2W2XA

Complex of rac2 and plcg2 spph domain
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
177
structure length
177
Chain Sequence
SQAIKCVVVGDVAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLRDDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein/hydrolase
molecule keywords RAS-RELATED C3 BOTULINUM TOXIN SUBSTRATE 2
publication title Structural Insights Into Formation of an Active Signaling Complex between Rac and Phospholipase C Gamma 2.
pubmed doi rcsb
source organism Homo sapiens
total genus 59
structure length 177
sequence length 177
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2w2xA00
3KKQA 2VHCA 3EAQA 4RSGA 4R2HA 1KAGA 2REBA 1JECA 3R8CA 3ADCA 2EYUA 3PEUA 2ODBA 4PSVA 2GDJA 1T8TA 1XMJA 1R5OA 2JIZA 2WM9B 4DWJA 1II0A 4NYIR 1G18A 3UG6A 4BFXA 4UJ3A 5EJEA 2H1LA 1BMFA 3HDTA 4JT4A 4NCNA 1P9WA 1G41A 2HCJB 4BASA 2VP6A 4CT4B 3PJRA 1AA9A 3LX8A 4D0NA 4LBWA 1JXMA 5DN6D 4CRWB 1ZU4A 4Z51A 4JSYA 3AVOA 4KODA 3H1TA 3K9LA 2XTZA 4QBGB 1KY3A 5FFMA 3C5CA 5EXPA 3DPUA 3MWKA 3C7KA 2BHRA 4MUAA 1S9DA 2QQEA 5HPYB 4E22A 4G5RA 3CZQA 2WJHA 2G88A 4DZZA 4I81A 3TR5A 1CBUA 4B3FX 1NF3A 4EPWA 2AKAB 1Y3AA 3I5XA 1MO4A 3U44A 6Q21A 4MDFA 2QTFA 1KKMA 2EW1A 4Q4HB 3IIJA 4R71A 5TXGA 1HT1E 2QRZA 4AD8A 2ZYVX 1CTQA 3PEVA 4HB3A 4ARZA 1UF9A 1OH5A 3CO5A 3CNOA 3ND8A 4P4SB 4RD4A 3C4JA 1ZINA 1ANKA 1U9IA 2Z83A 4A15A 4C7OA 4HAYA 2RH5A 5HKKD 1R2QA 1WA5A 1OE0A 2V55B 4PC6A 3RAPR 5B30A 1CRQA 2CCGA 4PAOA 3RS3A 1QHHB 4C0LA 1PZNA 3KQUA 1DOAA 3THYA 2GZDA 2CDNA 1IAQA 1YZUA 4URWR 2NPFA 5J40A 3TNFA 4DDVA 1WP9A 2H8KA 3BH6A 1P7CA 2BVNA 4PHHA 3G5UA 1N6RA 2ZYUX 4NYIQ 4ILEA 4IDNA 4NHOA 4ZKDA 1KMHB 3K09A 4FI3C 5GVRA 1B23P 2R8RA 4KI0A 3SU8A 5FBWB 4A6PA 2AXNA 5CJPA 3QJYA 5GJBA 4RY2A 3DOFA 2FMXA 3EIQA 2BDTA 2O8CA 2F1HA 1G17A 3FGNA 2RGXA 4ZO4A 4BEJA 2YKGA 5LD2C 1KKLA 2WSMA 4BLPA 2BMDA 2RGGA 4V03A 2ZUBA 1FNNA 1I2DA 3JVUA 3LRPA 4BQSA 3CH4B 1JQJC 3D7MA 4M9QA 2REXB 4DC9A 1FUKA 3AH8A 1XTSA 1X8JA 4HZUB 5AJVB 5KTYA 1UKZA 3L0OA 4TT3D 2F1RA 5BWMA 2CL6X 5KUTA 2D2FA 3SE0A 3WXMA 3RC3A 4PPNA 4GP7A 2GBLA 3AVQA 3ND9A 3MAAC 4A2QA 4DLYA 1UKYA 3RVBA 1JAHA 4IDPA 2J5XA 4Q01A 2PBRA 2A3RA 3DKPA 2JAQA 4LJ5A 5DE3A 1K6MA 4QGGA 3UANA 4PFSA 4B3GA 2O8EB 2P67A 3ZJYA 4XIGS 3RANA 3ZQ6A 4UNPA 1KSGA 2X8AA 2ZRHA 1T8UA 1GRQA 1JR3E 1XD8A 2B7BA 3G82C 2JLVA 1V5WA 3NTUA 5FTNA 3NIBA 1ZYUA 3RRNA 4DIEA 3GLHA 2PEYA 3VHLB 1XNJA 5FOVA 4V0LA 4TMZA 2WIBA 1XDBA 4PHTA 2DCUA 1LW7A 2QY9A 4YMVA 3KFVA 1RC8A 4YDHB 3VMFA 1E2NA 3P32A 2QSYA 4NBSA 4JLPA 3VX3A 4FINA 4JLKA 1S8FA 2YWFA 4QGFA 1KK3A 1KK1A 3QUSA 4NONA 1GTVA 2YVUA 3SJZA 4ZIRB 2I4IA 3E70C 2GWHA 2RGAA 2IT1A 3A36A 2ZITA 3T1QA 1ZW6A 1G4AE 4M4SA 1PUJA 1AQYA 1KZGB 1XXHA 1KJWA 2ZVPX 1KI7A 3CRQA 3EA5A 3C15C 4MRRA 1GKIA 3LBNA 4WBSA 3IQWA 2VBCA 3VR6A 1SKYE 1YZNA 8OHMA 1XTJA 821PA 4X8HA 3EX7C 4DCNA 3V9PA 1AIPA 4CT5A 2X2FA 4LJ9A 3K0AA 4JVLA 1DELA 2YOHA 3WNDA 2H57A 4C0QC 1UKVY 1I4LD 4D25A 4V0OA 3BOSA 2IYWA 2CL7X 4Q9JA 1OT3A 1BIFA 1GRRA 3LBHA 1TMKA 2CEAA 3O8BA 1Z29A 4DSTA 3B85A 5H68A 3CX8A 3KKNA 4M21A 4AG6A 3IEVA 2OG2A 1Z2CA 3KX2A 1IJEA 1S2MA 1MOZA 1NLZA 3FFBA 4MKHA 1L2TA 1WXQA 3BH0A 4F4IA 4EDHA 4IOLA 3UMSA 2VPPA 4B34A 1ZCAA 2WJJA 3OE7D 1XTKA 2FPMA 1Q3HA 1SVLA 2GK7A 4Z1MD 3KFXA 2LKDA 3IGFA 2G0TA 1G5PA 3GQBA 3K0CC 3QPUA 5DH9A 3ZS9A 3I62A 1T6NA 1SVWA 2FFAA 1L8QA 2QGNA 4W5JA 5IF9A 4QM6A 1NKTA 1ZNYA 1E0AA 1VIYA 2VF7A 1OXVA 3IIMA 2PLRA 2VIIA 2XNDD 2B6HA 4LWZA 4WZ6A 3GLFA 2ZYTX 3I8SA 2ZAMA 3IHWA 4JLVA 4HYYA 4YONB 3PXGA 3RSOA 3WYFA 4TZ6A 3ETLA 3IILA 1GG2A 5B57C 2ZPTX 1UM8A 4US1R 5HKKA 1G16A 1KOFA 2FU5C 4B43A 2C77A 4FXPA 2N42A 5H1YA 4RFSA 2HJGA 2QMUA 3PUYA 2BC9A 4FIDA 5GJWC 1N0UA 1SULA 3DM5A 4HLQB 4LV6A 3GJ6A 2HYIC 2DR3A 3X1DA 3K70B 2NO0A 4XWOA 2QP3A 2OCAA 5J4VA 3K0FB 1ZC3A 1KNQA 5DI9A 2B21A 4D4MA 4KFUA 4TLBA 4PO9A 3IIKA 3T1OA 2WKQA 2E87A 2IS6A 2P2LA 4D81A 5B58C 2Q3HA 4YQFA 1JR3D 3CH5A 2BJWA 5DSZA 4DCSA 2EFHB 4KFTA 5KNDA 3TK1A 4NKRA 4FMCF 3EZ9A 4U7DA 4M1OA 3C5HA 5L3SA 1E1QD 3RC8A 4ZKEA 1OXUA 2JGNA 2IYLD 1CEEA 3ICEA 4RD6A 4AYWA 3S1AA 3VR2A 2J7PD 4ZIRA 1KY2A 1QHNA 3BERA 2DY1A 4TT3A 4C0BA 1VYVA 5FOSA 2C95A 4QJ4A 1OFTA 1TUIA 5HE9A 3ZDQA 5EP2A 3W8NA 3T06B 4OYHA 2QNRA 3B2EA 3K8YA 1AS2A 2IS1A 3TIFA 2LCFA 5JWHA 2KB0A 3IUYA 4TMVA 1CULC 3L0PA 4DT1B 2C04A 3I73A 2ONKA 1HUQA 1W4CA 5EXTA 5JHHB 3BC1A 4CEHA 1GWNA 1ZNWA 1NNEA 1SHKA 1W0KD 2D7DA 1DPFA 5TVKA 2CE7A 5JBQA 4US2R 3THXA 1NL3A 4GL2A 1E32A 1OXSC 1SXJE 3IEUA 4B76A 3M6AA 5G3ZA 3U60B 3DM9B 2IC5A 4AY2A 2WVJA 5IDVA 3U4QB 2IS4A 2IA5A 2Z4SA 3GFTA 5DIFA 1K5DA 3B1XA 2RGBA 2WAXA 5AJXA 3ADDA 3ZZ0A 2XSZD 3O8CA 2W6ID 5FTMA 2N46A 4ESVA 3NBZC 4MDEA 3AP3A 3VR4A 1XPRA 3RABA 2GXUA 1JPJA 5JI2E 3FOZA 3LVRE 1JAIA 2OUKA 2YC4C 4IOJA 3PEWA 2G1JA 3CLVA 3N2IA 3EIHA 3LBIA 1XD2A 2FG5A 2CMKA 4MKGA 1JR6A 1P9RA 1MO6A 3MSXA 3Q7PA 2V9PA 4KSBA 1QVAA 1M6NA 3QXXA 3WYAA 1G7TA 1M8PA 3X1YA 4OHXA 1OJLA 4R2IA 3W6PA 1G19A 1N5KA 3TR0A 4BFZA 4FMBB 4IFBA 1E2MA 2H5EA 1S3GA 1JXOA 1VYUA 4HUQA 4LV8B 1OPXA 1XPUA 3NC1C 4LBVA 4OHVA 2BEKA 5DYIA 2F55A 2PZEA 2OO7A 2XX3A 4QXAA 3T12A 3GJ0A 3ZD7A 3VKGA 5CK5A 2CCJA 4WW0A 1MV5A 5FBQB 3THWA 2B92A 4H1UA 1E0JA 2PX0A 4V0KA 1SQ5A 3CKLA 3MUFA 5G40A 4L16A 4W9MC 1YKSA 3KUCA 3NH6A 3K0CA 1IN4A 1LY1A 3UG7A 3SYNA 4B6EA 5BW8A 4QC2A 5KYKA 2QPOA 2REOA 1E2GA 2WWGA 2AWNA 5AR1A 4RFVA 2DFKB 4M9XA 4AKHA 2FGKA 2YV5A 2GXAA 3BFXA 3CX6A 2GNOA 4LV5B 3OE7A 4B73A 4CEIB 2V54A 4Z1MA 3QEOA 1RVDA 2HUPA 3GMTA 3QKUA 4LJYA 4JIMA 4B6FA 1FMJA 1F48A 2P65A 1W36C 3JZAA 2HEIA 5EP3A 1KNXA 4GT1A 2VYFA 1UEIA 2ZSBA 1ZBDA 4HAVA 4AIIA 3PVSA 4MQBA 4A1FA 3AVYA 4DLUA 2OFOA 1J8YF 1XEXA 1Q57A 2ORVA 2XNDA 4K81B 3AKCA 3TW4A 2D2EA 2ZRDA 1OH7A 3BFVA 1QZXA 3R7WB 3PITA 4BFTA 4I1SA 5JCPA 1ESNA 1T3SA 4N3NA 1G291 1NSFA 4KITB 1NN3A 3HWSA 4RCZA 1J70A 3B1VA 5J4LA 1E3MA 3EARA 1CR1A 3BH7A 4UJ5A 3QIAA 3BORA 2WKPA 1IY0A 3CRVA 4NH0A 5AUPB 5C1BA 1GAJA 4Q21A 4JKYA 4LYAA 1G3IA 4PTLA 2CHQA 2V4ZA 3EASA 2KBEA 4KCGA 1AK2A 1GL7A 1VYTA 3HU1A 3W3ZB 2XOKA 4C30A 2XGJA 3NVAA 1KI6A 2YOFA 4F4CA 3NDPA 4AKIA 5K8TA 2CLDX 4GZLA 4W5HA 3AKDA 2P6UA 3KJIA 4DSOA 5LBIA 5J47A 1JR3A 3GJ3A 1IQPA 1DBSA 3OIYA 2GXSA 3GJ4A 4O2RA 3N2EA 4Q9HA 3VU9A 4I1VA 1I4TD 4MKIA 4TMXA 4R7ZA 1UBEA 1KJYA 5FPHA 1DG1G 3LQQA 2WICA 4QKQA 1E1QA 3KJHA 1AKYA 3P4YA 4TQ9A 3VR1A 3FE2A 2JDID 2CXXA 4OHWA 2J7PA 1II8B 4GRAA 1NMZA 5IT5A 2ZJ5A 2ZRFA 4BZPA 3JZMA 4QL3A 2OHFA 1SXJC 4TN1A 1CIPA 2ZI4A 1FFHA 1W5TA 3LV8A 3W9YA 5KNBA 1N6LA 2GESA 4PX9A 1UBCA 3GJ5A 4CGZA 2WWYA 5JMTA 3RS0A 3PG5A 1E6CA 4G5SA 2CK3D 2O0KA 4YMSA 1HE8B 3L2OB 1WBBA 3CWZA 3ZH9B 1W0KA 4KVGA 4M1TA 4XH9B 4JJKA 3NC0C 2FPLA 1FL9A 1PV4A 1G20E 1GUAA 2MMGA 1O87A 4PQYA 1U2RA 5A0FA 3KJEA 1KDPA 1DS6A 2Y8EA 1RKBA 2DWPA 3BB4A 3QG5A 5FOWA 3F3YA 3DZDA 4D4LA 5IK2D 3AKEA 1QF9A 3QKRA 2P3SA 3FMIA 2W6JD 2WWWA 3KTAB 2XSZA 2EWVA 1ZM7A 2W6IA 2VLIA 3NXSA 4ZCMA 2AX4A 3CF2A 2WOOA 3LQRA 1WQ1R 3ONWA 4N0EA 1ELOA 1Z0IA 2A5JA 3TE6A 4CDGA 3MLEA 3W5IA 1GIAA 4JLNA 1QDEA 3TJZA 4R9UC 3ZIAD 4C0SA 3GLFE 1P73A 2C78A 2OBLA 1KMQA 3D3QA 3CWQA 2ZRPA 1FQJA 4Q4JB 2JLZA 5EUMA 2RGDA 3B78A 3TMKA 5FR1A 4G5QA 2UZIR 1P2VA 2QZ4A 3BBPA 1CJTC 4XVUA 2CVHA 1XB2A 1EXMA 4BPBA 2C8VA 4LJAA 4URVR 4JLOA 2IF2A 4M9ZA 3X2SA 5L3VA 1A5TA 2VSFA 1R0ZA 1Z6YA 1Z28A 2BV3A 1W49A 4B3CA 5DI3A 2O8FA 1KHTA 1U8YA 3NH9A 4NZYA 4RD2A 4Q9KA 2OEPA 4B2IA 4B48A 4DLVA 3AVUA 4C9BA 3QBVA 2ZJ8A 3B60A 3EZ6A 2J59A 2WZQA 5C46F 3SS8A 4DIDA 3QF4B 5JFGA 1DAKA 3WMEA 4M0LA 1X6VA 1ZNXA 1ZM3A 4GOXA 2CNWD 1VPLA 2K5UA 1K8RA 2GCOB 2IXFA 3BE4A 4B71A 4CF7A 2JA1A 4QJ5A 4WXRA 5EZ6B 1MABA 2MMCA 3QENA 2O8DB 3WHLA 4MKFA 5D3MB 4QNMA 3LLUA 2ERXA 4KBGA 3ZS8A 1RIFA 4QBFA 4DDUA 1D8TA 3A1UA 2WKRA 1LV7A 3U3MA 3QKSA 4HAUA 4D4KA 3KQLA 3ZZTA 2KWIA 1YVDA 1Z08A 3KL4A 4NCKA 1TEXA 1X1RA 4ITRC 1QHSA 2QAJA 2QN6A 5IHPA 3B9PA 2VA8A 4JVNA 3X1WA 2AFIE 4PSKA 1FUUA 2EFDB 4XWAA 4ABYA 4BLOA 4MUBA 4Q19A 2FZLA 4Q4AB 2KSQA 3BS4A 4KU4A 4PXAA 3BAFA 4LHZA 2R6DA 2ZSEA 2E9SA 3LLMA 3R9XA 4QFMA 1TEVA 4DKXA 3TSZA 2CVFA 3PQCA 2QP4A 3HPRA 5KDDA 4MGYR 2FJUA 2ODEA 2UKDA 1KZ7B 4MRVA 4B44A 4NCJA 1SVIA 5JS8A 1MRNA 4EJSB 4LBZA 2VP5A 2GCNA 4C0HA 3LDAA 5FTLA 5FUWA 5JSZA 4KAXA 4B3BA 4I99A 3W5JA 4NL4H 2JASA 1G8YA 2CE2X 1DAIA 1OXTA 2RCNA 1SXJA 1DE0A 2IUUA 1JB1A 2WPDD 2ZUCA 1OF1A 3BXZA 4UXIA 2AXPA 4OBEA 1FTSA 2JDIA 2W83A 4Q1BA 4TMWA 4EIWA 1BYIA 1PLLA 1PUIA 4TLAA 2YWEA 3Q85A 4WZAE 3BB1A 2ODNA 4B33A 3TQCA 3FB4A 1QG4A 4IXMA 1VTKA 3TUJC 1F2UA 2Z6VA 2IWRA 5AJWA 2HV8A 2J0QA 3SYLA 1DAMA 1JBKA 2ZU0C 2J1LA 1TF5A 4N1AA 3CR8A 1FZQA 4FD2A 1I2MA 1EESA 2R2AA 2KBFA 3VQTA 1P75A 3CRW1 3HJNA 1A2BA 2CK3A 3CPHA 3GLIE 4ZDIA 2A5YB 1Z07A 2C9OA 3KUDA 4A8JB 2IYXA 3I5YA 5EE1A 4BFWA 2V8OA 4JSTA 4M1YA 4C0AC 1FP7A 1MH1A 3A4MA 3KJGA 1UFQA 3AEZA 2NMVA 3QY0A 5FPYA 3SOPA 5FUXA 3O8RA 2OCBA 2V1XA 1GOTA 3FHTA 4L8GA 2E1RA 5IK2A 4QBHA 1QHXA 5EQTA 4MYUA 2VHTA 4BUJA 2W6JA 3OIWA 5AJZA 3BRWD 1NG1A 1ODFA 1HQYE 1KI1A 3VR5A 3GCGA 5JCZA 4IDHA 5BYKA 1P2UA 1XP8A 1M7GA 2CHVA 2IHYA 3T34A 3GJ7A 5KO2A 1E2LA 1TUEA 4D0LB 3QKTA 1BKDR 2H92A 3U7HB 3ZIAA 1XTQA 1EG7A 1I4DD 3GP8A 2ZS8A 2W2TA 2AK3A 4PANA 3H2YA 1W7AA 2JJ1D 5LB4A 4KHZA 1GL9B 3TBKA 4MITA 4ERNA 4XTCS 1G3QA 4ARZB 2BKEA 4RD0A 3EPKA 3GJXC 4Q7LA 3DVLA 3UWKA 1Q1QA 2ZJ2A 2YZ2A 5FUYA 3R9IA 5K8IA 1N5LA 2HJVA 4QHYA 4C7OB 1E9FA 3NHBA 2XEXA 4DLXA 1EFTA 1NG9A 1CXZA 5D3QA 3K0EA 3AQ4A 4OK6A 4RD3A 2PX3A 2OZEA 2BCGY 4HI0E 1D2EA 4LHYA 4TQAA 1LS6A 1E2KA 4EFLA 3THYB 3SBEA 1TPZA 3OEED 3VX4A 3FDIA 2MSEB 3QXHA 5C4MA 1NP6A 4DB4A 2A5GA 2IW3A 5ELXA 4HZIA 4M53A 4NYJR 1JJVA 1RJ9A 4U00A 1NJGA 4OQLA 4JLBA 5AJYA 5KSPA 3WYGA 3QXJA 2CNWA 1E94E 5LPNA 1UBGA 4M1KA 1OIWA 1HH4A 1OSNA 2P5SA 1TF2A 1G3MA 4URXR 2VSOA 4Q03A 4TL7A 2O8CB 3I1FA 4LPKA 4QOSA 3CRRA 5SZIA 4M9SA 1Z5ZA 4RZXA 4OK5A 4AK9A 1E2DA 1DARA 4MRNA 1TQ2A 1Q3TA 2FSFA 4OQFA 4RVCA 2XZPA 4UXHA 2ZTSA 3HR8A 3SHFA 1XJQA 2ERYA 5CM9C 3DO6A 4LHXA 4ZPXA 1U98A 4AI6A 1GSIA 1E2PA 4HDQB 2O0JA 4LHVA 3PUXA 4NDZA 3K9GA 1VG8A 2DYKA 3UXMA 4LYJA 3TAUA 2QM7A 2IBMA 3RS7A 5EXSA 2X77A 1TX4B 4LJ6A 5KSYA 1ZC4A 3A4NA 4BFSA 1K5GA 3NG1A 4IXNA 3EPHA 1W2GA 3I32A 3MRSA 3GLGA 4D6PA 1UAAA 4JL5A 3HR7A 1P3JA 4II7A 1TL7C 2OCYC 2VHJA 1N6KA 2O5VA 2BMFA 3EW9A 1YR6A 3FWYA 3GLHB 5JZVA 3RRZA 5EXXA 1BYUA 4GOJA 4Q48A 1GM5A 2FFHA 1ZRHA 4NYJQ 5FTJA 3K53A 1S3SA 4GMDA 2QP9X 2WPDA 1NVUQ 1E2JA 2I3BA 3N5CA 4HATA 4HEJA 4LJ8A 3KZ1E 5DN6A 4JYCA 1EWQA 2Q3FA 2QAGC 3TH5A 1E4YA 4URUR 2J3EA 3IDQA 1EX6A 4DCUA 1KK2A 4DLZA 1NIJA 2WTUA 5GADl 3WMFA 2YWHA 4MGIR 1G1MA 1NVVR 3EWSA 3QG1A 1VG1A 2J0VA 3ADKA 3P26A 5GJVC 2JLUA 4V02A 1R5BA 4MYHA 1XTRA 3REFA 4M1WA 4GOKA 3K0FA 4WOPA 3PCRB 3SFZA 2GEVA 2IUTA 4XOIA 5C2JB 1W1WA 3ZD6A 1XXHB 2YOGA 4A0GA 4TSFD 3LVQE 1XEWY 4Q9LA 3LAWA 1N3BA 1RW4A 2GJKA 4BLRA 2ZJYA 3RRYA 1RRGA 2B8WA 4UNQA 2WAYA 4KV9A 4OL0A 4NE2A 2PZGA 3SEAA 3AF4A 1X1SA 3CW2A 4S2EA 2HYDA 1M2OB 1G5RA 2OESA 3EPJA 3L0SA 4WXPA 3K0AB 2B7CA 3OESA 3T1VA 4MYTA 3BJIC 4G5OA 2Q3MA 1XMVA 2AKYA 5L3QA 3KDSE 4TMTA 2R6AA 1EX7A 3SBDA 1T5IA 2ZE5A 4GSYA 4EQ6A 4QJ3A 4OI4A 4HB2A 1XF9A 2QSZA 1N2CE 3VR3A 2IS2A 4EUNA 1E2FA 3RRMA 1X86B 1CJMA 1Z47A 3Q9LA 1IY1A 3MGCA 2BCJQ 3V00A 1CRPA 1EFRD 2WBLC 5CLQA 4GNKA 4JVSB 1W48A 3AVWA 2C99A 1E79D 4F7WA 3TLXA 4EPTA 1AGRA 4I1UA 3I8XA 3QPVA 3L8ZA 1PJRA 1FW6A 5JRJA 2J0SA 1ZP6A 2AR7A 2JJ1A 1NVVQ 1GRNA 4C0JA 2GF9A 3UMFA 4BRUA 1NRJB 1R4AA 3EC2A 3SZRA 1IN8A 1P9NA 2V1UA 3GLFB 2CJWA 5A4JA 5K8UA 1Z0JA 4FWIB 3ZZUA 2FSGA 3H4MA 4D0GA 5H8WA 1H8HD 2ZYWX 4O2LA 4QHSA 1SHZA 3EC1A 4DCTA 3O8DA 2ZSFA 2FPKA 1OYYA 3T35A 1OFHA 1EFHA 5TMPA 2WJIA 1DAGA 4RFSB 4D26A 2JLXA 5FBVB 3OEEA 2ZRKA 2Z5FA 4PO1A 2VF8A 3SNHA 1TF7A 3NBXX 4DBLC 2W00A 5LD2B 3X1ZA 3Q5DA 3W3AA 4CVNA 2QPTA 3B82A 4JBXA 3SFVA 3W34A 1E2HA 3EZFA 3L0IB 4URYR 3B9QA 3L82B 1KSHA 1A4RA 1CP2A 3A1VA 2GK6A 3CB4A 1G64A 2ZUDA 3G0HA 2DWQA 4B74A 4DLTA 3B5JA 1RRCA 3NBYC 3OEHD 1Z06A 4TMKA 4ZDKA 1VCIA 1OB5A 3BD9A 2RGCA 3KKOA 1HURA 4ZCIA 2VQSA 2GRJA 4Q66C 1ONBA 1NMXA 2AD1A 4OI2A 5EE3A 1R5NA 1HE1C 1VIAA 2HF9A 1DAFA 4DRZA 3KQHA 1GDDA 1ZD1A 3S1AB 1SGWA 2FN4A 2XXAA 1RZ3A 1GNPA 3A6PC 3M4YA 2VRWA 3TRFA 3U3RA 2QORA 3LNCA 1CR0A 1D9XA 2PJZA 3RWMB 1MRSA 4OHYA 5CK4A 3T61A 3NDBB 4DXAA 3QVVA 4OQXA 3ADBA 1NLFA 2PLFA 4LI0A 3P20A 5AUNB 2RKOA 4JYBA 5JWRA 3NHAA 2A5DA 5P21A 5KSOA 1IONA 1N5JA 1NLYA 1W2HA 4US0R 3DDCA 3E1SA 2EFGA 2CLCX 5FTKA 4ASUD 1A82A 2ZRNA 1Q20A 2QAGA 4CEHB 1G8FA 1Z63A 4TL9A 5FOXA 3AM1A 3Q72A 1XTIA 1KIMA 3FKSD 1XCMA 1CU1A 3AF2A 3THXB 1XPOA 3GLIA 4LK2A 2OFWA 1FPMA 5HZKA 1FNMA 1J8MF 1O3YA 2J41A 2RAPA 1PLJA 4TLDA 2YINC 3TUIC 4L9WA 2BBTA 1A1VA 1Z6TA 3C14C 4TYPA 3H0KA 3ECCA 3U2QA 5GVSA 1OV4A 1G5TA 2F6RA 4IKEA 4QG7A 1CJVC 3IO5A 3FHCB 5J4HA 5DGXA 1XZQA 1KO7A 2DPXA 3QOFA 3OF5A 3PIRA 1PLKA 1RYFA 2EVWX 2QE7D 4BFUA 1QHGA 1YZGA 1ZM4A 2BKUA 1N5IA 3C16C 1F6BA 1YR9A 2WSSD 1XD2B 1LTQA 1TTTA 1S96A 3ASZA 4RCYA 4WVFA 5FPKA 2OSBA 4JLAA 2J7KA 4KYIB 4ZDJA 5BN4A 4YXWD 4TSFA 3IPYA 3RS4A 1XMIA 5BQ5A 2JLSA 1TNDA 1KSJA 3MJHA 1QVRA 2HT6A 2YHSA 4HUQB 4O3MA 1P72A 2ZSDA 1E9DA 3D6TB 1MKYA 1Z6XA 2OILA 3TSOA 2N1BA 2QBYA 4HB0A 2GZHA 4FMDB 4DLWA 2GJSA 3ZGXA 3U61B 2GEDA 3BB3A 4DJTA 4P3YA 4RKFA 4FW9A 4C0KA 1D2MA 4IJMA 3THWB 2GVDC 1GITA 2FSIA 1GP2A 3A37A 4PQFA 5HCNA 2IWHA 3ZVMA 2AWOA 4MGKR 1W4BA 1J90A 1R8SA 3HU3A 4IFEA 3CX7A 1XCGB 2F9MA 1G8GA 1NBMD 2GCPA 3GFOA 4PC7A 2C98A 3LXXA 4A0RA 2R62A 3IO3A 2FA9A 2FEOA 4JVMA 1DO0A 1T3HA 4EFNA 1YE8A 4D80A 4OJKA 5AUQA 2EWWA 4NU0A 4P4UA 4ZI2A 5FI0B 3X1XA 1EFRA 1AS0A 4A92A 1S9HA 1Z6GA 3AF3A 3OAAD 4B2PA 1E79A 2Q21A 1RRFA 2VH5R 2PH1A 3GEEA 4PHFA 3WRYC 2G3YA 1Z6AA 1XBTA 1W44A 4XSGA 1V43A 4LX0A 1X8KA 2FGJA 4PPGA 1G6HA 3FYHA 4U02A 1XEXB 2QEQA 2XTMA 4A2PA 4EKDA 2HT1A 4HDOB 1G21E 2PEZA 4CEJA 1H8HA 3HYTA 1OFUX 3LD9A 1WMSA 3GLGE 2HCBA 4C2UA 2GILA 3A1WA 4UQOA 4GI7A 4KJZA 3NWJA 5CB6A 1BS1A 3DL0A 5KDOA 2FV8A 5DHFA 4JT2A 4HLCA 4Y0VA 2ANCA 4MA4A 2GJAA 1XRJA 4GP6A 5E3HA 4PC2A 1N6OA 4UNSA 1FX0A 3T5GA 3LWNA 1VCNA 4ESHA 4LC1A 1ESMA 3SI7A 1TQ6A 2PCLA 1BOFA 1KI6B 2BMEA 4Q4JA 2OXRA 1VCMA 1J2JA 2BM1A 2NO1A 3CM0A 2ZROA 2AHOA 4M8NE 3OEHA 1M7BA 2PMKA 1NY5A 2W2VA 3VU9B 1UDXA 3BK7A 4TTQA 3GPLA 1G8PA 1RYHA 4JMPA 2UVQA 2RGEA 2VHQA 3I3SR 1HV8A 1IN7A 4D82A 3O47A 2F9LA 2J9RA 3F8TA 2XB2A 2RMKA 2ZI9A 621PA 3DMDA 1MO5A 3VKHA 4W7SA 4MRSA 3P1JA 4DCVA 2R6GA 4GPTA 5FI1B 4DSUA 1CF4A 1KI8A 2GZAA 5E7JA 4B75A 2IUSA 3QXCA 2AN9A 4YLGA 5EUQB 4KBFA 1Q21A 4PSAA 1NN0A 3CNNA 1FTNA 5ANRB 3CZPA 2WMNB 4BLTA 4V0NA 4XD7D 2IXEA 3KQNA 3R20A 4Y0AA 2SHKA 5IRCD 4ASUA 1IJFA 3PENA 1YR8A 4HLUC 2R65A 4YMUA 2FX3A 2VP9A 2QPAA 3EZ2A 3BWDD 4XVRA 4JS0A 1CR4A 2O8DA 3FHOA 3GEHA 2R44A 2JCSA 4AG5A 4MH0R 5BN3A 1SKYB 2ZRIA 3FKSA 1Z22A 1JJ7A 5SZKB 1A2KC 2AFHE 3HP1A 4YDSA 3UIEA 1DEKA 2FDCA 1IOZA 2NIPA 4A0HA 4E5UA 5FBLB 3ZQJA 4ZV4A 2NTYC 4A36A 5EZ5A 4MGZR 4O0MA 1WDTA 2F43B 3QKRB 4IHQA 4JBYA 3CIOA 4QNRA 5DHAA 5J5CA 3WRXC 4PAMA 2J45A 4GZMA 2QT1A 1F2TA 5CLLA 4KO8A 3CUEF 4Z54A 3VTKA 1JNYA 1US8A 5FL3A 2QE7A 3U3JA 721PA 3A1TA 1R8QA 3SJAA 1KK0A 2WSSA 3T1TA 5TDHA 3CF0A 1E9EA 1NVXQ 3ZLJA 2Z4RA 1X3SA 4AYTA 4WA7A 1ZVQA 3QSYA 1DTSA 2FH5B 2ODWA 5FOTA 4EPYA 4PAQA 5DISB 3WP1B 4M1SA 4BECA 2XZLA 2BM0A 5UKDA 5BN5A 2IXGA 1GNRA 2R9VA 2ZI5A 1CJKC 2C2HA 3L43A 1SKQA 3NBFA 4IRUB 2ECKA 5F9FA 3W90A 4HDCA 5L3RA 3TGPA 3D8BA 2O52A 5TB5A 1XJCA 4Q02A 1WCV1 1G3UA 4QHTA 3QXSA 2J0UB 5K8LA 4GDFA 1T5LA 1Z0FA 2BWJA 1LS1A 1U90A 1L4YA 3CPJB 4M22A 1HY3A 4B3XA 4LC0A 2CCKA 4AKEA 4V0ME 3WBJA 1AZTA 1VDZA 2Q0HA 3AGPA 4BZQA 2O8BB 5DI3B 3V4RA 2O8FB 1VHLA 1W36B 3P4XA 5EE0A 3RHFA 1E0SA 4XSHA 1B0UA 4IOMA 4PQRA 1DAHA 2ZR9A 4Q4HA 1P2SA 1SVMA 5HE8A 4PPQA 2OM2A 2QL6A 3TVDA 2OE2A 1Z3IX 1AM4D 3LY5A 1VHTA 5SZJA 2ZI6A 2GAAA 3OAAA 4G5GA 2I1VB 4P4SA 4ACBA 4IW3B 2J46A 3LW8A 3J81k 1MABB 4LGMA 4JLMA 5LDDC 2IYZA 2PL3A 5JJIA 5J4KA 2ZRCA 1NJFA 3I61A 3FVQA 3RS2A 2JJ2D 4A8JA 2FE4A 3Q3JB 5KNCA 1AQUA 1QHHA 3FMFA 4H9GA 1HYQA 4PHGA 2ONJA 4FMDF 1T4GA 4J0QA 3QKSB 3OFND 2ZIAA 1CLUA 1BH2A 2MSDB 4NTZA 1Z0AA 1QG2A 1Z83A 4QGHA 3K70D 3IBGA 1QRAA 4LDJA 5AWFC 1L4UA 2W58A 3TKLA 4K46A 1J7KA 1U0LA 4CIDA 3U6KA 1KMHA 4LRWA 4NMMA 5TV2A 1IN5A 1AGPA 4KYUA 1E9AA 1N0VC 3A4LA 5CDFE 3PUZA 4Q7MB 1CS4C 3K70C 2BBWA 4D4JA 2A5FA 2ZRGA 1ZD8A 2QMOA 3M1IA 4RZ2A 3QE0A 1MO3A 2FNAA 1IXRC 1F60A 5E95A 4BRWA 1ZAKA 1TAGA 4HZUA 3W6OA 4FMCB 5JSZB 4FN5A 3VAAA 1NY6A 2WWFA 2GF0A 1KI3A 1N0WA 4QRHA 3PR1A 4Q1FA 1VMAA 1SXJB 3I4LA 3L8YA 5JLJA 3JVVA 5DO9A 4PC1A 2BBSA 4UNRA 1OIVA 4A6XA 5FPTA 3EIEA 5F3WB 3AV0B 2O8EA 1SVKA 3B1YA 3DEFA 4KFRA 3SR0A 1W0JD 2UZ3A 4HLUA 4P0TA 1NN5A 3WNBA 2GJ8A 2ZJAA 3CF6R 4JJZA 2ZM5A 1IXSB 3U44B 1R0WA 3OIUA 4DHEA 3Q7QA 1F2UB 3R9WA 4KSCA 4TL8A 2FZ4A 1Q0UA 4PO8A 2J87A 1EFUA 3IPXA 1IXZA 3FMOB 3WP0A 2NGRA 4XD7A 3BFKA 1P61B 1G7SA 1VKJA 2OXCA 2VSXA 1IBRA 1UDWA 3KQKA 2W0SA 4L4UA 1G8HA 1NIPA 1U0JA 3NEYA 1LF5A 4KLZA 2DBYA 2OFXA 2EU8A 2I1QA 3LA6A 1E96A 4POAA 1KDOA 1M74A 1D6JA 3QF7A 4DVGA 4C2TA 2VP4A 1E69A 1N6IA 2DHRA 1NN1A 2NZJA 1Z2AA 1QHYA 4O25A 2KJQA 4DDTA 2V6IA 4W5WA 2IYUA 3IKJA 1Z0KA 1XWIA 1LF0A 2CBZA 2IL1A 4TLCA 3RLFA 1Q1EA 4DLRA 4BZXA 3HU2A 5FL7D 1UBFA 1KAOA 2F3RA 3U5ZB 1FOEB 4A9AA 1ZUNB 5JJLA 4XWKA 3EXAA 3CBQA 4R98A 2H18A 1NKSA 2WV9A 2YYZA 2NG1A 4RZUA 2ATXA 2HXYA 1T0HB 1E9RA 2A30A 3B6EA 5CJ2A 3WHKA 2ZREA 1YU9A 2D7CA 2DFNA 3EWAA 3UWOA 4QM7A 1WB9A 1Z0DA 1YZQA 3I72A 2GETA 4DEYA 5GJCA 1ZJ6A 3U6BA 4RJLA 3RNLA 1T91A 1Q22A 2GVZC 2V6JA 4BFYA 1QBKC 2QU8A 4C4PA 1XEFA 3F0TA 2QTVB 1T9HA 2QENA 2VTKA 3DHWC 1E9CA 3KKPA 1UADA 1G7RA 2DWOA 2ZRMA 4JZKA 4OHZA 3UKDA 1BO6A 4LUCA 4TWZA 4G3XA 2EQBA 5HTKA 1JI0A 2RGNC 1GKUB 1ZNZA 4XTRA 1W47A 4S35A 2KI5A 1OLOA 2QG6A 1P6XA 5EP4A 1OHHD 3UK6A 1R6BX 2G77B 2GEUA 1FMLA 1UEJA 2H7VA 2AL7A 1W4AA 3SQWA 1AS3A 3FMPB 4Q18A 3RWOA 2P5TB 1UJ2A 3GD7A 2QMEA 4HB4A 4NCIA 4DEXA 2QQ0A 2YNMA 1KI9A 3LH5A 5BYJA 1RJ9B 1AJEA 5JHGB 2GKSA 4NP6A 2JLRA 3A1SA 3QI2A 3ASYA 1KI2A 2WJYA 3NKVA 2F3TA 4F93B 1XZPA 3Q5EA 2IYVA 3FTQA 2F1JA 4LYFA 1OH6A 1G9XA 4C3ZA 2BEJA 2JJ2A 4OI0A 3K1JA 1KDRA 3AUXA 3VHXA 4TYQA 1WE2A 3EZ7A 2ATVA 4LYHA 1C1YA 2ZS9A 5CYPA 4E07A 3OFNA 4URZR 2HDNB 4DLSA 2ZE7A 2QT0A 4TYYA 1E2EA 1KO8A 1W46A 1VG9B 2OBMA 2X19A 1OXXK 2QUZA 2A7QA 2IEZA 4L15A 3BGWA 1JPNA 4UXJA 1LVGA 2D74A 1DG3A 2XNSA 3RS5A 1E1RD 1F3OA 4Q1CA 2XJ9A 1GVNB 3M0EA 5KSZA 1Q1BA 4AURA 3ZVLA 3GLGB 1E99A 2HF8A 3DKVA 1JQLB 4IVPA 2RB4A 1U0HC 4CZ2A 1XX6A 3V4FA 3A58B 2CHGA 5JS7A 1DADA 4Z8XA 3UMRA 2FSHA 1G6OA 2GHIA 1IHUA 2PT5A 4G1UC 3AGQA 3T15A 5A5GA 5KHOC 3TAHA 2ZXUA 2OV2A 3WBKA 1Q12A 4G0NA 4ZDWA 1CJUC 4EPXA 3WMGA 2WJVA 5BXQC 1L7VC 2ZSAA 3GEIA 1EK0A 1ZM9A 4I4LA 4IDQA 4JLDA 4PC3A 4DSNA 4TYWA 2JLWA 4DT1A 2D4HA 3PEYA 2VP2A 1W0JA 2DFLA 2ZRLA 4Z8YA 4K8OA 4LHWA 4TTPA 1S4QA 2L0XA 3FPAA 5HZHA 4AKGA 2DFTA 2ZEJA 1WBDA 2D3WA 4QBIA 3E5HA 2XOKD 4RZ3A 5FOUA 1JALA 1XFAA 2ZJZA 3OIVA 4LY6A 1M1YE 1R10A 1SVSA 2Q9AA 3HPQA 2JATA 3U4QA 1M7HA 1E9BA 2LWIA 1OFIA 2V7QD 1OW3B 2VL7A 2G9NA 5KPDA 4XJXA 4TYNA 1E4VA 5LB2A 3P27A 2Q9BA 1JEDA 3DMNA 4Q1AA 5FBRB 1NBME 4QGAA 2IYTA 421PA 1XD9A 3U7EB 1F5NA 2AD5A 5L3QB 2WWIA 4XVQA 3SQXA 5EP1A 1HA3A 4Q5IA 1R0XA 3MWYW 4X8MA 5L8VA 4OQMA 4EQ6B 4RD1A 5FL7A 4V0MA 2NO9A 4P33A 3F5FA 1II9A 1S1MA 4LJ4A 2PJRA 5DNYB 5TY0A 2GA8A 3OZXA 1Q1ZA 4ZCLA 4L9SA 3AP2A 4FWTA 3CPEA 3ICQB 1ZIOA 1ZCBA 2VO1A 2X1VA 4N0DA 4AWXA 4YMWA 2D62A 2RGNA 4CYMA 1S1CA 5F98A 2OAQ1 2FEMA 4PPFA 1H8ED 5L3SB 4RKEA 1YRBA 4HSEA 2IYYA 1OKKD 2BIFA 2H17A 1U94A 2C03A 4OJQA 4DB2A 2HXSA 3H84A 1ETUA 2FWRA 4OQNA 2BOVA 4PZYA 1WRBA 5TARA 1YZTA 3PUWA 4UNNA 4HLDA 2CJWB 2ZQ5A 4HAZA 1AKEA 4MYCA 3VNVA 1G4UR 3AVTA 4MRPA 1MR3F 4ON9A 1CKEA 1TQ4A 2ORIA 1IN6A 1N6NA 1OHHA 3AVVA 1OB2A 2VP0A 1GKYA 3KKMA 4CEIA 1EFCA 1LFDB 3AUYA 4B3DA 5CM8B 2NPIA 1Z8FA 2YWGA 3ZVNA 1TADA 4AYXA 3SYKA 2ASEA 2P6NA 3QVUA 3ZYCA 2GXQA 2EFEB 4IEIA 4IOKA 2WOJA 4X8OA 2ZETA 1KO4A 1GFIA 5CDFA 1COWD 3SC3A 4EFMA 2G0NA 2ZR0A 3FFAA 2ORWA 2XAUA 4U5XA 2C96A 3FKQA 1CR2A 3AB3A 2QI9C 3QQ5A 5G53C 3R7WA 4OKSA 4PR0A 2R6CA 1E2IA 1G7CA 2C5LA 3QEJA 2IF0A 4EPVA 5EE5B 4GFDA 2LKCA 4FCTA 4IVQA 2IYRA 3EA0A 5JRZA 2MSCB 1DAEA 4F91B 4CW7A 3N70A 4LBYA 1YR7A 2R6FA 1ZUHA 4LSGA 4LZZA 1YHNA 5CIWA 2C9YA 3K0SA 2NOAA 5C18A 1KI4A 4IEEA 2XXAB 2Q9CA 1T3LA 2V3CC 1KO5A 1T0JB 2HLDD 3MD0A 1W36D 1OYWA 1Q44A 3TVTA 1ZUIA 1E2QA 3REGA 3W6NA 5C4GB 4DUGD 1IY2A 1W4RA 4KFSA 2ZRAA 2XJ4A 4GMXA 4JKIA 1HTWA 5B64A 3LFUA 1ZIPA 4JLJA 5FR2A 3U3KA 4WAUA 1E1RA 3TQFA 1HQCA 1RE0A 5JWOA 2X2EA 3B7GA 1P5ZB 3K9HA 1H65A 4M1MA 4E03A 5KOYA 1D9ZA 4UKDA 1IM2A 2QAGB 2KE5A 3B13B 2YJTD 3AVXA 2D06A 1U8AA 1KTVA 1XEWX 2FOLA 2NO7A 3QBTA 2TMKA 4F4JA 5KU1A 2ZJBA 5CYOA 5M04A 4HAWA 5JJKA 4EJSC 2ZR7A 2EYQA 2ZAOA 2QM8A 1II8A 3GLIB 4D2IA 4YC7A 3TUZC 3Q8XB 2ANBA 3CR7A 1M34E 1NI3A 1R7RA 3CONA 3U7GA 2ZRJA 4M2LA 3RYTC 4OK3A 4BLQA 5AUOB 1RRPA 5G41A 2JJ8A 1U81A 3RSLA 2H16A 2QROA 2QMHA 2ZRBA 4BFVA 3LX5A 1N25A 3U7FB 2FFBA 1N6PA 3CRMA 4OI1A 4BLSA 4FCVA 4X8LA 4Q1EA 2WIAA 4WIAA 2BJVA 4BEBA 3OHMA 2AK2A 2NQ2C 2XB4A 2OT3B 4AC9A 3GLHE 2A2ZA 3W8RA 2XZOA 3QNUA 2G83A 3DZ8A 1P2TA 121PA 2QTHA 4JL8A 2ZJOA 4PZZA 2JIZD 2QA5A 2GTPA 5FH9A 2OBNA 1QHIA 4Q47A 2JLQA 2WJGA 2V7QA 3QPWA 4LOAA 3AP1A 1X8LA 1BMFD 5DYGA 1GILA 4B35A 2OCPA 1YZLA 3PV0A 4DDWA 1YQTA 4TZ0A 1EGAA 1C9KA 3KTAA 4HAXA 4YMTA 2FF7A 2QBYB 1SXJD 4BE7B 4BGDA 4H1VA 2IHBA 3E2IA 5KPJA 4A8JC 3RDPA 4P31A 3HYRA 2P6RA 1ZMXA 4NYMR 1WF3A 3VFDA 5JI3E 1P60A 1NSTA 4B47A 1E98A 4KVAA 1DO2A 2Z43A 3U3OA 2EFCB 1XXHE 1VECA 2JEOA 4G01B 5B2ZA 3WNCA 3UPUA 3GFPA 4Q1DA 2XITA 3AF0A 1TQDA 1P62B 3GJ8A 1VCOA 2F7SA 2O0HA 3EPLA 3MFYA 1YZKA 1RPZA 3B8HA 2B8TA 1KJZA 1D2NA 5G3YA 1JEEA 1LB1B 2VEDA 4NCHA 1AN0A 1KO1A 2DB3A 1HEIA 2QRNA 5CIQA 2WWXA 2F1IA 2RHDA 1H8EA 5EE9A 5HCIA 5E4FA 3SHWA 1OKKA 2IK8A 5F2EA 4A4DA 1GNQA 1YRAA 1U99A 5DLQC 3MCAA 1FP6A 3AF1A 4PZLA 3EG5A 1ZM2A 4TQUS 4F92B 1J99A 2OLJA 1AZSC 1UKEA 2F43A 3R8FA 2ZE6A 4KXFB 4LJ7A 1RFLA 4CEJB 4JBWA 1U9IC 3TSWA 3QF4A 4TTRA 2G6BA 1PVOA 5FPSA 1EWRA 4Q4LA 2ZE8A 3K9NA 4Q00A 2NO6A 5AK0A 1G3RA 2IEYA 3UATA 1FQKA 2FFQA 1KYIA 2WHXA 2GCOA 2PZFA 1N6HA 4P4TA 5FUVA 2A9KA 1ZU5A 3H86A 3I92A 4B32A 1VG0B 1D5CA 4ZI3A 1U8ZA 3VKWA 1E9SA 1E0KA 3KXLA 5D3MA 1FX0B 1SZPA 2PCJA 2RHMA 4GBMA 4BWYA 1C4OA 1XJ0A 3LW7A 4NYMQ 5JEDA 1COWA 5J4YA 2OLKA 2CLSA 4LPSA 2ZANA 4Q7JB 3AKYA 2GAOA 3C8UA 3IQXA 3K09C 3MWLA 1NMYA 2C9CA 1GL6A 3LO5A 2WMOB 2VHUA 2BMJA 2A78A 2XTNA 3BIFA 4EPRA 2W0MA 3MJRA 5E7IA 2JLYA 2NZ8A 2ZS7A 1ZD9A 2QGZA 4KLNA 4F38A 1W5SA 2J0UA 3PFIA 1DVRA 1YJ5A 4Q4AA 1OH8A 4WZBE 1TU4A 3WY9A 2G1KA 3AVPA 4TL6A 5HR5A 5JEEA 5KDLA 3SJBA 2Q6TA 2O8BA 3CNLA 2HLDA 4L5BA 3MG9A 4IVRA 3KXIA 4DUGA 1Y63A 4EAQA 3D31A 3ZVRA 1P4SA 1UPTA 4YXWA 1LNZA 4NPHA 5JECA 2GBLC 3DOEA 4EJSA 2IX3A 5E7MA 2BBOA 3VNUA 4Q9IA 4E09A 4A2WA 3MMPA 3TW8B 2ZVQX 1OIXA 1XCPA 2ZI3A 2IYQA 3MWJA 2CL0X 3KB1A 2OAP1 1SVOA 3B1ZA 4A0FA 1KGDA 1GZSA 1MT0A 221PA 3SJCA 1A7JA 1R0YA 3LXRA 4JL6A 521PA 3B1WA 3T5DA 3IBYA 3THOA 2W2XA 1KSFX 5H70A 4IDOA 5CITA 3KB2A 2PMDA 2GJ9A 1NBMA 1XU4A 1KDTA 4Q7KA 4HUTA 2IYSA 4I1OA 1NVWQ 4FCWA 5SZHB 4LCBA 3KXKA 3C41J 2ZI7A 4A82A 2PT7A 4ACAA 5CB8A 4TLEA 1XMSA 3A8TA 3NEJA 3PUVA 1F2TB 5F9HA 2WWHA 1S0UA 1HT2E 2P0EA 2Z0MA 1US8B 3IHLA 3SDZA 4P32A 1TU3A 2ZU6A 4B2LA 2YC2C 3SN6A
chains in the Genus database with same CATH superfamily
3KKQA 2VHCA 1ZZGA 3EAQA 4RSGA 1JS1X 1T8WA 2REBA 1CQXA 3DXXA 3R8CA 4YT5A 4K28A 3NR2A 3IDZA 4ZWNA 1VGRA 2JLBA 3QOXA 3RROA 4CODB 2JIZA 3U7QB 2AC4A 1FYXA 3RC1A 1NBWB 3PD0A 1Y81A 4QO8A 3EQ9A 4BFXA 4QT0A 1KVSA 3QJ5A 4UJ3A 2NU8B 5CX1A 3ZE2B 5EJEA 1E20A 1A4UA 2O2SA 4JJEA 2HD4A 1DKPA 1DWPA 1N2SA 4HLNA 2VP6A 4JXXA 2C9MA 1DIHA 4U2KA 5F1PA 1K4YA 3M9LA 1AA9A 3OZWA 4MQEA 2UUPA 1YVPA 5H0IA 2QX6A 1J2TA 1BWRA 2IY7A 1HXHA 1ZU4A 2I3GA 4JSYA 5AHOA 5LC1A 3Q0IA 3AVOA 4Z51A 5BUCA 5JCOC 3GH3A 1VJCA 2EZ8A 5DNCA 3ENKA 3RJZA 1B26A 3C5CA 5F78A 3RSSA 3DPUA 4MUAA 2YHAA 3BJRA 2QQEA 2LDXA 2B25A 2H1IA 3RS8A 4IJ6A 3GFFA 4UU7A 4EPWA 2AKAB 3U44A 3B6ZA 6Q21A 2HCFA 4MDFA 3EGWA 1J21A 1VKNA 2I4RA 2OQIA 3IIJA 4R71A 4RS3A 4HWSA 3TOSA 1U2GC 3JQEA 3AM5A 3O90A 4QPJC 1CTQA 3EA4A 4H60A 3L5OA 5FHQA 5J43A 1OH5A 1NJ5A 3VC1A 1HZZC 3IQDB 4GVXA 4AJ9A 2HZBA 1I0IA 1QMGA 3ND8A 3NHKA 1V5IA 3I2HA 4YEDA 4M46A 5AVQA 3KWLA 5EVJA 2FR1A 4HH3C 5JY1A 1PWXA 4HAYA 2RH5A 5HKKD 3FBGA 3L6RA 1IH8A 4Y6GB 2ZKLA 1QTIA 1EBFA 4G2TA 5TJ9A 1CRQA 4PAOA 1MIOB 4KQ9A 3RS3A 1QHHB 2WIKA 3W2HA 3E6AA 1OPRA 3V8PA 2RK6A 1GZ7A 4JI5B 1UBSB 2VYQA 4QIHA 1DOAA 1RMQA 1SVUA 1YVEI 1ITZA 1FVOA 2ODAA 3JPYA 1PJTA 2PX4A 4HDKA 4LY3A 1VLJA 4DREA 3NU1A 4PHHA 4PYLA 4YGYA 5AOCA 1QGED 1D0VA 3KE9A 4FQ8A 4NYIQ 1BN6A 3F7OA 5BORA 3GZNB 2YFHA 4H77A 4LFAB 1YMUA 5DBHX 1TT7A 3I04M 1XYYA 4ML3A 3I6BA 2J5QA 1VRWA 2R8RA 3DR3A 1M0SA 3PGKA 5AKIA 3RJ5A 3W9BA 4DRXA 4PG5A 3TZCA 3QJYA 1Q0RA 3VTFA 2FMXA 2PBFA 2BDTA 4ALKA 3PHLA 1USUA 1RAGA 1NOIA 3DHYA 3FGNA 4ZO4A 1PG2A 2RGXA 3AIMA 2O8CA 2YKGA 4KWTA 1KKLA 2WSMA 2XNKA 3GOQA 4A8TA 4BIIA 4BLPA 2ZJ1A 1EUZA 3ZY3A 1QV7A 1UBOS 2X8LA 3EFBA 1YE5A 2DPMA 3OSUA 1WXDA 3Q6MA 4NH4A 3CH4B 1JQJC 4MR7A 3DBRA 1ZMBA 3V1UA 3HSKA 1YH3A 2GB4A 1FU4A 1XTSA 1YASA 3ZE8A 4I5FA 1BOOA 5AJVB 3HEMA 2DUNA 1O9GA 2Y92A 3L0OA 2AQKA 1HLFA 3T3DA 2QRVB 5THQA 3WQHA 3DE0X 1B2LA 1CZHA 3RC3A 3R5FA 3HFGA 3HLKA 4DXHA 4GP7A 3TZKA 2PR2A 4TXHA 2QVXX 3GNTA 3IMKA 2AEFA 4HF7A 4BYGA 1UKYA 3KJNA 1WHSA 2AZDA 3BN3A 3D6NB 2ZIZA 3RVBA 3S2UA 4E13A 4FYJA 1NVFA 3MBKA 4LJ5A 2B1IA 3RTBA 3KEFA 4I5GA 5KQMA 2P4UA 4HV4A 1PK7A 1ZJ4A 4MWEA 3V80A 2RG1A 2ZBRA 4NOKA 2WVGA 2XUQA 1KSGA 3ZQ6A 2RK4A 1I1HA 2ZRHA 3E9QA 2UVPB 1EFVA 3HVHA 4FOTA 5JADA 3C3KA 2B7BA 3OVMA 5JC8A 2JLVA 1UPXA 1KHHA 3WB1A 3UT0A 1XNRB 4PCVA 1TM4E 2H0RA 2P90A 1ZYUA 3CUVA 4DIEA 2HPZA 3GLHA 2WD7B 2PEYA 1XNJA 1HEYA 3WKBA 4EB3A 3DE5X 5FOVA 2HWWA 4HJXA 4XDGA 5E2IA 4IGAA 1SUAA 5EPUA 2JHPA 3SEFA 2DCUA 1LW7A 2CMDA 3MS7A 5TQ0A 3L7DA 4YMVA 3PDUA 3LF2A 1RC8A 2IELA 3LZ6A 4FHDA 2QV7A 4HN4B 4H0FA 4UDXX 2XMSA 5IASA 3E4DA 1NHGA 3Q7IA 4CMIB 1XRLA 2V7WA 2ZUUA 1NW8A 1ZMOA 2OORA 3GLTA 4KN9S 4NBSA 2BAGA 1FP1D 4JLPA 3VX3A 1NU8A 4HXFB 5KBYA 4M0UA 4MIKA 2YWFA 4YAEA 4B79A 3DOIA 3QUSA 1LPSA 4A8HA 4ETIA 1TT5B 4ZI7A 2WU3A 4M0MA 2YVUA 3SJZA 3E70C 4YIHA 1RHKA 2NV2B 4HFRA 2IT1A 3V7FA 1H1LA 4W5RA 2L2QA 3T1QA 1ZW6A 3W8EA 4ARBA 1G4AE 1EYZA 3HZZA 5A03A 5I7OA 3BT7A 4R2LA 1PUJA 4IFIA 5E6UA 1KZGB 1XXHA 3A6JA 3G8CA 3E9MA 3AR8A 2HWUA 4RJ2A 4DDMA 2H85A 2C29D 3EA5A 1CZRA 4NE7A 4AWAA 3JARB 1GKIA 1W88B 3VR6A 2C7GA 1XN1A 1OX4A 1YZNA 2IIPA 2OV3A 2XIJA 1M2OA 5KCMA 8OHMA 3D6JA 2PH5A 3EX7C 3FTPA 3V9PA 4DCNA 3SVLA 1A69A 3PLNA 4Q16A 3SC2A 1GXSA 2OECA 4JVLA 4LJ9A 3ZV5A 2R1TA 3OQ6A 1VLVA 3OQVA 4IMRA 4C0QC 4D6XA 4JAVC 2RE8A 4V0OA 1R6AA 2IYWA 1E3EA 3MD9A 2KHZA 1OT3A 4Q9JA 1BIFA 4I08A 3ZPXA 7REQA 3QGMA 2PMCA 4OHPA 4G8DA 2ZWIA 4FR2A 1I32A 2QM0A 1ISFA 2DSNA 5H68A 1R8XA 5EZQA 2P79A 2R4QA 4ECEA 1Z2CA 3KX2A 3BREA 4C21A 1IJEA 4KDEA 3ZDXB 4E94A 1NLZA 4MKHA 1ZICA 1WXQA 1MENA 1XZMA 2XV1A 3R4VA 4EDHA 1PVVA 2BFCA 3M6FA 2O59A 2VPPA 3AI7A 4QPPA 3WWEA 5CDGA 2O5CA 1YRQA 2X8WA 1EDDA 4XYMA 2QTAA 3P94A 1P0FA 3KFXA 4PSDA 1SBHA 4Y2JA 2D0OB 5KEIA 10MHA 2F4VB 3BTVA 4G23A 3K0CC 3IV7A 5DH9A 3VDQA 2IZ0A 3NHLA 5HIIA 2QLMA 4OHKA 2FFAA 4OAQA 1X2EA 4X85A 1M6EX 1VIYA 3FWZA 3DYIA 4AMZA 1FY2A 1HK7A 1F0NA 2JCVA 3IIMA 3EUFA 2PLRA 4PPYA 4I9NA 2ZYTX 1TKAA 1JTEA 3WYFA 1QXSA 1UBUS 1PSWA 4RESA 5EHNA 5JQGF 2IV3A 4TZ6A 2XWBF 2ZPTX 3I3OA 4NEGA 1HE5A 4PYQA 4US1R 1UQRA 5HKKA 1G16A 2DQSA 2FU5C 4N6NA 2I6GA 3MUEA 4OV6B 3CBGA 1YFLA 4JNCA 3U4GA 1RYYA 1THMA 3RSHA 3ILXA 3T7KA 2PUFA 5ALGA 2OHHA 5AIAA 1PW5A 1OFUA 4BKOA 3HXLA 4FIDA 2BZGA 1SKBA 1U0GA 2BHLA 2ZWMA 3QVMA 5GJWC 5HRCA 3A2KA 2WYHA 5LXTF 2FUG6 3MOGA 3L6BA 4JEIA 4JI6B 3ZBPA 3K70B 5J1TB 3TEMA 4JQYA 1K7YA 2HJRA 2WG2A 5DI9A 3VJKA 5F23A 2CD9A 5AI6A 3PGJA 2WW8A 1G8SA 5BVGA 1YUNA 2DKFA 2Q1XA 2Y2VA 3CEAA 3IMFA 4P98A 4DRYA 4L8LA 3G0OA 4H7PA 3OZRA 4IZIA 5BW6B 2YMLA 1ZIYA 4F72A 2VR1A 4Y2QA 4Y9TA 3CH5A 1RPJA 2PL1A 4MW2A 5BMOA 2BJWA 4UZSA 4DCSA 2O2IA 2X58A 4KFTA 4RO0A 4V1CB 2CZQA 4ZOLA 5EQJB 1PZGA 3ED5A 3EC7A 3EH1A 1QRRA 3E8MA 3OU7A 5I9IA 1FJXA 4M1OA 2FR0A 1L6IA 4LGYA 1P3DA 2WHQA 4BAGA 3ENQA 2OVBA 1U0OC 4YRTA 1DCTA 4ZKEA 1OXUA 1HYGA 3TLYA 2GYWA 2IYLD 2P0AA 2ZDQA 1IUNA 1NVEA 3BERA 1V11A 7AT1A 2DY1A 2QDKA 2GRAA 2V6GA 1YS6A 3FLEA 2Q1WA 3KSZO 5BNTA 1TUIA 2AFHB 5AICA 4U7GA 1X0XA 3EULA 1V1MB 1HDIA 3MCVA 4U7FA 1YB1A 4LQ4A 3W8NA 2DBRA 4FYIA 5DBGA 1NQWA 3MSCA 1C0EA 1N8SA 1JZTA 5DLYA 5GQSA 5JWHA 4J2TA 1ETHA 4OATA 4TMVA 4PFQA 3CEHA 1TLTA 3MB8A 3A31A 3O84A 1GPWB 3I73A 3SG0A 1YE3A 4MOWA 3DF9A 4HYQA 1EFPB 1KEEB 1P81A 1OWNA 1RKXA 1Y8QA 2IZ6A 2PWYA 4XA8A 4FOSA 1MA0A 1WS6A 2XQVA 5D5QA 3JQ9A 5BV7A 1RCUA 3HJUA 4M38A 4R68A 1J09A 2IU0A 1XMPA 1Z9BA 1E4EB 1Z4MA 4YT4A 4RTJA 4CIVA 4WASA 1ZISA 5FOQA 3BSWA 5G3ZA 2X0KA 3I9NA 5HXAA 2O2GA 1E3WB 4AG3A 1B3RA 4L08A 2IS4A 1WU8A 1OV6A 5DIFA 3OX1A 1SUEA 1X38A 1K5DA 3F78A 3HYCA 4LOHA 4NXMB 4JD5A 4B3HA 3ESXA 2HDWA 4MAFA 1KVQA 5IUKC 2WAXA 4UUAA 4AW9A 5L95A 2VC2B 2FQYA 2VKTA 4PRZA 3HVRA 3D59A 2C2GA 3IOBA 1CVLA 2BM9A 1JSLA 1P1KA 2FR8C 2VSNA 4E15A 1QFXA 2JBWA 1JL3A 3AR5A 2O4UX 5DM4A 3VR4A 2P4HX 4DN6A 1ZGHA 1E60A 1USKA 2HKIA 4R6XA 4IOJA 3FIJA 3AWIA 3N2IA 3V8RA 4NX2A 4MKGA 1JR6A 2K4MA 3ZNNA 1MG5A 5A06A 4KSBA 1KR2A 1M6NA 2FQXA 4NC9A 1G7TA 3I6QA 4HK4A 1MJHA 2GO7A 3X1YA 1BXZA 3H05A 1VI2A 1G19A 3TR0A 1JEJA 3C39A 3BILA 4FMBB 1ZVMA 4IFBA 1E2MA 5J2UA 1VYUA 2M6LA 3GRPA 2NUTA 1QS0A 2G1PA 4DARA 3MVEA 5ICGA 1TEZA 1JIVA 1IHYA 4LBVA 1U04A 1LSOA 2H63A 2VUTA 2DE0X 3WLSA 4D25A 2GLTA 4RDCA 4QXAA 5FXMA 3GC6A 3GY0A 5AVJA 3T12A 3I01A 3VKGA 3JQAB 1GG8A 1N9GA 5FBQB 1L8AA 5LOVB 2ENUA 3LUPA 3EQ8A 4JC0A 5K6AC 1KQPA 1BQ3A 4XQ0A 4FOOA 5SICE 3EXHC 4FSDA 4V0KA 1Z4KA 1SQ5A 2EQAA 3RFCA 1QYVA 1LH0A 5JFOA 4W9MC 1I6LA 1P0CA 3NH6A 3P71T 4DCMA 1IN4A 2R8XA 3S68A 3T41A 2IU4A 1OOEA 4B6EA 5BW8A 4QC2A 1VSTA 1F8GA 3IBTA 1E2GA 1PUXA 4KWCA 2JF0A 4LQCA 1A9XA 3N59A 2GNOA 2Y9MB 4HSGA 4AS1A 1RHJA 2VQDA 4CEIB 1PFWA 3FOCA 2B8NA 1H6AA 2Q5OA 2ZB4A 4B6FA 5KVQA 1QIHA 1F48A 3V33A 1G9TA 1ABEA 2HEIA 4E33A 4L7VA 3RR2A 4WRRA 4F2PA 3WMWA 5GP1A 4MW7A 5BRAA 2I5PO 3WGIA 1N78A 1WUIS 4OLFA 2O3RA 3A25A 1O77A 3C1UA 3BDAA 1OWLA 2ORVA 4FILA 3FCOA 4LNAA 4EVSA 4BP1A 1EINA 1HMPA 2IUYA 1P17A 2B3TA 5IW8A 2E4AA 3NZEA 3ONDA 1ZI8A 2YZNA 3NOVA 1DKOA 1FF9A 3MJVA 5JCPA 1JHXA 4A3SA 3PT5A 1LLUA 2O1XA 2HWXA 4KTTE 2ECFA 3HWSA 4GR9A 4LTMA 4RCZA 4ZQGA 2V97A 4ZVRA 1CQWA 3G13A 3LK6A 3V4PB 3ZQ4A 2VK1A 4JOQA 5J4LA 3L1HA 1CR1A 4UJ5A 1E2UA 4J4BA 3QIAA 5AUPB 3VC3A 2AGVA 4RETA 5KYXB 1WMDA 2HU5A 4LYAA 2V45A 1R9NA 4PTLA 3EASA 2OZLA 1EWYA 3FTFA 3BSSA 2KBEA 1R4NA 3I34X 5CT5A 1MAVA 1GL7A 2VPIA 2WYVA 2XOKA 3NVAA 1JA0A 4AKIA 2CLDX 1OX6A 3FFXA 4W5HA 3VYRB 4BNJA 2WUFA 3IBSA 2WHPA 3AKDA 4M0DA 2P6UA 5JZSA 2JFQA 2XDQB 4RA9A 3IQEA 1G55A 4LMAA 3CLRC 2VZ0A 5FA6A 2XMBA 1DBSA 4Q39A 4AS3A 8LDHA 4MVJF 4LWPA 4WA8A 1EA7A 1BAPA 4PF1A 5LP6C 5H81A 1FDRA 3DH0A 2GN8A 4EG5A 5K4AA 4FP9A 2Y67A 3ONEA 2HA7A 2C4VA 4EVRA 4UHBA 4LVCA 5CVDA 3FE2A 2JDID 2OD7A 4OHWA 1SUBA 2QE6A 4KFCA 4ND8B 2RG7A 1V25A 4UAUA 5FQOA 3AEXA 3JQFA 3T9BA 5IT5A 1UXIA 4GX5A 1YZFA 3M6LA 2GAFA 3KTFA 1CIPA 2X5NA 4AKSA 2ZI4A 1AMNA 1P1JA 2BEWB 4X1KB 3WZLA 3KFLA 3E3MA 4HN9A 2PUHA 4X93A 2PGIA 3H9GA 3KT8A 3RPEA 1KQGA 1UBCA 4F5DA 3VXKA 3Q11A 2ZYHA 1Y80A 3ZHCA 3K4PA 1DIAA 3PG5A 3T9EA 3PCTA 3V7UA 2BFMA 2JRCA 2RDMA 3GJZA 1NZFA 3QUTA 4WZZA 3L2OB 4OQ4A 1LJ8A 2FHPA 4J1TC 3QFCA 2VYCA 1RI5A 3OMLA 4YPOA 3NAQA 3DEIA 5EWMB 4JJKA 3KU1A 2WYWA 3IVXA 2BLNA 1PV4A 2JGDB 1EE9A 4FFOA 1UFKA 1O87A 2MHCA 3HDJA 1SRRA 1P1HA 3KJEA 1KDPA 2V7UA 1ZFNA 1RKBA 3IERA 3O3CA 2VCEA 3DZDA 4X6UA 2HHCA 2V0NA 2VWGA 2Y0DA 4JJFA 2P3SA 4KAAA 4XD2A 4PZDA 5ED4A 3C6QA 3KTAB 3TQSA 4M8IA 2AX4A 2NW6A 2I8AA 1XQWA 1GPYA 3HWX1 3LQRA 4FJ0A 5DYYA 3RV3A 4FB5A 5BURA 1PJLA 1YBVA 3IP9A 3QYJA 1Z0IA 3QTBA 3VR5D 4CDGA 4HQNA 1O1YA 2R751 1QK5A 3QX3A 1SUDA 3TAXA 4MA0A 1S8AA 5F3DA 3K35A 4NFHA 4DG8A 4R9UC 1K2WA 3ZIAD 3CZ5A 4C0SA 2A92A 2HMYB 3GLFE 1P73A 2Q8QA 3TW6A 5IG2A 1NVKA 5E9AA 3CWQA 2SNIE 4B4DA 3HJBA 4X54A 5EESA 1CY2A 5JG7A 5LLSA 3UUEA 5KOHA 3G02A 3UWSA 4HQKA 3TMKA 4TZTA 1GDHA 3PFBA 1BXKA 2PS0A 1P5FA 3BBPA 3SD7A 3W1EA 4MAMA 3T9DA 4LEIA 1EXMA 5LNK6 2GUWA 3IE2A 2C8VA 3GQVA 3K96A 2B98A 3UCEA 2P9EA 2PUEA 4QUGA 3KPJA 4R1MA 1BVRA 4J9UE 4EP1A 3ANYB 3PFGA 5DPMA 5JAQA 2EJCA 4M9ZA 2GS9A 4GUAA 5ITZA 5BRNA 3FM9A 1JJAA 2A0YA 4UNIA 1NW4A 1XDUA 1VPVA 2BV3A 3NQ41 3ZR4B 2R86A 3A2MA 3G17A 3OZDA 4QTUB 1R9GA 3WV5A 3M2TA 1PL6A 5K4GA 2ZJ3A 4RD2A 4BX3A 1FVFA 3OD5A 4AZ3A 1CF9A 1VE3A 1QGDA 3WLOA 5C46F 5CFLA 1UQUA 3DEKA 1ADCA 4DIDA 3QF4B 5AVUA 3WMEA 3M49A 1OYOA 3UW1A 1S89A 2CNWD 3R75A 1EXVA 1GPLA 3BCHA 3KEOA 3KPVA 4H6XA 1AKUA 5I7EA 1XNQB 1A95A 1Y3HA 1K8RA 1FBNA 2GCOB 4AICA 4JBNA 4YLEA 4CF7A 1GNSA 1BC5A 3MGAA 4WXRA 1EM8B 1MABA 3GUVA 4QJBA 3VPAA 6ABPA 3OMXA 4QT4A 4XFJA 2OK8A 4ZZ3A 4YX9A 4H3HB 2BFFB 1BMTA 4WBXC 2ERXA 1H2HA 1KYXA 1PFQA 4C22A 1RIFA 4QBFA 3C6XA 2UXDB 2GKGA 1BX3A 3PJEA 4Y9SA 1KEVA 1Q0QA 3HN7A 1IY8A 3NVDA 3KJZA 5ALYA 3WGMA 4HS4A 4GPZA 4ALMA 1GTG1 3UENA 4U3JB 5AM4A 2DUJA 1I6MA 1Z08A 3KR0A 1O8CA 4GQAA 3V4ZA 1X1RA 3PD1A 4HFNA 1SJ9A 1QHSA 1P0IA 3NETA 4WT7A 4EW2A 1UMBB 4F9FA 2GPBA 1FUUA 1N2HA 1X9HA 2PANA 4XPIB 4BLOA 1JNXX 4JR2A 2D00A 2W6CX 2G8NA 4FZVA 1GNVA 1T10A 1OBCA 2YXEA 4UVIA 5F7JA 3WX0A 5FX2A 2KSQA 3BS4A 3GRRA 4Z3OA 2EF1A 5JHGB 5ELLA 5ERGB 3GPCA 2XYHA 4U7WA 4XARA 3ITKA 1ZR4A 1TZMA 3PQ7A 2QJOA 3FNQA 4QFMA 3U4MA 1K7FB 3WFJA 3TSZA 3WOHA 1Z4OA 2DX7A 2R47A 3LF1A 5JYDA 1RLJA 3FNEA 1ULBA 2QY6A 3AR3A 3AETB 3ONVA 1SVIA 1L4BA 4MWSA 4EJSB 4JV5B 2P9BA 3H1FA 2DPYA 1MJNA 3LDAA 5FUWA 1V26A 1QFSA 4IJKA 4LKOA 1G8YA 2CE2X 1HDRA 1Z56C 1LDGA 4N48A 3W05A 4E3WA 1U3CA 1O58A 2J3IA 2RCNA 2XOEA 3PPXA 5DGIA 1E63A 2ZUCA 3FNHA 3FRJA 3I2GA 1S2DA 3JQGB 3V1LA 4LF8B 3AB7A 1R0RE 2JDIA 1S3IA 5DWDA 4BO5A 4YUVA 5JH7B 3INTA 1DP4A 1PLLA 4ZEOA 4W7HA 3HYNA 3Q85A 4OSOA 1PZHA 5I3CA 3BB1A 3MXOA 3ZKWA 4B33A 2E4WA 1VTKA 1Y6JA 1G5IA 1YWGO 3BA6A 1ZOOA 4NJMB 3RFUA 3LDGA 1H4VB 5FULA 4UZFA 4C0WA 5JAIA 2ZSIA 1U0SY 4F71A 4OXNA 2ONYA 1P9OA 2H9YA 2JHFA 2JI6A 5A4IS 4YP9A 1EVLA 2XNJA 5HQTA 1K5HA 2QRKA 1BTOA 3TLKA 1A2BA 1VPWA 2GCEA 5GOTA 3EQ7A 3H11B 1RAAA 5E8RA 4ENVA 2P9JA 4BCBA 2XCRB 4DMKA 2A5YB 3KUDA 3M83A 1VQ1A 1QRTA 3D6FA 4BFWA 3B2NA 4C6SA 2FPXA 1CY8A 1FP7A 3LQKA 3QWHA 1X7YB 5DW0A 3L6UA 1SC6A 2I6SA 4ZALA 3DLPX 2HA0A 5F7OA 3AHJA 2OCBA 2C3PA 2X23A 3GRYA 1VI6A 1YTUA 2Y9PB 1Z0ZA 1VIVA 4PGAA 4F4UA 5LN1A 4XUGB 3SLRA 4YGXB 4QNNA 3VR3D 2ZXEA 1UZNA 4BV8A 3VR5A 4MSUA 2REQB 4QFDA 3OT5A 3IALA 5CA0A 3QWFA 1JDVA 4JJ7A 1XP8A 2IHYA 5HMMA 3T34A 1V8DA 2XDWA 3HCCA 1TUEA 5JMWA 1BU5A 3HUUA 4BWFB 1KJ9A 2O0LA 3GLQA 1BKDR 3MXTA 3QKTA 1EBUA 4FGKA 1I51A 3ZIAA 4AJJA 2V7GA 1K8QA 3GFBA 3HA7A 1I4DD 2XKJE 3GP8A 1TVCA 4P22A 3TZQA 1BXGB 2W2TA 5AVZA 2ET6A 3AIKA 4PANA 4CDMA 1D2CA 3LK7A 3ZCPA 1M66A 4WK4B 5J5VA 4JLUA 1GL9B 2WF6A 1FNDA 1K3UB 2A58A 3TBKA 2I2XB 3KV3O 3UYKA 4CTMA 4KMSA 2WABA 3IURA 1QCYA 4KX3A 4RD0A 4WL0A 3GJXC 2QRPA 3TNJA 4Q7LA 2G08A 3EPKA 1ONNA 1RLTA 4EAAA 3E15A 4G0QA 2XGGA 3RF7A 2BGGA 4MNTA 3AERA 2VDPB 3NHBA 4ZO9A 1CXZA 3SC6A 3DHEA 1MNAA 5AI4A 1K63A 1Q0HA 4LF7B 5GGXA 2CLHB 3C2QA 4M54A 2YHBA 4KMRA 4KR2A 1D2EA 4UVEA 1MB4A 1I13A 4TWRA 2A9VA 1HM5A 5CGQB 3VX4A 4F84A 3OF3A 4WCFA 5C4MA 5TMBA 3DTYA 1XAJA 1JJVA 1QH9A 3M33A 3S40A 3HXQA 2XD4A 5D3KA 1J2RA 3OWOA 4K9OA 5AJYA 2JGKA 3QXJA 4QELA 3WYGA 2CNWA 3MRVA 4WX2B 1OYVA 1UWLA 1YI8A 2APJA 3EEFA 3N28A 3OA0A 4TV9A 5D86A 3C3YA 1ZXBA 3CJTA 4M1KA 1OIWA 3OM0A 4IH4A 1I01A 1T43A 1ZK0A 2BKVA 1G3MA 4WOBA 4N5MA 4URXR 4J43A 2HOQA 1DRVA 1C8VB 1RWMA 2IGBA 3KV1A 3NOQA 3NOXA 4Q03A 4TL7A 5IEBA 3UPDA 5TPWB 5IDQA 2AI1A 3FDFA 4XCQA 5SZIA 3B6JA 1U7DA 2WQ6A 5F4ZA 4OK5A 4AK9A 4DBLE 4K3VA 5F9MA 2DGDA 2B0CA 4O5AA 4O2BF 3WYEA 5BV8A 3D54D 1XJQA 2CF5A 3L4SO 1A4XA 2OHOA 3NCTA 2ERYA 4IFTA 4P7GA 4UD2A 1RWOA 3CA8A 3RJMA 4B09A 3PLAE 1T5DX 1PGOA 2E7ZA 4BGEA 1M1UA 3UH0A 1GSIA 4H7DA 4QE3A 4URFA 3DTNA 4NBVA 1I2ZA 3IMCA 3P52A 4CLHA 4CCSA 1ZA2A 3EZYA 4CLRA 3I05A 3ZDAA 2IBMA 3RS7A 3D4LA 2I6QA 3K0HA 4BFSA 3JAMA 2PBZA 3JRWA 2MU1A 4J07A 2FZEA 4ZV7A 3RVKA 3GLGA 3F6BX 4ZEXA 5DP1A 1UAAA 4JL5A 3P0EA 4II7A 4C5BA 4IHJA 1TL7C 2FZGA 3F8WA 1GUDA 4GBED 2VHJA 1TYZA 3EGCA 1N6KA 4ITUA 4EO4A 3CVYA 3AQIA 1YMVA 16PKA 1BEZA 1EFKA 3GZ4A 5F51A 1EHIA 1LWOA 2YVKA 3ZHUA 3RFVA 4Q48A 4GOJA 5K3EA 2FFHA 1ZRHA 3CKYA 2NWQA 2YIJA 4DZTA 3R41A 3E5MA 3NVMB 4OMCA 1NVUQ 3A04A 1QYIA 1UM9B 5DN6A 4JYCA 1EWQA 5ED0A 4L51A 3K1AB 3LPDA 2Q7XA 2ZP1A 1WSAA 2GO1A 3PXBA 1WPQA 3ABRB 2NXWA 4QUIA 5E6SB 3IDQA 3PL5A 4DLZA 1IYZA 4UAGA 5GADl 4OB6A 1MGOA 1RS0A 1L5FA 2YWHA 2AN3A 4L4XA 2F3UA 4BMDA 1NVVR 4BQEA 2IU3A 1CUVA 3H7IA 5CT4A 1Y34E 4LF9B 3QG1A 2Y1OA 3H5LA 1VG1A 2J0VA 1YD7A 3QNWA 4YRIA 2FXVA 2PWBA 4V02A 1R5BA 1LPAB 1AGXA 5DTQA 2X0IA 4E2WA 2YWDA 2J9FB 3I5XA 2GEVA 4XOIA 4JROA 1ISSA 1W34A 1TVMA 4H31A 4LMPA 2YOGA 5KX5A 1NDQA 1ORHA 2CNNA 3AXSA 3AUSA 5EQDA 4Q9LA 2E2WA 2ZR8A 4UNQA 2EP8A 4Y6RA 4OL0A 4YCDA 2VHXA 3UCFA 2MTBA 1N4AA 2AEEA 1IOVA 4S2EA 3HY4A 4X1IA 4M0CA 3KD3A 8ATCA 4PN3A 4RLHA 1W2WB 4MMZB 3S55A 4QVKA 2IPOA 1Z68A 3OOJA 3OZBA 2ZT7A 3K0AB 4QVIA 1J0CA 4D3DA 1MAUA 4NPAA 2Q3MA 7GPBA 1JFVA 3N05A 4MW0A 1EFDN 1TLLA 2XTJA 4KDCA 1NBHA 1ULHA 2G7MC 1A1SA 3SBDA 5AW1A 4GSYA 2HSJA 1K6XA 4QJ3A 1SA0B 5FNVF 3AC0A 5HK9A 2G71A 4CHGA 2VPYA 4RNDB 3VR3A 1YA6A 4EVIA 1E2FA 1W73A 2VCYA 3NPMA 4P58A 3UWMA 3RRMA 1M2KA 5EKSA 1CJMA 3Q9LA 1CZNA 3GCDA 3E3OA 3W5HA 1IY1A 1EUDB 1I3CA 3MGCA 5JD5A 3V00A 4N9WA 1CRPA 4PV7A 4GNKA 4JVSB 2X1MA 4L8WB 3WIBA 1PIWA 2A1UA 5J9FA 2KLBA 2QLBA 5HM6A 1AGRA 2PT6A 3I8XA 4I1UA 1ZRMA 1DJPA 4WKBA 1X42A 4R8KA 5AVTA 3L8ZA 3TBHA 1PNOA 3QLTA 4OHFA 1NW9B 3H13A 4RDIA 3JVIA 4YQEA 3F6RA 1UMDB 1ZP6A 2CJFA 5TF4A 3CE9A 4PIPA 4QRIA 3MTEA 3QW2A 3UMFA 3VPBA 4D3XA 2R0QC 2UXBB 2EKZA 1R4AA 4IH9A 1DEAA 4OKNA 3ZLVA 1EQAA 3LUKA 4KN5A 2CJWA 4C1NA 3K6KA 3FTEA 4JB3A 2PL5A 1JLLA 1BA3A 2QUAA 4KNYA 1I3KA 1ISMA 5H8WA 3C5EA 2ZYWX 4QHSA 1SHZA 1NUTA 1MTOA 2R84A 1B93A 1OREA 3EC1A 1FCJA 4DWOA 2BR3A 3KWJA 3OQIA 4IWXA 3W7AA 3AXTA 2YCLA 1YDEA 5TMPA 1A5BB 1IPHA 1DAGA 2WJIA 3P5SA 4XKJA 4BQQA 4N3CA 2N0SA 1ODSA 3FIUA 4D26A 4TSKA 3IJRA 1QV9A 3RT9A 1TVKA 1VLZA 1U9ZA 3V8MA 1A9RA 4HOYA 3Q5DA 3PL1A 1UBNA 3B82A 3SFVA 3T3GA 3V8QA 3EZFA 5KZMB 3L0IB 3G2HA 4PFKA 3B9QA 4URYR 1QSGA 5LU9A 1CP2A 1PFGA 1W94A 1XPJA 2LIVA 2FLKA 4G8JA 4L22A 5AM5A 5K3DA 4FZ5A 1RRKA 3BIWA 4ME6A 4P2GA 3BF7A 2JFGA 3DL4A 2C97A 2I3ZA 4R8RA 1KYQA 2Y05A 2OMKA 1DBVO 1JA1A 4O4LA 3CB2A 1WR8A 4KN8A 5E1OA 3WL7A 2NZVG 1Z06A 4EA8A 2FKNA 4TMKA 4IMIB 3IXQA 4KDRA 1PYGA 4F2DA 3FNIA 3BD9A 5H5JA 2GR9A 3L0DA 5JDCC 2BTEA 5IJ9A 3KKOA 1CY1A 1NM5C 3RBXA 4ZCIA 4KLRA 4MQ5A 4Q66C 5EIBD 1N57A 2OVFA 2VDWA 2WAOA 1R5JA 1R5NA 3LOPA 3Q2KA 4YQYA 4B3IA 3VU8A 1Y6QA 3W77A 1GDDA 3S1AB 1SGWA 2FN4A 4N5HX 4XWWA 1GNPA 2E82A 3CPSA 1Z5WA 3M4YA 3AYXB 4I50F 4B8ZA 3A6PC 2EG9A 3NS7A 3ZLBA 3RUDA 3LNCA 1CR0A 1JTVA 2PJZA 2VQ6A 3F71A 1T0PA 5C3UA 3UK2A 1QZTA 1V6SA 5CK4A 1E5TA 1C2TA 5CXQA 1W75A 3ZBUA 3SQMA 2CUTA 3EJWA 3QVVA 3ADBA 7MHTA 1YACA 2RARA 1VBKA 2WUGA 3NIWA 4RLQA 1WY7A 3LNTA 3P20A 3VHQA 5AUNB 2RKOA 2MYUA 1C4XA 3NHAA 1C3JA 3AT1A 1IONA 1N5JA 2WT8A 4OA5A 5AW7A 1KY5A 3STUA 4OLBA 2B8JA 4ASUD 2CLCX 1KFEB 4IZ6A 3H3XA 4J0CA 4MRAA 1GSAA 2CVPA 3VR0A 3K15A 2QAGA 2NXNA 3C87A 4D3SA 3V2GA 3SKYA 4CEHB 1MV8A 2C5EA 2HSWA 3AOEA 3EVFA 4EBBA 3PUIA 1T0UA 1KIMA 4RXTA 1CU1A 1J25A 1NMSA 1SUPA 5DCUA 5I4KA 4IF6A 4RL6A 1X7HA 2B99A 5B4TA 1N33B 5K0LA 5JNWA 3G2MA 5HZKA 4B7XA 1QV6A 1VPDA 2J41A 2RAPA 1EGHA 1OGJA 1PLJA 1SOAA 2LV8A 2XY4A 5BYAA 4ZAVA 4A16A 3TUIC 4L9WA 1PL0A 1VHWA 1ZD5A 2VKQA 3HR4A 2BBTA 3ZXIA 1A1VA 1PKXA 1R6TA 3B6MA 4UHCA 1K98A 3LHIA 2EERA 5K8LA 4MUGA 2FPWA 3ZDBA 1WBJB 2Q3EA 1Q74A 2RH8A 4DWWA 2QE7D 5JYEA 2BKUA 1NJ1A 2I91A 3A7EA 4YHBA 4UPEA 3OX3A 3IP7A 1HDOA 1TTTA 4E3ZA 1DXYA 1S96A 3A1FA 3PGXA 1QIDA 5F5NA 5JZOA 2O2XA 5A9TA 1AKTA 2FP3A 3HKCA 3D0KA 3SIPA 4QOGA 4E5YA 5BN4A 3A4YA 3GXBA 3Q40A 1XZGA 1L7DA 4Y7DA 1ZKDA 1ZH6A 4PQGA 3RS4A 3ZXSA 4BKRA 2XUDA 1LRJA 1TNDA 4Q37A 3I9MA 3MJHA 4BJ5A 3KT3A 3LHDA 2NQ8A 3GPDG 6REQA 4CKXA 2YHSA 1YBAA 1T6ZA 1KC3A 4PSUA 1J5XA 1E9DA 3EHEA 2PSHA 3SE7A 4BNUA 3HWRA 3BIXA 3EDCA 4JOBA 3G85A 2GZHA 2X5KO 3TSAA 6YASA 3WL8A 2GEDA 1JHUA 1L7EA 2XVAA 3H9EO 4LTNA 4P3YA 3NIDB 3VNBA 1TKBA 1FFGA 1RYNA 1SCJA 3L7CA 4IJMA 4PBRA 5JMPA 4TUYA 4OXXA 2GVDC 1GITA 2FSIA 4MAAA 5AKYA 2IWHA 1J33A 2VAPA 4G36A 2AWOA 1IMOA 3M1AA 1TC2A 5FV4A 3ZVMA 4IIGA 1W4BA 2VJQA 5ALXA 2Y71A 4IFEA 5KJFA 2C9ZA 3GFOA 1NBMD 4PC7A 4UDYX 2GN0A 3WKDA 1J9ZA 3K6SA 1FJGB 1HLGA 2GBCA 3T54A 1Z34A 5C5DA 3G0DA 4X1KA 5FWXB 4Z4QA 1Y33E 4D80A 5AUQA 1I36A 2D2VA 1U7PA 1R27A 2QVBA 4ZI2A 5FI0B 1C1HA 3QTLA 4GBJA 3ZY5A 1QO0D 2MSNA 5FLYA 3M2PA 2C3UA 4I3FA 2CXHA 2Q21A 3ESDA 1DT3A 1JGTA 1ARZA 1MLDA 2HCRA 1Z73A 4XUDA 1Q77A 2VH5R 1KJ8A 3P7MA 2WILA 3HCWA 1ZSNA 4ID3A 1MA3A 1W44A 2KYRA 2XQFA 4MKZA 4XSGA 2VHVA 2FGJA 3JQDA 1G6HA 3GCZA 3GLRA 4KLCA 2Q2OA 1I7LA 3ZUGA 1GUBA 4F12A 1U28A 2HJHA 2HT1A 3FNRA 2DUMA 1PU2A 2PGOA 2A9RA 3HL4A 4IQ4A 4NU6A 3VAYA 1T1GA 2PQ6A 3S2IA 3HYTA 1OFUX 3LD9A 1IOWA 1RZRD 2P69A 3TLGA 4IF4A 4D9NA 3JATA 2HCBA 1DQYA 4K9SA 4CM9D 4JDUA 4C2UA 3QUQA 5CB6A 2CUZA 3UVEA 4NENA 1A8HA 2B4KA 3BVPA 2QU7A