1FVXA

Clostridium beijerinckii flavodoxin mutant: g57n oxidized
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
138
structure length
138
Chain Sequence
MKIVYWSGTGNTEKMAELIAKGIIESGKDVNTINVSDVNIDELLNEDILILGCSAMNDEVLEESEFEPFIEEISTKISGKKVALFGSYGWGDGKWMRDFEERMNGYGCVVVETPLIVQNEPDEAEQDCIEFGKKIANI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Control of oxidation-reduction potentials in flavodoxin from Clostridium beijerinckii: the role of conformation changes.
pubmed doi rcsb
source organism Clostridium beijerinckii
molecule tags Electron transport
molecule keywords FLAVODOXIN
total genus 50
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 1996-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1fvxA00
2QWXA 4QOHA 4YQEA 3EYWA 3TZBA 1AKTA 4FGLA 1ZWKA 2KLBA 2XOEA 1JA0A 3F2VA 1YRHA 1H66A 3FW1A 3KAPA 4FGKA 4GQIA 1YKGA 1ZWLA 1CZOA 2BF4A 4HEQA 4HS4A 1AKWA 3W7AA 1XT6A 1C7EA 1AKVA 1VMEA 3OX2A 1OFVA 3FX2A 3N39C 2FVXA 1DXOA 1FVXA 3NHPA 4XDHA 1E5DA 1YCFA 1J9GA 4ZVNA 2X2OA 1XI2A 4YAFA 3S2YA 4S24A 4DILA 3KAQA 3GAMA 1RLJA 1WSWA 4U7GA 1FUEA 5F4BA 5LBTA 2A5LA 2BZSA 4YALA 3UXEA 2OHJA 1C7FA 1ZX1A 2M6SA 3OX3A 3UXHA 3QFCA 3QE2A 4ESEA 2M6RA 1CZRA 1XYVA 1CZHA 4F8YA 3OVMA 2FDXA 1FLDA 3FNIA 3HA2A 4CF6A 3GFSA 3NHYA 3LT5A 3TE7A 2GSWA 3NHUA 3NHJA 4QOGA 4R81A 3NHSA 2HNBA 4BMOB 5LLDA 1T0IA 5A4KA 5EAIA 1SG0A 5F51A 1T5BA 4QOFA 2W5UA 3W77A 5LBUA 3NFRA 4GI5A 4C0WA 3NLLA 4D02A 4LTDA 2HNAA 4ICIA 2QX8A 3N3AC 2BN4A 1D03A 1QBGA 2FZ5A 2Z98A 4N65A 2B3DA 4QODA 2BMVA 1QR2A 4N82A 1JA1A 1J8QA 1QHEA 1BVYF 1YOBA 2FOXA 2OYSA 4LA4A 1OBVA 2AMJA 3B6KA 2WC1A 1RTTA 4C0XA 3G5MA 1J9EA 2QX4A 3K1YA 1OBOA 4ZVLA 2F1OA 2Z9BA 3F6RA 6NULA 4DIKA 5FX2A 3GFQA 5FA6A 3R6WA 3FJOA 1AKRA 2QR2A 3B6JA 3OWHA 1QRDA 2FCRA 2MTBA 2QMZA 1F4PA 3OX1A 1CZNA 4LTMA 4C14A 1YCGA 3NHWA 4ZVMA 2KQUA 2D5IA 1CZLA 1B1CA 1YCHA 2HPVA 1AKQA 5ULLA 5B3KA 1NNI1 2MWMA 2ZKIA 3P0RA 4QOEA 3ES9A 1AMOA 5NULA 2XODA 4PTZA 3SVLA 3B6IA 4NLLA 2MT9A 3KLBA 3W79A 3U7IA 3F90A 4H2DA 3D7NA 1AG9A 1AZLA 4U7FA 4XDGA 5EA2A 5F12A 5NLLA 2FLVA 2OHIA 2QMYA 2ARKA 1BU5A 2Z9CA 4FGJA 1FLNA 4NULA 3LCMA 1V4BA 3NHLA 1DX9A 5TGZA 4CETA 3K20A 3EDOA 5EMNA 4BMPB 3ZHOA 2RG1A 1X77A 3KEGA 4Y7CA 1XYYA 3L9XA 4YAWA 3O2NA 1KBOA 2R97A 3HLYA 3JSXA 2QX9A 4PTYA 3O73A 3ESZA 5FUQA 3NHKA 2V5UA 4LAFA 4U7HA 1D4AA 1D04A 3F6SA 1H69A 1SQSA 2BPOA 1J9ZA 4M0CA 5B3LA 2Q62A 5LMCA 2QX6A 3TEMA 3ESYA 1WSBA 3OJXA 3HR4A 4N9QA 3OWXA 4QOJA 4YAOA 2FAXA 3N3BC 4H6PA 3L9WA 1KBQA 1FTGA 1YDGA 3GFRA 3OJWA 4PU0A 5LVAA 4Y9RA 3ESXA 3NHRA 4GR9A 4OXXA 4DY4A 2V9CA 1CZKA 2V5VA 2X2PA 2Z9DA 4QOIA 4FX2A 5LJIA 1DXQA 1FLVA 4ZVKA 2N1MA 2R96A 1RCFA 1CZUA 3B6MA 4Y9UA 3W78A 2FZVA 2Q9UA 4LTNA 4C76A 5JROA 2MOKA 3RPEA 1RLIA 2OHHA 4YAUA 1AHNA 1TIKA 3QFRA 5BUCA 1I1OA 3FVWA 1FLAA 4J8PA 5LJLA 1AKUA 3U7RA 1GG5A 2FX2A 1FX1A 3NHFA 1TLLA
chains in the Genus database with same CATH superfamily
4FMDF 3F5MA 3ZGXA 2WF7A 1CR6A 1TYAE 1C0IA 2Y68A 2IEYA 3C70A 3JQ9A 3JPYA 4NPHA 1KERA 4Z0TA 1GQYA 1NE2A 3AUJB 4IZIA 4NMHA 3G1UA 3Q12A 1H2YA 3G2PA 1ZPDA 2QUBA 2HA3A 3N6VA 1V96A 2A57A 1B6TA 1NJFA 1VI5A 1OPXA 1A8QA 1ZD3A 4PAOA 3D5EA 4AP6A 1Z5PA 1OWLA 4TRNA 3EH1A 5EKSA 2WVHA 4MGIR 3DR5A 2EFEB 3GNLA 4A23A 3U61B 4DLSA 5ERYA 3UWKA 2P3LA 2FDXA 1RZ3A 4X3PA 4AF6A 1XDSA 1M66A 1DIHA 1Z15A 1ZRSA 2R8YA 4MR7A 1IPEA 2WIDA 3C6QA 4UUQA 3LC7O 2NVUB 3NRBA 5JS1A 2NU8A 4MQEB 4HDMA 2JGFA 3TTXA 3UG6A 3I76A 4NFLA 4OXQA 1OX5A 3A4VA 1T2VA 1AU9A 1XMQB 2C96A 1VECA 2AFIB 2BGNA 2CVOA 2NXNA 2QX8A 2GN8A 5HZGA 5FI3A 3OP4A 4C0KA 3WSWA 1OH8A 3WKEA 1L4GA 5JCJA 5C52B 1JIXA 1B2RA 4J43A 4RMIA 2C07A 2GEVA 3GJSA 4M98A 1YE5A 3L01A 3WGVA 3ZLTA 2WR8A 3VU0A 1M8JA 2F1OA 2C9ZA 2XGGA 1PNVA 3OX4A 2CF6A 4O59O 1AD2A 2HO5A 2PMFA 4O25A 5KCMA 4WFQA 3RWBA 2PDAA 2VBFA 5CVVA 1RYZA 2J07A 2FXVA 3Q72A 4CQNA 4HGZA 4QGAA 4PC6A 4WI1A 4YFYA 3E9ZA 4M8KA 4ZMBA 1L5SA 1QIGA 4RC9A 2BELA 1C3OB 4KMRA 4PG6A 2BZ1A 1Z17A 2P3OA 4TLAA 2YX1A 1F8GA 2IPXA 1EGAA 3SHOA 4FYHA 1AZLA 2A5FA 1U0RA 3M89A 4KGDA 5FXMA 4DWJA 2ZB8A 5DNDA 1HDCA 3SDSA 1HE1C 1YQQA 4RLQA 2W6MA 1E6WA 3O84A 4TTQA 1P4JA 2NM0A 3BSSA 4QHTA 2GJ8A 5CNMA 2P4UA 3DEFA 4YXFA 4KLRA 1RTKA 3ZV7A 4KR2A 2IW3A 3O4GA 4B32A 3SC2A 3QFHA 2VZ8A 1P2DA 4H60A 2ZSUA 4R0NA 4B4VA 4G8BA 2WP8J 4OGLA 1G8YA 3PJFA 2CGEA 4Q01A 1P62B 4U4AA 4UFNA 3GLIE 3DDNA 3LX5A 3NVDA 4G4SO 5H02A 1U04A 1XZGA 1ZO8A 3QG1A 4NVRA 2XZTA 5TPWA 1YKFA 4PPFA 4A9AA 2Y3IA 3TTUA 1J06A 2D4HA 2WJAA 3K1TA 3KV3O 4BYGA 5AUOB 3AV0B 1BDJA 3AUSA 2LIPA 1E2QA 4FOLA 4WBSA 2R8XA 4ZPXA 1KMNA 2ECQA 2VDUE 3VVLA 2FMUA 4HRXA 2Q28A 2I66A 3U7EB 3AX6A 1XZAA 1VIDA 4P3XA 3EIEA 4EOGA 4ZYXA 1NFQA 2I29A 2QL5A 4DCGA 1T9GS 5SZIA 1FNCA 4LY6A 3FNBA 3F2VA 5DXFA 1WBJB 3WXBA 1NOKA 2QXUA 2XYQA 2X5XA 3GJYA 2VCHA 3NZEA 4IUDS 4EUHA 5K3FA 1X14A 1UBFA 3RIMA 4BQEA 1DQZA 4PHHA 3LUFA 2ICAA 5I3ZA 2HLNA 3ETLA 4DY6A 4QGHA 3T1OA 4KN9S 1C7ZA 5B55A 2IY8A 2AI2A 4KV9A 2AFIE 2PO5A 1DKQA 4KQEA 5CX1A 4ENSA 2HSGA 4TQGA 4ABYA 1U2SA 1KZYC 3GLIA 4Q3AA 4YALA 5LMZA 3GDWA 4BL5A 3B38A 4BDSA 3SM3A 2FR8C 2CLFB 3FNIA 5AP9A 4ZCMA 2ZTMA 1Z26A 1XZQA 1SCNE 2CHQA 5KSWB 1XRSB 5KVCA 4KBFA 4BNXA 3E4DA 1Q2XA 2HWKA 3N2ZB 2ZRCA 3DO5A 3FETA 1P5RA 3VR4H 4LK2A 1MABA 2WU8A 2JA2A 2Q0QA 2LCQA 4C0WA 5BMVA 5B2EA 1ML3A 1RWKA 5JZVA 3DKRA 2G07A 3UA3A 5ILQA 1JIUA 1RAFA 2GFQA 4Z8YA 3T41A 3CG4A 3QBTA 2X14A 1KWKA 2BR3A 1G8PA 3BCHA 3M3DA 1ESEA 1QH1B 2YWRA 4OOFA 1L0BA 5K8LA 5KYXA 4F06A 5EFZA 4EWLA 2GJSA 3FZYA 1P7CA 2AVDA 3A0UA 3ZHQA 5IKEA 4BO0A 1KHTA 5JR3A 3QX8A 1GWNA 1TF2A 1KZGB 1WG8A 3C85A 1R74A 1ZKDA 3LQRA 1LEHA 2J5RA 2W2OA 3P4XA 4JLPA 2HKIA 4Z2YA 1AKRA 5LQRA 3FJ1A 5KTOA 3HK2A 1IWOA 2W8ZA 3IAM1 1RQXA 5F7OA 1AKQA 1T2AA 4BX8A 1Q7TA 4IRMA 4RCVA 1TF7A 1U2GC 1FE8A 2LKDA 3AIOA 2GBGA 3F0TA 2AHRA 5GM2A 4H4DA 4TS4A 1EESA 2DQYA 4BKQA 4FEEA 3DHNA 1X8KA 1Q0SA 1LD3A 1YT5A 4I5FA 1BU5A 1TW3A 2A3NA 3DAFA 1CUSA 4JV5B 4DMMA 4L8FA 5E38A 3CRVA 1WSAA 1TL7C 1TUBB 2C2BA 3GN2A 4GLOA 1N1GA 2Z1DA 4RKWA 2ODQA 3DFFA 1DEHA 3GR6A 1KBOA 2C59A 4QO7A 5J43A 3F5DA 3QX7A 3NDIA 4I5GA 5LYYA 5AVZA 2O8EB 4G4JA 4KDRA 5E1BA 1SQSA 2UU9B 1XEWY 2FTKE 3FPLA 4I36A 3FFWA 3QY9A 4MI9A 1RI1A 3L43A 3LKZA 5JPIA 3OECA 5LWHA 3JQQA 1UEXC 2TSYB 2RI1A 2AOXA 3M5WA 4DXAA 1PIWA 2ZSJA 3RI3A 4RGVA 5C4GB 1DI0A 3KOYA 2I65A 4FT2A 4QT4A 2C5BA 4WTOA 2B1IA 1NX6A 1UBNA 2OORC 3GCWA 4OM7A 5LJIA 4LV6A 3CR7A 4CFZA 1D9ZA 3D8RA 1Y1SA 1XC7A 3HCNA 2FJPA 3WLIA 4DMCA 1B3BA 3E0QA 4BX0A 1KJZA 3DEAA 3KB6A 3KBOA 2Q1XA 3PI6A 1I4OA 2UUBB 1QVAA 1M6EX 5A7HA 4MGYR 5CA0F 2P6RA 1ZUD1 2TMYA 2JIMA 1UFVA 2H1WA 2KYRA 2XCQA 2DUNA 3PVSA 4DRYA 1GPYA 2IGBA 2X1HA 2O3SA 3L41A 3NT4A 2EWMA 2IIVA 4JJAA 5A4MS 4IOLA 2VXCA 4ROSA 3RREA 4RKRA 3DBIA 5D86A 1AUVA 1HYGA 2PZBA 3AF4A 3QBVA 1KY5A 4N9WA 3LLMA 2DM6A 3NBXX 3PB3A 4HGNA 4NMMA 2I3DA 4NJMB 4XKJA 5CHYA 1DQRA 1G291 4PONA 1KAOA 5EHNA 4QXRA 2Y92A 5CX4A 4KOEC 2RHHA 3QG5A 4B48A 5SICE 1HDIA 1EMDA 3V32A 3K31A 3TGPA 4YRGA 4HWTA 4XOUA 3OE7D 1YKSA 3DFZA 1T1IA 3PQCA 3UAGA 3BGIA 4I6GA 4OBBA 1PR5A 3EWAA 4Q4CA 4PYQA 4FFMA 4D0GA 3U9LA 5CT4A 4FWBA 4FQ8A 3S1AA 3VH2A 3UB4A 1UBRS 1H4QA 4E88A 3CN7A 4TXNA 4B6OA 2NMVA 3A6JA 3SKVA 1M83A 2FWIA 4RHUA 4TL6A 2VLIA 3SSMA 3W2FA 2VUUA 3ISVA 5B2FA 5FWXB 3V8BA 3QNMA 3MC1A 4TS3A 4B9EA 4CBVA 1MH1A 2H8GA 2QYOA 3IV7A 4NXNB 1YJQA 3LBIA 3NPMA 2AMJA 1OXMA 3E48A 5JD3A 3NIWA 5KNDD 2XT9A 2OA0A 1ZVJA 2HSDA 3NAZA 4A0HA 5K6AC 4IJMA 3WA7A 3BMNA 3BXGA 2VUIB 5JTUA 2QGNA 5B53A 4QQRA 1I33A 3P9IA 5HTKA 1YJXA 4V0NA 1P8JA 1U1GA 3AR7A 4XR4A 3IBSA 3C8UA 2A9FA 2QLBA 4CMIB 4W1SA 1NBME 2RHOA 3BJEA 2PNJA 4DGQA 3ENKA 4Y6PA 3BD6A 1YZ3A 1Z0DA 1KEKA 1NURA 3OOJA 3URMA 4E09A 3K6SB 4FOPA 1EGQA 1W85A 4WZAB 1U9IC 3BEOA 2ZRJA 1JA9A 2FUG1 4K7JA 4NBRA 3VMFA 2J3MA 2PU5A 4HB3A 4ALLA 1Z0IA 2GHTA 4EB3A 1EWYA 2NVBA 2GM4A 4N48A 1OGIA 1IY2A 1Z6PA 3TIXB 3NOOA 2OLEA 3NONA 3ZU3A 3IAS1 1YVPA 5CG2A 5JJKA 5ELXA 1QIFA 5LQDA 1ZCFA 5JBNA 1E8MA 3QH4A 2XMZA 3IE1A 2ODWA 3B53X 1YZVA 1SO8A 2JFHA 2QL7A 3PFWO 2CV2A 3ILXA 1PJLA 3K8OE 2EAUA 1FXWF 3TK1A 1M1YE 5C8YA 3H11A 2CXQA 1FSGA 1ZZEA 2C1XA 3MFYA 3Q10A 4H1VA 1YS4A 4B0PA 1S1MA 2EJBA 4C03A 1ZSYA 3S1LA 4DHWA 4Y9UA 3C74A 3WTCA 1S9HA 3UFXA 3FKSA 2XIJA 4PGFA 3A6DA 1XHEA 3GDGA 3KUCA 3LKVA 4P4UA 4Q93A 2WIBA 3V2IA 3W5DA 5BT9A 5GINE 3ZU4A 3FAZA 2PWYA 3MSCA 4PPYA 2G40A 3LPNA 5E3IA 4EO4A 1MRNA 1VM6A 3ABRB 3IIIA 3BTOA 3LHDA 4IUCS 4UEJA 3AXTA 4YC7A 5P21A 3VR6A 1COWD 2QWXA 3FVQA 4N7RA 3HLKA 3LHFA 1JJFA 4KLAA 1DOAA 1VKOA 5AK5A 1PR2A 2JJYA 3HBAA 4GOKA 1FNMA 3CRZA 5I7RA 3SYMA 1A7JA 4BVHA 4A10A 3I1YA 4PBTA 4RULA 3QV2A 4KNYA 2GHQA 2OC9A 1K6EA 3A9WA 3FBGA 1IN5A 2FFAA 3CR3C 1YRLA 3UAZA 5JAZA 2OHXA 3SZUA 3VR5D 2EV9A 3DOFA 2ID9A 3EBPA 3R5XA 4HGOA 5TT0A 1J8FA 4YR9A 4RTNA 2JCSA 2NSLA 3CEAA 2O06A 1MNAA 2EKPA 1J7JA 4YYZA 4HH4A 4NCIA 4QUHA 3UW1A 2A88A 2H5IA 2QXYA 1JHRA 4KWEA 2O2XA 3M6UA 1GUAA 4K88A 4AUMA 5JXIA 3Q6IA 5GJWC 2ADMA 1SUFA 2GTPA 2PD3A 3IPXA 1CG6A 2G5TA 3Q3JB 4OJNA 3Q5GA 4UUPA 5FPSA 4GOJA 5J63A 3GN1A 5SZJA 3DNMA 2B82A 2YRXA 2ZULA 2QQEA 1E2EA 4F4UA 2YY5A 5DEOA 2VAWA 3KFVA 4P54A 5JARA 1D4ZA 2C94A 3H6HA 2H63A 1Z4OA 2W71A 1JIJA 2RKBA 3KYJB 1FMFA 2DWPA 1GNTA 1LJUA 5IDYA 3HU2A 3KOXA 4PIPA 1N3BA 5ALJA 1EK5A 2QD4A 2YVAA 5TQJA 1V16A 3RFXA 4DJEC 2A33A 2VRNA 2HC9A 4Z3OA 2YVLA 1YHNA 2DP4E 3EG5A 3Q8KA 1T15A 2FEPA 4BFSA 1II9A 2OFXA 2WW8A 1CJUC 1G3MA 3PNMA 4HEA1 2JLBA 4Y67A 2IYVA 4C0SA 3PLNA 1W36D 4P82A 1OLSB 4JUIA 4RK6A 1OT3A 5CFPA 2OY0A 5HOEA 1XU7A 1QK3A 1U3TA 2OKGA 2I3GA 2CW5A 1POXA 2PH1A 3A1FA 3D7NA 1XJQA 1E9FA 3DLCA 2DVMA 4X85A 3ZQ4A 3Q15C 2G70A 3PSAA 4FGJA 1GTVA 4XPZA 5C0OE 3K9BA 2OCDA 3G2JA 3MEQA 1X2EA 4PBRA 2VRCD 1KAHA 1EQ2A 1FFEA 2W98A 1G6Q1 3C8MA 5BMVB 4XWKA 5JISA 4MIYA 5I4CA 1SCQA 1N5OX 1SU8A 3AFGA 2DOKA 4YRJA 2XDYA 2FP4B 3GCXA 2VXOA 3K70D 4FD3A 2JLSA 4N0MA 2H6EA 1DKMA 2ZSDA 2JFYA 2QN6A 3PDCA 3ZZ0A 1GFZA 2V9ZA 3QIAA 1TQ6A 2CE2X 3DO6A 4F3KA 1BDIA 1W1IA 2GM9A 5L7TA 3RTAA 1ZJWA 3WYBA 1JJIA 5ENVA 1GQRA 2RG7A 3M4ZA 2GT1A 1TAUA 3UMGA 1VRCA 4OXXA 1PL7A 2G9NA 1KS9A 5DYIA 1L7AA 3FI0A 3BKWA 4ZCLA 4GKVA 3ZK9A 2VUHB 3OLCX 5G3YA 4I46A 3WY9A 4LTNA 4F4IA 1G6KA 3IOCA 1CUWA 2EIHA 1NSFA 2B5WA 4MITA 4PX3A 3WQRA 3T5TA 3EZGA 4E32A 4BB9A 4ZHSA 4ZMRA 5KS2A 3M6VA 3UJAA 3H0CA 5AIBA 1ZRMA 4AX4A 2XTJA 4FGZA 3GCZA 3LK6A 1KQGA 3QTTA 4U9HS 1G60A 5HUHA 3F2IA 5E9QA 4FCCA 4MS4B 2C7OA 1B76A 3I6QA 4D82A 2YJ6A 2Z4TA 2OE2A 2CKMA 5I9MA 2ILTA 2RAFA 3H5TA 5A05A 5T57A 1YD7A 2CEKA 3PC7A 2FSIA 3AIMA 4G5QA 4RH3A 3W8RA 5CPBA 1R0ZA 2QQGA 3T5GA 4YT2A 3GEMA 4NJMA 3DLIA 3NTRA 1PWEA 2JBWA 4MIKA 3V7FA 3STWA 1WKBA 1P4RA 3RYFA 3Q7EA 5MN6A 5FPTA 2FP4A 5CLJA 4CKEB 2O8BA 3S28A 2FNAA 3GFTA 2N46A 4XI9A 5JFGA 1GGHA 1D3AA 4DDKA 2EC5A 4ARIA 4C5CA 3ONDA 1TKBA 2CHFA 2H59A 3H04A 2GA9A 4LDJA 4QUEA 3GRUA 4FEAA 1I7PA 3Q3GE 4Q4JB 3NHSA 3K0KA 5CPFA 1LK5A 4MDFA 4PN7A 4G2NA 2QPOA 1R0WA 4KYTA 1JEJA 3DE4X 1XZLA 5FUBA 3FOFC 1DG1G 3W2EA 5JE8A 3ZLVA 4QREA 1HORA 4WN9A 3A6GA 4OHOA 1MA3A 4YCNA 3EY9A 1QNLA 1RDFA 3R7LA 4HNGA 3HBMA 4AN1A 2QPLA 1NRIA 1FVHA 1ZI9A 2OHGA 4TROA 5E3HA 4EECA 3A11A 4RXTA 1MQ9A 1UANA 1YR8A 1WX1A 1G2IA 3O91A 4CKZA 1E0AA 5JATA 2F1JA 4RD0A 3PGKA 1SJ9A 4IL5A 3MQ4A 2QTHA 1G63A 1TIPA 2A1UA 2Q2WA 1ISJA 3HSYA 5IC5A 3TIFA 4D9MA 1IUKA 1JQBA 1E3TA 1NQVA 3UPDA 1QIMA 1ZGCA 5EJGA 2PGNA 1Z5OA 2B5VA 1E4EB 3BMOB 3GHYA 3NEYA 4Z3KA 4EJFA 5A6SA 2P2NA 3AUUA 4HR7A 3HO1A 3NCTA 3R7DA 3QNUA 1VRVA 1W30A 3LBYA 3ZLUA 4R8RA 1X7WB 2JD1A 4C0BA 5LDDC 2YFQA 4HUJA 4Z86A 4XQEA 2JFOA 3RC1A 1TCBA 4UEOA 3VHXB 4E1VA 1IOZA 3KT0A 1SOUA 2GK3A 5ALGA 5JW6A 3CX4A 5BW5A 5F2KA 1X7YB 1HG0A 1Q1ZA 2VHEA 2IH4A 4GUAA 5FP0A 3SXJA 2JAPA 1CK4A 5FR2A 4UE3S 4IJ5A 3SSNA 2P2LA 2HBZA 4H1HA 4M8IA 1C9MA 4AS2A 4JX9A 3FE2A 5AW0A 3T3PB 4FZJA 4ZJYA 3F9CA 5HJ5A 5GAJA 1GNVA 4GU5A 1ZMTA 2NQ8A 4BV8A 4D5EA 5TMPA 4V0LA 3A04A 5JCZA 3W06A 1BVHA 3GJXC 2X2FA 3QU2A 4ILKA 2QTFA 1T13A 2Q2OA 1A1VA 3FYHA 4RL6A 4QFMA 1K63A 1MXHA 4PCVA 4BNMA 2ONYA 3GVXA 3DULA 1AGXA 2OB2A 1DFHA 1NBMD 1YOVA 4KU4A 2HZ7A 1K75A 1MPTA 1R9NA 2ETVA 2QG9A 3T7KA 2HA6A 5JS6A 3DDZX 2VJOA 3GOHA 5I9IA 1R18A 4RV4A 4S2EA 3IQHX 2ZUFA 4MCIA 2AKAB 2ZUDA 1HX7A 1QRSA 4WZBB 1KY3A 3R7FA 4GVLA 3IUJA 2LW7A 4PVDA 5F3DA 4A7PA 1SD1A 2C98A 5KX5A 1XQVA 2IHBA 2YYAA 4EH1A 2CBZA 3OTHA 4X20A 5KSPA 5CXSA 4HQNA 4IV0A 1H4SA 5A9RA 4L6IA 3AZPA 1UXGA 1ZUNA 4N01A 1MDFA 4JVMA 4BKRA 3F7TA 3B70A 4MVJF 4XB1A 2CLSA 3NYWA 5HE9A 5CX1B 3MJTA 4H7KA 2X9VA 3UK1A 3TNDA 1Q5PA 1PUIA 3S70A 2I54A 4MV6A 2GCGA 3ET5A 1LBEA 4DCPA 2ZUWA 5T67A 4LNAA 3ZPXA 2FR1A 5GJBA 5T7BA 1J70A 2JAHA 5EZ5A 2X40A 3L0YA 5FPPA 3CZ5A 1WSWA 1J42A 1HOTA 2QLTA 3FHOA 1KPHA 3T3DA 4BATA 3UBTA 1MORA 3K9WA 3EVAA 2HDWA 3IDOA 3KEOA 4BBJA 4EKIA 4X24A 1FYVA 3I4CA 4DEVA 2ZSAA 5JALA 5DOZA 4BQFA 1W0KA 3PUKA 3TW8B 1Y8ZA 1N5KA 1OV4A 1YVUA 4A4DA 5C8YF 3K2EA 4HFJA 4B3MB 3OFVA 4BZWA 4QU5A 4HV4A 1PX0A 3G6WA 2HMYB 2MCFA 4EW3A 4F3CA 5TNXA 4GPD1 4WNAA 1HK7A 2FPGA 3CMCO 1GZ5A 4TMXA 4UZFA 2V97A 4JBGA 3VYVA 4ER5A 3SLGA 1DUIA 4LJ6A 2PGDA 1HV8A 3DONA 4CKBB 1SBCA 3H9BA 4ETMA 2WUDA 1LDGA 1VJGA 1O6FA 1OOEA 4IOJA 3E9NA 4FHCA 3FI9A 4EY5A 2ZJ1A 1KIAA 1TYDE 5D3KA 1E60A 1WP9A 4F56A 4KYVA 2FW1A 2NU7A 4Y6RA 3VU9B 1LPSA 3AF1A 4DE5A 5JDIC 5M7EA 2RGNC 1ZM3A 2O7QA 3ZQ6A 4IYJA 3UOGA 2HRBA 4YR7A 4DUGD 5LDHA 2P2SA 4G0MA 4XQGA 2PKCA 1M74A 4U6NA 3GY0A 2F3PA 4H15A 3K6KA 2NUTA 4ZA2A 3HPQA 4DQKA 2VP4A 1RXIA 2A67A 3CLTC 2QKYA 1QP8A 3R6TA 4OH1A 1ZAYA 2G0NA 2Q5OA 1N4AA 2Z43A 3STXA 4L22A 3PDJA 5E6RB 2XT0A 4U5QA 4CYMA 2IYLD 1G21E 3DL2A 2P65A 4MR7B 4JB0A 4BJHB 1XNGA 1TVMA 1QGUB 4R40A 1IM5A 4ZOLF 2PZFA 3CA8A 2YMMA 1P6QA 4KQJA 1H69A 3E05A 5SYNA 2NU9B 2Q6IA 3B1JA 3R6LA 4JA0A 4DLLA 3NHAA 4FT4A 4BGEA 1WUJS 1QGAA 1NV9A 4O8ZA 2G17A 2OZKA 4Q7QA 1G8HA 1A95A 5DHAA 1O94A 5THKA 1FSZA 1GGVA 1QHXA 5AI0A 4LF9B 4M38A 5CUQA 2FGJA 2HJWA 1NMSA 3OZVA 5JD6A 3EXFB 4WKPA 3SZMA 1T2UA 3F5FA 2O19A 5IASA 5EE5B 1B16A 1YAJA 1SC9A 5C3UA 1RWQA 1M3SA 3QIVA 1V8BA 4MV0A 1C7RA 4BP8A 4CJXA 3K96A 4DR2B 4P7KA 4R2WA 1LFDB 1GT91 1ZIYA 3COZA 3IHKA 2V4UA 3N86A 4J8PA 2Z8ZA 5DX1A 1RBQA 5IW8A 3JCZA 2F3TA 5TY0A 1E8DA 2FW8A 1K8RA 3T4XA 3GWZA 5HBRA 1N6PA 4JOCA 3IJ5A 1OX4B 3W5IA 3EPRA 4TTAA 1NVGA 1DAPA 4NYIR 2PUWA 1O95A 2QG4A 4AI6A 5IKXA 3DGEC 3CB2A 5EPUA 1FYFA 2C4HA 1G19A 2ZBRA 3Q2OA 2WIFA 4OGGA 2H0RA 1QVZA 2VHJA 1VI6A 1SQFA 1YGYA 3HJTA 3ZGVA 3L5KA 4DT1A 4R9RA 4DR3B 4EENA 3C6XA 4GEKA 1IL0A 4WLEA 5AUQA 3KHKA 2VK8A 1TVCA 1IULA 3GV0A 1UPTA 3NC0C 4RY2A 5K8CA 4PS0A 3S2YA 2QN1A 3I04M 3G2IA 3ZJ5A 4L5BA 3I8OA 1O95D 2C77A 1CEXA 1JLKA 5EIAA 2I7CA 1O97D 4AO7A 4N8SA 2BE9A 1N5IA 3W5AA 4ZOCA 2A4KA 4JYBA 1P61B 2WIGA 3M6MD 1FW6A 5LOVF 1P5JA 4K05A 1PNRA 1A97A 4NOKA 2JF0A 3PR3A 4U9IS 5B12A 2B7BA 1JVBA 4FEYA 3WGGA 1OAKA 3ZK7A 1P7PA 1TO1E 2I78A 4QJ5A 1Z0UA 2NUPB 4HZUB 2WSYB 2YC4C 3OJ0A 3REOA 4BE7B 2W42A 2XQVA 3GYGA 4NNOA 1P3DA 2QRJA 1HEUA 3IX7A 4M0DA 3EVDA 3KOWA 4H7HA 5EG5A 4EEXA 2CD9A 2IY7A 3R7SA 2D3TA 821PA 2QM3A 4N6NA 1I13A 3DB2A 1GA1A 2B4AA 2OXRA 1WXGA 1KK3A 1X7ZB 3H87A 3MM4A 1S2DA 1GZSA 1DL5A 2XX3A 4NAUA 1U7HA 2W43A 1EVYA 4MPRA 1U0JA 2FPWA 3IB6A 3ZW7A 4ARCA 3FZEA 4A91A 3A70A 1GVHA 1ZJ5A 3ZWKA 5IKMA 3T9BA 1MX1A 2JD2A 1EPUA 3FPCA 4JENA 4XVUA 4QZVA 1HE8B 2GYYA 2HAEA 3HUDA 3ZE6A 2WD9A 3ZXUB 1F7VA 3H5RA 4KRGA 1FFHA 2RJNA 4WZAA 2NVOA 3IT2A 4DA8A 3H4MA 1QVWA 3J7AC 1O5OA 4QLAA 1FRZA 2C0QA 5IULC 4UREA 1BHJA 4H2DA 4B6JA 1KTIA 4BLVA 1W4CA 5KYWA 2X8WA 3PEFA 4KQ9A 3HDJA 4DF3A 2IK8A 1V4BA 1QANA 5EMKA 4GP6A 4LWPA 4OPMA 1FFXB 3GRAA 4PPNA 2Q3BA 4IMIB 1Y8RA 3KM0A 4RWEA 2VJNA 1XCJA 3FGOA 3OZXA 4QQFA 5JS7A 1YUMA 4DZRA 4U3JB 1OXXK 1N9ZA 1T91A 1J0BA 1XEFA 3O3CA 2QN3A 4A6DA 4GLLA 1XTIA 4HB4A 3TLXA 3I12A 3RNLA 2OUKA 2Y1DA 2OGUA 3P5SA 3F6SA 4GQAA 2VHVA 4UAVA 1MH9A 1NJSA 5H59A 4DJTA 4L1KA 1AO3A 5TPZD 1J25A 2H2FA 1I7LA 3PI7A 3PX7A 3JZFA 4GI1A 1J21A 4LDQA 3HJGA 4GBMA 4KO4S 3IUSA 4PYRA 3R1IA 4D44A 5AR1A 2XD9A 2O8NA 4LY3A 5D7NA 5FFFA 1Z0SA 3WWEA 4AF8A 5LCXA 1IATA 1QYIA 2FR0A 4ZU3A 3TPFA 3L7CA 1FFDA 1U1CA 1LDBA 5CCDA 1NJ2A 4LRQA 1EG7A 4GRAA 2RGRA 4LHEA 5EHXA 1GUYA 3WSVA 4B31A 2AC7A 1IMJA 3HV0A 3OHMA 2HOQA 4YQEA 1Z88A 4UM9B 4KC0A 5A4AA 4HYYA 1P7ZA 3JAKA 3N8IA 4X00A 1I2AA 2F4NA 2CLHB 3W2HA 2YHAA 4IIJA 3RAGA 4GYWA 1JG2A 2WJYA 1A8PA 1J9GA 1PJ8A 2VPIA 4PRZA 4PXYA 4BGVA 4Z1MD 1JHPA 3W2IA 1R9GA 1DBRA 4BOYA 3DDWA 5CYGA 2WJZB 2VDOB 4PGGA 3NR2A 1LA2A 3WIBA 2CXNA 2QRLA 3SQXA 1DBIA 3FMIA 4BNUA 1CR1A 3MCVA 3ZI0A 2JEOA 1D4OA 2P6UA 3BWCA 4YJ3B 3N6XA 1LU9A 3OFSA 3UT5B 4F4JA 2FH5B 4QUAA 4CKWA 2B9VA 3NT2A 2HHAA 4KV7A 1KQOA 1R6DA 4HBZA 4ENWA 2LUOA 3IQWA 1OYOA 1XTUA 2WQZA 3ZDBA 3R9WA 1PT5A 3MELA 3RRNA 1YA8A 5E7JA 1I4DD 2ID7A 1HMPA 3Q8LA 4JI1B 4Y3UA 2FEMA 2QD2A 3FTPA 3LYHA 1SHZA 2FSSA 2IZOA 3PDWA 4LA4A 4PLZA 1GLNA 1LB1B 1FQOA 1BFUA 4V0OA 3VDMA 2XEDA 4GKJB 1E5VA 1RABA 4P2GA 1DCFA 4AB1A 1F38A 3G0IA 1KIMA 4OFWA 3DC7A 2YJZA 3TZEA 4CKYA 3HMKA 1NAHA 1QHNA 4U00A 1GPLA 3CZ9A 4RD4A 2IC5A 1E3JA 1CZLA 4HRVA 1IJBA 1Z28A 2P4SA 3TOXA 3U48A 2XUJA 2CDRA 1RWXA 1VE1A 1Q3KA 1LBQA 3AR4A 3GLGE 4IEEA 2VYVA 4TLEA 2WWXA 2ZIXA 3WNCA 3KQWA 4JCCA 2E6KA 1NR7A 2ZSFA 3BRQA 4MMXB 4A1OA 3BS4A 5JYCA 1L2TA 3PQ7A 1NVMB 3INYA 1KZ7B 4PAMA 1OREA 1KFKB 4NKRA 2H2HA 3BAZA 4FGSA 3TLJA 1RZVA 1HE5A 1ZGAA 2Z6UA 1XK6A 3EF1A 4TUYF 4ZO8A 3AG5A 3AERA 1KKUA 4R1UA 5F1KA 5KJCA 3OFNA 3PX2A 4WOBA 1O03A 4IFBA 1Q44A 3THSA 2CNWA 1BA3A 4FYJA 4ZRNA 2XB2A 1SXHA 2WOOA 1EI9A 2A9RA 1JSLA 2Y0DA 3AR2A 3OZ7A 4Q48A 1PZFA 4TKUB 4X91A 4YGXB 1XXHE 1QRTA 3H1GA 4JS0A 2BEUB 2JLQA 1R0CA 1PYGA 2NYVA 2WWFA 4PC7A 4IR7A 3USZA 2OXTA 2HLHA 4DLZA 5FWDA 1ZVVA 4PE5B 3DWGA 2FWJA 2R5FA 4CL0A 1PFVA 1RLIA 3GDOA 3AJ9A 3RU2A 2QZZA 3AR3A 3TLGB 1I1OA 2GKSA 5JZBA 3DYVA 1Z73A 1FRQA 3AJ8A 2AFHE 2EZ8A 2BFNA 4YO7A 3EW7A 3U7RA 1TQ8A 4PYJA 2EARA 1SXGA 3K5WA 1L7MA 1BDMA 2EJVA 3HKDB 4GF5A 5AHKA 3DEZA 5CCEA 1N8KA 3ND8A 1BW9B 5DRYA 1V0JA 1O58A 1P0QA 3DXZA 2ODPA 1EHIA 5JSKA 2J8ZA 2HU5A 1UBHS 1Y3IA 3BGOS 3IYLW 5F5NA 3U26A 1PUJA 1AQ6A 1HT1E 3AM4A 4WCFA 1EDEA 5AK0A 4TN5A 4ZQFA 3FX2A 1N2CE 1TU3A 1B4DA 4UD2A 3X1KA 5LQKA 5K3FB 3VNBA 2JGDB 3DE1X 2YVKA 3JVUA 5L3QA 3HEBA 2RGGA 5HK8A 2NU9A 1C0EA 2QTAA 2WYHA 3GH3A 1C80A 4ZWNA 4YCLA 2C8VA 1IUPA 2H4FA 1PAUA 1TVKB 3BFXA 1ZG3A 3UO8B 2HUNA 3PWZA 1LSUA 2PGIA 1E1RA 4R2LA 4RJJA 4ZAGA 4HAZA 3UZUA 1KSHA 3GP8A 1ZW6A 4LXHA 4US1R 2XTMA 3ED1A 3GAZA 2OVFA 1JDSA 2JJ2A 3HCAA 5JBQA 5JMWA 4B3CA 4WJZA 2W5UA 3DF7A 1UFRA 1WM1A 3DPUA 1G20A 4FJ2A 4NY1A 5TPWB 2K7ZA 3NTQA 4BFYA 2BGMA 3BE6A 2W6OA 5BNIA 3FWYA 4I4NA 1JPUA 2PS1A 3VR0A 1M1YA 2DFVA 1N3IA 3ET4A 3ZU6A 3GPBA 4ETWA 3S81A 4JLOA 3CUSA 1UEIA 3GJ3A 2CL0X 1L6RA 3I45A 4PSKA 2NXJA 1PHPA 3I04A 3PWSA 4XQCA 2FKNA 3G5MA 1N0VC 4BP3A 5FT9A 4HDQB 4TMFA 1XNRB 4FYMA 16PKA 2KS6A 2N75A 4URZR 4M8LA 4R2HA 1KO1A 3EG9A 2OL4A 3F47A 5J2UF 4FS3A 3A2NA 4ZVUA 3RAFC 2X4DA 2WTAA 2WHQA 2H9IA 1C9JA 3WBJA 4UHCA 3FZQA 1QP4A 1OLXB 3AVWA 5CNJA 1PT9A 2Q5CA 2R8BA 2V7QD 5DHSA 2XZPA 5A9SA 2QNBA 5LZ8A 1KE1A 2BGTA 2NWQA 2UYGA 1WKVA 2B2CA 2FLWA 2DH5A 1ADCA 1YZLA 2XW6A 2ZE6A 3GGSA 1O97C 2PXXA 1Q17A 1E2FA 4U7FA 2J0QA 2P62A 2BWJA 3MRTA 3H84A 3PENA 3QWHA 4MB6A 2D0OB 4HJXA 1U7DA 2V45A 5GGXA 1FFCA 5GIPE 4YRLA 3CUUA 4MKGA 3WKDA 2CDNA 2CNWD 1DINA 3GK3A 1PJRA 1KZ1A 1FRNA 1L3CA 2H2GA 3AFNA 3RG8A 3SR0A 1WDTA 1EFLA 1XYYA 1GPKA 1KY4A 2YYYA 3EE6A 4JXJA 4L0DA 2X41A 1DO0A 2D8MA 2QR5A 4V3CA 3KJZA 1YONA 4JODA 3UJ7A 3IMGA 4URHA 1WHSB 3OF2A 4GSLA 5EESA 5ICCA 1OC2A 3JALB 4X7RA 3OPXA 1AQIA 1QIJA 4HAOA 5EY5B 1KMQA 1UQUA 2X7XA 3G0CA 3KOMA 3VDNB 1UQRA 1N6RA 1OAOC 1J99A 4OI4A 3UAYA 4HWGA 2BMJA 3X43A 2V1UA 4H6PA 3BAFA 4MWCA 4KSBA 5FJJA 4OSOA 1HT3A 2RK3A 3C48A 4CIWA 4DG8A 1NTRA 2G9QA 1WIWA 2QLLA 3NALA 4CLRA 1GTMA 4R8SA 5G02A 3V8MA 3BDVA 4MQFA 3W3AD 4F11A 1WPXA 3ZZ1A 1E1NA 3A1TA 1I4LD 3JQ7B 2O3RA 4Q1EA 1AJEA 1Q92A 3AM3A 1BEZA 2J6CA 4X20B 2VH1A 1WB6A 1FSFA 1YZNA 2HSZA 1PSWA 5BSTA 3M6IA 1TFRA 4URVR 3IUPA 3HCDA 2KLHA 2VYNA 4X90A 4DG5A 2WJGA 2AUNA 3WC4A 2J3QA 1OXVA 1X8JA 3OPVA 1JIVA 2NPIA 5B30A 3LXMA 4UJ3A 2UDPA 1ZMOA 4DQLA 1WDLA 3G82C 2D1QA 3AL2A 4RGQA 5ANRB 2ORIA 2IYPA 5E6UA 1OIVA 2CSUA 1H2WA 2X3FA 3BYZA 1BHQ1 2X0DA 5HZHA 2ZBGA 3E9DA 4M22A 1U1FA 1Z4PX 4RYLA 1C9EA 4OHYA 4P5PA 1VKNA 3DPSA 1UJ4A 1EFCA 3OUZA 1VLJA 3MRSA 3PQ5A 1S02A 4NBKA 1IM2A 4MKXA 3BJZA 3QVWA 4UU0A 4OI1A 2GXQA 3A3YA 4E31A 4Y8VA 1OFGA 3TQSA 2Z08A 1KOFA 3B82A 3PNKA 5J59A 1E2MA 4WPGA 2JZNA 3ILHA 2JI7A 4K26A 1WXFA 4J4HA 4QC2A 4B80A 5ED4A 5C1IA 1II8A 2QIPA 1TZMA 3RASA 4CKBA 1DO2A 1CPYA 2XLBA 5AQEA 2GWRA 2P1RA 4PLPA 1T8WA 1GNRA 5JNLA 5CT5A 1G9SA 4YCMA 4I55B 3R9IA 3TCKA 1W25A 3GUCA 3ORYA 5F7ZA 1L5HA 4C0XA 3ER9A 1FF9A 2ZPUA 3F4BA 2YJNA 2AK2A 2EBUA 3HKBB 4XLZA 2EKQA 5BWCA 2BKLA 1RVDA 3FH0A 3UA4A 1DBWA 5U1PA 4LF4B 3VPSA 1UOPA 4IIJF 4S1VA 3L3BA 2IHZA 2PO7A 5J9FA 2H2IA 2WAMA 2HRZA 4E11A 3VZCA 3UC5A 5DF1A 1XMOB 1TM4E 1LK7A 3D7LA 4YRCA 3EIWA 4N0EA 2GEKA 2IP2A 1L4BA 3FGNA 1TEHA 3KHUA 1GT6A 2QPTA 4NH4A 3D8HA 1TD9A 3LC1O 3W79A 4GC5A 3N0TA 1HQDA 1Z38A 1XZEA 3F6CA 3OSUA 3IESA 4CMBA 1QVVA 4EJSC 1N1DA 1R9MA 3P2EA 1RXYA 4IQFA 4S1OA 3NBQA 3RSQA 3VU9A 4OUDA 3DVRX 1M5RA 1NW4A 2OV2A 4I6JA 5KQPA 2IZ1A 4MVJP 1VFNA 1JQKA 2OOKA 1JH8A 1UXIA 1A8HA 3ITDA 1JG6A 1T4BA 2FPXA 2YOFA 3RUHA 2J7PA 2INGX 4DJDC 4MXDA 2Q3CA 2IBMA 2VHQA 3IBFA 3OLZA 1F3OA 4NE2A 4U6SA 4FSDA 2ZIXB 4EITA 3ESXA 3GLRA 2YYSA 5T6MA 4XVRA 2H1IA 4ZVKA 1KAEA 3BFPA 3DWEX 2YZKA 4M46A 1J4AA 1M1NA 2I22A 3HZZA 4RPHA 4ZCSA 3O4RA 5AW7A 3MWEB 2Q3LA 2CVQA 3IPLA 3O9MA 2JLYA 4CR8A 1VHDA 3PX3A 2AXNA 3SKYA 4XQ0A 4ARAA 2QYSA 4EFKA 3Q9UA 2KLBA 4RVUA 4YBRA 1I0ZA 2PH7A 3DTTA 2WZCA 3DLHA 2G5PA 2Q4EA 2X3UA 4LXTA 1U0GA 1KMMA 1Z36A 4RMHA 3USES 1KI6A 3ILVA 2CNLA 5HKLA 1RPAA 5HFJA 3RNOA 3EXEA 1K5PA 5FQOA 5HKAA 1JKMA 1RADA 5KAMA 4ZHQA 2P67A 5CLFA 1PV4A 3WOHA 3U60B 1GU7A 4O1MA 3BE4A 1LV7A 1DELA 5ENZA 5DHUA 2KMLA 5I7HA 2A0UA 2O52A 2RAPA 3H8SA 3G8YA 3JYQA 3EBLA 4D9CA 3GOQA 2G1AA 3OEHA 3M6FA 3TVYA 3AB3A 5EE3A 4PGAA 4GL2A 5IKOA 2PA0A 4AKTA 2HH9A 2AOUA 5DYNA 5T5QA 3VZSA 1PVVA 2P9YA 3Q0IA 3U4AA 2QN8A 4NPAA 3U9SA 1RWPA 3WJ2A 3WK7A 4CHGA 4NZZA 3A4TA 4YWJA 1R6AA 2BN4A 4X1IB 1SG9A 2YICA 1CC1S 2IITA 1IAQA 4ENPA 1CY0A 3K0SA 3R74A 2V0GA 2X0RA 1BCSB 1AGPA 1LI7A 2V74B 3EXHB 3IR5A 3VSBA 3KQLA 4J7CA 4E4RA 4HQKA 4UHDA 1E79A 3VI3B 2WTBA 2VT6A 1H0HA 4U0KA 2JATA 1UR5A 4NG4A 1B6SA 1ZW1A 1R5OA 3QOWA 4RD1A 1PLKA 3JQGA 5T41A 2BEKA 5G0TA 3SFZA 1BAPA 3DE6X 3UPUA 1Z12A 3O1JC 1M8GA 3P2MA 5NULA 1RM0A 4NLLA 1DRJA 3JARB 3I32A 4OF4A 5EGNA 3VZQA 3RS5A 2O2HA 1VBFA 4RFLA 4V1CB 4JOSA 1IXKA 2NGRA 2Q41A 4PICA 4CETA 3E5HA 4TTVA 3AVVA 3R8FA 2W6NA 3NKLA 4PLVA 1F2UB 3HACA 1ND5A 2HY7A 1AS3A 3CIOA 1YJBA 4RMJA 3ZE0B 5IHXA 1MB3A 3AFHA 2FRDA 3RRJA 1DZIA 4J9UE 1SKAA 2HWXA 4LOHA 4PRYA 1Z3IX 5F3RA 3OE7A 3G3EA 3OFND 1Q0QA 1K8YB 1U3WA 5F4ZA 4ZDKA 7ABPA 1WBDA 5HJEA 2VYFA 3VYWA 1OC4A 3IOYA 4X7BA 2MMCA 4X8MA 4UFOA 1Y9ZA 4ZYVA 2WM9B 4EF5A 5L4SA 3C1AA 3C1OA 4BEJA 1Z13A 4KXYA 4PC3A 2ZTUA 2B0CA 1EYZA 3TTSA 4BNLA 1M2WA 1U0HC 4N7MA 3A2MA 3QTLA 3PBKA 1YUBA 3AVTA 2BTQB 1X1CA 3HM2A 4OHPA 3UOAB 2EJCA 2Q3DA 4OX9B 4YUYA 3H9EO 3IB3A 4Q4JA 4OFBA 3KEMA 2ORWA 4UEWA 1NP3A 1DTSA 3O3OB 2KE5A 2EW2A 2PCJA 2Q5LA 4A8PA 1BA2A 3VO1A 3P9YA 1ZU5A 4OX9Y 2Y1CA 1FBTA 1FX1A 3VNQA 3GP5A 4TTSA 3DOHA 2J5XA 3WYFA 4TKVB 4RELA 4V0MA 1YC2A 3TW4A 1LDNA 1YRHA 1BH2A 1V8OA 1H3EA 4B8YA 1ZWLA 3TSCA 3UJ9A 1BHO1 1AKWA 1KVSA 5DNUA 5BXQC 3DLBA 1ZCAA 3QLVA 3D2CA 3SAJA 1N92A 4GVXA 3UYLA 4DVJA 1N77A 1DUVG 1FDIA 1N6KA 2H57A 3CZCA 3F46A 1W581 3JQEA 3R5HA 4XPIA 3QE0A 2IU4A 3LP5A 2H00A 2E4WA 1ZICA 3P9NA 5JY1A 1RYDA 2XMBA 5J47A 4DM3A 2E5WA 4LUCA 4X8OA 1JZSA 4M54A 3FNQA 2F17A 4IHJA 1RRCA 1QIHA 4PZDA 2P68A 4K9OA 4JI2B 3VISA 1VYVA 1Q7GA 1NLUA 2H85A 2O2DA 5HMLA 5BYJA 1KZHA 1J8DA 2E2WA 1LS1A 1XDDA 2CZCA 3Q3CA 1I3CA 1PYDA 3H2BA 4PWYA 3GJRA 2DQSA 4C2UA 2R84A 1K2VN 2J32A 3ORFA 3M6AA 3T3MB 4DDUA 3LUPA 3SGLA 4KKVA 2BC9A 2GZSA 3I6IA 3E53A 2BKAA 4HP8A 1Y48E 2P7HA 5DP1A 2EBFX 1ESCA 2I6QA 3TKAA 3TR5A 3NEPX 1WEKA 1XDWA 5IEBA 1I6WA 3WBFA 2NNLD 2Z2IA 3ZC3A 3QMWA 5KAPA 3CPEA 2FPMA 4P83A 1CNFA 2A94A 2DKFA 3BOSA 1XLVA 4KQWA 4MR8A 5U9CA 4RPCA 5CLQA 3GRKA 2JLCA 2AFHA 5DXAA 3U19A 4Q15A 1E1RD 1DX4A 1Y9JA 3UB3A 4H59A 3RS9A 4CV1A 3I6MA 4E2YA 2C7GA 1GDHA 4RK7A 3L0PA 2OO5A 3WL6A 3PUWA 3N2YA 1V41E 1E2JA 5BQOA 1RPTA 2WTUA 2P9GA 2ZRIA 5HBGA 3WGYA 4AYXA 1XFAA 4D25A 5C1PA 5AM0A 1UJMA 4NZNA 4KMSA 3KWMA 4WK2B 1Q12A 4BXOB 3ICQB 2Y77A 1TJNA 2PLFA 3K5IA 1A9OA 3KKEA 5L45A 4D45A 3NPAA 4UDXX 2XUQA 4O63O 1UDBA 1DEOA 1H5UA 3GFFA 1IZZA 3PXGA 3UMSA 3ZS9A 2REOA 5K0CA 3KS9A 3M4JA 4Q3BA 4OJMX 4QDTA 2OCLA 3RVJA 3SXPA 3UAVA 1P2GA 3BHJA 3PJEA 4N4AA 4MZXA 5AKKA 5FLXA 1JHVA 2FZCA 3AMVA 3R0IA 3II6X 1I30A 3GRZA 3HKBA 4RK1A 2W11A 4IY1A 4RIFA 5ECGC 1ZD1A 3O95A 3TD6A 2QV0A 3PHLA 1Y3DE 5F2EA 5G1NA 5HF9A 2FRVA 2AG1A 1VIMA 4LMRA 4S0XA 4F60A 1QOQB 2XVMA 3LVRE 5FRDA 4AP9A 1CJKC 1KQNA 4ASUA 1KETA 3ZCVA 3LGXA 3JQPA 4D9BA 4Z1OA 3MTEA 1NF2A 2IQIA 1B23P 2C58A 2QRNA 3JZIA 1FTGA 1RFLA 1J2TA 3BSWA 3BH0A 3QKRA 2NSHA 3RUCA 4D97A 4YUWA 3ROXA 5BN3B 1JIIA 1U2GA 4BQNA 2Z9DA 4CF4A 1CE8B 3SIRA 3E3AA 3ZQJA 1OU0A 4BFTA 1RWNA 1E2HA 1PEYA 3ABZA 3HYNA 2R11A 3EASA 2C57A 3K0AB 4EVQA 1DIOB 1UL1X 2IS6A 5H7XA 2B36A 3L6OO 4S1WA 4I2NA 1XXLA 3IUNA 2WFZA 4NNJA 13PKA 3BH6A 1Z68A 2W90A 2FMHA 3E15A 2C00A 2OYCA 2NACA 4RDCA 2JZOA 4FGLA 3R7WB 5KHAA 3DMRA 4Z9XA 3TQCA 4DBLE 4HEQA 3NRJA 3CLUC 4M7RA 5L3VA 4WUVA 5KYWB 1HC7A 2HN9A 4KWIA 3KXDA 4NJEB 4P5EA 5JUWA 2EXXA 4HNQA 1NDQA 4K6CA 1DXOA 4WIAA 3E9RA 3W1VA 5BSGA 1X87A 2F64A 2J4CA 3PNOA 4Q3NA 2ZYTX 4O1HA 1U2DA 3HI6A 3ZWAA 2CNDA 1NMEA 1SUAA 4MWBA 4NU8X 5JXWA 5C81A 1JG1A 4JSTA 5IVIA 2FN9A 1CZRA 2BFCA 2CNBA 1NE7A 2R6HA 2DEUA 3M4NA 1U7ZA 1FUKA 2KWIA 3GFSA 3L4SO 3WP1B 4YRIA 3RRFA 2ZXEA 1C8BA 2KX7A 1L4YA 1GAWA 3HU3A 3IGFA 3IV9A 4DV0B 3PXXA 2VTVA 3MRXA 1C8VB 1DO8A 3PP8A 4G84A 4MUYA 5AUNB 1M1YB 3NKFA 3QF4B 5LBUA 4M0PA 3D43A 4BIIA 1A98A 1EXWA 1I51A 1AF4A 1B73A 5ENDA 3QKWA 1LQTA 3WGTA 4GNRA 4ETIA 2HWYA 3B8HA 3GGCA 3QYJA 4B85A 1PP4A 5CH5A 1ZA2A 3CZPA 1E2GA 3CTMA 1LPPA 4MUHA 3I2FA 4RZQA 4JASB 5FNZA 3WOVA 2WT9A 4K9NA 3EGCA 5IHPA 4JNKA 3PJDA 1KEPA 3SG0A 1OFUA 1IHYA 1OLOA 2P2CA 4E2XA 2FN4A 3IVAA 3P2KA 4XYLA 1BFKA 1CRQA 1QM5A 3BWBA 1HDEA 5I4BA 4TXMA 2Z8YA 4N6OA 2MYNA 1C4KA 5AKYA 4KPUA 4ZZ1A 4CM8B 4R2XA 1C5KA 2W4IA 1KQ3A 1YCGA 3DVAA 2JGLA 3TLBA 2NO7A 2A30A 4ZHQF 3FZGA 2HT6A 2P90A 2Q4OA 3BK1A 3B9QA 3O0TA 2WWIA 4PW0A 1WOYA 2F9MA 3FYUA 3KT3A 3TGLA 3PD1A 2XITA 3DO8A 1E20A 3GJ5A 4FJ1A 3WHPA 4F2DA 1KNXA 2BZGA 1QH0A 2H9AA 1NT4A 2PX2A 3T0IA 5AW2A 3U37A 4QEKA 3STHA 4CM7A 2HDOA 2VDWB 4RSHA 2NZYA 4JXXA 3JALA 2O3QA 1XD2B 1FL9A 4YAWA 1JBQA 2DHCA 3E7DA 2XYVA 4FS8A 4YS6A 621PA 3LXUX 3LXRA 1NVAA 2EFHB 3V8PA 3ZVMA 3VTKA 3NCHA 3COJA 3DHWC 1H5NA 1USKA 2I62A 3GRYA 1HUQA 5HJ2A 5KOJA 4NOMA 1U3VA 3GJ8A 4AC9A 2A5GA 3ISJA 1KPIA 5ESXA 5IK2A 3GL9A 4JJZA 4X84A 3LQKA 4ZV7A 3LWDA 1R15A 4G81A 3GC6A 2VF7A 4WKOA 3AONB 5ALHA 121PA 5K0NA 3WK4A 3HQ4O 5KWVA 4M88A 2WYUA 4WA8A 5AJTA 1NW9B 3SXUA 4KQKA 1RVV1 1VL6A 1ECPA 2J4FA 3B6MA 4ISCA 4IIEA 5JROA 1MVOA 4LV5B 2HUPA 2MOKA 4L8YA 4X54A 4YDSA 5DDIP 5BYAA 5CEFA 3CM0A 4WADA 1H2FA 1W48A 2HJGA 3HJHA 4I4TA 1WVGA 4BFXA 4GYKA 3U80A 1FQKA 5UKDA 2E3JA 3UQYS 2EFGA 1Q0TA 4RTPA 1V95A 5LXTA 2HREA 3SJZA 1I3KA 1LC0A 1T5LA 1V8PA 5AKIA 2QP3A 4ZVOA 3AZOA 3QHAA 1WPGA 4RAOA 1E32A 4IWYA 3H19A 1QQBA 2JKZA 2XMPA 1TZCA 3KZCA 5LZ2A 5G4KA 3DA8A 3K0BA 2CVZA 4OKSA 4RVFA 5AXCA 1SKQA 4IIYA 4AJ2A 2BCGY 2GYUA 3LX6A 1GR0A 1X1BA 4L50A 5F73A 1CSEE 1BYUA 2M6SA 2QVZX 4ZT3A 5KYUA 1GDDA 1V8DA 5K0SA 3NHMA 5CTAA 4WVFA 1MJHA 2OCGA 2W2MA 3EY4A 3T1HB 2UXCB 5GIOE 2PVPA 5CDTA 5BORA 3A8TA 4TV9F 3G2QA 3R5FA 4ZODA 1NKTA 3ZG6A 4J3NA 1D09A 1FMCA 2FEOA 2XSZA 1N9GA 4JB8A 4U9UA 3VVCA 3O21A 3W9BA 4DC0A 1CHDA 1BMFA 1NX9A 1ACMA 4L3VA 4RD2A 3UJCA 2YFKA 5IMBA 3VKFA 3G2NA 4P31A 2QP9X 4PZCA 1HL3A 3RM3A 4F5EA 4S12A 4Z7QB 3CKMA 2VOEA 3Q40A 3SEFA 1AV6A 1NM5A 2ZITA 3L0OA 3AIIA 3WAKA 1RTTA 3DEHA 1VGQA 4K46A 4X6UA 4TKLA 2H4JA 3FDZA 3N58A 2O1XA 2P9CA 2B8WA 4XEHA 1RE1A 3WFZA 1OX4A 1VPDA 3DVSX 5EQTA 1KWGA 1XPOA 2GPWA 1CU1A 1SVLA 4HXGA 1YACA 3OO0A 3SR4A 4TS9A 4LECA 5KI6A 3V3KA 3V8EA 3ZIAA 4CLHA 2PMDA 3BA6A 3N53A 1NF9A 2PMEA 1BC5A 2YTZA 4HVLA 5D1NA 1WW8A 3KWFA 5BOSA 1V6AA 5C1OA 3ONVA 3CUVA 3CT4A 1UK9A 1LPAB 1YK1A 1WCV1 1C3VA 3HFSA 2V65A 5CFQA 2WVJA 5EA2A 4D6PA 1IHOA 5GMOA 4EGSA 3EEFA 2FPOA 3B85A 5E2BA 3H4TA 1FYDA 3M1LA 3KELA 1B7GO 1M6WA 1X9IA 1G7TA 2BIFA 2QS9A 2VBIA 4WXEA 2NSDA 3JAKB 4C07A 2XPCA 4UEQA 3L1JA 4PPGA 1NYRA 4BNYA 1J1ZA 4BTLA 1TYZA 1PKXA 2PS9A 4DZTA 1WPRA 2BHTA 1M0TA 4RJIA 3PTAA 3R40A 2Z3WA 3AHIA 2ATCA 2F90A 3KSMA 2ZQYA 4L2IB 3QVVA 1RQLA 5BRAA 3GUHA 4QD3A 3P26A 3NUGA 1RQ2A 1QHFA 1U0NA 4QOJA 3ADPA 4G0UA 3HR7A 4KN5A 3LC0A 1M6HA 1R12A 3OQOA 2WFAA 2ETXA 4YBZA 4DSZA 4DJFC 4RJTA 2V5AA 4PSDA 4ZAVA 5DNAA 4EY8A 3WGZA 4IXMA 2NSJA 1P9WA 3FWNA 5IRCD 5JAPA 4HTFB 4ZGGA 3IHTA 5CD9A 2Z6AA 1XMJA 1B6GA 1T1RA 3ICCA 3ENVA 3AESA 3ZS8A 2O5VA 4LDRA 1W6UA 4GGOA 2H5JA 5AM5A 5EHQA 4RL4A 4EJMA 1J33A 2G04A 3D3QA 3LFUA 4NU0A 4NZPA 4DMKA 3T99A 2B4KA 1JLHA 4HDRA 5DEIA 3QM1A 5FI5A 1VSUA 2BF4A 4IDQA 4IMPA 1ABEA 1OBCA 4YAEA 4YDRA 3B2EA 5DE3A 3S8MA 1LRLA 3WK5A 2OEPA 4FDUA 1MW9X 3C1TA 2CK3D 1ADFA 4KIJA 3CJTA 4PM4A 4Z9BA 4F6CA 2Q07A 3RYHB 1UC8A 5U4QA 4RTMA 2RGEA 1QTQA 5CH8A 3SZLA 4HEJA 4N5DA 2PGJA 4JI3B 4A5SA 2ISSD 4B73A 3RBXA 2HIMA 1RHMA 2Z1NA 3TMKA 2XB4A 1Q77A 4MLDA 1U8TA 1CF2O 4WWHA 3ZNNA 3ZW9A 3M4YA 5ER9A 1F6WA 2Q45A 3HB0A 1OMOA 2ZR0A 3E8SA 1X19A 3HGTA 3KQVA 4ZQIA 4BO7A 1LZLA 5FLYA 3IQXA 3VR3D 1Q1NA 3IMKA 3P71T 4PZZA 3NM4A 2GOYA 2HA0A 2IEGA 3TNYA 2B37A 3GFPA 3N7TA 1G7RA 1U2RA 4GD3Q 2O7RA 3EHDA 4R7GA 1G9TA 3P9KA 3A0RB 3A58B 4Q9JA 2IZZA 1W6RA 3DQZA 2C7BA 4KXNA 3WL4A 4H27A 1Z6YA 4EDFA 2QORA 5KJFA 2IEAA 1I5EA 2FEAA 1A1SA 1SXJA 1W2HA 1UZUA 4G86A 1KI8A 1M1XB 2EX1A 1Z7YA 4PQYA 3I8SA 4DDWA 4XQ9A 2FI1A 1R4NA 4UAUA 5KTTA 2I33A 4GP9A 4PSVA 2TECE 3MQ2A 4X92A 4CEJA 4EY7A 5F21A 1S2IA 5D1HA 4TUYA 1AB5A 3I4FA 3UJ3X 2BFBB 4UVEA 4UUAA 4LGMA 1E9EA 4IZ6A 1JRLA 4E5MA 4K1LA 3PZBA 4H77A 2GYVA 1O6ZA 1E1QD 2ZRLA 1SRQA 1BCSA 1A9PA 1F8UA 3H86A 4BLUA 3UUEA 1I3NA 3U1TA 2RB5A 2VN8A 3KU1A 3UBMA 1JMKC 1FXWA 2M1ZA 1P60A 1RYEA 1V7PC 1ZRNA 2FX5A 1G8FA 2BUAA 2OZEA 4DYVA 1KBZA 2ZJ5A 1YDHA 3ONNA 5ICSA 5EIFA 1X77A 2HJRA 4ZQHA 2O2ZA 4E2FA 4OYRA 4X1YA 5FLEX 3RIGA 1HDYA 5CB8A 4DXDA 3OJCA 1IZ7A 2NTJA 2X19A 5D51S 4MQUA 3EMBA 2VL7A 3O4IA 2FK8A 4E2ZA 1IQRA 5EYPA 1D04A 3GB9A 3RVPA 2VA9A 2Q62A 4Y6QA 5DXJA 3D6VA 2FPIB 1UK8A 3FYSA 1R6BX 3P52A 4NU6A 4EY4A 4JLUA 1DCTA 2JGRA 1P18A 1YJ5A 3P9PA 4JKOA 1ZITA 4NMLA 3P0JA 4ANFA 1I8TA 1W2WB 4MW7A 3W0LB 2CL7X 1BD3A 3PQEA 2ZDQA 2CXSA 1L5OA 3EXFA 3IAFA 3OEHD 2G1JA 4TM7A 5FBLB 3GXOA 4DANA 5HP4A 5L4NA 1JAZA 2QTCA 1XHLA 4W1PA 2VK4A 1F2VA 1TPZA 3I23A 3O8BA 4UNIA 5EWMA 1NJ6A 1D9XA 1HE4A 3GEGA 4Y1FA 5EVJA 3HUFA 4EVRA 2P5TB 2XDQA 1C3EA 1KDYA 4RCYA 5IUNC 3NWPA 1AGRA 2ZIWB 1E9SA 3FCXA 3OLYA 4OMDA 4KYUA 3SVTA 4FXOA 5AFSA 1BX1A 2HHCA 1EUCA 2VNIA 5DGCA 2VAMA 4PY2A 4G2TA 2QIOA 4CKCA 4XGNA 1XZBA 1SXJC 5HILA 1BQ3A 1WR8A 3K5HA 3TM5A 4DT1B 2DERA 1W9MA 3IXLA 1DC6A 1KAMA 4NMWA 4DYHA 1NPTO 5CA1B 4LJRA 4G6ZA 1B41A 1DAEA 2OKCA 2GZ3A 1Q84A 2J45A 1NR1A 1YI0A 2VSFA 4MSUA 1YNOA 2HNKA 1WHTA 3OOEA 1UDXA 4OA5A 1RP1A 3RB8A 2AB0A 2ZJZA 1FFSA 5T64A 2EL7A 5EZYA 3ND7A 3HJNA 4B3JA 5KYUB 2AWOA 3PHJA 4L85A 4I1IA 3O3NB 1XVTA 3OCXA 4MA0A 4U2CA 5HIJA 5IDVA 5EZSA 3T7EA 4ATNA 4Y1EA 2XE4A 4MV4A 2R5WA 1VE9A 5LMNB 3VAAA 2VXBA 3N8DA 2GA8A 4C7MA 5B3JC 2DH6A 1XA3A 1RYHA 1WUIS 3PFNA 3EVFA 1R66A 1FU8A 2XRMA 3LDUA 5K99A 4JYPA 1K3UB 4MKHA 3KYIB 1M8PA 1P75A 1UEJA 3ZDDA 4N65A 3LVFO 1QR2A 4F0JA 5K0FA 4FBMA 3LI2A 1T9BA 1PR4A 4PYLA 4EI7A 3A2KA 3HZRA 1KAQA 1WO8A 5JNTA 2KHZA 3PD7A 2H4YA 1JFVA 1VB5A 1DU4A 3OPNA 4MULA 2CUNA 4D3SA 1E3SA 1BE1A 3JY6A 4EFDA 4AS3A 3F5SA 1I1NA 1H85A 2P9JA 1FUUA 2K5UA 2WF9A 3D8SA 2AEMA 3NEAA 9ABPA 2F8LA 4K9MA 4AURA 1XA0A 2W83A 4KK4A 1KQPA 1VBKA 3AB7A 2OBMA 4Z7JA 1XTVA 3H7AA 2CJFA 1L4NA 2P35A 3L8MA 5G1PA 2Q9AA 3UTDA 3GRVA 2C2YA 1ZN2A 1M6VB 2ZVDA 4AZVA 4Z1MA 3OAAD 3UFBA 1VMKA 1Y37A 1XOIA 3MWLA 2NO0A 4NPCA 4PLHA 4FOOA 2RB4A 2VDPB 3LCMA 1MG0A 1QCYA 3OM9A 4NBTA 4UMVA 5JH7B 1XVVA 2A0XA 2DBVO 1QQ5A 2X8JA 1BVUA 3I9KA 2PRIA 3LE8A 3B48A 1Y4UA 3K9LA 1SG6A 1QZUA 2J9RA 3A1EA 2H4HA 3RT1A 4FHGA 3NI2A 4WGFA 4RANA 3OPYB 1TK9A 1HBJA 1OBFO 2UZ0A 3D0RA 5FUQA 2UZAA 4HN9A 1NR5A 2ESRA 5BO5A 5E6SB 1QE5A 1NYTA 1J5XA 1ZEJA 2XUGA 1EWRA 2AMLA 1R1DA 5A1TA 3K9GA 1KRHA 2F48A 3DR3A 2DUMA 3OOWA 4RVSA 4WOJA 5AW6A 2Q5QA 4HAYA 5KKNB 3WWOA 2WM3A 5HF8A 1BXZA 1UZLA 3H8VA 3ZZMA 1F9AA 3ZV3A 1RRVA 2QM7A 2VP6A 3RVLA 4EGAA 4ED9A 1M33A 3H9JA 3WRWA 1TCAA 1V7ZA 1VOTA 1G3UA 1PJ2A 1NRXA 1MAHA 1F0YA 1OTXA 2IYWA 3DJYA 3BX1A 1KVTA 3JU3A 4N40A 2H1VA 1BJKA 3TL6A 3KZVA 5D5QA 4P36A 5KWSA 1E4VA 2PUHA 1JXQA 3HA3A 1IWBB 4ALMA 5JEEA 3PNQA 3UJBA 4Q03A 3CUEF 5JVDB 1U8YA 2FW0A 1R10A 2F1KA 2IPAB 3MCAA 3Q7TA 1PGJA 5K8JB 1I7DA 1G8AA 1L5HB 2R1VB 2HF9A 4HWKA 4M87A 2XBMA 5CFZA 8MHTA 1XPJA 1CP2A 1Z5WA 2FPRA 5ARDA 5JI3E 1DRUA 1NT2A 1YWGO 2EFYA 2PKQP 1GPH1 1ZIDA 2FQQA 4GGMX 1DJLA 5A9SB 1U0TA 2WRZA 5BN5B 4Q5IA 4PYMA 1II0A 1LNQA 4II3A 3EEQA 2E9SA 3IQZA 2G4VA 2WSIA 4FP9A 1F2TB 2QJOA 1EFUA 1F1JA 1E7MA 1XYVA 1HM5A 4DCSA 1TEXA 1ITZA 5ALKA 2ORYA 4PINA 3FHLA 4WBNF 1EVIA 2V4MA 1R4MA 3EC2A 1Q21A 3QKSB 4PLYA 4KNWA 3S2IA 2LCIA 4R2JA 4FR2A 3X1MA 3AUTA 5THQA 2RHMA 5HIAA 3WJ7A 1DKPA 5FYQA 3ZWXA 4ER7A 1SUIA 3B3QA 3DE7X 5AK4A 4RTQA 3HN6A 1N2IA 4GPBA 4IICA 5C80A 5KTNA 5D87A 2IOHA 2FFRA 3ESBA 3F3SA 3NB0A 5FWYB 1GM5A 3BFKA 1C4WA 4XFKA 1Y5IA 4ZT6A 3FTDA 4KVFA 5FOTA 5B4TA 5IDQA 3GEBA 3MWDA 4ZPJA 4C6SA 2QZ4A 2ID4A 1TJ3A 4HSGA 3TQFA 2BLLA 2QF7A 2RSLA 4H7EA 5EQDA 4MLCA 1GGJA 3TLEA 5TE9A 3L1IA 3IR6A 3G5UA 3QKIA 1WV1A 5TDHA 3E9QA 4M1KA 4FIDA 5TS2A 3F73A 2HR1A 2BKXA 5B57C 2GLXA 3L1KA 3PQFA 4I4IA 5DV9A 3SIXA 5ESWA 1LWNA 1R16A 4LY0A 1URPA 4OHZA 1DGQA 3TRIA 3PC8A 4LHYA 4NK4A 3ZCXA 3PR2B 5A5DA 2O4UX 3G88A 3A26A 3KLBA 5LZ5A 1Z5NA 4KHPB 3HBLA 1MD9A 3LFTA 3IIJA 5TV2A 3JZMA 4DCNA 2CBXA 3SBDA 2MR5A 1OROA 4JCOA 5JSUA 3RBZA 4F3YA 1KEWA 2HYIC 3RS4A 2RMKA 3EVCA 1CKEA 3K20A 4UTXA 2BBWA 4XIIA 5TQ0A 4XIJA 5C7LO 4IH9A 3F6EX 3JQDA 1H22A 1RJGA 4YUAA 1KKMA 3O92A 3GLQA 3FYTA 3DAGA 3GBSA 3GEEA 3F3KA 1GL6A 4NC9A 2X9GA 2BEWA 3OT1A 1AGNA 2CB0A 2D0DA 3IXMA 4UZEA 4U7HA 3JWGA 4CHTA 4QLBA 3KZNA 2A5YB 1G4UR 3SI7A 2ZRHA 2ONZA 1EA7A 4GDFA 2O54A 3VZBA 3P9CA 1MC8A 2H52A 2IVFA 3FLAA 4XCXA 1R3UA 1JX6A 1Z6AA 1V1RB 3GEDA 2VHYA 5T8KA 3T9AA 1QU3A 4WXPA 1QQTA 5JAHA 4LWOA 4AFNA 3FBWA 4RNCA 4FUTA 3HZHA 3MFQA 4I50A 1Q3TA 1TYCA 4JUFA 4RK0A 3E18A 2BRUA 2HIAA 4HGYA 5EN4A 4B3HA 4J3JA 3ZR4B 3RUEA 4DLKA 1M67A 4MQLA 1G17A 1Z9BA 3S7ZA 2BEVB 4TMWA 3BBPA 3RANA 5DMXA 1GZUA 1ZSVA 2V7TA 3H2SA 1CEYA 4EZEA 1NN0A 4HYQA 4ZVVA 4UCWA 1V9CA 3MTQA 1H9CA 1P72A 3C1UA 1A4IA 1SBHA 1VA4A 1AF7A 2XE6A 3M7IA 1ABBA 3FVTA 4Q1DA 2CXUA 2E4UA 2VP3A 2GPNA 3G7NA 1FDTA 3QFTA 1T29A 1CULC 2VOJA 2ATVA 2XVZA 4V3BA 1HNXB 3KETA 3VC1A 4JROA 3RVMA 4V1CI 2A86A 5F23A 1JKFA 1QRUA 3K9NA 4UM8B 2P27A 4QUBA 4FFOA 3D6MA 2IYFA 2WJIA 1AQLA 5L3SA 2PAFA 1YDEA 3KKKA 3DKPA 1KL7A 2VA8A 4NOLA 3H8JA 2C99A 2CHUA 1L4EA 3IUEA 4L72A 4P3NA 4QG7A 1BRTA 4NBUA 3SZGA 3UNXA 1AH2A 1HFJA 1V4VA 3JYOA 4L57A 1I3LA 1RYBA 3WDMA 1QC5B 1M10A 1T3TA 2OZPA 4E7OA 1W5TA 2H1FA 3PWTA 3HUUA 1Q3HA 3PUJA 1MT0A 3HJRA 2Y1OA 4MAAA 2HJHA 2AQKA 3L7OA 4RZ3A 5DN6A 5IZ4A 2AI1A 2ZIGA 2WUVA 2PYZA 2WKRA 1B43A 2VJQA 3GLUA 1PCXA 3HP7A 5FHQA 5LIRA 2D0PB 3LWZA 3COVA 2UYHA 5KQMA 2VJPA 1B0AA 1TF5A 2QJRA 2F8SA 1FP4B 1XBTA 4D02A 3TBKA 1MMFB 1DAFA 3NXKA 1ANKA 1K0UA 1K7EB 2AN9A 2GQ0A 2IYAA 2BMVA 3ZEAA 1DSSG 3EMVA 3H83A 1XCMA 2PVSA 2HDHA 4RPLA 3FUVA 1JG7A 3WRYA 3BC1A 5D7BA 3I9V1 2GEUA 3Q0EA 5JAMA 2C2GA 3ZDXB 1X1TA 4K8RB 3DEYX 2J5QA 1MRSA 2FW9A 1XLUA 2ZI6A 3VNAA 4TKZA 3UH1A 1FPMA 3SBEA 4ZT4A 4EPRA 4OREX 1KDRA 2JAUA 1F4PA 2P1ZA 2DR0A 2SKDA 4U39A 4EVIA 1R0RE 5HM8A 1ZHOA 4IVPA 1PK7A 1NJ1A 1E69A 2RKOA 3KYCB 1CTQA 2PL5A 4HTAA 4TT8A 4JOBA 4CNBA 2X23A 1S7GA 3IEPA 1G98A 3FCYA 2DU8A 4RKYA 1UKBA 4OHCA 3DTVB 5KMGB 4NULA 1L5GB 2IA5A 1ZJZA 4BMVA 3DV2A 3EN0A 1QWSA 4LSWA 2YASA 1NDHA 1QDUA 1QAQA 2JGEA 2XDWA 2AIRA 4OHVA 5F2NA 5I6DA 1JAIA 3IE2A 4TTRA 4OB7A 2AJBA 3EPKA 1OJ7A 4QICA 2J1LA 2XUAA 1JMVA 3EDRA 1CUDA 4GLBA 1P8AA 3OBBA 5AVTA 3NHKA 1AZWA 4TZTA 2OO7A 1P2SA 4RDXA 1TT5A 4JA2A 1J9ZA 2FOLA 2JIRA 5MN5A 1Z06A 5K8VA 4MVWA 2IIBA 1M6NA 4YASA 5LQUA 2EJWA 4EF4A 4OVKA 3ST7A 3UGQA 1YFKA 2WD7A 3LYAA 3PC6A 4YT4A 3ML1A 1YB5A 4M60A 4DY4A 1FDSA 3ICVA 3D9QX 1XAGA 3H11B 4HDCA 4P84A 3WRXA 3Q9NA 2FK7A 4FVTA 4J2HA 2XRFA 2JBHA 1CUBA 2YDXA 5EP4A 3P0FA 1LLDA 1UXKA 2ZRQA 5A6VA 2UUPA 1R64A 1H23A 3W5UA 4EMBA 3L46A 2C95A 1ZC3A 2FE1A 1UM8A 4HX5A 4D9HA 4R6XA 1J00A 1ZS9A 4LMAA 5I7UA 2XWJI 5AVUA 3GX1A 2DETA 4OD0A 5KC9A 1DUSA 4GQIA 2JFFA 1DTWA 4HN2A 3WXMA 5CNKA 2C7PA 3BK7A 4LVNA 1KR5A 2FMFA 5ALXA 1BMFD 2Y4NA 5ALSA 2BYTA 3BQMB 4DIUA 4QECA 4XDHA 3HJCA 1EX7A 4QRIA 4ZO9A 2BFFB 3VDQA 3VSDA 3IUBA 3OCJA 5JRDS 1K8XB 4KE9A 4L7QA 4WEOA 3BWYA 1SCKA 2FWRA 1Q7EA 1V7CA 4BUJA 1BEEA 2ZTLA 3A3PA 1LUAA 4L4ZA 1LZKA 1E77A 1NBWB 2DLDA 3FDIA 4TPKA 5LSAA 2C1ZA 1FP2A 3DHEA 1IN7A 2WKWA 2YWDA 2VDQB 2FKAA 3BCSA 3EXIB 2MR6A 5CNIA 4TV8B 2I4MA 2JLAA 1O0SA 3LO5A 3KWJA 2AZTA 1OZ0A 2ZVPX 1KDPA 1VL8A 2I6SA 3E1SA 1Y4ZA 3RUPA 4ZV4A 3ZWWA 2HX1A 1T24A 1ZK4A 1RI3A 3ZHYA 1K9SA 4IIVA 4NF2A 3OA2A 4MINA 4IHKA 1QYRA 1HG1A 4E22A 1ZOLA 1BXRB 2J3KA 3MAAC 3HUTA 5TVKA 2BGWA 3A10A 1U81A 1UPUA 3IALA 1OD6A 4HZUA 5DLPA 2VNKA 4NCXA 2J3EA 3TDKA 3KYCA 3PQ2A 3ZLJA 5M04A 2FSHA 1JV2B 4EYGA 4RA9A 3D8NA 5T3YA 2O2JA 4KR6A 4LVUA 4JR2A 2I80A 3UCEA 3RAEC 3G0HA 3G23A 5K0LA 4PLCA 3MWEA 5FO0A 3V2GA 2GPAA 2YMLA 3O74A 4K28A 3K0FB 4QU8A 4IHQA 1R37A 3L2OB 3Q1LA 4X61A 4YMGA 3VC2A 4DSTA 4QRHA 1T8SA 1RHJA 2O5EA 1C3LA 1QV6A 2ZUCA 1U11A 1QYWA 3CLTD 2ZI3A 3P1JA 5CD1A 4ON9A 3WNDA 2PUGA 2QLFA 3E0XA 3IKJA 5FCDA 3F90A 3QUQA 4R6WA 4RVDA 4XWOA 5ETJA 2IP1A 3SQDA 1KARA 2QRMA 2VQ3A 4OLAA 2EP8A 2WPNA 3AY3A 3DEJA 1YVDA 1SOVA 4OG2A 3WGKA 4I14A 4AUNA 5TGZA 1BW9A 1NKVA 1ZNZA 2VVTA 2GCNA 1QFZA 5TVGA 2ZW9A 3T38A 1NBAA 3ZOZA 4C4RA 3N70A 1V6SA 1KO4A 5EWLB 3KQKA 1E2IA 3BWVA 3PA6A 1KP9A 1FX0B 1M2VA 2WWVD 3HY4A 4GG1A 3HDYA 2BGKA 4HDNB 2MYPA 2X22A 1RT9A 1GIAA 4HKTA 1JQ5A 1DBSA 3LT2A 4OL9A 4AYTA 5C9ZA 4KPFC 2YC2C 3A9UA 8ADHA 3Q2KA 3NTUA 3SWWA 1AKNA 1UQTA 4ODIA 2WG0A 4F5WA 3IIKA 4HSEA 1F8XA 3JXEA 4HGQA 1QGYA 4U7PB 1AN0A 2ZE5A 4G1VA 4LZNA 3UK2A 4A16A 3NC4A 4HAWA 2BKVA 1KZ4A 2QPAA 4NENB 3ZW8A 1O5IA 1VIVA 3KJFA 3LIPA 1Z6ZA 2RJ3A 1DEKA 4JIGA 2WPDD 4NH0A 4QL3A 4KXLA 5FPYA 3W8DA 3EOZA 1BFDA 2R65A 2G72A 5CRIA 1ENYA 3C4QA 1A9RA 1CF9A 3UVEA 2HT1A 1A72A 1ACJA 1C0KA 2BP7B 3M4XA 4BTEA 2NYRA 3FY4A 3SSOA 3IELA 1UZMA 3COSA 1SOAA 2XMGA 4JLNA 3AEKA 4JMPA 4Y18A 1FFYA 4FWIB 3QLUA 3VR6H 2OMKA 2X0FA 2VKTA 3OG9A 1G4HA 1ODJA 1WDWB 3CNQS 5C8XA 5DHQA 1B8NA 5JWHA 4MV5A 3WDLA 2DBRA 3EHEA 2HQBA 3NAMA 2Q9CA 4WW0A 1LGYA 1PS9A 2WVGA 3SKXA 4BGDA 3VBCA 3U6BA 2MINA 4KG7A 3E3LA 1Z07A 1Z0ZA 3FSGD 1NNEA 1MW8X 3FFAA 4UNSA 4WNIA 1P2VA 2NPFA 3K0EA 1V1RA 2AL7A 2NUAA 2QY6A 5IBPA 1XZCA 1DMRA 3DJFA 3LZ6A 4K6GA 1E0SA 4HDNA 4TN1A 2Q5HA 3PL5A 1QKKA 5AKEA 3BERA 2PIDA 3MWKA 4J0DA 4ZAXA 2PX8A 2XH8A 2EG9A 1VLQA 4WCVA 1FCJA 3NHUA 1O4VA 1MUUA 3AP1A 4FKZA 1EVEA 3NWBA 2R66A 2JI8A 2PFSA 3BSYA 2EJTA 3IBCA 4C7VA 3Q8XB 3QVSA 1E0DA 3PA8A 5DGTA 4JDUA 4JT2A 2WJHA 1NPDA 3R75A 3AT1A 3SNHA 3R7BA 1D6NA 4GPEA 1O6GA 1QBKC 4UAJA 1YOBA 4M9QA 1X80A 1Y9DA 1RQNA 4P3KA 3UMVA 4ZYZA 10MHA 5I5EA 3HO8A 2P4QA 4EMUA 5DGDA 2H11A 1NMXA 4TL7A 5AHOA 1L4LA 1DC4A 4NS1A 5D5PA 3Q3HA 3BWEA 3U4IA 2YIDA 2OV3A 4Q24A 3LUHA 1MX9A 2OXFA 5TLSA 3KJNA 2W2KA 2EGUA 2C54A 1HRDA 2ADFA 4CEHA 4X1KA 2FSUA 2DPYA 3T61A 4MQFB 3N76A 3EZFA 4TSFA 1GDTA 1EEHA 1EM6A 2MINB 2OSVA 3D3WA 4UXIA 4DSUA 2R7NA 3WNQA 4LJ8A 3QMMA 3QU5A 2F3RA 5IAGA 2QLJA 1PN3A 4BO8A 3L8ZA 5AOVA 2I3BA 3B6ZA 3LPDA 1YQXA 2J3IA 3OIVA 1SC6A 5FUWA 1IQPA 1JDBB 1N1EA 1N5LA 2VP2A 3ANLA 3CUKA 1LTQA 3O94A 4JC5A 4X5OA 3VTZA 2O2EA 1V1MA 4JVNA 3BRCA 2ZROA 1L6IA 3H4IA 4QLOA 1SCDA 4PZLA 4WESB 3RC7A 3TTVA 4DDHA 1UDWA 5FBHA 1ESNA 4MUXA 4QXOA 5FOVA 5HKOA 1T4CB 2O6HA 2PCLA 1G8KA 1C9YA 3IDQA 3O73A 1MAUA 3FR8A 4I4TF 3ROGA 4YJ2A 1F5NA 3N2KA 1P45A 5HQ3A 2G06A 2Z3VA 4BB6A 5IEJA 2J87A 2O8CA 5FO1A 5CM9C 4HATA 4QNRA 1E66A 4R98A 4X3CA 1TM1E 4YMWA 3PIRA 1E6KA 2ENWA 2JRLA 1U8FO 3PXEA 2HXSA 4OAQA 4UE2A 2ZUEA 5A0TA 1MABB 3IKTA 4P86A 3FMPB 1I0IA 1ODKA 2VPPA 3C7AA 1A8SA 1SB8A 2R8PA 3IAXA 3N8HA 3W78A 2VK2A 4X60A 4V39A 4MQEA 4JU9A 2YOHA 3KLMX 2VR1A 3F98A 3DZIA 4LOAA 1W5FA 4LXXA 4X1KB 3TSYA 1JEQA 2PEZA 1JTVA 3PCXA 3EISA 1NV8A 4WT7A 5DT9A 3FHJA 4O4HF 3MT0A 1JA0A 1ZUHA 4K1XA 3ETJA 2O2YA 1DG9A 3BL6A 1MC4A 1MEEA 4G1BA 4I5IA 3WWPA 1OKKA 2J0UA 3O8QB 4CF7A 3O8CA 4YAUA 4Z9AA 1E2DA 2O2IA 3L7LA 2WINI 3IT1A 3LPAA 1KDVA 3ER6A 3QWFA 4MPTA 2GAFA 4ISBA 4G36A 4PZ0A 5K3DA 3TPCA 5CJPA 5PNTA 2C9BA 3ZH2A 5DNEA 4D96A 2R6DA 1IXYA 4G5SA 3QXXA 1H1LB 4YJGB 3V42A 2HRRA 4LFCB 1E3DA 1IOVA 2B98A 2F1IA 4DW8A 1N2BA 2K2WA 3H65A 5K6AA 4PQEA 4ND2A 2CXTA 3UYKA 1KRXA 2YJ4A 2ZT7A 2JL1A 4O2BA 3K15A 3HY6A 3KXKA 1UADA 2AS0A 5EWJA 4D3ZA 1Q0UA 4H3KB 1E7RA 5REQA 1J2YA 1PGQA 1R9JA 1Z2EA 2GBFA 4NV3A 3GLVA 2VYCA 5LQAA 1T5TA 2H0AA 2HNAA 2R1TB 3AR9A 2UZ1A 1NONA 2VTEA 1MAVA 1QKJA 2GN2A