2W2XA

Complex of rac2 and plcg2 spph domain
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
177
structure length
177
Chain Sequence
b'SQAIKCVVVGDVAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLRDDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAS-RELATED C3 BOTULINUM TOXIN SUBSTRATE 2
molecule tags Signaling protein/hydrolase
source organism Homo sapiens
publication title Structural Insights Into Formation of an Active Signaling Complex between Rac and Phospholipase C Gamma 2.
pubmed doi rcsb
total genus 59
structure length 177
sequence length 177
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2w2xA00
2DY1A 4ZDIA 1XMIA 5GJCA 5HPYB 3GLFA 2P0EA 2GDJA 2OFWA 1GZSA 3TUIC 4TTPA 5C18A 2FSIA 1TMKA 1G8YA 1OXTA 4TMVA 2FSHA 3K0FA 3C7KA 2UZ3A 3TR0A 4TZ6A 5FL7A 5FUVA 1FPMA 1SVLA 1X1RA 3ZD6A 2GBLC 4DSUA 2J1LA 3OE7D 2BHRA 4XWOA 4A6PA 2FU5C 1MT0A 5E7MA 5G3ZA 3WHLA 3AVXA 2QSYA 2AXPA 2O8FA 5JJIA 3UG7A 4V02A 2VF7A 3THWB 2WMOB 4QGFA 3AGQA 1BMFD 4R9UC 5FFMA 4RSGA 2P6UA 2YWEA 1G3UA 1KJZA 2O0KA 4QL3A 1UJ2A 2CNWA 3BBPA 2R8RA 2G0NA 1FNMA 1KO7A 3BWDD 4CZ2A 1G7RA 4I99A 1E2JA 1RPZA 3RS7A 1CKEA 4JMPA 4WA7A 3B1WA 2X19A 2QSZA 1RVDA 2B7CA 2QROA 1NY5A 3U7FB 2GWHA 1DOAA 1AQYA 2XTMA 2ZAOA 1HY3A 3DM5A 5CLQA 3SQXA 3GLIE 2IS2A 3A1VA 721PA 2V6IA 3FTQA 4Q7LA 4GFDA 1AM4D 2IYSA 2OXRA 3AF4A 2FFBA 3QJYA 4WVFA 3RS3A 3WP1B 4M21A 3QKRB 3VKHA 1XTSA 1UM8A 1W5SA 2CL0X 1E2KA 1JXMA 5FOTA 1E2LA 1AQUA 2ZANA 3TAUA 2H17A 4RZUA 4HLDA 3UATA 1DAEA 1XP8A 2IF0A 3SOPA 1ZVQA 1RYHA 3TR5A 1EWRA 3U6BA 1G3RA 3EAQA 4U02A 1XMVA 4ZCLA 3FOZA 3OEHA 3BFKA 4C0SA 3AB3A 3KKMA 2NOAA 3NEJA 4ZI3A 5FH9A 3IEUA 4FXPA 1ZM7A 5AK0A 1W4RA 1XZQA 3SN6A 3IEVA 2YHSA 1I2DA 1E9BA 4DKXA 4M9QA 2CHVA 1W46A 3T15A 3UIEA 3EIEA 4NBSA 4B48A 1J8MF 2Z4SA 5KNDA 2F55A 4KVGA 3B6EA 5DISB 4B2PA 3RC3A 5JHGB 1KMHA 2WOJA 2IF2A 1G5RA 4MYCA 1U94A 1IY2A 2IW3A 2WZQA 1KZ7B 3RANA 4YMTA 3LXXA 4A2PA 3K0FB 5B58C 1NVVR 4DCSA 3NDPA 5DHAA 4NTZA 1KYIA 3E5HA 4DLXA 3L0IB 3AVTA 1IJEA 1G6HA 2C9OA 2OBLA 4LY6A 4M1KA 5E7JA 4DT1A 2EYUA 4IDNA 3QKUA 2FF7A 3THYB 1RJ9A 2ZITA 3FFAA 4JLAA 3PEYA 1KKMA 1GL7A 2WJGA 4QHYA 2YYZA 1NJFA 5FR2A 1ZP6A 5JSZB 5DN6A 2OFXA 4EFLA 3CX7A 1D2EA 3K9NA 2ZVPX 4QOSA 2ZRHA 3ETLA 5L3QA 5CIWA 3WYGA 3T06B 2ZI7A 2HCJB 2WJIA 2B8TA 1KNQA 2W2TA 2W2VA 3BRWD 2HV8A 1R8QA 3L0SA 3QEOA 2Q9CA 3W5JA 4DRZA 4PO9A 5EE0A 4NYIR 5CLLA 2ZREA 4MYTA 2NIPA 2N1BA 1EFUA 3WMGA 4M53A 4F7WA 3TJZA 1OIWA 2I1QA 3GLFE 1OYWA 4L16A 1GG2A 1GOTA 4V0NA 4D2IA 4PX9A 4Q1CA 4OQXA 5FBQB 3ADDA 1S96A 1DG1G 4CEJB 1U8ZA 5H68A 3AVPA 3ZS9A 4KVAA 2AFHE 2ZRJA 4RD6A 2D74A 3VX3A 4POAA 2F1IA 2O8DA 1GM5A 3KX2A 2W6IA 3BB4A 1S9DA 4TLEA 1COWD 3RNLA 4I81A 4A92A 2ZRPA 1Q1EA 4TL6A 3UMSA 4B3GA 3LW7A 1RIFA 4K8OA 4Q1BA 1TQ4A 3MGCA 521PA 3U7HB 4PHHA 3HU3A 4XVRA 1OLOA 2O0HA 1P60A 4D4JA 1W4BA 2GEUA 2BJWA 2PBRA 3FE2A 4US1R 4C30A 1JEDA 4EPVA 4QM6A 4OJQA 2JASA 3N70A 1SULA 1JR3A 4R2HA 2QEQA 4XWAA 1B0UA 1OSNA 2BDTA 5J4YA 1W44A 4IW3B 1H8ED 1VCIA 3CRVA 2QQ0A 5JFGA 2JDID 2PZEA 3GPLA 1EFRD 3RC8A 1D5CA 1RRCA 3DM9B 3NBFA 3EZ9A 2QPTA 1XXHE 4JLDA 2WAXA 5DI3B 4URYR 4BZQA 1FMJA 1N6OA 1K5DA 3CH4B 4TSFA 3E2IA 5LPNA 4B3CA 1E2IA 1FUKA 2BEKA 4DT1B 4PO1A 3THYA 4WW0A 5J4LA 1KAOA 4O2RA 3NDBB 4ZDWA 1XEWY 4NH0A 4I4LA 4KV9A 1NN0A 1UKZA 2FNAA 3PXGA 1TF5A 2IUUA 3VTKA 4ESVA 1OF1A 3JZAA 2WBLC 2F1HA 4Q18A 5IK2A 4OI4A 3TLXA 2RGBA 1NKTA 4TMKA 1KK0A 2VP2A 4WOPA 2C2HA 3SJCA 2FFQA 2G0TA 2ZJ8A 3B2EA 1EFTA 1NLYA 3GEIA 1E9RA 3W5IA 1G17A 1YZKA 1ZM9A 2O52A 2ZM5A 4PANA 1M7HA 1PLKA 3RS2A 4AD8A 2WWGA 3SYKA 2ZSAA 4A8JA 3KJEA 2KE5A 2ZYVX 4UNNA 3RRNA 4JKYA 4AURA 1LY1A 1RZ3A 4AK9A 1HA3A 3H2YA 4G0NA 1VKJA 3K53A 3W9YA 2IHBA 4TT3A 1M7BA 1JB1A 3DKPA 2GEVA 2ZYUX 1D2NA 2GXSA 4LYFA 1LVGA 2ZU0C 3BIFA 1HE8B 2KI5A 3ZVLA 3IILA 2IWHA 1IQPA 1DPFA 2GTPA 4HYYA 4P4SB 3SBEA 1R0WA 4CIDA 4KXFB 3TUJC 1II0A 1Q1QA 1NBMD 4AY2A 1COWA 1YQTA 4JZKA 3E70C 1XXHA 2IYWA 4Q21A 3EW9A 2XOKA 1SZPA 3U3MA 1XD2A 2DR3A 1PLLA 4KSBA 2IS4A 4QJ4A 3B1ZA 2IYYA 5FI0B 3WBJA 1DADA 3X1XA 4YXWD 3BK7A 1OB5A 2R6FA 2WICA 1MOZA 3DZ8A 1NN5A 3DO6A 4PZYA 2QU8A 3KQNA 3Q5EA 4TLBA 3UWKA 4NCHA 1Z08A 3R8CA 3EARA 2EYQA 2VHUA 4ILEA 1YJ5A 2CXXA 3WYFA 2ASEA 1KI8A 2H92A 1Z29A 1NMZA 2HDNB 1N0UA 2VO1A 3LX5A 5EQTA 3NH9A 4FD2A 4ZCIA 1E1QD 3DOFA 5FBWB 3T34A 2CHQA 3C4JA 4RFVA 3OEHD 3C41J 3WRYC 3QXXA 5DN6D 2EFDB 1BH2A 3NHBA 1FQKA 1DAMA 1CJKC 1UBEA 2JA1A 4LJYA 4ABYA 1Z28A 2ZEJA 2XNDA 4DWJA 1G1MA 2ZPTX 3NBZC 4DVGA 821PA 1T8TA 3AF0A 4PC7A 2IS6A 1P9WA 4I1OA 2BMEA 1VCMA 1XJQA 3L82B 1WQ1R 4A8JB 1JBKA 4JLKA 2IXFA 2DFLA 1XMSA 3ADKA 1F3OA 3B9PA 3HDTA 2G77B 1U90A 4L4UA 4LJ8A 4CW7A 2O0JA 4LSGA 3AF3A 4TYNA 3AP1A 3CM0A 2ERYA 3IDQA 2FV8A 3LLMA 4LJ7A 4EPRA 1Z6TA 1XEXA 2D06A 3IIJA 2QGNA 1N0WA 2NO0A 1KI3A 3LV8A 3PVSA 3X1DA 1KNXA 4JBXA 2Q9BA 2JLQA 1Z6AA 1QVRA 2P3SA 4RVCA 4Q00A 5HTKA 4MDEA 5SZKB 1R4AA 4PSVA 5L3VA 4ITRC 2I1VB 3RDPA 3P20A 2JLRA 4RKFA 4QC2A 1UBFA 3WRXC 3B8HA 3JZMA 3U4QB 5JJLA 1EG7A 1OH8A 2WTUA 1HH4A 5J4HA 2ZR9A 2GJSA 3C15C 4R71A 5DSZA 3REFA 2FG5A 2JLWA 1YR6A 3LQRA 3NXSA 3R9XA 1PV4A 2ZR7A 2L0XA 2JLUA 2DWQA 4JL8A 5FL7D 4MUAA 4F93B 1J90A 2ZS9A 2PJZA 2RGNA 1O3YA 1CR2A 4A9AA 4AG5A 4JLPA 1DELA 3IQWA 2PMDA 4LPSA 1R10A 1AN0A 4NHOA 2QRZA 1PUJA 1KOFA 4YMUA 4XJXA 2NMVA 3I62A 5C46F 4MKGA 4V0OA 2QM7A 4JYCA 1BIFA 2R9VA 2MSCB 1UDWA 1ZBDA 3I61A 4M9ZA 1PZNA 1WBDA 4DCUA 4MRSA 4HDOB 2C77A 2XJ4A 1XEFA 3I5YA 1F2TB 3QVUA 3VU9B 2O8BB 5JBQA 1A5TA 2NO1A 2D2EA 3A4MA 4TMXA 3EZ2A 3J81k 1ESNA 4TYYA 4LYJA 2JCSA 1E0KA 1CR0A 3M0EA 2IC5A 2ZROA 3CRQA 4US0R 2QAGB 3BH0A 4QBFA 1UAAA 3IBYA 5M04A 4BLRA 4KITB 1S3SA 1EFHA 1P7CA 4GT1A 1CXZA 4KLZA 1Z06A 4A4DA 4MRVA 5EUQB 2ZQ5A 4TWZA 1MO6A 4BLSA 2A3RA 1KDOA 2P6NA 5FPHA 3QXJA 4JL6A 1CS4C 5KU1A 3I92A 5GJVC 2ZJZA 3CPJB 1J99A 4TTQA 2FFHA 4E07A 1ZU4A 1O87A 5E95A 4W5HA 3VR2A 3CX8A 2AD1A 1XTKA 1AJEA 4JVSB 4URUR 1OXUA 4Q4AB 5EJEA 2GCPA 5LB4A 1S3GA 5FBVB 3U4QA 2EFEB 2IYTA 1CRQA 2WWFA 5C4MA 2AWOA 2NGRA 4LX0A 3AKYA 4GSYA 4LBWA 5F3WB 2VQSA 3NBXX 3HYRA 4LYAA 3VR5A 2JLYA 5LD2B 2ZRGA 4FWIB 1VG8A 4U5XA 5EUMA 2ZVQX 4CT4B 1U2RA 3EWSA 1EGAA 3O8BA 1NVUQ 3U3KA 2CVHA 3ZQ6A 2P5TB 4O0MA 5LBIA 3ZIAA 2J0SA 4JL5A 2IXEA 2X77A 1AZSC 4MRNA 2DFKB 3QIAA 1KJWA 1SVOA 4DHEA 4QJ5A 5HZKA 3LX8A 3F5FA 1TEXA 1Y3AA 1Z6YA 1FNNA 1XCMA 2ZSBA 4F92B 1W7AA 4BEJA 4D0NA 1U81A 1E2QA 2OCAA 2IYZA 2HLDA 4KFRA 3K09A 2ZRCA 5KUTA 5ELXA 3VHLB 1W0KA 3VU9A 4EJSA 2O8BA 2IA5A 1W5TA 5FBRB 3B60A 4XTCS 2IEYA 2JJ8A 3EZ7A 3HP1A 4HAUA 2QZ4A 1AIPA 3ASZA 4X8HA 1YZQA 2QPOA 3MWKA 3KKPA 2V54A 1II8B 2JJ1A 3KJGA 1NKSA 2XSZD 2XXAB 2ODBA 4RZ3A 2QY9A 4DCTA 4AKGA 1IN7A 1ZM2A 2QAGA 1ZIOA 2REBA 2QTVB 3MAAC 2JIZD 3DKVA 3L0OA 4B6FA 4YDHB 4Q19A 5AUOB 2P2LA 2V7QA 4AI6A 1V5WA 1NBMA 3N2EA 2WM9B 3GFPA 3O8DA 3T1QA 2C99A 1L8QA 4HAXA 2BWJA 2WIBA 4KU4A 3A1TA 4LJ4A 1HT2E 4V03A 3NIBA 3X2SA 4OQMA 1BS1A 1GUAA 4NCNA 1Z0FA 1E98A 1DS6A 4YMSA 3TVDA 2FZ4A 2WKQA 2J41A 1YKSA 3RWMB 2R6GA 1N6IA 3P4YA 3GJ6A 1NIJA 3ECCA 1OT3A 2WPDD 1RRPA 1YZUA 1G3MA 1VHTA 1P9NA 1ZRHA 2CCGA 2GJKA 1D9XA 3LBHA 1T6NA 3MFYA 4GI7A 5F98A 2G1JA 1Z0JA 1OHHD 2ZYWX 4KBGA 3WMEA 2VSXA 5F9FA 2R62A 3R20A 4RD3A 4LHWA 2MSEB 2OHFA 2YC4C 3TVTA 4PTLA 3ZLJA 5JMTA 5CK5A 3T1OA 2G3YA 2HXYA 1S1CA 4PZLA 1G4AE 4E03A 5KYKA 2WSSD 2HCBA 1E2MA 1IBRA 4C9BA 4OYHA 2C8VA 1OIVA 1X3SA 2G1KA 4IOKA 2GK7A 4Q7MB 2CE7A 3AUXA 1ZW6A 2QP9X 3OE7A 3DPUA 1KI2A 1FMLA 2H8KA 2WSMA 4TSFD 5JCPA 1VIAA 4NYJR 2ZE8A 5G41A 1Q20A 3C5HA 3THXB 2QNRA 2YWFA 4JS0A 4OK5A 2EQBA 3EPJA 3AGPA 3QF7A 1OH6A 4N3NA 2IT1A 4Q01A 4QHTA 1JR6A 1MKYA 4M1MA 2ONKA 3UXMA 3ADBA 2QA5A 4IXMA 1EX6A 2R6DA 1G6OA 2ZRMA 4C0HA 1X8LA 5B64A 1T9HA 4V0KA 3D31A 4AKEA 4DLUA 2CL6X 2D2FA 4LHZA 4URVR 1U0LA 1IXSB 4ZO4A 2B92A 4EJSB 5L3SA 1G291 5E4FA 1RC8A 1P9RA 2FJUA 3VQTA 3ZDQA 4LOAA 4XVQA 5EE3A 2ZYTX 4PC2A 1U8YA 1M34E 4OQLA 2WIAA 3MSXA 3TQFA 3AVVA 3DVLA 4GDFA 3M1IA 1G16A 3QBTA 4QGHA 2ZRKA 2F3RA 2BC9A 1KI4A 4XSHA 5G40A 2J87A 4WIAA 3RRYA 2OAP1 2JIZA 2RGAA 4Z54A 2QAJA 3LXRA 3I32A 4GNKA 4Z51A 3PV0A 1W1WA 3KQKA 2VTKA 3QF4A 1CF4A 4UNSA 4Q9KA 4GP7A 3AVOA 3IIKA 1C1YA 1GNPA 2EVWX 4DZZA 3FKSD 4LBZA 5JHHB 4M0LA 1FTSA 2FGJA 4MRRA 4DLWA 1OYYA 3AVYA 4Q1AA 4Q4HB 4JLOA 5SZIA 3RSLA 2C5LA 2EWVA 2QP4A 2VPPA 3W90A 3TIFA 2F7SA 3RS5A 3ZVRA 3PJRA 3TH5A 3KJHA 3TUZC 5E3HA 1FOEB 1P62B 2KWIA 1N2CE 1MV5A 4M9XA 1XDBA 2CVFA 1N0VC 1E9DA 2FPKA 4Q02A 1TQ6A 4PQYA 4RZXA 4NL4H 1YR8A 4L9SA 4YXWA 3D7MA 4UNPA 1LS1A 1GITA 4B3XA 4DSNA 3NTUA 4NYJQ 3LW8A 4NYIQ 3EX7C 3QY0A 1Z6GA 1T0JB 1GP2A 1GILA 2OXCA 3LAWA 1ANKA 5JWRA 4NMMA 4L8GA 5TB5A 3SJBA 4OKSA 1IHUA 3THWA 2VA8A 3OIYA 4PQFA 1X86B 5AWFC 1YHNA 2B6HA 1TAGA 1QHGA 1KMQA 1ODFA 1OIXA 3K9GA 3RVBA 4ZCMA 2IYRA 5KSZA 5D3MB 4GOKA 4EFNA 4LCBA 1MO3A 5CIQA 3CB4A 4A2WA 5B57C 3V4FA 1W2GA 5B2ZA 4B32A 1GIAA 1P2UA 4LJ6A 2Q3HA 4LHYA 3MWYW 5E7IA 2ZRFA 4PPNA 5L3SB 5FOVA 5EZ5A 4Q9LA 4Q7KA 1M6NA 2YKGA 2GKSA 2VP0A 1UKVY 3EIHA 4JYBA 5CYPA 3V9PA 3GJXC 1P2TA 4G01B 5HZHA 1FX0B 4L15A 4N0EA 5A4JA 2V6JA 5KSPA 2XAUA 4GP6A 2IYUA 4KLNA 3PUXA 3MLEA 4JLJA 4O3MA 2QMUA 3ZYCA 1Q57A 2ANBA 3BC1A 1DBSA 1EWQA 2F43A 2ODWA 3P26A 2OM2A 3KKNA 4MGYR 2ZE5A 1VYTA 3QF4B 3TQCA 3ZQJA 4QNMA 2ZRDA 2ZSDA 5CK4A 1GKUB 3SFZA 5EP3A 1G19A 2QMHA 2EW1A 2IX3A 2HYDA 1HURA 2QM8A 3QXSA 1LW7A 4JLVA 3KQLA 5LD2C 3B9QA 4ERNA 3GJ5A 5LB2A 2Q6TA 4H1UA 3GEEA 2GILA 3RRZA 3QE0A 4IOJA 2P67A 3OEED 3ZVNA 3NC0C 3W8RA 4B44A 2GA8A 3PUYA 2RGNC 3KQHA 1KMHB 1W4AA 4X8MA 4MYHA 3KTAA 4WXPA 3K70C 2JDIA 2CLSA 4YMVA 3CKLA 4PHGA 4A1FA 1QHXA 5FBLB 3WNDA 4U00A 2ZRAA 1E0SA 1FTNA 1HUQA 4P33A 2A5DA 4GOXA 3SYNA 1E2FA 1TF2A 3T61A 1X1SA 1VCNA 4X8OA 4TYQA 4YC7A 2YOFA 3MRSA 1XJCA 3QOFA 1LF5A 2B21A 2IL1A 2KBEA 1H8HA 1NSFA 2QENA 1IN4A 5AJZA 1KO5A 5D3MA 3TW8B 5KDLA 4D25A 1G8HA 1C4OA 3IO5A 2AWNA 2QRNA 4XVUA 2X2EA 2GZHA 3HR8A 4WAUA 4M1OA 5LDDC 3GJ0A 4JLBA 1U9IC 3ZZUA 4Z1MD 1NL3A 3LO5A 3NKVA 4GZLA 1A1VA 1GVNB 2O8CB 3RAPR 2QTFA 3G0HA 2A2ZA 3BH6A 1BMFA 1LTQA 1R5OA 5EXXA 4GMXA 5GJBA 1SQ5A 3UMFA 2LKCA 4IHQA 1RRGA 4OL0A 3R7WB 2Q3MA 2GAAA 4URZR 3L8ZA 1TQDA 3K0CC 1ZINA 1T3HA 3FHOA 1E0JA 4HEJA 2HJVA 4AIIA 1E79D 3TBKA 4M1TA 1VECA 2GCOB 3IO3A 2ORVA 4L9WA 1XEWX 4KHZA 4PSKA 4U7DA 2FDCA 2BEJA 4L5BA 2VSFA 2HF8A 3ICEA 2RH5A 3CPHA 4G5OA 3NH6A 2QT0A 3CNLA 1ZNZA 1JR3D 1HTWA 4XD7D 4BGDA 4BQSA 2O8DB 2IXGA 4AKIA 2PH1A 2QE7D 3H84A 2FSFA 4FMDB 3FMFA 4P3YA 1VIYA 2ZE7A 2JLSA 4QGGA 5J4KA 4CGZA 3LD9A 2VHCA 3TSOA 4KYUA 2YINC 1ZC3A 3O47A 4C2UA 1J2JA 4IJMA 3WXMA 3ZZ0A 1OH7A 2YNMA 3ZIAD 5J4VA 1G20E 4AC9A 2A5JA 1MH1A 4WZBE 3FB4A 5BWMA 1P72A 1Q12A 4NE2A 3ZH9B 3F8TA 3GLHB 2Q0HA 4RD2A 4OBEA 4JLMA 3RRMA 4C0LA 4EPYA 2XGJA 2JATA 1FL9A 5CM8B 1P4SA 1SVSA 2D4HA 2JEOA 3PUWA 3BB3A 4Q4JB 2EFHB 4EQ6B 2GXUA 1U8AA 1UDXA 3CRW1 4KJZA 2V4ZA 5IDVA 1F5NA 2B8WA 3PFIA 2P6RA 4C0KA 2FX3A 1NG1A 2XEXA 2K5UA 4GBMA 2AL7A 2BJVA 4AKHA 4M1YA 5KNBA 2VIIA 2QTHA 4EAQA 1GL9B 2BOVA 3OHMA 1EESA 3ONWA 1R5NA 3AF2A 5HKKD 5A0FA 4B2IA 2QP3A 1ZJ6A 3P32A 1P6XA 4XIGS 2O8CA 1WA5A 2NZ8A 4ZKEA 4TT3D 1T3SA 2OBNA 1P73A 1OXVA 2V3CC 1B23P 1S2MA 4QGAA 2BKEA 3U6KA 1GRRA 1ONBA 4Q66C 3A1UA 2UKDA 2FA9A 4BWYA 1G41A 4FCWA 4F4IA 1JAHA 1NG9A 2GCOA 2J59A 3DHWC 3AUYA 2J7PD 2H7VA 4AWXA 4Q47A 1EK0A 4FN5A 1N6PA 1NI3A 3BE4A 3SS8A 1S8FA 3A4LA 2E1RA 2X8AA 3I3SR 3BFVA 1Z8FA 2MSDB 1VCOA 1SHZA 4K81B 1CBUA 5DE3A 2XZPA 4KO8A 4PPFA 2RHMA 3P1JA 1T4GA 2QI9C 3A37A 4F91B 2PZFA 1BO6A 3WYAA 1WRBA 3ND9A 4BUJA 4EJSC 2ZS7A 3AKEA 2HXSA 3KUDA 4Q7JB 2RGGA 4C0BA 1DARA 2XB4A 3FPAA 2BMFA 4GPTA 2H5EA 3T35A 1E9AA 4WBSA 4BFXA 3M4YA 1VMAA 5BN4A 1XD2B 4RD0A 2V1XA 3W34A 3D3QA 4DLZA 1TPZA 4RJLA 4GOJA 1SGWA 1X8JA 1FW6A 2GZAA 1KTVA 3SZRA 3PCRB 1Z0KA 3U7GA 3K9LA 1OFIA 4BFZA 4V0LA 3KJIA 2XTNA 1G7SA 1PJRA 2G88A 2NPIA 2GRJA 5A5GA 4Q4JA 1TADA 3KFVA 4OK6A 3WNBA 4EQ6A 2HT1A 5FOSA 4EPTA 2CCJA 3Q7PA 1E69A 3FGNA 3DOEA 1CR4A 4ZDJA 4JLNA 4QNRA 1SKQA 4BLTA 1SVWA 3O8RA 3RWOA 3CWZA 5JS7A 5BN3A 4Q03A 3FKSA 1JXOA 1CP2A 4BZXA 1VG1A 1FP7A 3K70B 3R8FA 3GFTA 1KHTA 2ZSFA 2BMJA 2J3EA 2ZI4A 2ZJ2A 2FSGA 2DCUA 1TQ2A 1LB1B 5BW8A 2GVZC 2OCPA 4FW9A 1H8HD 4Q9HA 5K8IA 4MH0R 5J47A 1J8YF 4BPBA 2ZE6A 1J70A 1UF9A 3RABA 1ZM3A 4M1WA 3AKCA 4IDHA 2AFIE 4Q9JA 5BYJA 3W6PA 5L8VA 4B71A 2REOA 3KDSE 3L0PA 4FMBB 2GJ9A 1WB9A 3WBKA 1F6BA 1QBKC 2VSOA 3OIWA 3PIRA 2IYLD 3LH5A 4LK2A 3A36A 4BFWA 1AGPA 4RY2A 3CO5A 4G5RA 3T5DA 4WZAE 3LFUA 1XEXB 4RZ2A 1CTQA 1VTKA 4KYIB 4DEYA 1IAQA 4I1UA 4MA4A 2ZRBA 4KODA 4ARZB 2A5FA 2QN6A 1SXJE 1JJVA 2R2AA 5AJWA 3IPXA 5IT5A 4TL9A 3Q3JB 1N5JA 4QHSA 3ASYA 1IN5A 3VNUA 2QUZA 1NIPA 4TMWA 4A8JC 4Z8YA 4B35A 3ZD7A 1Q1ZA 3KQUA 4B76A 1Q44A 2C95A 2QQEA 3C8UA 2YVUA 1SKYB 3X1YA 5JRJA 3T1TA 2PT5A 2W0SA 2AK3A 4UNRA 2ODEA 2J0VA 2VHTA 4LJ9A 1NMXA 2A9KA 2QPAA 4BLPA 3QXHA 1NF3A 2OE2A 1QZXA 4UQOA 5EXSA 2YWGA 1HV8A 3EZ6A 4PQRA 2RGEA 3A1WA 5FR1A 3PUVA 2J46A 3WP0A 2C04A 3SBDA 1GNQA 2A5GA 2C98A 1NNEA 1GSIA 4MKIA 1XU4A 4Z8XA 4B3DA 4ZIRB 2E87A 2HT6A 3W6OA 4LBYA 3OZXA 3PR1A 1KY3A 3C5CA 4TQ9A 4OHVA 3SEAA 2IYVA 3W3AA 1XRJA 2BMDA 3Q9LA 3GLHE 2B7BA 3ZJYA 1WMSA 4HDQB 3BD9A 3GJ7A 3RHFA 4MUBA 4QRHA 3PG5A 1DAIA 4C7OB 4FMCB 1UFQA 1QVAA 1OE0A 4NPHA 4YLGA 2UZIR 1UBCA 4AG6A 2OEPA 2F3TA 1CEEA 2ZI9A 4DDUA 3U44B 1ZC4A 1UADA 2PEYA 2DBYA 4B3FX 1XX6A 1ZNWA 1ESMA 3VAAA 5IF9A 3IQXA 4HSEA 2P5SA 4PR0A 5KPDA 3QPWA 3F0TA 1FFHA 2V55B 4V0ME 4D6PA 5KDOA 3SQWA 1XTIA 3FFBA 2IEZA 1UPTA 4OK3A 2QT1A 2AN9A 1YVDA 4FCVA 3GLGE 1VYVA 2C03A 3K1JA 3QI2A 1E9EA 2W6JA 3P27A 4CDGA 3VKGA 4D4MA 2BBWA 2JLXA 5FTMA 5JI2E 1KI1A 1E4VA 3U5ZB 2F9MA 2DWOA 4S35A 2ZSEA 5AUPB 2XOKD 4OHZA 3CR8A 4ARZA 2FPMA 2J5XA 1L4YA 2XZLA 2F1RA 1BYIA 1M74A 1SVMA 4TLAA 5CM9C 4OQFA 2R6AA 1NVXQ 4PPQA 4Q4AA 2VYFA 1I2MA 1TEVA 1N5IA 3BS4A 2GF9A 5EP1A 4F38A 1D8TA 4WZ6A 2CHGA 2WAYA 4D0LB 2IHYA 1E32A 2EFGA 4K46A 4NDZA 3D8BA 3AVQA 2WWHA 4HUQA 4BFVA 1IOZA 3GJ3A 1CJVC 5L3RA 3QBVA 4HB3A 1NLZA 2X2FA 1A4RA 1Q0UA 4IKEA 5GVRA 1WE2A 4KI0A 1TU3A 5HKKA 2Z4RA 2WWXA 1OH5A 4NCJA 3E1SA 4Q5IA 2FE4A 1N6KA 4C4PA 1E0AA 3LWNA 5FUWA 1I4DD 4PO8A 1OKKA 4DCVA 3UWOA 2QL6A 2WJVA 3CNNA 1ZAKA 3FHTA 3B1XA 5JEEA 1ZD8A 4ZDKA 5BN5A 5FUXA 5FTJA 3EPKA 4FI3C 5FPKA 1W0KD 1US8A 4ZIRA 3EPLA 4Q1EA 1DAHA 1R5BA 4NP6A 2ZUBA 3X1WA 1WDTA 3R9WA 2CLDX 2CNWD 3B78A 3NWJA 5FTNA 3S1AB 1LS6A 4TYWA 1Y63A 1NN3A 2Q3FA 1E2PA 1G4UR 2GJAA 5DYIA 3ZVMA 3CF6R 4MKHA 3TMKA 1VG0B 4DIEA 3EPHA 1K6MA 1IN8A 4TL7A 4ZI2A 5D3QA 1JQJC 2IS1A 3H4MA 2X1VA 4C7OA 1II8A 2CDNA 2OLJA 3EIQA 5K8LA 4A36A 1OW3B 1XPRA 3O8CA 3B82A 2LWIA 4RFSA 5HCIA 4AYXA 3U44A 3AEZA 1QF9A 3BERA 5AJVB 1G7TA 4BASA 2H1LA 4W9MC 1H8EA 3KKQA 2XNSA 4OHWA 1S4QA 2CBZA 3MJHA 4A2QA 5AJYA 5JWOA 3TW4A 5DI9A 4PC1A 2WPDA 1CLUA 3GCGA 1ETUA 3EWAA 2YOGA 4PZZA 4AYTA 4O25A 1PLJA 2OFOA 1GAJA 2FN4A 2VP9A 4HATA 1ZUHA 3I1FA 1RW4A 1YRBA 3FHCB 2H16A 4RCYA 1NBME 4FMDF 1E1RA 2VP4A 4OI2A 4HLQB 3UANA 3HYTA 4M8NE 1OPXA 3WMFA 5HE8A 3UKDA 3VR1A 5P21A 2WHXA 2Z6VA 1F60A 1MRNA 1AK2A 2OCBA 4D80A 2WOOA 4A0FA 5TMPA 1P3JA 3FDIA 1W2HA 3FMPB 421PA 4E09A 3U2QA 1F2UB 2ZTSA 3MG9A 2OV2A 2OBMA 2QGZA 2RMKA 4LI0A 4RD4A 1Z63A 4Q48A 3DL0A 3HR7A 4LWZA 1Z22A 4HLUA 4XTRA 3B7GA 3I8XA 1NVVQ 2ZU6A 2YWHA 2ZRIA 5KHOC 2VEDA 4P4UA 1GWNA 2H57A 3ADCA 2NO9A 4QXAA 4JVNA 1OHHA 2VBCA 3VR3A 2Z0MA 3TKLA 4R7ZA 3VFDA 4G5QA 4EDHA 1CJTC 5C1BA 3BFXA 3K09C 2OAQ1 4P0TA 4JT2A 4H1VA 1US8B 1W36C 1V43A 1DO0A 5EXPA 4GRAA 621PA 2GNOA 4EFMA 3CLVA 5EE9A 5DYGA 3S1AA 5DLQC 2J0QA 1KKLA 4TTRA 2J9RA 2NZJA 3Q7QA 4IEIA 4A6XA 4BFUA 1N5KA 2QORA 1OFUX 3KXIA 5EP2A 1KIMA 4D81A 1R7RA 2QG6A 5ANRB 4G5GA 1SVKA 4AYWA 2FGKA 3SE0A 3AM1A 1XPUA 4HAYA 3A4NA 1G9XA 4FINA 1E3MA 3U3RA 2J7PA 2J0UA 1CR1A 2ZR0A 1UEJA 1GTVA 4Q1FA 5HR5A 3HPQA 5CB6A 1KI6A 1IJFA 1R8SA 4LRWA 4OI0A 1NSTA 2XTZA 1FZQA 1G18A 2HUPA 5TARA 3T5GA 4DJTA 3RS0A 3SR0A 1E9SA 2BBOA 2O8EB 2ZUCA 3HU2A 3GLFB 1ZYUA 1MABA 2BV3A 2EU8A 3OIUA 2G83A 4KBFA 3HU1A 2GBLA 3SHFA 2W6JD 3AQ4A 5HE9A 4CEIB 3TNFA 1G8GA 1M1YE 1YZGA 6Q21A 5DO9A 4BRUA 2J45A 2GK6A 2GXAA 4CF7A 1R0YA 1VYUA 4Q4HA 1KJYA 3LBNA 1KAGA 1KY2A 4BLQA 5C2JB 3I8SA 3HJNA 2C78A 3BOSA 3ICQB 1N5LA 1GKYA 4G5SA 2QMOA 2GVDC 1Z0DA 5KDDA 4B73A 2KBFA 4NCKA 3W6NA 3GLGB 2RGCA 3CF2A 4E5UA 1TTTA 4QBHA 2ORIA 3TE6A 1Z0IA 2O5VA 3G82C 3BJIC 3NBYC 2CK3D 3VR4A 1SXJC 2G6BA 3LBIA 2XNDD 3MMPA 4Q9IA 2FWRA 2WJYA 2JLVA 4CEHA 2FPLA 2ZJBA 3AH8A 2DHRA 3OAAA 1Z2AA 1DTSA 2P65A 5CDFA 2BM0A 3QXCA 2ONJA 4HAZA 4DIDA 3QVVA 1LF0A 5JI3E 1XF9A 2A7QA 3UPUA 1W36D 1LNZA 1XTQA 4KAXA 3PEWA 4A0RA 3B13B 4KFSA 3JVVA 4DLVA 2A78A 2ATXA 1NRJB 4A0GA 2FEOA 4PAOA 2IWRA 4DXAA 1Z2CA 2AX4A 1OKKD 3EZFA 1GDDA 1DAFA 4YDSA 2ZJ5A 2CMKA 1Q22A 1KK2A 4IDQA 4D26A 1ZCAA 2W0MA 3LVRE 5FPTA 3D6TB 2MMCA 4TYPA 2PMKA 4IVRA 1NJGA 3KL4A 3GQBA 1FX0A 3IBGA 2SHKA 2H18A 5GADl 1CJMA 1E2HA 4MRPA 2J0UB 5H70A 4TLCA 4QBGB 1J7KA 1QHIA 1FQJA 1XPOA 4C0JA 1TF7A 4JVMA 1G5TA 2PZGA 3LY5A 3LLUA 1BYUA 1QHHB 3CF0A 3VKWA 4BFYA 4UNQA 3QG5A 3PENA 3H1TA 2F43B 1OFTA 2O8EA 2FOLA 4HLCA 5KSYA 3M6AA 4NONA 1IXRC 1MABB 3K9HA 3SYLA 1XMJA 4J0QA 4CEIA 1U99A 3CZQA 2YC2C 1FUUA 3SU8A 3B85A 2LKDA 2CK3A 4HI0E 4UJ5A 1WP9A 1U9IA 2WV9A 1A2KC 1NP6A 1EXMA 1XD9A 4G3XA 4MKFA 5BYKA 1PVOA 3K0SA 1RJ9B 2VLIA 2OCYC 3GLGA 2RGXA 2WWIA 4LJ5A 3RS4A 1P2VA 4URWR 2VP5A 4JIMA 2RHDA 1XCPA 5JSZA 1NY6A 2QMEA 1E2EA 2XX3A 1CJUC 2Z5FA 1KK3A 1M7GA 1ZU5A 3KTAB 1P2SA 3FVQA 1GFIA 5FTLA 1OJLA 3CX6A 4MITA 4MGZR 1IN6A 3SDZA 4BFSA 5L3QB 4UJ3A 3HPRA 1YZNA 2HYIC 4M1SA 4MYUA 4CEHB 1LFDB 3SHWA 3NG1A 4KCGA 1JPJA 4WXRA 4LZZA 3IHLA 2JJ2A 5UKDA 2F1JA 2KSQA 3BH7A 3EG5A 2W83A 3AP2A 3CR7A 5GJWC 2BBTA 2OSBA 4OHXA 3I73A 4JBYA 4YQFA 2DYKA 1Q21A 4I1VA 3FKQA 4TQUS 4BECA 2DFTA 1SXJD 5C4GB 4F4JA 1ZUNB 4Y0AA 1RFLA 3DMDA 3G5UA 3EA0A 5CJPA 3X1ZA 4ESHA 4B34A 2ZAMA 1ZUIA 2RB4A 1YZTA 3C16C 1AKEA 3SJAA 4TLDA 1TU4A 3SNHA 1CU1A 1T3LA 3DEFA 5DH9A 4M2LA 1TUEA 1OB2A 5FL3A 1BKDR 4CEJA 1YZLA 5JWHA 2ANCA 1WCV1 3QENA 1P61B 3R7WA 3H86A 5K8UA 1EFRA 1GKIA 3BB1A 1MO5A 3CRMA 3NC1C 1EX7A 1KSFX 4C3ZA 2ZRNA 3T12A 1JR3E 5TDHA 4ACAA 4A0HA 1DE0A 1TUIA 1FP6A 1RYFA 3VMFA 2JJ1D 2PCJA 1QHHA 2QE7A 4JJZA 1D6JA 5IHPA 3F3YA 3KZ1E 4ACBA 3RSOA 4OQNA 3IGFA 1HQCA 5B30A 1VHLA 1JAIA 4TQAA 2ZI6A 3OF5A 5FPYA 221PA 3EC2A 2W6ID 3U60B 2VRWA 2ZRLA 4A15A 4PC3A 4GL2A 4IVPA 1A82A 4LC1A 5DI3A 2OUKA 1OFHA 2MMGA 3Q85A 1E79A 5GVSA 1VPLA 5JLJA 2QBYA 3MD0A 1XNJA 3MUFA 1R0XA 1WF3A 5FOXA 2E9SA 3K0AB 2W2XA 2ZI3A 2Z83A 1JEEA 4HB0A 4UXHA 1IY0A 4US2R 1KO1A 3MWLA 1E2GA 2EWWA 4IDPA 4ZPXA 3IIMA 1G21E 1U0JA 4IEEA 3RYTC 1NLFA 2W00A 4FMCF 4XH9B 2HEIA 3KKOA 3DZDA 3GLHA 2JLZA 3IPYA 4XD7A 1T8UA 3GJ4A 1W48A 1X8KA 4D4LA 4EIWA 2GZDA 2XSZA 2D3WA 3CUEF 3A1SA 1S1MA 3OFND 1UEIA 2VL7A 4W5JA 3VNVA 4NCIA 3HWSA 1OXXK 1DAGA 4C2TA 3BORA 2ZJYA 2FH5B 1T5LA 8OHMA 3FWYA 1YRAA 1HT1E 2C9YA 4HLUC 4LUCA 1SVIA 5KO2A 2YV5A 2AD5A 4IDOA 3VHXA 1KDPA 1M2OB 2ZI5A 4B33A 3QQ5A 2YZ2A 1ZNXA 5FOWA 3W3ZB 3AVUA 1NN1A 1ZMXA 2VHQA 2CE2X 4BRWA 1KSGA 2ERXA 2A5YB 3L43A 2AR7A 1Z6XA 4EPWA 3V00A 5J40A 4EPXA 4G1UC 3FMOB 4HAVA 3FMIA 3PEUA 4DEXA 1HE1C 2BBSA 5JS8A 5CB8A 1I4TD 2Q21A 3UK6A 2PCLA 4BZPA 2GAOA 4P4SA 4DUGA 4URXR 1YU9A 3OESA 3QPVA 1WBBA 1JQLB 1L2TA 1GNRA 2XITA 4E22A 3SJZA 4W7SA 2PLFA 1QHNA 3AP3A 5FTKA 3T1VA 4DLRA 1F48A 1XXHB 1IONA 1DG3A 2Y8EA 1G3IA 2KJQA 4FIDA 5CITA 2C9CA 1ZD1A 2G9NA 4HZUB 1ZD9A 4KFTA 1MRSA 1Q3HA 3K8YA 3OAAD 2VHJA 2ZJAA 2BKUA 2OO7A 5KPJA 3AV0B 5JEDA 2N46A 4RD1A 1UKYA 4IRUB 3OFNA 3WHKA 1L7VC 2BCJQ 3IHWA 3TK1A 4CT5A 5EZ6B 1Z3IX 2AXNA 3CBQA 3A6PC 1AZTA 1SXJB 2QBYB 3ZGXA 2ZXUA 1QHSA 2AK2A 3SC3A 1A7JA 3U7EB 4NU0A 3W8NA 5AJXA 3K0AA 5H1YA 1XFAA 2V7QD 4HB2A 4LHVA 4S2EA 3I5XA 2D7DA 3BXZA 3QKTA 5CYOA 4YONB 1G5PA 2KB0A 4D0GA 1LV7A 1E96A 3WY9A 3KB2A 1G3QA 4P4TA 2OT3B 4V0MA 4UKDA 5DGXA 3SFVA 3NVAA 2I3BA 3QKSA 3TGPA 1I4LD 5EE5B 2BVNA 2Q9AA 3LA6A 4DDWA 5F9HA 5HCNA 5JRZA 2GCNA 4LGMA 3OEEA 3TSZA 2HLDD 3QEJA 4P32A 2J7KA 2BM1A 2OG2A 2TMKA 5FOUA 2GEDA 2ZUDA 3UG6A 4NYMQ 4XWKA 2PX0A 4QKQA 2YJTD 4ASUD 4C0AC 1DEKA 5EP4A 4ZKDA 4ZV4A 4UXIA 4DDVA 1Z5ZA 1N3BA 4MQBA 4B2LA 3PITA 4OJKA 4D4KA 5CDFE 4FCTA 2AHOA 3LDAA 2RGDA 4IOMA 4QJ3A 1KI9A 1TL7C 3A58B 2D62A 4QM7A 1KI7A 4B74A 1Z07A 5FPSA 1KDRA 1C9KA 1XBTA 2WSSA 2EFCB 3N5CA 4F4CA 4YMWA 3B1VA 4BEBA 2ECKA 3UMRA 5KOYA 4UXJA 1R6BX 1MR3F 3KB1A 2VF8A 1G8FA 1EFCA 1CULC 3U61B 1GRNA 1CRPA 5CJ2A 1N6LA 2DPXA 3B1YA 3L2OB 4HUTA 5EE1A 1N6RA 3ZS8A 1N6NA 2I4IA 1U0HC 3P4XA 1XZPA 3DMNA 4HZUA 4IOLA 2WKPA 1W0JD 3GD7A 4TN1A 2CEAA 1E2DA 2GESA 5G3YA 2ODNA 1JPNA 4DLYA 1BOFA 2N42A 1W49A 1XCGB 1K5GA 2RKOA 1SHKA 4CRWB 2XB2A 3NHAA 4DSTA 3QUSA 2IUTA 1SXJA 1XTRA 3KXLA 4OI1A 1AGRA 3LNCA 4PC6A 4ASUA 3QG1A 1N25A 3ND8A 2ATVA 1F2TA 1DVRA 5F2EA 3IUYA 3PEVA 3BGWA 4JKIA 4R98A 4M22A 4DDTA 1G8PA 1D2MA 1G7CA 4Q4LA 2V9PA 3EC1A 4JT4A 3L8YA 3U3JA 2WWYA 3K70D 2IK8A 5EXTA 2IUSA 5BXQC 4GZMA 2ORWA 1E1QA 3QKSB 1XJ0A 3CNOA 4Q1DA 3CZPA 4NYMR 2FMXA 1NMYA 1E9FA 1KK1A 5SZJA 2BIFA 1R2QA 2OILA 5JECA 1Q3TA 3CPEA 3TAHA 3FYHA 2PL3A 1QHYA 1IY1A 1E99A 4KSCA 2GETA 3CWQA 2JAQA 2PX3A 3H0KA 1ZIPA 3ZZTA 5KNCA 2A30A 4JBWA 2IYXA 2JGNA 1VG9B 2Z43A 3K0EA 3DDCA 1U98A 1HQYE 3AKDA 4LV5B 5AUNB 1AA9A 1RKBA 4DSOA 1Z83A 1PUIA 2PEZA 3GLIB 2QAGC 4Y0VA 1E2NA 4Z1MA 1YR9A 1L4UA 1WXQA 3CH5A 1Q1BA 4HB4A 4LC0A 5IRCD 2CJWA 3GP8A 2W58A 3MCAA 2OLKA 4LPKA 4N0DA 5KTYA 4QFMA 1KZGB 4EUNA 1H65A 4PXAA 2AKYA 2OZEA 2LCFA 2PLRA 1QDEA 4JVLA 5AUQA 4O2LA 4ON9A 2NG1A 4DLSA 3BAFA 1E6CA 2R65A 2R6CA 4QG7A 1S0UA 4C0QC 1ZNYA 2WJJA 3GJ8A 1XTJA 3U3OA 1P5ZB 1W47A 4PHFA 3CRRA 3QNUA 2R44A 4JSTA 1MO4A 2NO6A 1II9A 1KDTA 5JCZA 5BQ5A 3Q5DA 3I72A 1KO4A 4HUQB 1NVWQ 2FEMA 5G53C 1R0ZA 1XD8A 4DLTA 1QRAA 2XZOA 2NO7A 1D9ZA 1ZCBA 3SI7A 3OIVA 4RCZA 1T91A 4DUGD 4M4SA 3PUZA 5SZHB 2RCNA 4PFSA 1Z47A 3THOA 3QSYA 2IYQA 2RAPA 4EKDA 3Q8XB 2ZS8A 4GMDA 5JZVA 2XXAA 1M8PA 2NPFA 5IK2D 1CIPA 4TMTA 2VH5R 3WNCA 2IBMA 3V4RA 4MGKR 2FZLA 1AKYA 4A82A 1DAKA 3MJRA 2GJ8A 1JJ7A 1KGDA 1XB2A 4NKRA 1GRQA 2CL7X 3TRFA 2CCKA 3EXAA 4LV6A 3VR6A 2PJRA 4B75A 1E9CA 5DNYB 4JJKA 2WMNB 4BE7B 1ZM4A 4XOIA 3AVWA 4PPGA 121PA 5TY0A 1GL6A 4RFSB 3GEHA 4PAQA 1YE8A 2YOHA 3TSWA 1E94E 2WJHA 4DBLC 5TVKA 2DB3A 1QG4A 3GLIA 1TNDA 3KFXA 1SKYE 5J5CA 3RLFA 4CVNA 1VDZA 1A2BA 4II7A 3PQCA 2CJWB 3A8TA 4QBIA 1P75A 1RE0A 3KXKA 4B3BA 4KFUA 1KSJA 3NEYA 1HEIA 4I1SA 2DWPA 4HDCA 4PHTA 4IFEA 2CLCX 5AR1A 3VX4A 1QG2A 4OHYA 4PSAA 4DB2A 4RKEA 2ZIAA 2PT7A 1G64A 2XJ9A 4W5WA 4B6EA 2HJGA 1KO8A 1Z0AA 2BCGY 1T5IA 1KSHA 5FUYA 4LYHA 2O8FB 2FFAA 2ZJOA 4IFBA 1W4CA 2GXQA 3LVQE 1AS0A 4M9SA 4NZYA 3THXA 1JALA 1F2UA 1YR7A 4HAWA 3CW2A 4HZIA 1UKEA 3I4LA 1AS2A 3KUCA 2GF0A 4XSGA 4DCNA 1W0JA 2HF9A 5JJKA 3B5JA 3JVUA 5DIFA 3C14C 1XWIA 2GHIA 4MGIR 1E4YA 4DC9A 4TZ0A 3R9IA 2WWWA 2F6RA 4IXNA 4BLOA 1E1RD 5DHFA 1X6VA 3CONA 5TV2A 4LBVA 2REXB 3LRPA 4LDJA 1OV4A 5FI1B 3CIOA 1AS3A 2C96A 1ELOA 1K8RA 3K0CA 2UVQA 3N2IA 4N1AA 4B43A 3QKRA 3GMTA 2WVJA 3MWJA 1S9HA 2AKAB 1TX4B 2V8OA 3EA5A 4LJAA 5KSOA 2F9LA 3LQQA 2WKRA 4FWTA 4CYMA 1T0HB 3REGA 2ZETA 2DFNA 4TMZA 3EASA 4DB4A 2NQ2C 1OXSC 2VP6A 4LHXA 1UBGA 3Q72A 5TXGA 3AF1A 1N6HA 1IXZA 4R2IA 4B47A 1JI0A 4MDFA 2OESA 1W36B 2V1UA 5H8WA 4BFTA 1HYQA 4X8LA 1JECA 3IKJA 2JJ2D 4P31A 4TL8A 4JSYA 3QPUA 5K8TA 4PAMA 1DO2A 1RRFA 1KI6B 4H9GA 4IVQA 2NTYC 4LV8B 4D82A 1IM2A 2D7CA 3GFOA 1JNYA
chains in the Genus database with same CATH superfamily
2O06A 4JXKA 5GJCA 4LF9B 4GZ6A 2IUEA 5D1NA 3U1TA 1GZSA 2BGJA 5MN6A 1I0IA 1ZSYA 1TMKA 2FSIA 3U4MA 1YC5A 1Z82A 3MJ4A 3M83A 1GNTA 3C7KA 4G1CA 4PY2A 4D8TA 2XMBA 3EQ9A 3QEBZ 1W30A 1FPMA 1SVLA 3DDWA 1SY7A 4WBNB 2BHRA 2OBBA 3IMFA 4FEYA 1ZN8A 4XWOA 5ERYA 5JJIA 2AXPA 2PUHA 2VYVA 3AM4A 3THWB 2GN6A 3WGMA 1K6XA 4IFIA 2ZUVA 4HLNA 4R9UC 4BVKA 2P6UA 4F11A 2C5GA 3OIFA 2QZ9A 1H2XA 1IQ0A 1UJ2A 2CNWA 3NTLA 3HCOA 3PGJA 4NZNA 2D5AA 2G72A 3OMWA 2AOUA 4IHJB 4CZ2A 1JJIA 4I99A 4XB1A 5IJ0B 3PWKA 3DVAA 4R4JA 4WI1A 3RS7A 4AFNA 5JFTA 2H0QA 1TCVA 2F3UA 3NJ8A 4MW9A 4YECA 2OB2A 4BVEA 2QROA 2HU7A 1I6KA 3QLEA 1K5PA 2XF2A 3F98A 2FZWA 3U7FB 3ACDA 1R16A 4JI3B 4F5DA 1DOAA 1AQYA 4I5FA 1UKAA 2VF5X 3BGSA 1BX3A 5K2MA 1IZZA 4DR7B 1X3LA 3FUWA 3N6XA 3NHPA 1Y7TA 3T7CA 4B48A 721PA 3GLIE 4RPJA 1LBEA 4WFJA 4MYSA 2G1AA 3L0ZA 4D5EA 5F1OA 2YV3A 1AM4D 3AF4A 1NYTA 1F14A 1SN7A 3GA5A 3RS3A 1ISFA 1HO3A 4G63A 4L22A 4ZOBA 4GR5A 1Y5IA 3UO8B 2HJ9A 3L0BA 4MVJI 1JXMA 3UJ6A 2ZANA 4BC0A 5IKMA 4WQMA 4B79A 3UATA 2IF0A 3CIFA 3M5WA 3DMPA 3ZBTA 2G70A 5H81A 1ZVQA 4GI1A 1J49A 4GVXA 3TR5A 1B6TA 3GYGA 1DV1A 2ENUA 2PGXA 1B3RA 4EHAA 4ER7A 4GMFA 5I4CA 3U6BA 4FCCA 4U02A 2Q4EA 3H9CA 5C7LO 2YMQA 3CY6A 5KVQA 1HTTA 3K92A 3FVRA 1QP7A 1ORDA 3NEJA 1BQEA 1ZM7A 5JAIA 2EJTA 1XZQA 4XWWA 2YHSA 4PM4A 4GX5A 3H2IA 1I2DA 1YUNA 4HXYA 4LWPA 4DKXA 2WINI 1E62A 4HS4A 3RK4A 1R64A 4ZP1A 3T15A 4NBSA 2OZKA 1J8MF 5GZ3A 2F55A 2FQYA 3FIJA 3B6EA 5DISB 4LXIA 3RC3A 3IAM1 4AP5A 1KMHA 1O4VA 1SKAA 2WOJA 3PZRA 2IF2A 4F5EA 1G5RA 3CISA 5JCXA 1IY2A 1ZGZA 2IW3A 2EGUA 5T4EA 5IZCA 4RV9A 1OLXA 3U7QA 3D1JA 5B58C 1IBLB 2DERA 3FX2A 2CB9A 2QQ5A 5DHAA 3WWPA 2ODTX 4YIHA 3ND6A 3HXLA 4GD3Q 1Q14A 3NCHA 4KE7A 3HXTA 4P84A 2WD9A 2Y0DA 5KKAA 1K8YB 1KMMA 1KMNA 1RVV1 2OBLA 3PQ2A 4Y3UA 1VPDA 3UV6A 4DT1A 4IDNA 4G9EA 1FDVA 1MJGM 1X38A 4XVHA 3L8CA 2WB4A 5K6AA 1V16A 1G5QA 1GL7A 3E3AA 3H5OA 5FR2A 5LXTB 1HE3A 5CVCA 2WFAA 4DY4A 2OFXA 2BGLA 3DVAB 3HVHA 1D2EA 2OHIA 3K9NA 2X4IA 2ZVPX 2ZRHA 4HN2A 4MA5A 5L3QA 3CNBA 3STHA 2HCJB 3R3VA 1I94B 4G1EB 2BMWA 4RHFA 1KNQA 1TMOA 2PMFA 2W2TA 3FSGD 3IV6A 4OLJA 3W5VA 3H2SA 1JFTA 4PZCA 1VSBA 3EQ2A 4RPIA 3MBKA 3ZI7A 4DRZA 1U3VA 2XRZA 1EDBA 1G8KA 5LIPA 5AW2A 5HK9A 3BRCA 3WB9A 2WZDA 2ZAGA 5I9NA 5J2UB 1DGQA 3I6IA 4G07A 3NGXA 4ENUA 1QLWA 3A9RA 2XYHA 1P0FA 1OIWA 5JH7B 1GG2A 4WNIA 3MPOA 5KKCA 3OBIA 3HSSA 3CTPA 1KERA 3A25A 5FBQB 3AO0B 1PL6A 1ODLA 3AT1A 2QTNA 1KP3A 3G9UA 4L74A 3WK9A 2YMMA 4QGSA 4GEGA 3ZS9A 2FPIB 2AFHE 3H2JA 4G81A 4KVAA 2SKCA 4LF8B 4POAA 1YVPA 1I7QB 3TXAA 4TLEA 1COWD 1YQ9A 5DU2A 4UZEA 5C5EA 2EEZA 3M6UA 1J0AA 2OQ2A 2ETVA 1T2DA 3D6NB 4Q1BA 5EYPA 521PA 4CMEA 4IRMA 4WZBA 3ZGLA 3TMAA 4XVRA 1OLOA 3D4PA 1U1EA 2HBQA 4UNIA 5T4BA 3GFVA 1BEUB 2C3PA 2VQDA 3RK1A 4D4JA 2H65A 2GEUA 2P4SA 3FE2A 5MFPA 1WDKA 1GZVA 4QM6A 4OJQA 1E1LA 4KQHA 3BTUA 2J8ZA 4R2HA 4C7KA 4DG8A 1S89A 2H85A 3E5NA 3RT7A 3TNJA 5J4YA 1GCAA 1A04A 3O3NB 2QQ0A 3A7EA 5IDWA 1GARA 2WYWA 3I2YX 5JFGA 1OLXB 2PZEA 1EFRD 4YIKA 4CR6A 3DM9B 3TL3A 3PWZA 4WFQA 2QPTA 2VZLA 4AY5A 3A10A 3KD3A 1DFGA 1JDUA 2FPPB 4R01A 4BZQA 3RYCB 3R5XA 1K5DA 1TVEA 3CH4B 4KDRA 4TSFA 3GUCA 4ED9A 2J9ZB 1Y7HA 1PSWA 1MFZA 2FW1A 4IUBS 4K86A 1FMCA 2BEKA 4KG7A 2JGDB 3EN0A 3JYLA 5E1BA 4DT1B 3NP7A 1H42A 3P9XA 4WW0A 3GFGA 1JBEA 3DEYX 3NDBB 3DFIA 4GGOA 5CDSA 2GEBA 1NN0A 2GPJA 3PXGA 3LYUA 1NKVA 2VI5A 3HM2A 4FFSA 3UAGA 4ESVA 1CUIA 1FJ2A 1OF1A 2H2HA 2GPAA 2QXUA 3HFSA 1NXTA 1HG1A 4QRDA 5EJMA 5LKRA 2EC5A 4HWRA 4Q18A 1O95D 2A33A 5IK2A 2YJZA 3PC8A 4IYJA 4L2IA 4TMKA 2WQ7A 3JYPA 3I6BA 5AHOA 5G2OA 4MAMA 1F1BA 5ALZA 3QMVA 3OC6A 2FFQA 3C5VA 4TKZA 5FQNA 2ZJ8A 4OGKA 4RTOA 5GINE 4P6VF 4B6PA 5BVHB 1XDUA 3W5IA 1XNGA 1G17A 2Q1SA 2QR2A 1H9AA 1I6WA 3VZPA 1PLKA 3EQ6A 4IG4A 2OV4A 2JFYA 1ZHHA 1M0TA 3KJEA 2KE5A 3L8FA 2GX6A 2WJWA 3M9XA 3P0EA 3A6ZA 2BFBA 3VMMA 3RUPA 1RZ3A 1O5IA 4AK9A 4XI9A 1HA3A 3H2YA 1V6CA 4G0NA 1Z56C 2FPGB 1VKJA 2ZXFA 3LCJA 3OHSX 4A6DA 4CNBA 4JOSA 4DXDA 3AY6A 3DKPA 3N2ZB 4ZV7A 1BD4A 5CP8A 1HMYA 2X7HA 2O3RA 4NBWA 1Z37A 2Q6KA 1LVGA 4BNLA 2YHUA 3KU1A 4UUOA 5E3IA 3A6HA 1RWKA 3ZVLA 2PBZA 1D04A 3D7KA 2IWHA 4YRBA 1ECFA 4HYYA 1UFKA 2FPWA 1AF7A 4NNJA 3SBEA 3MPUA 3F6BX 6YASA 2UZ1B 1IE3A 2WI8A 3OKAA 3SQOA 4CIDA 1XZJA 1II0A 4UMVA 4EJ0A 2M98A 4JZYA 1DL5A 4JZKA 1DUIA 3H87A 2IPMA 3NASA 1OZHA 3C3XA 1XD2A 2DR3A 4WT7A 1PLLA 5HJ7A 3OP4A 2HWKA 2X86A 2CHEA 5AW7A 5KWJA 4LZWA 3KOOA 3B1ZA 4HNTA 2IYYA 3SDBA 4ARUA 5FI0B 4HR7A 3WBJA 1CQPA 2AJ8A 3QW2A 1POXA 3X1XA 3OIDA 4YXWD 1EK2A 1QV6A 3RVMA 4FOTA 4Z3KA 2DHQA 3ZCRA 3DZ8A 1D1SA 1U1CA 1OZFA 2GD2A 3KLNA 4PZYA 5FCDA 5EIBD 1UJ4A 4R0MA 4RXUA 3RARA 1AMUA 3C98A 1FYFA 2IEBA 1M8GA 3E58A 5B1EA 1Z08A 1IPEA 2CXSA 3C1AA 1PJBA 3QIVA 2EYQA 3G1WA 5FWDA 1YJ5A 5MHTA 1P1FA 3K4HA 4YN3A 1UWKA 3R3ZA 2R85A 4Y98A 5JD4A 4IIHA 4AIRA 1NMZA 1YC2A 3JQ8B 4KAJA 2D5CA 3H3JA 5JCOA 5MN5A 2FSSA 1ND5A 2XA9A 1MX9A 3L7IA 1J8DA 3SR3A 2GD6A 3DOFA 1N8SA 3C4JA 4RF2A 4ZQGA 2PMBA 1E4EA 3U81A 1CZLA 4RK7A 4YRDA 5JVDB 3QXXA 4GM4A 1MVLA 2NO4A 2EFDB 1BH2A 3NHBA 2J4FA 4HNAA 4OJYA 4WEOA 3V1UA 1UBEA 4WBNF 4J0JA 2ZEJA 1CY6A 3THRA 2IELA 4EEZA 3IAHA 5CM2Z 4DWJA 4DVGA 4RENA 3BWVA 5EUCA 3AM5A 2ATCA 2E82A 1JH9A 2IS6A 4I1OA 1Q7EA 3DYVA 4IGAA 2JFHA 5K4AA 4KR0A 3UUWA 3QRWA 2MU1A 4FS3A 1Y3CE 1SHJA 4CCYA 1C0EA 2VJMA 4A8JB 4DLAA 3DR5A 1GT6A 4EX7A 3HDTA 2G77B 4QATA 5LMZA 4L6CA 4NCXA 1W5AA 3CM0A 4GGMX 2ERYA 3IDQA 2FV8A 5EKXA 3RVDA 3T54A 5KTPA 1I7SB 2D06A 4GPIB 4TYMA 5I5GA 1UH5A 2B5OA 2WIGA 4P7FA 1LX6A 3LV8A 3ZDDA 3X1DA 2EW2A 2Q3JA 4JBXA 5FUQA 1CP3A 1VM6A 4GECA 2XGSA 3SDSA 1DU4A 3BT7A 1DIRA 1NUAA 4MDEA 1GAXA 1T4MA 1C3XA 2FMHA 2KLBA 1Z26A 2QW8A 3PWSA 1ZCJA 2NAFA 3WRXC 1WSDA 3JZMA 2W6PA 4FKZA 2WT9A 3B6KA 3D02A 4HJXA 3EYAA 5ENZA 1B4DA 3LDGA 4Z3DA 2OOKA 2O5RA 2GJSA 3C15C 1BE6A 3VR3D 4EUSA 4V1CB 5DSZA 3IA2A 3REFA 3LQRA 1VCHA 4E11A 4XB6B 2G76A 4UDNA 1R4MB 2DWQA 2Q49A 4DWVA 1K86A 2FLWA 3DE4X 3UMYA 1EK5A 4XYLA 2ERCA 2L18A 2PJZA 4TQGA 1CR2A 1NVGA 1YQEA 1CCWA 4YRFA 5AXAA 1FNCA 5HJ2A 3IQWA 3RODA 4LRQA 1R10A 2AYYA 2GPSA 4IY1A 5EFZA 1KOFA 3NIFB 4XJXA 2ZSIA 2ZT5A 2PA3A 5C46F 1GPYA 4MPRA 3BVPA 4BV9A 1QWSA 1NXPA 1UDWA 3BEDA 1L7RA 3EBPA 1PZNA 2OCIA 3MMXA 2ZUSA 3AXSA 3P52A 5ER6A 4LVOA 2X0RA 4MRSA 4RANA 3RKRA 4DCUA 4F97A 2C77A 2XJ4A 1MOPA 5AJUA 3PQ5A 4LN1A 3QVUA 2EWMA 3VU9B 2O8BB 1TPYA 3RGWS 4LXHA 3PLNA 4YRQA 3CGWA 3TZ6A 3LPDA 1PJZA 1EGMB 5HZMA 3ZHYA 2P3LA 1U7TA 2ICAA 3B3FA 3OPNA 3M0EA 3HDVA 4I4IA 3NB0A 4FIZA 4R2JA 4BYMA 1AMNA 3LG2A 2H59A 2OP0A 2WA1A 3LUFA 4MJ3A 4KPYA 3CRQA 3TTWA 1DQSA 2O14A 2EGHA 2V5AA 4FWBA 2I1LA 5M04A 1UAAA 1ZBQA 4C07A 1RBZA 2X42A 3LYLA 4GT1A 4A4DA 3H97A 3MQ4A 4XDGA 3GOQA 5EUQB 3M1AA 4MRAA 5BR4A 1T6XA 4N5LA 3E6AA 4B6GA 5BV8A 4CCYB 1FXWA 4FDLA 5CT4A 1KDYA 3Q98A 1PN3A 3WA7A 3PGXA 3WKAA 2AI2A 4F84A 4I2NA 5K3FB 4FGZA 3KSDO 2GHQA 3I5AA 1N2CB 4JL6A 2ZZKA 4L5YA 1CS4C 3E7XA 1LI5A 1LI4A 3TM4A 3D8SA 4B80A 3FPEA 4N49A 2BISA 4Q3LA 1BDMA 5DSTA 3UMBA 4C4ZA 1ZU4A 1O87A 3G2NA 3KAQA 4MWSA 1V9CA 1LTKA 2AD1A 3A32A 1I7PA 1WABA 3GR6A 4BCDA 5ITZA 3DZBA 5JALA 3ZU4A 4JVSB 3TQTA 3QX3A 2R5NA 3DOIA 4DMFA 5IUKC 4DM3A 3H5IA 1KR2A 1UPBA 1Q84A 3VYUB 1Q6YA 3DONA 5K3EA 2VATA 4XKJA 5IVDA 1V3TA 4RH1A 5F3WB 1X14A 4FLEA 1HGXA 4LYAA 3HYRA 3VR5A 1WXHA 1LQ2A 2DU8A 3IMEA 4XGNA 5ALIA 5HHTA 1RTKA 3WI7A 4FWIB 1CY4A 1XYVA 1RQ2A 3O75A 4U5XA 5K7SA 4CT4B 2OOSA 4FKBA 1KAMA 2Z3VA 1DFHA 4NK4A 1SCQA 3O8BA 3M3PA 4RTQA 2JGMA 2CVHA 3G2PA 4ND6A 3WGNA 2P5TB 3HB9A 4FE4A 5FHRA 1M67A 4DRXA 4IJKA 4B6OA 2P27A 2RHJA 2D1YA 4RE5A 4MRNA 2DFKB 4X6XA 5AKLA 3ET4A 1ZCFA 4DANA 2A1TS 3ETNA 3BK2A 2B2XA 1TK9A 4DHEA 3LX8A 3F5FA 1EG2A 2OZVA 1Y3AA 8ATCA 4JP1A 1H5NA 3RYFB 1YONA 1JJBA 3INNA 5HX7A 5AFSA 3SC4A 4U2GA 1M2VA 2IH4A 2HLDA 3DO5A 3TYXA 1FNSA 5EWLB 2MINA 1Z8DA 2ZZNA 4CL2A 1W0KA 4EJSA 5C81A 4PXYA 3B60A 3JTEA 5LZ7A 1NVMB 4X8HA 2RKBA 2R25B 6ADHA 1UQTA 4QUDA 2BHSA 4XM2A 2JJ1A 1QF6A 1NKSA 2XSZD 4ZVUA 2ODBA 3NONA 2QY9A 1B1AA 1G63A 1FRNA 3HA2A 2SKDA 3NGMA 1FY2A 2Q2VA 2V6BA 4DLBA 2JIZD 3DKVA 3ORRA 4AJKA 4Q19A 2I3DA 3WLTA 4F6RB 1GCOA 2V7QA 2WRZA 1V5WA 2PUBA 1NBMA 3L41A 1JG1A 2WM9B 3OX4A 1QYRA 3GFPA 3WLEA 2GASA 4JITA 1L8QA 4HAXA 3VJMA 4C20A 2BWJA 1NXOA 1P74A 3NU1A 1TYAE 2QN8A 5BSUA 4CM3A 5JDCA 1HT2E 1FCJA 4V03A 2IDKA 4UCXA 3RIMA 4YV1A 2OXFA 2CLIB 1Z73A 4F4UA 1YJQA 3RWMB 2CC2A 3EVCA 3KJNA 4IGIA 3P4YA 1N6IA 3VR5D 1L3IA 4AZVA 2OHGA 3ECCA 3DBIA 3I2FA 1S01A 3ENWA 2AG0A 4LE1A 4CG0A 5DMXA 4E12A 1G3MA 2W2LA 2JLCA 1VHTA 2QJWA 1P9NA 2VWQA 2YHIB 4J0IA 2D5LA 3C7AA 4KVFA 3RT1A 1RSZA 4YAFA 3GRCA 3TKYA 1T6NA 4GI7A 2XEDA 1OHHD 4KBGA 2VSXA 2QZJA 4LHWA 2BFFB 2OHFA 1X80A 3MBIA 2PGLA 3OQBA 3MA0A 4P92A 5DYTA 3UB3A 2ABWA 1V39A 3P2KA 3T1OA 2HXYA 5IDYA 1AKNA 1QV7A 5DKFA 2HCBA 5CA0A 5HKOA 1GXSA 1IBRA 2Q8QA 1ULHA 4OU5A 4IOKA 4B2YA 1QKJA 2L42A 5BSFA 1PQ4A 1S2OA 2VZEA 5HQJA 3V1TC 3GAZA 1UIRA 3K8OE 4BAGA 2EBWA 1USIA 5EPEA 4CMIA 1FMLA 3KWMA 3GFSA 3ZNNA 4AJJA 2VAWA 3NHZA 5A5VA 5JCPA 1VIAA 4Y7DA 1ADBA 1UDCA 2ZWMA 3F9CA 3PNLA 1GZHB 2QNRA 5A2GA 4WUVA 3EPJA 4Q01A 1PVVA 1PZXA 1E6KA 1XZAA 1MKYA 2Y1DA 3ZKWB 1ZESA 2G7ZA 1VJTA 2XBLA 3UXMA 1N8NA 1R00A 2QA5A 1JZSA 1PUXA 1L3CA 1TMGE 2R6DA 2G40A 2M1ZA 4IXMA 1T6BY 5LBUA 4C0HA 4CWAA 4AKEA 2G80A 4DLUA 2D2FA 3GVIA 4X0EA 5CAEA 5CFQA 1J5EB 1O4WA 1YVUA 2OHHA 5FWYB 2RJNA 2QRGA 4QU8A 1CRLA 1ODJA 4QDKA 2ZT8A 4EJSB 1G291 4IM7A 3UAYA 1BEEA 13PKA 3EHEA 1RC8A 2FJUA 1U9JA 2AB0A 3ESAA 4J7UA 1D1PA 4BWVA 2OHVA 1YMQA 4IO0A 5GONB 2XMPA 1CFZA 4Q34A 3VNQA 4ID9A 4PCVA 5ES3A 3SYMA 4L4SA 2WIAA 3MSXA 4OP1A 3AVVA 1VPEA 1UT5A 3DVLA 3QTLA 4KXLA 5DP2A 4HMOA 5F1PA 3PICA 2ECQA 1NW8A 2DTDA 2Y3IA 4PAGA 4QGHA 2F3RA 1IZ9A 3C87A 3R0JA 3FY4A 1X1AA 4XSHA 5G40A 4YV2A 4NMXB 2J87A 4WIAA 3THXA 4PXSA 3C7DB 3N58A 1SUCA 2RGAA 4EHBA 3I32A 3CLKA 2XY4A 4EYSA 4Z51A 2VTKA 2RGYA 3QF4A 4ZVSA 3X2EA 2O9JA 2R4QA 1TCAA 3U19A 1U3FA 3VVMA 3AVOA 2W37A 5K1ZA 1Z75A 2IPLA 2FUEA 2A0XA 2EVWX 1IMJA 5IEBA 4YQZA 1FTSA 1M3SA 2DUUA 4JOBA 3AUKA 5EAIA 4KP7A 2A88A 2YHIA 4JBHA 1HDYA 1AG9A 3AUAA 4TXNA 1BS2A 5LZ8A 2VPPA 3LQKA 3TRKA 3QV2A 5NLLA 3BL5A 3RHZA 3KOXA 3PJRA 3LC0A 4Z9BA 5B7GA 4B84A 1PT7A 4R2LA 5K8CA 1GGJA 4UM5A 5T6MA 5BVGA 1QYDA 1X80B 1Y1RA 1N0VC 1QO0D 2DPLA 1LC3A 1TQ6A 2ZJ0A 2SCUA 1BC5A 2IXBA 4NL4H 1UPCA 1IBMB 1GYRA 3MAJA 5CH3A 5KCMA 4B3XA 1EJ6A 3NTUA 1FU4A 3A6FA 3GGDA 3EX7C 1T0JB 5E1DA 2HRZA 2RBKA 3MAGA 3PGA1 2B34A 2FSVA 4WBNA 2FEAA 1DEXA 2YIJA 4N18A 4NMMA 3SG0A 3SJBA 2VQ6A 4CMIB 4F9EA 4D99A 2FCAA 2GTIA 5ALNA 2AKEA 2X1HA 5A4AA 3DEIA 2B6HA 2Z8YA 4H3SA 2ZYSA 1KMQA 4LHEA 4ZCMA 4CM6A 2IYRA 5B7PA 4TLLB 4KPUB 4OAOA 5CNKA 2AFIA 4AMYA 2LGJA 2FRXA 4CKEB 4CU2A 2CV2A 1HTBA 4ARSA 2OHOA 3CB4A 3PFNA 4IZOA 4WKNA 5AP9A 4B32A 1J7JA 1GIAA 4IV8A 2V6FA 4JV5B 5IVKA 4X61A 1DZIA 1H4VB 1LUAA 3I8OA 4PPNA 1HDGO 4S1NA 5EZ5A 4Q9LA 4BO9A 1QRDA 2PX5A 1GGVA 4KXNA 3AJ9A 1M6NA 4YAUA 2Q6VA 3IB3A 3EIHA 3HY6A 1XA3A 3V9PA 4AMUA 1U0FA 1XCOA 2FEPA 4KIJA 3RFXA 4DILA 2Q7OE 4G01B 5HZHA 4ETIA 3LL7A 1C2YA 2QD2A 3NOVA 4IVNA 3OQPA 3IVCA 1FRVA 1ZA2A 3CUYA 2IYUA 1VKNA 1XZDA 1I32A 2G25A 3I9V6 1SVNA 5A7GA 1T8PA 2VJOA 3WRVA 4KXVA 2ANBA 5AXDA 2HF2A 3T5TA 1Y9JA 2PD3A 3B9BA 3CWCA 4OL9A 4RL4A 4LYEA 4UAUA 2YNMD 4E5PA 4MGYR 1BMDA 1P1BA 4DSZA 1GV1A 3TQCA 2ZRDA 4LWOA 1S3IA 2ZSDA 1JEQA 2LCQA 1X42A 3ROZA 2HV9A 2JKYA 2EW1A 3DV9A 1WUJS 3GLSA 3RJ9A 5ICCA 1LW7A 2JIPA 2VJDA 5ALUA 1SURA 3K96A 1DPGA 3NJRA 2BGNA 3C43A 2QZPA 4JLVA 4BX3A 4AJ4A 2JC3A 5KTRA 3AF6A 2DE0X 2Q6TA 3V7NA 3DE0X 4C04A 4J1TA 1GR1A 1SVUA 2P67A 3ZVNA 3WFJA 2VPQA 1X7WA 2YJ4A 4RZIA 2GA8A 3C5WP 3OQMA 4WY2A 5J9FA 3T7IA 1KMHB 1PU2A 1W4AA 1YS2X 3NAQA 4PLZA 5KQGA 3KQHA 2G8NA 3AM3A 3RJ5A 2JDIA 3U7QB 2G4CA 2EGGA 1VSQA 4PHGA 5J1TB 5FBLB 4A1FA 3NRJA 1L5GB 4EYKA 3MJSA 4U00A 4D43A 1F06A 1TC1A 3H7AA 3TCXB 4BLWA 1HUQA 3EG9B 4P33A 2A5DA 1A3CA 3SYNA 2YXEA 1E2FA 5EHQA 5B55A 1CIVA 3CW8X 4M0FA 1NXWA 3T61A 4D9JA 2VDWB 1RQGA 5FJJA 5K09A 3NP9A 1OPRA 4YC7A 5A02A 1RACA 2YOFA 3MRSA 4B5KA 1N77A 5CURA 5LJIA 1P2GA 4FR2A 2KBEA 4WVLA 5E0KB 3UY4A 1NSFA 2QENA 3U0BA 3R0VA 4GNRA 2CXRA 1JWLA 1JDBB 2AFIB 2X2EA 4RUKA 2WVAA 1KZ6A 2PXHA 2UZAA 3NHLA 3M49A 2BAGA 3OCYA 4I36A 2NU7B 3TRJA 3WAKA 2XQIA 1L5NA 3I30X 4Z1MD 2C0QA 3PUHA 2O8CB 3GUHA 2V3VA 4X1YB 1T5TA 3LCRA 4MCJA 5KOJB 1A1VA 3IHKA 2FE1A 2QTFA 2P9TA 3RU2A 5H9VA 3BH6A 1BMFA 3G0HA 3JVEA 4NEHB 2IHVA 3PE3A 4DR5B 1IPFA 4F2WA 3FWNA 2RHTA 2M6LA 4OL0A 1RRGA 2R66A 4YUWA 3TZBA 2Q3MA 1PQPA 3FZYA 3FNEA 1WNTA 2PV7A 1OI2A 3N3BC 3ICOA 3L6RA 5DHTA 4NIMA 3VPGA 1E0JA 4URFA 3TG2A 1W8IA 3WC4A 4AIIA 5JH7A 4LNUB 2GCOB 3U4HA 3IO3A 1WMAA 3QWHA 4L9WA 3KYDB 1X7XB 3MGGA 4PSKA 2DUMA 1J24A 2JNWA 5BUSA 1SBHA 3RQSA 3E8SA 3CPHA 4G5OA 1FFWA 3NH6A 2XLCA 2QT0A 2PX4A 3RJTA 4UTRA 4UUNA 4EY5A 4H6PA 4BGDA 3AY7A 3C85A 3PCTA 3UMJA 5LP6F 4AKIA 1E7YA 4E3ZA 3PRKE 2QE7D 3H84A 2FSFA 3VGJA 4FMDB 2D0IA 3FPFA 1SUDA 2M2IA 3MTJA 1TGYA 2IV2X 1G20B 2AZTA 4HBGA 4PRKA 5EYPB 5FEMA 4F5YA 3NAGA 2L17A 5C5CA 1MGOA 3HXOA 2VHCA 2ZYAA 5AOAA 2AMLA 5JQGF 3O47A 4YRZA 2BGGA 2QYTA 3FZQA 1QFXA 5C0OE 1GQRA 3B7PA 3FGZA 1UPXA 3ZZ0A 1QS0B 2AYZA 4M87A 1XJWA 1V35A 2YNMA 3ZIAD 1OLUB 2C4VA 5T7BA 2LIVA 4OQPA 3R24A 2VDRB 3GLVA 4YWHA 3LHSA 4N5NA 2HCFA 3SQDA 4AULA 2IHNA 3HFRA 4MS1A 1OY1A 4EM6A 3D5TA 4C14A 4GYWA 1WPXA 4NE2A 5G1NA 3FETA 3P9YA 3F8TA 3PC6A 4FB5A 2RB5A 4RD2A 2FEKA 4ZT5A 4C0LA 4JLMA 4LOHA 2J9YB 1P6QA 2FPPA 4D46A 1OA0A 3PUWA 2D7JA 1AV7A 3FNFA 3WGKA 3R3JA 5E9AA 1QJ4A 1BE8A 1CPYA 1E6UA 1NUQA 1UDXA 3CRW1 4KJZA 4CIYA 3BGDA 1F5NA 3NNNA 4X24A 1VJ0A 2ZUWA 2DVMA 3SJ7A 1LK5A 4LVNA 3HCNA 5BN3B 2GYUA 2FX3A 3VKUA 2XEXA 2K5UA 3BK1A 4KGZA 3RGGA 2JG3A 1B00A 3L49A 3UYKA 5BSHA 4JC5A 4LXXA 3L92A 4FHZA 3ONWA 4LDNA 4L2IB 3ZLBA 1QYXA 3HDJA 3BXXA 2FR0A 2NUAA 5A0FA 4V2IA 1NJ5A 3V97A 3L8EA 1M5TA 1WA5A 3GK3A 2EZTA 3VYSB 1YO6A 2OBNA 2IZ6A 3O4FA 3OZBA 3R5JA 1WS6A 4OD0A 4R41A 4CHTA 1S2MA 2V3CC 4O2BF 4QGAA 2BKEA 2QTAA 1ONBA 3IBSA 3R40A 4Q66C 2BEWB 3WKEA 3VNAA 1WAMA 4BWYA 4F4IA 1IXKA 1DCMA 3A3KA 2QB5A 1JAHA 2L69A 2GCOA 3DHWC 3SZOA 3KM0A 1WM1A 5FYDA 5CDUA 4AWXA 4N54A 2BFBB 1K0FA 3P8ZA 3QLVA 3S1SA 1T6YA 3SC2B 1BQ4A 2HKIA 3F97A 1Z6ZA 5LMCA 2FPGA 4XD2A 2IGTA 3BFVA 3GRPA 1XYYA 2EIXA 4YDRA 5SY9A 5D8DA 5EUBA 1FSPA 4GOND 1VMIA 4BQFA 1YF3A 1M33A 2RJOA 4YCDA 1CBUA 3KWLA 5DE3A 2XZPA 3INGA 2HTFA 2R8OA 3IQHX 3P1JA 4KO8A 5JVDF 4EW1A 2QI9C 2A59A 1VP9A 3A37A 2WTMA 3O84A 4BDTA 3F78A 1DCKA 4EJSC 1PJQA 4ESEA 3VJLA 3AKEA 3K16A 3MN1A 3Q15C 4TS9A 2UZ1A 3AWIA 3KUDA 4U2EA 2DECA 2QX4A 2XB4A 3ZZNA 4DV6B 2JZCA 3FPAA 1K6JA 2BMFA 3A2LA 5CH8A 3ZWPA 4BFXA 1NVKA 1TECE 1K6EA 4K6GA 1GSHA 10MHA 1GYPA 1VMAA 2QE6A 1QS0A 3GFRA 1V95A 1XD2B 4NESA 1C1HA 1C8KA 2X23A 4EYEA 3STYA 2FVXA 4GOJA 1X8JA 3AKZA 1FW6A 1AK1A 1JYFA 4RE6A 5AVTA 2J3IA 4LKRA 3N0WA 1MXFA 2HMUA 1C50A 4MVJG 3JQ9C 2V9CA 2X6RA 3M9LA 2DPYA 4V0LA 3KJIA 2XTNA 1HG0A 1G7SA 1LRKA 1PJRA 1RPJA 3CSSA 3DMRA 2G88A 3Q3GE 4BTVA 5F4ZA 4OY3A 1VE1A 1OJ7A 4HHEA 4ZGGA 4UFPA 5I4KA 3HSYA 4H3KB 4I50B 4U1RA 4FHDA 5KAPA 1XLUA 1JDJA 1XAHA 2QTRA 3M6FA 1CR4A 2QRKA 1KBZA 4QNRA 1SKQA 3IT0A 1SVWA 3WNQA 4Z0NA 3FNIA 1X0VA 5EJ4A 1L5KA 1YB5A 3PXBA 3ASVA 3JRNA 4CMBA 1FP7A 3PQEA 5IG2A 4GKBA 2BMJA 1V8BA 1HORA 4Y67A 4QYSA 5BW8A 3IV9A 3EQ7A 1UK8A 3AUUA 4D1YA 5FLXA 2OHXA 4EGSA 4Q9HA 1SG6A 1ORTA 1S8NA 1DX6A 4MW5A 1GCGA 4C7VA 1EE2A 4DNOA 1QCYA 4EZIA 5ES4B 1C3OB 4BPBA 2ZE6A 5CVJA 5IBPA 2B0JA 3HKCB 2VH1A 4AM8A 3ODGA 4O4JB 2GAFA 4IDHA 2YMPA 2WTXA 1V1RA 1C7EA 4Q9JA 1MAUA 5BYJA 4I3HA 1P1JA 2BEWA 2JI8A 4WLOA 1KIAA 2LPMA 3UHAA 4NK5A 1CS0B 1A97A 2REOA 3KDSE 4NJEB 3L0PA 2COUA 2D5BA 2GJ9A 3EB9A 3N6VA 3WBKA 5IT4A 1F6BA 2F8MA 1ISIA 4Z4QA 2OLEA 3WZMA 1GL3A 2HA7A 1A8SA 3KDAA 3KR1A 3OLYA 4LK2A 1C9MA 3A36A 3GJYA 4WESA 3U9LA 1RS0A 1AGPA 4NWIA 1Y7LA 3HCAA 5B3JC 1PJLA 2X0JA 1GU0A 1CDZA 4IWXA 4KYIB 3CUTA 5LVAA 1KEEB 1STOA 3ICVA 1XA0A 2ZRBA 2YTZA 4KODA 5JAMA 2A5FA 2QN6A 2ZB2A 1SXJE 3ICPA 5IVIA 5IT5A 4TL9A 1A9QA 1ESZA 4TZKA 1IN5A 3PX2A 5I9SA 3ZY3A 4BMZA 3VNUA 3RAJA 3O7WA 3A26A 4A8JC 1J39A 3Q7TA 1NQOA 4BTEA 3FCYA 2J85A 3OQHA 1JG3A 4TTSA 3I9V1 4UATA 5KHLB 3WR5A 4W99A 1JT2A 2R1ZA 4E2WA 3IBTA 2F1KA 3KSRA 2XTAA 2QLLA 4WECA 1Z8NA 4CUJA 1ECBA 2G17A 2RI0A 3A7DA 4XDYA 3X1YA 4LVCA 5HK8A 5LU8A 3T1TA 4GR9A 4Q3CA 5E4TA 3AR9A 4PVDA 3EFBA 2AK3A 3QLUC 4UNRA 5TQ0B 1E3SA 2GO7A 1YGYA 2ODEA 2VHTA 2A9KA 2QUJA 2QPAA 2IXAA 4LJ9A 4MNTA 4G97A 1UAGA 5EZYF 2XQVA 4BLPA 3DDSA 4EHKA 5IUNC 2E5LB 1DV2A 1RHUA 2EX0A 4PQRA 3A9WA 3AI3A 3PUVA 1BVHA 4GU5A 2H2DA 1W6RA 2WIFA 1ECJA 2OB1A 3V8PA 4N41A 3WFZA 2C04A 3E35A 3HZRA 1MG0A 2A5GA 3IJPA 3MMSA 1NNEA 4U2DA 1J23A 4J8PA 4ZA2A 4RADA 3OECA 1HFKA 3FWHA 1HF3A 4FNGA 2JAWA 1UKBA 1K9VF 2I9PA 4R2MA 3K71B 3UB2A 4LMRA 1QIKA 4MUXA 4UULA 1ZIDA 2IYNA 3W3AA 1EFAA 3LK7A 1IOLA 4FGWA 1YMVA 3PFHA 2YV1A 4HDQB 4LZLA 5KQSA 3RHFA 4LSZA 4WRRA 2NUTB 3GLKA 2GZ2A 3JQ9A 4GYYA 4KMMA 3PG5A 4QRHA 4K9OA 4TXJA 4C7OB 3PF9A 3EK2A 4XUEA 1GGHA 1UFQA 3LVBA 1OE0A 3KZXA 2PT9A 1UBCA 1NVAA 1PDOA 4L8FA 3SMQA 3V4PB 1I1NA 2HHCA 3V2IA 1AUVA 1EFPA 2NTJA 4V0SA 2QX9A 1UADA 1X7DA 2PEYA 3I58A 4KN5A 3U4GA 2P4UA 3KSAC 1ZNWA 4OJMX 3TDKA 2IVZA 3WGZA 3ZJVA 3QPWA 1CS0A 1OFVA 1SBZA 2V55B 4BHTA 1QIDA 4D45A 4CMKA 5HQ3A 1XTIA 4DA6A 2EZ4A 3LTNC 2FTKE 4OK3A 4FCVA 2D0OB 1N2CA 4G89A 5DEIA 4WESB 3CTMA 5C3UA 3U5TA 3QBJA 2QZZA 4PQEA 5G0TA 1JTFA 3KG2A 1V45E 1I5RA 2BBWA 2PVSA 4ISBA 3I9LA 2OHJA 5AK5A 2P4EA 1KI1A 1E4VA 2H4JA 2DXIA 2DWOA 2X0FA 2ZSEA 2NXJA 3F6YA 4WY5A 5EMJA 2E85A 4JSRA 4OHZA 5A5EA 2W6MA 1KOJA 3KIPA 1XVAA 2JGJA 1SVMA 4OQFA 4PCUA 2DBQA 2A0FA 1Y3HA 3HNRA 4OX9Y 1AB6A 1P5FA 5IASA 2AZ4A 5D3KA 1MAWA 4EEXA 3IX7A 2GF9A 3D5QA 4F38A 2MYNA 1QIJA 1R5JA 2WAYA 3C3KA 2V4UA 1QQTA 2ORED 1Y0BA 3FAZA 1GGNA 3JR7A 3R6LA 1T13A 4X6UA 3ED5A 2WWHA 4HUQA 4OHCA 1IOZA 3PKIA 3UK7A 4YQYA 4JYPA 4HB3A 4LRYA 3TE7A 4IKEA 4C03A 1A4RA 1Q0UA 4ZJYA 4GZ3A 2SNIE 2IP1A 2WSYB 4GSLA 3OA0A 1XZFA 3DVSX 4UFNA 4PAWA 1GTSA 1UCFA 4LYYA 2PG3A 2II6A 3DP9A 2FE4A 2VK4A 4PLPA 5L4NA 4C4PA 1I4DD 4MUMA 1OKKA 3UWOA 4RMNA 1TKCA 2Q0QA