1UXOA

The crystal structure of the yden gene product from b. subtilis
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
186
structure length
186
Chain Sequence
b'TKQVYIIHGYRASSTNHWFPWLKKRLLADGVQADILNMPNPLQPRLEDWLDTLSLYQHTLHENTYLVAHSLGCPAILRFLEHLQLRAALGGIILVSGFAKSLPTLQMLDEFTQGSFDHQKIIESAKHRAVIASKDDQIVPFSFSKDLAQQIDAALYEVQHGGHFLEDEGFTSLPIVYDVLTSYFSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative hydrolase YdeN
publication title Harvesting the high-hanging fruit: the structure of the YdeN gene product from Bacillus subtilis at 1.8 angstroms resolution.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 66
structure length 186
sequence length 186
ec nomenclature ec 3.-.-.-:
pdb deposition date 2004-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06821 Ser_hydrolase Serine hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1uxoA00
4U2BA 5CURA 4PO3X 2XUIA 5AI5A 3B5EA 4FHZA 1CIJA 4MYSA 2B20A 4QLAA 5CMLA 5C81A 3WK9A 3BDVA 1MU0A 4Q3LA 5JARA 1USWA 3WYDA 5T4EA 2DR0A 2ZYIA 4GECA 5JAPA 3G9TA 1BEEA 3WKBA 2GBFA 5ALKA 1E89A 4QDOA 4QDZA 2H9YA 3G0BA 2WUFA 1ETHA 5IVDA 1XRQA 1LPAB 3BIXA 3H2IA 1EDEA 1GXSA 2XMCA 4AN0A 4K6GA 1HQDA 2OAEA 3VVMA 5CXXA 2ZSIA 2VT7A 1W76A 1E5TA 1Q84A 3R40A 5C8VA 1Y37A 1OXMA 2OQVA 4J0KA 5HQ3A 5CH3A 4RE6A 4B6GA 2HA4A 3IA2A 2HRQA 4BTVA 5ALFA 3I2KA 4OB6A 2CBGA 3PF9A 3OG9A 1X2EA 3O0DA 2WIDA 4EY6A 4DMKA 4P08A 1JMYA 4DMHA 2OGZA 3HSSA 1LZLA 4K6HA 2OCLA 3G0DA 3L1JA 2D5LA 3DS8A 5JZ9A 2ZJFA 4EY8A 4X6XA 2HA7A 5JANA 4OD0A 3G9ZA 4X95A 1YSCA 4FBMA 5A7FA 2Y2VA 2RHTA 3WYNA 4WY8A 2I03A 3G0GA 1B6GA 2JEZA 2AJDA 2QUBA 4XJVA 3PICA 1YA8A 2Y2UA 5FUMA 1CUEA 1AZWA 2WU4A 4XX1A 4OYLA 3WWDA 3D5EA 4G8DA 2GBGA 2OCKA 2B61A 3FYTA 4B9EA 1EK2A 1E8MA 4HRYA 1C7JA 3I6YA 1YA4A 3WK4A 3V1NA 3PUHA 5AOBA 4M0EA 3CN9A 1IUNA 4XWGA 1QIJA 5J3JA 3G0IA 4P93A 4BCCA 1QIIA 4I4CA 2BKLA 5A7HA 2W22A 2J4CA 2XQKA 5I7UA 3ICWA 4X00A 3W06A 5FRDA 5EI5A 5SYMA 3BF7A 4H7KA 1GKLA 1R9NA 4YK7A 2VSQA 4AQDA 5ALPA 4J0DA 4K5QA 4UHEA 2XE4A 5ALMA 4EZIA 1XZFA 1FFCA 1HL7A 1XKTA 2WHQA 4DGQA 4DMFA 5I9IA 4ZGBA 3STWA 2ZJ6A 1TCBA 1ACLA 2BUCA 3AIOA 4DM7A 4DLNA 1BN7A 3C6YA 5HF5A 5ALNA 3FLBA 4WDRA 3QMVA 1T2NA 2BCEA 4C4ZA 1GZ7A 3UUFA 4DNQA 1J07A 4KRYA 2WFMA 2ZYRA 2CMFA 5AK6A 3FLEA 1FFEA 1THGA 1IUPA 1CUZA 1NU8A 1SOMA 2GYWA 1ZD4A 2OAGA 1K63A 3KSRA 2XQGA 1SCIA 1W75A 5ALWA 3WZLA 1R9MA 5AKHA 2XUHA 2ZJ7A 2HU5A 3W9BA 2HA0A 5LZ7A 5IKXA 4J0JA 4KEAA 5EIEA 2K2QB 5SYNA 1GQRA 4LXIA 1KU6A 4G4IA 3I2IA 3H2HA 1TQHA 1XQYA 3IBTA 5JZSA 3ED1A 3H19A 4BZWA 3FOBA 4N8DA 3N0TA 2J4FA 3HC7A 1ZIXA 1I6WA 4KE8A 5T4FA 3WK6A 4C01A 2QVBA 3SC2A 3SK0A 3DYIA 4G1FA 3I2JA 3M82A 4W1SA 5ALVA 1JJFA 2BJHA 2QJWA 1DWPA 1IZ8A 3KDAA 3ANTA 1LPMA 2HA3A 3AIMA 2O7VA 5AM4A 2XQJA 2OXEA 2E3JA 1C7IA 2ZSHA 1VLQA 2G63A 5ALUA 3P2MA 4F60A 1LPOA 4P9NA 2V98A 2G5PA 3PFCA 5JAHA 3QM1A 1WHTA 5D7BA 5LKRA 3DOIA 3FAKA 2HDWA 2VAVA 3W04A 3QPDA 2WQZA 3UMJA 3DLTA 4UHHA 1DT5A 1E8NA 2CUTA 4QDTA 1AMNA 1TK3A 3I2HA 3AZOA 3FYUB 5LZ9A 4MEBA 5EIHA 2XUFA 4O08A 2DQYA 4Q34A 3VXKA 1DU4A 4J7AA 2PKYX 4Y2TA 1CUJA 4TVKA 3LCRA 5AKIA 2RIPA 1AGYA 2HIHA 3OC0A 2JGMA 1XRRA 3LLCA 4X90A 3C6ZA 1CUDA 1XQVA 4CCWA 4Y2PA 2PU5A 1G66A 4B84A 1A8UA 3I1IA 1JU4A 3RLIA 4ZREA 2CZQA 4JEIA 3WKEA 3R3XA 1FSSA 5CT8A 1NX9A 1H23A 4DNFA 5T4BA 1LNSA 2X76A 2XUAA 3VJLA 3FVRA 5LZ4A 2DHEA 5IVIA 5CT5A 2FUKA 1PFQA 1QTIA 1ZOIA 4RPCA 4F0JA 3RARA 4WCVA 4X3CA 1YB7A 1D07A 4C88A 5AKLA 1MAHA 4JYPA 1BCSA 3WL8A 1GT6A 5ALYA 4H7EA 2DQZA 4EY7A 5DYTA 4BRSA 5LYYA 3C87A 1QO9A 1CR6A 1AKNA 4X71A 3IB3A 3H2GA 3H0CA 1CUHA 4IH9A 5AJHA 1FJ2A 2BGNA 4Y2QA 1DT3A 1CEXA 1YCDA 4C6HA 3BWXA 1VZ3A 4MQLA 1O6GA 1G4HA 2HA2A 4BAUA 1AQLA 3K6KA 2Z5GA 3DL7A 1F6WA 3GROA 4BATA 2QS9A 4QDXA 2WG2A 2WSLA 4B85A 2X5XA 4FLFA 1MN6A 3WMRA 5CRIA 2C7BA 4DNOA 1U2EA 4FDMA 1CUUA 2CJPA 2QJRA 2GYVA 4JH0A 4UBNA 1VJ5A 4A5SA 4H35A 5FPPA 1CFJA 2O2GA 1QIHA 2XMGA 2I3ZA 3FBWA 2C5FA 2JGEA 3H18A 2EEPA 2QKYA 4INZA 1Q0RA 5T4HA 3EQ7A 1Q0ZA 4BAGA 4GEGA 5CW2A 1EK1A 1DWQA 2VJDA 1XZAA 4IH4A 4QA9A 5K3BA 3WIBA 3M81A 1UK9A 3WA7A 3ICVA 4DIUA 1EDDA 3QBJA 3AJAA 4EBBA 4CCYB 4UBLA 1ZIYA 5AK5A 4WDQA 3Q0TA 4UHBA 4B83A 1QIGA 3WWCA 4EHBA 4EUSA 5AKJA 3OOSA 4Y2SA 3V1MA 1A8QA 3O4HA 2WLSA 4Y9SA 5ALSA 4CIAA 2YASA 1UWCA 5FV4A 3ESBA 3C43A 1IMJA 1VA5A 3N2ZB 2XUQA 3O4GA 5BOVA 3WA6A 4PSCA 3QVMA 4WFJA 1BEZA 5DLPA 1VZ2A 2CB9A 1DINA 3JWEA 4PF1A 4BDTA 4BVJA 2WFLA 2X8BA 4HRXA 3PI6A 4H0CA 3K2IA 1W52X 3DQZA 1QIDA 5JATA 2AJBA 3AZPA 3HZOA 3EQ8A 2ECFA 5K3FA 1QTRA 2VF2A 1MNAA 2H7YA 4KAFA 4W1PA 3C8HA 5BWCA 1WM1A 3ZLUA 1QONA 2JGIA 3HLKA 2WHPB 2OCIA 4PNZA 5EIAA 4X94A 5IVKA 3FNBA 2YYSA 4HXFB 4RNCA 2PL5A 5KBYA 2R11A 3BE8A 2QT9A 1EI9A 3F8SA 4LYDA 4QZVA 3H2KA 3DEAA 1J2EA 1PV1A 1JJIA 4UBIA 4FFWA 1ZD2P 4FKBA 3CN7A 1XZBA 1ORVA 1OCEA 4MQMA 2PSDA 4FNMA 1TAHA 4OPMA 1ZJ4A 3DJYA 2XUPA 5E4TA 3T4UA 1FFBA 3F98A 3FSGA 3WWEA 5HFNA 3OPMA 4LXGA 2DHDA 1ZICA 1HPLA 4L9AA 3L1IA 5ALRA 1DTEA 4KACA 1CUWA 4RE5A 3R0VA 4JUIA 5DNWA 4F5ZA 5ALLA 4KJXA 4KAJA 1LBSA 3R41A 4E11A 5AKEA 5CH5A 5EHNA 2WUDA 3C70A 3QPCA 4H77A 5ALDA 1ZD5A 4WY5A 1EXWA 1MO2A 4OSEA 1ODTC 1RYYA 4M0FA 3R3YA 4B9AA 1XZKA 5LZ5A 3KOOA 4J3JA 4BE9A 4BTLA 1LBTA 1IZ7A 1CUBA 3WKCA 4CG1A 1CUGA 2J3DA 5D3ZA 1EX9A 3A2LA 1DWOA 4ZV9A 5HK9A 4CFSA 1YS1X 3VJMA 2Z3ZA 5ALOA 3WLAA 2WTMA 4AXBA 1P0MA 5FDFA 4G9GA 2OCGA 4LKOA 3V1LA 2WG1A 2WTNA 3WIOA 2XT0A 4BBZA 1XKLA 3F9CA 2C0QA 5AKKA 5ALQA 2RGUA 4YASA 5E4JA 1QIFA 2PX6A 3IUMA 3U1TA 2QR5A 4HVTA 3BJRA 3AZQA 2XQIA 2YH2A 4Q05A 1N8SA 4AZ0A 1VA4A 1H2WA 1U4NA 2WIFA 5AOCA 1N1MA 1MAAA 3ILSA 1MT3A 4L3WA 2PPLA 1UOPA 3A6ZA 3C5WP 1K4YA 4H7HA 3DOHA 5EHXA 1X70A 4NZZA 2RAUA 4OCZA 1DQZA 1HBJA 2GBCA 5LZ2A 1QFMA 1XQXA 4W63A 4ZV7A 2HL6A 4W1QA 5F4ZA 3STVA 5EFZA 3I2GA 3H04A 2PVSA 1ODSA 2RONA 1GQSA 4UFNA 1THTA 2HHAA 3RKSA 4H7FA 1L7RA 4CG2A 2VT6A 3LS2A 2O2HA 4IHAA 5A71A 2P8SA 2D0DA 3GELA 1EHYA 2VEOA 3EBLA 4B81A 4ROTA 4C87A 1A88A 4WFIA 5EGNA 1XROA 4AO8A 4BB0A 1YAJA 2XMZA 2O2IA 4GWLA 5AI9A 1M33A 1XQWA 4A23A 5LKAA 4OUKX 4B0OA 3HYSA 4ZI5A 1W6RA 5A6VA 1ORWA 1WCYA 2XMRA 4CG3A 1K8QA 3HJUA 2ORYA 4TPKA 3TEJA 5A62A 1N5MA 1F8UA 1WB5A 4G5XA 5A7GA 4AMYA 4X93A 4GDMA 4QLOA 3V9AA 2BUAA 1Z68A 1YAHA 2PUJA 3QYJA 2AJ8A 4NVRA 4YX9A 2QZPA 1OILA 4BRZA 3I1YA 3FCYA 2VJBA 5ALTA 5AOAA 3EF3A 4DSAA 3R3ZA 4BVLA 4MJ3A 4PQEA 4KAAA 2WUEA 1BS9A 5AI4A 3W2TA 2ONCA 1BROA 2XUJA 3AFIA 1C4XA 1H2YA 1P0QA 4B7ZA 2ZYSA 5BV7A 4QEKA 1JFRA 5ALEA 1T4MA 5JASA 1BE0A 2R8BA 1UKAA 4XIIA 5D6OA 1ACJA 3NWOA 4QNNA 3I2FA 1DQYA 4AO6A 4D9JA 4WJLA 1H22A 4J0CA 3C6BA 4H18A 2IITA 5C7YA 5AK4A 2IX9A 2WHRA 4U2EA 1LPSA 1G5FA 5AIBA 4Q82A 1E8DA 4I3FA 3V1KA 1ODCA 1XZMA 1AC5A 2WFZA 3G02A 5EHZA 1GGVA 3HEAA 4GW3A 2RI6A 3VVLA 1XLUA 1H2XA 2C5GA 4AX4A 2AJCA 2VTVA 5DWDA 3A70A 3M83A 4KYVA 4BP9A 2XI4A 2H7CA 1GPNA 4MWTA 2ES4A 4KRXA 4DSZA 1Q83A 3HRHA 4OU5A 4GI1A 2FX5A 2XLCA 1ISPA 3E3AA 4W1RA 2QMQA 5HF6A 2VATA 1WOMA 2XUDA 3U0VA 4KE7A 4X6UA 2QXUA 3LIPA 4HAIA 5AP9A 1X2BA 1BN6A 4B0PA 2WG0A 2Z3WA 4Y2JA 1QJ4A 1QE3A 3DKRA 3FCXA 4G8CA 2DHCA 2Q0XA 2RHWA 3STXA 1TKRA 4UFOA 5ALGA 1ZGBA 3O9MA 1HDEA 3FYUA 3OTQA 4CIBA 3WL7A 4JNCA 4E46A 1RWQA 5YASA 3WK8A 3L1HA 3NOXA 4Y2RA 2WKWA 5C8XA 3YASA 1O6FA 2PSHA 1BU8A 3UUEA 5BWBA 4G4GA 4FLEA 1XRLA 5HKAA 4QWMA 5I8PA 3HABA 2OQIA 1KEZA 1UZAA 3IUQA 5CT4A 3BF8A 4G9EA 2XQFA 5KWIA 3PE6A 5DYWA 3FYUC 4PSDA 3QH4A 1CUSA 1JI3A 4DYHA 2XUGA 1F0PA 1CUYA 3W05A 1ZI9A 2CEKA 4X97A 5DTJA 1WPRA 3M3DA 1MPXA 2BFNA 2WJ4A 2QTBA 2QM0A 2GZRA 4FNGA 3F67A 5JAUA 5JD4A 3LP5A 5AM2A 1YASA 4Z49A 5AM1A 3D7RA 3E4DA 3WKAA 3TGLA 2GBIA 3O4JA 1VE7A 4K6KA 2HFJA 1AURA 1R88A 5DJ5A 3I6ZA 1FFAA 3E1GA 4PSUA 3X3HA 4A16A 1JT2A 3WWPA 1LGYA 2BGRA 3R3UA 2QOEA 1WB6A 4HS9A 4X85A 1MTZA 1EB8A 3WL6A 4N5HX 1H2ZA 3A2MA 4OB7A 4FTWA 4AZ3A 1B41A 4UBKA 3C5VA 4S0XA 3V48A 4BC1A 1XRNA 3WJ1A 4DNPA 4CI9A 5K3FB 3DDUA 3I6MA 3TRDA 3WJ2A 4HZGA 4EA6A 3MVEA 5K3EA 3ZI7A 5HFAA 4ARBA 2QUAA 5DNVA 3OURA 3NUZA 1SC9A 2JGLA 4PW0A 5AI0A 4B82A 2AJLI 1GPLA 4N8SA 3WI7A 4BVKA 4V2IA 5FP0A 4BC0A 2W6CX 3ESAA 5HQ3B 4CCYA 2VJAA 1Y7HA 5ALIA 4AB1A 1IVYA 2OG1A 7YASA 4BYMA 3D0KA 5FXMA 1MX1A 5CBKA 1VXOA 2Z8ZA 4H7DA 5AH0A 2XMBA 3CCCA 3FLAA 4BCDA 2WIJA 3A2NA 2HFKA 5A2GA 2ZVDA 4Y2YA 2G4LA 3SX4A 2EDAA 4NS4A 1QIKA 2XLBA 4QDUA 4J0HA 1QOZA 3HXKA 1SCQA 2UZ0A 1AUOA 3KXPA 4N8EA 3FSGD 1LPNA 4E15A 1W1IA 1PJAA 1XZHA 4U2GA 5JD5A 3O95A 1JKMA 4FLMA 3KD2A 5HCUA 1TCCA 1RP1A 1MX5A 1XZJA 4DMCA 2PSEA 1J06A 1FFDA 2IIVA 2JF0A 5ALJA 3ZWQA 5K5EA 2HU8A 3RM3A 3VISA 1EVQA 3IURA 1CLEA 3EQ9A 1CUAA 2HADA 3IULA 3IDAA 5AKYA 2WHPA 1WHSA 1CV2A 2C0PA 3JYHA 1VOTA 2B9VA 5ALZA 1JU3A 1LZKA 3PFBA 1XLVA 2HA6A 1NU6A 1CUXA 3CXUA 3KWFA 5CT6A 1CUVA 3IUJA 4G8BA 4C89A 1JMKC 2WIGA 2HU7A 5KWJA 1BRTA 2Z8XA 3RK4A 2OPHA 1UKCA 4M0MA 3DL4A 4BZZA 1HLGA 4ETWA 3QMWA 3ANSA 1XZLA 2XB6A 3GBSA 4GHWA 3VJKA 1QZ3A 3MGAA 2XDWA 4OU4A 1TRHA 3ESCA 2JBWA 1WB4A 4MEAA 1EINA 3G8YA 2DCMA 5JADA 2WIKA 2OGSA 1DX4A 3VKFA 2XMDA 4C4XA 3H17A 2EDCA 3WZMA 2FJ0A 4LIPD 1QFSA 4FWBA 1R50A 2V96A 1KU0A 4UHDA 1XFDA 2B4KA 2HRRA 2Y6UA 3D2CA 2QXTA 4U2FA 3H1AA 2PBLA 3QMMA 4NMWA 3H1BA 4UBMA 3ESDA 3WKDA 4LYEA 4F21A 2QRUA 3B12A 1CUIA 2HA5A 3STUA 4BDSA 1P0PA 1ZI6A 4EB0A 1K5PA 2C4HA 3OM8A 3O4IA 4X91A 5JALA 1UT6A 5LZ8A 3R3WA 4N5IX 2G5TA 4I19A 1YS2X 5AM3A 4YPVA 5CT9A 2XMSA 1WPXA 4GBGA 5AI6A 4ARAA 5HZGA 4Q3KA 2H7XA 5AM5A 5DNUA 4Y2XA 1UOOA 1W4LA 1CRLA 3B3QA 1EH5A 5CTAA 3SWWA 1UXOA 3G9UA 4H7JA 2DSNA 2WJ3A 4JYMA 2I78A 3WWOA 1EVEA 3G7NA 2ROQA 4AMZA 4OYYA 1AX9A 4MXDA 4DTCA 4C4YA 1E3QA 4Y2VA 1CQZA 2PM8A 5LLSA 1N5RA 3PF8A 3T52A 3Q8WA 1XZCA 1YR2A 3F97A 4OB8A 1YB6A 3DD5A 1ZD3A 4U2DA 2VAXA 5ESRA 3KWJA 6YASA 1IUOA 3VDXA 3O9VA 3GA7A 3S8YA 2BAGA 4FOLA 2WJ6A 5IH7A 4IQ4A 3ZLTA 1SCKA 2XUOA 3FVTA 1UK8A 1XRPA 1XZGA 2OLEA 5JZBA 5D3KA 3STTA 4GXNA 4EY5A 2V97A 3DYVA 1UOQA 1QIMA 1CUCA 1BCRA 4FBLA 2O7RA 5CH8A 3DKKA 5FOQA 3WK7A 4TGLA 1F0NA 3PDCA 2OGTA 3ZPXA 2WILA 4ZXFA 3BDIA 3D59A 4XVCA 4IH1A 2XUKA 5AO9A 3GFFA 4G4JA 2ZYHA 1SFRA 2JGJA 5AKXA 2BUBA 5FPQA 4Q3OA 2GZSA 1U65A 1GKKA 1EDBA 2ACEA 3WQHA 3ZV7A 1XZDA 5C8ZA 5JD6A 1XLWA 1TCAA 4H7IA 1JJBA 2CKMA 3FWHA 3AILA 5HF8A 3E0XA 1VXRA 3AINA 3G0CA 4J03A 2PSJA 5CXUA 1E66A 2Y6VA 1UKBA 2DFPA 5DTIA 3C45A 4UUQA 1ZJ5A 3HI4A 4FMPA 5AKZA 4P92A 3CCBA 4KE6A 2WU3A 4Q1VA 4X92A 2GYUA 2YXPX 1R3DA 4BAZA 5ISMA 3QPAA 4WFKA 5AKGA 2I3DA 5E4YA 3GUUA 2H1IA 4UHCA 2Y1KA 2AXEA 2FJPA 4KE9A 3BIWA 1L7QA 4UPDA 1ZI8A 5FLKA 5DYYA 4ZRDA 5AIAA 3C6XA 4Y7DA 2HM7A 2PSFA 5HF9A 1CUFA 1G42A 1MX9A 5AM0A 4AN1A 3PUIA 4QWWA 2JGFA 5E2IA 3IUNA 3G9XA 1K6EA 3I28A 5K3DA 4PV7A 2C58A 3ZLVA 2PUHA 4K2AA 1VKHA 1R1DA 3IVMA 1P0IA 1EA5A 3D3NA 1QLWA 3WL5A 4J0GA 1UK7A 1A7UA 3BJMA 4B80A 3S2ZA 2JGKA 3DCNA 3BXPA 4LHEA 4ZWNA 5HKBA 3H2JA 3WK5A 3LIIA 5LP1A 5FKJA 3AUKA 5ALHA 2PU7A 1Y7IA 1MNQA 2XMQA 1UK6A 4MYDA 4BE4A 3TJMA 4MWSA 4EY4A 5AK3A 3HACA 3D2AA 3NGMA 1CQWA 4U2CA 4HXEB 1QGED 2VJCA 3AIKA 5ALXA 1J1IA 2V9ZA 3BL8A 1U8EA 5JAOA 3MUNA 4X6YA 1XZEA 4AO7A 5AHXA 1DX6A 3JW8A 3R3VA 2WM2A 4ITVA 1S8OA 1LPPA 3QITA 1VE6A 1GPKA 3MUOA 1CVLA 4UBOA 1EB9A 4W9RA 1LLFA 2J3QA 3IIIA 4BCBA 2VQ6A 4UFPA 5AI8A 2JEYA 3F96A 3EIOA 2WFLB 5H3HA 1UFOA 3D2BA 2WUGA 2ACKA 2VA9A 1R4ZA 1XRMA 1TIBA 1QO7A 4J0IA 1ZGCA 3D4LA 2NW6A 1A8SA 1L7AA 5LIPA 4Y2UA 3QZUA 5HK8A 4E14A 3DNMA 4FFVA 5JYCA 5KREA 3K9BA 4L72A 4BP8A 3STYA 2LIPA 3W9UA 4HXGA 1MJ5A 3C8DA 5K3CA 5AICA 5IVHA 4GLBA 4UHFA 2JIDA 4LXHA 1LPBB 3GZJA 4L0CA 4UBJA 4QE3A 4RGYA 5K3AA 5EHQA 4X7BA 4KR0A 4IO0A 5JIBA 4HTAA 1XZIA 1QIEA 1CPYA 1HKHA
chains in the Genus database with same CATH superfamily
1JA9A 4Z51A 1HE1C 1JR3D 3L8HA 1SG9A 4D8WA 3KKZA 2XUIA 2DY1A 4DBZA 3DO5A 2C8VA 2VRCD 5E3JA 4LF4B 4FHZA 2D00A 4HUTA 4DDWA 2O8CB 5C46F 5H5JA 5FBKA 2O1EA 4HNAA 4QLAA 1AHHA 3CX6A 2J8ZA 3C3BA 3VR4H 3IELA 3WK9A 2ZLBA 3UZUA 1C0PA 4RKYA 4FXPA 1VLMA 3MJHA 2PD3A 3ZY6A 3ABOB 1X77A 4XYLA 1EGQA 2NO1A 3OMLA 4HBGA 4OREX 4L6IA 1L5KA 1YFKA 3H9QA 4M8NE 2FSGA 4PGHA 3E9DA 4AUEA 4F4IA 7ABPA 2DR0A 4ZOLA 1LTKA 1THZA 4Z0NA 2VYFA 4PC7A 1WJGA 1ADBA 2G71A 5BNFA 1Q1QA 2J9GA 4Z4QA 1C9NA 2OEPA 4NS1A 1TC1A 1Z16A 3K30A 3GDHA 3NHBA 5HOQA 4P4LA 3F49S 3R7LA 1TTTA 1ZVMA 3G9TA 1BEEA 2FY8A 4IF6A 4XW2A 3WKBA 4NBRA 5ALKA 4A0HA 4AY5A 1AKMA 2HOQA 3IPAA 1E89A 5A1JA 4KRFA 1NSTA 4QDJA 3HVUA 4AMVA 4BV2A 4D79A 5TGTA 4E5YA 5GJBA 4P31A 2FGKA 2C4TA 2NUAA 4PLGA 4L51A 4FEYA 1G21B 4GKKB 2GK4A 5IUNC 4ALLA 4GEKA 3COJA 1NN1A 1AQIA 1RMTA 2XITA 1Y1TA 1IE3A 3K9LA 3PZRA 1BSVA 1LY1A 2EWVA 2QVCA 5BQ3A 2PS9A 1IQPA 1TGYA 4P5PA 3B9BA 3BN3A 4RHEA 4OATA 5F23A 2JLUA 2E1RA 2GEDA 3RU7A 5TC4A 1RZVA 4QUJA 2VUIB 1X1AA 2H0RA 2IGBA 2RBKA 3W8RA 1PX0A 5K20A 1A4UA 9ATCA 3IEKA 3ZWNA 3OCJA 4BY9E 4TUYF 3UMFA 1P5JA 2B4AA 1XTZA 1Z06A 4UUOA 4EA8A 1G63A 5TR9A 1JQKA 3L02A 3Q88A 4GYYA 2FZVA 1Z5GA 5DASA 4BNWA 3EUWA 4V0NA 3TOZA 2J30A 4MWDA 4J0KA 2X8JB 1H1DA 3MXTA 3PC6A 2AN5A 3P9YA 4GPTA 4J49A 3NHJA 4FGZA 4QUIA 2N0SA 3N59A 4AURA 1WULS 3TQCA 3QTBA 3PGJA 1K9VF 4B6GA 3JPWA 4EGAA 3L8MA 2R5NA 1VIAA 3BCSA 3FHCB 4FDAA 2HRQA 4YMWA 5BUSA 3ER9A 4IMPA 1BMDA 1I01A 1MXHA 4OB6A 1E2NA 4XPZA 1U8YA 4KC0A 2E5WA 3GMSA 2J0QA 2QMZA 1WXEA 4L4SA 1Q20A 3GLHA 4H0FA 4YJHA 1E0KA 2Y4NA 3O0DA 4DXAA 4E32A 1VKOA 4G0NA 3RK0A 3O75A 1LX6A 1JMYA 3C14C 1B8UA 2QTZA 1YJBA 4PCLA 2IXDA 2FCAA 2YWEA 1LZLA 3LXUX 1WE2A 2OCLA 4TMWA 5DSXA 4ARSA 3JWHA 2C98A 2VNSA 3K0CC 5JZ9A 2R751 4GLLA 4GQBA 5FR1A 5K0GA 4OXXA 2KB0A 3LV8A 5TS2A 4Q16A 2FW0A 3B1XA 1LW7A 2AEEA 2C5AA 4UAGA 4H3HB 4OH7A 5FUBA 3RVQA 1VG9B 4X95A 1P2BA 3V3KA 4JROA 1RHKA 1YBHA 1YSCA 4FBMA 1SBCA 4MGIR 5A7FA 3ZGVA 2CSUA 1VSUA 3ZGNA 1TUGA 3A10A 1JDUA 2J6BA 5MHTA 2AFHA 4CWAA 3KK0A 4RFVA 4PXYA 2F17A 1SG6A 4PQRA 4Q4HA 3RABA 4NFHA 2B69A 3UIEA 3OE1A 1VECA 1PQUA 2QUBA 2VK2A 1UPUA 4J4BA 3PICA 1YA8A 5EE1A 3V6LA 1LLCA 5J59A 3AFHA 4PN3A 2AOTB 2ODEA 2CXPA 5JJBA 5J1SB 5J58A 5LBIA 1KJZA 1LJ8A 4J2HA 4OYLA 1GY8A 2DX7A 3PRYA 5J1TB 5BSRA 4CVNA 4UU7A 3EJWA 1Y6JA 4HS4A 2B61A 3NYQA 3GUVA 4L3OA 1AK1A 3NBXX 5ICFA 3RIEA 4Q4AA 2Q5FA 4O25A 2ZUTA 1AHIA 1E8MA 3L6RA 3FPKA 4MROA 4MW0A 1PGPA 3PR1A 2P7HA 2AK3A 2QEQA 2ZFUA 4I55F 5JBIA 4B4UA 1NUQA 4ENPA 1VDMA 1VGRA 2MR6A 4Y3UA 4YBRA 5JAZA 4BUCA 4YPFA 3RBVA 1T8YA 4WKNA 3AI7A 4B6EA 3SP1A 4HB3A 3V1NA 5I48A 2X9GA 3C3EA 3SF8A 1T6YA 3GGPA 1M2WA 1Z62A 4IUBS 5EJ9A 1K7FB 3CN9A 1IUNA 2COKA 1N9GA 5HUJA 4MRVA 1U1CA 3QFHA 4IDOA 5FLEX 7ADHA 1F7VA 3ZJUA 3LL4A 4PVDA 1RE1A 3LK7A 4I6GA 1UOEA 4IWXA 4JBIA 1BW9A 4PZ0A 1F3OA 4P4TA 3RYFA 4YUZA 3V42A 2RARA 5A3JA 3HN6A 2FN9A 3VX4A 3BVPA 3CSSA 5DCYA 1PJ4A 2VKQA 1UBHS 3ZEAA 2V1UA 4GM4A 4MWBA 2RAVA 2YNMD 3BOSA 1BA2A 2AF3C 3IALA 4TQ9A 3TOXA 4BNVA 3H83A 4YRQA 3PGA1 3PHBE 1P8AA 4L8VA 2BSQA 2OUKA 4MR7A 2EHDA 2QPTA 4H08A 4XE5A 1H5NA 2AHOA 2CYCA 1Y9DA 2ZJBA 4LZAA 1HDIA 2UUPA 1L4BA 4YJFA 4MH0R 2ZI3A 1GKLA 4IQGA 2VUTA 2G9NA 2HN9A 3IR7A 3Q8XB 1R9NA 3UXYA 5IHXA 5H1YA 1L7MA 2O2CA 4IRUB 4K1XA 3VZPA 1RCUA 4G97A 2FQQA 1QFXA 3E84A 1ZSNA 2NV0A 3EGOA 4Y0AA 5ALPA 3U3JA 2OB1A 4PYIA 2CDNA 1RAEA 3TPZA 4E03A 3VUFA 4XSVA 1QS0A 1JJVA 2QAGB 2XTZA 3KSZO 4YR9A 4EJ6A 2VZ9A 1JEAA 4OMDA 1A95A 1SBTA 2CJWA 4FE7A 4FP9A 1GTZA 5EIBC 2AYZA 2NU6A 2WOJA 4YUVA 3RSCA 4FFRA 4J2OA 2I55A 1TTQB 1HL7A 1XKTA 1Z2DA 2D2XA 2QG4A 4AJEA 4OK6A 2F9FA 2O5RA 2VP3A 1TZBA 1EBBA 4P82A 2JA2A 3IOYA 3UXMA 4OQLA 1IMOA 3NC4A 2EP7A 1ACLA 4YGXB 4CV2A 1BWSA 2OSVA 3VO8A 1CR0A 3OF2A 5EMNA 3DDZX 4EVSA 2W37A 4QGFA 1IJKA 3L41A 4G89A 3PL5A 2AVNA 2PL3A 4EGJA 5ALNA 4WK6A 5L8VA 4KIUA 2ATIA 2IXEA 2ZTVA 2ZVQX 4O4IB 1MAWA 5LMUB 1T2NA 1EXMA 1F6BA 1N3BA 1Z28A 2BCEA 4L50A 3WGLA 1WW3A 2XJ4A 3COVA 1KJIA 4B2IA 2ZJ5A 1GZ7A 2XB4A 3G6WA 4V0LA 3ZHCA 5C52B 1NNEA 1EFAA 1WCV1 4CLHA 3MZ0A 2I62A 4KRYA 1BJTA 4DIMA 3BL5A 2ZYRA 3VKUA 2IYFA 1T5OA 1UCFA 3H5IA 4YO8A 1TF5A 1SCUB 2B2NA 1FS6A 4G0QA 3LFHA 2ZPTX 1VKZA 3UT5B 1CUZA 3N28A 4NL4H 1K89A 2F48A 3A14A 3BHMA 1EM8A 1EFHA 4UZFA 3RVDA 1NJGA 1X80B 1A71A 4O2BF 1E2FA 5CA1F 3QHAA 2X0IA 4ZVUA 2R85A 1XA3A 3PGLA 1KO1A 3KSRA 3SGLA 2WZBA 2WKPA 4RL6A 4ZC8A 3IHLA 5BQ5A 2D7JA 4IEIA 4E5MA 4U0JA 2WA1A 3AJDA 3E48A 3WZLA 4TLMB 1E0DA 2V0GA 1Y8QB 2BBOA 1R9MA 3TIFA 3PFHA 4EITA 2R68A 4N7JA 5AVUA 2HQOA 3N2KB 3EYWA 2C3MA 1G2IA 3A6FA 5EP4A 5GPBA 2BGLA 1R8SA 3D6UA 3O38A 4BEBA 1R27A 3W9BA 3ESRA 2J3EA 3R6DA 3CNHA 4KUGA 4WNAA 3GL9A 2UU9B 2K2QB 3GJ6A 4RH3A 4LJ8A 1GQRA 1TEHA 5SYNA 1RWPA 5LJLA 1VPTA 1W2WB 5BPFA 4WN9B 1ZR2A 3E2PA 1MFPA 3EIUA 1QCYA 2JPDA 1M6EX 1E7WA 1R0ZA 3IBTA 4RJTA 3ICEA 1DPGA 1GUDA 1ZAKA 4UVIA 3HK2A 2JJYA 1I2AA 4K8RB 5E8JA 1XLTA 2FFBA 4N8DA 3RU2A 3N0TA 2FEMA 2IV7A 1NE2A 3JVEA 4PZAA 4WLEA 3AC0A 3MTAA 3THYB 1JRLA 4HNRA 4XYEA 4EEXA 3LL7A 2J4DA 4ETIA 4IJUA 4DARA 3WK6A 1HM5A 4C01A 2QVBA 5F1PA 3U49A 3MAGA 1P2TA 4Y98A 1J09A 1K8RA 3B3AA 5EP2A 4G1FA 5IF9A 1Y3FE 1PK8A 3I2JA 5ALVA 2P4UA 1JJFA 4CM3A 2BJHA 3EODA 3A3YA 4JEMA 5GQSA 3UJ9A 4D5GA 2RGYA 5AW7A 4OGKA 4AF7A 1S2NA 4M9QA 4GC5A 2DPLA 2P9HA 2UVPA 3VU8A 1BXGA 4MVJG 4X20B 3ANTA 3AVQA 3FR8A 4KUHA 3ZHUA 4MQFB 4WOCA 3TOSA 2ZAIA 2HA3A 5BMVF 1UC8A 4HQOA 5KYVA 3T1NA 4E13A 1H0HA 1R0LA 1C7RA 3IUBA 1L5GB 4I66A 3T9AA 3FOWA 1NC3A 3P0FA 2VAWA 3T0IA 1CBUA 2F90A 3HYRA 4B8YA 1YQXA 4DYVA 4TRJA 1AF4A 3RJ5A 1BYUA 2ZSHA 1VLQA 3EX7C 2VI5A 3ZXIA 5E9JA 2MTBA 2YVLA 2C84A 3I5UA 2Q7XA 3T9EA 4A5OA 5KTOA 4XX0B 1US8A 2AUTA 4LSMA 1QMPA 5ADVA 3P2MA 4JOQA 5JDIC 5CGZA 2VBCA 4BV9A 4F60A 1FU4A 1VBMA 1LPOA 4OOFA 3SJUA 1Z6YA 4P9NA 4Z0HO 5CBPA 1K92A 3DMTC 2HZ7A 2VF4X 1QAMA 1KDVA 1GQOA 2AD5A 2V98A 2UZAA 3O8QB 4NENA 3FMPB 3QM1A 4O5OA 5I5GA 5JAHA 3WHIA 1F7UA 5D7BA 5LKRA 1PAUA 4XPIA 4CKZA 1ZW6A 4YMUA 4DR1B 3U44B 1VSQA 3FAKA 3BHNA 4PRLA 5IAKA 1IM2A 2EX1A 3OAAD 3DLTA 4UHHA 4KXMA 3SIPA 4IBOA 2NUPA 1G8JA 1RI1A 3HWSA 5KVVA 3V4PB 2PKRA 4IXMA 1XPRA 4TTQA 2CUTA 3CV3A 3I30X 3AUSA 4IDAA 1Q19A 1ZGZA 2PEYA 4MPDA 4RJJA 5BYBA 2DOKA 5F64A 1TK3A 3OZCA 5DIZA 4DIOA 3PNVA 3KB6A 5DBFA 1OXBB 1KZ9A 3KEGA 1LDNA 3AZOA 2B4YA 4RPGA 3GLFA 4B2PA 2MDTA 2AI1A 1ZNQO 4D3ZA 2Q3EA 1KAEA 4B76A 3AG6A 3KVOA 1AKRA 1MG0A 3GLVA 2HI0A 4YFYA 1C1DB 4J91A 3GARA 1MB3A 1T5HX 1CUJA 4OP1A 4RKQA 4XCVA 4Y2TA 1QGUA 4B40A 5C1OA 3JRXA 2C5SA 1TMKA 1P7ZA 3E18A 2ID8A 4L7QA 2OORA 4LJ6A 4LXQA 3LCRA 2OGWA 4UE2A 5JBNA 3UGJA 2LCFA 1Z7YA 2Q2WA 1KYVA 4MS1B 4QGBA 1EESA 3S2YA 1LWNA 1MC5A 2W6IA 3O21A 1QRTA 2QSJA 2JGMA 4JD5A 4K9MA 4MVJP 4R0NA 3WRYC 5IZCC 4XR9A 3N70A 2GTHA 4X90A 3DVLA 3O4VA 4IJ5A 3OOWA 4WEQA 3HGTA 4WUVA 1M2OA 1CETA 5FOWA 1V8FA 3K72B 3E7DA 1W4RA 1E9DA 5EKUA 1NPTO 1G98A 1J0DA 4EFLA 4EPRA 2GCPA 3UA3A 4B3XA 4CCWA 2CD7A 2PU5A 4JB8A 4X1IB 4B2YA 1NZFA 4PYJA 1T6NA 2DERA 1N2IA 1ZNWA 4IS3A 1QF9A 1V8PA 2R1VB 2GNAA 2JLBA 2RBGA 4TL8A 1FNSA 4EKGA 1JTVA 1P62B 2YV4A 4G9BA 2JHCA 1DEOA 4D26A 3UKJA 1NX9A 3FFXA 2IPXA 1H23A 2VTBB 4DNFA 4KHPB 1HYGA 3K8OE 4C6RA 2BTEA 2XWSA 2Z4RA 3HUTA 2NGRA 1LNSA 2QYSA 1XDWA 2XUAA 4JYZA 4QOGA 1BIFA 1DXYA 3OX1A 3AM1A 5KKAA 5LZ4A 4P58A 1YHZA 4DR3B 1D5CA 1NHWA 2LRHA 4GLJA 3JAMA 5IVIA 5JJLA 2A5DA 2G88A 2FUKA 2WWWA 5HXAA 1ZINA 4NEGA 3PNMA 1E4EA 1D2AA 3HP7A 4WCVA 4FHDA 1CT9A 1E1MA 3CEAA 4CJXA 5IJ9A 5JQGB 2PD4A 5B4TA 5DGXA 2IUFA 4FHCA 1XA0A 3D3EA 1MAHA 4NFLA 5F9MA 4F92B 4US2R 1RW4A 2N46A 1RTTA 5JH7B 3I6QA 3U4MA 1BCSA 3EXFB 3WY9A 4FZ5A 4A8HA 1HLDA 4MTLA 4FGLA 2D2EA 4IMIB 1GT6A 4H7EA 2DQZA 4HEA6 4JDUA 3TQQA 5DYTA 2IU3A 4UNQA 1YUBA 2O07A 2QTLA 3AHCA 1C8VB 4JK3A 4O59O 3NHAA 3WGJA 1WD7A 3M9XA 3C87A 2HDHA 4AG3A 3PX2A 4HYQA 3VA7A 2XODA 1AKNA 1O94C 3IB3A 3U19A 1SKYB 3H0CA 4MQEA 3R6TA 4MHOA 1E3JA 1Y80A 4O4JA 1MPTA 1QK4A 5DLQC 5LU8A 3L07A 1GPH1 3OVMA 4GPEA 4PTZA 5DBGA 1HFEL 4H9GA 4YUAA 1HE8B 2EFEB 5G4LA 3EC1A 4MWZA 2NP6A 3MRTA 3TRKA 5IKPA 4B31A 3GNTA 1RKVA 2BGNA 4YAFA 5KJEA 1DT3A 3OPXA 1UDRA 3CONA 5IZ4A 1XHFA 1VMKA 3BGIA 4Q3NA 1BD3A 3JASB 3QBDA 4C6HA 4YCBA 3BWXA 1VZ3A 2JLCA 4P0QB 2BF4A 2DKOA 5HJ7A 2GJ9A 1FP4B 2LBPA 2OOKA 3E9MA 5BT8A 2Z83A 4O4HA 3ZIUA 2ZVJA 4CM8A 4BAUA 2HCBA 4M8IA 2FWIA 3RVOA 1UXGA 3EIQA 3IT2A 2I3AA 2GN4A 4POOA 5C1BA 2GCNA 2OC4A 1KERA 3U3KA 3DDWA 4Q1CA 3GROA 3AEXA 4YWJA 1K7XB 1G8SA 2QS9A 3DPUA 4Q00A 1N7GA 2Q7DA 4LZOA 5EJ4A 1RU3A 1AKVA 1KQ3A 3PR2B 4Z7JA 4AL4A 1SMKA 4AUNA 3RS9A 3FUVA 4GSKA 4DJDC 1QCDA 1U9YA 3A9TA 4G0MA 4RIIA 3LA8A 3U3ZA 1OROA 2W83A 1GG8A 1ECLA 1MN6A 1P6UA 1VP9A 2ECOA 1QLHA 4XJSA 1FS4A 4AJ2A 3DJFA 3GRUA 3OIDA 3M33A 4IX9A 2Q4DA 2FUEA 1FXWF 4F7WA 1F48A 3BS4A 3LYAA 4XDHA 2B37A 1DKRA 1CUUA 2YJ3A 2FW8A 2GYVA 3V8EA 4CDNA 4EHFA 3OHSX 4FFLA 1MVOA 4XUCA 1PRYA 4ZCIA 3VR5A 1QIHA 3ZGYA 3ZK9A 1XTUA 1Z2NX 4D8UA 1Z5VA 4RDXA 2BY4A 3FSEA 4D9BA 1ZO8A 4FYYA 1P17A 1E6LA 2O3SA 1GTVA 2VIIA 4QJIA 4DZTA 1N9KA 3C3XA 5T4HA 3KE8A 3PG5A 5J23A 3M6AA 4M8LA 3AEKA 2FH5B 3AOEA 4C07A 3BGSA 4XCQA 5JD3A 1E4YA 5FNVA 2BTQB 4KWHA 4JP1A 3PX7A 1EWVA 4IH4A 1A9SA 1IONA 2VJDA 1XXLA 4KFCA 3Q8MA 2PGXA 5IDYA 2G5CA 4O8ZA 4MP3A 1UK9A 3TIIA 3VU1A 2ODNA 3ICVA 3SS9X 2XZDA 2Y1LA 1QVZA 2FW1A 2O20A 3A9WA 1WQ3A 1TM1E 3AR2A 4M8SA 4PHGA 3SIXA 3AJAA 3CPHA 1LVHA 2XVXA 1KR5A 4ID3A 4ZVKA 3VM6A 1T91A 3AEUB 2RAFA 3MTGA 4QRIA 1JG3A 1E9SA 5HQTA 4HNUA 1SHUX 1RM0A 4C0HA 3A6PC 5BR7A 2LP4Y 5CVVA 3Q0TA 4UHBA 5TQ0B 5KOJB 3E82A 4GM1A 4JJKA 5FAKA 1O8CA 2I34A 2QW0X 5F12A 3TOVA 3K70B 4FOPA 2CVPA 2RC6A 3GQBA 4NCAA 2HSDA 3UJDA 3O83A 2GD2A 2WDPA 3OOSA 4JB3A 4BO9A 3AVXA 3GG2A 2FUNB 3INRA 3VDQA 1A8QA 2PY6A 3GDGA 1JXQA 4L57A 3LDAA 2HH9A 1O6CA 5EJIA 3VU9B 4ABYA 2CUZA 4NBLA 4U2KA 2WLSA 4HGPA 4Y9SA 1S8AA 3RUPA 1UJ2A 1C5KA 5K8JB 4NSNA 2X5OA 3WGYA 3VKHA 2PUGA 3D4NA 1P7CA 2YVKA 5FV4A 5IN5A 2ADMA 3OICA 1VHJA 4N9QA 2PGJA 4ZYUA 3IKJA 1KH3A 4W5WA 1NMXA 1WBDA 1J23A 1RE0A 3Q2KA 4KI0A 4L0QA 4LSWA 3O4GA 3NM4A 3KKMA 3OY2A 4AZSA 5TF4A 4BLQA 4BO3A 2ZUEA 3ONFA 4PSCA 1J8MF 3QVMA 3GC6A 3N0VA 3U3XA 1EBFA 3NJ8A 3OWOA 5M29A 3C5CA 1BEZA 5EESA 1HC7A 4MLDA 5JMWA 1VZ2A 5JJIA 4TTPA 1QFJA 3CEHA 5EUMA 4CW7A 4LRQA 1KF0A 1T9GS 2OCXA 3EGVA 3HBAA 3W4IA 4ZCPA 2IJGX 4AJ4A 4BEJA 2X8BA 3AK4A 1XNGA 5ADHA 3K0BA 1R0BA 1Z29A 3PI6A 3I62A 1LB1B 4Q6WA 5KVAA 3K2IA 2ZBFA 1YH3A 3K0AB 5BWMA 1H2FA 1V1RB 5JATA 4UM9B 3B1KA 1II8A 2QJOA 1B0AA 1F14A 4LSZA 1T9HA 2GJ8A 3FCCA 3CLTC 3D5QA 3KUDA 3CH7A 2HRZA 4ACBA 1RWOA 4PHFA 1NAIA 2HZBA 2GH1A 5ECWA 2X1LA 4JYCA 4LHVA 1ZAYA 1T8RA 1HV8A 1W93A 2ECFA 4GP6A 4HH0A 2R6GA 3A6GA 4IV0A 2Z98A 4IV5A 4MW4A 3IB6A 5K3FA 1QTRA 3FI0A 1SVMA 1GGHA 4JX8A 4COKA 2G7MC 2VF2A 3T9DA 1T3LA 4OI2A 4CKCB 2H7YA 1PO7A 3RD5A 3QHPA 4KAFA 1BKYA 2CFTA 3S27A 1XVLA 1DELA 1X86B 3MFQA 2ZIXB 1RLUA 4FYMA 5EE9A 2JDIA 1WM1A 1UKVY 2A9FA 2BEWA 3HRIA 3MSCA 3OTWA 2ZI4A 3QLUC 1TA4A 3ZLUA 5C18A 2JGIA 3H5AA 4YJ3F 3AVYA 4ZRMA 2DR2A 3SJBA 5KNBA 5FBVB 3WNBA 4C6SA 3P19A 4ERNA 3HBMA 5E6RA 2FPWA 3ZE2B 1YGPA 1EWKA 2YYSA 4QHSA 2VWQA 2VQFB 2FMTA 3IUSA 2PGNA 4RNCA 2WWXA 1DFGA 3S0JA 3N8NA 2O52A 5KBYA 2VCHA 2X7XA 5CA0A 3ZOKA 3ABQB 5CX4A 3MUEA 2O7QA 1PEKE 2REQB 3A4VA 4IIYA 4RH0A 4B32A 4F4UA 5JCJD 5KWEA 3L4EA 4D3YA 3SMQA 3F8SA 2XGGA 1RHRA 4C20A 1IYZA 4NCHA 1VMIA 2YXEA 2RI1A 3H2KA 1OLXB 1W25A 3DEAA 3DQQA 4LMRA 3ZE9A 1SUAA 3ZHVA 4RY0A 3W5CA 1JJIA 4HLNA 4UBIA 3FBGA 5HBGA 4FFWA 4X1KB 3K2EA 4XVRA 1H94A 1ZD2P 3E9NA 1Y34E 1L5QA 4CUJA 1YR1A 1BGWA 1OCEA 1V8DA 4MS3A 1J8QA 2GN8A 4FNMA 1E69A 5E2AA 5I01A 2IEGA 2X8AA 2YC2C 3TKLA 2ZUDA 1UMBB 1XTBA 1M2HA 4GZMA 3TR0A 3QY0A 1EP2B 1LLUA 2LDXA 3G17A 3K8QA 1E2IA 4KQ9A 5E4TA 3F98A 4ER7A 1ZMRA 3EDQA 3WWEA 2GZAA 3I39X 1R4NB 5FYDA 4EL0A 1N25A 5U4QA 4I08A 3OZXA 2C2WA 2IOFK 4IHQA 2B94A 2D54A 2WAYA 5IT9A 4EBFA 1DXOA 1K88A 5KTSA 2RGNA 1ZICA 2FG7C 5FI5A 5BN5B 2I4NA 1ZS9A 3CRVA 3G8AA 4L9AA 5B53A 2EQBA 1DTEA 2CJYA 4KACA 5HIIA 3VAYA 1PG0A 2RGWA 2YZ2A 3D7SA 2OO5A 1ADGA 2IDZA 2Z2JA 1B8PA 3BWYA 1BHSA 2HMYB 4PRYA 4F5ZA 5CFLA 4ZVOA 4KJXA 3W5AA 1U2SA 4MRMB 2Q07A 4C7KA 2R66A 5COBA 5EVJA 4R1MA 4OV6B 1Z2EA 3W1EA 1K06A 4GKAA 3OCVA 4E11A 1Z88A 3PE4A 1U3DA 1VI5A 3Q15C 2QQ5A 4RK5A 3KQOA 4R7GA 3OLWA 4PYMA 1GYRA 2ZETA 1Q0TA 1ZD5A 4XIJA 1X7DA 2ZI5A 1B7GO 2HF9A 2QTVA 2AMLA 3P2EA 1IWOA 1P2FA 4X8MA 3GDOA 4RVDA 1UQRA 2GJKA 2ZRDA 3DWEX 1WZIA 3VU3A 1RYYA 3X1JA 3R3YA 5H16A 3HQ4O 3VR3A 3UJPA 4XARA 4ARVA 1YRWA 4AQYB 4J3JA 3AVUA 1JLSA 1TAQA 1B42A 1NULA 1CUBA 4G09A 2ZQYA 1TVKA 4JSTA 1XGKA 2CW5A 4UDYX 1LDBA 3UO8B 2OCAA 3DZCA 4QPPA 3HUDA 3AETB 2FNAA 3R4VA 4FQ8A 3JQAB 4OSOA 4F04A 1SZJG 3B6EA 5HK9A 4JKIA 4KNYA 2B1IA 4CFSA 4C7XA 4D8XA 1YS1X 3ZZMA 2WSIA 2J5XA 2JLVA 2I87A 1OI2A 1XXHE 1UQUA 2TMGA 2X14A 2J46A 2N1MA 2BH9A 3LG2A 3MUFA 4G9GA 2OCGA 4LTNA 3DAYA 1T1SA 3LGAA 2DYKA 2NO4A 2EFGA 5IKOA 4C14A 5AW5A 3MPOA 1PHRA 2R5FA 3V1LA 4EG8A 3EG9A 2UXDB 3UKDA 5CM8B 3VYSB 3KT3A 1Q6YA 3EEIA 1OPRA 4JNKA 4E4YA 5G40A 3QFRA 1IOZA 3NBQA 2I2WA 5AKKA 2RGUA 2E4XA 1U5CA 2J9ZB 2W58A 1ZNZA 2C9YA 4RPHA 1YMUA 1MIOB 4AJ9A 2AFIA 5HRAA 4JP8A 4R8KA 3T9BA 2IZ7A 3HP1A 4R8RA 5AHKA 4HDSB 3MT0A 2AA3A 2NN3C 1JECA 1Z45A 2O1WA 1XRSB 4AJNA 2FHPA 4CQLB 4X45A 1W5TA 4DN6A 1A69A 2JCYA 2WPNA 4BLRA 4BO2A 2VTKA 5C4GB 4HVTA 4LC9A 1W49A 4Q3BA 1VYHA 2JGDA 4FYKA 1KVRA 4KQEA 3TLZA 4MR9B 1Q12A 3UAWA 1E2GA 3NNSA 2OA0A 4L3VA 4X1OA 3SJAA 3SZRA 2PL1A 1U4NA 4E5UA 2N3ZA 4F84A 4BO7A 3MB8A 4DLVA 2OBFA 1LU9A 1MAAA 3UPDA 1K4MA 4JLKA 1KI9A 2AMJA 4L3WA 1L8QA 1GLGA 2Q6IA 4C7MA 1UOPA 5LQJA 1FS5A 2V1XA 5AHWA 3VI4B 1JBQA 2B34A 1Z6XA 4ZVQA 3MMPA 1XELA 4LBZA 4YJGA 3U1VA 4BMPB 3QA9A 3AQ4A 4LE2A 1NAHA 4M1KA 3OSUA 4DMMA 1FNDA 3DOHA 1OLSA 1I3LA 1IHUA 3E5RA 2ZRHA 2QQFA 4GRIA 4DGSA 3HZRA 4D0GA 4OCZA 1J7KA 1MBZA 5AOVA 4X63A 5EXXA 2AV6A 2XKJE 3FKSA 4QU5A 4DRXB 6ADHA 2IEIA 4DUGA 1PJSA 2YQZA 3ORYA 2JARA 2JS7A 2P6MA 2E37A 2QL7A 4MV8A 4ESEA 4CGYA 2I4MA 5HM8A 1GUFA 1CY7A 3DP9A 3A1UA 4QD3A 3B36A 4OBBA 3IAS1 1KEWA 3F3YA 3LY7A 3WGNA 4EOGA 5F4ZA 4QBFA 4RC9A 4FR0A 1NY6A 2DXIA 4JBYA 5EFZA 3R75A 2PJDA 3GDFA 4FKMA 4K2HA 3I2GA 2ZU0C 4EI2A 2G0AA 3H04A 2I6FA 1KMIY 3OD1A 3TPFA 3K0HA 1NXPA 4OKSA 1CJTC 1MXFA 3UK7A 4ZK2A 2OZEA 5AW8A 2IXTA 2C5BA 1UM8A 3A4MA 2OZPA 5DEOA 4DCNA 1TRKA 1G4AE 1L7RA 2O50A 4H1VA 4OLFA 3R7SA 4CG2A 3LS2A 4EYEA 5T7BA 4NE9A 4WX2B 3O74A 1OX6A 1AGNA 2HQBA 3DBHA 3CZ5A 2B6HA 2FZCA 1N8TA 4TMFA 5EIOA 1N2SA 1H6BA 1VJTA 1DBRA 2OXFA 2DE0X 3GB9A 3T4PA 3G89A 3EARA 3TTWA 2FOLA 3QTLA 121PA 3H11A 3CPJB 3LFUA 1JT9A 1FDWA 2JHPA 1F0KA 1EP3B 3PFFA 2PA0A 1XROA 4KHZA 4XQGA 3UWSA 5FPKA 2PS3A 1XZ8A 2LKCA 1YAJA 1GR1A 3ORFA 4XYMA 4NBNA 2YWDA 3VPHA 1N2CA 2O2IA 3BFVA 5MFPA 3L7MA 2FLWA 1M33A 2GCOB 2BE9A 1OYWA 4NV3A 1IJFA 3SYKA 1UM9B 1FZQA 3BWDD 4B0OA 2P1RA 2Y66A 4EGQA 2DT5A 3Q7RA 3ZLBA 4WCDA 3HYSA 3EXHB 4B4DA 1ADJA 5D2CA 3EWAA 1ORWA 2PXCA 2OR3A 1H9AA 3FTQA 4PWZA 4XH9B 3V32A 5F9HA 3ABZA 1KDYA 2QW8A 2A1UA 2H8KA 4RZUA 3HCPA 1E5DA 2B7CA 4I50A 2WT8A 4TLAA 1EJ6A 2TYSB 3LUFA 5DNAA 5DSTA 3PDHA 3DWIA 2IXAA 3HUFA 3RG8A 2EW8A 4DJJA 1O4WA 4PZCA 3WMGA 3V1YA 2R3SA 1KI4A 3BRCA 4WMLA 2W93A 2VLIA 4FFPA 1UBEA 3OZWA 4L73A 4DPMA 1IBMB 1F8UA 2JI4A 1DUSA 5A7GA 3T12A 5G3YA 2GVZC 4HWPA 1G291 2R2AA 3UK6A 4X93A 2FSPA 1CD5A 1AD2A 5C34B 4JLAA 4HV4A 1RC8A 2XRFA 1TC2A 3DMGA 1Z68A 3JCZA 4N12A 2GVDC 3DF9A 5K9ZA 2BGTA 4BXOA 4DQLA 1BXZA 2PUJA 4NVRA 1M1YA 1VCOA 3A58B 3DKPA 4MW1A 3FPJA 3UXEA 5CDSA 1E2QA 2WF5A 1QYWA 4BE7B 3HYLA 1HFWA 4PZZA 2RE8A 1DO0A 3VYTB 3FF4A 4M54A 4ZCQA 1Y3IA 4O02B 3EGEA 3OZSA 1EVKA 4LGVA 2UZ1A 3UCEA 3ZZ1A 3EF3A 4LHYA 5K8TA 1TA9A 1TFRA 3WLIA 4BVLA 2FZEA 4KOAA 4MJ3A 4D3FA 1KRHA 1J8DA 2G08A 4F8JA 3C4VA 2P35A 1EFDN 3DFKA 3UQZA 2DBRA 3NDJA 1MLDA 5B57C 3R7AA 1Z4PX 1Z6ZA 3I9FA 1EEHA 1WPGA 5CYPA 1Y4ZA 4WZBA 4S05A 4K28A 2WTBA 3WLEA 1RLJA 4X7RA 2YZ7A 4LE1A 3WBJA 5JV5A 2GJ4A 1B6SA 1ZM3A 1VIDA 1Z5OA 1M0EA 3FZGA 3TH5A 1QZUA 3HR4A 2R8BA 3IIKA 5B58T 2GPWA 2FZLA 1CY6A 1AG9A 2XBUA 4YBZA 1Z13A 4YAGA 1ACJA 2ZZMA 3EC2A 3H9UA 3MJTA 4C0LA 4EYQA 5G2OA 3ZY2A 1NBHA 1I30A 2C5LA 1L7EA 4NBUA 5AJTA 1Q2UA 1TTHA 1VRVA 2H1FA 1NJSA 1XYYA 3C6BA 4H18A 5BNTA 1C3LA 4G2TA 2QI9F 4DUZB 5DISB 2Q2OA 3NHFA 1RM4A 1N2EA 1I9GA 5IM4A 1E94E 4W7IA 1LPSA 2Y8EA 3W2IA 3HDYA 3L6EA 4RIHA 3BEDA 4TVOA 4YPOA 2IGTA 3LNCA 5G41A 2L18A 4NWIA 1M83A 3JQQA 4F38A 3I0NA 3ESZA 4BFXA 2P5SA 4W5OA 1KK1A 1UR5A 2CE7A 2QTRA 2B4RO 5EHZA 3HEAA 1I4WA 2FFAA 2CFOA 1IY8A 4MW6A 5H3LA 5LD2B 2DECA 1PDWA 2ZIVB 5DCUA 1M8GA 2JL1A 1FRNA 3MWGA 5DHUA 5TEVA 3B1YA 3OQPA 4XM2A 1IRIA 3I3SR 4HSGA 2LKDA 3GYBA 2AJCA 5BSTA 3UWMA 2VTVA 5DWDA 4N0MA 3QEMB 1KFJB 3SR4A 2OZLA 7MHTA 2PX3A 2QN9A 4LHSA 3M83A 4NJEB 1ZMTA 4HQKA 4OAPA 3EASA 5KOHB 3MGCA 2XI4A 2WVAA 5FR2A 3JQFC 1JLLA 3ENZA 3EZNA 4KO3S 3ZHTA 2ZBPA 1NBME 1GPNA 4QT0A 5CDYA 4V1CA 1H5UA 4MWTA 2ZPAA 2C7VA 4E12A 2AQKA 3ZCPA 1H2RS 1OU4A 2AQHA 4IDFA 4RVHA 3ANNA 3DTVA 5CVEA 1LVUA 1Q83A 4B33A 2XAAA 2I9KA 2JFZA 1JDVA 3BILA 2QMYA 4UVDA 1T26A 1APBA 1R9JA 4ZMSA 4CDMA 3NRCA 4G1CA 4UVEA 2CLOB 1YACA 2C8LA 4PO1A 1CNEA 2QZSA 1Q7CA 3U0VA 4NFYA 3TK1A 4NULA 4UNPA 4DC0A 2QXUA 1PFKA 3K09C 4EKNB 3PQ5A 2CT8A 2RIRA 1PZMA 4Q4JB 3IVXA 3L05A 4HWKA 3BWEA 3H8JA 1O77A 1E7SA 2WG0A 3N2GB 3S68A 1IQUA 1GGNA 1YHYA 2XOKA 1PF7E 4YREA 4WBNF 4XASA 1W4AA 1R37A 4KK4A 2YTZA 4OBWA 2VYND 2F3UA 1DKMA 4EJSC 4EX7A 1DLJA 1MRNA 3AR9A 4L7VA 1SQ0A 2D3TA 3HV2A 3WAGA 3B53X 1QG6A 3TQTA 1Z82A 2Q3BA 3LUCA 1NF8A 1IOWA 4H31A 1EAYA 1BXRA 1ULBA 4DNXA 2PQ2A 5JAMA 1HUQA 5IJ0B 4BO0A 1JWLA 1SIUA 3DKRA 4W9NC 5K0NA 1KVSA 3FCXA 1G6KA 2FEWB 1GQYA 4JHLA 4F5YA 1E99A 2RHWA 4JJ8A 4UTXA 3RH0A 3RYHB 5DFAA 3CRZA 1DAHA 4QBTA 5CCEA 1GM5A 2GZ1A 5J63A 4KCGA 2PS0A 5ALGA 4KIJA 4D4JA 5FYQA 1J2UA 1HDEA 3G1UA 3UJ8A 4CIBA 5DBIA 5DYNA 3NBFA 1Z22A 1ZXBA 3FCAA 3IEIA 4RA9B 1YOBA 4R0MA 1CK4A 1JSRA 3BICA 4Y2RA 1FL9A 2R00A 1I32A 4RTQA 3RADC 3R0ZA 1NUHA 2WKWA 2GZMA 3AJRA 4O6VA 5C8XA 1YTUA 1NLZA 2D8MA 2X6TA 3SNHA 2EP8A 4M87A 2J45A 2ILTA 1VI2A 3KTAA 4DR4B 4WKPA 4B7XA 4Z4FA 5ICEA 4YTEA 3FJYA 4FLEA 4G4GA 4GH5A 1G21E 5H68A 3WWYA 5BWBA 2IYYA 3ZHXA 3PPVA 4QWMA 4WOKA 3HABA 2OSBA 1AT1A 4JS0A 1ZK3A 4Q15A 5HM6A 3V4ZA 3KALA 5CFNA 1HT2E 3VGPA 5F5LA 1HTTA 3B48A 4N7MA 1UZAA 1WG8A 3IUQA 4R2WA 5C1IA 1F4PA 2ZOSA 5DSZA 2X7HA 3BF8A 3RSFA 1A27A 1CFZA 1G5TA 3PJDA 4NJMA 1WZ2A 2NPIA 3IMEA 1UBSB 3PS9A 2Q6OA 1PNTA 2FDXA 3MWJA 4WZZA 4YGYA 1EVZA 1QP8A 1XKXA 1RJ9A 5ESWA 4MICA 4TTSA 4CFYA 4ZICA 1VI6A 5EJ6A 5KQLA 1RXVA 3PE6A 5DYWA 3LPCA 4RLFA 2OV4A 5ELMA 1UFQA 2OFFA 4D9MA 4NESA 4PSDA 3ROGA 2CMKA 3H5OA 3H7AA 3SM3A 4YAOA 1SN7A 2ZSDA 3G6KA 4P2GA 4DRYA 1O03A 2V59A 3A6LA 5KTNA 1YS6A 2CFRA 3JV7A 1PL7A 2XUGA 1YB4A 3F7TA 2PWPA 2NP7A 1CUYA 1V41E 2DY0A 2AFRA 3HO8A 1TX4B 2ZP1A 1YK0A 4PLPA 4RLSA 1ZI9A 1L1RA 2CEKA 4DKJA 2PWBA 1XJ0A 1S3IA 1U0NA 2PMKA 4MIKA 4MI6A 2DULA 4LGYA 3VH2A 4BMNA 3V2GA 2ZB3A 1Z56C 1XYVA 2BFNA 2NZJA 2IOHA 4PLZA 1G8HA 1LDMA 4HPXB 4LSGA 1YE5A 3RAPR 4URVR 2JLYA 2M2IA 2QE6A 2QJFA 3HFSA 4LJYA 3X1WA 1E6KA 4E7PA 3F67A 3VR5D 1POXA 1QH1A 4RCZA 1A72A 1GJRA 1WXFA 3PTAA 5AM2A 5IDQA 3U5ZB 1RYNA 1DRWA 1PR2A 4M8KA 4RMJA 4NZYA 4MPTA 3T5TA 4B4KA 5JSFA 3LF1A 1QB7A 3D5TA 2Q8QA 3IAUA 1TKCA 1X7WA 4F3TA 4MV1A 1SUDA 1R8XA 2Y77A 3GJXC 5A5EA 3WKAA 1NVMB 2JFQA 4FNAA 3SHFA 2F9LA 3H1TA 3O4JA 2HFJA 2IUTA 3MPUA 4NZNA 3UAYA 1AURA 3LZ6A 3NDPA 5FBZA 2KW5A 1JVNA 1R88A 2O1SA 3DC2A 4M83A 2V0NA 4AWBA 1WV0A 4NMHA 1Z6PA 3DHEA 4MGHA 1HZJA 1PQPA 2Y05A 1ILWA 1YOVB 3LLSA 1W44A 3S28A 1Y7LA 5B3KA 5IXYA 5IM4F 3FOCA 3AO0B 3ELBA 3TNFA 2BGIA 2BEVA 1LGYA 2BGRA 3NX4A 3VNAA 3M6IA 3N1UA 4FYHA 2M6RA 3ILHA 4HS9A 1M67A 4MVJM 3RO7A 1N0IA 5CB4B 1GCAA 3CUEF 4JGGA 3WGHA 4A0GA 2PT7A 1UIMA 3AM3A 3N9IA 4EL5A 1SD2A 1XCLA 2QD5A 4I4IA 3GWGA 4IX1A 4ALMA 4AZ3A 2W42A 1Z0DA 2Z56A 4OP2A 2XJ9A 3NHMA 2X2OA 1A9PA 1N2HA 4XD7A 2OFOA 4H17A 2V74B 3E81A 3G1WA 3LPNA 1NC1A 2RMKA 3UA4A 3TLCA 4CV3A 5TQJA 2WFAA 4DNPA 2JKYA 3G5MA 4GVLA 5TIIA 1JQAA 2DU8A 1A2KC 2G9QA 2FF7A 4ZEOA 1L0BA 3OEHD 4WY2A 3NTVA 1FBNA 2P9BA 2PMDA 3VZSA 4D8VA 2NACA 1PWXA 5JVDA 3WJ2A 1ONPA 5LWQA 3UH0A 1Q1BA 4HZGA 1N6LA 3TKYA 1E60A 4HX2A 4NEQA 1ZUD1 3MVEA 3DWFA 3WV5A 4JWTA 1JEYB 2A5JA 1NOIA 2PMCA 2GAJA 4AF6A 2XZTA 4F3RA 5KTYA 1DHTA 2NSLA 4ARBA 1XVTA 3DZKA 4PPQA 1CKEA 3DM9B 3ERCA 3O90A 5T6MA 3IBYA 5TJ9A 4E1AA 2X0EA 5DNVA 2EZ9A 3OURA 4EPTA 1RIIA 4M1SA 1AQJA 3T1TA 3NUZA 1KGSA 2PUFA 1YIAA 3HR8A 4F6CA 1SC9A 3UUGA 3RJ9A 4UTOA 5KMGA 1VCHA 3ZW8A 4EB6B 3VRHA 4TN1A 2BJWA 5T3UA 4RKEA 1GXSB 4PW0A 2QDXA 1AKWA 2ON6A 2FPPA 4QO7A 1V7CA 2P77A 3E9CA 3EXIB 4QYIA 2AJLI 3UB2A 3DOUA 1S9HA 2OG2A 5DPMA 4Z0TA 4V2IA 3CLVA 4BC0A 2FOIA 4YRLA 3FOZA 3AY0A 5F2EA 1KH2A 1JKFA 2QM3A 1UZNA 2JDID 3CX7A 4M0PA 1WY5A 4RA6B 5EGSA 4OQEA 1Y7HA 3L6OO 4RIEA 5A06A 3HU5A 4QAQA 5KNBD 3KL4A 1JQDA 2CVOA 2Q62A 4AB1A 1IVYA 4S35A 2VSOA 2R6FA 4KL8S 5DZSA 2YY7A 2WD7A 4MDFA 1BQ4A 1E3TA 3P27A 1G5HA 2DPGA 4O2AA 4MLPA 2SCUB 2WT9A 5FXMA 4RZSA 1RBZA 2EQ5A 2QQEA 1MQSA 3EBPA 2QUJA 4PPGA 4PZPA 3UWOA 1GEEA 1KSGA 1GVNB 3VPCA 2YCLA 3OC6A 3CUTA 4H7DA 4EQ6B 1QHHB 4GOKA 2P2DA 3V2HA 5LDHA 3QTTA 3LVBA 3DB1A 4RM3A 4BCDA 4RMIA 5IYZF 2ZE5A 3A2NA 4RTKA 3T06B 5I4BA 4I1VA 2OOSA 1SU6A 5KAMA 2ZVDA 3N7UA 4JEHA 4PHCA 1T43A 4Y2YA 3TE6A 1CTQA 2EDAA 4NS4A 3B78A 5F3DA 1U90A 3JQ8B 4DV4B 4B7UA 9MHTA 1YZTA 2NYVA 2JFYA 4JLBA 5CUQA 4MYUA 3P0RA 3E8SA 4ZVVA 2B0CA 2C9DA 2ZJ0A 1KZ4A 3ETLA 4Z1MA 1XK7A 3ELUA 3I4CA 1F9AA 5JCOA 1AUOA 1WV1A 1QH8B 4BJHB 4C43A 2Q2QA 1NUAA 4K03A 5I6DA 5KNCH 1W1IA 4URFA 1O95A 3RAFC 2GASA 1I3KA 3K0KA 3IT1A 4N7BA 3G85A 3K6RA 5BSEA 2O3JA 3C4JA 1TKBA 4CHTA 1ZBDA 4FLMA 2B3TA 4PC3A 2AD1A 1V4NA 2I76A 3HA2A 1CY1A 2BFWA 2W2LA 3BFPA 1W5FA 2BLLA 1HLFA 1AUPA 2V4MA 2VK8A 3L77A 5HCUA 1FRVA 2IL1A 5A3VA 1C80A 3S8MA 3ZGLA 2PSEA 1VBKA 1T3TA 2JHGA 4PRZA 1J06A 3SS8A 1RI5A 3AH8A 3OFNA 2ZVPX 3GAAA 3B7PA 3DAHA 4DREA 3ZWQA 4CM7A 4EDHA 3IQIX 3EEQA 3S2EA 4KXNA 5CIWA 1CUAA 1P2GA 1NDUA 3IDAA 5AKYA 2WHPA 3LC0A 2A67A 3TEFA 3VKWA 2JB9A 3JYHA 3NUGA 2EGUA 3KZVA 4PYNA 1U0TA 1JAYA 3OWHA 3KE9A 4X7PA 1JKJB 1KMHB 3PZBA 5DXJA 1RQLA 4F2PA 5PNTA 1T24A 1LK7A 2PLAA 2H4JA 1OXUA 1CUXA 3CXUA 4MYTA 2OYCA 3MERA 2ZCUA 1ZP6A 2EERA 3OQIB 1ZMXA 3K6SA 1QZXA 4C89A 5BR1A 4GDFA 2I54A 3COYA 1GLVA 1VLZA 1EVIA 4MR8B 4WCFC 2ZSJA 2WYHA 3E35A 3IV7A 2RG1A 1RXEA 4INOA 3VR1A 4M9CA 3R44A 2IWHA 3COPA 3NVKI 3P52A 1NR5A 5TPWB 3ZTYA 1V1MA 2O6LA 4Z0PA 1SEVA 1YKSA 4N0DA 3RUHA 4Y9RA 4UREA 3SLKA 2X8JA 3FB1A 3SZUA 2Z8XA 3RK4A 1UKCA 4M0MA 3DL4A 2ZRBA 2XT9A 4EI9A 2O8DA 4V02A 1FJXA 3DT9A 1A7JA 2JK1A 3DBIA 2JLAA 4FN5A 3ANSA 4OHKA 4QJ5A 2XB6A 2YMLA 2XCQA 3GBSA 3ETEA 4YUYA 2E4AA 3VJKA 1TYDE 3MGAA 2FOXA 4KDFA 2XDWA 4ZN6A 2PUAA 1T0UA 2C42A 1TRHA 1UKEA 5KYWB 4C03A 1HEIA 3OPQA 2XD9A 1WB4A 4MEAA 5DU2A 4YLYA 2AXPA 4IXDA 1UODA 4DBLC 3AKZA 2CFCA 2DCMA 3L7LA 3NORA 4QEDA 5JADA 3BXOA 1FVFA 1A0OA 1NXXA 2GGSA 4TZ0A 4S1TA 4FD2A 3LXXA 2R8XA 4RVUA 3SKVA 3TS1A 1H69A 3HCWA 5LOVA 3M9WA 1M34B 3MMXA 2EDCA 1CIPA 4LIPD 5LUBA 4GBMA 3V4FA 4QYMA 3ZY4A 2C3OA 4AJOA 3BG5A 3C3MA 3DKIA 2P9YA 2OPBA 4KITB 1XG5A 4URHA 4DLBA 4HDCA 4E1BA 4YJ2B 3EZLA 3PQ7A 3BD7A 5DK4A 5THKA 4YP9A 4BZXA 2FU5C 2JVJA 2ZUSA 4DHEA 5IS2A 1P1HA 4GP7A 4YACA 3GF4A 4HDNB 3U9SA 1T3SA 1Y9EA 3RHSA 1HEUA 1V9SA 3H5RA 2IPLA 3HFRA 2F67A 4LK2A 2WPDA 3KOXA 3H1AA 3IAAA 1OI7A 3O26A 3QMMA 3IPXA 5A5DA 1O9GA 4Q7JB 5FQNA 3W3AH 3NYRA 1QHNA 3PD7A 4Y2GA 1ZXXA 3SBOA 4BMVA 4CR6A 1GA1A 3DEKA 4AX8A 3QGMA 5H9VA 1N0HA 4LG1A 3K32A 1VGQA 2J7KA 3ZN2A 2AOTA 5KDDA 2NG1A 2Z09A 4NPCA 2IWRA 2VYVA 4N49A 4BUZA 4LYYA 1CYEA 4QFBA 3L7OA 3AEQB 5KCMA 5I9MA 4DUGD 3HY6A 5LP6F 3EULA 5BSWA 3G59A 2IYOA 2PH7A 5H7XA 4F21A 4DZZA 1LBEA 1JPJA 3B12A 5LQKA 3I5MA 2Q27A 4CE6A 1FEZA 2IZOA 4JBHA 3UNXA 2O14A 2B1JA 3I23A 4RK1A 3IRUA 1NV9A 1Q1GA 5AHOA 2IYNA 3STUA 3NTRA 1P0PA 2M32A 4BDSA 1T5BA 2RK3A 3JZDA 3A3KA 4I1PA 2OTCA 2ZT5A 1YE8A 3ZWXA 4A0QA 1GSOA 5E1DA 2INGX 4PPNA 5D51S 3UMMA 1H8ED 3DEIA 3L06A 5LZ8A 3GUHA 1XPUA 4DT1B 4EIWA 2E21A 2GHTA 3IOBA 3Q9SA 5CNJA 3DE6X 3VR6A 4ODIA 3G2LA 3FPCA 1ZZEA 3VO1A 1YS2X 1ESZA 2MYUA 1AKQA 3V7NA 2R7MA 1QP4A 1JIJA 1ZRNA 5CT9A 3FA2A 1P9RA 1I0IA 2P6PA 4QT4A 1F4VA 3I72A 3M89A 4WFQA 1AV6A 5AI6A 5CCXA 1X1CA 3MJRA 3ZCXA 3G5UA 4C0JA 2JJMA 2N75A 3E8XA 3KV3O 4ZYZA 5DNUA 3MEQA 1VLLA 4FNOA 3HSYA 3O1HB 4AYXA 2FW6A 3EHDA 3RAGA 4CDRA 1UOOA 1HWYA 3I53A 3NOVA 3WNDA 1W4LA 3J81k 2PNFA 4R9VA 4BN5A 1X1QA 1TJ3A 1NVVQ 4YRAA 1QP7A 3HBFA 4ND4A 3NAQA 4AJLA 2H08A 1QB8A 1OBHA 2JRLA 4NMXB 3BHIA 2CD9A 1JIIA 1SVWA 2D2IA 3VUEA 1UXOA 2D2FA 1JXAA 2JH9A 2DSNA 5FA5A 2D1TA 2WYOA 4PX9A 3TL3A 1FNCA 4MVJA 5E0OA 4IKPA 4ZO6A 1V25A 4AXXA 4TYWA 4RK7A 3UJAA 2QAGA 2WJ3A 4HYEA 3QX8A 5HX7A 3L7KA 4L78A 4HXYA 3DXXA 3L4BA 2FRDA 2ROQA 3G7NA 4AMZA 2EKLA 3I6BA 4HL6A 4MMYB 3DZFA 1A5AB 3LW7A 1NSYA 4J7XA 5DN6A 3VTKA 3DXFA 3CKKA 1SKYE 1RWKA 2BSXA 4KGVA 4RYLA 5KSOA 2WA2A 5KNDH 4C4YA 2O2EA 3IDSA 2WI8A 4LJKA 1QAOA 2IHVA 3U7RA 1PS9A 2X23A 2IQ5A 3PF8A 4M1ZA 4TV8F 4BFSA 2NPFA 3WTBA 2XWPA 2R47A 3MIZA 4HKTA 3ECAA 4GBED 4O4IA 1FA9A 4MA5A 4C4PA 3LNTA 3MMSA 3KJQA 1LWOA 4J3NA 2QTHA 3TUZC 4MEJA 4MDHA 1UBLS 2XDYA 4LZJA 4AY6A 1ZGGA 3IOCA 3LXRA 4XIYA 5IKMA 4F8YA 1WHTB 4NOJA 4KDEA 4V3BA 5D3MB 4JWKA 2VAXA 3MWLA 4U2DA 4B3DA 4EA7A 4ZJUA 3EHEA 1VMDA 4PAOA 4EFNA 1K6IA 4X8LA 5EZYF 1OYYA 4EO7A 1SCUA 1KYYA 4G0YA 5KKCA 3VDXA 2AI3A 5KQMA 4OHRA 3GA7A 1OFUA 1ZX1A 4W8OA 1QNFA 4V0OA 3KWLA 4DIBA 4DMUB 2WNIA 1M1UA 2I6XA 1FUYB 1QV9A 2WRZA 4R16A 4ZARA 3I34X 1E2DA 3I32A 3T7RA 1OXSC 3WAKA 2X41A 4XUDA 4KGXA 5CAEB 2WU1A 3QJ5A 3ZLTA 1UMDA 4EJSB 3BD9A 2XUOA 2JG3A 1WB9A 4KU4A 4N54A 3FGZA 1HRKA 1P1BA 3DE2X 1QX4A 1Y8QA 4KO2S 1WKCA 2QP9X 1XZGA 3ZY5A 1XTPA 3QJYA 1JIVA 1CJVC 2ONZA 1P2VA 4B09A 1J00A 2OLEA 5CK5A 2ZTUA 1PJ8A 2ZAGA 2OXTA 5D3KA 4J4TA 5SZHB 4P84A 3UWKA 1KMMA 3P4YA 4XLTA 3RS7A 5E0KB 3STTA 4LRSB 5I7OA 1C9DB 2PAFA 3M1IA 4JA2A 4KN8A 1H4QA 1YVEI 3NXSA 2X0KA 1Y7TA 3VDRA 1C7FA 3PPXA 4IIEA 5H0IA 4ZYTA 5CB0A 4OLBA 1ZH0A 1ODIA 2HBZA 3CX4A 5CNMA 4CR8A 4YRZA 4JJFA 1YR3A 3C39A 2O7RA 4Y6OA 3ILVA 1FPMA 1JH9A 3NT4A 4TUYA 3VU0A 2Q99A 4FQ5A 4MWEA 4N3BA 1EFVB 4YP7A 4TGLA 4CN8A 5E6UB 2GEKA 3BB4A 1ESMA 2PANA 3G2PA 3CSDA 4ZT3A 3ZPXA 1FDSA 3EGDB 4K9LA 4MGYR 4GF5A 4U6NA 5EERA 4EB3A 5D5QA 4ZXFA 5I9BA 3AFNA 1FZTA 1T34A 5I7FA 1YZNA 3D59A 2JHFA 1NYTA 1N6RA 1O3YA 1JSCA 3SX0A 1U0HC 1Z0IA 5LQRA 3VPBA 5C1DA 3CZ4A 2OD9A 3U1BA 4HTFB 1Y63A 4G4JA 3FYDA 1SOWA 1IN4A 2EZ8A 2O05A 1NRJB 4R5MA 4ZMBA 5EKTA 1S4MA 3Q9LA 1SXJB 1KZYC 1N2BA 4FBGA 1SFRA 4H27A 3R77A 4Q1AA 3IHTA 3V9PA 1VIYA 5I7SA 5FPQA 3CNLA 1DXHA 4JUCA 2DJIA 3JVIA 3GOHA 5BSMA 4CMIB 4D96A 2P4EA 1W88A 3IO3A 4KWEA 1EDBA 4X20A 5AR1A 2ACEA 5LQMA 4I2NA 4ZOLF 1WZEA 3S40A 4QJBA 2VKTA 5BPHA 1XZDA 3DTVD 1XOIA 4TWBA 2CLIB 2VT3A 2YHSA 3FWYA 1W9HA 5LMCA 3K4QA 2CKMA 2ID4A 1W29A 1JZTA 2VDRB 1SKQA 4OK5A 2IYLD 3E0XA 3M70A 3U16A 3AINA 3G0CA 1DG1G 2X5NA 4LJSA 4YI5A 1B00A 1REQB 3VR4A 3PXXA 3THXB 2B5OA 2P40A 3GJ4A 1DARA 1E0JA 3Q6IA 1P2SA 2JIRA 4PO9A 1JG4A 4XVHA 4CHGA 1BGVA 3UYKA 5AHRA 5M34A 2Y6VA 1KO5A 1BAPA 1NASA 1KEVA 1SK8A 2FPGA 1Z39A 3L46A 2XOKD 3L7YA 4I2VA 5DTIA 5F7ZA 1CEQA 3TNJA 1BQ3A 3HXPA 3KWMA 3LCJA 5JHHB 4P92A 1HG1A 3FMFA 2B3DA 4PIMA 4ZJYA 4AC9A 3O8QA 1U0SY 1DCFA 4C06A 4R7ZA 1SH7A 5A05A 4A36A 3FH0A 4EG6A 3GLIB 2YXPX 1R3DA 3KNZA 3U44A 4MRNA 4HATA 1BS1A 2RHLA 2X9VA 2X77A 1FXUA 1RFLA 2H06A 4ZQHA 2AOUA 3IQDB 4WFKA 2G6BA 3SYLA 2Q8NA 3IJRA 3E5HA 5A4JA 2P5TB 5IXJA 4DC1A 2Y0EA 4TL9A 1HO3A 1SELA 2JCSA 2PKQP 4GRDA 2HWKA 4Q1EA 1A2QA 1MAUA 5K4AA 4AULA 3EK2A 2Y1KA 3DV0A 3ZJ5A 4L8FA 3OTOB 1G2PA 2AXEA 4KE9A 2JATA 2Z6QA 4P4SB 2DETA 3VC7A 4ZRDA 2HEGA 2Q7OE 4YHBA 2YYYA 3PEUA 1C4OA 3A32A 4JX9A 1F06A 1NVFA 4U8GA 5AIAA 5GZ1A 5JYEA 1JZSA 1C1DA 2QGFA 1XMJA 1HYQA 2IIPA 5I4CA 1L5HB 4Q3DA 5AVOA 1G42A 2I2FA 4Z2YA 4NARA 2NWQA 2J0VA 3M1LA 3L0PA 1ZY2A 1CRQA 3NVDA 3UJ6A 1CCWA 2OORC 3OEED 5E2IA 2KLHA 5KVSA 1VRCA 2H6EA 3PJFA 4KPGA 4B6PA 4CQMD 5HJ2A 3MC1A 3WYEA 1ZN2A 2ENWA 4IJVA 3UUWA 2FSSA 3UT6A 4MAAA 1VSBA 1J33A 2ESRA 1N6KA 1XVVA 2C58A 3EOZA 3FUWA 4NZPA 4PV7A 2BZGA 3SHQA 1XUOA 2QTTA 4UUAA 1FNMA 4KXFB 2N47A 2VP2A 2A5GA 4O2BB 4QFDA 4OI1A 5FX2A 1QYXA 5BRJA 5JJ5A 4X1IA 3D3NA 1RP7A 1QQ6A 4PR3A 1NVBA 1SUSA 3BAZA 4FDTA 4J0GA 4QOJA 4Y1FA 1I7NA 1T36B 2R1VA 2ZUWA 5JFGA 1A2OA 5K6TA 1YC5A 3LT0A 4B80A 5EJ7A 3S2ZA 5ITZB 4XXHA 1PFVA 2A9KA 1JFTA 2JGKA 2QBYA 1BS2A 2G82A 5BUCA 2C9CA 1E7RA 2YFYA 3ITEA 4ZT2A 3MW8A 1R5JA 2W6OA 1EX1A 3BXPA 1V7ZA 3JVVA 4LV6A 4PE5B 1PE0A 2IF0A 2ZSEA 3EDOA 4FMCF 4JN6B 1BOOA 1YZFA 2OE2A 3IJPA 4ZWNA 3ZXSA 1N9ZA 3EIXA 3AX6A 3BGWA 3OZIA 1TU3A 1B93A 1OD6A 4G1VA 5EL0A 4OF4A 1W46A 2NO9A 4OQXA 5K8LA 1G3IA 1M2FA 1LK0A 2DR3A 2N42A 5ALHA 1TCVA 2PRSA 5E95A 2PU7A 5EMKA 2YJTD 4L75A 4HEQA 3U4QA 4PSAA 4HAXA 4BKUA 1BYIA 4JZYA 4TS9A 4F4FA 5B7GA 1PWYE 3IHKA 3O8BA 5JSUA 1E9RA 1UK6A 1XVAA 1FP2A 3RF6A 2XIQA 1CQIB 2HCTA 4MWSA 2I29A 4QG3A 3UMSA 3OT5A 3HACA 2NVWA 3DC7A 2EBHX 2ZWOA 5PGMA 3EXFA 2P5YA 2O8BA 3OU6A 3ANLA 2PUEA 2ACWA 3NGMA 1PKEA 3RK1A 1E5QA 1CQWA 2MSDB 4XM0A 2Y1EA 4U2CA 3UBMA 3W6ZA 4UHKA 4B6FA 1L6RA 1B0PA 1KA9H 1Y5RA 1JAIA 3P9KA 1O9BA 4HQFA 4J94A 2PZMA 3ZWYA 2A8YA 2I7CA 4MYHA 5CIQA 5LMZA 2XCTB 4TZ6A 3MUNA 5D86A 4JGIA 5CJ2A 2A5LA 3EMBA 3H2SA 1RS0A 2FUCA 2GLTA 3E7FA 4HNHA 5B3AA 1QANA 4YHHB 4JU8A 1PW5A 1GAEO 1H42A 4K9KA 5AHXA 4FJ1A 4KX5A 3R3VA 3QIVA 3OD5A 2LCQA 4Y9DA 3EVEA 1KO7A 4RKRA 1N5JA 4YROA 4UUPA 1TEVA 1U7DA 4XZ3A 3DFFA 3Q12A 3F5DA 5EWLB 3WQSB 1ULAA 1Y82A 1FYDA 4C4SA 1MOSA 3EVCA 1E7MA 4PBRA 3AV3A 1KC1A 3JASA 1U8UA 4X24A 3LMKA 1OFUX 1XJ5A 3V55A 1EUDA 2EP5A 1FP4A 3JQ6A 5EZQA 3V4VB 3ZVNA 1MW8X 4D1YA 2PZEA 1HH4A 3ZWDA 4M60A 3IILA 3EZ2A 1G8GA 1S4QA 2R2GA 2WJVA 3O2NA 4M1YA 1UFOA 4N0PA 3F2IA 3VSAA 3R0QA 2WUGA 5BW4A 3U6BA 1J8YF 1WMSA 2CDRA 2I6QA 4HVAA 3TLYA 3ZVLA 5IANA 5KHLB 4BFCA 1CR1A 4N7RA 2B8JA 3OFKA 1XQ6A 1ZM4A 5DX8A 2FFHA 4IF4A 1VSTA 1TIKA 4P22A 2AK2A 2A88A 2IDMA 4FEAA 4IGAA 5BWNA 1VL1A 1EWRA