1UXOA

The crystal structure of the yden gene product from b. subtilis
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
186
structure length
186
Chain Sequence
TKQVYIIHGYRASSTNHWFPWLKKRLLADGVQADILNMPNPLQPRLEDWLDTLSLYQHTLHENTYLVAHSLGCPAILRFLEHLQLRAALGGIILVSGFAKSLPTLQMLDEFTQGSFDHQKIIESAKHRAVIASKDDQIVPFSFSKDLAQQIDAALYEVQHGGHFLEDEGFTSLPIVYDVLTSYFSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Putative hydrolase YdeN
publication title Harvesting the high-hanging fruit: the structure of the YdeN gene product from Bacillus subtilis at 1.8 angstroms resolution.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 66
structure length 186
sequence length 186
ec nomenclature ec 3.-.-.-:
pdb deposition date 2004-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06821 Ser_hydrolase Serine hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1uxoA00
4GI1A 1H23A 2VT7A 2WM2A 5AI9A 4QDTA 1ORVA 5ALNA 1ZJ4A 3PI6A 3I28A 1WM1A 2E3JA 3VVMA 1QIIA 4CG3A 3B5EA 2B9VA 2WFMA 4WFJA 4EY7A 5F4ZA 3DL7A 2YYSA 4J7AA 2PBLA 3WK4A 5K5EA 4QLAA 3MUNA 3A70A 2ZJ6A 4J0DA 4Z49A 1U8EA 4C4ZA 4IHAA 5C8XA 5DYYA 4F60A 2CKMA 1K4YA 3EBLA 4H7HA 4ZGBA 3F8SA 4DMFA 1QO9A 1EA5A 2B61A 2C4HA 3EF3A 3G0IA 5LYYA 3EIOA 1LPMA 4G9GA 3DNMA 3WA7A 3ESCA 1DWPA 3G9UA 3DL4A 1ZD3A 3FYUC 4BC0A 4G1FA 4I3FA 3BJMA 3SWWA 4C4YA 2WJ4A 4TVKA 1EH5A 1LNSA 1EDDA 3R3ZA 1UK8A 1RYYA 4Y2TA 4FLEA 3JYHA 3RK4A 2V97A 3IIIA 3STWA 5AOAA 4Y9SA 1GT6A 3L1IA 5C8VA 3BDIA 3ICWA 3WKBA 1A8SA 5FPQA 1NU8A 3H2HA 1ODTC 1JJFA 4C01A 2HU5A 3WJ1A 1ETHA 1R3DA 4UHFA 1E8DA 3PUIA 3X3HA 1E8MA 2BGNA 4E11A 1CUYA 4W63A 3VJLA 3WI7A 2PSFA 4UBLA 4AXBA 1F6WA 3QVMA 3QH4A 3ESDA 4W1PA 4E14A 2VJBA 4EBBA 4PF1A 2B4KA 4MWSA 3H2GA 1DWQA 3O95A 1IMJA 4G4GA 1FFCA 1Q0ZA 1MX5A 3C87A 2WJ6A 1HL7A 1QIFA 3RKSA 2BCEA 1UOQA 2BGRA 5AK3A 4BTLA 3E1GA 2WG2A 1XZCA 3IUMA 3D59A 2C5FA 1LPOA 1XLVA 1GPLA 1XQWA 1UKBA 4BTVA 4B9EA 4F0JA 3WKEA 3DKKA 5K3BA 3H2IA 3WL6A 1GPNA 2ORYA 3IUNA 3LP5A 5LZ4A 1IVYA 5LKAA 1LPSA 1XZIA 3AINA 4J0JA 4QNNA 3ANTA 3FVTA 1J07A 5CH5A 4QDZA 1ZGBA 3LCRA 5CT4A 3FNBA 2V96A 1TRHA 1O6FA 3HSSA 1AX9A 4WY5A 5AM3A 5HFNA 5AP9A 1T2NA 4KYVA 3VJKA 1MT3A 2QXUA 4QWWA 5ALUA 4UUQA 5JAOA 5AKGA 5C7YA 3STUA 5AM4A 3FSGA 4WFKA 3G9TA 1FFDA 3FWHA 3GELA 4DSAA 5AM2A 5BWCA 1P0IA 5AJHA 3C70A 4LKOA 2FX5A 3JW8A 3ESBA 1VE6A 4PNZA 5HF8A 1HBJA 1EI9A 1A8UA 5ALFA 2HL6A 3W2TA 4DNQA 3FYTA 1QTIA 2QR5A 1QFSA 3BIXA 3STXA 2WQZA 3GROA 1DU4A 4TGLA 2OCGA 5HF5A 5ALYA 1P0MA 3U0VA 5AIBA 5AKHA 3G02A 3WMRA 5ALDA 3EQ8A 1G66A 1U4NA 3D2BA 5AM5A 3I2HA 3WZLA 1TKRA 4Q82A 1WB6A 1XRQA 5JD4A 2AJBA 4B0OA 5ALVA 1FFAA 2HDWA 1ZGCA 1W75A 4KAAA 4NMWA 3IA2A 3QPCA 1N5MA 1G5FA 2XMBA 4K6HA 1TCAA 1EDEA 3Q8WA 2CMFA 3H1AA 5CH3A 3WZMA 5HQ3A 3B3QA 5AO9A 1X2BA 1UKCA 4CCYB 3CN9A 3AUKA 4C89A 2XT0A 2HFKA 2BJHA 3A6ZA 1L7QA 3QITA 4B83A 1R1DA 4GDMA 1P0QA 4U2EA 4AMYA 3TEJA 1FSSA 4EY8A 2HFJA 3M3DA 3K6KA 5AI5A 2IIVA 3G0BA 4X00A 2OXEA 5IVIA 4BE4A 4BVJA 1UT6A 1XKTA 4KEAA 3OC0A 1YA4A 3DYVA 2OAEA 4OCZA 5IKXA 1XZEA 3QPAA 2ZYHA 2C0PA 5KWJA 3T4UA 3L1JA 3ZWQA 3R3UA 4B80A 1DWOA 2UZ0A 5HZGA 2XQFA 5CTAA 4I19A 4JUIA 3HEAA 2QUAA 4WY8A 1G42A 2Y2UA 3KXPA 3LLCA 2H7XA 1UFOA 2BKLA 4Q3LA 4NZZA 2ZVDA 2ACEA 4BP9A 1W6RA 1C7IA 2H7CA 5DYWA 5FV4A 3PFBA 3O4JA 4MYDA 1FJ2A 4J0IA 2OGZA 4HZGA 4INZA 1AGYA 1XRMA 2QJRA 1P0PA 2QXTA 1EB9A 1CUCA 4H35A 1R4ZA 1XKLA 2ZYSA 1EINA 2NW6A 5K3AA 3QMMA 4UPDA 3NWOA 1QIJA 3C5VA 3D2CA 4OB8A 4EY4A 4CG1A 3PE6A 1XRLA 5FPPA 5AKIA 1DQYA 1YCDA 1E5TA 5DNVA 1AQLA 4FBMA 2VA9A 4AB1A 1Q84A 3DDUA 1PJAA 2XLBA 4KRXA 1EVQA 2G5PA 3I2GA 2GBCA 2B20A 5AKYA 1O6GA 1IUOA 4J0KA 3I1IA 2D0DA 2ZYRA 3I6YA 5DNUA 2W22A 4DGQA 4K2AA 5DJ5A 1CUXA 2XMCA 2OQIA 4CIBA 4FKBA 3W9BA 2OCLA 3FYUA 5JADA 3W05A 5D7BA 1RP1A 3P2MA 1ORWA 5AI8A 1CUIA 2BUAA 5CRIA 5T4BA 5HKBA 2WHRA 4LHEA 4BRSA 1VZ3A 1U65A 3G8YA 1QFMA 4AO6A 1U2EA 2PSHA 4OSEA 1QONA 4LIPD 1CUDA 4MQLA 4I4CA 1VA5A 3A2NA 3ZI7A 1EXWA 4MYSA 4H7FA 3IULA 4L3WA 3UUEA 4HXEB 1H2YA 1HQDA 2H7YA 3G9XA 5E4JA 2IX9A 4H7DA 2ONCA 3SC2A 3AJAA 4BAGA 5IVDA 1A88A 2PSJA 2VJAA 1LBSA 5IVHA 3WJ2A 4X90A 3H18A 2JBWA 2WKWA 1DT3A 5EIHA 1HLGA 3I6MA 3KDAA 5CT5A 4K6KA 4Y2YA 4AO8A 5DYTA 5DLPA 1MNAA 1A7UA 2OQVA 3WYNA 2PM8A 4B84A 2CEKA 1QIEA 4C87A 4EY5A 4AMZA 2Z5GA 3AZOA 1SCIA 3O4IA 4GXNA 3YASA 4UFNA 2QOEA 5K3FB 5KBYA 2XUQA 4QDOA 1XZFA 3AILA 4FLMA 4Y2SA 1CUAA 3ZLTA 2I3ZA 1QE3A 3A2LA 1XRPA 4AZ3A 1YSCA 2JGJA 2I78A 1N5RA 5CURA 3WA6A 3VKFA 1I6WA 2QTBA 2YH2A 4Q05A 2P8SA 2WFLB 4EHBA 3C6XA 3QPDA 1CUSA 5K3EA 4YPVA 3WWCA 3PDCA 4UHDA 1TK3A 3IVMA 4YASA 2C7BA 2WUDA 5H3HA 2AJ8A 3I2JA 1QIGA 4RPCA 3PF9A 2HIHA 4Y2XA 3UMJA 1Q0RA 3N0TA 2V9ZA 3GBSA 1HDEA 3ZLVA 4OYYA 4UBNA 1CRLA 2BFNA 2XUAA 3HI4A 3GA7A 1LLFA 1XZBA 2OCKA 4ITVA 4UHCA 4Y2UA 5LZ8A 4JEIA 2C0QA 3FYUB 3UUFA 3C8HA 1CQZA 2XLCA 5I7UA 3E4DA 3F98A 1TCBA 1OCEA 2WTNA 4HTAA 4X6YA 1AUOA 2RHWA 2PVSA 4X6UA 1QO7A 5ALMA 2HU8A 1WPRA 5ALQA 4QLOA 2Y2VA 4E46A 4Y2VA 3WKDA 1A8QA 3BIWA 1VXRA 4H7EA 1BEEA 1JMKC 4KJXA 2WJ3A 3R3VA 2I03A 2OCIA 4DSZA 3LIIA 4G9EA 3D7RA 5C8ZA 4FMPA 5AKEA 5AI6A 3BJRA 3FCYA 1LPPA 5AIAA 4BAUA 5CW2A 1ZD2P 2O2GA 2VT6A 1VA4A 2ACKA 2VAXA 2GZRA 2VJDA 3FCXA 4BP8A 2ZYIA 4QDUA 3H19A 1JU3A 3DCNA 1ZI9A 5FXMA 4H0CA 4DIUA 5I9IA 4EB0A 4RE5A 3VDXA 3R3WA 2XMRA 3I2IA 5KREA 5EIAA 2XB6A 4J03A 3MVEA 4M0EA 5AKJA 4EZIA 1XQVA 1ZD5A 1USWA 4IO0A 1K63A 2RI6A 2XE4A 1ZOIA 4FNGA 5HFAA 5JAPA 3R40A 1Y7IA 4PV7A 4UBKA 2EDAA 1M33A 1CUEA 1GKLA 5JZBA 2HU7A 4KE7A 1MX1A 4WDQA 4HAIA 1YASA 1WB4A 3F67A 2XDWA 1EX9A 2JGLA 5CH8A 4BZWA 3RLIA 1DQZA 1JJIA 3LS2A 4O08A 3STYA 3TJMA 2JGEA 2BAGA 5IVKA 2QRUA 3ZPXA 1XFDA 4JYMA 2FUKA 3STVA 2DHDA 1PV1A 5A7FA 3TGLA 4J0HA 2QKYA 4Q34A 4KAFA 1BN6A 3ILSA 3CN7A 2WU3A 4GWLA 2PKYX 3W9UA 2ECFA 1MU0A 3M83A 2CZQA 1XZHA 2JGMA 5T4EA 3I6ZA 2HA0A 3HLKA 3FOBA 1W1IA 1MN6A 2HA6A 1UZAA 4B0PA 3WWDA 1J2EA 4GBGA 3HABA 4HVTA 5ISMA 1CUZA 2PX6A 5EHXA 5DNWA 4TPKA 2FJPA 2AXEA 3B12A 2QVBA 4OU4A 3WIBA 3E0XA 1R50A 5E2IA 5T4FA 5SYNA 3G0DA 1E8NA 3NUZA 3K2IA 4W1SA 2GBIA 2H9YA 1KU6A 3H17A 2PU7A 3BF7A 1N8SA 2WSLA 2XUDA 2FJ0A 4MEBA 3ED1A 3U1TA 1H2WA 3DKRA 3VJMA 3I2KA 2WIGA 2GYUA 5KWIA 3HXKA 4PSDA 3K9BA 4X85A 2X8BA 3MGAA 3C6YA 2WHPA 2WIJA 1MAHA 4DNFA 1UOOA 3BXPA 1YB7A 2RGUA 2CUTA 3HYSA 3HC7A 4FOLA 2OAGA 4N5HX 2Y1KA 5ESRA 2DCMA 1WPXA 1BCRA 1LPNA 4U2FA 2LIPA 2I3DA 2DFPA 5AOCA 3D5EA 4QZVA 2Z8ZA 3SX4A 3RM3A 1YB6A 5FRDA 5D3ZA 4ZREA 2HADA 1BU8A 2ZJFA 3JWEA 3DS8A 1SC9A 1SFRA 5CXXA 3WIOA 4QE3A 4ETWA 1C4XA 4X97A 3VVLA 4M0FA 1HPLA 4MJ3A 2XMQA 4Q1VA 4GECA 1CUUA 3C5WP 5LZ7A 2WUFA 4AZ0A 2WLSA 2HA4A 1ZD4A 1C7JA 1MNQA 3A2MA 4BCCA 4OPMA 4XWGA 1ZJ5A 4IH4A 5CT6A 4AQDA 1X2EA 4P92A 1ISPA 5AOBA 1QIHA 2V98A 3BF8A 3W06A 4KACA 5LKRA 3V9AA 1K5PA 3ZLUA 4B82A 4EY6A 4ZV7A 4UBIA 3O0DA 2QT9A 3R41A 1CEXA 1JI3A 3BL8A 1CUWA 3RARA 1QGED 2VSQA 3PFCA 4A16A 4FLFA 4K6GA 2RIPA 3QBJA 2DQYA 4LXGA 4X93A 3EQ9A 1JKMA 4KE9A 4CFSA 4GLBA 2PUHA 2HHAA 4OUKX 3FLAA 2XUPA 4ZWNA 1F0PA 1OILA 4B9AA 2QUBA 4MQMA 4WCVA 1BRTA 1K8QA 2WUEA 3OM8A 4DM7A 3WKCA 1G4HA 4DMHA 4HRYA 2OGSA 2X5XA 3ICVA 5ALXA 4BVLA 4J0CA 4G8DA 4DMKA 1PFQA 1HKHA 1WOMA 5JD6A 5BWBA 4GEGA 2OLEA 4A5SA 1SOMA 1H22A 4BDTA 2XMGA 3OG9A 4XVCA 1WCYA 4B6GA 3FSGD 1ZIXA 5A71A 1LPBB 3C6BA 3AFIA 5ALHA 4FFWA 3W04A 4CG2A 4MWTA 4G8CA 3KWJA 1R88A 4H7IA 3WWEA 5FUMA 5HQ3B 5JANA 5JZSA 1YAJA 1WHTA 1DINA 3DYIA 1AC5A 3MUOA 5CMLA 1CUHA 1XRRA 4KAJA 2HRQA 1MAAA 1BS9A 3QYJA 4U2DA 5IH7A 2XQJA 4FWBA 1W52X 2HA5A 3H04A 3STTA 3OPMA 4K5QA 5HCUA 5CT8A 5C81A 1XZJA 2GBGA 1GZ7A 2ROQA 5A62A 3WL8A 3DOIA 1YS2X 1ZIYA 5HF6A 1VKHA 2RHTA 5LZ5A 1D07A 4DNPA 1LZLA 4DMCA 4WJLA 1CUBA 4BYMA 4HXGA 5ALIA 4PSCA 5K3CA 4UBMA 1BROA 3T52A 5DTJA 1ZICA 3QMWA 2XUJA 3V1KA 3S2ZA 5ALWA 1QIDA 4RGYA 3C45A 3FVRA 1VE7A 4N8DA 4OD0A 5AI0A 1VLQA 4RNCA 4UBOA 2D5LA 4ZI5A 2QMQA 4ARAA 2HRRA 4JNCA 2YASA 3WK8A 2GYVA 3IUJA 4YX9A 1TCCA 3KWFA 4FNMA 5I8PA 2XUHA 2X76A 3HACA 2BUBA 4S0XA 1XROA 1GPKA 2ZSHA 1BN7A 4X7BA 3WKAA 4Q3OA 3O9VA 3V1LA 4J3JA 5AK5A 2AJCA 1TQHA 5LIPA 5BV7A 1QJ4A 4HRXA 1UOPA 4BC1A 4DYHA 4BRZA 4DLNA 5D6OA 1J06A 1IUPA 2PUJA 3CCBA 4J0GA 2JGFA 4N5IX 2JGKA 4QDXA 4DNOA 2BUCA 5ALPA 1EHYA 2JGIA 1IZ7A 1CV2A 2XUGA 4X94A 3GUUA 2VATA 4FFVA 3D2AA 3SK0A 5ALTA 2WUGA 2AJDA 1LBTA 1KU0A 1QOZA 2Z3ZA 5EI5A 5A2GA 1VZ2A 4AO7A 1AZWA 2CJPA 1ODSA 1W4LA 4BDSA 3IURA 1YAHA 5JIBA 3IUQA 3NGMA 1CUFA 4OB6A 3ZV7A 1YS1X 4XJVA 2EEPA 4JYPA 5FKJA 5BOVA 4WDRA 3Q0TA 3WQHA 4B7ZA 5HF9A 1N1MA 5D3KA 1E89A 2XUIA 3PICA 2RAUA 1SCQA 4P93A 4W9RA 4G4IA 4RE6A 2RONA 4LXHA 4QEKA 4BCDA 1XRNA 1JMYA 1R9NA 1WB5A 3GFFA 1ACJA 3FLEA 1QIMA 4HXFB 3AIOA 1MX9A 4G8BA 4CCYA 2G63A 1XZMA 2XQGA 1F0NA 1RWQA 2OG1A 1AURA 3R3YA 1H2ZA 1H2XA 1JU4A 3AIMA 2WIKA 1XZDA 5JZ9A 3WYDA 4FTWA 1THTA 1FFEA 2IITA 4ZRDA 3WK6A 3HRHA 2WG0A 5DWDA 4Q3KA 1X70A 4C6HA 3H1BA 1JJBA 5K3DA 3KOOA 2H1IA 5LZ2A 4GHWA 3H2KA 3VISA 3BWXA 4Y2PA 4GW3A 4OU5A 4Y2JA 2WIDA 2DSNA 5AK6A 3I1YA 4KRYA 2J4CA 2PSEA 3ESAA 4NVRA 3NOXA 4V2IA 2CB9A 1J1IA 3IBTA 4CCWA 4MXDA 2CBGA 2R11A 5ALSA 4P9NA 5LZ9A 3D3NA 5ALKA 2HA7A 4MEAA 4FHZA 1CUJA 5EFZA 4L9AA 5AKZA 1CPYA 5AICA 5ALEA 1Z68A 4C88A 1IZ8A 3WLAA 4X71A 2C58A 3M81A 1MPXA 1XLUA 4D9JA 4ARBA 3N2ZB 3M82A 4PQEA 5HKAA 4F21A 4KR0A 5AH0A 4ROTA 4JH0A 4QA9A 3WK9A 4BVKA 4UFPA 2PL5A 3C43A 2PU5A 4KE6A 2XUFA 2WU4A 4X95A 1AKNA 1GQRA 2WIFA 3R0VA 2J3DA 3WK7A 1QLWA 4X6XA 2VEOA 5CXUA 1CVLA 3OURA 1XZAA 3VXKA 2XMSA 2J3QA 2DHCA 4BCBA 3V1MA 5LP1A 2PSDA 4FBLA 4IQ4A 4PO3X 1QTRA 4F5ZA 5EHZA 3HZOA 1UXOA 2EDCA 4A23A 3S8YA 5A6VA 3D0KA 1CUVA 1S8OA 1E66A 4QWMA 3PF8A 1SCKA 2DQZA 1UK9A 1CFJA 3EQ7A 1MO2A 3V1NA 3HJUA 3O9MA 2DR0A 1QIKA 5ALZA 4ZXFA 3H2JA 4M0MA 4BB0A 1DT5A 1UK7A 2OPHA 5ALGA 2YXPX 2WILA 4LYDA 1Y37A 2JEZA 4UHBA 1XZGA 1CQWA 2QS9A 3WL5A 5JYCA 1VOTA 1F8UA 1KEZA 4H7JA 4IH9A 2G4LA 4Y7DA 4N8EA 5EHQA 3OOSA 4U2CA 5E4TA 4H18A 4L72A 1LZKA 4KE8A 5A7GA 5AKKA 1NU6A 1VJ5A 1JFRA 5CT9A 5T4HA 1DTEA 4CI9A 1JT2A 1ODCA 2Y6UA 4EA6A 2Q0XA 2WHQA 1CLEA 4G4JA 4ZV9A 2GZSA 2Y6VA 4OB7A 1ZI8A 3FBWA 1UKAA 5E4YA 1LGYA 2XUOA 4BE9A 1WHSA 1B6GA 3G9ZA 4N8SA 3BE8A 3R3XA 5CBKA 1XLWA 3F96A 5JD5A 4LYEA 2O2IA 3IDAA 5AM0A 1XZLA 2J4FA 4XX1A 5AK4A 5HK8A 2DHEA 1OXMA 3TRDA 2VJCA 2VF2A 4W1QA 5J3JA 3AIKA 2WFZA 4P08A 3DEAA 1TIBA 2W6CX 3D4LA 1GXSA 4LXIA 4H7KA 2WG1A 1EK2A 4XIIA 1XQXA 3QM1A 1Q83A 2ES4A 2JEYA 4B85A 5DTIA 4UHEA 5FOQA 4BATA 1L7AA 2HA2A 4PW0A 1CIJA 1W76A 5K3FA 1YR2A 2QZPA 1MTZA 1MJ5A 4WFIA 2OGTA 4BBZA 1QZ3A 4AN1A 1L7RA 1ACLA 1GQSA 4W1RA 2VAVA 2QJWA 1AMNA 4L0CA 3G0CA 5JATA 2C5GA 4Y2RA 1DX4A 3AZQA 1NX9A 3KSRA 6YASA 2WFLA 3C6ZA 2Z8XA 1CUGA 2Z3WA 5FP0A 2O2HA 1GKKA 4HS9A 3H0CA 5ALLA 3F9CA 3DLTA 1Y7HA 3O4GA 2XMZA 3WK5A 4PSUA 2HM7A 4FDMA 5FDFA 5EHNA 3OTQA 5AI4A 4UFOA 4U2GA 4UHHA 1TAHA 1BCSA 3CCCA 5JAUA 2ZSIA 5JAHA 5FLKA 1LPAB 2GBFA 2R8BA 1VXOA 1K6EA 2QM0A 2WHPB 1EDBA 2O7RA 4H77A 3LIPA 3WWOA 1R9MA 1FFBA 4Y2QA 3V48A 3L1HA 5ALRA 4B81A 3GZJA 3IB3A 4DTCA 2XQKA 5ALOA 7YASA 3FAKA 1THGA 3KD2A 5SYMA 3G7NA 5EGNA 5A7HA 4X91A 1T4MA 1BE0A 5JALA 1XZKA 2JIDA 4U2BA 4NS4A 1UK6A 4AN0A 4EUSA 3F97A 4E15A 3QZUA 4X3CA 5HK9A 2G5TA 2WTMA 5AKXA 2GYWA 3AZPA 4YK7A 4OYLA 2XUKA 1UWCA 4AX4A 5EIEA 2PPLA 2JF0A 3ANSA 2K2QB 5LLSA 5ALJA 3PUHA 1EVEA 4IH1A 2XQIA 3DD5A 3DJYA 3DQZA 5AKLA 1DX6A 1EK1A 1GGVA 2VTVA 4X92A 1B41A 4BAZA 1E3QA 3I2FA 4C4XA 3FLBA 1IUNA 3WL7A 2XI4A 3O4HA 4CIAA 1XQYA 3G0GA 3BDVA 3CXUA 2HA3A 3E3AA 2ZJ7A 1CR6A 3DOHA 1BEZA 2O7VA 1YA8A 2VQ6A 3WWPA 5AM1A 3QMVA 4BZZA 3C8DA 5JARA 2XMDA 5AHXA 1ZI6A 5YASA 1EB8A 5JASA 4G5XA 2AJLI 4UBJA
chains in the Genus database with same CATH superfamily
4N1AA 3WWZA 4D6PA 2WDPA 2OFXA 1HMYA 1VTKA 3AHDA 1Z5VA 3N2KA 1HDYA 2V7VA 1YGPA 1AGNA 2HHCA 2VT7A 2Y05A 4GUDA 5THKA 4DZRA 1FP4B 1SKAA 2GH1A 3BE6A 2DZDA 3LP8A 1QE5A 4J0EA 4QDTA 2F1KA 4IOKA 1ZJ4A 3HLYA 3S3TA 1AUQA 2E3JA 3PL1A 1W48A 1S2LA 3R8CA 1QIIA 1C3XA 1W0KA 3CC8A 3OIYA 5FPYA 1OV6A 5BR8B 2VPXA 2BFCA 3H7IA 4JI6B 3ZZ0A 1WXFA 1FTWA 2WFMA 1TA0A 3CRQA 3O75A 4HI0E 4WFJA 4RTPA 1NBAA 4INOA 5F4ZA 4ZARA 4A8HA 3ER8A 1HT2E 2HQRA 2YYSA 3VNQA 1TZBA 2H5EA 1MXHA 2PBLA 3ABOB 4PFKA 3KSZO 4EENA 1JEYA 3EUFA 5KDLA 4OKSA 1QQ6A 3TSZA 4AF6A 5DLYA 4J1NA 3D0OA 2QMZA 3QF7A 4A8JC 5JBQA 3SHWA 3ZD8A 3FBGA 4EH1A 1K2VN 1TZCA 1U81A 3PDJA 2GK4A 3LT5A 4HP8A 5DYYA 3K8QA 5L45A 3GWZA 3GL9A 3ROPA 1OFHA 2P8JA 4EW3A 3RADC 3GV0A 4QDKA 3PUXA 4IGEA 3CQ9A 1OZFA 5ANRB 4AF8A 2IBSA 4MB0A 5CYFA 5M3BA 5ED4A 4YXWA 4DMFA 2VZ0A 4IX9A 1YD7A 3H2YA 4EHFA 5JSUA 1PFKA 1QO9A 2P9GA 3OFSA 4I2NA 4JFAA 1E1RA 3A58B 3G0IA 3EF1A 4HQNA 4DDUA 1PJQA 4ZJYA 1P5ZB 1ML4A 1VHDA 1U0TA 4OHYA 2EGUA 3CU5A 3ESCA 4HVAA 2RI1A 2QN6A 1Q2UA 4CT4B 2IIBA 4RTQA 3G9UA 3OE1A 4B3HA 3FYUC 1ZD3A 3LRTA 2QTCA 1MAVA 2O48X 2Y9MB 3A3YA 3VI4B 2IXEA 2BFBB 5C7IO 1GLVA 2XIQA 1MV8A 4BC0A 2OCPA 4MKXA 4KB5A 4D4JA 3BQMB 4XFDA 1YC2A 4LI3X 4DV3B 3DOUA 1XU9A 5DMXA 4Z9YA 1H8ED 2H11A 5JO9A 1Q77A 4BNLA 5HIKA 1E60A 3AXTA 3O3NB 2PO5A 4R01A 4H17A 3CNEA 2DXIA 4S1TA 1M2OA 3Q0EA 4C76A 1I8TA 2VZLA 1RJGA 3NASA 2FQQA 4LF7B 1UJCA 4DOMA 5JSHA 4FLEA 4KQFA 1UOEA 3AKDA 4XPIA 1U5CA 3FX2A 1QK3A 5EYPB 4J2OA 2PNJA 1OGJA 3RK4A 2H51A 2FMXA 2VDKB 4P8RA 3IIIA 4LHSA 5TT0A 1Z73A 2V8BA 4ND4A 2G1UA 1BVRA 1MX3A 2GZ3A 3AKYA 3BQ9A 1N8NA 2XTJA 2R3SA 4FT2A 4KBGA 3S8MA 2ISQA 1B23P 5BMVB 4MPTA 1XK6A 5DCWA 4DV0B 2WE8A 4J3FA 4R9RA 4A03A 3ZHXA 4YMTA 2I9PA 2Q27A 3U26A 3OT1A 5CDGA 1A9YA 2QE7D 3L1IA 2ZI5A 3TQIA 1E69A 2VP4A 1CDOA 1DXQA 3MWLA 1WX1A 3RG8A 3ICWA 3EPRA 4L8VA 2G9QA 1NU8A 2BGTA 1G5TA 1H6AA 3ZDFA 2R7AA 1ODTC 1Z35A 4HLQB 1LUAA 5B3AA 1NP3A 3G2HA 3W3AD 1T4BA 3QX8A 1C9EA 2BMDA 4LS3A 2H5JA 1XK7A 1ZRMA 4ZQCB 4EUEA 3L04A 4Q9DA 3S1SA 4BNJA 3RS7A 3N0WA 5KI6A 1R3DA 2ADOA 3Q3VA 1NVFA 2XOXA 2XKJE 3SQXA 3AETA 3EOAI 1E8MA 4Q3CA 4EFLA 2O59A 2BGNA 4JLWA 1W47A 2JZCA 1Q15A 2BFWA 2Q3BA 2X6TA 4JJEA 1CUYA 1AKMA 1OX4A 5E7QA 5TS3A 3SSOA 5LOVA 1C7ZA 3B8EA 2CV0A 5EP4A 3VJLA 2UDPA 4AXBA 2X3FA 3L49A 3QVMA 1Z3CA 1P4RA 4L22A 3BFKA 3K5PA 4U9UA 4W1PA 4E7PA 4B73A 5CEJA 1RWBA 2BMFA 3LHIA 3LKZA 2P11A 2LPMA 2KJQA 2X5KO 1G8FA 1G5QA 1I24A 2O8DA 1KFCB 1A82A 1VDZA 1HYEA 2JGDB 4NEGA 4O1MA 4TV8B 1YQWA 3A4VA 3HDQA 1UPFA 5BN5B 2Q9CA 2OWEA 2DFTA 4S12A 5H68A 3QA3E 1WSWA 4Z4CA 3O95A 1IMJA 1B6SA 1UIRA 2XCSB 1FZQA 4RYDA 5AVQA 3R20A 4UTZA 4FCWA 1JFLA 1K4MA 9GPBA 1FFCA 3AGPA 1MX5A 3QUBA 2CDAA 3ZNQA 2XZLA 1IY9A 2I55A 1L5GB 2RGEA 3DKIA 4EMBA 3V4ZA 1ONNA 5C7OO 1SUDA 3KYBA 5GOZA 3ZNNA 3WLMA 2M6SA 2BGRA 1M9NA 4KQWA 4PCVA 3SFTA 1ZL2A 3WADA 2F3QA 3DFIA 4ZVKA 3U7JA 4LJ9A 1TU4A 3LX4A 2GA8A 3SSNA 2B83A 4IXMA 2C5FA 1LPOA 2MIIA 2V6FA 3RVSA 1DZ3A 1XKQA 2IP1A 1M76A 2B4TO 3P94A 1FFHA 4IXDA 4FEEA 3SZUA 5A9SB 1FP7A 2BRUC 3O1LA 1BO6A 1Y6JA 1KR5A 1RPAA 3RVNA 4D99A 4LVCA 2ECQA 1VCNA 3ZX4A 3IAM6 1N7JA 3H2IA 3OESA 1QG2A 3K31A 3KLPX 4G63A 4EABA 2ECKA 3LP5A 1MG5A 4EX6A 1EE1A 5LZ4A 1NMYA 4JY7A 3T7SA 2C8JA 3AINA 3DLIA 3R2JA 4J0JA 4R6WA 2MINA 3FW1A 2CZCA 2ZROA 4M86A 3ZV5A 3RT7A 2ZRGA 3ANTA 3V80A 3SHTA 3WOHA 4F6RA 1YUBA 5AVXA 2PJUA 3PHCA 5HDQA 1YZHA 3RT9A 1NL3A 4JA0A 1U28A 5JC8A 1W7AA 3KOMA 3QPUA 5CH5A 4UD6A 1GVHA 1VPLA 4RKWA 5I3CA 1F2VA 1MJHA 2OV4A 3ZWOA 2VP0A 3KQKA 1ZGBA 2RGDA 4WADA 2H1VA 1RYZA 1VCMA 1B0PA 5CT4A 1UPTA 3ZTTA 3ZWDA 3ADCA 3AVPA 4FGUA 3HSSA 2NUPB 1CF2O 1L7OA 3CISA 1TVKB 3RVOA 4TRRA 4Z3KA 1NLFA 2VF8A 3LV8A 1D8AA 2ZJOA 5TR9A 3V8RA 3S8EA 5B4TA 2OZKA 2WHYA 4U5XA 1ECJA 2HQBA 5AHRA 1Z5ZA 4FXOA 5TXGA 4DILA 5IN4A 4YRCA 1AZLA 1X42A 4DR5B 2C9DA 1YDWA 3UAWA 1GUFA 3UBTA 3IEXA 2QTZA 4YMUA 3GLHB 1M3SA 3HJCA 4PRZA 5ALUA 1WG8A 3U5ZB 1Z7WA 3AXSA 5IJZA 1WCIB 3G9TA 1YOVA 1ZUD1 3FWHA 1CY6A 1IHXA 3OIUA 5IM4F 1E4EA 5AJHA 3FHJA 2APJA 2BJWA 2R8YA 5FQNA 1O95C 2FHSA 1JLLB 5JHGB 2FGKA 2I1QA 1FP1D 2ADMA 4CJXA 2FX5A 3NRBA 4EJSB 1OFIA 2ZUDA 4GPEA 3SZRA 1EEHA 1HQCA 1QGUA 3RWMB 4W5TA 3LXRA 5CTJA 5HF8A 3OBBA 1PWYE 2ACWA 4U3JB 2JDIA 1U6JA 3R6TA 2OO7A 3ZGLA 4ENSA 1A8UA 1WSDA 1NXSA 2AOUB 1B3RA 3AHGA 3C8ZA 1W4CA 3EEYA 4IUBS 3M9LA 5ALFA 4IOLA 1KZ7B 2CKDA 5F5XA 5KQLA 4X3OA 2H1SA 3W2TA 4BNXA 2CFOA 2VOEA 4DNQA 1K8XB 1ESNA 2SICE 4WXHA 1GIAA 1GSOA 2XNKA 3H5VA 4RVDA 4WCFB 2ZTSA 1K3UB 4PZ0A 3IIJA 2WZBA 3Q3JB 5J4HA 2QMUA 4LPSA 1UJNA 1OYYA 2YV3A 2WQZA 2RCYA 2D59A 3B2NA 3GHHA 3FGOA 2Z5VA 4TVBA 2HN9A 1D6NA 2C84A 3N8DA 4RD2A 1DU4A 3DLAA 1K75A 1NT2A 1SOUA 3CWZA 3K1ZA 4ZJZA 5HF5A 2V3CC 4EITA 5HR5A 5AUQA 3UJ3X 1BDBA 5AIBA 3FPLA 3IQGX 2HXGA 3OUZA 1KNXA 4B44A 1LQ2A 5ILQA 4H59A 4YUWA 1X8LA 1G66A 2O57A 2W2QA 5EWJA 2B1IA 2GEDA 3H8WA 5F2EA 4ARUA 3I2HA 1E1DA 3ZVMA 1RABA 1USIA 4M8KA 2P6PA 4H1WA 1TKRA 3L05A 1T5BA 2CK3A 2OP1A 3LMKA 4WCDA 5BNIA 4FSDA 3RFFA 3BJEA 3CH4B 1U0OC 2AJBA 3MMSA 1Q7RA 1KFJB 2GDJA 3D6MA 5GPBA 1V8DA 3D2LA 1VCHA 3W34A 4CPDA 1GPJA 4B2PA 4PY2A 2HDWA 3EFEA 1BMTA 1E9RA 4HQLA 4KAAA 5HIAA 3AL3A 5IKPA 2UYGA 1XAIA 4NMWA 1JHDA 3IQHX 3WJ7A 3FB1A 4ENRA 2O07A 1U2DC 3UAVA 4FX2A 3U6BA 3LU1A 3PA8A 2V1UA 4NCAA 5E2BA 1QRTA 5F2KA 5TC4A 2PA3A 3L1KA 1QVAA 1M5TA 3FRHA 2F1RA 3IXMA 4F1KA 3DEFA 4B74A 3Q8WA 3BFVA 2FHPA 2QUIA 2XWSA 1KOLA 2GD1O 3H1AA 5CH3A 4YT8A 3IKLA 3TH5A 1YHZA 4Z9FA 3WZMA 4Y6LA 3SAJA 5HQ3A 2WWFA 3GUYA 1H1LA 1XCOA 2QPOA 3F1LA 3M6IA 4URXR 3W4JA 4BFZA 2YZNA 3TL3A 1E79A 1SCAA 1RZ3A 3N9IA 1I0LA 4K7JA 4X20A 2EFYA 2C20A 1EJ6A 2WNHA 5KU1A 3QUTA 2AX3A 5CYPA 4AI6A 1CU1A 2J6IA 4UUMA 2NSYA 3K73O 1V9SA 1ZK0A 2G17A 4GPD1 2IH4A 1AKEA 3K7EA 2BJHA 3A6ZA 2XRFA 4B83A 4QTTB 3IX7A 3JWJA 4WXEA 1W36C 3W5VA 4EGQA 2UYHA 5HNKA 2Z6AA 1E2MA 4W99A 2H08A 1YVUA 3D3EA 1N5JA 1PNQA 4GDMA 4C3UA 2NP6A 2AMLA 1FJHA 5K8LA 4D4IA 3O3MB 1XL1A 5LMUB 4PRYA 2W6OA 4BL5A 3P0FA 1ELOA 1OLOA 3B1XA 1UMCA 1J8MF 3FIUA 3NZEA 1N7HA 4RX1A 1YE3A 2RHMA 2VYVD 2IIVA 3G0BA 2GVDC 3CTMA 3I83A 3LQRA 5TDHA 3SQWA 2JAHA 4GOKA 3CXRA 1BA3A 1P45A 4DS3A 3RTCA 2E4YA 1UT6A 3UV3A 4BVJA 2D0IA 4Q3NA 3OLZA 2X0IA 2R44A 4KEAA 1KYVA 1OT3A 1XUOA 4E5KA 4N9QA 3ZU5A 2OYRA 1W2GA 2I4TA 2XVZA 1KMCA 4DGSA 3O91A 4DQUA 4EQ6B 1KEEA 2DHRA 4GPIB 3RRZA 5D85A 3ZDBA 1WKCA 1XZEA 2G72A 2D7JA 2FYTA 5GONB 3QPAA 4I4TB 5BYBA 4BUJA 3KQPA 3N70A 3LVFO 3W4KA 2C0PA 3VNUA 2PL3A 4OX9Y 821PA 4I5DA 4NE9A 1KAHA 1BDIA 2AFHA 1NDUA 1U7UA 1XDBA 3L1JA 4I3HA 3OX2A 3C6QA 3SY8A 4Q3BA 2PGLA 2DTEA 2PKQP 2W8BA 4URVR 3NXSA 4AZWA 1TZKA 3DSRA 3R3UA 4CMHA 2QLLA 3FB4A 1UF9A 3LBFA 5CTAA 2MSDB 4I19A 4TV8F 1P73A 2IS6A 3D54D 4IIYA 1EU1A 3C39A 2IPXA 3HEAA 2FFBA 4KQ9A 1EDOA 2B30A 1G42A 2A30A 2PGJA 2Y2UA 4MVJH 1JP7A 5KTPA 2H7XA 1B16A 1D2EA 2BDEA 1UJBA 4F71A 5ADWA 1QVVA 3AM5A 3OQ1A 2D3WA 3EDCA 1JYSA 1J2TA 2BKLA 2FMHA 4ND1A 3T06B 2AN1A 3DKVA 4IMJB 1DAEA 1VPVA 2JAQA 1ESEA 4YH1A 5G1PA 4BP9A 1XIVA 1KYXA 1DO0A 2C2WA 1W6RA 3LK6A 1U2SA 4HEHA 5DM60 5FFFA 1A9OA 3RD5A 1BVYF 5B7GA 1TQ6A 2Q1SA 4Z7OB 5BUZA 2Q7XA 3H5IA 4NBTA 4HDRA 5E1OA 3RW9A 2CVHA 4J0IA 5HHTA 1RYEA 2OGZA 2YY5A 1AGYA 1MB0A 2ZJ1A 3KETA 5KWEA 1SHTX 2IYRA 3LWDA 3TLYA 4E4YA 4H35A 3UH0A 3DE4X 4C7XA 2V4UA 1M6VB 1Z33A 2ZYSA 1KQFA 1G4UR 2HH9A 2WJIA 3LUDA 4TV9B 4PNEA 4UPDA 4B7CA 3AF2A 4KI7A 1MRNA 1EBUA 3K0KA 3JTMA 2GR9A 4RNDB 3DGFC 1Z16A 4HUQB 3NFYA 4QYMA 3VZQA 2QTFA 2IOHA 3PE6A 4MQFB 3EC2A 2HWXA 4JEHA 4RFVA 2FW1A 4RHEA 4XKJA 3GLIB 3I5XA 1R5JA 4Y6SA 3ZHYA 3M1LA 1S96A 4HX5A 2CL0X 2Z30A 3O4RA 1M2HA 1THZA 4UPVA 2Q45A 4MJXA 5KQPA 2WA2A 3VDRA 4JXJA 2WAYA 1EAYA 3NM4A 1ZNWA 3UJ9A 1E5TA 2WDZA 5DNVA 1OLXB 1AQLA 2JCVA 5LJIA 1ZAYA 1HDOA 3R7BA 3ZWNA 4O3FA 3AVWA 3LSYA 5K0EA 4B3RB 1RQXA 2QSUA 2TECE 5DN9A 2G0TA 1GCAA 1UP4A 3LUAA 1L7MA 5CLGA 4YRTA 5AW8A 1MFZA 1G3MA 4BQSA 4C0WA 1K86A 1BD3A 1VJCA 3QE0A 1HFWA 5E6UB 1WXGA 1JPVA 1PJAA 3CO0S 3L8FA 1EVQA 3EBPA 1LRKA 3D6JA 4J49A 1AK2A 2PMEA 4EPYA 1BJRE 8ATCA 1T2AA 2GBCA 2WYIA 3DAYA 4NU8X 5NLLA 2B20A 3B3FA 5AKYA 1O6GA 3R7WA 3TPFA 4ER3A 1L5YA 3UJPA 1G8PA 1HG1A 2XY4A 2X6RA 3UICA 2ZIXA 3I1IA 5CIQA 4A26A 4B7UA 5IBCA 1JXAA 1R4NB 3DPIA 3E9RA 4HWTA 4HMQA 1HLPA 3G1UA 3TEFA 4ENVA 7ABPA 2YWXA 4KFCA 1FMJA 1VGRA 4TTJA 2IIQA 2G76A 2L42A 3TTXA 3KSAC 1N77A 4H6VA 4K2AA 5FPSA 2IWHA 5HJ2A 4IDOA 4QPDA 4WY2A 1QFZA 2OXTA 4XOIA 3J7TA 4MYRA 3KLMX 4B8YA 5CYGA 3RAFC 4G41A 1B2RA 2D6FA 4N65A 4XSVA 4EDFA 2UUOA 3AR3A 4MULA 3W5JA 2XPCA 5IWAB 3CX3A 2A9VA 1ND6A 3ECAA 1Y7LA 4DIOA 1U0BB 1RM3A 4JJ6A 1II9A 1S89A 1ORWA 3OLQA 2ZE7A 1K5HA 3O8LA 1PX0A 4WLEA 5AI8A 1CUIA 2BUAA 4EZEA 2ANBA 4YS6A 4B6RA 3HADA 2HYIC 4K9KA 4BRSA 1VZ3A 2XDAA 3BH6A 2GLUA 5TQ2B 1TCUA 2EATA 2HT6A 2R4TA 5IU6A 1L5WA 3Q1KA 4DCJA 2Q3FA 1U2EA 5T41A 4OQMA 2PSHA 3PLNA 3TGWA 3U3MA 4LIPD 2PQ6A 3R1IA 2ZI6A 1PLJA 1F0KA 2LVBA 4EW6A 4M1SA 2XCUA 4I4CA 3R09A 4ZZ1A 5AVTA 1VA5A 2FDCA 3GCGA 4E51A 4BLQA 3E7XA 3HB9A 3D0RA 1TJ4A 3IULA 4H7FA 5FUVA 4R2IA 4XUCA 5FUWA 5I7WA 4QRDA 1H2YA 2D7CA 5EXPA 1HQDA 1OT5A 2GRUA 5AJWA 1V2GA 2H7YA 3G9XA 4JMLA 3C4QA 2B69A 1ZA2A 2REBA 2EFJA 2PZFA 3U09A 1VKZA 1CR0A 1M1YB 5KNBH 1A9QA 4Y9DA 3SC2A 4H0FA 4PAWA 1HA3A 1BXGA 1W59A 2AZ4A 1O8CA 1A88A 4FHEA 2PSJA 2GXSA 2H1HA 1ABBA 2IYVA 3QG5A 4LOKA 4LWQA 3S1LA 3VUEA 2FZVA 2JKVA 2PRJA 4AMVA 1H4QA 4W7IA 1L4FA 1NQOA 4RZ3A 3A0RB 5JS1A 1AXEA 3P1JA 2WT9A 3DBRB 3K70B 2WKWA 3O84A 1KKUA 4PFQA 5EIHA 1Y4AE 3VR2D 4W5NA 1TD1A 3QNUA 1V5FA 4FMBB 5A3VA 2HMAA 4QTXA 1Y3HA 1GV1A 4A4DA 1GG8A 2WYWA 5IF9A 4Q4LA 3SP1A 1JTEA 3F46A 1ZM9A 2GF9A 4A73A 4MPPA 2ORVA 3WGGA 1C8VB 3DVAA 4TT8A 1H4VB 2OC9A 3WSTA 3LYLA 2JD0A 4LCEA 4YJKA 5DLPA 2RGCA 4B6SA 2GO7A 2WWWA 2RKWA 5EMHA 1QO0D 1VSTA 4GX1A 3WP1B 1YCGA 5KMGA 2B98A 3H7AA 3IVAA 1H2FA 3RHFA 4JJAA 4DEYA 3CSDA 4EA9A 3IHLA 3HP1A 5K3SA 4CDMA 1GGKA 1SIUA 2Q3DA 2CEKA 3HSKA 3SDZA 3T5BA 4GOND 5JH7A 1KI4A 1G4AE 2BZ0A 2O8CB 4GXNA 3ZBTA 2AN9A 4YP5A 1DBSA 3IAFA 3ZHOA 4DBVO 3UJNA 3B1KA 1ZUHA 3EMBA 3LFHA 3DAGA 3NP9A 3ZBQA 2X1LA 4WKOA 1L3BA 4MS3B 5K3FB 3KDSE 5KNDD 4QDOA 4RS4A 1JHPA 1YT5A 3QKRB 1Q14A 2YV5A 5I7FA 1U5BB 4CW7A 2EKDA 1FUUA 1AK1A 1QE3A 1D1QA 1PSZA 1UADA 3A2LA 1XV5A 2W0MA 3LDHA 3LUHA 3MGCA 1LLCA 4I1UA 3ABRB 3LDFA 5A5FA 1TU3A 4US2R 2FDRA 3PRHA 4LX8A 4XPZA 4Y6OA 3II6X 4S24A 5DHFA 1UR5A 2R2AA 4I4TF 4M8NE 1Z06A 4YQFA 3PIRA 1I30A 1MOZA 2C5BA 4G81A 5FAXA 1XA3A 3WA6A 4RD1A 4RVNA 5BXQC 2H92A 4BVBA 3GFQA 1UC5B 4HRVA 5B3KA 2ZYTX 4E6PA 5AVRA 1MEEA 4MTCA 4ZI7A 2I3BA 5A4FS 1BSVA 2PJZA 3AVQA 3ED5A 2ZYVX 2N42A 3OF2A 4NDAA 2C9MA 4PSAA 3SSMA 3HVIA 2WTXA 2DWQA 3VOBA 3CJRA 5JNWA 2X8JB 4JI2B 3LZ6A 5H1YA 2I1WA 3G5MA 4ZZ2A 3UANA 4CKBB 3PDWA 4YPVA 5AW2A 1UBLS 2HRZA 3NX4A 1SZCA 4NU6A 4E2FA 1K8ZB 4HNTA 4F7DA 4UHDA 4BB6A 3MRTA 4PQFA 4CEHA 1CZLA 4UU1A 1IHOA 1U0EA 1AV7A 3DP7A 1VJ1A 1CE8A 1SXGA 2YL2A 1NVDA 3PEUA 5JFTA 3L82B 3ZU6A 3I9V6 4ZYZA 4KL8S 1DPFA 3EYWA 3PF9A 3UMJA 2GSDA 2WSBA 1Q0RA 2ZJAA 2YN0A 3N0TA 3FSJX 3COPA 4DANA 1W46A 1NBHA 2O1WA 3CSUA 2EIXA 1LQUA 1W73A 2JRLA 3CLTD 3EF0A 4FFOA 4CMIA 1Y3FE 4INJA 2XNDD 1EZZA 3B1YA 4OYYA 3F9RA 3WYEA 3LPLA 2CFRA 1MZVA 2IYNA 1GVNB 4PLVA 5BSMA 4D9IA 3EWAA 3MCTA 4DYVA 2QRZA 1WL8A 2XUAA 2FPGA 4JWTA 2XWQA 3HI4A 3LBYA 4ZV4A 3ZCRA 1CY4A 3GA7A 4IMIB 1UBRS 3QXXA 1XZBA 4TV9F 3WNQA 4Z4FA 4CQJA 1OD6A 1SBTA 3EC1A 1RPZA 2OO5A 3CWCA 3OUUA 5SZIA 4ITVA 4UHCA 3WQBA 4AY6A 1BGWA 2PFSA 1XTIA 2JATA 4YY3B 3ASVA 3JVDA 4NV3A 2GKSA 3U3RA 4Q12A 1TK9A 4MHOA 4RUKA 3EY9A 4MW5A 2A6PA 4KITB 5JW6A 4KQ6A 3GPLA 3UMMA 2C0QA 4RLQA 1H4SA 5CLLA 2WVAA 2BTEA 1IH8A 3DP9A 1CNFA 5EJMA 4P3XA 4PTLA 5IZ4A 4V0KA 1G8GA 3MLEA 4IINA 5I7UA 1MAWA 2YNMC 1QCYA 2X5JO 3Q85A 3GYBA 3EC7A 3OZEA 4R5MA 5DPMA 1R8YA 4NCIA 5LB4A 5C37A 2AQHA 3SG0A 4FEAA 2PUEA 3HO1A 2C95A 1S9HA 2IYOA 2VJMA 1E4VA 1PZFA 3FVWA 3W90A 1B8PA 3HUUA 1JJAA 4P4UA 1U1IA 5IK2D 5ALQA 2VKTA 2YMLA 4BMSA 1TK2A 2ZBPA 3N28A 4EJ6A 4Y2VA 1PL7A 3WKDA 3AV0B 3C48A 3GR6A 3OHMA 4DBLC 4XIGS 2ZE8A 1VXRA 1YIDA 3D5TA 3L0CA 3NVMB 4HG2A 4H7EA 4JJ7A 3DBLB 4P5DA 4XTCS 4MRPA 2F1OA 4MKGA 4RDIA 1M34B 1NW8A 3KQNA 3BTUA 2ZJ2A 1YK0A 2FTKE 1SRRA 4C3ZA 4YRGA 3KR0A 5JCXA 2OXCA 2OCIA 4Z1OA 3T5PA 4CNBA 2HUPA 3OHSX 4TSFD 5AHWA 1PJCA 1X7DA 3OJOA 4RV4A 5A0VA 3ETEA 1KO5A 3OE7D 3K0AB 5CU7A 1JIKA 1EWKA 2PKCA 3C15C 3EQ6A 2NU8B 4QPJC 4D9FA 5KDDA 1LDYA 1Z15A 1FRNA 2GJAA 1T8SA 3WBJA 3F74A 3SLKA 4A2PA 3E9MA 5CA1B 2PV0A 4J0QA 1PJSA 4P4SA 3EEIA 4Y9UA 1ICIA 5A06A 4ZJUA 3HWSA 3WGKA 3NM6B 3FCYA 5EQFA 4QJ4A 1HNZB 2IEYA 2E21A 1A7KA 3L8CA 1ZIOA 3LXUX 4R3UC 1FYVA 5CW2A 2VHCA 3ZE6A 3OEYA 4NCXA 4FYXA 1ZLXA 1XJQA 4L15A 3DBOB 1PSDA 1VA4A 2VAXA 4JLVA 5DYGA 1BFUA 4TLCA 1E2KA 4TN5A 1EFRD 5K0JA 3KFVA 4ALKA 1XTQA 4RM3A 4TWJA 5TQ0A 4EF4A 5BN1A 1WULS 1G7SA 1JU3A 3UUWA 1NZJA 4R71A 3QTBA 1ZI9A 2O2CA 5LUBA 2A0XA 4C06A 5FOSA 4QD3A 4D8VA 4H0CA 1TVEA 3ZX5A 2QUZA 1DBVO 1ULHA 2W43A 3FCUB 4ZRNA 4DIUA 3UMGA 2JAXA 2IEAA 3DTVB 3KZMA 2EBHX 3GFPA 3H8SA 4EI7A 1ZOLA 4PZDA 3I2IA 1HDRA 3CEPB 4ZFNA 3CZAA 4KKVA 1FFXB 4IYRA 4QL3A 5FBVB 1XMVA 2XVXA 4B6FA 2YXNA 3IERA 3GRCA 5JS8A 4QUEA 4I0WB 2XB6A 4D3FA 4RPLA 3HCDA 3D3WB 4NZOA 1PZGA 3CX6A 1DZIA 3PLRA 2WP8J 5AJZA 3RYFA 4A0SA 1NKSA 4Q4CA 1GR0A 1IONA 2XE4A 4IJUA 1ZOIA 3IMKA 3ESQA 4D26A 4KIGA 2XB9A 2JLCA 3COYA 3RLFA 3QYFA 4YREA 5L53A 5HFAA 2JLUA 4FW9A 2C07A 3N2KB 1FTSA 1Z7YA 3SX4A 1YS4A 2VP9A 3MS7A 1UIMA 5A3QA 3A1DA 5C7LO 3MCUA 1ESCA 5HSGA 2WWRA 1W5SA 3PZRA 1SU8A 2ZU6A 5KAPA 3LXXA 4AY2A 3FZYA 1GPYA 2NOAA 3GFOA 1WUHS 1TOAA 5KSZA 4UE3S 1S3GA 2EDAA 1JE1A 1F14A 1M33A 3SM3A 4LWOA 5JZBA 1U1CA 2BFCB 3TKYA 4KE7A 4DRXA 3A1TA 3OWHA 1DWUA 1TM1E 2FK8A 2HV9A 1FZTA 4DARA 1DLIA 4MARA 3O9ZA 5IUJC 3PHGA 2QRKA 3R7AA 3U44A 1JEYB 5LQKA 4FN5A 1TJPB 5TV2A 1RRPA 2JGLA 2ODPA 4OBWA 3DE3X 5CH8A 4CQMB 2V7GA 1SC6A 1DQZA 1XN4A 3OKFA 1SD2A 1M8FA 4M53A 4DRYA 3STYA 1ZN8A 3TJMA 4CMBA 2Q29A 4WAUA 3GPDG 1GWNA 2QR2A 1T3LA 2CUNA 2BAGA 2WUWE 1YDFA 3CF4A 1DOZA 3Q87B 4FGSA 4R2JA 4RDCA 5JHHB 5B6PA 3VGJA 3QXSA 1POXA 1XFDA 4L28A 2FGJA 1J8YF 1UKYA 4YAKA 1DAHA 1P2GA 5A7FA 3OEWA 4B87A 5CLFA 5HUJA 4BJ5A 3TGLA 4UXIA 1QYRA 2HDNB 1L4LA 1JYEA 3V2UA 4Q34A 2B5VA 3L4EA 1ZA1A 5C80A 1BHJA 3TUJC 4IDHA 4JUBA 4ECEA 2B8EA 2RH4A 1F1BA 3ILSA 5TF4A 3TG8A 2Q4OA 5JVDA 3CN7A 4GWLA 4CU2A 1IM2A 3A1SA 1SG9A 4QSHA 4EG3A 2OY0A 1ZESA 1T5TA 2ZREA 2ATXA 2NU7B 4HQ6A 2Z1MA 3HBJA 1G98A 2CZQA 1T5DX 4GLOA 3RSHA 1VCIA 4KMOA 1JVSA 2ZRJA 3AJ8A 3MWEA 4GMKA 3BCHA 5EEGA 3WBFA 1XZHA 1N2HA 2JGMA 3VI3B 2KE5A 3PRJA 3H5OA 4G0ZA 2I6TA 1YULA 1DPGA 4N0QA 1WZEA 2HA0A 3MTEA 3HLKA 3KAKA 4C0LA 4GKJB 4FD3A 4WNIA 2PUWA 3ZE0B 1P9OA 1G18A 1Z0DA 2DRIA 3P9QA 1E9DA 1RZUA 3HGQA 5EZYA 4XPIB 3DTYA 2FKNA 5B53A 3LBIA 5F1KA 1KWKA 2YWRA 3HABA 4GBGA 3FY4A 3KWLA 421PA 3LT4A 3PPXA 2FSSA 3LC7O 1PT8A 5K0SA 1R0YA 3PA6A 3S2UA 4KNVA 3QK7A 4ZCSA 1MO6A 1GZHB 3G13A 4MUMA 1I3CA 3ERCA 1NI3A 4BV2A 3HMQA 2ZT8A 1AJEA 1Z8DA 3W7AA 4A1FA 3CVYA 2SCUA 5E2IA 5T4FA 3IKVA 5SYNA 4X6LA 1WDWB 4ZYUA 3DEZA 3ETHA 5F51A 2O5EA 221PA 1KSGA 2QVCA 4MRNA 5CCDA 3H05A 2I7XA 2E4ZA 1DDGA 3VYRB 1JDSA 2XXAA 4IX1A 3H17A 3ETDA 1SKYB 2AIRA 3IL2A 4BNZA 2W6NA 4E1BA 4WT7A 2CF6A 2A9KA 1JR4A 2WSLA 1H5NA 4MEBA 3ED1A 3KXDA 5JCOC 4KXYA 2XIJA 1BH6A 1EBBA 3VJMA 3WFZA 5LIRA 2QU7A 1CEEA 1TM7E 2GYUA 1NV9A 2JFNA 4LNUB 2C4NA 4WOBA 2RGGA 3RIHA 4LPKA 2DG2A 2X42A 2IU4A 2VF7A 4LXUA 4NMLA 1BKDR 3H65A 2X8BA 4NQRA 3MRXA 5CDTA 3AF5A 1DMRA 3E9NA 3V97A 3JQDA 2C4WA 2QRGA 4J16A 3TLMA 2ISSD 4WASA 1OX4B 2YY6A 1IOWA 1Y48E 5LOVB 1MAHA 1RC8A 1N75A 3CZQA 3LLUA 4DNFA 1USGA 5IARA 3W5UA 4ZDWA 1J00A 4PPGA 1PL8A 3NKLA 4G0NA 2R6CA 3REOA 4MMYB 1JDVA 1VRCA 5DASA 4NCKA 3THXA 2WHEA 1IFXA 4LZZA 2CXRA 5GOTA 4K6MA 2QMOA 4QBIA 2O7NA 5FOVA 5BORA 1LA2A 4CLOA 4C7OA 2DCMA 2YIDA 4DHWA 2O8DB 2QTNA 4PFSA 1QORA 3JD2A 3VM6A 5M2QA 2BMEA 3NR2A 4IQ0A 3GLFB 2DT8A 1TJ3A 4TXJA 2NO1A 3NV7A 4ZT4A 2J5BA 1H3NA 4MIOA 3D5EA 3K8ZA 3QJGA 3BL6A 2Z8ZA 3LO5A 4HMOA 4G85A 3F7TA 3JQ9C 3RM3A 3EK2A 3BRQA 2DFVA 2IHTA 3ER9A 5FAKA 4QYIA 1NYQA 5D3ZA 4Z1MD 3ZVKA 2V8OA 1I2MA 2B9EA 2LR0A 1A7JA 4FCCA 4QXMA 3X1WA 4MIEA 1US8A 5IYZF 2Q6KA 5AD1A 1SCJA 1VE5A 2RHCA 1SFRA 2DKNA 5TJ9A 1TTPB 5B6JA 3NDBB 5TQVA 2EL9A 4L76A 2V7XA 4QE3A 2FSVC 3ZHUA 5CA1F 2CN1A 2IVZA 1KGDA 2P0AA 1C4XA 4PBRA 5L7WA 1YKFA 3E58A 3E9CA 3BS4A 2VQSA 5DH9A 4QFBA 1HPLA 4Z3OA 1FUKA 4C7KA 4TTVA 3Q3IA 2IPMA 1FXSA 2FZLA 1G63A 5EMMA 1Z74A 3PBKA 4YNBA 4D92A 5J23A 4WACA 4X1YB 3RT1A 3EFHA 3VR6D 3L6EA 4JQZA 4KZKA 1X9IA 3AP1A 4IWYA 3TPCA 3T7IA 2E5LB 2WUFA 1MDBA 1Z7BA 2G8LA 5EWLA 3ISTA 3CVXA 4YMIA 3BJIC 1V8FA 4TT3A 4A0QA 1J97A 3O1JC 4IXWA 4C2UA 3GPIA 1VLJA 2FR8A 2ODNA 4DJAA 1GPUA 2OCBA 2Z08A 1E9VA 2WWTA 2BGUA 2C2XA 3SNKA 1VE9A 4AMUA 4F4FA 5CNIA 4UQLA 2DHQA 4AQDA 1YIAA 2P2ZA 4JI3B 3LOQA 3I0MA 1IRXA 3AUYA 3A3NA 4CV3A 3NORA 4LXXA 5KEIA 3GOHA 5I9SA 2SHKA 1ZITA 2I4IA 1REQA 4KSYA 4XFKA 1W5EA 3FUVA 4QECA 3ZIAD 4FM9A 1SPXA 4TMTA 1Y4SA 2BEVA 1TU0A 1G1MA 1NNUA 4X41A 1K5PA 3ZLUA 3F6CA 4W8GA 1GPAA 1NSYA 2GLTA 2Z2JA 4B82A 1DI0A 1NWHA 3M33A 4DEXA 5JPDA 3ZU2A 4ESHA 1BE1A 1JKIA 3N2NA 3O0DA 3T4EA 3TECE 2UUBB 4ATNA 4Q9NA 2Q4RA 3QEJA 4R81A 4TTTS 1YOVB 4E2XA 3HB0A 1BMFA 4QO7A 4MVJA 2JFZA 1E4EB 3G9QA 2VRCD 2ASEA 4GVPA 4XCXA 1AT1A 2D1YA 4A5OA 4B3IA 4LE1A 3TAHA 4E32A 2P1RA 4LDPA 2RIPA 2IDJA 4CEIA 1C3LA 5F73A 2DQYA 1EVLA 4I1SA 1QGUB 4LXGA 1OPXA 4N39A 4L4RA 5J5AA 3ZS8A 2WMYA 2I2BA 4KE9A 2PE5A 3EXFA 4CFSA 4V1CA 3U39A 1R0SA 4YJFA 2XA1A 2AE2A 3LT1A 5F35A 1C2TA 4PX5A 1XAJA 2PUHA 3AFOA 2PUTA 5C35A 3O2QB 2VP5A 1G8KA 2NXJA 3Q5GA 5FR1A 1AH2A 4MLCA 2EFGA 3ILHA 3S7TA 1E64A 1F38A 3FF4A 2DFDA 1RE1A 3HU5A 3KLOA 4FDTA 5EE3A 1F12A 2ZBVA 3DXFA 3QVSA 2PNFA 2QUBA 4PTZA 1KBZA 5HG0A 3OWXA 1JAYA 4BFSA 4BMPB 1OIVA 2FK7A 2ZFUA 4OP2A 4QGAA 5LBIA 1BRTA 3JXEA 1EVYA 2HB6A 1RQGA 2K2WA 1TCVA 1QMPA 2Z83A 4F56A 1H3EA 3OM8A 1RVDA 4QOGA 1SCBA 4Q3EA 1M72A 4IEFB 1AK9A 1JGTA 2AYYA 2D8MA 2DPGA 4IJ6A 5EXTA 3VSAA 1G38A 2Y4OA 2QG6A 1WMDA 3ICVA 1P7WA 2AWOA 2CT8A 1V3VA 4QEDA 1TUGA 2HNAA 3RFCA 3KSBC 2NVUA 1PS0A 4S04A 1HKHA 3CRNA 3R0ZA 1M1NA 3ZZUA 3TQOA 5B1YA 5JD6A 2WABA 2JI7A 3JPWA 3LWNA 4TWBA 5BWBA 2EOAA 1NXWA 1JSZA 8OHMA 3PV0A 4QFMA 2G8NA 3K6JA 1RM5A 1I5RA 1UBEA 4RMIA 2HPZA 3H8JA 2BGMA 3GIDA 3VDQA 3QU5A 5FLEX 3A3KA 1P62B 4N7BA 1G5PA 1KY4A 1JL3A 4P81A 4EX7A 4DZTA 3FSGD 3ML1A 1ZIXA 2DLDA 2GM3A 3O1IC 1U3DA 4ESVA 1U1DA 5ALHA 3OKPA 3A25A 2X9NA 4FFWA 1A9XB 2P5SA 1JSLA 4O0LA 3W6PA 5K3OA 3GJSA 3QXGA 2GRJA 1ZNXA 3PGMA 4MWEA 4U6NA 4D02A 1YQUA 3U17A 4BN5A 1B43A 1AB6A 3H99A 1HFEL 3DMTA 4G8CA 4HNAB 1E96A 4ENTA 1RS0A 1G9XA 1K0FA 5K2OA 4IVNA 1P0CA 5HQ3B 5JANA 2I80A 1XTVA 1YAJA 1M5UA 5C8DA 3DYIA 3EFOB 1OAKA 3F47A 4ENWA 4WKNA 4URHA 1CUHA 1YL6A 3TD6A 3ETGA 4KAJA 4POAA 1G0OA 2HRQA 4X20B 2CNWA 5FUYA 4ABTA 3SOZA 3RAJA 1U8ZA 5K8TA 3QYJA 1PUJA 3WYCA 1L1FA 3BMQA 1YH3A 4U2DA 2XQJA 4XM2A 2ZGVA 4WTOA 3S44A 3VR3D 4FYHA 4JLSA 5TPZD 2ZUBA 3FDZA 3ZR4B 1LSJA 1RP7A 3WGOA 5C81A 1XZJA 3NXKA 5L4LA 2OZLA 1KETA 3M6WA 1H66A 3S5JA 1F3OA 2ZJ5A 4KUGA 1WXDA 4JN6B 1UZLA 3D6NB 3QW4B 1W6UA 3WYAA 4BBJA 1UMCB 2BR5A 2VUHB 4YJ2A 1TEHA 3FGNA 4QGGA 3EVEA 4K40A 3P9CA 4BJ3A 3EVTA 4MS4B 3DOIA 1YS2X 5K51A 1SB9A 1ZK3A 4RD3A 4J94A 3PC8C 1ZY2A 3SR4A 3U7QA 5DW0A 3UT0A 2RHTA 1OASA 4Z4IA 4HAVA 5FUBA 2Q0QA 4NI5A 2VZEA 3CLUD 3OZVA 3TJRA 1NI5A 1KEEB 4DNPA 5L3QB 4U4AA 1CUBA 3W5SA 1I1QB 3BSFA 4YECA 4MQUA 2I4RA 3QKIA 1B1AA 1VMEA 4KIUA 3GRVA 4UMFA 3TK1A 3E8XA 4BPRA 1R8JA 2YFKA 5MN5A 5LOVF 1PIWA 1VPDA 5C4MA 3GBPA 1NXTA 5JV5A 5KNBA 4CF7A 1XG5A 4RMGA 4DLSA 4EPWA 2PH5A 4IEEA 2V7BA 1LY1A 2HW8A 1BXRA 4YCCA 4B47A 2DUMA 4V39A 4ZPXA 1U8FO 2G67A 3GJ0A 4QGSA 5ADUS 5IDXA 4FNAA 3NWEA 3V1KA 1CLUA 4A2QA 2B8JA 2QQFA 3O8BA 3RU9A 1QIDA 1ZCBA 1F3LA 2VNIA 4OJQA 5E95A 3M4XA 1M66A 1VE7A 2NG1A 5FWXA 1GZ4A 5J4YA 3OJWA 3WRYC 5AI0A 3DOJA 2Y1OA 2VDRB 2BKEA 1RHMA 3R0JA 4XASA 1M75A 1VLQA 1ECFA 2D5LA 3KUKA 3OZRA 3ZD7A 4TRJA 4AROA 3P20A 2JVKA 2A5GA 1FPMA 1GARA 2FW7A 4K0RA 4LNHA 3R4VA 4GT1A 2EW8A 4JNCA 3MMZA 4BKMA 3ZE1B 4K81B 3QKWA 4C5AA 3ADPA 3ZNPA 3O8RA 2GYVA 4MWBA 1SZDA 3AO0B 3COWA 1IRIA 3A1VA 4QM7A 1N6HA 3QBTA 5DLDA 1E5XA 3L01A 1D6SA 2W48A 1LFAA 1IOZA 4Y2GA 4GI2A 3RUIA 3FPKA 1Z6XA 3D8TA 2C04A 2P27A 4XW2A 3VRHA 4JZYA 1D5WA 2V55B 5I8PA 2MYPA 2X2OA 5A03A 1UBFA 4HQOA 3S27A 1G2PA 3FYCA 4JBWA 4ZAVA 4KV9A 3KUUA 5JNSA 4KPEC 2BUBA 3K70D 3PHBE 3OQOA 1JWAB 2BL4A 2YDYA 3DMYA 1ZIPA 4FYMA 1GPKA 3K05A 4TKLA 2CLIB 5BSTA 1M2EA 4YROA 4GBED 2A33A 4URYR 1Q20A 3IPCA 2PH1A 4IDFA 4UNIA 5HJEA 2VK2A 3U40A 5TIIA 1DKMA 2JI9A 2I2DA 4R1MA 3WDKA 1LDGA 4DDVA 2Z3VA 1YJ8A 1IQPA 3A27A 5KCMA 4GU5A 1ECGA 2W7TA 4HWOA 3H5TA 1QJ4A 2FWRA 4Q4JB 3DVQX 4HRXA 2J9YB 3WL3A 3BM5A 5AXBA 1H0HA 1I2AA 5H02A 3L8ZA 2ID4A 1UOPA 4BNUA 4NE2A 3GF4A 3W6ZA 3QRWA 2W6PA 4DYHA 4REMA 4LF8B 4AF7A 2GX6A 3N2GA 1EM8A 4EKIA 3RJ9A 3ZY5A 5A5GA 2BMWA 2JIMA 3SQMA 3UGQA 5MFPA 4R8RA 1J06A 1IUPA 4UNQA 1C41A 2J85A 3H1TA 1Q0SA 4Z0NA 1KO8A 2XZOA 1KA9H 2X9QA 1NY6A 1WW3A 1PD0A 5D01A 4GVLA 3T5TA 2VEDA 3ZQ4A 4N5IX 1XXLA 2IYSA 2H2WA 3OZXA 1U1GA 1T6YA 2J07A 1M2WA 1YFKA 1EHYA 1DBIA 1IZ7A 1CV2A 2FI1A 4X94A 3LDAA 1Z4PX 3GUUA 1WQ3A 3DHNA 4Q7LA 4K6FA 3KFLA 1R74A 1RFLA 1L5LA 1TJYA 3E27A 1QLJA 3H97A 2QMEA 4E5YA 2C4UA 2R25B 3D2AA 4G9BA 4HDQB 3EIWA 1P1CA 4BX0A 1WR8A 5ALTA 4ML3A 4WK4B 2J59A 4O4IA 5FA5A 4G97A 4QX6A 1XEAA 3T3HA 3KAJA 4NXMB 2P9ZA 2P1ZA 1PR9A 3NU1A 2ZANA 1KJ8A 1X1SA 3PLAE 5L40A 1A2BA 1XZNA 2FP4A 4CODB 5BY2A 5DKFA 2JD1A 3OZIA 1T8WA 2WKRA 3CF4G 3NS7A 2MTBA 2CDCA 2CDBA 2ZETA 4PLFA 3OEED 1NC1A 4B3TB 5L3RA 3HA3A 1K7FB 1DIBA 2B99A 4LJ8A 1VZ2A 2FZWA 2VHVA 4LJAA 4MDEA 3BMCA 4KYUA 4MO9A 2ETXA 4NOLA 4AO7A 3NYRA 2EZ8A 3I8XA 4XM1A 3UXYA 2F62A 1T1JA 4LF6B 5GTDA 1UFVA 1MV5A 4C0BA 3NWBA 3CLSD 3MS4A 1K0UA 4ER6A 4DCSA 4ZOCA 3RUDA 1RC0A 1GYRA 1CUFA 1H2AS 3JWGA 1T6BY 2V6IA 3HXQA 1I4DD 3MCWA 1N4AA 1J1ZA 2FOXA 3HL0A 5AVOA 4R68A 1VSUA 4LYHA 1X8KA 2NO4A 2ZE5A 4J90A 2HLDD 3WQHA 4B7ZA 2GESA 3ICOA 1N1MA 1RYMA 5D3KA 3RDPA 4QXRA 4NQZA 4ZVTA 3I64A 1SVWA 3ZXUB 4B31A 3D8NA 4J7CA 4GUAA 1TTTA 4CFYA 3A4NA 4CM9A 3LBNA 4RWZA 4P93A 4LJYA 1WUYA 5K4HA 4TWAA 2KBEA 1VLVA 4Z0TA 3WE7A 5D3QA 5H70A 3TFQA 3DNFA 1FDSA 1ECLA 4FSXA 4CM8B 4ZEWA 4PE5B 4N7MA 4HC4A 3R5HA 1DAGA 1UH5A 2ID8A 2P7HA 1JDNA 2GZAA 2TMDA 4EQZA 2BKUA 5KB3A 2I4LA 2PRSA 4L27A 1S02A 1P0FA 3ZHBA 2NVBA 4C05A 3IIEA 4UEKA 4IHKA 3IPRA 1JG4A 1OGYA 3DV9A 5HZMA 4MO2A 4YFVA 2ZBRA 1WA5A 2FSFA 1C9JA 5CJJA 3TL6A 3W8FA 1HZZC 3AHIA 4M8IA 3WFJA 3WNDA 3HDYA 1L1EA 3NIGB 1ZYUA 4ZT6A 3UJAA 2Q2OA 1KDOA 4OP3A 2RSLA 2ZSAA 3TIFA 1NJSA 1QIMA 4X65B 4MS1A 1D4ZA 4YRBA 3RC7A 2G63A 2LGJA 2XQGA 5ENZA 2VDJA 2X19A 2TMYA 1RWQA 1A9RA 2OG1A 1AURA 1U2RA 3TRJA 3R3YA 1DJPA 4NOKA 1H2XA 1OW3B 4RJKA 5C1OA 8AT1A 1LVUA 3LFUA 1T9DA 2P5YA 3QVTA 1M2VB 2GKGA 1UBMS 4R1PA 5G2OA 5JZ9A 4FTWA 2QGNA 5EN4A 3A3OA 1YS7A 2XWPA 4QGBA 5DM4A 1OI3A 2DLNA 4ZVNA 1BOFA 1VJDA 1YUMA 2VHTA 1LCIA 2QLTA 4HN2A 2WG0A 2BY4A 2O3QA 3UWOA 4Q3KA 1X70A 4DIDA 5C5DA 1N6KA 2XF8A 2RFLA 1BWPA 4JLNA 3OIGA 4HFJA 3E9YA 4COOA 1JJBA 5HIIA 4EEZA 3RC1A 1D0SA 5M34A 4MGEA 4GHWA 3H2KA 2EKLA 3Q11A 2OWDA 7REQA 1KVUA 1LC0A 1X3LA 5F21A 3HZZA 3PT9A 4BQPA 4C4OA 5BMOA 4P4TA 3Q7QA 3U4HA 3GARA 2WIDA 3KHSA 5JS7A 2A58A 5KYVA 4N3GA 1AU9A 5AK6A 5JEDA 3I1YA 4HTFA 3FPCA 4DV6B 2B94A 5T8KA 2H18A 4MAAA 3DE6X 2BEJA 4IL5A 2J4CA 5JFGA 1GFZA 2A5JA 3ROMA 1X7HA 5I7AA 1ODKA 4RY0A 1OIXA 1SCUA 3NOXA 4UUAA 5AW3A 2NX2A 4B6QA 1TJ5A 2DUWA 1GRQA 4MVJI 5AW0A 1J39A 2D06A 1UDBA 4W82A 4Z3DA 1AS2A 2EHJA 2Q1WA 4CTNA 2OESA 4ZI7B 5LNK1 2IE8A 3QBEA 4MNTA 3BWEA 2WYOA 4ZU6X 1KOJA 3RYIB 1KZ4A 2FPSA 1RLUA 2HRBA 2VHQA 4P86A 3D3NA 3M3PA 2EQAA 4Q3AA 3ZWYA 5CFZA 2WB4A 3FOFC 1R8QA 1TDJA 3C4JA 2O9JA 4KN8A 2H2IA 2QX6A 3UOAB 4V1CI 3EVNA 3H5RA 1CUJA 5CFLA 4BWGA 1VHTA 4FGWA 1NP6A 2X14A 3K4QA 4P53A 4BO3A 1E9EA 3LSTA 4C3OB 4GOMD 1R0ZA 1TLFA 4EL5A 4CEHB 4HLUA 2XTZA 1F8GA 2RC5A 1CE8B 4IIHA 1IZ8A 5SY9A 4Q7MB 3EB9A 1M2GA 2CHEA 2GB4A 1O9HA 3OFNA 3A2KA 3M81A 1MPXA 1WUKS 1YB5A 3DHWC 1E58A 3JPYA 2JBAB 2PZMA 1PHRA 1R5BA 4MA0A 4PHTA 4JLUA 4JKIA 1MABA 3RYHB 2O8FB 4N18A 2IW1A 3TRKA 4RTSA 2IU6A 1QOQB 2FPGB 3R6WA 4EI9A 1QS0A 1GNQA 1DEKA 3GFTA 4ROTA 1PI3A 1P19A 5AXCA 3TIIA 2PGAA 3NVKI 3FPGA 4NENA 4R2WA 5FNVB 2KPOA 5JUWA 4HT3B 3FMFA 4RU1A 4NEHB 2PT9A 2PU5A 2B37A 2XTAA 3LUCA 3Q40A 4L75A 4F2WA 5JTUA 1ZJWA 4X95A 3DDSA 4TMVA 4Z0HO 121PA 2IA5A 1H42A 3SE7A 5AT1A 4MVJM 2IUYA 4I1OA 3WDLA 3QYAA 1SHZA 2G9ZA 1YJAA 3DCJA 3PHJA 1OB2A 1K5GA 5FORA 4D9EA 1TQ4A 1Q74A 2X7JA 3QWBA 1O89A 2A92A 3R0QA 4RPHA 5HIJA 4E7OA 1EUQA 4X6XA 3TUZC 3TUIC 3GNTA 3CVOA 5CXUA 5BYAA 1YZGA 4MGHA 2P9EA 3L0ZA 4RXTA 2PCLA 3NKVA 1KK3A 3OWOA 4CQMD 4L0MA 3OTGA 2L0XA 3LY9A 4BQRA 5JSFA 4FFBA 2YUTA 1U0SY 1LX7A 1B6TA 3FFTA 2PSDA 4AIRA 3UQYS 4IQ4A 2O3TA 5EE9A 2QG4A 3BBPA 3CPSA 2FUCA 1CCWA 3B3AA 4NJEA 2IV3A 3T3DA 3EVBA 1F4LA 2H1RA 2ZRDA 1GKYA 4OF4A 3HZOA 1G5RA 1FXUA 1PHPA 2H4WA 5DXFA 4A23A 5EHZA 3MMNA 4YXWD 2VTKA 1HLFA 3H5LA 1E1RD 2VAWA 1S8OA 5ES4B 5IZCA 3IAS6 2EP5A 2PWZA 3L4BA 9ATCA 1V26A 3KEOA 4KYTA 5IKEA 1G21E 1SVUA 5WRFA 4MX8A 1OI4A 1UXGA 2EXXA 1KVQA 3MA0A 3AKEA 5HQJA 1FTNA 3I73A 3MXTA 2VYNA 4ZVOA 1ZSVA 3PENA 4P98A 4X7PA 2V3WA 2WD7B 4A2WA 2BFFA 4E21A 3NQ41 3ES9A 1EE2A 3O9MA 2A9QA 5ALZA 1EG2A 1ZFNA 2PSSA 1V25A 4ND5A 4DXHA 1LS1A 1Y0BA 5KS2A 5G3ZA 1SVIA 2HAEA 3VAYA 3ZK9A 4ZOLA 5ALGA 2WILA 4RKEA 3LT0A 3N6RA 3N5CA 5KWVA 1XZGA 4O63O 3D0QA 4LJKA 2QL6A 4PZUA 4RMHA 5DM1A 1YI0A 1U94A 2QS9A 1DARA 2EFCB 4BQNA 1N5KA 3T54A 2BLNA 3OM9A 2VJLA 2QMYA 3OZGA 4PXAA 4Z2YA 3K8YA 4HH0A 3WL5A 4Z7NB 2M1XA 1Z8NA 2DYKA 4JL5A 4R83A 4FFSA 4N47A 3RRFA 3E3MA 1W87A 3V1YA 3BMOA 1M74A 1UKEA 2N46A 2RK4A 4MJ7A 3O93A 3W5BA 4OI4A 3SEZA 1ZH2A 3OOSA 1TKAA 4U2CA 1CR2A 1T6NA 3HNOA 1IE3A 2P77A 1IK4A 2CMKA 4AJOA 3PGKA 4BJ6A 3GXOA 1URPA 1L1QA 4OQXA 4FD2A 5ER6A 2W6JA 1NU6A 1N32B 1T25A 2A5FA 3SIRA 1YS9A 5D87A 4HNSA 2C42A 1VJ5A 4P6VF 1JFRA 2PX8A 1AKUA 3S29A 1F8YA 3LY5A 5MGBA 1I6KA 4ARSA 1B15A 3QUAA 2PX5A 3RYFB 5U9CA 4AYTA 2C83A 1JT2A 4Z4GA 2C78A 2Y6UA 1IHDA 3ZQ6A 5EWMA 4EAQA 1BX3A 1P9LA 4ESOA 1KSHA 2VDQB 5BV8A 5AW4A 3LX8A 4QHSA 4GR9A 5L3SB 1L8XA 2HT1A 3DAFA 2DUUA 3BEOA 1QB8A 1HDIA 1FDWA 4KV7A 4Q4DA 2BEKA 1L7BA 4OB7A 2V74B 3O38A 3SLGA 1ZI8A 3FBWA 1UKAA 1LJ8A 1JZSA 1H93A 4YMSA 1LGYA 3QELA 5E4YA 1BQEA 4ETNA 2BV3A 2TRSB 4R3NA 1SUIA 2POQX 3LNCA 3RSFA 1O6CA 4X1IA 1Y6RA 2Z9BA 4LXTA 5K03A 4EJ2A 1FUEA 2G25A 4DRXB 3ZE8A 1KVSA 1JQBA 3MWGA 2I0FA 3ZJ5A 2P6NA 4B2YA 4EY3A 1Y5IA 5IM5A 4X3PA 5JD5A 2ILTA 2O2DA 1NMSA 2VG8A 5GP1A 1LI7A 3PTAA 1T2UA 1VB3A 2J48A 1XZLA 1LSUA 3GY0A 1U28C 2HKIA 3H4VA 1KSJA 1WLYA 4ROSA 5ICSA 3GLIE 2YJZA 8MHTA 4CM6A 3SDSA 3ZVRA 4DUPA 1Q17A 1WPGA 1QHSA 3A6PC 1XLTA 3VU9A 4GPAA 1FP2A 1WOYA 3BD7A 3NBZC 5CNKA 4BFUA 1Q7TA 1NUSA 1OXMA 5CLHA 3TRDA 1X7XA 3V55A 1X1TA 4K9MA 1DJQA 3TQCA 3H1GA 4AU1A 1MG0A 1WJGA 4NCNA 5JH7F 2CJFA 3AIKA 1NAIA 4MUNA 5EZ6B 1GNPA 2C7GA 3I04A 3M4NA 3MJVA 3VHXA 3EWIA 3WDSA 2R65A 1EJ2A 1K6JA 3CVJA 3OCXA 3X1XA 4DCPA 2W2LA 3K5HA 3DEAA 4LZLA 5HFJA 4JHLA 4Z9XA 3IKTA 2PGNA 4BMOB 3NT4A 4WK2B 5DHPA 3T41A 3GG2A 3LQQA 1TC1A 3IMGA 5JVDB 4QLBA 5DBHX 3PPIA 5T5QA 4CM3A 1K27A 1Q83A 2JEYA 3ASUA 5M04A 1GZ3A 1WW8A 3IJEB 2ECPA 2FKAA 5DO9A 1V11B 2PZAA 2JFUA 4BATA 2XOEA 1V45E 1R6DA 5EE1A 3C3EA 3KYCA 1RJDA 3T7CA 2HEIA 3MWEB 1F60A 3MJSA 4FILA 1HSZA 4DV1B 2QZPA 4D79A 1BXZA 1NTRA 3GLRA 1JQEA 5B1HA 1TKCA 2OGTA 3MBIA 1RJWA 2PXCA 1HNNA 1ISMA 4ZI7F 1DFGA 2WAMA 1QZ3A 2OG2A 2YWCA 3E8MA 3VZRA 5CEEA 2G1PA 1L7EA 3DEHA 2O3UA 2D5BA 4JITA 1G6OA 5FTJA 1QYDA 1MJNA 2GJ4A 2W9XA 5FPTA 1C0IA 4H4CA 1GADO 2YN4A 3GVCA 3KWMA 3NP7A 2C98A 3G0CA 5AUPB 4TWIA 4ZANA 3T7TA 5JATA 2C5GA 2DE0X 4ZMSA 3FXAA 4GGMX 2GM5A 1O1YA 3C6ZA 3VNAA 3W2FA 3EVAA 3T9AA 1CUGA 1JDPA 1P81A 1R37A 4GXTA 4BX3A 4CN9A 5LMCA 2SCUB 4HAWA 1P6QA 2Z3WA 4MW1A 2C99A 5J9FA 3HQ4O 3VUFA 4TS3A 5ICCA 2Q0SA 3L0YA 1PR2A 4JJZA 4OBEA 3SS9X 5HRCA 3QEKA 3S7ZA 2I4NA 3H0CA 1YRBA 2C03A 3A32A 3I1JA 2G40A 5I4BA 3F9CA 3QOYA 4IMPA 2GJ9A 4K8OA 4BZPA 2SECE 1VKNA 1SXJA 2C8LA 3EA5A 3TINA 4US1R 3VR4D 4EGCB 3C7TA 2PR7A 4PSUA 1QCDA 3ADDA 4JVSB 1KMHA 2FOLA 1X15A 3A1WA 3GFGA 5EHNA 2COUA 1H2RS 3FWNA 3OTQA 1W2HA 4N3NA 3RBZA 1Y8CA 2H2GA 2IBTA 2OCXA 4JGIA 3CT6A 3KM0A 5EQDA 1PZMA 5C2JB 5CITA 5JAUA 1PLKA 4XAQA 2JDID 1UMBB 3NETA 4MP6A 4Z2AA 4BKQA 1RPNA 2ZG6A 3OPQA 5KTNA 4NBRA 4IDGA 4R2MA 3FNQA 1T10A 5EGSA 1F51E 1FBTA 1EDBA 3OX3A 9LDTA 1L9XA 3FBTA 5MFZA 3DLHA 1N78A 5U4QA 3KV1A 3LIPA 3EZNA 4H77A 4D74A 1OI7A 4KXLA 2GEKA 2NAPA 1FNNA 4JT4A 1NV8A 1R9MA 1W5AA 2YCLA 4TRNA 2Z58A 4Y2QA 2JJ8A 3AF0A 2CLHB 3LQ1A 2CUZA 4OATA 1GU0A 3V48A 5FJIA 5K6TA 5K8UA 1PJ4A 1TTQB 2R6AA 3ELBA 3MELA 5JTTA 4C7OB 4CLOB 2C5EA 1NR7A 5IUNC 4B81A 1SK8A 2H63A 1EFVA 2WI8A 3X1ZA 4ER7A 5FUMA 4DTCA 1DKUA 4UDXX 2FPRA 2QAGA 5F7ZA 4HRAA 3KD2A 4S0ZA 4TLMB 5SYMA 2H2DA 3G7NA 4BU1A 1JH8A 1NSFA 2M9MA 1ZGZA 2HCTA 4UE2A 1P1HA 1XBTA 3KVVA 1PFGA 3EWSA 3L8YA 5JALA 3VZSA 2R1ZA 2UU9B 5FBZA 4NS4A 2D5CA 3WLPA 3CEJA 4PEVA 1FK8A 4H4DA 2RD2A 1N9GB 5DBOA 1FBNA 1J56A 1RHJA 2OFOA 3EE6A 3I92A 4NSNA 1L4KA 1SVSA 2ID7A 3EIEA 2Z2ZA 5HK9A 1E7QA 2OUIA 4E13A 3UQZA 3CGGA 3HU1A 4FYIA 2BJVA 1L4MA 2GUGA 3BIOA 3KBBA 3RC8A 4Y1RA 2ZM6B 3QVLA 3DZJA 4MA5A 1UBUS 3PXBA 4MVCA 3R7FA 3RBXA 3ZUGA 1UP6A 2NZYA 1NN1A 4HDAA 3HCOA 1R6VA 4ADSG 1B7GO 2V9CA 4TVOA 1KI7A 3ZU3A 3OLWA 1LWNA 3DBHB 2C77A 3L8EA 3SC3A 4JT8A 1ULZA 4ME6A 4IH1A 5EWLB 5C8YA 3OLVA 3UKDA 1A2KC 2OB2A 1VL8A 4OQQA 5AKLA 2FZKA 4UTNA 5K2MA 2QEQA 2NZVG 1XCPA 4B33A 2XYPA 3PC2A 3WIVA 2V7QA 1XYYA 4J4BA 4MINA 3MG9A 5JLAA 3BBLA 3HO8A 3E5RA 4X92A 2H9IA 2PT5A 1E3QA 2G9VA 4L4UA 1TB4A 3TTUA 2AL7A 3KC2A 4G67A 3C0KA 1E2QA 2R7KA 4UTXA 1W35A 4C4XA 3OUTA 1I2DA 3DZ8A 3PVCA 1E63A 1Y34E 5JSKA 3O4HA 4X1KA 4XWWA 1Z0KA 3L0DA 2VUSA 4UAUA 3BDVA 1Z62A 2Q50A 3KX2A 4RVHA 4WNAA 1GAWA 3K3PA 2O52A 2Y27A 4MI6A 4EKDA 2O8FA 1OFGA 2DP4E 1XI2A 4V3CA 1RM0A 3U7EB 5IFKA 3IE0A 4YMWA 4RULA 1Y1SA 4TWZA 4F38A 3KR1A 1YA8A 4Q9KA