2W2XA

Complex of rac2 and plcg2 spph domain
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
177
structure length
177
Chain Sequence
SQAIKCVVVGDVAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLRDDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAS-RELATED C3 BOTULINUM TOXIN SUBSTRATE 2
publication title Structural Insights Into Formation of an Active Signaling Complex between Rac and Phospholipase C Gamma 2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/hydrolase
total genus 59
structure length 177
sequence length 177
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2w2xA00
3LVRE 4LYFA 4D0GA 4LPSA 2FFQA 4Q4AB 4NMMA 3GLIE 2HF8A 4NKRA 2V6JA 3IPYA 3U44A 4XD7D 5EP1A 2ZR9A 2FDCA 3BERA 1N0UA 3NH9A 4DSOA 5FOWA 5FTJA 1Z83A 2WM9B 4KYUA 1NN3A 2VP9A 1CS4C 4TQUS 4HLUC 2QQEA 1CBUA 4ACBA 2EFCB 1S3SA 4KITB 5LD2C 4FWTA 5FUWA 1DG3A 1FUUA 3QENA 3AVTA 2GF0A 2WKQA 3NG1A 3TQFA 4I1OA 1U8YA 1F2UB 1AK2A 2AD5A 2ZREA 3KQUA 2WZQA 4PC7A 4DDUA 3WRXC 3FFAA 5JEEA 2FN4A 4XTCS 3CH5A 1X1RA 4DLRA 1IXZA 4CEHA 2F9LA 5HPYB 2QAGB 4CEJA 4JT4A 4HLUA 1N6RA 4DCSA 1E2LA 2O52A 1W0JD 3KXKA 3GJXC 1VG1A 4X8LA 3U5ZB 1HYQA 1T0JB 1PLJA 3PEUA 5JHHB 2XXAB 2AK2A 1W36D 2PLRA 3P4YA 3QJYA 1XEXA 4WVFA 5EJEA 2ODWA 2JA1A 3V00A 1E0KA 1O3YA 2QN6A 4L4UA 2WPDD 2FH5B 1EX6A 2V3CC 3QNUA 1II8A 4F4IA 4PC6A 2JASA 5F2EA 1QG2A 3PVSA 4PZLA 4FWIB 1N0VC 2W6ID 3UK6A 5JSZA 3MJRA 1HT2E 4LX0A 4IHQA 4OQMA 3GFTA 4KFTA 2VQSA 2NQ2C 5GJBA 1NG9A 3ZVRA 3B82A 1E2JA 2JJ1D 3NDPA 1GIAA 1WP9A 4M1TA 1H8ED 2D7DA 3SS8A 1E99A 2QE7A 2ZRKA 2IS2A 3L8ZA 2Q3FA 4Q1FA 3EPHA 4QHTA 1JALA 2PJZA 3W8NA 3CF6R 2VP4A 5FL7D 2ZAMA 3EPKA 1IM2A 2CL0X 1EXMA 3K70C 3KB1A 1U94A 2CCGA 2WWGA 3EIEA 3DEFA 4EFMA 1P72A 5FUVA 1R7RA 2ZI7A 4CVNA 2ZJAA 3MWYW 4MYHA 4TT3A 4JLMA 4Q9IA 1NY6A 3BE4A 2FF7A 2QI9C 2X1VA 2D3WA 3HR8A 4JJKA 3W90A 2DFTA 4M21A 3B85A 3QG1A 1QHYA 3BORA 3U7HB 1LY1A 1ZBDA 1B0UA 3CX7A 5EQTA 5A4JA 1YZQA 3OE7A 1DTSA 4BASA 4GNKA 1R0ZA 3R20A 4MGYR 2IXEA 1L4YA 2DCUA 2P67A 1NG1A 2CJWB 2QMHA 1NKTA 1RJ9B 1VCOA 3EAQA 5JECA 1YE8A 2L0XA 4BFWA 1C1YA 2GEVA 5FBVB 1PUJA 1MOZA 4OHYA 3VFDA 5BN3A 1EFCA 2F9MA 4PHTA 4CGZA 4QM7A 5KSPA 1LS1A 2KI5A 4QNMA 2FZLA 2H57A 1UBFA 4NYJQ 4QG7A 4BZPA 1YHNA 3TJZA 3U7FB 3ONWA 4B2LA 2JEOA 4Q4HB 4MRVA 1KK2A 2QQ0A 1II0A 1M8PA 1P73A 5KNDA 3GLFB 4A15A 2XSZD 1X6VA 3H84A 4TMTA 1BKDR 5FI1B 2CK3A 1NIPA 3B78A 2JIZA 3UATA 1LB1B 1NP6A 2X77A 3Q72A 2IT1A 2VBCA 2ZANA 3C5CA 4D4JA 1OXTA 2ZJZA 5EXXA 5GJVC 1A1VA 1IQPA 4K46A 1Q12A 1FFHA 3P4XA 1P7CA 2B8WA 1IN6A 5K8IA 1KDTA 4RZXA 2BJWA 2FMXA 3KQHA 4CEIA 4BE7B 1XPUA 2BM1A 5DE3A 4MKGA 2PZGA 3T1QA 3QF4B 4MYUA 1W4AA 2ZE8A 1XMJA 2GJKA 4QGHA 3AGQA 3GLHA 1R2QA 4HAZA 1L8QA 3FHOA 2H7VA 2W2TA 3ICEA 4DCUA 5TY0A 1ZM7A 2GDJA 4KU4A 3NKVA 4KHZA 5AWFC 2VP2A 4C2UA 2OUKA 2W0SA 1Z8FA 3NHBA 3FKSA 3ZZTA 1A82A 1SXJC 2OE2A 2QP4A 3RANA 1HA3A 2QBYB 1BS1A 4LJ8A 1NLZA 1E2MA 2A5GA 4DSTA 2WKRA 2W6JA 2EVWX 3VHXA 3DHWC 1G5TA 3KKQA 1X8LA 3PITA 1RE0A 5FPKA 4WXRA 4B48A 4LHYA 2G6BA 4B2IA 3N2IA 3HPRA 4LBYA 3EW9A 1BH2A 4NYIR 4PPGA 4RD0A 4QBIA 3GJ6A 3BIFA 2PLFA 1UEIA 1P61B 1NIJA 2J41A 3KKPA 4UNQA 1SXJA 2BCJQ 3LBIA 5CDFE 4Q7JB 5H68A 3NEYA 5FBWB 4QHSA 2ERXA 3ZZUA 1LV7A 1UFQA 5JRJA 2YOHA 4HATA 5K8LA 3OEEA 4RKFA 1Q1BA 2J46A 3UPUA 2GILA 2IA5A 4OI2A 1XJ0A 2DY1A 4UXIA 3KXLA 4B3GA 1CP2A 3CPEA 5FR1A 4PSVA 4Y0VA 2IX3A 1YRAA 3SEAA 3GCGA 3VTKA 1WXQA 4M1WA 4XD7A 2GAAA 1WB9A 1KSJA 5LDDC 3ADKA 1ZD9A 1Z3IX 2WAYA 3R8FA 2CMKA 3EG5A 1KZ7B 3SHFA 2W58A 3B1YA 1TQ4A 3LX8A 4RZ2A 3UKDA 1U99A 2VF7A 2G88A 5H70A 3GLGA 2ZJ2A 1OSNA 2NOAA 3HP1A 4LYJA 5H8WA 3I4LA 4Z8XA 1S1CA 4EQ6A 3AV0B 1VG0B 3ZJYA 2IEZA 4TYPA 1N6NA 4P0TA 1ODFA 4IOKA 1F6BA 1XDBA 5EZ6B 4JVLA 5FTNA 4MITA 1W36C 4RCZA 1T8UA 2X2FA 3W3ZB 2V1XA 4ON9A 4OL0A 4CF7A 3NBXX 5M04A 221PA 2X2EA 1G16A 1ZNXA 4DLXA 3CO5A 4EIWA 3S1AA 2GEUA 2RH5A 621PA 4AC9A 2AFIE 2BDTA 2ZRIA 3AF4A 3P26A 1XWIA 2EFGA 2XZOA 4UNPA 2QRNA 4HLDA 4UKDA 5L3VA 2QMEA 4IXNA 3W5JA 1MH1A 2NO0A 2QMUA 3CNOA 5L3RA 3R7WB 2MMCA 2OILA 2ERYA 2YWGA 4FMDB 2EFHB 3VNUA 2WPDA 4YMTA 3M0EA 1E2QA 3LAWA 3QKRB 5B30A 3A1TA 2JLXA 3OIUA 2A5DA 5DLQC 2AFHE 1US8B 4C9BA 4BPBA 4ZDIA 3U7GA 4OHZA 1Q3TA 2W6IA 1FNNA 3UIEA 1CR4A 2W0MA 4ZCMA 1FW6A 3NWJA 1W46A 2B92A 4HAYA 1E4YA 4NCIA 3GLIA 2O8FA 5DN6A 2WWFA 2EFEB 4KSCA 4MRNA 2FFBA 3GD7A 3MG9A 5GVSA 2JJ1A 1LW7A 2GZDA 1J90A 1H8EA 2FWRA 1ZC4A 2C96A 2VLIA 3SJZA 4KVAA 4JLAA 2D2EA 1II8B 4AURA 1VYVA 5FL7A 1OKKD 2QTHA 3O8BA 1KKLA 4ZO4A 2NO1A 2WJGA 4JYCA 1JJVA 2CLDX 3SQWA 2HT6A 2DFLA 1J70A 2QPAA 4N0EA 2E87A 3FMIA 3CIOA 2R6DA 2FZ4A 1RVDA 5DHFA 4B74A 3VR3A 4AK9A 5GJWC 3KXIA 4ILEA 2PMDA 1N25A 1ZMXA 4PPNA 4AIIA 4US1R 3D8BA 1AGPA 2EFDB 1MABA 1BMFD 1T8TA 1ZU5A 2QGZA 4D4KA 2A3RA 2OESA 4B3XA 3LWNA 1RYHA 4AY2A 3PEYA 4LV5B 4KXFB 4B6FA 1QHXA 5KOYA 3EASA 1VIYA 1T5IA 3MD0A 2XB2A 5JRZA 3WBKA 4W5WA 3WYFA 4M1MA 4CYMA 3U3OA 3IBYA 1LF0A 1ZVQA 2OFXA 3OHMA 4D4LA 3IHLA 4Q7KA 1A2BA 3CWQA 2XJ4A 3VX3A 3FHTA 2IYSA 2Q3MA 3JVVA 4UNSA 1G3UA 4Q02A 2IK8A 2JATA 4AG5A 2ZI9A 4JT2A 1MO3A 2KJQA 3AKYA 1I4TD 4AYXA 4IDQA 2CNWD 3VKGA 2FFHA 3GJ8A 5L3SA 2ZUCA 1A2KC 2XNDD 2ONJA 1W2GA 4JLDA 4PAOA 3SHWA 3EX7C 3AVYA 1GNPA 1UM8A 1FPMA 3LX5A 4ZV4A 4A36A 1KDPA 1Z08A 4BZQA 4GOKA 3W34A 1NSFA 4BECA 3I72A 4M1YA 4ZCIA 2PCJA 3TUZC 3HU2A 4B73A 4NU0A 4NZYA 4URYR 2GAOA 4E07A 3DDCA 1UADA 5F9FA 2KBEA 4TLBA 3QKUA 5C2JB 2WJHA 4JLBA 3SNHA 3KKNA 3VKWA 1G7SA 4MRRA 4WXPA 1S9HA 1KK3A 2MSCB 3V4FA 1E1RD 4HDOB 1D5CA 4RD6A 4C7OB 3ECCA 4EJSC 3N70A 1U90A 4IEIA 1ZM9A 2WVJA 3GLHB 1AZSC 1RFLA 1CR2A 4GDFA 1M7BA 1RRFA 4Q03A 5G41A 3THYA 5KYKA 2VHUA 1XMVA 3OESA 4ACAA 4MGKR 3LD9A 4NCJA 2N42A 1TQDA 3T35A 4C0LA 1QHGA 4M1KA 1SGWA 1UDWA 4JBXA 4ARZB 5FFMA 4BEBA 3T12A 1G291 1XP8A 1G3RA 1G19A 1GDDA 3EA5A 3LLMA 2QRZA 4NPHA 3ZQJA 5CB6A 3LFUA 2MSEB 2WOOA 2NO6A 2O8EA 4YQFA 1CJKC 2HJVA 4F7WA 1EG7A 4ZPXA 4XH9B 1S3GA 1CRQA 1A4RA 2VO1A 1EFHA 3I1FA 3Q8XB 2JLVA 2I1VB 4US0R 1DELA 4DLUA 3SJBA 5DGXA 5KPJA 4PC1A 3K09A 2ZR7A 1UBCA 4Z1MD 2DWOA 4FI3C 1KGDA 2CDNA 2REBA 3CUEF 1UBEA 1LTQA 1ZD8A 2F1JA 3I5YA 1F48A 2IUUA 1Z06A 1YZTA 4EKDA 1KO1A 2V4ZA 3ETLA 3SDZA 4A0GA 4U7DA 1JI0A 4TMZA 1DVRA 1KO4A 2HLDD 1FUKA 1S8FA 4P4UA 4JIMA 1SZPA 1P6XA 1MV5A 2J7PD 5AR1A 5IK2D 1FX0A 4RVCA 2JLWA 3BB3A 4C2TA 1XTRA 2BV3A 2YV5A 4PXAA 2B21A 3FFBA 4OI4A 2QNRA 2QG6A 3ZVLA 1TAGA 5FPYA 1SVKA 3FTQA 1LNZA 4U00A 1NNEA 3TMKA 2A30A 4IVPA 2BWJA 5L8VA 3GLGB 2Z0MA 3K70D 1OHHD 4WZ6A 1TL7C 4JLKA 1ZINA 4Q01A 1YQTA 2D4HA 4ZI3A 4BFUA 1JB1A 3Q9LA 4LSGA 4EPRA 4TMXA 5CDFA 3KJIA 4M22A 4A2WA 2PX0A 3U3RA 2J87A 2ZJ5A 4TLAA 2NZ8A 1KI6B 3BBPA 4KCGA 1ZAKA 2ZTSA 2A5FA 1L2TA 3GEHA 4PTLA 3AF1A 3ZS9A 2NPFA 4DLVA 4OI0A 2CHQA 3PEVA 1KO7A 3B1ZA 4DIDA 1CXZA 4A8JA 2GNOA 2H17A 4D6PA 3CPJB 1GRRA 3MFYA 3OAAD 4X8OA 1P4SA 1X3SA 1F2TA 2REOA 5DI3A 1D8TA 1G8GA 5JI2E 4X8HA 3AP2A 1QVRA 1QHHB 4OK3A 4Z54A 4LV6A 3ZYCA 4PPQA 3V4RA 3SFZA 1SKQA 2J3EA 4KSBA 4W7SA 4P31A 2BM0A 4WW0A 1OKKA 2FSHA 2E9SA 4WBSA 2C95A 3B2EA 3H86A 1E2DA 1WE2A 1WRBA 3I73A 3EZ6A 5FL3A 1K5GA 2OCPA 2FJUA 2GXUA 4CW7A 3GLIB 4OQXA 1J99A 1XEWY 2GESA 3AH8A 3CBQA 4ZDKA 1FTSA 3W6OA 2FA9A 1CF4A 1IOZA 2A5JA 4G1UC 1MRNA 3QXCA 4PHFA 4IVRA 1NRJB 1E2HA 3G0HA 1NLYA 2W2XA 1Y63A 1XXHE 2OT3B 4MKFA 2IHBA 4MYTA 3B9QA 2AD1A 1BMFA 1OE0A 3MWLA 1GKIA 2V55B 3CKLA 5KSYA 4O3MA 3CB4A 2ODNA 5FTLA 2J1LA 1ZIPA 4L8GA 2FX3A 3CNNA 1TPZA 4A1FA 3IBGA 1UKYA 4G5GA 4F4JA 2F7SA 1DAMA 1KOFA 2D62A 4DEYA 1GP2A 2PL3A 2AXPA 3QXHA 4LDJA 2MMGA 1JAHA 2RMKA 1MABB 1P75A 2Q9AA 1MO4A 1AS0A 2BBSA 4TYQA 4NYMQ 5TV2A 2IYWA 1GFIA 1IN8A 1R5NA 1R5OA 5BWMA 2HYDA 1SKYB 5DYIA 2CNWA 3T61A 4N0DA 3B5JA 1A5TA 5HZKA 2XNDA 1II9A 4MUAA 4I1VA 1RZ3A 4MGZR 2FE4A 4KVGA 1Z0AA 4LHXA 4PHGA 1Q21A 1Y3AA 2BIFA 2IWHA 3MWJA 3DZDA 5FI0B 5C46F 2PBRA 4DDVA 2ZM5A 3DMDA 3C8UA 5IT5A 4EPTA 1OIWA 3KTAB 4KFSA 2G83A 4LJ4A 3GFPA 1YZKA 4MKIA 5DNYB 3B8HA 4MDFA 1VTKA 1E79D 1OH7A 3OIWA 4V02A 4TYYA 1E0AA 5L3SB 3TAHA 2ANBA 3BS4A 3QOFA 5SZKB 5TDHA 5JJLA 2FEOA 3K9LA 4DLYA 4GI7A 2RKOA 3ASZA 5J5CA 2HEIA 1E1RA 1FP7A 1BO6A 2ZJBA 5KDOA 2RAPA 1IBRA 5BQ5A 4NE2A 3T1OA 4RD2A 3DL0A 5TVKA 2O8BB 4UQOA 1PVOA 4XVRA 2SHKA 3MGCA 3UG7A 4YMUA 4NP6A 2YZ2A 4TWZA 4HUQA 5BYJA 3MSXA 1OH6A 1ANKA 3K0AA 1E9FA 5FTMA 1LS6A 2P5SA 4URZR 2W2VA 2AKAB 2YJTD 2DFKB 2GK6A 2GTPA 3PXGA 3ZVNA 1W1WA 4KO8A 1P3JA 1ZW6A 4BRWA 4PANA 1P2TA 1XTKA 4HB4A 5AUOB 5BYKA 3NBZC 3FE2A 3QE0A 2ZYUX 1P2VA 3IGFA 1W5TA 2WSMA 4QGAA 1LVGA 2A78A 2VHTA 4HZIA 3VR6A 4LC1A 1F3OA 1NJFA 4ZKEA 4P4SB 1TF5A 3MMPA 3PENA 4LRWA 5EE9A 2BKUA 3RS5A 3UWOA 4BLSA 1R6BX 3O47A 4Z1MA 2RGAA 1R5BA 4D26A 4NHOA 3TSOA 3PUXA 2IF0A 1OIXA 1P5ZB 1R0WA 4C0HA 2ZPTX 2ZRLA 4QBFA 1Z6YA 1KMHB 2HUPA 2NO7A 4PC2A 3AVWA 2IYTA 2ZE5A 5E7MA 3M6AA 4TN1A 1KJWA 1EK0A 2HLDA 3REGA 3LQQA 5AK0A 1N6LA 3FMFA 5CLQA 2J7PA 3UWKA 1K6MA 5IK2A 5C18A 3FMPB 4QC2A 1IXRC 2ATXA 5AJVB 4ZKDA 3AVOA 2XB4A 4RY2A 3VU9B 1W48A 2IYVA 3AVPA 4V0LA 4QBGB 4PPFA 1H8HD 1UKEA 5LB4A 3WMGA 2ANCA 1YR7A 2XAUA 1YZUA 2GZAA 1N6OA 1YZLA 2FG5A 2P6RA 2GJ9A 4PQRA 1XZQA 1OHHA 1OFTA 4BLPA 2RGBA 5BN4A 3MUFA 4WOPA 5HKKD 3QXXA 1G18A 1ZUNB 3I5XA 4Q19A 3FDIA 3WBJA 4TTRA 1FX0B 1W4CA 1WDTA 2OFWA 4BFTA 1OH8A 1GUAA 1P60A 3R9XA 3AF0A 4L5BA 5SZIA 2FSGA 1R0YA 3RNLA 5TMPA 1DEKA 3SU8A 4TTQA 6Q21A 3EPJA 1JEEA 4CRWB 4D25A 2GRJA 4KAXA 2P3SA 4AKHA 2F1IA 1KJZA 3GFOA 3PUYA 4A82A 4G3XA 1Q20A 2YWHA 5HZHA 3OAAA 5E3HA 1XMSA 3E5HA 1DBSA 5AUQA 5LB2A 1IHUA 2CE2X 1I4LD 4GFDA 3MCAA 2UZIR 1EWRA 4IEEA 4MKHA 4POAA 3T15A 2OBLA 2ORIA 4L16A 2ZRPA 3C15C 4QJ5A 4V03A 2FPKA 1KO8A 4IOLA 5F9HA 2OEPA 2VP6A 4PC3A 5G3ZA 3NC1C 2P2LA 4I81A 5EUMA 1E2FA 4TMWA 1NJGA 4P32A 2J0UB 8OHMA 1KK1A 2VHJA 4Q4LA 2ZU6A 1JBKA 4A8JB 2ZJOA 4TZ6A 3TBKA 3IQXA 2EWWA 1X8JA 4DDTA 2ZS7A 5J40A 4NONA 1EFTA 1Z2AA 4ABYA 5CK4A 4K81B 3K0FA 1P2SA 4PHHA 3SYKA 1G64A 1Q1ZA 1O87A 2LKCA 2QU8A 2R8RA 3SYNA 4PSKA 5L3QB 1NLFA 4L15A 1YKSA 3IHWA 4H1UA 4DKXA 5J4KA 5JS7A 1JEDA 2E1RA 3IDQA 1OPXA 4Q00A 4YDSA 1VCIA 4L9SA 4NBSA 3WYAA 5C4MA 3U4QA 5JJIA 1PV4A 3K53A 3MRSA 3TKLA 1GTVA 1FMJA 4OQFA 5JI3E 1N5LA 1BOFA 3KDSE 5D3MA 2W00A 4A4DA 4PQYA 4TL7A 1CU1A 1E9EA 1JNYA 1DADA 1NF3A 2OAP1 5F98A 1AQUA 3TW4A 4DHEA 2ATVA 4JZKA 5G53C 3O8RA 1UAAA 2O8DA 4B3CA 2OXCA 4RKEA 1HQCA 3Q7QA 4NTZA 2HCBA 3SYLA 3UMRA 1IXSB 3V9PA 2ZE7A 2ZRBA 3QXSA 4WZAE 4Q4JA 4PO8A 4DLSA 2ZIAA 2GCOA 2O8CA 4M9ZA 2Z6VA 1UDXA 3AVXA 1JJ7A 3LXXA 2F6RA 4XJXA 4KLNA 2WAXA 2CHVA 2IYXA 4V0OA 3IILA 1DO2A 3DOFA 3K9HA 2HYIC 4R7ZA 1VECA 2NPIA 4BLQA 4LV8B 1QRAA 2KB0A 1DS6A 1KI8A 1S4QA 1IJFA 2X19A 1Z63A 3B1WA 3CRMA 4ZIRA 1NBME 1GL6A 1GVNB 3DZ8A 1E79A 1ETUA 1KI3A 4GOJA 1DAIA 3AUXA 3SC3A 1EGAA 4C0QC 3CZQA 3TVDA 1E94E 2JAQA 4JYBA 3BFKA 2PEYA 3LLUA 4WZBE 4TZ0A 4BUJA 2EYQA 2QT1A 1MKYA 4PX9A 4TLDA 1YR6A 4RFVA 4ZI2A 1AS2A 2OCAA 3HYRA 4WAUA 5CJPA 1UKZA 4Q1AA 3U44B 4DIEA 1XXHA 1OF1A 3O8DA 4RFSA 3BD9A 2QROA 1SVLA 1MT0A 1RRPA 3BK7A 2B7BA 4DLZA 1OYWA 2G3YA 1VYUA 2A7QA 3A4MA 2DB3A 1W47A 3RS7A 2AWNA 1W0JA 2ZJ8A 2IEYA 2OFOA 4IXMA 1TTTA 1G7TA 4H9GA 4JBYA 4ZDWA 1OXUA 2C78A 3LRPA 3QVVA 2NO9A 3MAAC 3IEVA 2R9VA 3CX6A 3ADDA 1Q44A 4HB0A 3WNCA 3VHLB 2WV9A 4LYHA 3FVQA 3RC3A 3H4MA 1CR1A 1CTQA 1J7KA 2VIIA 4CEHB 2LWIA 1D2EA 1G7RA 1XMIA 1E1QD 3QEOA 4CEJB 1R8SA 4NCNA 3WHLA 1QHIA 3PCRB 2HXSA 4ITRC 1DAKA 3THWA 4BFVA 2CVFA 2ZRMA 3ZIAD 1AM4D 3I61A 5LD2B 3HPQA 4XSGA 4MRSA 1UBGA 4Q47A 1CJMA 1OXVA 1VMAA 1NL3A 4JVSB 3K0AB 3BC1A 3EZ9A 1XEXB 1U2RA 5FPHA 5CB8A 3B1XA 1SHKA 3RSLA 1ZP6A 4B3FX 3EWAA 5J4LA 1NN5A 5FBQB 1HE1C 4FMCB 2G77B 4CT4B 1Q0UA 4UJ3A 1NBMD 3QXJA 2GWHA 1U0JA 2H5EA 4QHYA 3LY5A 4Q66C 1TEVA 4DRZA 4DSUA 4ESHA 2QUZA 5AUNB 1C4OA 1GG2A 4BFSA 4BEJA 5JSZB 4QGGA 1RRCA 3EC2A 2EWVA 1N5IA 1U8ZA 4DWJA 5DSZA 1FTNA 3TAUA 1HE8B 3PFIA 5EXSA 1OXSC 1QG4A 3BAFA 2AKYA 2VF8A 4Q1CA 2QT0A 4IRUB 2PJRA 1UKVY 1H8HA 1K8RA 2NG1A 2CLSA 2J7KA 4UNRA 5E7JA 5HR5A 2AHOA 1T6NA 4DBLC 1U9IC 3LV8A 2KE5A 3C7KA 5HKKA 3CH4B 1WF3A 1FP6A 4GL2A 3CR7A 3RS2A 2IXFA 4RZUA 1UEJA 2G9NA 2ZROA 3RAPR 2IBMA 1OW3B 2WIBA 1BYUA 4I4LA 4EDHA 1JAIA 3IIJA 1TUEA 4D2IA 3A8TA 3PEWA 3NIBA 3IIKA 3VNVA 4ASUD 4DB4A 3AQ4A 3JZMA 4OJQA 4Q21A 3IO5A 1KKMA 2XSZA 2QP9X 4TSFD 3K70B 4DT1A 1XPRA 2XOKD 1E9RA 3P1JA 2IYUA 4ZDJA 5BW8A 1Q1QA 1VHTA 3VR1A 3TH5A 2ORWA 3T5GA 1M2OB 3E70C 1SVIA 2ZYWX 4Q4AA 5E7IA 5GJCA 1HH4A 3EWSA 5JHGB 4PFSA 4YMSA 1AIPA 4HDCA 4TLEA 1XCGB 5A0FA 3B7GA 1CEEA 2XITA 3ZGXA 1Q1EA 2PH1A 1TQ2A 4NH0A 3C16C 2J59A 2QAGC 1X1SA 1TF7A 5HE8A 3UMSA 4A92A 1Z0JA 3T06B 4DC9A 3DPUA 4IOMA 1V43A 3GEIA 4TMKA 4OI1A 3X1DA 2GVDC 1CRPA 3Q7PA 4LWZA 1T5LA 3RC8A 1NKSA 1F2UA 2WMNB 2OXRA 1T3HA 3Q5DA 2YOGA 3W8RA 3L82B 2QORA 4CEIB 3TIFA 4URVR 1KI2A 2RGGA 4F91B 4QKQA 3DMNA 2C2HA 5EE5B 1KSGA 3U6BA 1KTVA 1E6CA 4A6PA 2ZS9A 4Q7MB 3QQ5A 4JSTA 1ZM4A 3L0SA 2CXXA 1XNJA 4IDHA 4V0ME 5CIWA 5KDLA 1SQ5A 3X1ZA 2IHYA 1Z0KA 2WICA 2ZRHA 1TF2A 2YWFA 3MWKA 1E96A 3TK1A 4URUR 3R9WA 2A9KA 4J0QA 3BH6A 2GCNA 1G8FA 1CLUA 3AUYA 2HF9A 4FXPA 2UKDA 4D0LB 2HCJB 3K0FB 3WNDA 5A5GA 1NMZA 2BOVA 5JCPA 2EQBA 2WJJA 5FTKA 4P3YA 3I8SA 4FIDA 5EUQB 3HYTA 3OIVA 4RD4A 4EJSA 2R6CA 1E9BA 1R4AA 3AP1A 2I4IA 3BWDD 3NH6A 4IOJA 2V1UA 1VDZA 4GP6A 4Q7LA 1OFHA 3KUDA 1DARA 1Z28A 2F55A 1B23P 1GOTA 1Z0IA 4JJZA 1I2MA 3DVLA 1G3MA 2JLYA 3RRMA 3TSZA 4HAXA 4TMVA 4GZLA 2C9YA 5E95A 2FSFA 1Z47A 1J2JA 3ZS8A 1XX6A 1E2PA 1YU9A 2IW3A 2ZRCA 2ZE6A 3QPWA 3K0SA 4Y0AA 1SXJB 2WJYA 4JLJA 1D2NA 5HCNA 1CULC 2WWHA 3KQKA 2OAQ1 1AZTA 2R62A 3RRNA 2V54A 4E03A 2PX3A 2NGRA 3QVUA 1G6OA 1KHTA 1KIMA 1PLLA 3TE6A 1T4GA 3ADBA 1J8MF 1OT3A 4EFNA 4V0KA 1Z0FA 1E3MA 2Q0HA 1Z07A 4I1UA 1VIAA 1GRNA 2C9CA 2K5UA 1ZIOA 4LCBA 5F3WB 2O8CB 2ZRFA 1XB2A 4IFBA 2I3BA 2JJ2D 3TSWA 1VHLA 2FPLA 4B76A 1N5JA 1XRJA 1EFRD 4D80A 3QBVA 4ERNA 1ZUHA 4RD3A 5DO9A 2XX3A 2BCGY 3A1SA 2V7QD 3W6NA 4M9SA 1G41A 1WBDA 4R2HA 2RGCA 2PCLA 2QY9A 5HCIA 1TNDA 2CJWA 4EQ6B 3BFVA 5KHOC 3BH0A 2R65A 5CJ2A 1OXXK 4U02A 3U2QA 5AUPB 1W49A 2WWXA 2YNMA 3X1XA 3WP0A 2C8VA 2N1BA 3VMFA 3A36A 3HDTA 1XXHB 1E9SA 1XTSA 4JSYA 3KKOA 2B7CA 4B75A 2H8KA 1M7HA 3U3KA 1E1QA 4Q4HA 4HUTA 3DO6A 1GWNA 3BOSA 2CCJA 3GJ0A 3A1UA 4HAVA 4P33A 3S1AB 4MUBA 1LFDB 3ZIAA 4PZZA 3MLEA 5EP3A 2BBWA 2GEDA 4KYIB 1YR8A 3EA0A 3U7EB 2GA8A 3CM0A 4UJ5A 2FU5C 1W36B 4M1OA 1N0WA 2BJVA 3E2IA 2YOFA 3UXMA 3L0IB 1YVDA 1CIPA 4BFYA 4G5RA 1E2EA 1DAFA 3MJHA 3WYGA 1TMKA 3RDPA 4BQSA 4M0LA 4B2PA 1NBMA 4Q9HA 2A5YB 3HU3A 5JS8A 4URWR 4Z8YA 3QF4A 5EE1A 2J0VA 2ZITA 3SR0A 3AB3A 5EE0A 1MRSA 3ZD6A 2RGEA 1AN0A 3WRYC 5EP2A 3RLFA 4BLOA 2IYRA 1P9WA 4U5XA 4XTRA 4A0RA 1NVVQ 2O8FB 2JDID 3FMOB 1K5DA 4TL8A 3GMTA 3H2YA 1GL9B 2H18A 3RABA 2REXB 2QMOA 5G40A 3Q3JB 3W6PA 3SE0A 1ZRHA 4NL4H 3A6PC 1W44A 4LBWA 2ZRDA 3KZ1E 1ELOA 2P6UA 4IDPA 4W5JA 2JLUA 2QM8A 1IN5A 1E9AA 3U61B 4M1SA 2QBYA 1JXMA 3CLVA 4MA4A 5BN5A 2HDNB 2N46A 3THXA 2V9PA 2ZSAA 3BB4A 4OYHA 2ZYTX 3L0PA 2H1LA 1KSHA 3TGPA 1AJEA 1AKEA 4C3ZA 2ZETA 3QI2A 4B44A 4BLRA 1UF9A 5KUTA 4OK6A 1ZUIA 2D06A 4JL5A 3K8YA 2P65A 1IONA 3IIMA 4LY6A 3I92A 2JGNA 2DWQA 2H92A 3LVQE 4ASUA 2Z4RA 1QHNA 3HU1A 3K0CC 2IUSA 3DKPA 421PA 3NEJA 4BWYA 3B9PA 1FMLA 1OV4A 4NYJR 4TSFA 2GXSA 5H1YA 3TW8B 3QUSA 4TQ9A 2XOKA 3DKVA 1XTJA 5K8TA 5JZVA 1RRGA 3THOA 1KMQA 1KSFX 2O0HA 4B3DA 2IS1A 1KY2A 2QTFA 1WQ1R 2RGDA 5CYOA 1YZGA 4OJKA 1NI3A 5KSOA 4N1AA 5DYGA 3AM1A 3CRW1 1Z6GA 4A2QA 4F93B 2QTVB 1VCMA 5D3QA 4F92B 5CK5A 4I99A 3K0CA 3J81k 1TU3A 2VEDA 2XEXA 3KKMA 2DR3A 2BMJA 1XU4A 1SHZA 4QRHA 1MO6A 4LBZA 3RRYA 3WY9A 2Z83A 4EUNA 1KI7A 1R10A 3QF7A 2F3TA 5IDVA 1HEIA 3WHKA 4CIDA 2AN9A 4TQAA 5ANRB 2ZSFA 1NMXA 3VR2A 1CR0A 2WHXA 3PG5A 2O5VA 1NSTA 2BVNA 5FBRB 1X8KA 3SQXA 2BC9A 5EXTA 3RRZA 4OQNA 3AGPA 3PR1A 4DEXA 2X8AA 3TNFA 1NVUQ 2RHDA 1G9XA 1ZNZA 1N6HA 4M2LA 2ZXUA 1R8QA 2R44A 4O25A 2OBMA 1FL9A 1VKJA 4PZYA 1G17A 3TVTA 1TX4B 3BFXA 1VCNA 4DB2A 2OG2A 5JJKA 2FGJA 2G1JA 2O0JA 1HV8A 3KJEA 3R7WA 2ZJYA 4GP7A 2C99A 3ZD7A 4M9XA 4OKSA 3IKJA 5IF9A 3TUJC 4PR0A 1KDRA 3D7MA 4Q1BA 4DXAA 4FN5A 3KUCA 4GMDA 3JVUA 3QKRA 4YXWD 4RZ3A 2VPPA 4WA7A 1US8A 4LJ6A 4M8NE 4QBHA 5JLJA 3THYB 1KAOA 3D3QA 2F43A 3ASYA 1E0SA 3KJGA 2ZRJA 2GK7A 4QNRA 3IQWA 4BRUA 2XZLA 2PZEA 3QEJA 5AJXA 2QAJA 2GJAA 3LO5A 1CJTC 1SKYE 4CDGA 4CZ2A 4C0KA 2BEJA 3TLXA 1COWD 3SOPA 1Z22A 1XJCA 1QHSA 2ZAOA 1RIFA 2OM2A 1D2MA 1G8HA 3NBFA 4LZZA 4EJSB 1RKBA 1I2DA 4BZXA 3CR8A 1QBKC 3RYTC 2O8EB 4TYNA 1D9XA 3AVUA 2C98A 5DI9A 4YDHB 3VR4A 5DH9A 4AKEA 3GJ7A 1OJLA 4FD2A 3CZPA 4KBFA 3FHCB 4OHWA 1TUIA 4TL9A 5DN6D 5LBIA 3EZ7A 5KNBA 2JJ2A 1GKYA 4L9WA 1XD2A 2EYUA 2ZEJA 3T34A 1EFRA 1SVOA 2F1RA 4Q9LA 4AWXA 1AS3A 1XTQA 1YR9A 5FR2A 4LPKA 1IY2A 3BB1A 4O2RA 4Q9JA 4I1SA 5JCZA 4V0MA 2V7QA 4FMDF 3ZZ0A 3VKHA 2BHRA 4LJYA 3QBTA 2IL1A 4B47A 3BGWA 3X1WA 2P0EA 3RS0A 3CF0A 4QJ4A 2JLQA 2YKGA 4GT1A 4KLZA 1UPTA 2AXNA 4GOXA 1GNQA 2C9OA 5TARA 5KNCA 1FZQA 3RWMB 2P6NA 3FWYA 4XOIA 4D81A 4LUCA 4OQLA 1CJVC 2V6IA 3IUYA 1Z0DA 2ZI6A 4C30A 3ZVMA 1T3LA 1U81A 1IN7A 3PV0A 1EWQA 4R9UC 2RGNC 1YJ5A 2Z5FA 3LBNA 2ZI4A 3F8TA 4JLOA 3RWOA 3RS4A 4QJ3A 2VSXA 4FMCF 5EP4A 3W5IA 4P4TA 2A2ZA 1WMSA 2ZVPX 4K8OA 3VX4A 3C41J 2HT1A 1VG8A 1WA5A 2ZVQX 3B1VA 1M34E 3KQNA 2OV2A 2PT5A 3VR5A 2O0KA 1HTWA 4AKIA 2C04A 1E69A 1Z2CA 4B33A 1OB5A 4BFZA 1T3SA 2WJVA 1E2NA 1HY3A 4LJ7A 2DPXA 1SULA 2RGNA 4GBMA 4B6EA 4B34A 1E32A 1NY5A 2R2AA 4Q48A 3W9YA 4XWOA 4URXR 3PIRA 4QFMA 2C77A 3IPXA 3FYHA 1XTIA 3AF2A 4JMPA 3GEEA 5AJWA 3U3JA 3ND9A 2IXGA 2Z43A 2R6AA 4LHZA 3K1JA 1KNQA 5AJZA 3SFVA 3A58B 1F2TB 5DI3B 2JDIA 1HQYE 5FUYA 3AVVA 2Q6TA 3GPLA 3SZRA 3ZQ6A 3X1YA 4DCVA 4HLQB 2ZRGA 2OLJA 5FOXA 3REFA 5CIQA 5KDDA 1G20E 3NDBB 4AD8A 4C7OA 5CITA 2BMFA 1YZNA 3GP8A 4W5HA 5C4GB 2PEZA 3QKSA 3A1VA 4LYAA 3B13B 2FSIA 2F3RA 1OFIA 2NMVA 5JBQA 1A7JA 1RC8A 1D6JA 1PZNA 4ARZA 4EAQA 2MSDB 1G7CA 4DVGA 1N5KA 3B6EA 3HJNA 2XJ9A 2RHMA 4DUGD 4XWAA 3THXB 2RCNA 2CLCX 3LQRA 4D4MA 4JL8A 3GLFE 2AWOA 4W9MC 5AJYA 3R8CA 2XNSA 1CKEA 2ZI3A 3LW8A 2KBFA 2BKEA 3OFND 1E2IA 1SVMA 2GHIA 3VQTA 1TU4A 1NMYA 4HYYA 2JJ8A 4BLTA 5CYPA 4B43A 2J0SA 1L7VC 5HE9A 1FQKA 3OZXA 2D74A 2ZRAA 3TR0A 3ZH9B 1KYIA 1XCMA 3DM9B 4JL6A 4N3NA 1VG9B 1G4UR 1OLOA 3L2OB 4EPVA 1XEFA 3FPAA 3GJ4A 1M6NA 2FEMA 4JVNA 3TUIC 5JWRA 4JLNA 1OB2A 3EARA 1OIVA 1F5NA 2OO7A 2I1QA 5FOSA 1XPOA 4C0AC 4PSAA 4FINA 2TMKA 1E2GA 2CL6X 3U3MA 2Q3HA 3LXRA 1TADA 1WBBA 2HXYA 2BBOA 2J9RA 2QENA 2IF2A 1T0HB 2WTUA 1E9CA 1G4AE 1SVSA 2D2FA 4MGIR 3X2SA 1XBTA 2NTYC 5FOUA 4RSGA 1VYTA 2VP0A 4FMBB 2G0TA 4H1VA 4MYCA 2DWPA 1U0LA 1Z6AA 3CONA 4IFEA 2V8OA 1IY1A 4IDOA 2WOJA 3LBHA 1ONBA 1W0KD 2BEKA 3ND8A 1Z29A 1G8PA 3KB2A 5KU1A 3H0KA 2B6HA 2BMDA 3CRQA 1GRQA 1JQJC 2NZJA 1DPFA 1Z5ZA 4AYWA 1S1MA 4D82A 3N5CA 4HB3A 5J4YA 3KL4A 2IS4A 1JR3E 3PUVA 1KI6A 3L0OA 3LNCA 5KTYA 4JLVA 2ODBA 4YXWA 2FV8A 1W4BA 2VRWA 4DLTA 2VH5R 4PO1A 4KJZA 2UZ3A 4O0MA 1F60A 5SZJA 1AGRA 1W5SA 4HAWA 4V0NA 3FB4A 5GVRA 3SBDA 4HUQB 1GKUB 1WCV1 5FUXA 4E09A 5B57C 1MR3F 3RS3A 1U98A 3OEHD 4BGDA 3EZ2A 4S35A 1RYFA 2ZQ5A 1COWA 4G5QA 1G3QA 3OIYA 1QHHA 3DM5A 1ZCBA 1IY0A 1R0XA 4DDWA 3CW2A 5JFGA 1IAQA 1ZM2A 4PAMA 1ZNWA 2ZI5A 4IKEA 4WIAA 2KSQA 2GXAA 1W4RA 1V5WA 3TQCA 3A4LA 2F43B 3EPLA 3D6TB 2QL6A 4FW9A 5K8UA 2VSFA 2QSZA 3RSOA 3EIQA 4IDNA 5J4VA 3NTUA 3BJIC 4G0NA 2GKSA 5FBLB 3SI7A 3KJHA 2OCYC 3QPVA 3BRWD 4OBEA 4C0SA 1AA9A 4G5OA 2DBYA 3EXAA 1E2KA 3M1IA 3TRFA 1G1MA 4YLGA 4A0FA 4JS0A 1T91A 1Z6XA 3IO3A 2WWIA 2PT7A 5FH9A 3WMEA 1KO5A 2HV8A 4DCTA 1XF9A 2ODEA 3PJRA 1QDEA 3VAAA 1JR3D 2Y8EA 1KY3A 3QG5A 4HZUA 1XD2B 2WKPA 4YC7A 3QKTA 1JPNA 4FCVA 3KQLA 1MO5A 1TQ6A 2OLKA 4QM6A 4KODA 1ZJ6A 4AG6A 4EPXA 2FPMA 2GVZC 4GZMA 1DAEA 2AL7A 5HTKA 4LHWA 2Q21A 4KI0A 5JEDA 4R98A 2OSBA 1U9IA 1HUQA 4NYIQ 4IW3B 2B8TA 2ORVA 4Q5IA 2VYFA 2DHRA 2WWYA 3Q5EA 4A0HA 3F3YA 3L8YA 5TXGA 2J5XA 3I8XA 2QZ4A 4G01B 4HB2A 1XD8A 2ZSEA 4JLPA 4R71A 1C9KA 5CM8B 4RCYA 2FOLA 3AVQA 3QSYA 4S2EA 2C5LA 2ZUBA 2CHGA 1S2MA 2WSSD 4HAUA 5GADl 1KAGA 2ZSDA 3GJ5A 4RD1A 2GCPA 3LW7A 2CBZA 4UXHA 5DIFA 1JQLB 3KTAA 2JLZA 3ZLJA 4E5UA 3T5DA 1YRBA 4BFXA 2Q9CA 4RJLA 1RPZA 4YMWA 4C0BA 3F5FA 3NBYC 1E98A 5DHAA 2QA5A 1W2HA 1H65A 3L43A 2VTKA 3AKDA 1ZD1A 2WIAA 4MRPA 1E0JA 1J8YF 1QF9A 4QGFA 3PQCA 5EE3A 1JECA 1G3IA 3P27A 4YMVA 3A37A 4G5SA 1GZSA 1NVVR 2FNAA 1KZGB 2VSOA 1S96A 1Z6TA 2YWEA 3K9NA 4LGMA 1U8AA 3QY0A 2ZSBA 1GNRA 4GMXA 3BH7A 3C4JA 1BIFA 1VPLA 2LKDA 2OBNA 2QAGA 2IYZA 1N3BA 2AR7A 4LJ5A 2O8BA 1ESMA 1NN0A 3FGNA 2HJGA 3LA6A 4OK5A 4HSEA 2ZUDA 1Q57A 2NIPA 3KFVA 2BBTA 2GJSA 1FNMA 4LJ9A 2XXAA 2BMEA 2AK3A 1S0UA 2RGXA 4NCKA 1NVXQ 4JVMA 3W3AA 4GSYA 5EZ5A 1SVWA 1FOEB 4AKGA 1M1YE 1P2UA 2GF9A 5KPDA 3KFXA 1QVAA 4AI6A 2ZS8A 3C14C 1ZCAA 2DFNA 4GRAA 4DUGA 4DSNA 4US2R 1LF5A 3SN6A 1N2CE 3N2EA 5FOTA 3RHFA 3UMFA 5J4HA 1N6IA 1Q3HA 4Q1DA 2OCBA 2YC2C 2ASEA 3QKSB 3WNBA 1KJYA 1KDOA 4C0JA 3U4QB 1U0HC 5LPNA 4FCTA 2W83A 3NXSA 3F0TA 3M4YA 4D0NA 2PZFA 4CT5A 5D3MB 4NYMR 4YONB 3OFNA 4P4SA 3NC0C 1G6HA 1GITA 1P9RA 3CRRA 3WXMA 3U60B 3P32A 5B2ZA 5UKDA 2YVUA 2PMKA 3K09C 2WMOB 3HWSA 5FPTA 1ZU4A 2GBLC 2O8DB 1D9ZA 4A9AA 3Q85A 3QIAA 2WWWA 2EU8A 3TR5A 3CRVA 4X8MA 1NVWQ 4M4SA 1KMHA 2GJ8A 1GAJA 2CE7A 2LCFA 5JWOA 2VL7A 3AKEA 2IUTA 4M53A 4Q4JB 4E22A 721PA 3OF5A 2GCOB 1JXOA 4C4PA 1GM5A 2WJIA 4QL3A 1E9DA 1G8YA 2QM7A 3CX8A 1M7GA 5C1BA 2YC4C 4LHVA 3D31A 1ZM3A 3NHAA 4LC0A 2GBLA 4LBVA 2QE7D 3VU9A 4DJTA 4LOAA 2D7CA 3H1TA 2XTZA 2CL7X 4XWKA 1KNXA 3QPUA 2QSYA 5KO2A 3PUZA 2JLRA 1S9DA 1QZXA 1G5PA 4OHVA 4M9QA 1KI4A 4ZIRB 1AQYA 1XFAA 2FGKA 3GJ3A 4HEJA 3CF2A 3GLHE 3ZDQA 2Z4SA 1PLKA 1RJ9A 2ECKA 1W0KA 2XGJA 1EX7A 3DOEA 5FPSA 2Q9BA 2DYKA 3AP3A 4JKYA 4TT3D 1ZC3A 3FKQA 1IN4A 1BYIA 4DCNA 1ESNA 1HT1E 4JKIA 4RFSB 4B35A 2QP3A 2ZU0C 2YHSA 3CWZA 3KX2A 3I3SR 4UNNA 2H16A 3T1TA 2VHCA 1OH5A 2EW1A 3ICQB 3OE7D 2JLSA 2XTMA 4B71A 1XCPA 3LDAA 3ADCA 3WP1B 3GLFA 4XIGS 1DOAA 4GPTA 1AKYA 3PUWA 3T1VA 4A8JC 1P9NA 4ESVA 2CEAA 3OEHA 3CPHA 5BXQC 121PA 5ELXA 1ZYUA 5G3YA 2IS6A 1DAGA 2G0NA 4QOSA 5B58C 5JMTA 1IJEA 2C03A 3EZFA 5DISB 5JWHA 4XVUA 5TB5A 2QPOA 2RB4A 3EC1A 4PAQA 2R6GA 1SXJE 4DZZA 4II7A 3AKCA 4LK2A 1UJ2A 3THWB 1X86B 3BXZA 2GXQA 5KSZA 4A6XA 2J0UA 1W7AA 2CK3D 2YYZA 4XSHA 2JIZD 3I62A 2GETA 4LI0A 3AEZA 1XEWX 3R9IA 2ZYVX 1DAHA 2OHFA 2XZPA 1CJUC 4KFRA 2IYQA 3SJAA 3G5UA 4NCHA 1XJQA 4ZCLA 3K0EA 5IRCD 4AYTA 1N6PA 5P21A 1FQJA 2CVHA 1NN1A 5B64A 2P5TB 5EXPA 1PJRA 4F4CA 3UG6A 5L3QA 3GQBA 5SZHB 2J45A 4TTPA 3SJCA 2WBLC 1TEXA 4KFUA 4NDZA 521PA 2CCKA 3WMFA 1DG1G 4KBGA 4B32A 1OFUX 4TLCA 3IEUA 4IJMA 1I4DD 4HLCA 4EPYA 3GLGE 4KV9A 4EPWA 4PQFA 3U6KA 4UXJA 1T9HA 1EESA 2GZHA 5FOVA 1JR3A 2YINC 2UVQA 4XVQA 4B3BA 1HURA 2ZR0A 3I32A 1E4VA 1XZPA 3FKSD 4TYWA 1M74A 1KI9A 4MQBA 5CLLA 4MDEA 1RW4A 1Q22A 3NVAA 2QEQA 3AF3A 2VA8A 2F1HA 3E1SA 4PO9A 4Q9KA 2W6JD 1JR6A 2VHQA 2IC5A 2FFAA 1KK0A 2R6FA 2IYYA 3EIHA 2QGNA 3A1WA 4FCWA 3C5HA 1KI1A 3JZAA 1JPJA 2QPTA 4Q1EA 5CM9C 4EFLA 2ONKA 1GL7A 821PA 2XTNA 3A4NA 3CNLA 4JBWA 2OZEA 3K9GA 3P20A 1EFUA 4HDQB 2IWRA 3O8CA 4HZUB 4LJAA 2AX4A 3UANA 3FOZA 1GSIA 4F38A 4HI0E 3RVBA 1SXJD 4A2PA 1GILA 2KWIA 1N6KA 1XD9A 1ZNYA 2WSSA 3LH5A 2IYLD 5IHPA 3HR7A 4Z51A 1PUIA 4Q18A 3G82C 5E4FA 4IVQA 4TL6A 1DE0A 2G1KA 1P62B 4DT1B 3B60A 4R2IA 1DO0A 1OYYA 2J0QA 3OEED 3SBEA 1G5RA 2VP5A 2JCSA 4MH0R 2ZRNA 1L4UA 4OHXA 4DLWA 5J47A 1G21E 4O2LA 4QXAA
chains in the Genus database with same CATH superfamily
1E5LA 1QAOA 1QH1B 2G4VA 3FM9A 4D0GA 1H0SA 3IH5A 4FR0A 4ODIA 2FFQA 5AK4A 1NRWA 4NMMA 5FAXA 3RYFA 1YE5A 2V6JA 3ZY4A 3TSAA 4CHTA 5EP1A 1D2HA 3BEOA 3LC1O 5E6SA 1N0UA 2PJDA 3HJAA 3NH9A 4NVRA 3V6MA 4ZJPA 2CFCA 4DCPA 1XQ6A 1QC5B 1Z83A 2J9GA 1RM5A 2VP9A 3VSDA 3G6KA 5B12A 1EQ2A 5AVOA 5JH7F 2YWRA 1O6CA 3FTNA 2H11A 3QENA 5DWQA 1J5PA 1FDOA 2XMPA 5DZSA 2ZREA 4XASA 3FPCA 3KQUA 2WZQA 2WWTA 4DA9A 4MWTA 2XA1A 1NJ2A 2Z04A 3WLPA 2KYRA 2Q6LA 3K6SA 4OGWA 2XDQA 1O5IA 4UVIA 5KWEA 1VMDA 3FNRA 1IXZA 2WTBA 3BJZA 1RBQA 5EXDA 4C5CA 4ZN6A 1U6JA 2F9LA 4GPIB 1KGSA 1VJ1A 5ER6A 3UJ9A 4DAOA 1I2ZA 2ZZKA 4HLUA 4JT4A 3LPMA 3EEFA 5CA0F 1Y1TA 2VJBA 3O0TA 1E2LA 3TE7A 3DBIA 3DL2A 1VG1A 1W19A 2JIBA 4G86A 4X8LA 2DCMA 3D2LA 3EVTA 1HYQA 1NUPA 3N2GB 2Y92A 3OJCA 3PEUA 4M38A 1DOHA 2Q8PA 2C4UA 4NV0A 3JD1A 3WLSA 3ZBPA 4F1KA 4HDSB 4Y2GA 5KNDH 1IRXA 1S2OA 2PLRA 4K9LA 1AMOA 5LZ8A 1U3WA 5FEUA 3B12A 2GI4A 5LOVF 2H63A 4WVFA 4WY2A 1OTYA 2OBXA 3HBNA 1E0KA 5TMBA 4CL3A 3LCUA 2QN6A 1PHPA 4G0WA 2IXAA 2HMSA 3QU4A 5B3JC 5HS4A 1PS8A 2BP7A 4PC6A 4D0RA 2JASA 3DC2A 3PVSA 1UPUA 5CX1A 4MS3B 5HUHA 3DG9A 2AQKA 1P4HA 3ESQA 2QTMA 4MRAA 4OHKA 1XTVA 2CDAA 2XMBA 4G56A 2BM9A 2R86A 2O50A 2ZTVA 4EX6A 4FM9A 3UK6A 5DK4A 1PSWA 3T4EA 1SKMA 1GSHA 2B82A 4LX0A 5DTRA 4JYPA 1IJBA 4M0UA 3RRFA 1IBKB 1OVMA 3F5MA 2P1RA 2FOIA 3G2JA 3NM4A 4FS8A 1X1DA 2YWBA 2BRUC 1FSZA 3DE1X 2GPWA 4BKPA 4D57A 2GD6A 3IODA 2Z2IA 2QJWA 4LZPA 2D7DA 1X7ZB 2QE7A 2IS2A 3L8ZA 4JXJA 3G1TA 2AA3A 2XPCA 4DUZB 2Q3FA 3VO2A 4EG4A 3G1WA 2PWBA 3P2IA 4OSOA 3W8NA 4QUAA 2VP4A 5FL7D 3G9UA 3WHIA 3ZWBA 1IM2A 1WVGA 1NVEA 2YCBA 1SG0A 5E8RA 1D7OA 5YASA 5HHTA 3FPLA 4DBVO 1L4BA 4B4VA 1F8XA 5T3UA 3KQOA 4P4LA 4R2KA 3DEFA 4EFMA 4WCFA 1P72A 5FUVA 4DXHA 3A6ZA 2EFJA 3DFIA 4GG1A 4MR9B 1V11A 1E6KA 4R54A 1M1YA 5LJIA 3FYDA 1LZLA 2C57A 1GZ4A 2D3WA 1ZONA 4OFBA 3GZ4A 1KU0A 2QN7A 3LT4A 3BMCB 5DHRA 2X3YA 2DFTA 5DLPA 3W90A 3U17A 3ZK8A 4PGGA 1JAXA 2CXHA 2VCEA 1GPAA 4EY4A 5DFAA 1P6QA 4C2BA 4DA7A 4MGYR 4DLKA 2I4LA 3R20A 3L7DA 3V8NA 4AQYB 1UBTS 5G0SA 2EGGA 3RFFA 4RF4A 3GPBA 5IXJA 5CVVA 1RJ9B 2UVPB 4ZZ0A 5JECA 1ZQ9A 1OXBB 3SHQA 4QO8A 3R7BA 3WRVA 3W2FA 3E3NA 4OHYA 2XB9A 4AAYA 1NYLA 2NNWB 4OMFG 4CKBB 3A1FA 2F9MA 5BN3A 5BVHA 5AK5A 5KSPA 2KI5A 1TRKA 4QOFA 3NVMB 4PG7A 3UM9A 4NYJQ 3H75A 4BZPA 4IQGA 5IT9A 1PFGA 2YXPX 4RMGA 4Q4HB 4MRVA 1KK2A 1C0PA 1M8PA 4XW2A 2J3KA 3BMNA 4FYYA 2XSZD 2YN4A 1RCUA 2OBFA 4H1HA 4CQMD 1WB4A 1GA1A 2PZBA 4WZAB 4C2AA 4UOZA 5CLJA 2QN3A 2CK3A 3ZOKA 2POCA 1MRZA 2GT1A 2TMYA 4GZ5A 4IKOA 3AB8A 1P3DA 2Y76A 3B38A 3UXYA 3HS3A 4D4JA 2H2GA 4J6FA 4B8WA 3WTBA 1XAGA 1MVNA 1CW2B 3HUEA 4HKTA 2Z5LA 4FS3A 2B8WA 4TYMA 1VHJA 4OUKX 1PNQA 1GFSA 5I9TA 1KDTA 2B1GA 2HY7A 3KQHA 3FDJA 4WECA 3CINA 4WLEA 3A10A 1RYEA 2PZGA 1FFEA 3QF4B 4CODB 4TVOA 1CNFA 4IIUA 3ZWWA 3BSWA 4D9EA 1RTTA 4HAZA 1M66A 1RAFA 1J23A 1GFZA 1YCFA 3LVFO 3TLGB 1F0KA 2H7VA 3D1VA 2W2TA 1Y0BA 3PGVA 5JCOC 3ESBA 1GQ2A 1WMEA 1ZVJA 1E3QA 2Z9DA 1JLMA 2ACEA 3WIEA 4LMPA 4YT5A 2AKEA 1GO2A 2GDJA 3IELA 5BSVA 4NX2A 5LMZA 4GD3Q 4JU8A 1QO0A 1TCAA 4CF6A 2I1WA 5AWFC 3EGDB 1PGOA 3QM1A 3NHBA 4RADA 4CL8A 1E5XA 1PGPA 2QI9F 3KP1A 2CXPA 1EZ4A 2QP4A 4QX6A 3RANA 2XUJA 1Y4SA 2BKLA 4LJ8A 1FFSA 1T1GA 4RF5A 5K3FA 3DCJA 2EVWX 4XR9A 3OJ0A 3DHWC 4PLPA 4LNUB 4OF4A 5FPKA 4EB8A 4RVDA 5CHYA 5ES3A 4AS2A 4B48A 2MSLA 3WGOA 2G6BA 4EGJA 1ADFA 2QD5A 2Z9BA 3EXIA 3N2IA 4FLFA 3UJDA 3S7TA 4QICA 4YRKA 4CKXA 4TV8A 3RYIA 4TKZA 1NURA 1QORA 2ETXA 1MA3A 1L5KA 2BCJQ 1XHEA 3GT7A 3GUCA 3PXUA 4P3OA 4OMUA 3BTOA 3O2SB 3VBEA 1BE8A 2ISSD 2X4GA 3KNZA 4F8EA 4HXGA 1Z6QA 4YDRA 3DZGA 1LV7A 1OPRA 1PFQA 1UFQA 2NX2A 3E84A 3GBSA 3KD3A 3QGMA 4HATA 2C5SA 2DT8A 2P7IA 3U1VA 5IUJC 3JQCA 4LRQA 3EH2A 1GQSA 3UPUA 1T34A 4HC4A 4OLHA 1XJ0A 4UXIA 2WIDA 1ISFA 3TBHA 4B3GA 4EELA 1MXHA 5BUZA 1KZHA 1OA0A 5FR1A 4M60A 2IX3A 1EAMA 1VKRA 2RK3A 1V16A 3V8VA 3ZNQA 3EDMA 2JFFA 3MT0A 1K92A 3OWXA 4UBJA 3VTKA 3VPSA 1U04A 4I3FA 4GUDA 4M1WA 1V8DA 4FFBB 1ST2A 2C9DA 2UYOA 3ONEA 1K98A 1L5FA 1NWHA 1U1EA 1XWWA 2PR7A 2PSJA 2VNAA 3ZXXA 5JSQA 1U2QA 1ZN7A 4XARA 4QAQA 4OHUA 1R8JA 3O91A 1UJ6A 1E1YA 4RZ2A 3UKDA 4B09A 2XAAA 3AL2A 2G88A 3PJEA 3ZBTA 4JCOA 4BKUA 1RXVA 1DRJA 3U48A 2ZJ2A 4EUKA 3TM4A 1CG6A 3I4LA 3PGXA 4KKXB 1XNRB 1VG0B 2EL7A 3PFBA 3QELB 2D1SA 2IEZA 3Q0IA 1F20A 2TECE 4P0TA 3ZUGA 3CSSA 1ODFA 2Y6VA 3VJMA 4IOKA 1YHYA 1F6BA 2D4AA 1ZJZA 1XDBA 4QPJC 4MITA 4L2IB 3KEOA 3ZCRA 1XRLA 3NI2A 5DLDA 1T8UA 1YRYE 1TE2A 2C88A 1QGYA 2X2FA 3RIXA 3WGJA 4OL0A 2QLNA 4CF7A 5JISA 1C3OB 1ZWKA 221PA 2EC5A 3FNGA 4BLVA 2X2EA 3GLTA 1JZQA 1CUYA 2JK1A 5K20A 2Q5FA 4WOJA 1E61A 4EIWA 3TXYA 3MAJA 2GEUA 1JR4A 1RD4A 4G0ZA 2ZJ0A 1EP1B 1ESEA 1U65A 2AFIE 5GP1A 4AC9A 1ZNQO 4GRDA 1M2FA 3F7OA 1FXWF 5A7HA 3AF4A 3DOCA 3JQ9A 3NYRA 1XWIA 2XZOA 1U0GA 3P2OA 1CQIB 2QMEA 4IXNA 2AHRA 3V42A 1GV0A 2NO0A 4QTXA 2QMUA 4Z9AA 1QTIA 5ILOA 2WQ6A 4KW7A 2A9RA 5TNXA 2MMCA 3LSTA 3Q3EA 3SZGA 3ZHRA 2OILA 3K71B 1QUFA 1JIVA 2ERYA 2QZZA 4X0EA 1UP6A 2EFHB 1Q7TA 3AL0C 1Y80A 1DC3A 2J9YB 2WPDA 4QTTB 3VNUA 1E2QA 2Q3LA 3QKRB 4K2AA 2ZUSA 3GZTB 3UMMA 1OAOA 3K7EA 3L9WA 3OIUA 1G2OA 3QA9A 1FCJA 5DLQC 1OILA 6YASA 2DF8A 2PUWA 3DB1A 4J2OA 4EJMA 2O2GA 3QOYA 3UIEA 3H7AA 1CR4A 2VJYA 1ZSVA 2W0MA 3UOWA 3B51X 1BDIA 1QE3A 3NWJA 2CMGA 3OU7A 3VVLA 2B92A 3KOOA 2J4CA 4HAYA 3VOSA 3KR2A 3W6UA 3OG9A 4N8SA 4B6OA 1KP2A 4H27A 4MUFA 2E2WA 4JQCA 2EKLA 1UBNA 1J90A 4G0PA 1H8EA 3CJTA 3OPYA 4NZMA 3F7TA 3WB0A 3QEBZ 1Z3CA 3SJZA 1DJOA 4EHHA 1P91A 2D2EA 4CFZA 3VRHA 4I8XA 4L78A 1HYGA 1O97D 5LQCA 1CNMA 1TJNA 1ZJWA 2DFPA 1M8KA 3QYPA 3ICPA 2K7FA 4TV9B 4EG3A 1H5NA 1X38A 2GGSA 3PC2A 1A7KA 4JYCA 5FLXA 3PRYA 4YASA 4ALIA 4HGQA 4L5IA 4LOLA 4O4IF 4JP5A 2HMTA 4P7JA 5KYUA 3ZHCA 4DZRA 2E87A 6LDHA 5DHFA 4B74A 4GH5A 1CUCA 1SCNE 3RVDA 2V5AA 3VR3A 4DE5A 3R24A 3UK7A 3KXIA 4RANA 3PGA1 5GM1A 4UM8B 1DKPA 1Q1GA 3KQWA 3SR4A 4J90A 4PPNA 5EVJA 4PGHA 1G1AA 2JGIA 3D8BA 4DF3A 1NI4B 3ZKAA 1MABA 1ZU5A 2C58A 4TTAA 5AW6A 1XRSB 3GD5A 2DFDA 4RMNA 2A3RA 1T1JA 2OESA 3OUZA 3LWNA 3SQDA 4B3XA 4DQVA 4Q7QA 4LV5B 4KXFB 2W6OA 4GPD1 5IU6A 1QHXA 1T5IA 2I2FA 2YMLA 3DZIA 3WBKA 2WUWE 3DE2X 3WYFA 2H00A 3DVAA 1U11A 3EGWA 3N2KB 2OBBA 3E35A 4DIFA 1WULS 1WABA 3Q88A 1LPSA 3WLJA 5KYWB 4YQZA 4HVLA 2G17A 2RAUA 2XJ4A 2NSJA 4LE2A 2Q3MA 3VX3A 2DPMA 4IWNA 4UNSA 2KW5A 1T4DA 5IFLA 1CUBA 1N36B 4RZQA 3RD5A 4AG5A 3BIOA 2ZATA 4JT2A 3AKYA 4BO6A 4CG3A 1TYBE 3GFQA 1T10A 4IDQA 1IQUA 1YVUA 4D41A 5HGXA 5KJ1A 1U0BB 2QTRA 3K16A 2YHIB 3GJ8A 4CMIA 4JNCA 1A2KC 2C0PA 3D3WB 3ACCA 1TO2E 4X9XA 1BVRA 2OMKA 1E4EB 1NUAA 2V6MA 3BBLA 1USKA 1N2EA 1HE3A 3KVNA 5BW5A 3EWNA 3PTLA 2Y1KA 1M6WA 2XVAA 4M3NA 1KDPA 5L7TA 2W2OA 4MO2A 2XE8A 4B7UA 2NU6B 1VB5A 1C9YA 1DXYA 1Y33E 4GOKA 3FR8A 2QZJA 3I72A 4M1YA 5IAAA 4B73A 3HRKA 3LQKA 1NUUA 1RWNA 4PS1A 2XYHA 4HJRA 1LJ8A 3L77A 3N05A 4NZYA 2BFBA 3VV2A 3GWGA 4HEQA 4I9HA 4TLBA 3QKUA 4AUKA 1CSEE 1P5JA 4S1PA 2WJHA 3CYFA 1AUXA 1P19A 3N2LA 5T41A 3SNHA 4EHBA 4EJ6A 4KREA 4BNUA 1GZ7A 1DWPA 4RPLA 4PSDA 3WDMA 2RGUA 4WXPA 2ZK7A 1U1DA 2H4FA 3OKCA 1E1RD 3N53A 3A4IA 3L6OO 2C8JA 2JCYA 4C7OB 2JH3A 4FUTA 1E6MA 1GRVA 1N2SA 4IEIA 1L4NA 3GLHB 1NE2A 3ID6C 2NU9A 2AV6A 5B3AA 1PU2A 1CR2A 2YL2A 3CCFA 4JC8A 2W7TA 4YGXB 4B3JA 1JYEA 5ITWA 1IL0A 4EKYA 5KYKA 2NP7A 3DONA 5HVNA 1H4VB 1NA5A 1YQEA 3GCDA 2X40A 3IAXA 1EMDA 4JJ7A 4NCJA 4Y2TA 5EZYF 1XOIA 3T35A 3WLTA 3WFZA 1VL2A 3LO8A 4G65A 3H3JA 5CDHA 2FAXA 1KWKA 4JR0A 4KH0A 1DWUA 2P6OA 5BNIA 5MF6A 1JIJA 1WX1A 1G3RA 1G19A 1TM1E 3B6JA 3BSYA 2GRAA 3EA5A 3ECSA 3QVGB 4XGQA 3UGKA 1Q92A 3ZQJA 5LLTA 4FOTA 2SECE 5LQRA 3TLCA 3FWKA 3LFUA 2PTHA 2MSEB 2WOOA 3VOTA 3EXEB 3PC8C 2LIVA 2A9OA 1WSDA 2JGDA 4EENA 1GL3A 4UCQA 1QGAA 1SUBA 4DV6B 4YPVA 4LRSB 3UGJA 2WINI 5AXCA 2HK8A 2HWWA 4E5PA 4ZPXA 4XQ9A 4LE0A 3GRKA 4XH9B 1UODA 1ZHFA 2VCYA 5NULA 4WGGA 1P0FA 1EFHA 4BQFA 4FJ0A 4L73A 2AUMA 1MHPA 3NYQA 3LTNC 2JLVA 1H2EA 3LHDA 1CDEA 4ES6A 4CQJA 2G1PA 4PC1A 4JLUA 1DBRA 3S2YA 5D3ZA 4EHKA 2ZR7A 4DL9A 3THRA 1HETA 3NHYA 4R8VA 2UDPA 1KGDA 1ZK3A 3CUEF 3GARA 3HXPA 4W9NC 1IRIA 1LTQA 2VF2A 3DTTA 5FPPA 3IDOA 3RGWS 5CA1A 1Y8QA 2GH1A 1U7UA 2I6GA 4MLDA 2CV1A 2OCXA 1Z06A 2QWXA 3HQ4O 1NPYA 1Y3CE 2HSGA 3R8XA 3SY8A 2P78A 3IALA 5IG2A 1UJMA 2V4ZA 3LOUA 1LU9A 4LCEA 1LTHR 3CLRD 3EJWA 4P58A 3WTCA 4EDFA 2XHEA 3CE9A 2FRDA 3A2LA 4U7DA 1JI0A 4KRXA 5LYJA 3TFOA 1S8FA 2E85A 4P4UA 3ET5A 1MNQA 2YNMC 4MLPA 1FX0A 4UHDA 3ZWOA 4C2TA 1LX6A 3I01M 2IPLA 4KN9S 1RRKA 2YV5A 5IW8A 5BMVB 3DP7A 3DA8A 4U7PB 1FLNA 3FFBA 3OM9A 1C8VB 4OI4A 2VXOA 3TCXB 4ZT4A 3S6JA 1SVKA 1DAPA 4O2AF 1NNEA 1CJCA 2A30A 3TMKA 3GLGB 4WINA 1A97A 2B8JA 4MGEA 4MIOA 4WZ6A 1LPPA 1HL7A 3PICA 5JASA 4JLKA 5BMOA 3A9WA 4FNAA 2OV1A 3RJTA 1UMCA 2H51A 3BL5A 3AHGA 1QX4A 2AOUA 3C5VA 3L79A 3K2QA 3Q12A 2C9MA 4LDNA 4NULA 3RAJA 3DE3X 4C29A 3HACA 2ZJ5A 4DILA 4TLAA 1KI6B 3WOVA 4LWQA 4YBZA 4UFNA 1L2TA 5D6OA 4N54A 1O97C 5AVZA 1O03A 4I9NA 1RTKA 5KTOA 4OI0A 1HLPA 1QGDA 1U2GC 2MT9A 3HCWA 2CHQA 3O94A 3PEVA 3STHA 3WA6A 4WBNB 4XI9A 1P1IA 3J7AC 1C30A 3D7NA 2CW5A 3BREA 1CXZA 5CVCA 4JI5B 2H17A 2PSHA 2Q4DA 3HM9A 4EB0A 3CPJB 1O95A 3OAAD 2WZDA 3SZMA 2JFGA 4M7RA 1X7WB 4ISCA 3OHSX 4AUMA 4EG7A 1BX3A 2REOA 2R1VB 5JI2E 3PF8A 4UUBA 1IQRA 3AP2A 1I7PA 4OK3A 5HQJA 2HRBA 3EY4A 1JG7A 1AKTA 1RWPA 2J3EA 4PVDA 4KSBA 5JS1A 2FFJA 2JLAA 4P31A 4QRIA 4FI3F 5TGDA 1YB6A 4HDNA 3MHPA 3CUWA 3GAAA 3H18A 1GPDG 4RK1A 4XDGA 2J6IA 4XYEA 4WBSA 3I28A 2C2GA 2OGWA 3OSUA 4DR2B 2AZXA 3REQB 1R27A 4R9RA 5K0EA 4DRXA 3IESA 1ARZA 2Y1WA 5B4TA 1W34A 3ESAA 2FJUA 4HVAA 3WAGA 1SA0B 2FY8A 2YRWA 4RK7A 2OXEA 5KYGA 5EUCA 1YJBA 2QR3A 1FTSA 3WGTA 3AZPA 4KWCA 4WDRA 5EHQA 3RTBA 1SUEA 2I4NA 3ZDEA 2YWDA 4UHJA 4YQEA 5IDYA 1NRJB 2FJ0A 3MYRA 4MVJH 4P35A 1E2HA 1FLAA 1ONNA 2C9ZA 3B9BA 5CGQB 3G0HA 4CKEA 1UBKS 4IUCS 1KY5A 1NU8A 2F48A 5JH7A 3CLKA 4E3WA 4MYTA 1BMFA 1YK0A 4XCVA 3BXPA 1SEPA 1VE1A 5KJ6A 3C1TA 2FLVA 2VR1A 4B3TB 2GWRA 4MKZA 4JQOA 5JY1A 3DKIA 1RWVA 4YAIA 2MYUA 1M54A 4B3SB 3K0HA 3J80A 2QRHA 2FX3A 2GMWA 3CNNA 4EYQA 1EUDB 1LBHA 4WOBA 1KU6A 1R66A 1XDDA 3IBGA 4KKVA 4G5GA 1O89A 1F3LA 2QZPA 2BFDA 2F7SA 1F06A 1KOFA 3OHPA 3PUJA 4TS9A 1IUKA 1JXAA 1GP2A 2PL3A 2AXPA 4LDJA 2AFHA 1Z36A 5LZ7A 3EVDA 3TFQA 3DAPA 5ALOA 4I8IA 1BKYA 1TCVA 2FUKA 5EEGA 1BXZA 1QH8A 1K86A 3ACDA 4GLOA 2BBSA 2CF5A 2YXEA 4NYMQ 2IYWA 1NUSA 3K4HA 5BWMA 2QMQA 3ZGYA 4N0DA 3B5JA 2AF4C 1YUNA 3N6XA 4R7TA 4O4LA 3NHMA 1J9GA 3NWOA 3ZTWA 1JTVA 3VR4H 1RZ3A 4E14A 2GYVA 3QU9A 1Z0AA 4JJFA 3JYLA 2NQ8A 5C46F 3KZKA 4U9IS 2PBRA 3ZHBA 1HTBA 3RIMA 4DDVA 3OQVA 5LWHA 2J8ZA 1TT5A 5IT5A 2O3TA 3OU6A 5E1BA 3KTAB 5FBZA 4LF5B 2G83A 4LJ4A 4RNCA 3B8HA 5KI6A 4XUGB 4ZC1A 2VDUE 1WTCA 3M3DA 4MYSA 3VPBA 1I7SB 1OH7A 5E2BA 2QXTA 5DBGA 3EA4A 4EB3A 3TAHA 2ANBA 2JZNA 1OA1A 3BS4A 3IQHX 3X2EA 3OCXA 3QOFA 4L50A 4NWIA 1J2EA 2FEOA 3K9LA 4PQGA 3R40A 4BP8A 1FP7A 3LP8A 4G1CA 4TTJA 3MS2A 3EVGA 3LMKA 4EUSA 2DOKA 3RSCA 2RAPA 1IBRA 5K4GA 4RD2A 2GVNA 1C1DA 1P81A 2CNLA 4KQFA 1K7FB 3IDAA 1GZUA 4U2DA 2H8GA 4UQOA 5U4XA 3UG7A 4DPMA 3ZZ1A 2YZ2A 1YB1A 4YMUA 3L7KA 4O8CA 1N1EA 1CY4A 4DIUA 1OH6A 1X1AA 3AJEA 1ANKA 1V48A 3K0AA 2Q4OA 4OO3A 4AZSA 4F7DA 1PFWA 2WU1A 4B5LA 3SKYA 2JAWA 3NVDA 2X76A 3IUSA 1Z18A 3U61B 1TT7A 2BT4A 4GSLA 3UHFA 5A4FS 4RDXA 3ZVNA 3NGLA 1RWWA 5GOTA 1T2AA 1ZMTA 3U4MA 1L5WA 3B1JA 3ZVKA 2EBWA 1XZMA 3GRPA 3ZY3A 3FE2A 3GDOA 4E5DA 2ZYUX 2D5BA 1UT5A 3H13A 3NKFA 2COKA 4JJAA 3CEAA 3A27A 3QKIA 2XRMA 2VPTA 4RUKA 3CLRC 4BMXA 1P17A 3VR6A 1MAVA 2WZCA 4D79A 2YX1A 4LSZA 4UZEA 5DIZA 3ZPXA 1TF5A 3PENA 2I5PO 3UWOA 4B81A 2OGSA 3RS5A 4BDSA 5LVAA 3N8GA 3QBJA 4GQIA 3HUFA 4G0MA 5AT1A 2A1IA 2V7GA 3U37A 4F5ZA 3WIUA 1JR2A 5JNVA 3VV3A 1BW9B 1DXQA 3ZEIA 1KYWA 2RGAA 4Y6GB 4D5EA 1R5BA 3HY6A 2ZJ6A 1GYQA 4UUMA 4XEHA 3PUXA 1DDIA 3V7FA 2GD1O 4FX5A 2XGGA 4FC7A 1VL1A 1Z39A 1V4BA 1ZGZA 2NTEA 1KMHB 2HUPA 3C8MA 4MW0A 3N8IA 3MOIA 3MUEA 5K3DA 1QK4A 1U8FO 1D03A 2ZE5A 2EARA 3LY7A 3WGKA 1WR8A 3AI1A 2Z30A 1SUSA 2WU0A 1ADGA 1KJWA 2HLDA 3VAZA 3MJ4A 1K2VN 1JFFA 3REGA 4Y6LA 3LP5A 1SPBS 3FMFA 5AK0A 3GB9A 2WHPA 3EZXA 3QK7A 1NF2A 5HTOA 3QU5A 2QX7A 2YMMA 2GA9A 4QC2A 3JU3A 3VU9B 4NBTA 4YCSA 2FPWA 4QBGB 2RC6A 4G5HA 3GUYA 5LB4A 2ERCA 2XAUA 1YZUA 1CHDA 2WAAA 5BXYA 5C1OA 1CUWA 3HKCB 1N6OA 1U3FA 1IEWA 2GJ9A 1YUBA 4PQRA 5SYAA 13PKA 1OHHA 1OFTA 1GQOA 3MRXA 5BOSA 1S8AA 5COAA 1UJNA 1JWLA 2K6GA 1SRRA 4MYRA 4YIHA 4UM5A 3WBJA 1NW3A 4KTVE 1YFLA 4J8PA 4J1TC 1M2OA 3DBOB 2Z8YM 1WDTA 2V5VA 1GTMA 2ZKLA 3M4ZA 4CWAA 4DM4A 4Z4GA 1GUAA 2KMLA 1WQ4A 3BDAA 4W8OA 3F73A 1XZDA 4FYJA 5TF4A 1NW9B 1B6RA 4QREA 4XUCA 3RNLA 3SU8A 3TD2A 6Q21A 5HQTA 3ELWA 1WZCA 4XVHA 1UK7A 1JEEA 3Q3VA 2VSNA 4CRWB 1U8XX 1MXFA 3F9IA 4PNEA 2Q45A 4D9BA 1X15A 2R8XA 1YDFA 4IIFA 1OBCA 1Z5PA 3OBIA 5EYPB 3R7SA 2CUTA 4A82A 5L45A 2MSKA 4GM4A 2HMWA 5HZHA 1HOXA 2V9ZA 3Q8KA 1UIRA 4QPCA 5A7FA 5F2NA 5LIRA 3DEKA 5K8VA 3TOVA 1T2FA 3GLSA 1FBNA 1EWRA 3KB8A 4MKHA 4DMGA 2OBLA 4L16A 4LVOA 3H4TA 4OB6A 1UXGA 1XK6A 3CEMA 3DFKA 3OTWA 2PL5A 2ZB4A 4H7KA 4IH1A 4IOLA 1V39A 1U2EA 2AOWA 4PV7A 3D54D 4R4JA 4D8YA 2CV2A 4XPIB 1JDSA 1TTHA 3HUTA 2HTFA 4S0ZA 4IIGA 2M6KA 4L0QA 4P32A 3IKLA 5CFLA 2WV7A 5L4NA 1KK1A 4Q4LA 2BEVB 2ZU6A 3VXKA 4A8JB 5JAMA 1ZXLA 2BR5A 1EP3B 2M98A 1YOBA 2ZJOA 1U0SY 2ZBDA 3TBKA 3IQXA 4A03A 4C87A 1LBEA 2M1ZA 1MQ9A 1Y9ZA 4G85A 4U2BA 5DNUA 4RTSA 2O7RA 3LHIA 1ESDA 3EVEA 4NONA 4D3YA 1DV2A 1P1CA 5F1KA 4GXTA 3E1GA 1MEJA 4YRJA 1C50A 2GK4A 2VQ3A 4BE9A 1T2NA 5IKOA 5ELLA 5B3LA 3SYNA 2Y9MB 3V4ZA 5L3QB 3AF6A 2A67A 1NLFA 2CN1A 3C5WP 5J4KA 4DKXA 2QZ9A 4P7BA 4P3NA 2AMYA 3GIDA 4YDSA 3HBLA 4Z49A 4NBSA 1HFEL 3E3LA 3DTVA 2FG7C 3R5JA 3LUPA 4JASB 4WGFA 3RUPA 4CBVA 5C4MA 7ABPA 3TKLA 5FWXB 4F97A 3G8AA 4H59A 2IYEA 2MJLA 5EKUA 2P5UA 3GJTA 1RAEA 4BY9E 1Y5MA 2W00A 1VE5A 2VSQA 3ECAA 1DT3A 2ZBPA 5IKEA 5IYZA 1K9VF 1CU1A 4TL7A 1QUEA 4E1BA 2OA0A 3PB3A 1TVEA 2JFPA 4P0PB 3GLVA 4DR4B 1SURA 2HDOA 3A2NA 3P9KA 4FDUA 3CJQA 3O8RA 2O8DA 1G98A 4B6PA 1FXWA 3MNFA 3THSA 1FXUA 1GTJ1 1E8MA 4ZAWA 3Q10A 2G4LA 4KYVA 5HUJA 1E3LA 4ZU3A 5IJAA 4L27A 4ZOLB 1N8NA 5A0VA 1JG6A 1G5QA 1UR5A 2QG4A 4HFNA 2ZRBA 1BXGB 3IMEA 4Q4JA 4ID9A 4DLSA 3BD7A 2GCOA 3NWEA 3OCYA 3WDSA 4Z4EA 2O8CA 1E58A 4NV3A 4HGYA 2YV2A 1CZOA 2NN3C 4M7WA 4C76A 5BN4A 1DLJA 1JJ7A 2WT8A 1PFUA 2KM1A 3EIUA 3FDZA 3IILA 4KIWA 1Z6PA 1ZX1A 3K9HA 3R0IA 4KMRA 1U4OA 4LV8B 3RR2A 1OTXA 2WWVD 5BPHA 2KB0A 3AETA 2W8BB 3FOCA 1IJFA 1PGQA 3GPIA 3PNQA 1KJ9A 1BE1A 1DFGA 1Q95A 3C1UA 1N8KA 1NBME 3KUXA 2OCIA 4N0QA 5JVDB 4DDKA 1E79A 1JE0A 2P2DA 4L4ZA 1BJRE 3AUXA 2E6UX 3SC3A 3TQHA 4ARVA 2IU6A 3AC0A 4C0QC 4G0VA 1R5JA 1T1IA 3AR3A 2IZ0A 3BWYA 3LCRA 4JYBA 3LLUA 3QLTA 3VKFA 3BZUA 1T9CA 4ILKA 4YAKA 3Q8LA 2QT1A 4PX9A 2IIQA 3IT0A 3RYFB 4ZI2A 1NQUA 5K9ZA 3EEOA 4H2DA 5C7LO 1XXHA 1VBKA 1N7GA 2X0JA 3K1YA 3O8DA 5H9VA 1NMQA 3OC0A 3AI2A 3DDSA 5E6SB 2XYPA 1LK7A 1RRPA 3BK7A 4OH7A 3YASA 4DLZA 4Q9AA 1VP3A 3MTDA 2RKBA 3GZNA 2C1XA 4EYGA 2CLFB 4KR2A 4O4IA 5L7WA 1W0JA 5AVQA 2OFOA 4IXMA 1G7TA 2GLXA 2C78A 3QVVA 2NO9A 3IEVA 5J43A 2BGKA 2QX9A 2B4YA 4JOCA 5ALKA 3TI9A 3PPIA 4EO4A 1N5RA 3ISTA 5AW2A 3IPLA 4B9EA 1X9HA 3UTCA 1VLHA 1ZITA 3DO8A 1HZZA 3VTFA 1LPAB 1Q6YA 3QUBA 5AHWA 3K6SB 2XDQB 3FPHA 4GMHA 3W9SA 2XODA 2XBLA 2R68A 5ALJA 3EXHC 4AT1A 1ULHA 3T3OA 3GO4A 2V96A 2WJ3A 1GA4A 3A6HA 4RYDA 4B85A 4F3TA 2KS6A 1UMDA 3TFWA 3I61A 3HPQA 1TB4A 1UM9A 1UOQA 4N5HX 3OOWA 3EVBA 4MRSA 4O4JB 2HK7A 3DAGA 1C9DB 3W79A 4Q47A 1CJMA 3QVSA 3MCTA 2FPRA 3IXMA 2BEUA 2CFRA 2G7ZA 4L0CA 4OHCA 1WG8A 3NR2A 1GXSA 1O6GA 3FKJA 4KEAA 4GYKA 2CSXA 5CB8A 4LIPD 1NOKA 3RSLA 3B53X 4S1VA 5D84A 4J16A 2RHGB 1G6KA 3HLYA 3R3WA 3ZK9A 1FNDA 1V3QE 2G77B 1Q0UA 3HUUA 3GRCA 3I01A 4GOND 3R0VA 4J7CA 4UJ3A 3I45A 1JG2A 2VPZA 2H5EA 3NDIA 4QHYA 5CX1B 3VH3A 1E2BA 4RX1A 1GG2A 1Y7TA 4J7AA 3TZHA 3LDGA 4BFSA 4EVRA 4QGGA 4FOPA 4AKTA 3EC2A 4HGRA 3WIBA 4YH1A 5FPQA 1N5IA 3QVOA 3P2KA 1L3BA 4WOKA 1W5FA 5TS2A 2WYVA 5DSZA 2A3NA 3TAUA 1HE8B 1PJSA 1QFMA 1NASA 2DTEA 2IY9A 3JRWA 5EXSA 5I4CA 3ENVA 3WLMA 4OD0A 2OV4A 2VF8A 4OBXA 1CR6A 1H0HA 3E9ZA 4QYIA 4Y2QA 1XZEA 4FONA 5EJIA 1WHSA 3RU2A 1I4EB 3QX8A 2CLHB 4PLHA 1UKVY 4FTWA 5L7YA 2ACVA 1PO7A 5C8YF 1JUDA 1X42A 4GI2A 2A1UB 2CLSA 1V95A 1JH8A 3HCFA 2AHOA 4JBLA 5HR5A 1IK6A 4MGHA 5BQOA 1H85A 1RI3A 4DBLC 2KE5A 3PA6A 3V2UA 2R1ZA 3EISA 4WCFB 1JQEA 1LK0A 4G1MB 3H2HA 1V1RA 3RSQA 5DGTA 1V11B 3JR3A 4GL2A 1M1YB 1NLUA 2O1SA 2IXFA 4F2PA 2XRZA 3UQYS 4R41A 2ZROA 2CD7A 3HI6A 1ZJYA 1GQRA 1THGA 1OW3B 2IBMA 4I4LA 2LVBA 3IIJA 4C89A 4D2IA 4B6SA 4EW2A 4UE6A 5IJ0A 1X74A 3R4CA 1RYDA 4BO9A 4I50B 4J2HA 4Q21A 3TL3A 4UW9A 1KKMA 2NXJA 3JSXA 5EZYA 3GRUA 4DT1A 1KR5A 1PQUA 4AF8A 4MWGA 4ZV9A 2OG1A 1JHPA 2P41A 3E6AA 1WY5A 3L7CA 5L40A 3TYXA 1E7QA 1CUXA 1D0SA 1HRKA 1Q1QA 1VHTA 4ZI7F 4AMZA 1SG9A 4K5QA 1VKZA 4AFNA 4RORA 5FWNA 5BN3B 5BVHB 5JSUA 4FLEA 5E7IA 5AW1A 1TYDE 2OSVA 3KTOA 5F35A 4DARA 1NWCA 1B8PA 2WLTA 3IAUA 2DY0A 2F8TA 5BSUA 3ZLTA 1CEEA 3ZGXA 2B4QA 3ZI7A 2OZVA 3BMNB 1KL7A 3W8DA 1P29A 3W2HA 1JIIA 2J59A 2X6RA 1TF7A 5AK3A 5HE8A 2D3TA 3FNIA 4OQYA 3UMSA 1P3Y1 3ZGLA 2YWXA 4DC9A 3BL6A 3A3OA 3AY7A 2C4MA 3GOQA 4AZ0A 5DWVA 1GDHA 1HE5A 5A2GA 2GVDC 5EZQA 1BS9A 1T9AA 2GPSA 3MERA 4OJNA 2X1LA 3UQZA 1NKSA 1F2UA 3BPSA 2V03A 2WMNB 4DNOA 2HSWA 2OXRA 1T3HA 1YZHA 3W8RA 4D9NA 4LE1A 3L82B 5ESRA 2GX6A 3RHZA 1BN7A 4M0CA 1CY1A 4BWGA 4D0SA 3JATA 3TIFA 1S7GA 2RGGA 4BP3A 4KUHA 1YQQA 2HOQA 1Y9EA 4BVEA 1W35A 1V35A 2WT4A 2ZS9A 3I12A 4Q7MB 3QQ5A 2P30A 3K94A 2DUMA 4A26A 4JSTA 2IEBA 1J97A 4RZSA 1G5HA 1XNJA 2CXXA 4MW6A 4UHHA 5I6DA 2EHDA 5LLDA 1ZH4A 4OB7A 4WNYA 5HF8A 1KZ9A 3ORYA 3R9WA 4KXYA 3MWKA 4W6ZA 5KYVA 3TK1A 5EPOA 3BH6A 4MVJD 1EGMB 4OSEA 3C3XA 2XWSA 1G8FA 3RUAA 3D4PA 1X2BA 1A76A 2GNPA 3IT3A 2OB2A 3K0FB 3WNDA 5JCPA 2WJJA 4KXXA 1AHIA 3MBKA 4P3YA 4DY4A 2NNLD 2PKXA 1XE3A 2QY6A 2Z3WA 5FO1A 4XVCA 3HYTA 1TJPB 3FGOA 2WJWA 3OIVA 2R6CA 3QJGA 2J9FB 4YTEA 1D6NA 3BWDD 2HGZA 2V1UA 5K3FB 5LC1A 1T2EA 1VDZA 3T7RA 2OHOA 4NH4A 4Q7LA 1O8CA 1VSUA 1GOTA 4NZ9A 2OGZA 3NIWA 4YUZA 1G3MA 3SC2A 3TSZA 1L7OA 4ZYXA 4TMVA 2WP0A 1RQ7A 3MBOA 4Q39A