2PZEA

Minimal human cftr first nucleotide binding domain as a head-to-tail dimer
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
228
structure length
226
Chain Sequence
SLTTTEVVMENVTAFWEEGGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCSQFSWIMPGTIKENIIFGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLDFSSKLM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structures of a minimal human CFTR first nucleotide-binding domain as a monomer, head-to-tail homodimer, and pathogenic mutant.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Cystic fibrosis transmembrane conductance regulator
total genus 76
structure length 226
sequence length 228
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2pzeA00
2DCUA 2ZEJA 2D2EA 3GJXC 1G17A 5FOWA 1NN5A 4ERNA 3CF6R 3ZVMA 3I32A 3BB3A 3TNFA 2CDNA 4BFXA 4Q4HA 1SULA 3UMFA 4YONB 1Q57A 3P26A 1II8B 3T12A 5J4LA 1PLJA 1YJ5A 1WP9A 3OIYA 3LXRA 4LYFA 4P4SA 2DFTA 1PUIA 3X1YA 4K8OA 2BOVA 4E07A 2PZGA 4NCIA 2BKEA 5TMPA 1P2SA 3AVQA 5EXXA 4CEJB 4NYIQ 4Q7KA 4V03A 3ZH9B 4AC9A 1P9RA 2ZSFA 2HUPA 5GADl 1XWIA 1YZGA 2OSBA 2AX4A 4I1SA 1NG1A 4WXPA 4M21A 1G7CA 5C4MA 4JKIA 4X8LA 4QNRA 4QJ4A 1G3RA 4DSUA 3X1DA 5KDOA 4AYWA 4TMKA 4OQXA 2CNWA 1XBTA 1W4BA 3A36A 3KDSE 3CB4A 1Y63A 3KUDA 3NBZC 4Q1AA 4V0ME 5CLQA 4C0AC 2BKUA 4D4JA 2GCNA 5H1YA 4HAXA 3BOSA 2QTHA 3EWAA 1SHZA 3UXMA 4RD0A 1E32A 1XCGB 4YLGA 1Z0KA 5BYKA 5F9FA 4B3CA 4LK2A 5KPJA 3NC0C 3EC2A 4TYQA 3D3QA 2NMVA 3VU9B 1TF5A 2F3TA 2LKCA 1KI2A 2GJ9A 4YXWA 3T61A 4UNQA 1AGRA 1SKYB 1KKLA 3ADDA 2GXAA 2A5GA 1KTVA 1AM4D 5JJKA 2ZUBA 4I99A 3SEAA 2BHRA 2FA9A 2CCJA 5CJPA 3T1VA 2JLUA 2HF9A 2BV3A 2YOGA 1BKDR 2YYZA 2OCAA 2ORVA 1ZD9A 3VR2A 1VHLA 1KHTA 2J41A 1SVOA 3CBQA 4JVMA 4P4UA 4AK9A 3SZRA 3AKYA 1YHNA 1RRGA 4JS0A 2NQ2C 3AB3A 1QHSA 2RGDA 1ETUA 3GEHA 3LBNA 4BZXA 1KGDA 2GXQA 1HA3A 2IEZA 2ZJ2A 3L0IB 4F4JA 4PR0A 2CCKA 4MRPA 1GVNB 4Q01A 3B9QA 4G1UC 1M74A 1VYTA 4W7SA 3ONWA 1R5OA 2DFKB 2ZREA 4LRWA 1OH8A 4DT1A 2BJWA 4ESHA 2E1RA 2VSXA 1HURA 1FTNA 4A8JC 2EFGA 4JLJA 2VF8A 4PC2A 3ZIAD 4XSGA 4IOJA 2WTUA 3THWA 4NPHA 821PA 2GJSA 4WW0A 1P60A 4M9ZA 1LNZA 3CUEF 4Q9HA 1U2RA 3KXKA 4KLNA 1E1RD 3ZZUA 3LW7A 1N0WA 1YRBA 2BM0A 1NLYA 3HYRA 5FUYA 3HU2A 4MRVA 2QQ0A 2ZANA 4BZQA 4JLVA 3CNNA 5C4GB 4G3XA 3J81k 1FFHA 4EPVA 2XTZA 3B1VA 1A5TA 3LA6A 3TMKA 1Q20A 3OEHD 3JVVA 1DOAA 1OXXK 1S9DA 1PLLA 4UXJA 1VCNA 4HB4A 3CX8A 1DAMA 2HT6A 1W0KD 3CPEA 4RD6A 4YDSA 2GILA 4KSBA 3RANA 4AG6A 4DLUA 4PC1A 5FTKA 3EASA 3QVVA 3JVUA 3OFNA 2FSGA 3VHXA 4E09A 4TLDA 1Z0DA 1LVGA 2BM1A 2JGNA 2IS4A 3U4QB 4L8GA 3DEFA 3EPJA 2AXNA 3PJRA 1YR9A 1I4DD 3CRMA 4A6PA 1US8A 5IT5A 2RGBA 2EFEB 3PENA 1XTJA 3B82A 2WWGA 1OIWA 3CZPA 5CB6A 1KNXA 2W6IA 3Q5EA 2ZITA 2G6BA 2OFXA 3EIEA 4Z54A 1FTSA 1UDXA 3JZMA 1WB9A 3KXLA 1E9EA 2R6CA 1EG7A 2FF7A 4PHGA 2IS1A 3CLVA 4PANA 3SI7A 2HEIA 5HPYB 3GLGB 3BBPA 3FB4A 1BMFA 3B7GA 2IYUA 4BFSA 2KWIA 2QT1A 1GIAA 5IK2D 5FUXA 5SZIA 3RDPA 3GP8A 5EXSA 2PEZA 2QM7A 4IVRA 4GFDA 1H8HA 5J40A 1P3JA 4RY2A 1E9RA 3MD0A 3RSOA 3LBHA 3LH5A 1XD8A 3E70C 3SC3A 4DLTA 1G4UR 4QGGA 1ZNWA 521PA 5A5GA 2IUTA 4MGIR 2VEDA 4G5GA 5EUQB 1ODFA 1FMJA 1YVDA 1VG8A 2H7VA 4QJ5A 2D7DA 1M7HA 2EU8A 1Z07A 4B35A 1E2HA 4LSGA 3U6KA 1KK3A 4GT1A 3PEVA 4TYNA 1ZNXA 4AKIA 1FUKA 2DWQA 1ZCAA 3NHAA 1DS6A 2KI5A 3SYLA 3WYAA 5H8WA 1RRFA 3QF7A 4OHWA 3ASYA 5EQTA 3P32A 2ZM5A 2HXYA 1E94E 4PSVA 2ZRNA 2X8AA 2XNSA 4A15A 4Z1MA 3SU8A 4A92A 1CJVC 5KHOC 2OLJA 1KJYA 4MRSA 3EPHA 1G7TA 1E2FA 2A2ZA 4WZBE 3VR3A 4PO1A 1N6IA 1RC8A 1G20E 2JLSA 1TMKA 4ARZB 4LPSA 2ATXA 2J0VA 4MRRA 5BN5A 3W8RA 1CF4A 3NBXX 5KYKA 3H1TA 3BWDD 1P4SA 1W48A 4M9SA 3M1IA 2FFQA 1RVDA 5FBLB 2GXSA 2WMOB 3LLUA 4JLPA 3T5DA 2QORA 1UDWA 2ZRFA 3A1TA 1S4QA 4AI6A 5FOXA 4E03A 3B9PA 4TLAA 3CKLA 3AH8A 2CBZA 1AJEA 1JNYA 1UBCA 4M1WA 3RNLA 5L3SB 2GXUA 2JDID 2VRWA 4HUQA 3W3AA 3RVBA 1GFIA 3MWLA 2GCPA 5JHGB 4JYCA 1Z29A 1WQ1R 4EFLA 1US8B 2ODWA 3GJ7A 4LJYA 4QGHA 4Q02A 4OHXA 4AG5A 2QENA 1NN1A 1ESMA 3IPYA 3LRPA 4IDNA 2O8BA 3DVLA 3IDQA 3K0FA 4EFNA 2C9CA 3B2EA 3WYGA 5SZHB 5HZHA 1BYUA 1TF7A 2R8RA 1AKEA 3U3JA 4KBFA 4Q4JB 5BN3A 4PFSA 5BYJA 2ZAOA 5JSZB 3K9GA 2WJIA 3SFVA 1YZUA 2WWWA 4N0EA 2A30A 1R6BX 1G6OA 2VP6A 5DHAA 4KV9A 3TVTA 2DB3A 4BWYA 3K0EA 2J3EA 2G88A 1RPZA 4N1AA 3PV0A 2OM2A 2XNDD 2HF8A 1KSGA 5JHHB 421PA 4A82A 1P2VA 2P6RA 3PITA 2RMKA 4TQAA 1MO5A 1A1VA 1G8HA 1MH1A 5K8IA 1IONA 3WP1B 1TTTA 2F9MA 3KQLA 1G291 4ZCIA 3H2YA 4HAWA 1RYFA 3QG5A 2PLRA 2CE2X 4ZI3A 1RFLA 4C0KA 1HYQA 2GAAA 3K70B 4PSAA 1AS2A 1JXOA 4HAZA 2ZI4A 2H8KA 1E2GA 4R71A 2RAPA 1OXSC 3K0AA 1GM5A 2GVZC 2IL1A 3LLMA 4U7DA 3PQCA 3AVPA 3KJHA 4CDGA 2WMNB 3QBVA 4WVFA 2C8VA 2OFOA 2C04A 1H8HD 1ZVQA 1ZU5A 4FIDA 4GP7A 1U9IA 2ZJ5A 3AF2A 4I81A 1W4RA 2P5TB 4AY2A 2AD1A 3RRZA 5CK4A 1S8FA 5EP3A 1XJQA 1RYHA 2B21A 1XNJA 4MDFA 3KQUA 3BB4A 4V02A 1A4RA 3QXHA 2NGRA 1MKYA 2WOJA 3NH6A 3R9WA 3NDPA 3GLGA 3W6PA 1E1RA 1M7GA 1X8KA 1EESA 1KAGA 1TQ4A 2I3BA 3RS7A 2Q9BA 2FZLA 2HDNB 2WJHA 3BH0A 4LI0A 5K8TA 1R10A 3NDBB 1XXHA 2CMKA 3VHLB 3P4XA 5DI3A 2IW3A 3KL4A 3N5CA 3ZZ0A 1MT0A 3B1XA 4GBMA 3ADCA 3THXB 3E1SA 4E5UA 2QNRA 2V55B 1ZINA 2WZQA 5DYIA 1KJWA 3LO5A 1EFRD 2QQEA 3F3YA 2OV2A 3KJIA 3HR7A 3UATA 3DMNA 3H84A 1C1YA 3QXSA 1F5NA 3X1XA 4ZI2A 5TVKA 2WJYA 1ZM3A 3ZD7A 3GLIB 2R44A 1XTSA 3UMRA 1R7RA 1W2HA 4PZLA 2GK7A 2FGKA 2W2XA 5GVRA 3GFTA 4TTPA 4TTRA 3RS4A 3U7GA 4EAQA 2ZU0C 2ZQ5A 3DOFA 1SXJB 1KZGB 4OYHA 2GK6A 5FOVA 1OIXA 4US0R 3T34A 4BRWA 2ZJYA 4PC3A 3ZDQA 5EE1A 1Q21A 4NCJA 4KHZA 4AIIA 2AKYA 4DIEA 1W5TA 4M9QA 2F6RA 1MO4A 1JQJC 3BXZA 4A8JB 2YWEA 1IAQA 4OQLA 3C5HA 3TRFA 2ZRIA 1CR2A 3DKPA 4FN5A 1Q44A 1HTWA 2N1BA 4ITRC 3I62A 3H86A 5CM8B 3ADBA 1CR1A 3QPUA 4AKGA 1X6VA 1UBGA 3MWYW 1NI3A 3QPVA 1T3HA 1BIFA 1DBSA 5G41A 2FPLA 1UBFA 1T0HB 2AK2A 1XEXA 2YOHA 2VL7A 3EZFA 1TEXA 2OUKA 4C3ZA 4Q9JA 4EPTA 2AKAB 4YQFA 2R6FA 2Q21A 1E69A 1N0UA 1JPNA 1EXMA 5FPTA 1NVUQ 1G4AE 3L8ZA 1KO7A 1EX6A 3CF2A 4KFRA 2ASEA 2AHOA 1CRQA 4LV8B 2GDJA 1E2QA 3Q8XB 1SGWA 1SHKA 4HZIA 1W4CA 1UEIA 2XSZD 2OLKA 2GF9A 3GFPA 3P1JA 1KDRA 1YZQA 3VTKA 2J1LA 1F2UB 4KLZA 4CT4B 5FI0B 2FJUA 3QPWA 1BH2A 3NBYC 1IQPA 4EUNA 4US2R 3ASZA 2CNWD 1JB1A 4JBXA 4A0GA 1QVAA 3DPUA 2C96A 3QBTA 4F38A 2R62A 5FUWA 2FEOA 1N5LA 1G5PA 1WF3A 3HR8A 5LDDC 2OESA 4RJLA 4BRUA 4M0LA 2Z0MA 1Z2CA 1DO0A 3O8DA 5FUVA 2ZRPA 3BFXA 4C9BA 3OIVA 4UNSA 5CDFA 4B3XA 4PO9A 4XWKA 4TQ9A 4BLOA 2GCOB 2ZS9A 3DZDA 5IRCD 3TW8B 4HDQB 4QBHA 4DC9A 4TN1A 4BFUA 1NIJA 4OQNA 1NIPA 4AURA 5G40A 2Z83A 3QKRB 4D26A 2ZIAA 4Q19A 4QOSA 1DAGA 1QRAA 3GLGE 4A4DA 1MO3A 4JJZA 2FFBA 3THXA 1TPZA 1KI6A 5UKDA 3AVYA 4C2TA 1XU4A 3LBIA 1CU1A 3CPHA 2H17A 3A58B 4FMBB 5KOYA 1Z08A 1DELA 3BS4A 1W1WA 3K1JA 2B7CA 1H8ED 3H4MA 4KO8A 1HV8A 2NO6A 2VP4A 5FTMA 2O8FB 4B76A 3I92A 5CYOA 1WBDA 1DG3A 2OG2A 3GQBA 5KNCA 3WXMA 3QE0A 2X2FA 4P4TA 5AUNB 2ODBA 1U0LA 4XD7D 4PQFA 4U5XA 2QAGB 3W5IA 1YE8A 121PA 1KIMA 2X1VA 621PA 4G5OA 2FGJA 6Q21A 4HUQB 4G0NA 2QGZA 2VF7A 3FKSA 3DKVA 4Q4AB 4JZKA 3PXGA 4DDUA 2VP0A 4XJXA 2JCSA 3A4LA 4HZUA 2IF2A 3BFVA 4MKGA 2V6JA 4PC7A 4EKDA 1DAFA 4OI0A 3RAPR 2B6HA 1KNQA 2ZE5A 3QEOA 4PPQA 3T5GA 5G53C 1TNDA 2FPMA 4U00A 4OI4A 5B2ZA 4B74A 1AKYA 1VG9B 2F1IA 4URVR 2PCLA 4UNPA 5FTNA 1BYIA 1UEJA 2HYIC 4TT3A 5TB5A 4LV6A 1G3UA 3GLFA 1JR3D 1KI4A 2ZJOA 3AV0B 3CWZA 4TMZA 3OE7D 5F3WB 3TSWA 4ZIRA 5SZJA 2IUUA 2YJTD 4ESVA 4CRWB 2C9YA 3SR0A 4MKFA 3LWNA 5AJVB 2Q3HA 2OBMA 3WMEA 2IEYA 3AP3A 4A0RA 4H1UA 3C16C 4A1FA 4D0NA 3I3SR 4HAUA 1SKYE 2GESA 1NP6A 4IDOA 5HKKD 1D5CA 1XTQA 2W6JD 5E95A 5EE0A 2HXSA 2WWYA 1K6MA 2IS2A 2F55A 3K9HA 4Q7MB 4KSCA 4ZPXA 4WBSA 2W0MA 3SDZA 3I8SA 4B3GA 4AWXA 3BIFA 1XDBA 1JEDA 1TF2A 4BFZA 4URZR 3BD9A 2CLCX 2ZS8A 3LAWA 4HAVA 3IKJA 1Y3AA 2J0QA 4AKHA 2WAYA 3FTQA 3MCAA 4PHTA 1R8QA 2WIAA 2Q6TA 3T35A 3GLFE 1TUEA 5JEEA 3U44A 5TY0A 5EE9A 1FP7A 4LJ7A 1G6HA 3GJ3A 4FXPA 4NCKA 3LY5A 4OK5A 4KITB 3T15A 2A5FA 3C5CA 1L2TA 1M7BA 2ZRBA 1BMFD 5HKKA 4MYHA 4EJSA 4LPKA 3LDAA 2IUSA 1G5TA 3TJZA 3MGCA 3ZYCA 3R9XA 2XAUA 2R6GA 1ZD1A 2ZETA 5E3HA 4BQSA 1W0JD 3EIQA 2JLZA 4TYWA 4R9UC 4B3DA 1FMLA 1G21E 1P2TA 2FZ4A 3DHWC 3KFXA 4EFMA 3HWSA 2HYDA 2ODEA 2GA8A 2IYTA 2ZI7A 4LBYA 1KMHA 4S2EA 4HAYA 1ZCBA 2EFHB 2QI9C 4R7ZA 4F93B 1UAAA 1DO2A 1MABA 5EP2A 1W5SA 5AR1A 2FPKA 5FPKA 1EK0A 3LVQE 4DCTA 1SVWA 3AP2A 1FZQA 1W0KA 5EZ5A 4A36A 1QG4A 1G5RA 2QPAA 1N5KA 4QHSA 4P32A 1W44A 3K09A 2QBYA 1KI3A 1K5DA 2GBLA 2XOKD 3OEHA 4LUCA 3KTAA 3NIBA 4NYMR 2O5VA 3I72A 4TZ0A 4Q4LA 3REGA 8OHMA 1IY1A 2DPXA 4WIAA 1J90A 1Z6YA 1BOFA 5LD2C 3WHLA 1WE2A 1XFAA 3DMDA 4KXFB 4X8MA 3EPLA 2J7KA 4GMDA 3SQXA 1OXVA 1TL7C 2ZE8A 3GLHB 4NTZA 1F60A 1KI7A 1U98A 3AF3A 4D25A 2VYFA 1NVVQ 2PZEA 4M1TA 4LJ5A 4Q1BA 5DI9A 2WPDA 1KY3A 3THYB 5DIFA 5AJYA 3RWMB 3VMFA 4E22A 5FPYA 5JJIA 5DGXA 4FD2A 4XVQA 4LBWA 1HT2E 3OIWA 1AIPA 5EUMA 3R8FA 4EPRA 3KKNA 3KKPA 3SJCA 4JVSB 4IXNA 3WY9A 1GTVA 1WBBA 4EPYA 1NBME 1CIPA 2ONKA 2QE7A 2V4ZA 2RCNA 3DZ8A 1N2CE 2CJWA 4POAA 4IHQA 5KDDA 2FFAA 1JI0A 4NZYA 1T4GA 1MOZA 1KY2A 2GEVA 1CLUA 2WKPA 4JLAA 1XF9A 4Q4AA 1B23P 3A4MA 2QSZA 3AKEA 3QKSB 1NBMD 3ICQB 5HE9A 3OESA 2J7PA 4NYIR 2NTYC 2V8OA 5KPDA 1CEEA 5AK0A 1LF0A 1W36C 4DLXA 1ONBA 1MR3F 1EGAA 1ZM7A 1M1YE 1L8QA 3B5JA 2OBLA 2KBFA 2A5JA 1Q1EA 1Q3HA 3F0TA 4FWTA 4Q1EA 5FOTA 3BB1A 4EJSC 4GDFA 2BC9A 1BO6A 3CWQA 4FWIB 3BH6A 4HZUB 3SYNA 3AGPA 2EWWA 4P3YA 4OBEA 2WWHA 3B85A 1L4UA 1YQTA 2V54A 1SVIA 3ETLA 3QXJA 3R20A 4M22A 4WOPA 3SJAA 2GTPA 1L7VC 4Q18A 4DLYA 3VU9A 5FPHA 1WRBA 2G0NA 3LD9A 3U7HB 4NYMQ 4BLQA 5KU1A 1NBMA 3HPQA 5JRJA 4D4KA 3ZVNA 5JJLA 2RGGA 2IHYA 4M2LA 1KO5A 1ZJ6A 1VECA 2BCJQ 2GCOA 4RD1A 3KKQA 2CXXA 4IXMA 4C2UA 4N0DA 3L0PA 4IDPA 5HCIA 1NVWQ 2QP3A 3W6NA 3VQTA 4M1SA 4R2IA 5HZKA 5D3MA 2ZS7A 1IHUA 2ZUDA 4JBYA 3I61A 2CVFA 1AZTA 2GJ8A 3SOPA 1J99A 1KK2A 1M6NA 4URUR 4W5HA 1HH4A 2J0UA 3SBDA 1R8SA 2OCBA 3W90A 4BZPA 2ZROA 3IPXA 2JJ2A 4UJ5A 1XCPA 2BJVA 1J70A 2JLWA 2WBLC 3Q9LA 4XD7A 2QZ4A 1CXZA 4LBZA 4LWZA 4FI3C 2W0SA 4CEIA 1XXHE 1YU9A 2V7QD 1AQYA 1XJCA 2W83A 4DLVA 1KI8A 1TQDA 2GWHA 3EZ6A 4HYYA 3KQKA 2JLYA 1KMQA 2IYZA 1QHXA 2QAGA 5JECA 3E2IA 2LCFA 5ANRB 2VSOA 2IYYA 3WNBA 4MGZR 3WRXC 2I1QA 1NKSA 2VLIA 4TYYA 2WSSD 2OILA 4IDQA 4TLBA 2XX3A 4NKRA 3A1UA 1EFRA 4O25A 4C7OA 4P33A 1W49A 2GZHA 2YC4C 3IEUA 1G41A 4EDHA 1GITA 2Q3FA 4TL8A 5BN4A 3OE7A 2RGNC 3OEED 3A6PC 3ND9A 4QKQA 1VIYA 2ZRDA 2XTMA 1G7RA 2Q9CA 2YZ2A 3CW2A 3BE4A 2OO7A 3CNLA 3CR8A 4G5SA 3GEIA 5JWHA 3MG9A 2WWXA 5EE3A 5J4KA 1R2QA 5H68A 1E9FA 2WIBA 2WKQA 3PFIA 4QM7A 2G1KA 2QY9A 3GPLA 2QP4A 3THOA 4RFSB 4OJKA 1S96A 3AP1A 1LS6A 4R2HA 4RZXA 1LF5A 5LPNA 2QA5A 2WV9A 5JBQA 2XZPA 2X2EA 4CT5A 5B64A 1T0JB 5IF9A 4FW9A 2O8DA 4B71A 3AKDA 5CLLA 2CHQA 1FNNA 5KNBA 1D2EA 1YZTA 2XXAB 1QBKC 3I8XA 5D3QA 5F98A 2WJGA 4Q00A 1CTQA 1N6HA 4QM6A 2ZJ8A 3Q7QA 1OJLA 3NWJA 1XPRA 3WRYC 2A78A 4MYCA 2GKSA 1F2UA 1OT3A 1T3LA 3BK7A 3RHFA 3TQFA 2AFHE 3UG6A 3THYA 3MSXA 4LHXA 4P4SB 3WNDA 3AVXA 1YZLA 2P3SA 2F9LA 2GNOA 3FFAA 4QBIA 4URYR 3U5ZB 4D0LB 3O8BA 3AEZA 1VCIA 4IW3B 4EQ6B 2AL7A 4UXHA 2GEUA 5TV2A 4ACBA 1XPUA 2J87A 1SXJD 1S2MA 2IYQA 3SNHA 5L8VA 4DSTA 1CKEA 4LCBA 1G1MA 1RJ9B 4MQBA 1P9NA 1KI9A 4BLSA 1NVXQ 2IYSA 1XZQA 3LW8A 5GJBA 4LJ8A 1NMYA 4XIGS 4Q5IA 1QVRA 1X3SA 4KYIB 4B3FX 3GEEA 4ON9A 4XOIA 3FHTA 4QG7A 2QUZA 2IWRA 3GJ4A 1OKKA 1AS3A 2DY1A 4LJAA 3RRYA 2UZIR 1OFTA 2FOLA 3AF4A 5HE8A 1IXRC 2DFLA 3ZQJA 1GNQA 3CM0A 1RW4A 2XGJA 2NG1A 2SHKA 1YR6A 4LYHA 1HE8B 1JR3E 3LXXA 4MYTA 5KDLA 1GRRA 1JAHA 4IEIA 2RGEA 1KMHB 2C77A 2GF0A 5G3ZA 5B58C 2VBCA 4DJTA 5EJEA 221PA 3PUWA 4IVPA 2XJ4A 3CRVA 2ZR7A 3Q72A 4BECA 2HCBA 1IXSB 3VNVA 2IT1A 4W5JA 5JCPA 4BPBA 4OHYA 1TU4A 2YWHA 4Q7LA 2H92A 2RB4A 3AVUA 2JIZD 1TAGA 3KZ1E 1P61B 1MABB 2QE7D 4EPXA 3ZD6A 3G5UA 3NKVA 3H0KA 1GILA 4QBGB 3OAAD 4UNRA 1XMIA 2ZU6A 4PXAA 3W5JA 3P4YA 2OBNA 3BERA 2Z6VA 1Z0IA 1L4YA 3GJ8A 3UPUA 3T1TA 2QP9X 1HEIA 2FE4A 5FR2A 3AVVA 1DPFA 1E9DA 1R0WA 1IN4A 5JS7A 3K70D 1R0YA 2FEMA 3GLHA 1SQ5A 4Y0AA 4CIDA 1X86B 1C4OA 3LV8A 4A9AA 2HLDD 2Z4SA 4MA4A 2GAOA 3UANA 3VR5A 2VP5A 1UFQA 2NPIA 5JWRA 1GDDA 1Z47A 2G9NA 4DCVA 5K8UA 3AUXA 1XCMA 4II7A 2LWIA 1E1QA 1ZD8A 3IHWA 2BDTA 5BW8A 1DARA 2BEKA 5J4YA 1SZPA 3U7EB 3F5FA 4MKIA 1F2TB 4OKSA 1E2DA 1AZSC 1PZNA 1T8TA 1HE1C 1Z2AA 2HV8A 3AGQA 1UKEA 2D3WA 1PV4A 3VNUA 3EZ7A 1LV7A 3EW9A 4C0QC 2CVHA 3B1YA 1GP2A 2VHTA 2IBMA 4B33A 2ZXUA 3N70A 1Z83A 4O3MA 1XMVA 2DYKA 2J0SA 3WYFA 5BXQC 4PAOA 3WMFA 3T1QA 3MJHA 2BVNA 1P2UA 3RS5A 2ODNA 4OK6A 2REOA 2VO1A 3AUYA 3QKTA 2O8CA 1YKSA 3PVSA 4D81A 3ZS8A 2IYVA 3K0SA 2C95A 2PX3A 2XB4A 4TSFA 4AKEA 2UVQA 4ARZA 1FNMA 2HCJB 1W4AA 4BFTA 2GRJA 4Q1DA 4BLPA 5JS8A 3UWKA 1XB2A 1P75A 1XD2A 3QF4B 2WWIA 4Q66C 1OFHA 3ICEA 3CRRA 1TQ2A 4JLMA 3RS2A 1KSFX 3V9PA 3Q85A 2WJJA 4UJ3A 2H1LA 3ZLJA 3HJNA 1XJ0A 3IQWA 4JKYA 1JXMA 1Z0AA 2QEQA 2QN6A 3TGPA 2F1RA 4HI0E 2WKRA 3MLEA 4UKDA 3O8CA 3KQHA 1ZMXA 5FFMA 1T91A 1FPMA 4CEHB 4XWAA 3R8CA 2BBOA 2FU5C 3LFUA 2CK3D 2Z43A 3CZQA 4HSEA 3W34A 3QI2A 1EWRA 3L82B 2O52A 1Z22A 4KYUA 5CDFE 4LYJA 1VKJA 4BLRA 5J4HA 4IEEA 5JSZA 2W00A 5EP1A 2C9OA 2D2FA 1AGPA 1Q0UA 3I1FA 4NBSA 4JLOA 4XVUA 1E3MA 2PJZA 1NLZA 2IYWA 4ZV4A 3EZ2A 4JVNA 4QBFA 4AD8A 3K0FB 3MUFA 4YMTA 1OW3B 1JPJA 1VPLA 4D80A 3LX8A 4DBLC 1QHYA 3RRMA 2EQBA 4I1OA 4PX9A 1I4TD 4NU0A 2YWGA 2YVUA 5C18A 1W7AA 1ZW6A 4PHHA 2QMUA 3QUSA 4URWR 2J45A 1MRNA 2EYUA 4HB3A 4IFBA 5J47A 4HEJA 3RC3A 4Q03A 4PC6A 4NYJQ 4OI2A 4BLTA 1GSIA 1R5BA 5L3VA 2V7QA 4OQMA 1LFDB 1EFUA 3B1WA 4DUGD 4D6PA 1IM2A 1G64A 1G19A 5KSYA 1GNPA 1Q1BA 3NEYA 4O2RA 5B57C 1U8ZA 3CRQA 1OFUX 3UK6A 4MRNA 3QG1A 1W47A 4MKHA 2EYQA 2NZJA 1N6PA 3FKQA 5FBQB 2XB2A 2IHBA 2BMFA 2IYXA 1OPXA 4GZLA 1UBEA 2FG5A 1T5LA 1E9AA 3EPKA 3HYTA 4UNNA 2JIZA 5FPSA 1ANKA 2N42A 2Q9AA 3PUXA 4QHYA 1OIVA 5DHFA 1RZ3A 4L15A 3FGNA 3OEEA 4JL8A 2ZSAA 1ZNZA 1NL3A 1N5IA 4NYJR 4HLCA 4A0HA 2G77B 4QGFA 2WHXA 5A4JA 1SXJC 3KFVA 2KB0A 2D7CA 4TL9A 3BGWA 3GLIE 4B44A 3V4RA 2GZDA 2ZVPX 1YR7A 3CX6A 3NEJA 1UKYA 1PLKA 3W3ZB 3LNCA 2VTKA 3C14C 2ZSBA 4QL3A 1II9A 2FV8A 2B8TA 1Z63A 4RKFA 1OV4A 3EWSA 3N2IA 4BASA 1QHHB 2BCGY 2PEYA 3O47A 2K5UA 5AJZA 4L9SA 1OKKD 2OCPA 4A2PA 1XEFA 5DH9A 4ZCMA 4XVRA 1D6JA 2GETA 1RRCA 1QHIA 2C99A 2RGNA 3VKGA 2VH5R 4TLCA 2YHSA 1LW7A 2MSCB 1GL6A 5EZ6B 2F7SA 1KK0A 4HLUA 1VMAA 3T1OA 4B2IA 2ZRKA 2WWFA 4J0QA 1XEXB 1GKUB 2GJKA 4UQOA 1COWD 4GPTA 3U61B 1E4YA 4NP6A 1I2MA 4W9MC 4GP6A 2XITA 2OEPA 4N3NA 2ERYA 2YINC 2ZI3A 3UWOA 3GLIA 1XPOA 1SKQA 4HLQB 1NKTA 2KE5A 1F6BA 1R5NA 2JLRA 2CHGA 1KAOA 1E2PA 3PEUA 4ZDJA 3U3MA 1KDTA 2JEOA 1P5ZB 4B73A 4DVGA 3K70C 2ZJZA 2ZYUX 2RGAA 3GD7A 5DO9A 1CS4C 3C41J 4WZ6A 2JA1A 4TYPA 3MRSA 4JSYA 3DM5A 4CEJA 2XSZA 1GRQA 1ZUHA 1NLFA 1OSNA 1XMSA 4FMCB 4JL5A 5CITA 4LV5B 3A1SA 2V1XA 2QAJA 3D6TB 3FMOB 4DKXA 1LS1A 4OQFA 4Q21A 1EWQA 5DLQC 2O8EB 2XTNA 3RLFA 2OAQ1 4PHFA 2JLXA 4C7OB 5DISB 3IEVA 1NMZA 3ZIAA 1EFHA 2PMKA 1J7KA 3QY0A 2ZI6A 1KO8A 4C4PA 3TAHA 3B60A 4DDWA 1ZC3A 1W2GA 2O8FA 3L0OA 5TDHA 4L9WA 2BIFA 1KJZA 1ZU4A 2QPOA 5E4FA 4G5RA 2BWJA 4Q47A 1Z5ZA 5BWMA 1AN0A 1J2JA 1E2KA 2JJ2D 1PVOA 1E0KA 4I1VA 3SS8A 1XTKA 4OL0A 2WVJA 1KSHA 5L3QB 1E79A 1VIAA 1P9WA 2FDCA 5A0FA 4US1R 3MFYA 4NMMA 2VA8A 5M04A 1N6LA 1S3GA 3OF5A 2OT3B 4DWJA 4ZIRB 2NPFA 2R2AA 4DHEA 2ZE7A 2IF0A 2C98A 4DEYA 5L3QA 1RKBA 3L8YA 2FNAA 4MH0R 1T6NA 2O0HA 2UKDA 2ZRAA 2VSFA 4ZO4A 2GHIA 3IUYA 3PUYA 1S1CA 2DR3A 1IY2A 1Z6XA 2H57A 2C78A 4DZZA 3TVDA 4GOKA 2DWPA 3HPRA 4DDVA 4DB4A 4XSHA 3KB2A 1YR8A 2YKGA 4JIMA 2F43A 5JCZA 4DT1B 1OE0A 3UMSA 3HU3A 4BEBA 5CIQA 5LBIA 1KI1A 4KVGA 2DWOA 1FP6A 4LDJA 2RH5A 3LX5A 3MAAC 2RGXA 1Z3IX 3KQNA 3A8TA 3EA0A 1PJRA 3KXIA 2W6ID 4EQ6A 2FX3A 4O2LA 5CJ2A 2CJWB 2J5XA 5IHPA 1EFCA 4MYUA 4LHYA 1F3OA 2ZRLA 2XZOA 1DAEA 4DLWA 2HJGA 3WMGA 3EX7C 3K0AB 1GL9B 3SJBA 4B34A 1U99A 1OHHD 1U8AA 4BFVA 1PUJA 4JYBA 1CJUC 3ZZTA 1S9HA 4JLDA 4FMCF 3RS3A 2H18A 4TL7A 1JALA 4LJ9A 2JATA 1U81A 2NIPA 3RS0A 3TAUA 3TR5A 5JEDA 3UIEA 3FVQA 3W6OA 5IDVA 3KJEA 2C03A 3MJRA 1Z06A 3OZXA 4ILEA 2OXRA 2QPTA 2XNDA 3FE2A 3U6BA 2ANBA 1KO4A 5DN6A 3TLXA 3N2EA 5P21A 4Q9IA 3IGFA 4HB2A 1DAKA 3GMTA 2QM8A 3CH5A 2FSIA 2ZR0A 4IVQA 5JLJA 2DBYA 1CJTC 4D2IA 4KU4A 5FBWB 1KK1A 3I73A 3ADKA 2QRZA 3L0SA 4NH0A 4B75A 3CONA 4L5BA 3Q3JB 5EP4A 1CR0A 2QMHA 3CPJB 3KKOA 2ZYWX 2VHUA 2VP9A 4M1MA 2G3YA 1XX6A 2L0XA 5LD2B 2AN9A 4W5WA 1VTKA 4P31A 1FX0B 2HT1A 2WPDD 1F2TA 4OI1A 2IXGA 2REXB 1N3BA 2VPPA 1P73A 2ZVQX 3WHKA 2JASA 3FMIA 2ERXA 1WMSA 4M1KA 1G7SA 4A2WA 3FWYA 1DTSA 2Q0HA 5JI2E 2O0JA 4V0OA 4B47A 3T06B 2V9PA 3KTAB 3QOFA 4OHVA 1GZSA 5DNYB 4RD2A 4LHVA 3EG5A 5LB4A 1H8EA 3TUJC 2IYRA 3ZS9A 3Q7PA 2FMXA 1OHHA 1X1RA 3AVTA 1V5WA 2J59A 2O8BB 3IHLA 1VG0B 1IN5A 4GOJA 4LZZA 1CRPA 2AR7A 1IN8A 1DAIA 4DXAA 3FPAA 2O8CB 1P72A 1TEVA 2WM9B 3MWKA 4B6EA 2VIIA 2GBLC 3D7MA 1KKMA 2YC2C 5AUQA 3AVOA 3S1AB 3W8NA 4DIDA 3BRWD 3EARA 3AF0A 2MSEB 2QMOA 5TXGA 4QHTA 4F4IA 2B92A 4KJZA 1W0JA 1OXUA 4Q7JB 2C2HA 2P0EA 4RZUA 5FOSA 4JMPA 5CB8A 3RC8A 3D31A 3FKSD 1BS1A 3BORA 3M6AA 3QKSA 2F3RA 3TBKA 4B6FA 2CHVA 3RRNA 2FFHA 4C0HA 1CJKC 1X8LA 4FCWA 3OHMA 3SN6A 5C46F 3EAQA 4KFSA 3WNCA 1DG1G 3EZ9A 2CLDX 3QEJA 1IBRA 1U94A 3PUVA 2Y8EA 3SE0A 4EJSB 2VP2A 4MDEA 2YWFA 2IS6A 4ACAA 2IWHA 1VCMA 4KAXA 1FW6A 4ZDWA 1IN7A 3B13B 4A2QA 3C7KA 1HUQA 4DLSA 1OH6A 2J46A 1FL9A 4F91B 2PCJA 1N6OA 4PPGA 4S35A 2ONJA 4QFMA 4WXRA 2R6DA 2MMCA 3IBYA 4BE7B 2BBSA 4XWOA 4GRAA 3DL0A 4PQYA 3CRW1 1FOEB 2KBEA 2AWOA 3FYHA 1SVLA 4Q1CA 5KO2A 2DHRA 4MUAA 1Q1QA 1CULC 1G8FA 2VHQA 3A1VA 3I4LA 5FL7D 1O87A 1W36D 1KSJA 4BFWA 2B8WA 4GI7A 3VX3A 4HLUC 4IRUB 1K8RA 1Z6TA 1FX0A 3REFA 5HCNA 1Z0JA 3GJ0A 2R65A 4MITA 2ZJAA 4DCUA 4G01B 4QXAA 1U8YA 2PH1A 4B2PA 4F7WA 3VAAA 1E1QD 1A7JA 1HQCA 1U0JA 1GUAA 4PPNA 5GJVC 5F2EA 5FL3A 3R7WB 2NO7A 3THWB 1N6RA 2OE2A 1I4LD 1QG2A 4K81B 4H1VA 2NO9A 4QC2A 1U9IC 4RD4A 5SZKB 3B6EA 1NN0A 2FN4A 5GJWC 3QQ5A 1UF9A 4V0MA 4HATA 2JJ1A 1CJMA 1JR3A 1XMJA 3GFOA 1NY6A 2D74A 4JT2A 3BJIC 2XEXA 1JBKA 3A4NA 3ZQ6A 3VR6A 5TARA 3AF1A 2C5LA 1YZKA 4EPWA 3QKUA 5CYPA 3UKDA 3WBJA 1OB2A 1NN3A 4H9GA 1G16A 2N46A 1D2MA 4HLDA 3U2QA 4L4UA 3F8TA 3MMPA 4GZMA 1SVKA 2ZYTX 4V0KA 1E0SA 2P5SA 1OH5A 4RZ3A 3FHOA 4LX0A 1F48A 4GSYA 2O0KA 1ZYUA 4Q1FA 5B30A 5C1BA 3NC1C 3U44B 4L16A 2AXPA 1COWA 1RJ9A 5AUPB 2JAQA 4TL6A 3SHWA 2X19A 2FSFA 1NMXA 2ZUCA 1Q12A 2MSDB 1NY5A 4JSTA 4DEXA 4I1UA 3VX4A 3GLHE 3SQWA 2BMEA 2D62A 2OAP1 5BQ5A 2LKDA 1QF9A 2RGCA 1E96A 1XP8A 1VDZA 3FHCB 3RWOA 2HLDA 1N5JA 2ZJBA 4JLKA 4C0BA 2KJQA 2OCYC 2CCGA 4IJMA 1R0ZA 4RZ2A 1ZIOA 4F92B 1OB5A 2VHCA 4OJQA 1OYWA 2P65A 4GNKA 4HDCA 3RABA 1ZUIA 4A8JA 1OH7A 4LOAA 1OFIA 4M1YA 5K8LA 1XTRA 2XXAA 4ZKDA 2BBWA 3DOEA 4LHZA 1E9BA 2W58A 1E0JA 2P6UA 4LC1A 1OLOA 4KBGA 4NCNA 2GZAA 1IY0A 5AWFC 3U3RA 3SFZA 1Z0FA 2D4HA 1O3YA 4KCGA 1ESNA 5EXTA 3EA5A 3K09C 4FCTA 1SXJE 4URXR 2FH5B 4WA7A 5C2JB 4KI0A 4NL4H 5D3MB 2B7BA 1E2IA 4XTRA 4D82A 1XZPA 5HR5A 4KFTA 4B43A 3PUZA 3NXSA 2AWNA 2RKOA 4TSFD 1WDTA 2FSHA 3LQQA 1QDEA 3KKMA 1UKVY 3DDCA 4OHZA 2O8EA 1WA5A 3JZAA 3Q5DA 3TW4A 1S1MA 3IO5A 3A37A 2QTVB 2V1UA 1MO6A 1U90A 2EFCB 3TSOA 2OFWA 3EC1A 1II8A 3G0HA 2CK3A 1W46A 4A0FA 3QKRA 5IK2A 1KO1A 4C0SA 2ZSEA 4B3BA 2REBA 4DCNA 5JMTA 2PMDA 1ELOA 4U02A 5JRZA 1M8PA 2ZAMA 4ABYA 3GCGA 3SHFA 2ZRGA 4PAMA 2WAXA 5GVSA 1AK2A 1N6NA 4AYTA 5FTLA 1E98A 1XEWX 3NBFA 2V6IA 3O8RA 1WCV1 3M0EA 3P20A 4Q9KA 1H65A 5E7MA 2IXFA 1SXJA 2ATVA 3NHBA 4EIWA 1D8TA 1QHNA 1GKYA 1GG2A 1A82A 2GVDC 3VFDA 4PPFA 4WAUA 3X1ZA 3PEWA 3IO3A 3I5YA 4IDHA 4M9XA 1KZ7B 1DEKA 2H5EA 1I2DA 1XTIA 1KDOA 2XOKA 2ECKA 4YMWA 1UADA 1S3SA 4DRZA 4TLEA 4DLZA 4CW7A 2AD5A 4D4LA 3KUCA 2JJ8A 2OXCA 1FQKA 4CF7A 1D9ZA 1KYIA 3KB1A 3PEYA 1CR4A 3E5HA 2O8DB 2I1VB 2XJ9A 2NO1A 3QXXA 5JWOA 2YOFA 2W2VA 3UG7A 2PL3A 3C15C 4Z8YA 4JT4A 5ELXA 4RFSA 3FMPB 5LB2A 1NVVR 3CO5A 1UJ2A 1XXHB 1GNRA 4PSKA 2AK3A 5DI3B 5FH9A 5H70A 1DVRA 1OF1A 3AVWA 3DO6A 3IIJA 4RCZA 2JLVA 2GJAA 3CH4B 1XRJA 3ZJYA 2KSQA 4FINA 4NDZA 4YMVA 1N25A 4MGYR 2PBRA 2I4IA 4Q4HB 3U7FB 2A3RA 3IILA 1ZM2A 1LY1A 1XEWY 5EE5B 1FQJA 1E9SA 1WXQA 1OYYA 2IYLD 4PZYA 3CR7A 2FWRA 3M4YA 3TR0A 1ZBDA 3SYKA 1NF3A 3GJ6A 4OK3A 3IIMA 1ZM4A 4ZKEA 1ZC4A 2ZRCA 3VR4A 5AJWA 2QBYB 2QG6A 1VYUA 2JLQA 2ZRMA 4GOXA 4LYAA 1VHTA 2IX3A 3FDIA 1C9KA 2QMEA 4IFEA 2F43B 5FL7A 4BGDA 4D0GA 4CVNA 4DB2A 1P6XA 1E2MA 2BMDA 3V00A 4LJ6A 3BFKA 1V43A 2J0UB 3WP0A 2EW1A 3B1ZA 4QGAA 2RHDA 4QNMA 3ND8A 1W36B 3CNOA 2CE7A 3AQ4A 2YV5A 4JLBA 3PCRB 2A7QA 1A2BA 2H16A 2HJVA 4TMXA 1XD9A 3KX2A 2QGNA 1T3SA 2RHMA 3PR1A 3B8HA 4IKEA 4M53A 721PA 4TTQA 1N0VC 3NVAA 1A2KC 1DE0A 1UKZA 2WICA 4TMTA 1AQUA 3K0CC 2QU8A 2X77A 1T8UA 4YMUA 2MMGA 2QRNA 4K46A 1MV5A 2ZE6A 1CBUA 1ZP6A 1JR6A 4WZAE 1HT1E 5EXPA 2ANCA 2P67A 4KFUA 4TQUS 5FOUA 3TQCA 1Z28A 4NCHA 4Q48A 4PAQA 4BEJA 1P7CA 4TWZA 2OHFA 4D4MA 4IOKA 1IOZA 3ECCA 4X8OA 3VKHA 2IC5A 1Q3TA 1B0UA 1ZIPA 1KOFA 1GAJA 4NE2A 3R9IA 1QHHA 2P6NA 4X8HA 1Z6GA 4NHOA 4IOMA 1IXZA 2A5YB 1JJVA 1IJFA 4BUJA 4ZCLA 4ZDKA 1T5IA 4Z51A 4LHWA 5KTYA 2J9RA 2WOOA 4Q9LA 4LJ4A 4TMVA 1R4AA 4I4LA 1R0XA 2ZPTX 5KNDA 4Q4JA 1E6CA 2G83A 3X2SA 2CLSA 1TQ6A 4P0TA 5KUTA 3K8YA 3A1WA 2P2LA 3B78A 3D8BA 4BFYA 2OZEA 2BMJA 4LY6A 3U60B 4IOLA 5KSPA 4NONA 3TK1A 1T9HA 1CP2A 1GL7A 1SVMA 5DSZA 4CEIB 1G8PA 3TKLA 3LVRE 4MGKR 2CL7X 3C4JA 3P27A 4Z8XA 3R7WA 2JDIA 2IK8A 2DFNA 3TE6A 2NOAA 2Z5FA 3PG5A 3I5XA 4C0JA 4DLRA 2QSYA 4UXIA 2NZ8A 1K5GA 1ZM9A 3GJ5A 4KODA 1JQLB 3QXCA 1E79D 4FCVA 2BBTA 2ZR9A 4M8NE 4CGZA 2QROA 5JZVA 2PZFA 1J8YF 3NG1A 3BH7A 2BEJA 1G18A 1HQYE 2ZSDA 3HP1A 2PT5A 4QRHA 3L2OB 3OFND 3U4QA 4AYXA 4V0NA 1II0A 3QVUA 3IBGA 2PJRA 4RKEA 3ZGXA 4PZZA 2ZYVX 4DDTA 1DAHA 4TZ6A 3EIHA 1YZNA 4HUTA 2ORIA 1NJGA 5J5CA 3FMFA 3CIOA 1AA9A 3EXAA 4FMDB 4PTLA 2EWVA 1JAIA 2F1JA 1X8JA 2UZ3A 1Q1ZA 5CIWA 2ORWA 1E99A 3MWJA 2E9SA 2GEDA 3SJZA 4YMSA 1M34E 4C30A 4QJ3A 3GLFB 1P62B 3K0CA 4V0LA 1NRJB 5DYGA 4B48A 3C8UA 3QIAA 1XD2B 3QF4A 1VG1A 1NSTA 5E7IA 2ZRHA 1KDPA 1UM8A 4A6XA 4FMDF 4ASUD 2V3CC 3WBKA 1E9CA 2W2TA 4F4CA 2R6AA 4YXWD 1X1SA 5AJXA 4MUBA 1GWNA 2A9KA 1JECA 1SVSA 2CL0X 1JJ7A 2WSMA 5FI1B 1G8YA 5JFGA 1ZNYA 1GKIA 1TU3A 1N6KA 3G82C 4RFVA 5L3SA 2D06A 4XH9B 4B32A 1IJEA 3L43A 4LBVA 4O0MA 4B2LA 3NTUA 4Z1MD 2VQSA 1NJFA 1RE0A 2XZLA 4R98A 3IIKA 3PIRA 2PX0A 5DN6D 5KSZA 1Z8FA 5DE3A 2WSSA 1ZUNB 5FBRB 3BAFA 1QZXA 4ZDIA 2ZI9A 5FTJA 4C0LA 2Q3MA 3S1AA 1MRSA 1VCOA 3V4FA 3W9YA 3FOZA 4DSOA 1J8MF 2WJVA 4PO8A 1LTQA 1RIFA 3QSYA 1NSFA 5L3RA 1RRPA 1G3IA 1EX7A 1TUIA 4CZ2A 1GOTA 2QL6A 2A5DA 3CX7A 2ZTSA 3U3KA 2IXEA 4RD3A 4RCYA 4DSNA 3VKWA 5FBVB 4YDHB 4TT3D 5CM9C 1EFTA 3IQXA 1ZAKA 3HDTA 1E4VA 1HY3A 3AM1A 1G8GA 4LGMA 2QAGC 1E0AA 3SBEA 2EFDB 1DADA 1GRNA 1Z6AA 2JJ1D 3QJYA 2R9VA 4JL6A 3FFBA 2QTFA 1E2JA 2TMKA 1M2OB 2IA5A 1LB1B 2Z4RA 3BC1A 4YC7A 4ASUA 4GL2A 5E7JA 1IN6A 3TH5A 1FUUA 2PT7A 1OXTA 5JI3E 5GJCA 1TX4B 2E87A 5HTKA 5J4VA 3TSZA 1KI6B 2CL6X 2YNMA 4JVLA 5KSOA 1E2NA 3K9NA 2EVWX 2W6JA 4CEHA 2PLFA 3QENA 3RYTC 3CF0A 1U0HC 1E2EA 3DM9B 3KJGA 4JLNA 3OIUA 2G1JA 3LQRA 3K9LA 4GMXA 3TIFA 3K53A 1VYVA 5FR1A 1Q22A 4G5QA 1NNEA 3RSLA 3X1WA 2ZRJA 3U3OA 1TADA 1D2NA 2ZI5A 4RVCA 3AKCA 4Y0VA 4M1OA 3QNUA 4LC0A 5AUOB 2G0TA 4TMWA 1AS0A 1G3MA 3HU1A 3ZVRA 1YRAA 1ZRHA 3NH9A 4M4SA 1S0UA 3TUZC 1D9XA 4RSGA 5G3YA 4DCSA 4JBWA 4HB0A 2CEAA 3VR1A 1E2LA 2AFIE 4PQRA 2QT0A 2NO0A 4DUGA 3OAAA 2VHJA 1NG9A 1JEEA 1UPTA 1G3QA 3TUIC 1G9XA 2J7PD 4HDOB 4CYMA 5F9HA 2F1HA 4KVAA 4JJKA 4XTCS 1QHGA 5CK5A 3ZVLA
chains in the Genus database with same CATH superfamily
2J3QA 1NMQA 1H4VB 1K98A 1D4FA 4HZGA 1G17A 5FOWA 3WICA 3ZVMA 4ERNA 3CF6R 4EG5A 2V3WA 4FJ1A 4E6EA 3E9RA 3AEQB 2CBXA 2ZTHA 5G4LA 1KQOA 2EERA 4XPIB 1SK8A 2B4YA 3CHYA 3GJSA 4BFXA 1T5HX 1X1EA 3DC2A 2JHGA 2LUOA 3EF0A 4NATA 4O29A 1BVYF 1C80A 1II8B 3P26A 3LU1A 1VKRA 2Q49A 1YJ5A 1WP9A 2W2KB 3OC6A 5BWLA 5JVDA 3HBMA 3KIPA 4BCDA 4AXXA 2Y6VA 1XKQA 4KGVA 2PBFA 3X1YA 1R6VA 2EQAA 4LOIA 1Y3CE 3GYBA 4NCIA 2X5XA 4EL5A 5TMPA 1P2SA 2X7JA 3ZH9B 3EQ7A 4ARBA 2B1JA 3R74A 3MCZA 2ZSFA 1YZGA 1IATA 1NG1A 2ZYSA 3Q2OA 4M21A 4WXPA 4I14A 1E62A 3ZXXA 1WCIB 4QJ4A 3VU0A 4DSUA 5CDHA 3X1DA 2PUGA 4IIJF 1K6IA 3WR5A 4B4OA 3MTGA 2AVNA 1XKTA 1XBTA 3FYTA 3QU7A 1TPYA 5DBIA 3CB4A 5FTWA 4LMBA 2DLNA 2OD2A 2WKWA 1U1IA 5G4KB 5NLLA 4FB5A 2GCNA 2I9PA 3JW8A 4X63A 4KUGA 1FRVA 3ZXYA 4XFDA 2WYOA 1QRDA 2IDKA 1SHZA 1TVKB 1SCNE 2ZYDA 4BNGA 1B23P 2HBYA 2QM3A 1HDOA 8ABPA 3NBKA 5K01A 1E32A 1I0ZA 2QV0A 1Q6ZA 2W9XA 3TZ6A 1WL8A 1Z0KA 4QUEA 4E4YA 2HLPA 3I2YX 4B3CA 1QC5B 3TB4A 3EC2A 4TYQA 1DBQA 4HYEA 3VU9B 1XGKA 2NU7B 2AB0A 2I2CA 2IODA 1GGJA 2BH9A 4LFAB 1KI2A 2OYSA 1X80A 4RACA 2DKOA 3E9NA 1AGRA 4MQEB 4UNQA 2Q8NA 3ADDA 4EB6B 2GXAA 1C5KA 1AE1A 2O2EA 1AM4D 4XGKA 1M2GA 2ZUBA 4ZOCA 3LX4A 4ZCPA 2AZXA 4I99A 1S8AA 2FA9A 3T1VA 3LYHA 3JRXA 5CJPA 3WGZA 5TF4A 4DJFC 5ECGC 4EKNB 2BV3A 3E9CA 4NSNA 2YYZA 5AM5A 4D42A 1CF2O 2OCAA 5JNWA 2Q1TA 1R16A 4PBRA 3T9EA 1VHLA 4HWOA 1KHTA 2ZT7A 1I80A 1SVOA 3C3CA 3QLTA 4ZVPA 4AK9A 2HBZA 5LDHA 3SZRA 3B36A 2O2CA 3EZGA 4V24A 3RUPA 4GWGA 1FXSA 1RRGA 3KZVA 1S2GA 2A88A 1S7GA 3GEHA 2HB6A 2Z57A 3LBNA 3QFCA 4BZXA 1A9YA 3LQYA 5HA5A 1FSGA 2IEZA 1HA3A 2G5PA 4XQ0A 4CR6A 3IQIX 4JXJA 4NBNA 3RTAA 2V7VA 2XKKA 1O6ZA 2OGZA 3HBFA 4TKUA 4JJEA 2XYPA 4WMLA 5GWXA 3T4PA 1OH8A 3VU3A 4DT1A 3QKWA 5B6PA 1HURA 1FTNA 1SBNE 2I7TA 1K06A 3ZIAD 3QV2A 3BE8A 5H82A 4BU1A 2WTUA 3THWA 3NAGA 4NPHA 821PA 1FQOA 5B1DA 1NJ8A 3AFMA 3PHGA 1P60A 3L77A 1GLNA 1RWBA 3AXSA 4TRRA 1BEZA 4YHBA 1L5MA 5MN6A 3BMOB 3IDOA 4CIYA 1PX2A 3KXKA 4F7DA 4F3TA 3PPVA 1NHWA 2JH9A 3DLCA 3OP4A 3RIGA 1MG0A 3OECA 5JUWA 4FNGA 3AB8A 3AEXA 1OWMA 2A59A 3LW7A 5FUYA 1GD1O 2IW1A 4FW8A 3CGGA 4JLVA 3CNNA 4R8KA 3DJYA 3BQ9A 4FJ0A 3PVZA 1G4HA 1RZRD 3LKZA 1SCUB 2EEPA 2O2YA 2XMBA 1FFHA 3MGKA 4F6RB 3B1VA 1A5TA 1G21A 1PJAA 3TMKA 3SLGA 1DOAA 4G41A 4OU5A 1U2DA 1KYVA 4HB4A 5LZ9A 3OZIA 4QA9A 4Q7QA 1SZJG 2QUJA 3CPEA 3KT6A 3RANA 1NBHA 2AQHA 1FYDA 2HMSA 1WQ3A 1D2CA 4J29A 4ZO6A 1BTOA 4DLUA 4TSKA 5JJBA 1Y5IA 1BW9A 2QPLA 2YBDA 3CN7A 3QVVA 1CJSA 1ZVMA 3IEPA 3JVUA 3KWLA 3H2KA 4WL0A 4G0UA 2IS4A 4CKBB 1AXRA 3ED5A 3EPJA 5ERGB 1MU0A 2AXNA 1XUOA 3PJRA 1UMKA 4L0MA 3DDWA 4FHGA 2HK8A 4OLFA 4JUIA 2WD9A 1QYRA 3U9LA 2WWGA 2OCDA 1X7DA 3CZPA 1KNXA 1RCTE 3H1PA 5G02A 1VKNA 2ZITA 3OZEA 5I9MA 3HXTA 3NWPA 3T99A 3HGMA 4EVSA 2Q5OA 3UJ9A 4BNVA 1FTSA 1OLXB 1UDXA 2D2XA 3R24A 4B7CA 4ZGWA 4XLZA 1GUZA 1XL1A 1E9EA 4CLRA 3SBOA 1EG7A 1GNTA 3NIGB 3G0GA 4WCFB 3R7BA 4BAGA 1T8WA 3B89A 1PGQA 1R18A 2X9NA 3M2TA 4PANA 4WZAA 4V0RA 2HEIA 3LI2A 4CJXA 2ZYIA 4K87A 3BBPA 2YJGA 1ID1A 3FB4A 3IPAA 5C31A 4CKEB 3PKZA 4H4EA 4GGOA 3S8EA 4MPTA 5EJAA 2QYTA 4GZ6A 5FUXA 2LBPA 4OFXA 5EXSA 2PEZA 1Y5NA 2HIAA 3HGQA 3O92A 3QWHA 3GNQA 4GSKA 2PV0A 4HH4A 5J40A 3MD0A 3OY2A 3FR8A 3GLVA 4DV6B 3WA7A 5K8CA 3SC3A 4LMPA 5E6RA 2IYPA 5I7OA 1AKRA 2VDNB 3NDJA 2IUTA 2ZQZA 2VEDA 3FRJA 1EFPA 1MB2A 1ODFA 1A9XB 5FLYA 1CZKA 1L6IA 1YVDA 4X1KA 3ZKWB 2F3PA 5K3EA 3PNMA 3NOOA 4DXHA 1M7HA 2EU8A 2CXRA 2WR8A 3PICA 4R4JA 1KK3A 4XFKA 3ND6A 1E7YA 4UHHA 5DCUA 1ZNXA 1PFQA 3NHAA 2WF9A 1DS6A 5H8WA 4KPUB 5L4LA 2V5AA 4FNMA 2I65A 1K0UA 3P32A 4UDOA 1D1SA 2ZM5A 5CDSA 1HG1A 3KZCA 1RXVA 3GU3A 1MC1A 2FG7C 3O0TA 1VKOA 4FGJA 1BGWA 1TK3A 3OX1A 3IVXA 1BA2A 1YB2A 4ISCA 4HGRA 1S4MA 4L5YA 4OQPA 5HBGA 4Z1MA 4D9GA 2P9JA 1CJVC 2J9YB 5BNWA 4G26A 5EJIA 3EEBA 4ZRDA 4ZEXA 4Q3AA 4D44A 4FBGA 1GT6A 1E2FA 1YTLA 3OLYA 4WZBE 1ZH8A 3VR3A 4E2YA 2R66A 1G20E 4IO1A 3B3AA 2AQIA 4U2CA 3VPHA 1JSRA 1MQAA 5FEMA 1XJ5A 1SRRA 3DDHA 1K4MA 2P2GA 1SQ6A 3EZNA 1SB8A 2XQKA 3U1VA 3W8RA 5JCXA 5FO1A 1PL0A 1CF4A 3NBXX 2QRQA 3B3QA 3QOYA 4IO0A 3ZWNA 3WLJA 5KYKA 2VWPA 1Y8QA 4DIMA 1W48A 3F67A 4TV8F 4XB2A 4ENRA 3WGIA 4DV3B 4TS9A 2AJLI 5D2CA 4M9SA 2HCRA 3KEGA 3M1IA 1R74A 1DCFA 2B0CA 4WLFA 2XUIA 4EMBA 3BXOA 3LLVA 3LLUA 4FS8A 1WDWB 3T5DA 1ULZA 5AVZA 3KE9A 5A6SB 1S4QA 4B6QA 3B9PA 4RM2A 4TLAA 4NE7A 1PO7A 3CKLA 1HSZA 4QGBA 1EVJA 1WHSA 1V47A 5B3JA 3ESZA 3OHPA 3ZE8A 2B99A 1NLMA 4KE9A 4M1WA 2CKDA 1QYXA 5C5IA 3HSYA 2Z9CA 1JEYB 4RQTA 4JHXA 2J48A 2GXUA 2VRWA 4HUQA 3TR6A 1PAUA 5A4IS 1GFIA 2QD4A 4AY6A 2GDZA 5JHGB 1PHPA 1EGMB 1FP4B 2F9FA 1XRRA 2PU5A 3AJ8A 2B8EA 3G8DA 4EB8A 3GOHA 1RWPA 3IKLA 4CLHA 4AG5A 5L51A 1ESZA 2NUAB 3HZHA 2O8BA 3IDQA 1RP1A 1VHWA 3D3KA 4ID3A 1NPTO 1P77A 4KGDA 1IM5A 3HDJA 5HIAA 3TEJA 4JI5B 3M4ZA 1T2DA 1P0CA 2IDZA 1LDMA 1QF7A 4KUHA 5BN3A 3LJKA 3ZI7A 1L4NA 1CUBA 2WJIA 1GUYA 1U3VA 3K9GA 5DVZA 3SFVA 1EX1A 2QMZA 4PIPA 4G63A 3ZUPA 4RK4A 4BWYA 1JDPA 1TT5B 3V3KA 2G88A 1TEHA 4UHFA 3TQTA 5FAXA 5ENZA 1LBTA 5JHHB 4WKCA 421PA 1IZ0A 4A82A 1T0IA 4LMRA 3KHKA 4RDCA 5A04A 5A1TA 2P5YA 3GFQA 1JBQA 1MO5A 3LZDA 1AD2A 1G8HA 1GGNA 3KT3A 1O9HA 3MMNA 2GX6A 2XKBA 1C4XA 4WNAA 3ZD9A 2IGBA 5KREA 1TTTA 2F9MA 1J42A 3AJEA 5K3FA 4ZCIA 4J3JA 2DX7A 3ETEA 4UZEA 4LF4B 1FDOA 3C1TA 4C4ZA 2E1PA 3ZV4A 3H8VA 5CD1A 2CE2X 4ZI3A 2GERA 3ZZMA 4GLBA 2MWMA 1TW3A 4EKIA 1JXOA 1FU8A 4HAZA 3P9RA 2ENWA 5M29A 1XZFA 4KN9S 2PYDA 3SQDA 1TUBA 3K0AA 3O6VA 3IKTA 3MXTA 3LLMA 3OUZA 4I1IA 3WAKA 3OKPA 3PQCA 1NNLA 3D1VA 1PJCA 2VSNA 2VAMA 4CDGA 2WMNB 2HSWA 2OFOA 4JCCA 1FRQA 3P9QA 4PLVA 1H8HD 2JGAA 1ZU5A 4HN2A 4LIPD 2Z1MA 1BU5A 5H3CA 1KGSA 2FW1A 1U9IA 5FJJA 4EMUA 1W4RA 1RQNA 3JASA 4QDZA 3NUQA 4AY2A 5BN4B 3N86A 5CK4A 4E15A 1BN6A 1S7CA 2APJA 4OJYA 5EP3A 2Z6AA 4IBOA 1RYHA 4EA8A 4JC4A 5ITWA 3H2ZA 3W1VA 4RSRA 4YO8A 2ODPA 2CFTA 1SHUX 4CV0A 5LQKA 3TDNA 3IS3A 1MKYA 1LV8A 4EKYA 1J22A 4EF6A 1C0IA 2FZVA 3GLGA 4XB6B 3FNEA 1X8KA 5IYZF 3P8ZA 1QDLB 5C7YA 5MFPA 1BXGA 1FXWA 2I3BA 1RHQA 1J9ZA 2O05A 1X7WA 5ALNA 1IUNA 3BH0A 1Y3IA 3ZJ5A 1J8FA 4AQ7A 2HF7A 2OZPA 2SKDA 2R87A 3LHSA 3UH1A 1JPUA 1NE2A 5BPFA 3MYRA 3MS7A 4OXXA 4WESB 3KL4A 4X92A 2HMWA 2GFHA 4LJLA 1UK6A 4GBMA 3V7YA 2QRUA 5D84A 4TSRA 3T3OA 3THXB 2ZATA 2V55B 3BYZA 5DYIA 3LO5A 1CUUA 1T0PA 1ZR2A 2RJOA 3OCXA 1QB8A 2WG0A 4CIBA 2IYFA 4M98A 3DMNA 4UBKA 1C1YA 4K6CA 1BD4A 4XGRA 3X1XA 1DDOA 2WJYA 4OHKA 4YRPA 4YUZA 5HTOA 3GLIB 5CNKA 5IBQA 4KRYA 4DIUA 4HG2A 3D54D 4N5HX 2Z2KA 3TFWA 3FN4A 5EGSA 1L5NA 1LX7A 1Z6QA 4AQDA 3D8SA 3PDWA 2HWWA 4TTPA 4OOFA 4N8DA 4TV9A 1DXOA 3BF8A 3LBAA 3L7LA 3PFBA 3WWEA 4PINA 1DIAA 4FEGA 5ITSA 4BRWA 2H07A 1D2RA 2GBIA 4WOCA 4NCJA 1OI4A 2A0KA 3RT1A 3EGXA 4PYMA 3CC8A 4Q9DA 4M9QA 4JI7B 1YL5A 2GK4A 1K27A 4BMVA 1RVV1 1JQJC 5F21A 2Y3IA 3OMWA 5BR8B 1P18A 3TRFA 2ZRIA 1CR2A 3IP7A 4RHEA 4CIVA 1IDN1 4XWTA 2N1BA 2AI3A 4KE7A 4XKJA 4Y7CA 2DQSA 3I62A 5CM8B 3ADBA 1CR1A 3QPUA 3BCHA 1OFVA 1UBGA 1X6VA 3Q2IA 1NI3A 4X7MA 4ABTA 4ZK2A 5ETJA 1BIFA 1DBSA 1WXFA 4XQEA 5B58T 1PD1A 1OUMA 1T0HB 2PMBA 5HQTA 3AJAA 1TEXA 1XT6A 3NANA 4GGMX 4W6ZA 5EHNA 3C8MA 3AI1A 2EBFX 4WK6A 4Q9JA 1KXJA 5K51A 3CZ9A 4YQFA 2I4TA 2Q21A 4OQEA 1OLXA 2BFMA 5FPTA 3H5OA 1E9VA 4ZQFA 3L8ZA 1EX6A 2Q4EA 5IJWA 1NBAA 3O4IA 3HXMA 5GONF 1KOJA 4KFRA 4H0CA 2ASEA 5BQPA 1AUVA 3VUFA 3QE4A 2G9RA 3NT2A 1JEAA 4HWGA 3GBSA 2ZR8A 5F5LA 1K6XA 3RREA 2H4FA 4N7BA 2A35A 3NETA 5H5JA 5T41A 5CBKA 1W4CA 1VMIA 5DM0A 1UEIA 2XSZD 3MCVA 4I4IA 3GFPA 5F7XA 2YVKA 4EBBA 5BSHA 4RDIA 3WBFA 2BI7A 4AJ2A 4M49A 3TEMA 4CT4B 1IOVA 1CUWA 2PMWB 1GLGA 1BX1A 4BO4A 2R4UA 1IQPA 5BOSB 2WHYA 3ASZA 4JEIA 1QVAA 3QBTA 2HQOA 4NBVA 3RYCB 1N33B 2QY6A 1OX6A 3HR8A 3UKOA 4GLFA 4QICA 3QTLA 4QFDA 2Z30A 2ZRPA 3TN7A 2GAFA 3MWEA 3U17A 2OHOA 3N2LA 4IV5A 4EHIA 4B6GA 4YAIA 1Z74A 4ZAFA 2VHWA 1LZKA 2RHRA 1PT9A 1XWWA 2XZDA 4IIXA 1Z4MA 1WJGA 2ENUA 2I66A 4DF3A 3ZWOA 3KSRA 3RFVA 1NIPA 5JPDA 5G40A 3L3BA 3LOQA 1D6MA 1PYDA 3PLAE 4L5IA 5LOVB 2FUKA 3EGCA 1DAGA 5IM4A 3Q8LA 3E03A 3HL0A 1TPZA 3AL2A 4YRSA 4LGCA 1QV6A 1X1DA 5JXIA 2RAFA 2Y0CA 3EQ8A 1J0AA 3KWMA 1KQPA 3L8FA 1TU0A 4YX9A 1Q7TA 3CPHA 3I2HA 1JEOA 4U8GA 3ZU3A 3F47A 4OF4A 1DELA 3F6EX 3BS4A 1JDTA 3W8DA 3K71B 3KEOA 4EY7A 1FZTA 1RXEA 2H4JA 1BH6A 2IKSA 3EJWA 2NO6A 2VP4A 4FVTA 5FTMA 3EPPA 3OMXA 5CYOA 3K6SA 4LDRA 1L5QA 3ZHQA 1U31A 4EY3A 4CCYA 2Z2YA 3FH0A 3D81A 4DL9A 5KHLB 1YCGA 3D2CA 4PQFA 5IUJC 2VBIA 1YBHA 4HLNA 1WZCA 4WXMA 4QUJA 4G5OA 621PA 4HUQB 4G0NA 4H15A 3ZE1B 2Z08A 4ZI7A 4CL0A 4HS4A 2ONCA 2VP0A 5ALEA 2NQ8A 2V5UA 2ZTUA 2BEWB 2V98A 1A77A 2WI8A 3BFVA 3N2NA 3NX4A 4X5OA 2ID7A 3IAUA 3RVDA 3RTCA 2W2MA 4OI0A 1QMGA 2OGSA 2B6HA 5JARA 3GFRA 3VZCA 1H69A 5AK3A 2OCIA 1TNDA 2E5LB 3DLHA 4OI4A 2PGOA 4FHEA 3G13A 5EN4A 3G9ZA 2C82A 1AKYA 1VG9B 2VH2A 3BD7A 3O82A 4UNPA 5FTNA 3PUKA 4R1PA 3AY6A 5TB5A 3ZK7A 4YCNA 3GLFA 1JR3D 1A76A 2VOEA 1QHEA 3AV0B 3KRTA 1ORRA 1RWNA 1IB6A 4TMZA 4Z9YA 4JJ4A 3WI7A 4LF9B 1MGPA 4NCBA 3CRZA 1Z6PA 2YJTD 3DWIA 3QVJA 2IUUA 2B1IA 3OF2A 4CRWB 3I9JA 2DVMA 4KP7A 2C7OA 2QYOA 5IBPA 3ULKA 3DO8A 2H8GA 2JF0A 2Q3LA 3PC8A 4PQEA 5REQA 3WMEA 4E12A 2AOXA 1M2HA 1V6SA 4K8RB 3HKCB 4I3HA 4HQLA 4A0RA 5MN4A 1ONSA 4M0EA 3C24A 3I3SR 3LCVB 4GQAA 4OXYA 3PDHA 3D59A 5EJ8A 1CUAA 2PZMA 2GESA 1SZDA 1M8KA 1SWWA 1Q83A 2VWHA 4BLVA 3WDKA 1GL3A 5E95A 3CSUA 2HXSA 3OQIA 4CF5A 3I0MA 4IUYA 5BWNA 4DV2B 1PK7A 3ZZ1A 2YY5A 4FGUA 4ZAZA 2W71A 5A5VA 2ERCA 3OTWA 4ZPXA 3C98A 2QN7A 4E21A 3I8SA 4J07A 5K8JB 4B3GA 1GN9A 4DG5A 3O2QB 2EJWA 3BIFA 3PNBA 5FCDA 4D9EA 2OP1A 4G8JA 4H1WA 1EAMA 3GRFA 1YB4A 4G24A 1LPAB 3NKFA 5LVAA 1EGVB 2VQ6A 4AKHA 3GJYA 3D02A 4F84A 4MVJF 1BFDA 2BGMA 2JLBA 3AOGA 1TM3E 2P11A 1PSWA 4PGFA 3RTDA 5LQMA 4INJA 4OLHA 1IOLA 3R75A 4BQPA 3KT8A 4YCCA 1KDZA 4XUDA 1P74A 1L9XA 3COYA 1A8PA 2ZRBA 3LDAA 4W5NA 1KZ9A 4JYMA 3R9XA 1ISSA 1WVIA 2HHAA 4ENUA 2WVGA 4AJ1A 1CFZA 1ZD1A 2LE0A 3FFWA 1MAWA 5A02A 2V5VA 2CYCA 3E5NA 3H9QA 4NU8X 1P19A 5IW8A 3PR3A 3L1KA 2VAVA 4GP9A 1CEYA 3LMKA 5FLEX 2HGZA 1VFPA 5FWYA 1CUJA 1YT5A 3HWSA 2I55A 2VYVD 1SD5A 3AFIA 4LVOA 3S1SA 2EBWA 2D54A 4EEZA 5B2EA 4CCWA 2CUZA 5DXFA 3WL5A 3BCUA 1ZCBA 3T3MB 1JLRA 1UAAA 5CVTA 2VSQA 4KW7A 5SYAA 3C7DB 5AR1A 1P1HA 1I30A 5AVJA 1KARA 3RSCA 1VB3A 4X66B 1EK0A 2WTNA 1UUFA 4DCTA 4FCCA 4NU5A 1SVWA 4CGYA 3E6AA 2AMFA 1ST2A 4X62B 2D2VA 2Z2XA 1G5RA 4MX8A 4UDXX 1B74A 3HDYA 2YTZA 1TD9A 4XYBA 2QD2A 4RVOA 1KFJB 2PSHA 3OEHA 5LP1A 1ZISA 1FFCA 2R86A 3O8LA 4YJGA 3I72A 3BVPA 2P41A 2WF8A 2BZSA 2HK6A 2JAPA 3EXFB 4UU0A 5BVGA 2DPXA 2P9GA 3M49A 1Z6YA 3CKKA 4XGNA 2AV6A 3WHLA 5A0TA 4KXFB 5AW8A 3PT5A 5F1YA 1DIOB 3DZBA 1MP0A 3PTZA 3U7QB 2IHJA 1EHYA 4OUKX 1KYWA 2OV8A 4CLOA 2X5OA 4NV3A 1F60A 3NNDA 1U98A 4TT8A 2FFRA 5DYWA 4PGHA 5BVGB 1ZUNA 4HC4A 1KP2A 1HDIA 1I10A 2WLTA 5DI9A 4Q1BA 2WPDA 2H1HA 5DIFA 4IP0A 3VMFA 2I67A 2WIDA 1Y89A 3MHPA 4MCJA 2J5BA 3MVEA 2H31A 4MP8A 4U1RA 3VZPA 5JJIA 1Y1LA 2QF7A 5J1TB 3FDJA 3I58A 5EIWA 1E3QA 1NKVA 4M8IA 4LBWA 5E4YA 4ZV7A 5EUMA 1ISPA 4R9VA 4N47A 4P92A 4IKPA 2K7FA 4PSDA 4DMFA 1DRJA 3KKPA 1NJ6A 1GTVA 4EPYA 4UTNA 3V8MA 1CIPA 1KPGA 3VGPA 2ONKA 2QE7A 2V4ZA 5CM2Z 3WTCA 5KDDA 1Q1GA 2CJWA 1UPCA 4M7WA 1ML4A 2O8VA 3AQIA 1QRTA 3HA7A 4QTXA 3DC7A 4NZYA 1MOZA 3EXIB 3CLRC 3EMVA 3OY7A 3N5KA 3P9XA 3USES 1XF9A 5FWAA 2H7YA 2XRMA 3AR5A 2QSZA 1PJLA 3WLTA 5HS4A 1JKFA 1UAYA 3DAGA 5G1PA 1KWKA 3AT1A 1NBMD 1ZK3A 4FS3A 1VL8A 4REMA 3ICQB 3OESA 2H9YA 1T8YA 3BWVA 4Y6LA 5IJXA 1T4MA 2NTYC 5J58A 5B1HA 5KPDA 3GNTA 4DLXA 2GD2A 2VSYA 5C8YB 4K1LA 1ZM7A 1QR6A 1L8QA 5THQA 3OLWA 2PGJA 3ZDZB 2KBFA 1Q1EA 3F0TA 4YCBA 2BP7A 1GRCA 5T57A 2FPIA 4Q1EA 4OLAA 2XGSA 5FOTA 1HR0B 3MW8A 4R8VA 1HTBA 5HF5A 1WMAA 2BC9A 1BO6A 1UINA 1ML3A 1M6EX 3SYNA 1I36A 4Y6RA 3AGPA 2OMKA 3ECSA 4P3YA 4YI3A 3M6IA 5AT1A 3SYMA 1BS9A 2V54A 4ER7A 2OA0A 3UOAB 2NU6B 1FVOA 1UT5A 2GTPA 4E0BA 1C3EA 1WX1A 5FPHA 5FLKA 4L4XA 3RVQA 5TGDA 4ZTBA 3DL4A 4G0XA 1Y5LA 4ICIA 4IWYA 5KU1A 2NV6A 3CVXA 3PHBE 2NZWA 4U7PB 1ISHA 3ZVNA 1P3DA 2RHGB 5CG1A 1BZYA 1GNVA 1G42A 3HFRA 4XI9A 2DULA 3KU1A 2AOTB 5JV5A 3KKQA 5EQJB 2E82A 1QV7A 4N0DA 4IDPA 4B84A 2HHCA 5JO9A 1EUQA 2QP3A 1SHTX 3A6HA 5HWSA 1UR5A 3JQEA 3I53A 4J43A 3UCEA 4ZYZA 2A7XA 4Z3KA 5TMEA 1IHUA 2H7XA 3G85A 3I61A 2CVFA 2O7RA 4WQMA 3HHPA 1A0OA 2GJ8A 1H1LB 2BGGA 1XVIA 3GN1A 1M6NA 1N8TA 3CIFA 4MV8A 2J0UA 3ABSB 1R8SA 4E2XA 4UPEA 1DQPA 1FLNA 1JQ3A 3KAPA 4W5QA 2ZROA 3CW8X 1N2EA 4NQRA 5JD6A 1XCPA 2EKLA 1LDYA 2WBLC 5IBRA 4XD7A 3U9SA 4GPIB 4R1QA 4FI3C 4UARA 4I7EA 1YU9A 3UMGA 4Z2AA 3LWBA 2XXAA 3DD5A 1IH8A 4R9SA 2W83A 1FE8A 2IP2A 1KI8A 3ZV7A 3JR7A 1U3CA 9LDBA 4IG4A 2GWHA 1VRVA 4O33A 1QNFA 4Q3LA 1L7EA 1WUJS 1KQFA 1Y7LA 5ANRB 3GVXA 1EM8B 3D6UA 5AK6A 3IHKA 4J6FA 4XX0A 2G07A 1IUOA 1W19A 2QZJA 3DHNA 1NKSA 4ZT2A 5BQOA 3ZBUA 2WSSD 4P98A 5CJJA 5T4HA 3HLTA 4UUPA 2XX3A 5H3HA 3BWCA 3K6SB 1FUEA 1NPYA 5ICFA 3UY4A 4DE5A 4N76A 3G23A 1QU3A 1MIHA 3LUDA 4QEDA 4EY4A 1XZMA 1P1KA 4MVJM 3ESRA 2FP4B 3PX3A 2O06A 4XX0B 3RASA 4O3FA 2PSJA 4HJXA 5CCBA 3UTCA 1INLA 2O3TA 2XTMA 3N8IA 1G7RA 2Q9CA 5K1ZA 3TLCA 3CW2A 1S6YA 1XXLA 2IOQA 4RAOA 5FD8A 4IQFA 5JWHA 3F8WA 5IJ0B 5CCXA 4RENA 1NTRA 4KEAA 1R2QA 2PKCA 1UMCB 3ZY3A 5J4KA 1E9FA 1JYFA 2WIBA 2WKQA 3GPLA 2C94A 2EIXA 2G1KA 2C58A 2QP4A 5DHTA 4OJKA 2I29A 4NZZA 1RMTA 4FOTA 2VF5X 2WV9A 4R69A 2EDAA 4BO5A 1S2IA 1FS5A 2JFVA 3NHFA 4CT5A 4OA5A 5FNVF 1L8XA 3BRQA 1SKBA 4FW9A 1OZ0A 2R8PA 3AIKA 3AKDA 2DHCA 3CB2A 4W63A 5TVGA 2WA1A 5I7AA 2JG3A 1GGKA 5BQXA 4PXSA 3LECA 2W11A 3NIDB 3I8XA 4EENA 2WJGA 4MS4A 4A1OA 4Y2HA 3OURA 4LNAA 4C20A 5C9ZA 5F1KA 4CLDA 4QGSA 1XPRA 1H2ZA 2MSWA 1GNLA 4EA6A 4CNQA 4DMRA 1PUXA 1TJNA 1KORA 3MSXA 4LHXA 4XUGB 4E3WA 3AVXA 1VHQA 1YZLA 3IMFA 3DF7A 2AC7A 1SPBS 2ZWOA 2F9LA 3CJTA 4X61A 1ACMA 3U5ZB 4D0LB 5FULA 4F9GA 4MJXA 5LR6A 3LF2A 5F77A 4JX8A 3D7KA 4V0QA 4UDYX 3L41A 5TT0A 1TO1E 1SXJD 3PTAA 3PXXA 1S2MA 3K2BA 5AI5A 1RIIA 3TCXB 3R5FA 4NH4A 4GRIA 1XK6A 2CSUA 1XYGA 1IXKA 3T7IA 1RJ9B 4X7RA 1KAMA 2IYSA 2HH9A 4G2TA 5GJBA 3QWFA 3RVOA 1W5EA 3G1UA 4R68A 1J97A 3S44A 4LOKA 5EEGA 1LRKA 2DQ4A 4A03A 3CZMA 1EUYA 1ORHA 3BSYA 5H81A 2PA0A 1AS3A 2QN1A 3OCYA 4FFBA 3VR4D 1TZJA 2FOLA 1Z33A 4NRDA 5HE8A 1IXRC 5HCUA 4D4GA 2IE0A 3ZQJA 1GNQA 2UZ1A 1OBHA 2C2OA 3PFNA 3VJLA 2XGJA 3JQPA 2CJPA 1M6VA 3OSUA 4EVIA 2X14A 4MUMA 5J59A 3LXXA 3RS9A 1Q95A 3FPLA 3NVKI 4IEIA 4R83A 3UYLA 1VC2A 3ILYA 4QELA 3MAGA 4BCBA 2VBCA 1RI4A 1ISGA 221PA 4IVPA 3IV7A 1YBAA 3Q72A 2ZUWA 2C57A 4OJTA 5JSYA 1K7CA 2HCBA 5EHGA 1F0NA 4G4JA 4W5JA 1C3OB 1YC2A 1TU4A 3E35A 3HWWA 4J3FA 3VVCA 3N8HA 3BGSA 2H92A 3OZCA 4I66A 3ON5A 5T67A 2XUFA 1U3TA 2ZKLA 3KWFA 3D0QA 1P61B 1F6DA 3ZD6A 3TTVA 4EPXA 1T5SA 5CBPB 1HG0A 2Q4RA 2DP4E 2D5CA 4PSCA 1EFVB 1G66A 4ZT6A 1GILA 3H9GA 4QBGB 4L3OA 1RDFA 1SMKA 1YA4A 3ZGYA 1AKMA 3UJ6A 2CZGA 3B1JA 1A5AB 1QANA 3I9OA 1LD3A 1Z0IA 2C2GA 3N8DA 4IMJB 4RHYA 4P0QB 5JNLA 3T1TA 2QP9X 2VDPB 2ZWMA 3D6HA 3G17A 4YV2A 3O8OA 1IN4A 3E5MA 3K70D 1JDNA 2CWWA 3Q12A 4WESA 1B7GO 1R50A 1IRIA 5I8ZA 3AOEA 4BX8A 2JIRA 2X4LA 3FHJA 5IWAB 3QJ5A 4FB4A 2NPIA 1U0FA 3HA2A 5DGDA 1FP1D 1S2LA 1GDDA 5LKAA 5TPWA 1PNVA 2ZIUB 4DCVA 2R8XA 5JJ5A 3ER8A 1QKKA 1XCMA 3AUXA 3B6IA 1Z82A 4BB9A 2JI9A 4CXMA 2BSAA 3G2MA 2UVPA 4AZ3B 2BDEA 2BEKA 5J4YA 2IHNA 4X64B 4OKSA 1ZEMA 1JG4A 3IHTA 1PZNA 1Y6ZA 4GOND 2K4MA 4AMVA 4HT3B 3S6JA 3W5SA 4IMRA 4BS9A 2WMYA 2D3WA 3I76A 3L8MA 3MERA 4HX2A 2H0QA 1F14A 1VIVA 3EZ7A 1KY5A 4M7PA 3FYCA 3T7DA 2ACEA 2P3LA 3ANLA 4ND8B 3PGLA 2VHTA 4HFRA 4TRMA 1TEZA 3BMCA 2LIPA 4NMXB 1RC0A 1QQAA 1LTHR 1GGMA 4OYRA 1FSFA 5BXQC 4PAOA 3WMFA 1ZCZA 3MJHA 3X0DA 1JFFA 2YN0A 4BAZA 3M1LA 4LYDA 3K0KA 3PVSA 2GZ1A 4EGFA 5AHRA 3EXG1 4HRAA 1OAOA 2IYVA 1BMQA 2R7AA 4YV7A 1O7JA 1P5FA 1VLMA 2WHPB 3BJEA 4AKEA 2UVQA 2VDOB 4ARZA 5BNTA 2GSDA 4F3CA 1NXSA 2P2CA 1X7XA 2UYOA 4BFTA 4HFNA 1XTBA 4BLPA 5JS8A 2OGTA 4QYWA 1XB2A 4WUVA 1XD2A 2A9JA 2WWIA 2ZPUA 1UKAA 1V5FA 2QUHA 4H6PA 3ICEA 1TQ2A 4ZYUA 1NULA 1QCZA 1PSDA 2NUTB 3Q4GA 2R3SA 3DSRA 1C50A 3HCFA 1NVMB 4FOSA 3R3VA 4H7JA 1ESDA 3LGSA 3CTMA 1PJ2A 3IQWA 1Z0AA 2QN6A 2VLBA 4ZAWA 1FYVA 3KELA 2F1RA 3KR2A 4HI0E 5JTUA 1EWYA 3TGPA 3FLEA 2WKRA 4XUCA 4TV8A 4UKDA 3KU4A 2SKEA 1T8RA 5AOBA 5FFMA 3KM0A 1BJKA 4XWAA 4TWAA 3R8CA 4WASA 2WY2D 1AN9A 4C5AA 2P90A 4HSEA 4M89A 3U7QA 2HL6A 3W34A 1EWRA 1WD5A 3G79A 4CR8A 3HC7A 4LYJA 4MVJI 2QE6A 3RARA 1JN0A 4BLRA 3G8BA 2CXOA 4ARVA 2H7CA 2EATA 2W00A 4OBBA 1AGPA 1K8QA 4N65A 4KXLA 2F4VB 3I1FA 1IG3A 3BMNB 4NNPA 4UZSA 4A8JB 3TZHA 3QHPA 5JJCA 1UIMA 4FFLA 4DQUA 2Q1YA 3QY9A 1FB5A 3N6XA 3WISA 2YHIA 1OW3B 3M81A 2DF8A 1JPJA 1RZRA 3IIEA 4D80A 4WOBA 5KSWB 4I1OA 3MD9A 1YFZA 2DUNA 1XQ9A 2YVUA 1A2QA 2YWGA 4MWCA 4JV5B 2OQ2A 1TTPB 3OX2A 2R79A 4IFBA 3U31A 1U6JA 4PC6A 1O8CA 4FZ3A 4OI2A 4BZZA 1LFAA 4YP0A 4OQMA 2AF4C 1RYNA 3D6JA 4QDOA 1WPRA 3C6MA 1IM2A 3KOWA 3UHFA 4EW2A 1G19A 1N1DA 5JBNA 4RY9A 1IULA 1Q1BA 3ZWXA 2XVZA 1U8ZA 4H60A 5EWJA 3SOZA 4MRNA 2YFHA 4DQXA 4GNRA 4MKHA 3U13A 1TYAE 3C6YA 2YV4A 4HOYA 3WB0A 4Z7JA 5AW2A 1RRVA 3PUIA 1CW2B 4IGIA 1FDVA 3BHJA 2EX1A 2BGIA 1E9AA 5CR9A 4D3XA 2BR4A 2N42A 2A84A 1OIVA 3DOIA 4UFOA 1HRDA 3DAHA 2C84A 5EESA 4A8HA 1ZNZA 5IC5A 1U3UA 2AJBA 2G77B 4I50F 5LP6C 4QPJC 3ZG6A 1SXJC 3UJ3X 4IHJA 5FNZA 2KB0A 1CZUA 3EVEA 3K31A 3M5DA 3FSRA 4FE4A 3KYBA 3UA4A 4DJAA 2UZ1B 3DP9A 4PU0A 3WL3A 2NXEA 5KWSA 1M6VB 1NVKA 4D9HA 1YR7A 2AEMA 5H4HA 3FTCA 1PLKA 4IG9A 1J2RA 2VTKA 2GBFA 1KA9H 1M2EA 3EZXA 3WQRA 4HPXB 1NUTA 4KR0A 1C3XA 1Z37A 4GYWA 4JT9A 4L07A 4RKFA 4B85A 2CT8A 3KJQA 4BASA 6REQA 1PNQA 2HZ7A 3O47A 2O3UA 2TYSB 3LFHA 2Q5HA 4A2PA 2OCPA 3NNNA 4ZCMA 1GPWB 2GETA 4R0VA 5HFJA 3ORSA 1RRCA 2W6PA 1QHIA 2C99A 2RGNA 1ILWA 4GBGA 3VKGA 5ALUA 4ZVNA 1Z4NA 1N7JA 3QVOA 1WZNA 1O08A 4BMSA 1B6TA 4B2IA 3T3DA 2ZRKA 2WWFA 3LQ1A 1DWQA 2DT8A 4B8YA 3CR3C 1HYEA 1XEXB 2Z2JA 3DQPA 4MMYB 1SZCA 4KQFA 1A8HA 1KY4A 5KNDH 2GJKA 1U0GA 1WUTA 4HHEA 4IICA 1BGVA 4H3SA 3A6LA 4L7VA 1O94A 1YDEA 2OXEA 2OEPA 1G1AA 4WFJA 5JNVA 3UWOA 4YIHA 4ARIA 3VVBA 1DRUA 1S5PA 4HLQB 4B3SB 5CB4B 4EHDA 2WIFA 4BVFA 2ASVA 3V1UA 1U9YA 2PUHA 5AIAA 3FFTA 2KE5A 2X5KO 4J7XA 1R5NA 4OHRA 4D43A 3ZIUA 1CYEA 3E3OA 1KAOA 2AW5A 3WRYA 5JQGB 1L4GA 4ZDJA 3EMBA