1FVXA

Clostridium beijerinckii flavodoxin mutant: g57n oxidized
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
138
structure length
138
Chain Sequence
MKIVYWSGTGNTEKMAELIAKGIIESGKDVNTINVSDVNIDELLNEDILILGCSAMNDEVLEESEFEPFIEEISTKISGKKVALFGSYGWGDGKWMRDFEERMNGYGCVVVETPLIVQNEPDEAEQDCIEFGKKIANI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLAVODOXIN
publication title Control of oxidation-reduction potentials in flavodoxin from Clostridium beijerinckii: the role of conformation changes.
pubmed doi rcsb
source organism Clostridium beijerinckii
molecule tags Electron transport
total genus 50
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 1996-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1fvxA00
4ZVNA 3NFRA 2B3DA 1T0IA 3KLBA 4ICIA 3ESXA 3D7NA 1CZUA 3ESZA 3HR4A 1CZLA 2FZVA 3W7AA 3FNIA 4CETA 2X2OA 1DXQA 2QX4A 3KEGA 3TZBA 4GQIA 4ZVMA 3NLLA 4C0WA 1FLAA 3N39C 4PTYA 4D02A 4LTNA 2XOEA 2HNBA 3B6KA 1FVXA 1E5DA 1H69A 4GI5A 3OX1A 5JROA 5LJIA 1AKRA 5A4KA 1AKWA 5LMCA 3L9WA 1BVYF 2FAXA 4ZVLA 1GG5A 2FCRA 3U7RA 5EA2A 2WC1A 1OFVA 5NULA 2QMZA 2Z9BA 4LTDA 2MTBA 4C14A 5LJLA 3OWXA 1YCGA 3QFCA 1RCFA 1AZLA 1YRHA 4LAFA 1ZWKA 1D03A 4CF6A 3NHWA 4H6PA 1CZOA 1J9ZA 3NHSA 4J8PA 3ZHOA 4DY4A 1H66A 3KAQA 4N9QA 3GAMA 4QOFA 2FX2A 1VMEA 2HNAA 3NHLA 1QR2A 3NHJA 4OXXA 1SQSA 1XT6A 2MOKA 5LLDA 1J9GA 1TLLA 4GR9A 5F4BA 1T5BA 4FGJA 3QE2A 5FX2A 3HLYA 4YAUA 3UXEA 3ESYA 3F2VA 3QFRA 4HEQA 3OJWA 5EAIA 1WSWA 2Q62A 4QOJA 6NULA 1JA1A 4M0CA 1RTTA 4DILA 4N82A 1CZRA 1YCFA 3GFQA 4YAWA 3K20A 4Y7CA 2XODA 4YQEA 5ULLA 2N1MA 2RG1A 2MWMA 3FW1A 3OJXA 1ZWLA 2V5UA 2W5UA 3NHYA 2V5VA 2M6SA 4PU0A 1CZNA 2X2PA 1AG9A 2R96A 3W78A 5BUCA 1AMOA 5FUQA 1NNI1 2Q9UA 1XYYA 1BU5A 4U7FA 1I1OA 1QBGA 2QR2A 3B6IA 1B1CA 2D5IA 1AHNA 1YCHA 1WSBA 3K1YA 4LTMA 1FLVA 2M6RA 1YDGA 4H2DA 1DXOA 3OX3A 3KAPA 4QOGA 1KBOA 3F6SA 2ARKA 3HA2A 2F1OA 4QODA 1FTGA 2GSWA 4BMPB 5B3LA 4YALA 1V4BA 2QX9A 1CZKA 3F90A 5LBTA 4QOEA 1YOBA 3SVLA 2MT9A 3UXHA 2QWXA 4LA4A 1OBVA 1D4AA 3O2NA 3S2YA 3U7IA 3N3AC 4QOIA 3N3BC 1TIKA 2Z98A 1XYVA 4FGKA 1DX9A 2HPVA 4C76A 3NHPA 2OHHA 3JSXA 4U7HA 3P0RA 2BZSA 4QOHA 3W77A 1C7EA 3FX2A 3RPEA 5LVAA 4ESEA 3EDOA 2A5LA 2QMYA 2FVXA 2OHIA 2Z9DA 3TE7A 2QX6A 5LBUA 4N65A 1XI2A 4F8YA 3LCMA 1RLJA 3FJOA 2OHJA 3B6JA 3L9XA 4ZVKA 3F6RA 4NLLA 1JA0A 2FLVA 1FX1A 4XDGA 3EYWA 2BF4A 3G5MA 4PTZA 5F51A 1J8QA 4BMOB 1KBQA 4S24A 2AMJA 1QHEA 5B3KA 3NHKA 2BN4A 5NLLA 4NULA 1YKGA 2R97A 3B6MA 3OX2A 1FLDA 4FGLA 5TGZA 1C7FA 3O73A 4XDHA 5F12A 1AKVA 1FUEA 1X77A 1QRDA 3ES9A 3OVMA 3NHFA 2BPOA 3R6WA 2KLBA 3NHUA 1AKUA 1AKQA 1AKTA 3GFSA 3OWHA 1F4PA 2OYSA 2V9CA 4R81A 2BMVA 2KQUA 3NHRA 4U7GA 1SG0A 1J9EA 5EMNA 4DIKA 2FZ5A 1CZHA 1FLNA 1OBOA 1D04A 2Z9CA 5FA6A 4Y9RA 4C0XA 4FX2A 2ZKIA 4HS4A 3GFRA 3FVWA 4YAOA 4YAFA 2FDXA 4Y9UA 1ZX1A 2QX8A 2FOXA 1RLIA 3TEMA 3LT5A 3W79A
chains in the Genus database with same CATH superfamily
1Y5MA 4D43A 4YMSA 2ZJ5A 4DOMA 3UMBA 1WZ2A 1OWPA 2FMHA 2W58A 3GQBB 3NEAA 2RHRA 4M53A 4XYMA 5F23A 2G0AA 3RIYA 1G8AA 1G41A 5H81A 4F5EA 4YRCA 3BFKA 1W4CA 4MVWA 4TMZA 5DLDA 5BOSA 4ZC8A 1XZHA 2XOKD 3HJUA 2HX1A 2K4MA 3BWDD 1W4LA 2A30A 3JS5A 3JWJA 4RZHA 1CZUA 3EG9A 2NZVG 4URHA 4YMWA 1V26A 1WXXA 5AM1A 5G0VA 3KYJB 1ZXXA 3T5TA 4DQDA 1UJCA 4MWBA 4LYDA 2XZDA 1H93A 2XNDA 3DHWC 3T3DA 5EHXA 4G1CA 4D3XA 2WHQA 3RSZA 1JDZA 3LUGA 1VQ1A 5BXQC 1SBQA 2H92A 1KY3A 2HJRA 3A8TA 4YMIA 5DXJA 3SX0A 5EPOA 5BWBA 4URYR 1IUNA 4R1OA 5F7ZA 2OHGA 3PR1A 2PZLA 1WB6A 1EFCA 4J0GA 2IEDA 3WGVA 1T4GA 4NJOA 4ND8B 3ER9A 1U0JA 3NBQA 1EFHA 2F4VB 1CLEA 4XGNA 2OCIA 4IO0A 4P1ZA 1FC0A 5CLGA 1R5BA 1D2EA 4PFQA 1PZHA 3DZKA 4IILA 1ULSA 3X1KA 2WUFA 1Z7EA 2B8NA 4HAIA 2GPNA 1M2FA 3GP8A 1HYQA 4O4JB 3KXDA 5DBGA 3EA4A 1T2FA 3DMNA 3D0RA 1K8YB 5B2ZA 3WMGA 3H0EA 1PJLA 3S28A 3JZAA 1ZCJA 3OKPA 1O1YA 5DWDA 3LXMA 1QZ3A 2DECA 4BEBA 3TYXA 4WZBB 4BRSA 4LX8A 3EAQA 2VJDA 1M2OB 1NIPA 4CKCB 3WKAA 2DPHA 1NXWA 1EFRD 3OT1A 2BE9A 4BO2A 3QUQA 1YZGA 4BVHA 1K97A 2NU6B 2D3WA 4A5OA 4ZU3A 4X95A 2V45A 2ZVJA 5J63A 2O0JA 3D0QA 2FR8C 1VLZA 4R8KA 3T4PA 3NAQA 5BSEA 3A70A 3AEYA 4Y2PA 4V24A 1QTQA 1B16A 1HE8B 1C1YA 3QNWA 1VSVA 5IEJA 3EPPA 4LJRA 2FAXA 3K7EA 3BJIC 5ALOA 2I34A 2AFHE 3UWSA 3HSKA 1G63A 4K28A 4LNAA 1FDRA 2JIQA 3I9V6 5D01A 1L5HA 4GICA 2P2SA 3JAKA 1G5IA 3HRKA 3VJKA 2HBQA 4YYZA 4YCBA 1KERA 2JH8A 3HPQA 4NU8X 4FYYA 4UTOA 4YECA 4Q15A 1BJRE 2HCJB 3HVIA 3VYUB 4DG9A 4BLQA 4JCOA 2Y8EA 1UJMA 3DDHA 3L8CA 1L1FA 4HGOA 2MIIA 3QFCA 2BSAA 3VTAA 3WNDA 4EAQA 3NHMA 2K7ZA 3TZEA 3ZVNA 1P81A 2WFZA 5DXAA 5EE1A 3SKYA 2XNKA 3LKVA 2BWJA 3O1LA 3NPAA 3PUJA 4Q3KA 2WOOA 3GYGA 2AT1A 5FI5A 2BFFA 4ZHQA 3ENWA 3GRVA 3GDHA 4MRRA 4HPXB 1DQYA 4H6PA 3B8HA 1T2DA 1UBKS 4L08A 5TIIA 3JQ7A 2E3JA 4GM4A 4MI9A 1S9DA 3EIFA 2JHAA 4QOFA 2HGSA 4YBZA 1BA3A 1GTZA 4OXQA 1A9YA 2JJMA 3P96A 1XYGA 4O1MA 2Z2ZA 1KAMA 5FPPA 1RLMA 3EQ8A 1FUKA 1Q1AA 5TPWB 1RP7A 2PMEA 4RA6A 3DTTA 5EINA 3OIDA 2UZ0A 1LVGA 1TYEB 2GILA 4A36A 5AQEA 2ZYUX 1NDHA 1Q1ZA 1QP4A 1QHXA 2FDCA 1JKJB 3AKDA 5AIAA 5T57A 3RU9A 1NNEA 3ASUA 1XLTC 4UDYX 2JGKA 3CF4A 2XEDA 4MH0R 2LV8A 3LUPA 4WQMA 4EYOA 4E51A 3L8DA 1CT9A 3F4BA 2YHUA 2CL7X 3HJGA 2OOSA 3IDZA 3EZ2A 1M0SA 1OYYA 1W5TA 4JI4B 3AGQA 3W6ZA 4JL8A 4WW0A 1GN8A 1GN9A 1RKBA 2CLFB 4XH9B 3CC8A 1YFLA 4WI1A 3EZ7A 2NWQA 1J23A 1DDGA 5FV4A 1Z34A 3GGDA 3MOIA 1R74A 3VVCA 1HFWA 1PSWA 2C5HA 2RBGA 3HUTA 3B20A 3HWRA 3DT6A 4G25A 4M98A 2J9XB 1JZSA 3P2IA 1XNGA 3KT6A 2VBFA 1ZH4A 5FT9A 3TZQA 5GZ3A 2J0QA 2EKQA 4D9BA 3EIQA 3NBAA 4LOHA 4DSUA 3IDAA 4M0CA 4O29A 1H2AS 5AW5A 1E8DA 3LGAA 5LDHA 2NQ2C 1SK8A 3OEWA 2XAAA 4GP9A 2AFIE 4XWTA 2FSVA 2GLXA 4NMHA 3N2GB 3WYDA 4DILA 2JIBA 4G1MB 1DAKA 1G6KA 1Y7LA 2NTEA 4N82A 4QXMA 1ESMA 2B21A 4IQGA 4XYGA 4JLNA 1EB8A 3T9CA 2IYYA 3VKVA 2BTQA 3X44A 2H7XA 5F7OA 4UEJA 3PVCA 5ICFA 4EHNA 2HJSA 5BVHB 3L49A 5HS6A 4BTEA 4KU4A 3LO5A 4JUBA 3UMSA 1HFKA 1GTSA 2IH5A 3MAGA 1YVDA 1PNQA 2WAMA 3PJFA 3EGCA 3THYB 2ISCA 1FW6A 4BAUA 1I0LA 4E4YA 2IHKA 2IVFA 2C1XA 4IOKA 3RS9A 2ODAA 3PQ4A 4MZXA 1YIOA 4OQLA 2BP7B 3TLJA 5KQGA 5KX5F 1KMHA 4N40A 1RI4A 3R41A 3GLFA 3KFXA 1H8HA 1RM5A 1Y3FE 2PKXA 3E15A 2XSZD 2XCSB 2A59A 3S68A 3M2TA 1ADGA 2ZRLA 4R2KA 2A4MA 1TCCA 2DX7A 4OQXA 3AI3A 4RENA 3W78A 3MAAC 1XEXB 2Y9PB 4CKZA 4KNWA 4LWZA 4URUR 2HHLA 2DXIA 3VX3A 3WAKA 4LZPA 2GK6A 4K9NA 2EHDA 1BX0A 3SZMA 2ZRJA 3PZRA 1SIBE 3VRHA 3FHJA 4PZ9A 4Q4AA 5AKHA 4C3VA 3B1WA 1I36A 1O5IA 4P3KA 1NM5C 2P79A 1FS6A 5TSDA 3S40A 2XITA 3KJGA 3VFDA 5M29A 1W7AA 1N1EA 4K46A 5BN3B 1N78A 3VGJA 1OKKD 1IL0A 2C58A 3GJTA 4PLHA 2ZJFA 4C22A 3T1NA 3UENA 2JVIA 2QAJA 1T9ZA 1ZN7A 2WD8A 5I4IA 3G2MA 5L3VA 3LZDA 2RK4A 3QE9Y 3G49A 3GJ5A 3HSSA 5KTTA 3RJTA 3K8YA 4PZAA 1LCIA 4J49A 3LCRA 4F60A 4XRRA 1U9CA 2OGZA 3ZOKA 3Q3HA 3QXHA 1YE8A 5EHIA 4X1IA 1SRQA 3WGTA 3PB3A 4RS4A 1TEVA 1Z15A 1M73E 1OZFA 4NEQA 2P5TB 1XD8A 2DPMA 2XWQA 4QL3A 3ZOZA 1R9JA 3KP1A 5IKPA 2HPHA 4TT3A 4M1QA 4H4EA 1M9NA 3DBRA 3K96A 1QPBA 2Q4DA 2ZB8A 1G0NA 2AD1A 3UBMA 4EH1A 2R1VB 4QXQA 3KQWA 5BWOA 3MGCA 5IYZA 5KWVA 2IP2A 1ULAA 3JVIA 4LQDA 1ETHA 1NQVA 3CJRA 2N75A 1ORVA 2DBZA 2D3TA 1GV0A 2F6RA 5CT4A 2XQKA 3RFUA 3RV3A 3UAWA 1PGQA 4LYJA 5LWQA 3UB4A 1LJ8A 3EB9A 4Z6KA 5CAEA 4JH0A 3ROFA 4CIDA 1Z88A 2G0NA 2G4CA 3DR3A 1JBKA 3OUZA 3U16A 2AUTA 3GJ8A 1QHHA 5A5EA 1TADA 3K6SB 5HE8A 2P2GA 2MT9A 3JQBC 5G0SA 1VB5A 2GBPA 3LT2A 3PCXA 4NL4H 1Z7BA 1QF6A 3D54D 2APJA 4MULA 5DRTA 3BREA 3OESA 4ERXA 4KQ9A 4NG4A 1NF2A 1CUVA 1UFRA 1VDZA 4CIAA 4Q1VA 1C3XA 1SCDA 5EIBC 3F8WA 1Z4NA 1I51A 4H1UA 1ZOIA 1IONA 3GR6A 4YRGA 1P1FA 1OLSB 1TIKA 2P4QA 3DVSX 3H1TA 1L9XA 2NXNA 1Q50A 2GQ0A 1JXMA 1G8HA 1CUBA 1SBNE 3H75A 3OX4A 3PT9A 5E1MA 5EI5A 3ZXIA 2CBGA 4D3FA 3EGDA 4LQCA 3CF0A 4RK7A 2ZWOA 3S1AB 1XMXA 5EKDA 4HFMA 2QRHA 3UMFA 5HZKA 1ZAYA 4KE7A 5E2IA 2C2KA 1CQIA 1R2QA 3QV1A 3ZTWA 4C6HA 1VHJA 4FJ0A 4QDJA 1DBVO 3JD3A 4IGFA 4Q3BA 4XM2A 2UUPA 4KPGA 1GSOA 2CJPA 4OJKA 4QJIA 1CY6A 1FPMA 1RRVA 4G56A 5EWLA 3BORA 2Q6IA 3RC1A 3VAYA 3NHPA 1HEYA 4DQ0A 2E9SA 2OHHA 1L0BA 1QZUA 3ZY3A 3BUSA 5THXA 5DTEA 2BZSA 3LC0A 3P5SA 3HFJA 4AP5A 4F6RB 2E4WA 3CWCA 4MUFA 3KVRA 1YULA 2J85A 5C7LO 2NVOA 1Q14A 3CT4A 3LTNC 4RVGA 3VKHA 2J41A 2V6BA 4I2VA 3O82A 1FJGB 1U9YA 3ESQA 1JLHA 1BU8A 2LRHA 1U9IC 1V7PC 2VZ0A 2H06A 4Y0AA 3ZX4A 4RFSB 4B81A 5JEDA 2E4VA 5F1PA 3DAHA 1P8AA 1SEVA 3F4LA 1A5ZA 2QX6A 3HMKA 4MGIR 1LJLA 4YV0A 3KZOA 1T0HB 4RCZA 1W88B 4UHBA 2Q1WA 1GARA 3GD5A 2E55A 3LBIA 2C4TA 5H3HA 3WK9A 4JEUA 5IWAB 3PT5A 1YS9A 5K09A 1KTIA 2GRJA 4N5DA 4UOEA 4X8MA 3C24A 3U5TA 4LSWA 1DCKA 5LMUB 2QL6A 3UA3A 3UK2A 1I7LA 3A3OA 3P9IA 1AV7A 4N0PA 2HJHA 2Z3VA 4HDRA 3I28A 1B8PA 3N0RA 2PUFA 3JAWA 2BEVB 1I80A 3LSYA 2GXAA 2Q7XA 3R76A 4WXYB 1Y0BA 2E2WA 2GCEA 5AW8A 4UFNA 1Z0DA 5DTMA 4DM3A 5MF6A 4XWAA 4HYQA 2BF7A 2WIDA 3OO1A 9MHTA 1YS2X 1YQGA 1R27A 4IX1A 3WLAA 4ACBA 4DLZA 4JJIA 5KPJA 1U0RA 3LK6A 4MUBA 4ES6A 4G67A 5T6MA 4JYCA 3T7CA 2FWBA 4GWGA 3FY4A 5E0KB 3JZDA 4IIEA 5CFQA 4TWZA 1RXSA 4W9MC 4WNAB 4D81A 4F8JA 1GPMA 2VDJA 3LF2A 1E1YA 3NMUF 3VDMA 2Q3CA 1CKEA 5BO5A 4QJ4A 4QLOA 2V4MA 3QXJA 3LCVB 1BCSB 3PXEA 3VOTA 3UPTA 4D82A 1ND5A 1IIBA 1WR8A 2R4UA 3ZI0A 3U6KA 1GNPA 1QVVA 1Z4QA 2FG6C 1V95A 2BN4A 1WEKA 2W2VA 2WIJA 4CMEC 1YV9A 1P4JA 3NIGB 5IUNC 3EPKA 2ZJBA 3MA0A 4FBMA 4K8RB 5AOCA 3BWMA 2ERYA 4XIYA 3VKGA 3D3EA 1R66A 1UXHA 5KNLA 1EUDB 3QA3E 1TQ4A 1RRMA 4ECAA 5KNBH 4L8GA 3CH5A 3BOSA 2EX4A 1RS0A 2EZ9A 1TIPA 3SC6A 2PSEA 4Q93A 3TSCA 2VPTA 3HNRA 4IFTA 5HRCA 4X84A 2PX4A 1TA0A 4P22A 1LU9A 4W6ZA 1U3FA 4DARA 1Q57A 5E7JA 4ER6A 3GEGA 3ELDA 3M5WA 4YLEA 2C4KA 4NHOA 3M6AA 3AEZA 1OA1A 2HU8A 4JEIA 4MI1A 4H0FA 4X94A 2JBAB 3UA4A 4F9TA 1SD1A 2J3MA 3FNEA 4AJPA 2OC4A 4MTCA 3ICOA 3BEDA 1A8HA 3B1XA 1K2WA 4MINA 2X9GA 3PFFA 4AK9A 3ZYZA 3CF4G 2BGLA 1F4PA 1Y5IA 3CCFA 4B46A 3LQRA 1AKMA 1ZI8A 1AUPA 2OQIA 5JSYA 4ENTA 5C18A 3HO1A 4FE4A 1BH6A 1H2BA 2Y77A 1HK7A 1MENA 1ZJ4A 3ADOA 3AF1A 5TXGA 4KWHA 1IHDA 4I6GA 1CEQA 1UPXA 3PYMA 2OA0A 2C5EA 3T9DA 5T3UA 4OV6B 4PIMA 3T12A 3I9OA 3C6YA 1VE1A 1JE0A 3HKEA 4NMXB 5A7HA 1T3ZA 3E18A 1P1JA 2QVCA 2B7LA 4OHRA 4JEMA 1WMFA 2YWGA 1GGMA 2FRDA 3M70A 2QG4A 2J59A 2TMKA 5JTUA 2Q3HA 1N6OA 4YIKA 1UJBA 1JSZA 3UO8B 1E4YA 3ACCA 1J2JA 1L4HA 3DLPX 4DR4B 3IDQA 3ROKA 1XDUA 2YL2A 1MAVA 2YXDA 3HYTA 1B6GA 1VYTA 3GZNA 2UXDB 2DBYA 3MWDB 3P52A 4B4OA 2EEPA 1LI4A 1ULZA 2PR2A 3G13A 4FMCF 2NUPB 9GPBA 3EOZA 1KARA 3FRIA 3VR4D 4Y67A 3VTFA 2ASEA 1KAHA 5JPIA 1XXHA 1A8PA 3VC1A 1TEHA 3F46A 4BBZA 2VSYA 1ESZA 1E2QA 4I50A 4C30A 2HNKA 3IP7A 5L3QB 5FQNA 2HMSA 2C2OA 2VYNA 4ZICA 4WY8A 1ZX1A 3CJTA 4KW7A 1KP9A 1ULHA 3SYLA 4G5RA 4MK4A 1KDPA 2FJUA 4PFSA 5CB8A 4BPBA 1GDTA 3TE6A 3PSAA 4BIIA 2MYTA 2EKZA 3SEZA 4CMAA 4IIYA 1L6IA 3L7OA 3UHJA 4DLAA 3T7AA 2OL4A 1GGJA 1C7QA 5EMJA 1E1QA 4ND3A 4D3YA 3BL5A 2YKGA 1FBNA 2C5GA 2OORC 1R4MB 1PFKA 3TBHA 1A27A 1UBTS 1MUUA 5BW4A 2O0MA 3MMNA 4FFNA 1QZXA 4X3PA 5ENZA 4QUEA 4OIMA 4CUZA 2WVGA 1PFQA 3BJEA 4YLGA 4RD1A 1M6HA 1UOPA 1P0FA 2NG1A 2GKSA 3IS3A 4ARUA 4JN6B 2E89A 2E21A 3R3UA 1QOPB 3KKZA 3R5XA 2RB4A 4D5GA 2HZ7A 2NZJA 2OGTA 4FOLA 1UT8A 3DVQX 2GCOA 1KI2A 3FDXA 2FMFA 1TMOA 2RHGB 1ZITA 1SA0A 2O8NA 4LNHA 1SUAA 2RAVA 3MUOA 1R6TA 2FRVA 1TUBB 1KI3A 2AJ8A 3O21A 3N2ZB 5T8KA 4K6OA 3GA0A 2F7SA 2Z2IA 4WY2A 2XY4A 2V8OA 3QUCA 4ZZ2A 3LNCA 4NOJA 4C0WA 5C1OA 1YNSA 2KBEA 3G79A 1E4EA 3HVKA 5DYWA 2BFCB 4D9JA 3PTAA 5IT0A 1KMQA 2VQSA 4IINA 3JQFA 4KP7A 5SY9A 2H1HA 1ISGA 2HLDD 4R0NA 7REQB 3E9ZA 3EFOA 4HBZA 5HCIA 2QPLA 2YDYA 4MS3A 3Q11A 2XOEA 4KH0A 1UP4A 4JOBA 3TRIA 2V4ZA 1HXHA 1V3QE 3RVLA 1L7NA 4EG3A 1OFGA 2A88A 1FVXA 3DV9A 2A9OA 3N5CA 2P7IA 4NI5A 1LX6A 1SC9A 1LW7A 1GUDA 4AO6A 5ALFA 1NPTO 3BFJA 4GI2A 1K7FB 1BHO1 3QQPA 2A1TR 3NOOA 4JZYA 1KIMA 4L0CA 4N49A 3VVMA 1X80B 3EXEA 4KUGA 4ARAA 5L3SB 1QANA 3MRTA 4RJJA 4Q16A 3ZWNA 3BXFA 5MGBA 4I9FA 3LWNA 5TQ0B 2GAAA 2P9JA 4ZVLA 3HY6A 1N7HA 1XAJA 1ZUWA 5C1IA 1A9XB 4EYKA 1JQ5A 3PE6A 2MINA 4OMDA 5AKJA 2KE5A 3LC7O 3U6BA 1THZA 4HMPA 3UZUA 3WL6A 2VA8A 1BNCA 1YRBA 4L51A 2I76A 3GCZA 4QGFA 5BQ5A 5BSMA 4M46A 4WFJA 3PQCA 2VPYA 4KTTE 5IBPA 4NBSA 1J22A 1SNYA 5E9AA 1KQ3A 1I9CA 4IBOA 2JAPA 5LZ8A 1FQWA 1KL7A 2XB8A 2RGBA 3DQQA 4BUCA 1YRHA 2OXFA 1LC0A 2VXCA 3RUIA 3ZPXA 3ETNA 2I4MA 4LGYA 4C6SA 3I61A 3EDYA 5C8XA 2O2SA 4PSUA 5BVGB 3GLGA 3J7AC 1Y1QA 3R40A 1II8B 1ZKMA 2VNHA 3VSBA 4EG7A 3FUUA 3WGOA 2I9KA 3NONA 4P7JA 1RYNA 4DCPA 1A7UA 5E4FA 5KQLA 1P6XA 1VLLA 4IUCS 5BN5A 3UT5A 4A3SA 5EYPA 1VE9A 3ZI4A 5FPKA 3C85A 3GBVA 1QCYA 4Z4FA 4QASA 1WHSA 2YS6A 4BZXA 4B6GA 3TMAA 4LFAB 5AVRA 1V48A 1CNMA 3CKKA 3CXRA 1XL0A 4XASA 4AY6A 3P71T 1A1VA 4B3XA 1F4VA 2C0CA 2C0QA 5C5DA 4MKIA 3VMMA 2RH8A 1ECPA 1TEZA 3JQGA 2C8LA 4O1IA 1A76A 2VDVE 1BDJA 2WRZA 3BJRA 3FUVA 3NVDA 3C6MA 3OE4A 3W2TA 1Z13A 4CKYA 3RREA 4RWZA 3ZVRA 4IWYA 1JIKA 1JMKC 5FR2A 1GPNA 1E62A 2VJCA 3ZDZB 1F6DA 2G71A 3DF7A 1LTQA 2WJAA 3ENNA 5EKXA 1SUBA 4Z3DA 1BYIA 5DI3A 3A3KA 5C9ZA 3LPAA 1RSZA 3KJNA 4DNPA 1GAWA 1XRRA 3BMXA 3O7MA 3CB2A 3UV3A 1L5FA 1YH3A 2YC4C 3E53A 3NUQA 5ESXA 4UMDA 2C7QA 4TKMA 1FTQA 5C51B 1QXSA 1DLIA 2W2MA 3U4CA 1P6UA 3I42A 3PPXA 4ZT6A 3UUFA 5B64A 5M7EA 2XBLA 3CFYA 3IKJA 2Q8QA 3R5HA 1J0DA 1DAFA 3TD9A 4TXLA 1PL0A 1MHPA 1H1LA 3Q40A 2HMWA 3A0UA 1AUVA 1LBSA 2DE0X 4FMPA 1BVHA 1XCGB 2ZRIA 1EWYA 3MCWA 1Q20A 1I1NA 4YQEA 2O8DB 1KK2A 1PQ4A 3ZCXA 3CVWA 2CV1A 4GW3A 1DXYA 3WAJA 1ECLA 3K5IA 4JUCA 4EHAA 1KMNA 1Z33A 4D5EA 2EJUA 1HNXB 3BT7A 1R0SA 3KELA 1QH1A 2ILTA 3I64A 3IKMB 4WWHA 4ALKA 4ND8A 4AY5A 3QOWA 4PCUA 2ZYHA 2C9DA 1FBTA 4HZUB 2R4TA 3VA7A 4U2GA 4URXR 3HJAA 4JJ4A 1NUSA 1IBRA 1AG9A 2NZ2A 4RPIA 2WV9A 4JYPA 2X9LA 1XDWA 4AN1A 2J5QA 3O2QB 1TPYA 1VMKA 1SUDA 3I6QA 4HH3C 4O4JA 3KUXA 2GPAA 1TRHA 4QU5A 3U3XA 2ZTUA 1RABA 2GRAA 2O2JA 1WKBA 2JZOA 3EZNA 4GYJA 3WNZA 2OLKA 1SVLA 1JLKA 1VLQA 4WZBA 4DJJA 3VHQA 3ROGA 1M2OA 4ZT5A 1XYYA 1NJ2A 4LV8B 4BFXA 1BU5A 1S6YA 3OE7D 4OQNA 4R6WA 1EFUA 4DTIA 1SVUA 1QRTA 4H1TA 3PWZA 1NBEA 1Q7BA 3PGLA 5TR9A 2BM0A 5DCUA 2H1SA 2NU6A 2ZJ3A 4IJQA 3SGLA 3EMBA 3GMIA 2QE7D 4M0FA 2NXCA 4Q1BA 1OTYA 2RAUA 1SKAA 3QIVA 1C7JA 3LU1A 3D2AA 4MWTA 4E1VA 5CCXA 3PDWA 1BEUB 3M5CA 2HF9A 2ZJ6A 4NNOA 4LYFA 2M6KA 4ZT4A 4B8YA 4P3YA 3N0TA 2Q45A 1DJOA 1ZH6A 1VI6A 3E84A 5JQGB 3QMVA 3GMSA 3K0FB 3BTUA 1TVEA 3C98A 1WMEA 1QYXA 3N6RA 4INPA 3DBLB 2DG2A 5GONB 3ZE8A 4PCLA 3OX3A 3PC7A 2AE1A 2FPUA 1MF7A 2P30A 3A9UA 4MWEA 3UAZA 4JYZA 1QJCA 1Z2NX 3KCNA 3DDCA 4HUQA 3KDAA 3F6SA 2OLJA 4IICA 4G81A 3SYMA 4IVQA 3N87A 5BQXA 3GY0A 5MGNA 3UK6A 4QVIA 4PZ0A 2C9YA 4BMNA 4MDEA 3TW6A 1IEXA 4NEGA 4LJ5A 3PZBA 4KQHA 5E4TA 3SZ3A 5TLSA 3GYBA 1S3IA 1YFZA 2OFWA 3DOEA 2GM3A 3ANNA 3LLMA 1TJ5A 3W5HA 1NVAA 4L4SA 3RJMA 3H19A 3V8MA 5A62A 4M8SA 4HVTA 1P7CA 2AYYA 3DPSA 4PYKA 5HBRA 3RHTA 1PNVA 2CE2X 2QU7A 721PA 3UYKA 2D5AA 1W581 2IOYA 5TPWA 5DHSA 1G7TA 5LZ7A 4EYQA 4E4RA 1FXWF 2BDEA 3O2NA 4CZ2A 1ZQ9A 4PRKA 2OYCA 1JKJA 4OPMA 5FNVB 2BFEB 5AJYA 2IHVA 3QWFA 3HEBA 1CS0B 4EF4A 2YFYA 2H85A 4LRQA 1GZVA 1JU9A 1FRNA 2XUPA 3QVGB 4BMYA 2VIIA 4YMLA 4ZCIA 3WG9A 4PBTA 1WXHA 3TR0A 3QVTA 3UAVA 2O7VA 1ULUA 4L6AA 1ADJA 4YAKA 3IEMA 4DLNA 3JVEA 4MR8B 5G0TA 4CGYA 2CDCA 4NSNA 5JD3A 4FGUA 1ISSA 3E8MA 4W82A 1RXVA 2CF5A 2G1JA 5ABPA 5DOZA 2I6GA 1EEHA 1VE3A 2C2XA 4J3JA 4GL4A 2OG2A 3EGIA 4WTOA 5ER6A 3LVQE 1M66A 3D6UA 4MQ6A 4EFDA 2PPVA 4O4LF 5L53A 1WM1A 1D5WA 1KYQA 1NNLA 1U31A 4LV5B 4YASA 4YP7A 1VL0A 4LSMA 3TLAA 7GPBA 4IS2A 2OMKA 4GPBA 4DABA 2UVQA 5AHWA 3DO5A 3W77A 2IYSA 2E5WA 1AQNA 2AJLI 4ZARA 3GFFA 1DOHA 3K09A 2HJWA 4ZDIA 3OIUA 2PS0A 1JQJC 5A5VA 3R3SA 1X19A 2RK3A 4TV8B 4WOJA 1N2JA 2G8NA 3HCRA 2R6R1 2ZRPA 4BNZA 2CSUA 4C78A 5BVHA 3HU5A 2AUMA 1ZIDA 4Q02A 5BURA 2V3CC 2KWIA 3I9KA 4GI1A 4REMA 3KQNA 1VL1A 2O4CA 2R5NA 1XCJA 1FTWA 3L2OB 4HB0A 2W8ZA 1I3MA 2NW6A 3OFVA 5CJPA 4HCJA 3SG0A 5A06A 2DT5A 4LECA 1ZYUA 1I0IA 4L5CA 2BP7A 1KNXA 3WL8A 1U5AA 1JG6A 3TB6A 5AVJA 4W8OA 3VZCA 3K71B 3L7JA 1FSPA 1FTNA 1YIAA 2M2IA 3VPSA 4GX1A 2RFLA 3RTAA 4FMDB 1F7VA 3WKDA 3WYFA 4I5EA 2VJBA 1QJ4A 1K6IA 3HDHA 5HJ7A 5HF5A 4CCSA 4RHEA 1XEXA 3AZQA 2ACWA 3P0HA 4MO2A 1UXJA 2AXPA 2WTMA 4WMLA 3FNHA 4CM8B 2NP7A 3PS9A 5J43A 1OPRA 5JUWA 5DHPA 2OXTA 1WMAA 1RM3A 4WUTA 2C96A 5BT9A 2GX6A 3BDIA 1BEEA 4MR9B 4TTJA 1NW6A 2BIFA 1BGWA 4MDFA 4HNAB 1ZG3A 1CEXA 2PYDA 2B1RA 3PPWA 1MB3A 3WGKA 2OAQ1 3ND8A 2O5CA 1O94A 1DKLA 3GO4A 5BN3A 4DMLA 3NBYC 4M0EA 3LSTA 3G9QA 2I1VB 1O89A 4F7DA 2FE4A 1GCAA 3NBXX 3VNAA 4R1TA 3KUCA 4RV4A 3L8FA 2R6FA 3NG1A 1PR2A 1U3GA 2CNWA 2D74A 1C9YA 1KAOA 3B78A 3I0ZA 4BNJA 3L82B 4GE0A 5HK9A 4XD7D 2XIQA 1UFKA 1YZFA 1YRWA 4KQKA 1R9GA 1M6EX 3SNKA 3EPLA 1G0OA 2BHSA 1UKVY 2MYPA 1E9BA 3EVAA 3HHEA 4Z9XA 1A7KA 1LQTA 1K66A 3BGIA 1HTBA 1Z06A 3CUEF 3TTXA 3FHLA 5LYJB 2BRUA 1GEGA 4BTLA 4EA9A 4G0VA 4AUMA 4BY9E 3PGJA 2LCIA 2R97A 3C6XA 2R1VA 4FGLA 3HYRA 4MA4A 3GLIB 1NDUA 1TZMA 1NRXA 2R5WA 1UC4B 2TYSB 2VQDA 2IUEA 2SKEA 1W4BA 3KT3A 3NI2A 2PGNA 4JUFA 3RVDA 2QTRA 3AM1A 1VLMA 2VRNA 3M5PA 1DC8A 3Q1KA 4AYWA 3BB1A 3QLUC 4BEJA 2YHAA 4ETMA 2AN3A 5LIPA 4KMRA 1AUXA 1MHTA 2Z2KA 4RAOA 5ICEA 1JAYA 1IAVA 1K8XB 1THMA 2I9PA 2IYEA 2VAMA 2VZLA 3DC2A 1O87A 1RAHA 1X94A 2FPSA 3LBHA 2HA4A 3G6KA 4B40A 1CEEA 1MGOA 1SUEA 2Q7OE 3GUCA 2PFSA 3WY9A 2AR9A 4HQRA 1F6BA 1PJ8A 4KAXA 1GPBA 2R7AA 3QVOA 4UNPA 4G63A 4UEKA 3GLUA 1QKKA 1WAMA 2PA0A 4Q7QA 2IYZA 3OMXA 1ONNA 4NIMA 1WUJS 2DH6A 4EO9A 1EVLA 2QZ4A 1JKIA 2VXYA 2P2YA 3HZHA 4XWKA 2V9CA 1QO7A 1RLOA 4I5DA 4UC0A 5BRAA 4LJSA 2QJOA 3CONA 2GFHA 2HRQA 5KINB 3N2EA 3I0NA 3CB4A 2J3JA 4HQOA 4BKQA 3ZK7A 3PL5A 3QNUA 1WY7A 4RVSA 1GGVA 1W4RA 3P2EA 4Q0MA 3S1AA 3SE7A 3FKQA 4BJ1A 5L7TA 4RIGA 4TMWA 4E5PA 5J58A 1AGPA 1ZM3A 2VRCA 3KVNA 4IYRA 4L8YA 4LDAA 4QBIA 1XZNA 3P2YA 5IHPA 1IOVA 1RWXA 2D00A 4BFYA 4NESA 4DLWA 2ZCJA 2REQB 3T9FA 1YZVA 4NYJR 2QXUA 3PPVA 1D04A 3NBKA 2ZYSA 1I3CA 4Y2RA 5K6AA 5J1SB 4F6RA 1DAOA 3TJMA 1FIUA 2DYKA 4XGKA 5ECWA 4QQFA 1AHIA 2H54A 1P2SA 2R1ZA 3FNQA 3H2ZA 5INTA 2OBNA 3MD9A 3NAZA 4OG2A 4XA8A 4B2PA 3PNMA 3E7PA 1K7EB 4RV5A 4UM5A 4LHEA 1JIVA 2P2ZA 1Y8RA 2QRKA 4LRWA 5E3HA 3O83A 4BVLA 5BMOA 5J4YA 2PZBA 5JCJA 4CM5A 1KP2A 3PQ7A 3IL2A 2IU4A 1EGAA 5LFAA 3ZD7A 1NGSA 3LCUA 2AV6A 2X0EA 4AJ9A 1W88A 1KH1A 2BE7A 3WV5A 4TTVA 4FZ3A 4CIXA 1EB9A 3Q8KA 2QX8A 3GLTA 5EIBD 4CDGA 2GXSA 4A2PA 1U9JA 4JK3A 5LZ9A 4W5OA 2A5GA 4JU8A 1TKAA 4I1VA 4L9SA 2C9CA 2FOXA 1XNHA 4LG1A 1GFWA 3A1SA 3FNFA 3TFWA 2I7TA 1CWUA 3GQVA 1SOMA 1ZHOA 3CHYA 3ZVKA 1W52X 4C06A 4DCCA 1HYGA 1Z7YA 2GYYA 4URFA 1H2FA 1E2PA 2BEVA 2JB9A 4H3KB 4MUYA 3K9WA 4XDZA 5CX4A 2W7TA 3ANMA 4NU5A 3PNLA 3EW9A 1Y7IA 2P9HA 1EVYA 1X1AA 3BMCB 4QYWA 3RS3A 5EE3A 1DOZA 1QMGA 1U7DA 4CMHA 3DF9A 3M83A 1RCTE 2HMUA 3O0TA 3B12A 3GLQA 1D4ZA 3N2YA 3EODA 1ZD1A 4F1JA 1D6MA 2Z5VA 4QDKA 3BMNB 3OLWA 1VPVA 4KO1S 5J5VA 1ZM2A 1KFBB 2QX4A 3MWGA 4FS3A 4H77A 3LJKA 4O4HB 1MOPA 4P4SA 4HAZA 4WNAA 3RH0A 4CLOA 5K45A 3E1GA 1WQ3A 3KEGA 4L8VA 3JQEA 4G5HA 4HDAA 3K6KA 4WBNF 4LUCA 4LF5B 1JB1A 3FMGA 3NGXA 4JASB 4L8LA 5FA8A 1XO1A 2R11A 1EI9A 4OBXA 2NTNA 1BCSA 1T3GA 4DV7B 3SBOA 2CUKA 3FWPA 3K0EA 4GT1A 3VV3A 1QOQB 1DKQA 1XALA 2Z08A 1BZYA 2R8XA 4PZLA 2CXQA 1H6AA 1IHUA 2AQKA 1XJCA 3QEOA 4KE9A 4OK6A 1C9MA 4RX1A 2E6UX 3W06A 4N48A 2R48A 2KHZA 2DHQA 4PTYA 3V8PA 4YT5A 2JJ1D 2JEYA 1P6QA 5TY0A 1T24A 1RHUA 4RY9A 5H3LA 2AZMA 1EUDA 1GTL1 5A04A 1UWKA 1D2CA 1P1RA 4Y1RB 1QIFA 4GMFA 3R7BA 4F46A 4B85A 2Q0QA 4U2FA 1CQJB 1Y1PA 1WUKS 3HP7A 4TVBA 2JGEA 3GFPA 4UHDA 1PZXA 1WIWA 3SD7A 1VJ1A 4DMKA 5JCOC 2O3SA 2DPGA 2Z4RA 1G8JA 3RC3A 2YOHA 3LD9A 1BXRB 1Q17A 3EW7A 3M6XA 3MW8A 5I7VA 3PLAE 3N8GA 5CUQA 1NX9A 3A1VA 5LDDC 3FIUA 3A28A 1BVYF 4QELA 2HO5A 2DU8A 2RIRA 3WWPA 3AOEC 4AJLA 2JBAA 1Y8QB 3BPSA 3PEVA 2FCRA 5EQDA 4EJSB 4OX9Y 3PD0A 3ZW8A 3IDSA 4B84A 5GOZA 4I4TA 5FFNA 1B3RA 1L8AA 3OTQA 5LLTA 3ME5A 1RC1A 1AQJA 2PUBA 4CTKA 4LV6A 4WLOA 2PMWB 1SULA 1JG2A 4ZQIA 3SF8B 4G5FA 2JPDA 2QTTA 5IS2A 4XWYA 5AXAA 1EUQA 4F0JA 3EFBA 3RTDA 3AFHA 2B4TO 3AV3A 4K5QA 4J3NA 3WDKA 4KFSA 1Y8ZA 2PS1A 3MN1A 3SS8A 1RYFA 3F3YA 4PG4A 1M76A 4QEKA 4Z0HO 1GAEO 1YMVA 1NRIA 2HY7A 4PNHA 4RL6A 5DI9A 3WS7A 4WRRA 3ANTA 3AVUA 1K5PA 2PH7A 2JVKA 3U44B 2I0FA 1XZEA 2WAAA 4DJAA 4RTRA 1SHLA 3M6WA 2CXNA 1OU0A 3MOGA 3MTEA 3Q7TA 4G4IA 4HDQB 4YCNA 2ZRQA 5C80A 2PKYX 2QTWB 1VKOA 4CR6A 4GAEA 4IO1A 1QB7A 1IY2A 1N9GA 4EVQA 3MWDA 1ZL2A 4BB0A 2VTBB 3I53A 3UQZA 2WWFA 1JR6A 1REQB 2QLJA 2JGIA 2QQGA 4QHYA 4RZ2A 3AI1A 1UFOA 4WASA 2NUPA 5JNVA 1NVVQ 5COBA 2BMEA 2PQ0A 4N5NA 4I1IA 1TU0A 4EG0A 3FLBA 1O77A 3L77A 2WUDA 4GS5A 1FYXA 5JBNA 3HEAA 4IMRA 4OXXA 4AUEA 4ED9A 4GU5A 1MQAA 2J1LA 2ZSIA 4EYSA 5HIAA 5EZQA 4QDUA 1LRKA 1P7PA 2BKVA 1M1YB 3IP8A 5TVKA 4ZREA 4GPD1 3UMRA 1QP7A 3LX6A 4LHXA 1N5KA 2EBHX 4ID9A 1M1XB 4JR1A 2A5JA 2HSGA 4FP9A 3AR6A 3DOOA 4G1VA 4PSKA 4DYHA 2GAOA 5C8VA 1E98A 1ORHA 1QC5B 2O6LA 3D6MA 2WDZA 3SZRA 1XTKA 3V9PA 2XOKA 1B6TA 1NX6A 2JBHA 5EPEA 1ZMBA 4MARA 2JBWA 3K1JA 4FKMA 1P4GA 4EO7A 4J2OA 2YJTD 2GBCA 2GBGA 5DMHA 4IG4A 4LHZA 1N2OA 1R4MA 1D9XA 1B8UA 1KFKB 3DFUA 1KSHA 5F5XA 4BNUA 1GQSA 1KAGA 4CE6A 1G19A 2REXB 1PW7A 4DA4A 5DGCA 2RGRA 3H9JA 1RWNA 3T6KA 2D0IA 3GXBA 2OR3A 3EIHA 2WU4A 4E2YA 3WHIA 3EEIA 4NYMQ 4Z7NB 1FXUA 3IAS6 2HB6A 5TGTA 4EUSA 4ND1A 1T2VA 4E70A 3TINA 3KZVA 3MG9A 3M4NA 4JNKA 4LZWA 4C7JA 3L8EA 1NQ5A 1QDLB 3D31A 1B0AA 1DDIA 4DGSA 4K0KB 3DGFC 1GFSA 3D4PA 4IP0A 4LMPA 1D2MA 3G8CA 2AR7A 5ULLA 4FFVA 5LD2C 4P54A 4KR9A 3VU8A 4US2R 1GKYA 3OJXA 3EFHA 1J24A 3SZUA 4GRDA 4FYJA 1J2EA 1PJSA 1TUBA 1ZK0A 2BZGA 4RUKA 3T1VA 3UOWA 5HZMA 1ZMTA 2GJKA 4DMMA 5KOIA 1EFRA 4YRNA 4K88A 1J8YF 4EX6A 5I45A 1YJ5A 5KYNA 2BFCA 4OO3A 2PCLA 1O5OA 1MABB 2X2PA 3EN0A 3G2PA 3P2JA 1OY1A 4WNCA 1EKXA 4H6WA 1XTQA 4JQSA 1CIPA 4DMFA 5C5EA 2ZITA 3L0ZA 1NATA 3UKOA 1FP4B 3N0VA 4AMBA 7REQA 4JNCA 1S5PA 3T3PB 2O2EA 4IUBS 1C2YA 3VR6H 1DEXA 4E1AA 2R00A 3OD1A 4UQPA 1NRWA 1OI7A 2QGZA 1NC1A 3O1JC 4J2TA 3ZU3A 1AKYA 3FOCA 3QRWA 3OQOA 2X2EA 1OW3B 3HH8A 1GQYA 1NFQA 1SQ5A 1YBHA 2H5JA 3D5EA 3D8UA 2ODWA 4J7CA 4C0BA 3ZIAD 2ONJA 1EP1B 3ZCPA 1D5CA 5IDVA 1SHKA 2X77A 5DBHX 3IOMA 1HQCA 5IDXA 5C81A 2IRWA 4NAVA 2I8AA 5BUQA 3FLMA 1WSBA 2ENWA 2PU5A 3IA7A 4HO1X 1X80A 5EUCA 1OGJA 3ESDA 3GLGE 1LZLA 3IH5A 1XRLA 1E3SA 5TQ0A 1Z6PA 3LFTA 3PHJA 2J3HA 4AF8A 2F1HA 5GADl 4NV0A 1A9XA 2GPBA 3DC7A 1KZ1A 1WB4A 4MJLA 4X63A 3AQIA 1I4WA 1E1DA 1P9RA 3FUWA 4W6QA 1Z4IA 2FWIA 3A6DA 4OJMX 5E1DA 4JT8A 4ALJA 3CXUA 4BLRA 6ABPA 3KAPA 4MDYA 3GEPA 3SEQA 4FDVA 4EITA 2G5PA 2QD2A 2WWXA 4OVKA 1JIJA 4P3PA 5EHZA 2F8SA 3M8KA 4HI0E 5A9TA 2WQ6A 4DDUA 1QUEA 1JR3D 4QO8A 1APBA 1ACLA 2NVBA 3ZV3A 2IPXA 1EJ0A 3PC6A 4W5NA 3THXB 3WZLA 1FTGA 2ERCA 3E81A 4MS4A 4UBIA 4YCAA 1JEYB 3FAKA 3L4JA 3E0QA 1GG2A 1S02A 5B3LA 2B7CA 4BMCA 5BVGA 1I2MA 1QVZA 3ESRA 2OAP1 3O9VA 4HLUC 3IUEA 1U3CA 1II8A 2RHLA 2G4LA 4S2EA 3OTHA 2QX9A 3DT9A 4DKJA 4FT2A 4WUVA 5DGXA 4B3FX 3IAEA 5T4BA 5DBEX 2Q46A 5LBTA 3R6LA 2J9GA 3W1EA 1VCMA 3I1JA 2I4NA 2F8MA 3HV0A 1CE8A 3IRUA 5H83A 4C2BA 4D56A 2ZS8A 1Y6GA 2AR0A 3QTBA 2OQ2A 3AVTA 1FA9A 1COZA 4OATA 1AF7A 3BWCA 4DPKA 4JBXA 1QF7A 4ZZ3A 1OBVA 1D4AA 1SBYA 4MWZA 1NJSA 1OMOA 2VI5A 3FCEA 1Y5LA 4BIMA 3DUFB 2VZEA 1HYEA 1QG2A 3E9CA 3EH1A 2H65A 4IM7A 5HUJA 4AZ3B 1QQAA 3N3BC 4X1YB 2ZFUA 3MGKA 1N6PA 1LKZA 1P5HA 2R7MA 5DT2A 2EBWA 4E32A 1Z29A 5HUHA 2P65A 1QHYA 4J07A 4PLWA 4GRIA 3RK4A 3PHLA 3ZY6A 3C3WA 1U8FO 4U2EA 4GMXA 5JOQA 1ZBQA 2QMOA 4O4IB 3TR6A 4PXYA 3WNCA 1WP4A 4A5SA 1P7ZA 1Q3HA 4KJXA 3EGWA 4L73A 4LJ8A 4Q9IA 5JO9A 2YW9A 1NA5A 4HTAA 2QM8A 3H97A 4KGVA 1QO0D 3EXG2 4OL0A 5AUNB 3PDUA 1L5NA 1DKPA 3GJ0A 4EGQA 4W5RA 4RE6A 5JAOA 2IK8A 1XD2A 1Q12A 2VK1A 5B3JC 5IXJA 2XSZA 3SC2B 1EUCA 2X3FA 1QLWA 2YN4A 2A5LA 4WZBE 4N01A 1IXKA 2FVXA 3P9RA 3JYLA 3VDQA 5CVCA 4OM7A 3PQDA 3C1AA 5U9CA 5CT9A 4UUAA 1HLFA 4PGFA 3V7YA 3VOSA 4CWAA 1C3LA 1T8PA 2H5EA 2RJ3A 3HUEA 2YVAA 4MJ7A 4ZCTA 1AKEA 1NVGA 5BN4B 1DFGA 4IY1A 1KDRA 4QNMA 5LA6A 4IHQA 3R7LA 3WLRA 3D6AA 1U2QA 3DW1X 4HZUA 5JALA 3HVUA 4B83A 1BXGB 4FK8A 4RW0A 4B7XA 4DN6A 4WBSA 2C5SA 3PR2B 5JJIA 2V1XA 4PCAA 4YRDA 2VWHA 4YR7A 1OKKA 2CXUA 2PKEA 2QGFA 1YS1X 1XCMA 3L9XA 4C88A 4OH1A 3IE1A 3VAAA 3FSEA 2AKEA 4AUKA 4N4AA 2I4IA 2EERA 3PHGA 4XWWA 4QUIA 5KTRA 1FUUA 1C80A 2FLVA 3WIEA 2K2QB 4XDGA 4ARVA 4QAJA 4J94A 3X1MA 5A03A 1XQ1A 3QSYA 5A4AA 4PSDA 4EZIA 4EFLA 4XIFA 2ECOA 5JNTA 1KOFA 2WBLC 4FFLA 3V8QA 3KAKA 5EP2A 4KQMA 1I8TA 1NSYA 1P2FA 2F00A 3GLHA 2J87A 5L7WA 1NUPA 5D5PA 2B8WA 3H1PA 4YJ3F 3GD7A 4AU1A 2QAGC 5JQGA 3FPEA 1SU4A 4BMOB 1EGQA 2DKFA 3B52X 3K0FA 5DEOA 3U9TA 1J5XA 2F64A 4YT4A 5GONA 5HGJA 5EGSA 3VUEA 2MJLA 4O8CA 2LDXA 2W48A 1AQUA 1TUGA 3P0FA 1JG3A 1ZIYA 2JIZD 4II7A 1ZW6A 5E38A 3U3MA 3UUGA 4RESA 5IC4A 3U56A 1O4VA 5HQTA 2P9FA 2QT0A 2R68A 1ZSNA 4UTVA 2CNDA 1X1SA 1NBHA 2ZIGA 3K0BA 5IJ0B 3V1NA 2DLDA 2C04A 4NE2A 1FLDA 1M5TA 4HC4A 3IHLA 2IJGX 3BH0A 2XYQA 5I9MA 2MR5A 2IYXA 3T3EA 4PM4A 1LLFA 4O0LA 3OHMA 2WAXA 4DNFA 2SECE 5BMVF 2H2HA 4E15A 2I6TA 4HAOA 1H2EA 4Z1OA 1X87A 2GCGA 4DKXA 1X77A 1BXKA 4MP6A 1X92A 1GPYA 1V47A 2D1TA 1U98A 2ZUSA 3QUSA 3RVMA 1DRJA 4OYLA 2H63A 5I8WA 4BRWA 1QZZA 1KI9A 3UJ6A 2VJMA 1L4KA 5BWMA 3NX4A 5AIBA 4LZLA 2V59A 1P73A 3K9NA 4RS3A 4B7AA 3TIXB 4PQEA 2BFEA 3ZGNA 2GM9A 1C29B 5FO1A 1JFTA 1CS0A 2ZWAA 2X23A 1SAYA 2EJCA 5BNWA 3QVGA 1R6BX 1ST2A 5L4NA 2YFQA 1C0IA 1AK1A 1JLLB 3V4OA 4FBLA 1N5IA 4MGYR 2EOAA 1DDOA 1UPCA 2D1YA 3BE6A 3PNKA 4MR8A 2C8VA 5HFAA 2GHTA 1WKCA 4ZOLB 3GBSA 3PXGA 3AZOA 3TVDA 1KI4A 5F77A 3UMYA 3V4FA 4UTNA 3ABRB 3FVRA 4MQLA 1VL8A 3WLLA 4DNQA 1PJ3A 1Q83A 4EYGA 5CDUA 1UDCA 2W2QA 3HWX1 4QULA 1XF9A 4D3ZA 4DIKA 1PAUA 1GJRA 1VM6A 3H5LA 1NI5A 4OAQA 3ZYCA 3KSUA 4BTVA 1ZJZA 2XYRA 1EUZA 1QSGA 4TKZA 1QE0A 3AVOA 3OPMA 4Q9KA 3W7VA 4JVMA 5K05A 4MZDA 5DM0A 5KSZA 2TMDA 3DE1X 1NU6A 4GBJA 3UWMA 2OFOA 1L7AA 5F78A 3U40A 2C54A 1X7HA 4RIFA 4XSVA 5DVZA 3X1XA 3KJEA 3I8XA 3IMGA 3R6DA 4WBXC 3DE0X 3E2IA 4IIUA 5KAMA 3CUVA 1RADA 4WXPA 1KFJB 1Z36A 1XZKA 2VYFA 4JX8A 4JI8B 4Y98A 3GEHA 3KK0A 3EG5A 1AKNA 3FVWA 3F2IA 3NR2A 5A3SA 2O20A 2WIKA 4CL8A 1PW5A 4YAFA 4WEQA 4C7BA 1U2GA 1KOGA 1W0CA 2VDRB 4HAVA 1QP0A 3HXQA 2VH1A 2OO3A 3OQJA 4IMJB 4MYCA 3OPYI 1EWTA 3L7BA 5JTTA 3ZQUA 2YMQA 3J7TA 3HKCA 5C7YA 3VVBA 1P9WA 4CODB 3HM9A 3WLOA 1FQOA 1FVFA 2FP3A 2BT4A 1E9AA 3GJSA 3OPXA 3V2IA 3EF1A 3AC0A 2DR2A 1L3BA 2ISQA 3E1KA 2X6QA 5TF0A 4AZTA 2Z1MA 4ZYUA 1RVV1 2WT9A 2XCIA 2WV7A 2WSBA 5I48A 3ECCA 4HX2A 2JI8A 3RVNA 3KZKA 5CB4B 1ZK4A 5E7QA 2P2DA 4MR9A 1H3EA 1FMLA 3OIGA 4FHDA 4K1XA 4PZYA 5AHRA 3V1TC 4HNAA 2EVWX 3HUDA 3SK0A 4CTJA 1KO4A 2YS7A 1N2ZA 2RGGA 4TYWA 3I8OA 5HIIA 1QTNA 5K3AA 2QK4A 3HU1A 3Q15C 1VHTA 4EJFA 2HLHA 3W7AA 4NZMA 3JASB 3VC2A 2XA9A 3BSSA 3RANA 1GM5A 2HQSA 5AR1A 3NW9A 4HLNA 2Z2JA 3V1KA 2VJPA 4GOXA 2XT9A 1NC3A 4B6EA 1RXIA 3DQPA 1YTUA 3NYQA 5HRAA 2PDAA 2XRMA 2P6OA 2IXBA 4RMJA 1ESEA 2Y1CA 1K4YA 2ZUVA 4HF7A 1N57A 5JH7B 3O92A 3E4CA 1PRYA 3RC2A 4EHBA 4PPFA 5JVDA 5A2GA 1UXOA 5LYJA 3WA7A 4W7IA 3U60B 1A82A 2XGOA 4IH1A 2VJOA 3KLOA 3URKA 2DETA 1PTKA 3TCKA 3FBWA 3K8QA 2ZB2A 3GFGA 3I2GA 4QREA 1TX4B 4L6CA 2QMEA 3LUBA 3SIPA 3Q6MA 1ZJ5A 2HNBA 2RHHA 2BMWA 3GLIA 3KKNA 2Q3MA 1AF4A 2CNNA 1UBFA 3FLEA 1ARZA 3GVCA 3QPCA 1XTSA 2FUKA 2IU3A 2HF8A 1H5UA 2XBUA 3GJ7A 4FZ5A 4K03A 4YRFA 3UPDA 1E0KA 2REBA 3RYFA 1H69A 2JGFA 3FE2A 4GI5A 5AW0A 3H11B 5C3UA 2TRSB 3IBCA 4Y6SA 2IVZA 4LPKA 3RABA 4L27A 3IQIX 1AKWA 2Q9CA 4B74A 1A3CA 5B4TA 4QFCA 1P1IA 1N5OX 2KBFA 1A5SB 1U0GA 2QI9C 1GG5A 3PA8A 4WKBA 4EI7A 5B58C 1LGYA 3R4CA 5KQRA 1UMBB 3KB2A 2Q27A 2PL1A 1JB9A 1IH8A 2XR1A 4KCGA 3QF4B 1LA2A 4BFUA 2XV1A 5SYMA 5NULA 4N41A 4LF8B 1PR1A 4L4XA 4EKEA 3KAJA 3RIGA 3TIFA 1E60A 4AS3A 5LJLA 4EHIA 1S96A 1V1MB 4DV0B 4JQOA 3K0CA 2W2OA 1EX7A 5KYKA 2AFVA 1E2EA 3B85A 3QF7A 3QX9A 2IE8A 3IXMA 5K8JB 1NV8A 3VR4A 2ZM6B 4KXYA 4NY1A 4QQNA 4B17A 4JP2A 3NVAA 1XN4A 1UJ2A 1BFKA 1YQ9A 3D43A 3BWBA 4HP8A 4PPQA 3D6TB 2OXCA 2REQA 1IUPA 3IQZA 5JZVA 1HZJA 5LOVF 2QP3A 1PEAA 1QONA 3GAMA 3KQVA 3IURA 4KACA 4C5CA 1QFMA 3MGBA 3K9CA 4OHUA 4E0BA 1IUOA 1I3LA 4N6OA 3URMA 2VG8A 3DSRA 1DAMA 3BHMA 3MPUA 1QG0A 3ELWA 2YV5A 3Q5GA 2D0OB 4L7VA 3B51X 5FUBA 2QU8A 1XCPA 3IAM1 2AJDA 2DPXA 1OREA 3JPWA 4JBGA 1EAMA 4PPGA 4KXLA 4U6NA 1G8PA 2IYRA 1ZZEA 2F43B 3V8NA 1A88A 5CB6A 2C2YA 1UK8A 1W1UA 3I5YA 1CR0A 1EK0A 1OROA 4OYHA 3W6UA 1G3RA 2RGYA 1NQTA 1E20A 3N7AA 1M10A 5A71A 3ZH2A 5JZMA 1NI4A 3A6JA 3ORRA 5SZIA 1CFZA 2Q1XA 2WT8A 3FPGA 1QGYA 2IYPA 1U81A 3JQ6A 3CF6R 2X8LA 3E05A 4HDMB 3E3NA 1PFUA 1X74A 1K98A 1JZTA 2A0YA 3EMVA 2ZJ7A 4RH0A 4Q9DA 2XUOA 4BCDA 3TZHA 5EIXA 1VMIA 2ZPUA 3DLTA 2FEMA 4DQKA 4U5QA 5AVVA 5IUKC 4ZANA 4H7DA 5FYQA 5HYVA 3BMCA 3PJRA 5CVEA 4JHXA 2ZEJA 4X20B 2GJ4A 2C94A 5B3AA 3VKUA 4E07A 5KHOC 3JZFA 4ZOAA 4RHYA 4KUHA 3RWMB 1JR4A 1W85B 1MX5A 2V58A 4QXPA 1MEEA 3RSQA 3PQ2A 4B7ZA 2Q0SA 3K20A 2FSVC 3BMNA 1G17A 5GJVC 1E3TA 2I78A 1LTHR 2HLDA 1E7WA 4O4HA 1QE5A 2Z6AA 2MWMA 2AEFA 4NZZA 3FW1A 2BMDA 4OHWA 2XUFA 1BOFA 2JJ2D 4NU0A 3KC2A 1T9CA 3NASA 4E2FA 1XZCA 5TB5A 5FAXA 3USCS 5EJGA 2IZ7A 3WP1B 1HR0B 4RH1A 1SCAA 2IHZA 4QXOA 1VIYA 2C42A 2O23A 3W7BA 1QH0A 4BVJA 4EUHA 1E8MA 4X6YA 4MNTA 2EV9A 3AR3A 3W5SA 1MEJA 1IN4A 5EJFA 3E5RA 4KBYA 1LF0A 2CJFA 4RIIA 4DZRA 4TZTA 5JNWA 4MKRA 5BV8A 4IW3B 2FSGA 1Z4MA 3FZEA 1CHNA 1O9HA 2IXAA 4FFRA 3UKJA 4Y1RA 3RWOA 5BRJA 4BFSA 1PQUA 1CQJA 5BNZA 1DIGA 5DTJA 2QSZA 5CW1A 3W5JA 4PQGA 4UM9D 1F51E 1YT5A 3C16C 3G8YA 4P4NA 2EWVA 1B1CA 1ZI6A 3FROA 4N9WA 4JYBA 5G4LA 2W70A 5I01A 1JH9A 1IQPA 1FYVA 1XEAA 4EP1A 1BXRA 3K1YA 4C6TB 4TLBA 5D3QA 2ID8A 2XZOA 4UUQA 1U7TA 4E2ZA 1GT6A 1KBZA 4TVSA 3IBTA 4MMZB 2AMVA 2HIAA 2W2NA 5AJHA 5FPYA 1QORA 1Y8QA 2OSVA 4KK4A 4ZWNA 5C8YB 2C4VA 5LNK1 4EJSA 3MFQA 3ET5A 3VBCA 2C83A 1JE1A 2Q07A 5JJCA 4AUNA 1I4LD 4U8GA 1GCUA 1Y1TA 4R7TA 1Q3KA 1OLOA 3C7TA 3DW3X 4B5LA 4WCVA 1U0BB 2C3OA 3SF8A 1GD1O 1XDGA 1KE1A 1Z83A 3LX4A 621PA 4NPAA 2ZYWX 4FQ7A 3SHOA 4YYEA 4ZJPA 1P5FA 4BVKA 2WYWA 3L0CA 2CHQA 4X44A 2FP4A 4G8JA 4G8BA 4QU0A 3TLXA 3KIPA 1LLCA 1WDMA 4MKXA 1RLTA 4N76A 5CYOA 4JOQA 5D86A 1KMMA 2G82A 5KDDA 3VZDA 1GNTA 2FMUA 2I6QA 2CHVA 3AJ8A 3M6VA 3Q2IA 4QC2A 4RSGA 3WTCA 4GOND 4DA0A 3TUIC 3PQEA 3HJCA 3PQ3A 3GW8A 1T1GA 3U44A 4GDFA 2C03A 3BCRA 5I9BA 5CB0A 5JHHB 5IULC 2HA2A 3GF4A 3GDWA 3WLPA 4BQPA 2XEXA 3ZHSA 2ZTMA 1N92A 1V4NA 4NAUA 3CZRA 3CNEA 5E8RA 2JFZA 3UV6A 4EECA 1GNSA 1QV9A 3QMMA 2YXBA 8MHTA 4LYAA 1REQA 3Q7RA 2Z1NA 2P9EA 1N5RA 4BJHB 4LA4A 3KEQA 2BEKA 2ZRHA 3ZWQA 1WCV1 2VPWA 1WDLA 1VE6A 4BGIA 3UFBA 2NSJA 2AEMA 3TX6A 4Q4CA 4WXHA 1Z0AA 2CWWA 4RK0A 4G2NA 1ODKA 1G6HA 4MB6A 1M1YA 2P0YA 1MX3A 3GIWA 4NBRA 2P6NA 3OFND 5ISMA 3HL4A 2IBMA 1HTTA 3OPVA 3S99A 1PK7A 2QPTA 3ZZTA 1QC5A 4BZWA 2Q28A 3PCRB 4FCCA 4AX4A 2EWWA 3OURA 1IOLA 1P4HA 3S8MA 2MSNA 4ZK6A 3IQWA 1ZBDA 2I55A 5B37A 4CU5A 2ZUFA 3T61A 2A9RA 1F20A 4RBNA 3H7IA 3QSGA 4P31A 3RNOA 4C89A 1US8A 2VHYA 4L4YA 2KB0A 1S2DA 2P27A 2W0SA 1ODTC 4FHGA 3Q9LA 1TQDA 2B5WA 5G02A 3VHRA 3OIVA 4DBLC 3OSZA 1I9GA 2ONZA 3U9LA 2VHJA 3QPAA 3AQ4A 3D8BA 1WSAA 3DCIA 2CLDX 1R3DA 2H6EA 4RXTA 3OJLA 4F1KA 3T1HB 5E6SB 3E7XA 3L6BA 3FX2A 1N8SA 3MHTA 4HGPA 3GUVA 2IKQA 3A1EA 1VL5A 1T3TA 3PNPA 4G26A 4QPDA 5CH8A 2MU1A 1M2VA 1IHXA 3C4QA 4IMIB 4ND6A 5ENVA 3STUA 5EXPA 4L22A 5JJKA 4G5GA 1ZGHA 1N6LA 1LVHA 1XZAA 3DB1A 4PX2A 4JYAB 4KI0A 3IAHA 3CZCA 3Q3EA 4RGQA 3KOMA 2GCIA 3EIWA 3QKIA 2XI4A 3O91A 3ABIA 3DPUA 3OE7A 3UJHA 4L9AA 4UUOA 1N7GA 4TM7A 3B6JA 1Y4SA 5K4AA 1MABA 1UZMA 2QE7A 3U49A 3T5DA 1XPOA 1I14A 2BGIA 1HM5A 5BV7A 1LTKA 1FP4A 2Z5LA 1MJ5A 4ZVKA 1MD9A 5CA0F 1K08A 3SLKA 2BFBA 2OXEA 1AX9A 3FI9A 3H6HA 1RI3A 3PUWA 4NYIR 4LOIA 4GUAA 5ECDA 1UAAA 5EQJB 5GGYA 4EKNB 3UPUA 2R9VA 3R8FA 3FSJX 1K7SN 2P5SA 1F9AA 2B94A 4PLYA 2UUBB 1KVTA 3T3OA 4REQA 3RFVA 3JQ9A 3QIAA 3LVRE 3LHIA 2X9VA 4TMFA 1Z35A 1XWIA 1VSBA 2JZNA 2Q1YA 3AVXA 1S7GA 3AEUB 3WL3A 3ZGXA 1DB3A 1E2GA 3I58A 2IEIA 1XZ8A 2CLOB 2H48A 2JGDB 4KIGA 4RD2A 3WDMA 4HH1A 2I65A 3HXMA 1A96A 3DM5A 3VC3A 2P3QA 5KJCA 2NADA 3STTA 3MUEA 3G2JA 3UMGA 4XZ3A 1DLJA 2V7GA 2AMJA 2PZEA 3OZAA 4QGGA 3U19A 5ALUA 1QHEA 1UDXA 2BI7A 4OQFA 4MV0A 2XMQA 4DG8A 4IXNA 2V96A 3P19A 5ARCA 3T9BA 4F9GA 3R77A 2R66A 3IEKA 3QITA 3ZGZA 2OVBA 4GP6A 1N6RA 2A2ZA 2VHXA 5M34A 1UBLS 5CT6A 1FDWA 2XRYA 3RT1A 5IAAA 2VR1A 3OX2A 2PE5A 3THXA 1LC3A 1ORIA 2FR8A 4IIVA 4AJ2A 3QVWA 3FKJA 5AVZA 1Q16A 1OBFO 1Q1EA 3ABQB 3AHHA 3OE1A 4LDNA 4N5MA 3NVKI 3ZU5A 3BRSA 3IAM6 4YRZA 5AVWA 2ADMA 2IU0A 1Z7WA 3FF4A 5LQAA 1X7XA 3TUZC 1NULA 2VUIB 2CFSA 3A4VA 2B0JA 4HEJA 1G59A 2OK7A 5F12A 5I7UA 1JQBA 2I2CA 3WISA 1W76A 1Y4UA 4NONA 2EQAA 3D8RA 5SV2A 3OEHD 2G08A 4TKUB 4B5KA 1GZ3A 4V38A 5E3JA 3N0WA 1RACA 4TWIA 3MJCA 3A31A 4PANA 1MAWA 4KQ2A 1ODSA 1F4LA 3E9NA 5MHTA 1P0MA 2HCTA 1Z3IX 3FDZA 1KVRA 4ITUA 4KQ6A 1DUVG 2GFIA 2ZR0A 1YRLA 2BMAA 3DUFA 2IU6A 1D09A 1E69A 1Z5UA 4FR0A 2A0XA 1FFCA 2UUOA 3L93A 4MO9A 4Q1CA 4QUAA 2ONKA 2B2XA 5SZHB 4AZ3A 4X1YA 2OYSA 4FGSA 4WJLA 4RGYA 1G7CA 5JBQA 1MB0A 1YZUA 1JIUA 1QQTA 3CEAA 4IPTA 5CW2A 4JKYA 4C0QC 4MQ4A 5IM4A 5TRTA 1JKMA 5CCEA 1SG0A 2LWIA 3C2QA 4MVXA 3RRNA 1DL5A 3K0AB 4JI2B 1R0RE 4M8KA 4MRMB 4DIBA 3RVPA 3H2YA 1GIAA 2H07A 1HMYA 3QYFA 4G4SO 3B9RA 4F8EA 4O4IA 1GXSB 2DTXA 2ZAMA 1W6RA 1N0WA 1O97C 5EMNA 2A3RA 2ZBPA 1IATA 2HCBA 3H4TA 5FD8A 1KXJA 4D9EA 3QEKA 2FG7C 2B1JA 3MJTA 2FRDC 1KJ9A 3D2BA 1E1NA 4W1QA 3TLBA 3VBEA 3QBEA 2HU2A 3STVA 2P91A 1XLTA 3PFNA 2YX1A 1XQ9A 2I3GA 2XQGA 1W1IA 4XD2A 4YWHA 3UC5A 3SI7A 2DCMA 3SC2A 3RGWS 3HNPA 2JHGA 2JATA 3TVTA 3WC4A 1OXUA 1QGDA 4B4WA 5ALYA 2VA9A 3N7UA 5B1IA 3A4NA 1OZHA 1F12A 3LPCA 4UEOA 2QLBA 2WIAA 1K2VN 4U3JA 4EY7A 3GRZA 3LUJA 1TMYA 2XCRB 1L5MA 2FUG1 2P77A 4QPZA 3W5UA 5EZYB 3COJA 1K4KA 4MVJG 4P34A 5CCBA 2JVJA 2VF2A 3G2NA 5BN4A 5CDSA 1M2JA 1KETA 1DKRA 1MJGA 4ZAYA 2JGNA 2P3LA 5JU6A 1GRCA 3D7RA 1W96A 1QDUA 4K9SA 3QUAA 1TAHA 3EZ6A 2E37A 4GM0A 2V97A 2EGUA 3ONWA 4HRXA 3BD6A 5ER9A 4AKIA 4AKGA 4IV0A 4ZAXA 4MB0A 1SB9A 1CQZA 4EPTA 1CUWA 4WNYA 5LP6F 2BFOA 4PC7A 3AT1A 3EXHC 1YDWA 2P2LA 5E8JA 3X2FA 1T26A 1WLYA 3GN1A 3SCZA 4MCIA 5DF1A 3C5HA 1P33A 1W29A 3O03A 4B2LA 3F96A 2Y4NA 1QNLA 4TXNA 2XMGA 5JFGA 5AKZA 2FQWA 1A77A 3FNBA 4XD7A 3V33A 4HWKA 1KZHA 4HNQA 4FPXA 3O8NA 3K94A 3WQRA 1RXEA 3FZNA 1ZNYA 4CV0A 4WGFA 2AZ4A 2QIOA 1NP7A 2NO7A 2VUUA 3LNTA 2HHCA 4PZEA 5DKFA 3FNIA 3RRYA 4WFIA 2GTHA 5KNBD 1JP7A 3CW8X 1I6KA 1YASA 3KYDB 5EIHA 1QIJA 1X13A 3LRPA 5J2TB 5F7JA 3ZHOA 2XKKA 3KZMA 1K0UA 4DSZA 3PNQA 1TMKA 2IQ5A 5K8LA 2CXOA 3I72A 4Q00A 2J32A 4YONB 2E5LB 4EL0A 1G64A 1J1UA 3U3DA 1YB1A 2GZHA 4RY2A 1GUBA 4O25A 1FX0B 1MORA 4ILEA 2DCUA 4I55B 3MZ0A 5DYTA 1EDDA 5H7XA 3DR5A 1S0UA 2Y76A 3DV0B 1T34A 1WXWA 1BRMA 1WSDA 3AUYA 2G5TA 2XYHA 5B1YA 4LCJA 1NM5A 2QTBA 1A9TA 3GAAA 4IHKA 4KEAA 1G21B 4HVAA 1S2NA 3EF0A 3JQFC 1AO3A 3UYLA 3L8MA 1ZA1A 3SHFA 1OV6A 3KCQA 5AK6A 3ROMA 4LGVA 3P2MA 4BWYA 1XMSA 5K51A 2CXXA 3QKSB 1Z0IA 4E6PA 4KDRA 4GZ5A 4TSRA 4OUDB 2O8CB 3DMFA 3V1UA 4H7KA 3NDRA 2W6PA 1XMVA 2ZWMA 1TT7A 2WYHA 2W43A 4OHPA 4PX5A 4UARA 4UATA 1ZVMA 4RTQA 5ELXA 2OV6A 5DW3A 1KZ7B 3S3TA 1BROA 2Q99A 4CLHA 5AK4A 3IVMA 1KJWA 4F86A 2IHNA 4PYJA 8OHMA 5C3MA 3VTKA 3WR5A 3ZDFA 1G98A 2NVUB 5IVHA 2J3DA 2LP4Y 3W0LB 1XJ5A 1QIGA 2G70A 1RM4A 2CMHA 4DNOA 1S8AA 3N75A 2NU8B 2WG2A 3JQAD 4M2LA 2OECA 4EBFA 1OD6A 3OZ7A 1Z26A 5F7XA 2XWPA 3THOA 1H1DA 3SYRA 1EVIA 3IVAA 3W5IA 4YDRA 4ZOLA 4LJAA 1RCFA 4G86A 4WPGA 1YJ8A 4Q7LA 1HFJA 1Z5VA 2HU5A 4YFYA 5M3BA 1J8FA 1F8XA 2QG9A 1EFPA 2PX8A 3KFLA 5LKAA 2B37A 3HZOA 4PNPA 4G23A 3JQBA 4MVJM 3CLUC 3IR6A 4ZQEA 3NHWA 5DGIA 1W59A 3U7HB 1HLGA 2FKAA 1EX1A 4QHTA 5ALKA 1E5XA 2A92A 4HYTA 1RYYA 1XU9A 1NZJA 2ZBVA 3A1CA 3EVZA 1K5DA 4U7JA 5C37A 5HS4A 3CU5A 3V1MA 4I5GA 4JBWA 4MVJP 5KAPA 5EMKA 2RD2A 1M1UA 2QN9A 3L4EA 1JRLA 1NLFA 1PI3A 4I6JA 1OTHA 3S7TA 4CEJB 5EKSA 2Q0XA 4UVDA 1GAQA 1VI5A 1ZGJA 4GYWA 3OO0A 4P82A 2ZULA 4M7RA 3AGPA 2PBLA 3AL3A 1J42A 3CURA 4I66A 4HQNA 4BE4A 1F6WA 4YPOA 1DAEA 1N2IA 4Y8VA 1NE7A 2OZKA 2R25B 4DBVO 3K9HA 3AY6A 1TXGA 2EGHA 5DRYA 3EC2A 1LWOA 3QHAA 4JJZA 5CLHA 5F4BA 3RW9A 4EPXA 1ODIA 1H0SA 4ZYTA 1MO2A 3JQQA 3PTZA 4O2LA 1LBTA 5IX8A 5KVCA 1P7YA 5CBKA 4YAUA 3QFTA 5A7GA 4FONA 4AP6A 3LT1A 5JAMA 1P60A 3GLRA 4NNJA 2I7DA 1YDHA 4BN4A 4YMUA 2J46A 5K6TA 2G1UA 4N3BA 2YJ4A 4AJ1A 3TLMA 4FD2A 2I6FA 5CB4A 3GROA 5AUOB 1GADO 1RRKA 3BXOA 2RSLA 3DYVA 1PT8A 1U2ZA 2J30A 2OYRA 3W2HA 3AERA 3I5MA 3F98A 3KJHA 1C1DA 3TNJA 1O95D 2JEZA 3ZKAA 4MP3A 2PT9A 1R8XA 4IF4A 4JSYA 3WXMA 5K99A 1XX6A 2P6UA 2CD9A 4Y1GA 2XODA 3JASA 1ONSA 2JJ1A 1ZNWA 1A7AA 2XDQB 4KFUA 4WESA 5H0IA 2IH4A 1ZSYA 3USZA 5KVAA 3GH1A 5EJ7A 1RHMA 2FQYA 2X9QA 4ODIA 3C7DB 2O2XA 4G97A 4NDNE 4N03A 4INOA 3S2SA 3TH5A 5AW1A 3S70A 3QA9A 4YCDA 1EA7A 4UM9B 5C7OO 5JH7A 1RW4A 4TTSA 3VUFA 4K9MA 2R96A 2Z5GA 3P4UA 5AUQA 1RXUA 1CP3A 2D0PB 4NCIA 2NUBA 2Q6LA 3NEYA 4K8OA 1Z17A 5K9ZA 3C3AA 2IHYA 3IESA 4Q82A 1MV5A 1FFEA 4LZOA 4LBYA 2M9MA 4U2BA 1FMTA 3HJRA 1GU0A 5F9MA 2WG1A 1UQUA 3TNLA 3E5NA 4JITA 2PWYA 3W2EA 5DM60 5JWRA 2PIDA 4FDTA 3NAMA 1N3BA 2VCYA 3FPLA 1U4NA 4X91A 1LLUA 3PQ5A 1T8RA 2GN2A 4OQMA 2CF6A 1EFKA 2ZDGA 1C9KA 2HSWA 2CBXA 2VHZA 3H11A 4GXRA 3JALB 3IQDB 1EQAA 2BHLA 4BDSA 4EVRA 2AYXA 5EXEA 3A11A 2AW5A 3DPIA 3OP1A 1CY2A 3DOFA 3QMPA 1HNWB 1ZCFA 2QYTA 2WT4A 4OMCA 2R87A 3NBUA 3U62A 3CG4A 3WIUA 1IY8A 3D4BA 4D7AA 2X7JA 4TQ9A 4DWOA 3AIMA 3T5MA 3CLTD 5COQA 4UZFA 5KHLB 1UMBA 4H2DA 1DJMA 4CMEA 3E2PA 3ZBPA 2F3PA 2YV1A 3T1QA 5KDLA 3AW8A 2DOKA 2UZ4A 4F6LA 4IKOA 5BQ3A 4W5JA 4G01B 4R2MA 1XXLA 4IUYA 4QVGA 4UDNA 3B53X 5FFMA 5MN4A 1NWHA 3OQBA 4L16A 2JAXA 3K05A 5DN6D 1KEEB 1QHGA 1OOEA 3KEMA 1JHOA 4XJTA 4BNTA 3DDWA 3ZLUA 4DB2A 3O4GA 1K7YA 4LCBA 2G9RA 4U6SA 1M34B 1CUEA 3LT4A 1I3NA 1L5KA 4M1WA 4BAGA 2F1IA 2HSEA 3GL9A 4G09A 3S6JA 3KS9A 1NNSA 3LFHA 1G60A 1CVRA 2WYOA 3I9JA 4C7XA 1C4XA 2O3RA 2WU0A 4J0FA 5D87A 2FFAA 1F14A 5I7EA 2V8BA 3EZ9A 3LDHA 1RRCA 2ZAYA 3KTAB 3U81A 2AE2A 3LV8A 2FEKA 2JJ8A 3NTQA 2J67A 3BD8A 5DV9A 3WL4A 3KZNA 1P2GA 3NNNA 1UWLA 5A3VA 4KIJA 4J6FA 4FFPA 1X2EA 3R5KA 4G37A 1Z45A 4UNNA 5LQMA 5F98A 1G66A 2N1BA 2YZ2A 1KS9A 4AYTA 4Y18A 3UJ3X 1PNRA 1NVWQ 3SQLA 4B3JA 4AJKA 1BN7A 2FZCA 3A4MA 3NOVA 4XJXA 3WHPA 5LQRA 1U02A 1OQAA 3C87A 5DYIA 3V1YA 3DFFA 3K2BA 4NECA 2HT1A 5DE3A 1Y82A 4PPYA 1FNMA 4B3IA 1CQXA 2VKQA 3TQTA 4CM1A 2O3QA 2F43A 1WF6A 3NBZC 3N3AC 4MVJH 5K4HA 1R5JA 9LDTA 1KOJA 2VFAA 1BKSB 3MYYA 4KQ1A 1BIFA 1DO0A 1NXXA 1F9EA 5DNEA 4HPWA 2Q6OA 2R8EA 2IX3A 3L18A 4LYYA 2X1HA 4DCJA 1VHQA 3D6HA 2ASVA 2BUAA 5ARDA 1M2WA 3EXFB 1FL9A 1MB2A 1YMUA 2QYOA 2XVAA 4JU9A 2PX5A 4BO8A 1A8SA 1DIBA 3MMPA 4J3FA 2Z09A 4FX5A 1NKSA 3NT2A 3JSXA 3WYEA 4S2UA 1U2EA 2XCQA 5IDYA 3EA5A 1E6LA 1K3FA 5CLJA 5IAOA 2WYVA 4G0XA 4UNQA 4TLMB 4QDZA 5JSZB 3R0IA 1C7EA 3NV9A 4PRYA 5KSPA 3RU7A 4UEQA 1U11A 4B3GA 4EDFA 2PNFA 3DHVA 1XRNA 2F17A 5ERXA 3L4BC 4EG1A 1U0HC 2QJRA 1X7WB 1PFVA 1KR5A 2F2TA 3IVRA 5AM2A 4EI8A 3A6LA 3FNGA 1W48A 5CA1A 5D00A 4HUJA 1A0OA 1X8JA 5DJ5A 3I1YA 3OCVA 3OG9A 4PC3A 4QD3A 1ESCA 1IBCA 1ZC4A 1YRYE 4LSZA 2WJ6A 5D7NA 1XZDA 5JD4A 1JAIA 2AG8A 2BGKA 3ZIAA 4Q7KA 4KPFC 2HJVA 1A4XA 4MVJI 1BG6A 4EW2A 3FJOA 1CBUA 4MLDA 3W2FA 4RVOA 3DULA 3PR3A 2XUGA 3TW4A 1E2NA 1Z18A 3AR2A 3WOHA 2WHPB 3BK7A 4RHXA 4U5XA 2C8KA 4DDMA 1II0A 2XD4A 3AWIA 3H1FA 3NC0C 3JRWA 3HNOA 1SM4A 4F3TA 1NVKA 4IDOA 4J76A 3F6RA 4HXFB 3MERA 5KVVA 1KRHA 5C7IO 5LQKA 4YJ2A 4JQYA 5DTIA 4YCMA 4KE6A 4M36A 5LD2B 2JFBA 1Y3DE 2OV4A 4UDOA 1GOTA 3D8TA 1FMJA 2WQZA 1UC8A 4ILKA 4EPVA 4M88A 2YWBA 2NOAA 3R5SA 5DSZA 2PT6A 4AZ0A 4NCKA 3PFGA 3E0XA 5IT4A 1F38A 1KH3A 3CGWA 4PTZA 1GHTA 4RIHA 4C6TA 3ETLA 4GP7A 3TQFA 2XTZA 3CVXA 4MW2A 4YLYA 1CDZA 1JR3A 2H51A 4IXMA 4RYDA 3REOA 4H6XA 5JLJA 4FS8A 4U2CA 1UMCA 4Q3NA 1J21A 1DBPA 1FK8A 1M0TA 3AILA 3I73A 4OAPA 3VU3A 2O2DA 2XYVA 2AH5A 4GSYA 2C31A 5C8YA 1L5ZA 3O4HA 2FFRA 4X1KB 5CDFE 2NPOA 5J23A 2Q4OA 1AY0A 5BQOA 2FEOA 3WJ2A 5KOYA 5I6DA 4TMKA 2DJ5A 1E7MA 5ANRB 1YMQA 4KSBA 5FAKA 1AQIA 1BFUA 2YC2C 3R3ZA 1POWA 5NLLA 4A03A 4PLCA 1JHAA 3SOZA 5CURA 2B92A 3M6MD 3HG7A 1M1YE 2NYRA 2BRUC 3IDFA 1O8CA 3VU1A 3HYLA 4LJ7A 3VOAA 4JYMA 1YFJA 5IEBA 5DOVA 3WFZA 4BMZA 2FEAA 3DKVA 1YQUA 5LYYA 4US1R 2W0MA 5A0FA 3ZY4A 2I7CA 5ILGA 1BYUA 5KTPA 1QVAA 2EKDA 4H18A 1OH5A 1R6AA 1TD9A 4W1RA 4PYIA 2WHEA 2B34A 4TX1A 3F3KA 3I2FA 4LHVA 4LBZA 3UHOA 5IASA 1W35A 5FL7D 2QUBA 3OCWA 4PW0A 2PXCA 2PZJA 3PJGA 2NSHA 2AG1A 2X0FA 4M1KA 4ZKEA 5FOTA 4P35A 3LLUA 2F3SA 3ILHA 1HDCA 5D51S 3H83A 1PL8A 1S8NA 3NRJA 4FDUA 4B3CA 5EIWA 4EDHA 4DGQA 4DSAA 2QG6A 4OQEA 3ZBQA 5CH5A 1AKUA 5IYZB 3LWBA 1FDIA 4QKQA 3L0OA 4JELA 3GFSA 1U3TA 2Y1KA 2ZROA 1FNNA 5JFTA 5GV8A 2OEPA 5LQJA 4IWXA 1FSZA 2JS7A 4S3MA 2DR3A 1ONPA 2EFEB 1RQPA 2P8JA 3MIZA 1G5PA 5EP4A 2X5KO 2R8ZA 1BW9B 3TJZA 4DXHA 1GA4A 3WRYC 2IUYA 3K2IA 2NIPA 2VTDA 3PC2A 3KOUA 1PGOA 2GAJA 2ZZNA 1AZWA 5IH3A 3S2IA 3DAYA 2PKCA 4BU1A 1K6MA 3QY0A 1TW2A 5J47A 3L01A 2Z3WA 3PKIA 4GPAA 6REQB 1OBOA 1KC1A 2QSYA 1CEYA 1QYDA 2JFXA 2VYVD 4JHLA 2P2NA 2VVTA 1L5VA 2FZKA 3MJEA 3TTYA 1WS6A 5E6SA 1ZK2A 3FCYA 1IZ9A 1G2PA 3IJRA 3KJFA 4W99A 3RYTC 4DDKA 4AJNA 2GDJA 1NR7A 5K6AC 4BMDA 5A02A 4G5YA 2Z6UA 5CIQA 2VWGA 1YGPA 2FF7A 3N7TA 3S8EA 2WNHA 2H1OA 1HLDA 1J2RA 2ZKIA 3PGMA 4H3VA 4UHCA 3FYTA 3HDQA 2CY0A 5AJWA 1Q7RA 4D92A 2JH3A 1TQ2A 2ZKLA 3HN2A 4RPHA 4J7AA 1E2HA 1Q1QA 8ATCA 2B8JA 4MHSA 3DKPA 1YL6A 2RB5A 3F8TA 1KC3A 5CXSA 2H4FA 2V7PA 3PENA 3HO6A 4TRMA 1ILEA 1YBMA 4IGEA 4WZAB 4F4FA 4AMUA 2VTVA 4O3MA 3Q8XB 1L7OA 1KI7A 3EVFA 1SIOA 5HNKA 3G0IA 1BWPA 4AZVA 5B53A 3LT5A 1ZMXA 2GMWA 2FWPA 4X93A 2ATIA 5G0UA 3A4IA 1OH7A 1A71A 4MQ5A 2BI4A 4Z9FA 1VRWA 3VX4A 3H86A 2VJNA 3U2QA 2Q49A 4QG7A 3O4JA 2ZJ2A 2IYVA 4TTTS