 4RQAA 4Y1RA 4KHPB 1DOZA 4QICA 4L7QA 1EX1A 1GFZA 2BMFA 1YI1A 4KYVA 2BHRA 2XECA 4AMBA 2JLWA 4B5KA 3ZE6A 3Q3VA 4M9QA 4OF4A 2OP0A 2ZVDA 4YHBA 4A0QA 5B3JC 1F8XA 1MQSA 2HFKA 5K6AC 1Z5ZA 5LMNB 2QG6A 3R4CA 3IPCA 1LC3A 3GB9A 5T6BA 4K3VA 4A16A 4DJJA 2QVCA 2RKWA 2PGAA 1RWQA 3DUWA 3SMQA 3UMCA 1CD5A 5HNKA 5G4KB 4WBNF 4Z4IA 3KE9A 4IGEA 2ZETA 3G8AA 3ZDFA 4FGJA 4ZQIA 5ICFA 1PHRA 3CXUA 2FW8A 2H2AA 2N0SA 3OBBA 2EHDA 3AK4A 4N0EA 3D4NA 3TLZA 3ZHBA 2PRSA 3EDYA 5ALMA 4AS2A 1HWYA 3EXHB 4L73A 2NUTA 3QY9A 4W99A 1WQ3A 3JQGB 3VPDA 3GGSA 3MWEB 5AVZA 5LIPA 1NVFA 1XZGA 5AUOB 1D6JA 3AR9A 3HVHA 5KTYA 3DTVD 5JZOA 3SN6A 1RABA 5HOQA 1XYYA 5D3MA 4E31A 5KYYA 1OPRA 1GADO 3HFSA 4MI3A 4X3PA 2BDEA 3GAFA 4URXR 3KT6A 2A33A 1I3LA 5CLQA 4DR2B 1Y5MA 2EQAA 2JD1A