2PZEA

Minimal human cftr first nucleotide binding domain as a head-to-tail dimer
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
228
structure length
226
Chain Sequence
SLTTTEVVMENVTAFWEEGGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCSQFSWIMPGTIKENIIFGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLDFSSKLM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cystic fibrosis transmembrane conductance regulator
publication title Structures of a minimal human CFTR first nucleotide-binding domain as a monomer, head-to-tail homodimer, and pathogenic mutant.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 76
structure length 226
sequence length 228
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2pzeA00
4NONA 2VRWA 1LB1B 5GJVC 3X1ZA 2CEAA 1R5BA 2J87A 4ZKEA 3WBJA 1JALA 2I3BA 3KTAB 4O2LA 2RCNA 3GJ0A 3T5DA 3TLXA 2EWWA 2HF9A 1FPMA 3EPLA 3H0KA 4HB3A 2R6CA 2IYSA 3EWSA 1SVLA 2QE7A 4RCYA 1E9DA 3RRZA 4MYHA 2QZ4A 3NH6A 1C9KA 1J7KA 1ZIPA 3QVUA 1DG3A 4U5XA 4A6XA 1UFQA 1TQDA 1KSGA 2ZM5A 1S9HA 2WMOB 1TQ4A 4B2IA 1D9ZA 3B9QA 1J99A 3ADKA 2BKUA 3M0EA 3OZXA 3KQLA 2J3EA 3VMFA 3P4YA 2WPDD 1LTQA 2J5XA 1E9CA 3QKRB 3VR1A 2PBRA 2H57A 3VHXA 3L82B 2AKYA 2W0MA 1E99A 4B47A 2FGKA 3MFYA 4HLDA 3PUWA 4M21A 4HAWA 4YMTA 4EQ6B 1NMYA 3CNLA 3A58B 2HT1A 3BB3A 2ZS8A 2AN9A 4C0SA 5BN4A 2WM9B 3Q85A 3CB4A 2Z0MA 5GJBA 3K9HA 3FOZA 4C0BA 1XJ0A 4DKXA 4ESVA 2D2FA 3SQXA 2A3RA 4JJKA 4AG6A 1P60A 4NCKA 3V9PA 1WCV1 5JSZB 2MSDB 1A1VA 1Z6AA 3GLHB 1KMHB 3PUYA 4WXPA 4BE7B 721PA 5E95A 4DUGD 3CKLA 3O8DA 1S0UA 1G6HA 3TUZC 3B1XA 4URXR 2CLSA 4P33A 4X8LA 1GL7A 4LBVA 2J46A 3GD7A 1CJKC 1TF5A 3P27A 2G0NA 2JLWA 2P5TB 1W46A 4BFZA 1DARA 1G8YA 1KKMA 4LCBA 5GVSA 2OCYC 4B34A 2OT3B 2H92A 4IXMA 1S3SA 2BJWA 5FUYA 121PA 1X6VA 3EASA 2PZGA 2HXSA 5EE0A 4CVNA 2R8RA 2LKDA 2IXEA 4MYTA 1MH1A 4AG5A 4L9WA 1D2MA 4GT1A 1QG2A 1ZMXA 3LY5A 2IS4A 3IEVA 1KYIA 1P75A 3GEIA 5FTNA 2JJ1D 4A2WA 5F2EA 5TVKA 1EGAA 2Q3MA 1KAGA 1MO6A 3H4MA 4RKFA 3RHFA 4F7WA 3G0HA 2AHOA 4BZPA 821PA 3QXSA 3KX2A 3BGWA 4JVNA 2FF7A 4PQRA 3T1OA 4N0DA 1KGDA 4NP6A 4PO8A 5KPDA 3B7GA 5J5CA 4ZV4A 4TLEA 4ZDWA 3TE6A 1XDBA 2JEOA 2QAGB 4LYHA 2ZRLA 4JSTA 3TW8B 4JT4A 4B75A 3WHLA 2VYFA 3CWZA 4FWTA 3R9WA 4URVR 1HYQA 3RWOA 3SC3A 3LXRA 1M74A 3W34A 3Q3JB 1OXSC 3NG1A 1R0YA 1E9AA 5FPHA 3KFXA 4P31A 1QF9A 4ZCMA 4CGZA 1YR8A 2GJSA 2QPTA 3OEHA 1FQJA 5CIWA 1H8ED 4CEIB 3W5IA 2XB4A 1W36B 3QENA 2V54A 4IOJA 2FFQA 1PVOA 4BFWA 1H8HD 1Z0KA 2DR3A 4QBGB 4D4KA 1YZUA 3CLVA 4Q47A 3AVQA 3U3JA 5FOSA 3R7WA 1WBBA 2IYQA 2ZEJA 4B71A 4C0LA 4BLPA 2E9SA 4LYAA 1KDOA 3CH5A 3NBXX 1SVOA 1HH4A 4QC2A 5KDLA 4JLJA 3A4NA 3HR8A 3QG5A 3X2SA 3B8HA 1VHTA 2QG6A 2H18A 3VKWA 3EARA 2Q6TA 2XOKD 4FMCF 4BPBA 3ZDQA 1HT1E 2V6JA 3AF0A 1E1RA 3I32A 4U02A 4W9MC 1RPZA 1M7HA 1ZUHA 2W00A 2HCJB 2WJYA 5E7IA 3HJNA 4RZUA 1UEJA 4RD3A 1GWNA 3CRRA 3KTAA 2WBLC 2EU8A 3F0TA 2VQSA 3BFXA 3V00A 3HYRA 1R5NA 2IYLD 3QUSA 3OEED 4JVSB 4FCWA 5DI3B 5JCZA 1I4DD 4QBIA 2GVZC 2EFHB 4GSYA 4U00A 1G5PA 3T5GA 4AC9A 1OXUA 3IGFA 5FBLB 1IBRA 1OYWA 2ZRDA 2ODNA 3Q9LA 5JHGB 2PZFA 4UQOA 2BCGY 3T1VA 3NBYC 4HLQB 3QKRA 5A4JA 1R8SA 5JJKA 2IWRA 4G5OA 1HV8A 3LD9A 2R6AA 1OXVA 2QMUA 4BEBA 1TU4A 1NSTA 1AS0A 2BMEA 1G291 1VECA 2C77A 2OILA 4EQ6A 2GESA 4JSYA 1SZPA 4UKDA 4YXWA 2R44A 1R7RA 2MMGA 2GDJA 4TLAA 4JYCA 5AJZA 4E09A 2GF9A 1X1SA 2UZIR 4LJ7A 1E3MA 4PAQA 1QRAA 2H7VA 3QOFA 4AK9A 1FW6A 1OFTA 3DOFA 4NCIA 2WJJA 4Q02A 5JSZA 1X8LA 1L4UA 3GLHA 1KMHA 3OIWA 5SZJA 4DB4A 3GQBA 4NL4H 3E5HA 5K8UA 3CF6R 2QQ0A 1W4RA 2CCKA 1T5LA 4OHXA 1E79D 4I1SA 4F92B 3DZ8A 2XEXA 2ATVA 4JLVA 1X1RA 4N3NA 5L8VA 4GBMA 2RGXA 4B73A 1XPUA 3RSOA 4C30A 2DHRA 3KFVA 4PC7A 5AUNB 1P9WA 4QBFA 4W5WA 2Z43A 5EP3A 1NY5A 5CYPA 5HE8A 1SQ5A 2R65A 4OJQA 2ZYWX 4MKHA 2GF0A 4B3BA 2O0KA 2ZYUX 3WYAA 4PPQA 2ZRKA 1LS6A 2ZE6A 1S1MA 5EP1A 1Y3AA 2BM0A 4BFTA 4RD4A 2AFHE 3FMFA 2FSHA 3FE2A 2O8EB 2XTZA 4IEEA 5KNCA 2YV5A 4K46A 5HTKA 2PCJA 4TQUS 4HUTA 5FTLA 4AWXA 1Z0DA 2VHJA 2OCPA 4R2IA 5KDOA 4G1UC 3FB4A 3AKEA 4BFSA 5H70A 1KNXA 4XSGA 4ZDKA 3KUDA 5DYGA 1G7RA 3PUZA 4EKDA 1XTJA 1XPRA 1SXJD 3H86A 1U9IC 3K0CA 4M1YA 2QAGA 3AF2A 1AGRA 2B6HA 1CR1A 3AP1A 2JA1A 3B13B 1MRSA 1U8ZA 5EUMA 1JQLB 2BCJQ 4MGYR 4I81A 5JLJA 4BWYA 1JJVA 2IUSA 3SYKA 2G83A 4ACBA 5H1YA 1U94A 2FPMA 2YWFA 4PC1A 5CITA 1US8B 1FUKA 4JJZA 1YZKA 2NO6A 4G3XA 3K53A 1KK1A 1Z08A 4CEIA 3TBKA 5CK5A 4ZKDA 1P73A 2C96A 2FMXA 4MUBA 2CHGA 2ZJZA 4IDOA 4LPKA 1U99A 2BC9A 1BO6A 5CYOA 3FHCB 2GVDC 1W2HA 4Q03A 2GBLC 3TJZA 2P65A 3AVYA 1Z29A 2PL3A 1ZM4A 3C14C 2NIPA 4WOPA 1G7TA 5LBIA 3PEVA 5DHAA 3C4JA 3UANA 3VKHA 5LDDC 2KWIA 2GK6A 2CL6X 2Z4SA 1G8HA 2GZDA 2IYXA 1KIMA 1ZD1A 2O8DB 3SJAA 1W48A 3PUVA 3PXGA 2WPDA 4IVPA 2UVQA 5B57C 2ODWA 3HU3A 5B64A 2REXB 2BKEA 1YE8A 4LDJA 3WMGA 5JHHB 2F9MA 2WOOA 4B3GA 1NVWQ 2HJGA 3QNUA 2AR7A 1OKKD 5EE5B 3R8CA 4CEJB 4DJTA 2GEVA 4HATA 4KFTA 4A8JB 1DAHA 3PEUA 3PQCA 4IXNA 4DDVA 1LV7A 1P2TA 5DI3A 3OIYA 3P20A 2A9KA 4FMDF 1IONA 3BJIC 3G5UA 2IEYA 2VEDA 4Q18A 2WKRA 5GJWC 4US1R 4DUGA 1W2GA 4E22A 4PO1A 1IN4A 2XNDA 1Z0IA 2WVJA 4C2TA 1OFHA 5CDFE 2QT0A 2I4IA 1KK0A 2KBEA 1R5OA 3CIOA 3QQ5A 2ZJ2A 1FMLA 2C9OA 5G53C 2IWHA 4HLUC 1AN0A 2VH5R 3UMFA 1G20E 4P4UA 4A15A 1NMZA 3AB3A 2VSOA 1ESNA 1ESMA 1U0HC 1OJLA 4Q4HB 2D7DA 2QBYB 1TADA 1WXQA 3W6OA 2W2VA 3NDBB 2QY9A 4MITA 1KSJA 1OIWA 3TUJC 1GL9B 1VPLA 2ZANA 1PLKA 1W49A 4MRVA 5CJPA 3SFVA 1FNNA 1Q0UA 1Z28A 3EIHA 2JJ1A 4LJYA 4AKIA 2DFLA 1HURA 2DWQA 2FOLA 3C8UA 4DCTA 4HYYA 4C4PA 3V4RA 3AF3A 1VDZA 2ERXA 3D3QA 2O8FB 4E5UA 3CW2A 4ESHA 4V0NA 4N1AA 4OI4A 5C2JB 2C5LA 1XZPA 3N2IA 1D2NA 4YDSA 1SXJB 1YHNA 3PEYA 5JJIA 1N0VC 4GMXA 1AKYA 1VCIA 5FOTA 2J0SA 2DY1A 2ZUCA 2JGNA 3BIFA 1E9FA 5DSZA 1P4SA 1IXRC 2IK8A 3EC2A 3TUIC 1ZNWA 5JWOA 1U90A 1QHXA 2Z4RA 4URWR 3ECCA 1VTKA 4NYJR 1KY2A 3FMIA 2N1BA 2O8EA 4TLBA 3CRQA 4PPFA 3FFBA 1G6OA 1IHUA 1H8EA 1OLOA 1DTSA 1OYYA 3LQRA 5KSPA 1QHNA 2GNOA 4G5GA 2NGRA 1Z5ZA 3V4FA 3QPWA 2GAAA 1TAGA 3TSOA 5LPNA 2X19A 3ZYCA 5FR1A 3WMEA 3X1YA 3OFND 5JMTA 1KSHA 5FI0B 1E0KA 4WZAE 1OW3B 3VNVA 1DO0A 1E9RA 5GJCA 1NN3A 4YC7A 3CONA 2XOKA 4QRHA 4MKIA 2RAPA 1HA3A 2P2LA 1XMSA 1US8A 2GAOA 3NEJA 1GNQA 1V43A 5E4FA 3KQUA 2FA9A 5HKKD 3WP1B 5FOWA 1QHHB 1NY6A 5KNDA 2WWHA 3RABA 2FPKA 2FPLA 3M6AA 3WP0A 2JCSA 4UNSA 4C7OB 3BFVA 4RFVA 3RS3A 4Q7LA 3FHTA 3LNCA 4BZQA 3CPHA 4KSBA 6Q21A 3OEEA 3RLFA 2SHKA 2FN4A 1N6NA 4C0AC 3U7HB 5AWFC 4O2RA 5BYKA 3EZ7A 1EG7A 1ZCAA 5BN5A 3EG5A 4KBGA 1O3YA 3X1XA 2O8DA 2ATXA 3T35A 2NO0A 2W2XA 2ZSBA 5DE3A 2PLFA 2ZJAA 4LX0A 2VP0A 3QXCA 1AA9A 1BIFA 1F6BA 4Q9JA 4IKEA 1GL6A 1NVXQ 1ZD9A 2FZLA 1SHKA 4EJSC 3AGQA 1N6IA 1G18A 1YRAA 2A5GA 2MMCA 3H1TA 4MGZR 1K6MA 2XTMA 3B6EA 4KO8A 1UADA 3PR1A 2REBA 3VX4A 1NF3A 1U81A 4B6EA 4CEJA 4LV6A 1DELA 1AQUA 2P67A 1P2SA 3I5XA 1ZM2A 2F6RA 4A8JA 1RIFA 1MO5A 3LWNA 1NKSA 1G16A 2C98A 1PJRA 2IX3A 3WXMA 1JB1A 1U2RA 2FGJA 1GKIA 3EWAA 1NVUQ 1J70A 4D4LA 4YQFA 5K8IA 1WBDA 3TVTA 1Q12A 1QZXA 4HEJA 3ADBA 1QDEA 2A78A 3BB4A 5CM9C 1MKYA 1VCNA 3MGCA 5KSZA 1XEXB 1F2UB 1E9EA 4B3XA 1JXMA 4BLSA 3U7GA 3UATA 1E79A 2QTHA 2Q21A 2ZE5A 1MABB 1LW7A 5KSYA 1GUAA 4LUCA 1OB5A 4B32A 1J2JA 1L2TA 1OXXK 2FSGA 1JEEA 2IA5A 2CK3D 4M1MA 2IBMA 2OXRA 3DM9B 4PZLA 5EE9A 3VQTA 3WYGA 1EX7A 4ARZB 5J4HA 4L4UA 1BKDR 1CJTC 1YZNA 3SYLA 4HB0A 3U61B 5BN3A 1VHLA 3HPRA 1FQKA 4IFEA 4Q4HA 3K1JA 1N5IA 4ZI2A 4J0QA 2QBYA 3ZS9A 1FMJA 4PZYA 1E0SA 2ZSEA 1XRJA 4X8OA 4XVUA 3QKTA 3SZRA 5HZKA 2V6IA 3UG7A 4M1OA 5KUTA 2C8VA 2XZPA 3JZMA 3L2OB 3BORA 4WVFA 3RNLA 3SBDA 2NO7A 4X8MA 3N2EA 1N3BA 2OESA 4KVAA 1Q1EA 4I1OA 5TB5A 3T34A 4Q19A 2WJVA 2O8FA 1EFHA 3IBGA 5P21A 1XPOA 3U44A 3AVPA 2ONJA 2QPAA 2ZTSA 3EXAA 1BMFD 3UWKA 2ZQ5A 1ETUA 1SXJA 4D82A 2GRJA 4Q7MB 4IDNA 1F5NA 4PZZA 2V4ZA 3UKDA 1N25A 2X1VA 4M4SA 2B8TA 3A1WA 4M1KA 4NTZA 5FTKA 4F93B 1HY3A 3QBVA 2BBSA 2ZUDA 4EFMA 4D25A 4PO9A 3I62A 4XJXA 3SR0A 2IXFA 2JJ8A 4TSFD 621PA 1E2FA 2Z83A 4TL9A 3NBZC 1CR0A 3RVBA 4IVQA 4HDCA 1E2IA 3CX8A 3GEEA 1G4AE 2YKGA 4HAYA 2F55A 3SHFA 1G4UR 1XD2B 3H2YA 1DADA 3T06B 3X1DA 3VFDA 1FP6A 4RCZA 5JFGA 4II7A 5FUXA 4NPHA 4QM6A 2GCNA 5DO9A 5DHFA 5TV2A 3AVVA 4GMDA 4L5BA 4PFSA 1BOFA 4C3ZA 1K5GA 1VMAA 2DFTA 2Q9BA 3QG1A 2GXUA 4Z1MD 3K70D 3SJBA 3CO5A 2ZRFA 3JZAA 1GP2A 1KOFA 3BOSA 4OI1A 2QNRA 1SXJE 1W36D 3MJRA 1D2EA 1G5TA 5JEEA 1R10A 5E7JA 4L8GA 2J7KA 4A4DA 1NIJA 1KAOA 4DC9A 3B82A 4FCTA 3ADCA 2ZYTX 1ZNXA 2VLIA 4PC2A 2VHUA 3CR7A 2PJRA 3WNDA 1F2TB 1QHHA 1U0JA 1E2QA 3EZ6A 1NN5A 2FU5C 4GP7A 1TPZA 5EXXA 3TSZA 4OHWA 3CX6A 3LBNA 3NXSA 1GG2A 1OKKA 4FINA 5EXTA 4B35A 1UAAA 4MKGA 2B21A 3RS4A 4YDHB 1S8FA 1RC8A 4TWZA 2A5YB 2AD5A 4DT1B 3CNOA 4AI6A 4Z54A 2QEQA 3KJIA 4Q9KA 2F3TA 1IN5A 5AUOB 4TQ9A 2ZS9A 3GFOA 4PX9A 2ZAMA 3MJHA 1GZSA 2D62A 3B1WA 3NIBA 1Q1QA 1P9RA 2YNMA 3LW7A 4JS0A 4CW7A 2ZSAA 4CT4B 3SN6A 1UKZA 3GJ6A 1NMXA 3AM1A 1JR6A 3R9XA 1XJQA 2FH5B 1ZUNB 3IIMA 2AD1A 4UNPA 4A1FA 2VA8A 2OCBA 3VU9A 4TYWA 4EFNA 3TAUA 3SHWA 1PZNA 1NI3A 2A2ZA 2JLXA 4QHYA 1GIAA 2XNSA 4HAZA 3E70C 2A5FA 3JVUA 4NYJQ 3W90A 4R9UC 1QBKC 3UIEA 1SGWA 4DLTA 4EFLA 3IDQA 3Q5EA 2XB2A 2ZR9A 3QKUA 4RD0A 2VF7A 4TQAA 5B2ZA 2RGGA 4GPTA 1E0JA 3A37A 4LBWA 5IRCD 5JRZA 2XNDD 1KO1A 1LF0A 4RD2A 3W3AA 1RJ9B 1P72A 3K0FB 3HR7A 3FKSD 4OQXA 4Z51A 2V3CC 1XEXA 1F2UA 2VSXA 2GTPA 1DO2A 1FL9A 1KY3A 1RFLA 1KJWA 3C16C 3K0EA 3I4LA 1GRRA 2VBCA 1OH6A 1D5CA 4BFXA 2J0UA 2QA5A 2C78A 4LV5B 1YZTA 4KAXA 1ZM3A 2W6ID 3AEZA 3CZQA 4ILEA 4ARZA 4DRZA 4JVLA 1EFCA 1HTWA 1NJFA 1NLYA 4FMCB 3FWYA 4QL3A 4AD8A 4JLKA 3TH5A 2DWOA 2QP4A 2CLDX 2ZPTX 1GILA 2J7PD 2QMHA 2ANBA 2H1LA 5H68A 3BK7A 4IW3B 1B23P 1M1YE 2F1HA 5LD2C 4TMWA 3I72A 2XZLA 1LY1A 4AYWA 4BECA 2D3WA 2JATA 2HLDD 4DSTA 1SKQA 3QI2A 2BIFA 5CLLA 5E3HA 4AKHA 2YINC 1OFIA 4HZUB 4HAXA 4JL5A 1G1MA 1II8B 4RFSA 5G3YA 3U7EB 1DEKA 3SE0A 1KZGB 4R71A 1YZQA 5C46F 2JLYA 2C2HA 3J81k 4DDTA 1ZM7A 2Z6VA 3QPVA 2O8CB 1OT3A 4A6PA 5IK2D 2O0HA 2K5UA 2ZRMA 2WWXA 4LI0A 1G3UA 1U98A 3O47A 4A0RA 2AK2A 5SZIA 1XEFA 1I4TD 2BMFA 3CBQA 4TLCA 3IQXA 1JAIA 3OFNA 5FBWB 2O8BB 1PV4A 3MSXA 3W8NA 2R2AA 3K70B 2G1KA 4QJ4A 1QHIA 3SOPA 1EXMA 1R6BX 1L4YA 3DEFA 3AVUA 5FUWA 5BWMA 2WAXA 1N6RA 4DLZA 4GFDA 2BMJA 4G5QA 3MWJA 5EXSA 5GVRA 2DYKA 4F91B 5HKKA 2VL7A 5FOXA 1XZQA 2P0EA 1VCOA 2XX3A 2IHBA 3GEHA 3K0AB 3KKQA 3ZIAD 2F1RA 4DVGA 1Z6GA 4Q48A 4BLTA 1UBCA 4LJ4A 4NYIR 1GM5A 3ZZ0A 4D2IA 2Q3FA 1JR3A 3IILA 1ZD8A 3PFIA 4Q1CA 4M8NE 5DISB 1TEXA 5JECA 3FKQA 3VAAA 2J1LA 2A5DA 4Y0VA 2ERYA 2YOHA 2RGCA 1SVMA 1M6NA 1MR3F 1T0HB 1OH7A 2AWNA 2G77B 3IUYA 3EZFA 1E2NA 4XWAA 3W5JA 5J40A 2NO9A 3MCAA 3DOEA 2QENA 1IQPA 2EFGA 3NC0C 4KODA 5JJLA 1XCMA 1F2TA 3NH9A 5DYIA 4TMKA 2GJ8A 4ZCIA 3M4YA 5DH9A 4US2R 4POAA 1T5IA 2P6UA 1W5SA 2VP2A 3P32A 4JT2A 4DT1A 4EPTA 5J4KA 4LRWA 1JECA 2Q9CA 3OHMA 1YR7A 3WNCA 1L8QA 2I1VB 1UDWA 3CWQA 1XXHB 2QRZA 3HU1A 2ZI5A 5J47A 4O0MA 2AK3A 1NRJB 3TGPA 1SHZA 4G01B 2QU8A 4Q1AA 2IYUA 2ZRPA 4QJ3A 1RYFA 1JR3E 5EJEA 2RGNA 2QL6A 4DWJA 1JI0A 1DE0A 2JAQA 3RS2A 4DLUA 4Q7KA 4PXAA 3L0OA 4FXPA 4MYCA 1UM8A 1RRFA 2CK3A 1Z6TA 4MA4A 3THWB 221PA 3MMPA 3RYTC 3CX7A 3NDPA 5JBQA 1DOAA 2ZI7A 1W7AA 4CF7A 1DAFA 2Q9AA 3RS0A 1SVSA 1R4AA 2VP5A 5FH9A 4AY2A 4DLSA 3GMTA 2IYWA 3K9LA 1CRPA 3VR5A 3D7MA 1RJ9A 2HYDA 2R9VA 1RRCA 5JWHA 5CIQA 2WZQA 2BBTA 3K0CC 4X8HA 2ZJOA 3GJXC 2RHDA 4IRUB 2N46A 1SKYB 2BOVA 5FUVA 2IYZA 3ZH9B 1SVWA 4TYYA 4ZDJA 2ZXUA 2IW3A 2IYYA 3FHOA 1BMFA 2GCOB 1XTIA 4OHYA 3CRVA 2GXQA 3KB2A 1Z6XA 1XCGB 2FE4A 2W6JD 3BERA 1P2UA 4DLXA 5DI9A 2CBZA 2F1JA 3K09C 2BMDA 5GADl 1Z0JA 1E94E 3DVLA 2FSFA 4P0TA 4YMUA 4JYBA 4OL0A 4LOAA 2RB4A 4NCJA 2JDID 4QNMA 4G0NA 4TSFA 2GILA 3A1VA 3NTUA 1VIAA 3I61A 421PA 4MDFA 5J4LA 4FN5A 1IJEA 2EVWX 4IOLA 4HZUA 4DBLC 1II8A 3AVTA 3C5HA 3N5CA 4PPNA 4WIAA 4D4MA 1DAEA 1ZINA 2PZEA 2PEYA 1A2KC 4BLOA 1GDDA 2O8CA 2CNWD 3TQFA 1Q22A 4YMWA 5TXGA 4FMDB 3FMPB 4NKRA 5KDDA 2JIZD 5TARA 4M2LA 5F9FA 4O25A 2D2EA 2GA8A 4MH0R 1KO4A 5FPKA 2O8BA 5HE9A 2DFKB 3GJ5A 4Z1MA 3LLMA 1CR2A 4AURA 2NPIA 3KXLA 4TN1A 1G7CA 1E2MA 2C95A 2PH1A 3MWLA 1YVDA 4S2EA 2GXAA 2GZAA 2ASEA 5AJVB 5JCPA 4DEXA 3LBHA 2FSIA 3QY0A 4URYR 1RRPA 1AS2A 1UBGA 2AKAB 1J8YF 3ONWA 2QP3A 1EWQA 4IOMA 3I73A 3K0AA 2FEOA 2KI5A 1ZRHA 2LWIA 2ZU6A 5CDFA 2IS6A 1OH5A 2ZRGA 1IY1A 1CXZA 3OIVA 3AP2A 3CH4B 2V8OA 4LHWA 2GCPA 3U5ZB 3ETLA 4MGKR 4WXRA 4RD6A 2P3SA 1BYUA 2E87A 3KXKA 2Y8EA 3A4LA 1ZC4A 4KU4A 1DAKA 1KDRA 1NG1A 1WE2A 2WJIA 3OE7A 2ZRAA 1E2HA 4DSUA 4TZ0A 4PQYA 4MKFA 3X1WA 1W0KD 1UBFA 2CCJA 2VP4A 4ON9A 1Q1BA 2V55B 2ZAOA 5BYJA 2DFNA 1TQ2A 3L8YA 1YJ5A 1SULA 1W5TA 2IYVA 2YJTD 1QVRA 4AYXA 1UKVY 4F4CA 1CF4A 2FDCA 3FFAA 4D0NA 3LQQA 2ZJYA 1AZSC 4JBWA 1JEDA 1NN1A 4KJZA 5CLQA 3RRMA 1FFHA 3ZLJA 4WZ6A 2KJQA 2VPPA 3GLGB 2IS2A 5TY0A 3VR6A 3FKSA 4ASUA 2PLRA 1RW4A 2H17A 2J41A 1FZQA 1TEVA 5JS7A 3DMNA 4Q4JB 3TIFA 3GFPA 4H1UA 2WAYA 3CRMA 2P5SA 4QBHA 3SDZA 2OEPA 4IOKA 2G3YA 2OLKA 3EZ2A 5C4GB 5FI1B 2W6IA 1E9BA 3THWA 1WF3A 2ZRIA 4F4IA 1XU4A 3QIAA 2JLVA 4LK2A 4QXAA 2CL0X 1XMVA 4LJ5A 2J7PA 4URZR 2CXXA 3IO5A 3MWYW 3K9NA 4UXJA 5CB6A 3ZS8A 3EC1A 4KV9A 5EUQB 2OXCA 4KBFA 5HZHA 1IOZA 4YMSA 4LGMA 2GK7A 3ZQ6A 3D6TB 4NBSA 4ABYA 4NYIQ 1NKTA 2HCBA 5AUPB 2BEKA 2HLDA 2JLQA 1ZU5A 3VTKA 1FTNA 3AV0B 2QAJA 2ZVPX 4EPYA 1H65A 1XXHE 1ZBDA 4D81A 4DSNA 3FTQA 4G5SA 1WMSA 2ZU0C 2Q3HA 4TL7A 5IK2A 4BLQA 2GCOA 1AQYA 4NYMR 5B58C 3GCGA 2BHRA 4PC3A 1OFUX 4CZ2A 2L0XA 1Q3TA 3W8RA 4OK5A 4TL6A 4EUNA 3FPAA 2EFEB 4JBYA 1IN8A 4XOIA 3IEUA 4DZZA 5K8TA 3Q5DA 3B2EA 2QTFA 4HDOB 1GRNA 1Z22A 1FUUA 1KSFX 1X86B 4LYJA 1Q21A 1KHTA 2HV8A 2PMKA 5L3VA 4TTRA 3DKPA 3DHWC 4BZXA 3VR2A 3M1IA 1HUQA 4HLUA 2XITA 2GXSA 3THOA 1P9NA 3IBYA 1OXTA 4LJ9A 1N6LA 1Q20A 4LBZA 5CK4A 3ZIAA 4P4TA 1S4QA 1HE1C 4EDHA 5FPYA 4RZ3A 4DCUA 5AJYA 3NHAA 4TLDA 1ANKA 5EP2A 1G8GA 4DXAA 1OIXA 2VP9A 2OE2A 1IN7A 1COWD 1OIVA 1Z83A 1HT2E 4NDZA 3K9GA 4A0GA 1YQTA 1SKYE 2D4HA 5A0FA 3MG9A 3SEAA 1Z2CA 4CIDA 5FPSA 1Z2AA 1QHYA 4A8JC 5DN6D 4QFMA 1PLLA 2RHMA 3I8XA 1VYUA 1R8QA 1JQJC 3SQWA 4LWZA 2FWRA 4FD2A 3R20A 3PENA 2IF0A 4PHHA 4B3DA 4B76A 2YOGA 4A9AA 1KI8A 1ZUIA 1EFRD 5JEDA 1OF1A 2ZR7A 3AQ4A 1JR3D 4RZ2A 2PX0A 3PG5A 3AKDA 2G1JA 1AKEA 3KQNA 1P2VA 4DLYA 3WHKA 2EYQA 5FBQB 5HCNA 4C0KA 4XVRA 1XCPA 1E6CA 4A0FA 1G3IA 3T1TA 1VYVA 2YWEA 2NTYC 1FNMA 1NLZA 4BFUA 1HQCA 3EPJA 2WWWA 1D8TA 3O8BA 4RKEA 3CF0A 4P4SB 4Q1EA 2XAUA 1R0ZA 3KUCA 2NO1A 3GLIB 1KI3A 2MSCB 1OE0A 5L3SB 2WHXA 1N6HA 3GJ8A 1KKLA 1CIPA 4KCGA 2KBFA 3N70A 4MUAA 4Q9HA 3BWDD 1GOTA 3UMRA 1M8PA 3VNUA 4HLCA 4LJ6A 2REOA 3S1AB 2CMKA 1OB2A 2FX3A 3GFTA 3U7FB 5FFMA 1MT0A 2ODEA 1CJUC 3HU2A 5SZKB 1G7SA 2GEDA 2WKPA 4EAQA 3GLGA 2IC5A 4LBYA 1U8AA 3BH0A 3I1FA 5BXQC 2X2FA 4L15A 5AJWA 5FL3A 3R8FA 2HUPA 2WSSD 1T3SA 2EFCB 1UF9A 2XTNA 3QBTA 5EP4A 2NPFA 1KJZA 4Q4JA 3CF2A 3PEWA 2X8AA 3AF4A 1N6PA 3ZVRA 2QMOA 1AIPA 3AGPA 1UKYA 5D3MB 2WICA 1ONBA 4US0R 2BBWA 2V7QD 2WJGA 3MD0A 4WBSA 3ASZA 2IYRA 1GITA 3KKMA 4IVRA 3TMKA 1XTKA 1VG0B 2W6JA 4RVCA 1EWRA 1ZAKA 4B6FA 5KSOA 2DB3A 2VP6A 1XF9A 3MAAC 3O8CA 3PITA 4RD1A 521PA 1CRQA 1V5WA 2JDIA 3CR8A 2HT6A 4B44A 1N0UA 2F43B 2GEUA 2D7CA 2NOAA 4LHVA 4P3YA 2OBMA 4OQNA 2R6GA 1E98A 3BAFA 5ELXA 1Z0AA 5B30A 2ZJBA 4Q9LA 3K8YA 1GRQA 4NZYA 2F7SA 5AR1A 4TZ6A 1E4YA 3KL4A 1A2BA 4LHYA 3GLGE 2XJ4A 2CNWA 2BM1A 3NBFA 3QEOA 1TMKA 4URUR 2XSZD 4JLOA 2GETA 2OUKA 4LHXA 4D0LB 2JIZA 3KQKA 1AS3A 4TYQA 2QT1A 3PVSA 4R98A 1JXOA 1A7JA 3LH5A 1N6KA 1CU1A 1GTVA 3NVAA 2QMEA 1FP7A 2X2EA 2ZI6A 3KKPA 3QPUA 4PAMA 4Z8YA 1D9XA 1GKUB 1T0JB 4Q5IA 4HSEA 5C4MA 2QN6A 2WWIA 1GNPA 4DEYA 3PIRA 4BGDA 1U0LA 3LBIA 2HYIC 1QHSA 3MRSA 1G8PA 1RYHA 5EXPA 3QXHA 1KI9A 1C4OA 2ZREA 4GOXA 1XEWX 1JPNA 1ZNZA 2F9LA 3AUXA 2ECKA 4Q01A 2VIIA 5FPTA 4GZMA 5HCIA 1DBSA 1GFIA 4V0OA 4XH9B 3UXMA 3AKYA 4KHZA 2PT7A 4M1SA 3QXJA 3IO3A 4XVQA 3WY9A 5LD2B 1IXSB 1NBMD 3PUXA 4XWKA 1X8KA 2ZROA 4HUQB 5AK0A 2UZ3A 3WBKA 4TTQA 2ANCA 4TYPA 4JKIA 2AWOA 1PLJA 4C2UA 4TT3D 2A7QA 2OBNA 4PSAA 2J9RA 5G40A 3U2QA 5FBVB 4JBXA 2ZUBA 3BH6A 1W0KA 4ZI3A 2BV3A 4DLRA 4YMVA 1GKYA 1ZU4A 4C7OA 2ZI3A 4R7ZA 3WRXC 3CZPA 4CRWB 1YRBA 1XFAA 3QXXA 3LX5A 3O8RA 1XTSA 2OFOA 1Q3HA 4XSHA 4LHZA 4MQBA 4IDQA 3B85A 4TYNA 1YZLA 1IY0A 4JL6A 4DCNA 4QGFA 4C0QC 1RKBA 2GHIA 3OE7D 4XTCS 5C1BA 4I99A 1Z47A 4F38A 3ZVLA 4KXFB 2GJAA 2HJVA 3LLUA 3NEYA 4NYMQ 1MRNA 1LF5A 3THXB 1KTVA 4XIGS 2ZRHA 4IHQA 2R6FA 3L43A 5BW8A 1UJ2A 4P4SA 2OV2A 1KO7A 1KDPA 5L3QB 1S96A 2OZEA 2ZYVX 3ND9A 3GLIA 2FV8A 3QF4B 5L3SA 4GRAA 4C9BA 2B92A 1LS1A 4V0ME 3FGNA 1XEWY 4WZBE 4D4JA 3S1AA 1VYTA 3KXIA 1YU9A 3QF7A 1NJGA 1UDXA 5AUQA 4B3CA 1MV5A 1BS1A 4ASUD 4BQSA 4PQFA 3I8SA 2J0QA 2O5VA 3IIJA 4V03A 3RWMB 1RZ3A 3IIKA 3VR4A 1UPTA 4RZXA 2J45A 1E1QD 2C99A 4QGGA 1AJEA 4M1TA 3C41J 1MABA 4M9XA 4QKQA 1Z63A 2RGEA 4JLPA 1NNEA 1I2DA 1X8JA 4NE2A 4OK6A 4LPSA 2PMDA 1G64A 4OHVA 3DM5A 3LXXA 5BQ5A 3EZ9A 3DPUA 5D3MA 4B48A 4I4LA 2XXAB 1K5DA 3T61A 1IY2A 4JMPA 1M7BA 2Q0HA 2QM8A 3VR3A 1F3OA 3VHLB 1N6OA 3GLIE 4DB2A 1DAGA 1W1WA 3F8TA 4UNQA 2C04A 1WB9A 2OHFA 4AIIA 3DL0A 3ZVNA 2IEZA 4DCVA 3WRYC 3BD9A 3BRWD 3KQHA 1E2KA 2F43A 2WMNB 3EA0A 2XZOA 2XGJA 4D0GA 2DCUA 4UXIA 2EYUA 1RRGA 1E2DA 2IUUA 3B1VA 4BASA 1LNZA 4L9SA 2NQ2C 1GVNB 3TK1A 5IHPA 4A0HA 1YZGA 3BB1A 3CPJB 4AYTA 2GWHA 1CTQA 1P62B 4W7SA 3C5CA 4RJLA 1RVDA 1G17A 2FNAA 2OBLA 5KNBA 4Q7JB 1KDTA 4PANA 3OAAD 1COWA 2YZ2A 1XD9A 1N5JA 2VHCA 2EFDB 4V02A 2WJHA 3BFKA 5LB2A 2X77A 1ZW6A 4QHTA 1XD2A 2G0TA 2ONKA 3U4QB 5DN6A 4NU0A 5FOVA 1E2LA 1I2MA 4LSGA 3VKGA 4MRSA 1ZCBA 2A30A 2WV9A 2BJVA 3L0IB 2KSQA 3LDAA 3ZD7A 1EFRA 5CM8B 3RC8A 4B3FX 2F1IA 3AKCA 4TTPA 1P7CA 4K8OA 1UKEA 4KITB 5TMPA 1YKSA 3SS8A 2NG1A 3THYB 2RGNC 1XBTA 4OI2A 2QRNA 4IDHA 2W83A 1VKJA 1FOEB 3SJZA 4HUQA 1NLFA 1JPJA 1II9A 4WA7A 3TVDA 2PJZA 1G9XA 2ZSFA 4LYFA 3WYFA 4XD7D 1D6JA 3GLFB 2ZE7A 3W6NA 1DPFA 2YYZA 1BYIA 3T15A 4QG7A 2VO1A 2H16A 1T3HA 1VG8A 2CJWB 2LKCA 2PEZA 4D26A 1MO3A 2FFBA 2IYTA 3A1UA 4FMBB 4EPXA 3C15C 3I92A 2AXNA 5D3QA 2ZJ5A 4ERNA 4LJ8A 1S3GA 4Q9IA 4W5HA 2AXPA 4A92A 4TL8A 2ZI4A 3CM0A 4ZO4A 3RC3A 1VG9B 3IHLA 4OQMA 2VSFA 3OF5A 4DDWA 3U6KA 4V0LA 4I1UA 2ZS7A 5CB8A 2D06A 3KJHA 3TRFA 4B2PA 1G21E 4OYHA 4R2HA 2VHQA 4QOSA 5DGXA 3E1SA 1FTSA 2ZJ8A 1N2CE 4CEHB 4QHSA 3THXA 3FVQA 4A2QA 5EZ6B 1EX6A 2WSSA 5FTMA 1E9SA 1XWIA 4Q00A 5L3QA 3GJ3A 1ZC3A 4FW9A 4GZLA 2NZ8A 3B1ZA 3QF4A 4ZPXA 2YOFA 4WW0A 1NN0A 1T3LA 1R0XA 2OCAA 4JIMA 1B0UA 1DAIA 2VTKA 2BVNA 3SJCA 2JJ2D 3PCRB 4C0HA 2BWJA 2NZJA 2V7QA 4KFSA 3U3KA 2CE7A 2RGBA 2QUZA 1AGPA 1XD8A 3K0FA 3RRNA 2JLSA 1NVVR 1G3RA 4Q1FA 3IPXA 1AK2A 3AP3A 2QAGC 5JI2E 4CDGA 2P6RA 1NSFA 4G5RA 1DAMA 3Q8XB 4GI7A 3C7KA 5EQTA 3UK6A 3ZZUA 4BRUA 4M9SA 2AL7A 3BH7A 3NHBA 5J4YA 1XMJA 1IM2A 3K70C 5FL7D 1TX4B 4KFRA 1JAHA 1J8MF 1WRBA 3G82C 5KTYA 2F3RA 3FMOB 4TMTA 5IDVA 4PHFA 4ZIRB 2CVHA 3DKVA 2YWHA 2V9PA 3TNFA 5KOYA 1W36C 2XSZA 1Z06A 5KO2A 2XXAA 3A36A 4H1VA 2VF8A 3ZVMA 4MRNA 4B33A 1IAQA 3LAWA 2FFHA 3DO6A 3UPUA 4DLWA 3P26A 4EPRA 5KU1A 1C1YA 3LW8A 4DLVA 4EPWA 1WP9A 1TL7C 3LRPA 1T6NA 3RS5A 1L7VC 3EPHA 2WIBA 3CPEA 3A6PC 3DZDA 5IT5A 1LFDB 1Z07A 4NH0A 2QSYA 3KKOA 1CLUA 1TF7A 4M9QA 5FBRB 3EA5A 1CP2A 1P5ZB 5LB4A 4BEJA 5F98A 3NC1C 1S9DA 1Z0FA 1M2OB 1GNRA 1T9HA 4P32A 5AJXA 2FFAA 4HZIA 4MRPA 2YC2C 3GLHE 1Q57A 1IN6A 5M04A 2ZI9A 4E03A 1K8RA 2FJUA 1NBMA 3L0PA 1S1CA 4HDQB 2JLRA 3PV0A 3RRYA 3RSLA 1SVIA 1CR4A 2GJKA 2RKOA 1DS6A 4M1WA 1XNJA 1W0JD 2WIAA 4TT3A 1KI2A 4DCSA 3U4QA 3B60A 1DG1G 1Q1ZA 2W2TA 4PHGA 4EPVA 1IXZA 3KJEA 1J90A 2PCLA 4M0LA 1I4LD 3AVWA 5SZHB 3IKJA 2QROA 5DLQC 4DIDA 3T12A 4ACAA 3HYTA 1Y63A 3OESA 5KHOC 4GDFA 2NMVA 4FIDA 3UMSA 1CULC 3LV8A 2C03A 1XP8A 4GP6A 1T8UA 1KI6B 4HB4A 5FOUA 5HPYB 2J59A 3IPYA 1N5LA 2E1RA 1O87A 2B8WA 2RGDA 3MWKA 4LC0A 3K09A 2G9NA 3THYA 3ICEA 4MRRA 3L8ZA 2IL1A 2W58A 4B2LA 3ZZTA 4BUJA 3TQCA 4JLBA 1JJ7A 1OPXA 5TDHA 3AVXA 3Q7PA 3GP8A 1ZJ6A 1VIYA 1CJVC 1ZP6A 1OHHD 4HAUA 3GLFA 4PPGA 4OJKA 1XTRA 4LV8B 1AZTA 2CJWA 1TNDA 3U3MA 1NBME 3UWOA 4Z8XA 1CEEA 1U9IA 5ANRB 4BFYA 2GJ9A 1DVRA 4M22A 3KJGA 3QKSB 1Q44A 3TR5A 1QHGA 4GNKA 3AH8A 3P4XA 2I1QA 4OHZA 2WSMA 2WWGA 1XXHA 2OM2A 4QM7A 2QM7A 2ZRBA 3B1YA 2CVFA 2QE7D 3TSWA 1EESA 1VG1A 3E2IA 4KFUA 1N0WA 1WQ1R 2QI9C 3SNHA 2QSZA 4PHTA 3SYNA 3A1SA 3U3RA 4PSVA 4CEHA 3LO5A 2WTUA 1E1QA 4CT5A 2O0JA 1FX0B 1A5TA 4OKSA 2H5EA 3BC1A 5J4VA 1KK2A 1KJYA 4HAVA 2GBLA 3TKLA 1RE0A 2IXGA 4I1VA 4IFBA 1F48A 1HEIA 4NHOA 4D6PA 3SU8A 4JVMA 1KI7A 2N42A 3ASYA 3LFUA 4Q21A 3GLFE 4JZKA 1R0WA 1ODFA 4DSOA 1CS4C 3QEJA 4KLZA 4C0JA 2ZIAA 3U3OA 1S2MA 4O3MA 1ELOA 1E2PA 1PUJA 3EAQA 4FCVA 2OO7A 4YLGA 5KPJA 2BBOA 3GPLA 4EJSB 2ODBA 3F3YA 5A5GA 4TMXA 2GKSA 2GZHA 1A82A 1G3MA 1EFUA 3WNBA 2QP9X 2KB0A 4D80A 4Q1BA 4JKYA 2C9YA 4RSGA 4JL8A 4Q4AB 2W0SA 1P61B 1TF2A 4QGAA 1ZM9A 2IS1A 1KNQA 1E32A 4ZIRA 4L16A 4ZDIA 4ITRC 1WDTA 2O52A 4JLAA 3DMDA 3UG6A 2QORA 1KK3A 2CL7X 1W47A 2ORVA 2R6DA 3LA6A 2ORIA 3LX8A 4AKGA 4KVGA 3U44B 4UNNA 3KDSE 3OAAA 1BH2A 4OQFA 4PSKA 3AUYA 4M9ZA 2P6NA 3ZQJA 2CDNA 5G41A 2WOJA 4DIEA 1R2QA 3OIUA 2JASA 5JI3E 1TU3A 3WMFA 5C18A 2EW1A 4Q1DA 4KI0A 1JNYA 2PX3A 1W4AA 2RGAA 4PR0A 2OAP1 2FEMA 2VHTA 1GSIA 1XB2A 5FTJA 2B7BA 2OFWA 3RS7A 2OFXA 3SI7A 3L0SA 4A82A 3U60B 2OSBA 3Q72A 3ADDA 4OK3A 2V1XA 2QPOA 3B5JA 3KKNA 1M7GA 1UEIA 4ZCLA 4B43A 1XTQA 3HDTA 2HXYA 2ZSDA 3QJYA 1H8HA 4NCHA 2LCFA 2CHQA 1EFTA 4OI0A 2XJ9A 3H84A 1G41A 4IJMA 4YONB 4OBEA 3BS4A 4V0KA 1P3JA 5JRJA 4AKEA 1T91A 4XD7A 3I3SR 4BRWA 4EIWA 2JLZA 4QNRA 4HI0E 3I5YA 4HB2A 1NVVQ 3OEHD 1QVAA 1Z3IX 2DWPA 2HEIA 3A4MA 1UBEA 4IDPA 3REGA 3REFA 3FDIA 1QG4A 5JZVA 4Q4LA 1KZ7B 1XX6A 5IF9A 3PJRA 3ND8A 4RY2A 3TW4A 4QGHA 4LY6A 4DDUA 2UKDA 4FI3C 1KI6A 1W4BA 2PT5A 4LJAA 1P6XA 1NIPA 2JLUA 4W5JA 4JLDA 2IF2A 3D31A 1KMQA 3Q7QA 3D8BA 1E2GA 2G88A 1JBKA 3LVQE 1U8YA 1Z6YA 3QE0A 4IEIA 3JVVA 4H9GA 3RANA 1XMIA 5K8LA 5CJ2A 3SBEA 1W4CA 3GJ7A 4KYUA 1CJMA 4Y0AA 2OG2A 1HE8B 2Z5FA 1E1RD 5EE3A 4TMVA 3QVVA 3CRW1 3A1TA 4MYUA 5F9HA 5UKDA 3ICQB 2BDTA 3ZGXA 4KLNA 4A2PA 3EIEA 4N0EA 3KB1A 1OV4A 2YC4C 3QKSA 2QQEA 3B9PA 5FR2A 1E69A 2R62A 3VU9B 4MDEA 4CYMA 2JJ2A 5DIFA 3VX3A 3U6BA 1TTTA 1T8TA 4TMZA 3R9IA 2YWGA 1SXJC 4Q66C 3LVRE 3HP1A 3HPQA 4XWOA 1MO4A 1XJCA 2FZ4A 4LZZA 5KYKA 4FWIB 1CKEA 1KI1A 1E4VA 1G5RA 4KYIB 4E07A 2B7CA 4NCNA 3BBPA 5G3ZA 1FX0A 1II0A 2D74A 3KZ1E 3MLEA 2KE5A 2OLJA 2ZE8A 2ZRJA 2ZR0A 1IJFA 5FL7A 1YR9A 3AVOA 4PTLA 4JLMA 3MUFA 1GAJA 4S35A 5L3RA 2QGNA 1ZYUA 5HR5A 3IQWA 4YXWD 5E7MA 5F3WB 2CLCX 3RAPR 3SFZA 1Z8FA 1AM4D 2YHSA 2J0UB 2QGZA 1E2EA 2C9CA 2CHVA 3TAHA 4DHEA 1KI4A 4UJ5A 1LVGA 8OHMA 2H8KA 2QTVB 1MOZA 3IHWA 2HF8A 3BE4A 3A8TA 2EQBA 3FYHA 1N5KA 4GOKA 3TR0A 3GJ4A 4OQLA 4EJSA 4PAOA 2EWVA 4PC6A 2IUTA 4UNRA 2AFIE 3W3ZB 2IT1A 1ZIOA 4WAUA 5JS8A 3HWSA 1TUEA 1WA5A 2G6BA 4Q4AA 5EZ5A 1SVKA 4MGIR 2WWYA 3EIQA 4NMMA 1T4GA 3RDPA 2DPXA 5DNYB 2TMKA 4RFSB 1ZVQA 4A36A 1E2JA 1NG9A 1X3SA 2AX4A 2CCGA 2J0VA 2WKQA 4KSCA 4GL2A 4B74A 3CUEF 2CE2X 2V1UA 2ZETA 3F5FA 2ZVQX 4QJ5A 2WWFA 2IHYA 3NKVA 4UXHA 3T1QA 5EE1A 4XTRA 3W9YA 3QSYA 1YR6A 4BFVA 1W0JA 2DBYA 1E96A 1HQYE 2MSEB 2RMKA 1W44A 1VCMA 1PUIA 3EX7C 2ZRNA 3EW9A 3CNNA 1ZNYA 1E0AA 1F60A 3ZD6A 1NP6A 3K0SA 1EK0A 2ZRCA 5H8WA 1M34E 2BEJA 2FG5A 1OSNA 1A4RA 1NL3A 2A5JA 2ORWA 3R7WB 1KO5A 1TUIA 3ZJYA 3B78A 4F4JA 2OAQ1 2YVUA 1OH8A 2RH5A 3NWJA 4M53A 4BLRA 3BXZA 4K81B 1G8FA 4JLNA 3DDCA 4V0MA 5JWRA 3W6PA 4LC1A 3EPKA 1KO8A 1G19A 4U7DA 3P1JA 3AF1A 1CBUA 2HDNB 4GOJA 1G3QA 1OHHA 4UJ3A 2ZITA 1TQ6A
chains in the Genus database with same CATH superfamily
4NONA 5H3LA 3CCCA 4OJTA 5E1BA 5KOJA 1A71A 3MJVA 1LB1B 4ND7A 1M54A 4ARUA 1R18A 1T6BY 1I7SB 1R5BA 1OXMA 3NIDB 4AY4A 3VDXA 4ZKEA 4QTYA 5IVPA 2I3GA 4TS9A 4DANA 2C2BA 1GRVA 5HXAA 1EHIA 5T8KA 1JALA 2I3BA 5AI5A 1PYOA 3H8WA 5A9SB 2W2OA 1FDOA 3GJ0A 2HM7A 4JYZA 1PX2A 1HDYA 2FVYA 2AN3A 2PRIA 3H0KA 4HB3A 1L7PA 2R6CA 3EWSA 1J9GA 1GLGA 5T41A 3RRZA 4I55A 4M86A 2YXNA 4K6FA 3NH6A 4O4IF 1C9KA 4AZWA 2A33A 1UMCA 4U5XA 5AK5A 5JBIA 1TQDA 4ANFA 3OZXA 1EU1A 1ADGA 3DD5A 3M0EA 4KREA 2J3EA 3AG5A 3GPIA 4NZPA 3VMFA 3INRA 2C2XA 4O4JA 5I9SA 1HNZB 3VR1A 4HVLA 1M72A 2H57A 3PSAA 3VHXA 2IHZA 3QMWA 5A4KA 1RFGE 2W0MA 4LRXA 2NPOA 4MLDA 1X39A 2GZ2A 2QX4A 3MFYA 3R3XA 4HLDA 2CD7A 4NR0A 3U9SA 4YMTA 1O5TA 3KEQA 3JWEA 1NW4A 3LPLA 1NXTA 5GPBA 3VTZA 2JFNA 1SHUX 4EQ6B 1GPWB 3BB3A 2XCRB 2LDXA 1MH9A 3OHPA 1YSCA 2AN9A 2FZGA 3GUUA 4FFSA 2BONA 2F67A 4A8PA 2AFHB 2Z0MA 3CCFA 3D0QA 1G55A 1U2QA 1ZCJA 2J07A 3FUWA 3K9HA 3LQKA 3QLJA 4HK4A 4M8KA 3FOZA 4ESVA 2PUTA 2D2FA 2WJ6A 3ISTA 3V2IA 3VKVA 3I04M 1XGKA 2ECOA 1FSFA 4UHJA 4NCKA 2D59A 1YVUA 1EWYA 5ADUS 4TV9F 1T9GS 1A1VA 2NLOA 4HWOA 1UH5A 1KQPA 5KZMB 3CKLA 1M66A 1OZHA 1IPHA 1G6HA 1L4GA 1YIAA 2CDCA 1JHMA 2FUNB 1Q0SA 2I22A 4FYMA 3VOBA 4URXR 1KQGA 1UANA 4LRQA 3NVMB 3WLOA 2CLSA 4B4WA 3L1IA 1GL7A 1N8TA 4XYMA 4XX0A 4KQCA 2YQZA 2DGDA 3DV0A 3JWJA 1D07A 5B3LA 4L3WA 3EFOB 3DZBA 1G8YA 3T5MA 4LCBA 5GVSA 3ELUA 1BE6A 4B34A 2AUMA 4BMNA 2Q4RA 3K5PA 5G4LA 2QVCA 2WHPA 5FUYA 3MA0A 3L79A 1N3IA 4L8FA 1H05A 3T3HA 4D9IA 2G9RA 5HX7A 4CVNA 4B09A 3KQOA 2VAXA 4G23A 5FWDA 2HB6A 3KAPA 3TSAA 3BEOA 2IKQA 4BUZA 2JFYA 3DVAB 3ROGA 2C2YA 3LY5A 1PN3A 3V4SA 4RIIA 3WHIA 5HFJA 4ER3A 1KYIA 1XLWA 3HWWA 2OVFA 2F62A 3EB9A 1I7NA 1NBAA 4G2NA 2WA2A 1NFFA 1WPXA 2AMFA 2GLTA 3OPXA 4FW8A 4J1QA 1ISSA 4P4LA 4PIVA 4ZO7A 1Q5PA 4PINA 3H4MA 3U39A 4B8ZA 2VTBA 4HCJA 3KKKA 4TZKA 2X0DA 3EGVA 1Z5WA 3A6KA 4YJDA 4TXMA 3B36A 4K9QA 2FF7A 2ZIFA 4PQRA 1Z82A 4EB6A 4PCAA 4IRMA 5KPDA 5FHRA 2V7TA 4CIAA 2BR4A 1R37A 4JUAA 3B7GA 3K1YA 2ONZA 4TLEA 2DLDA 4LYHA 1L4NA 5FIUA 1Y0BA 5FFNA 5HW0A 2PGIA 3WHLA 4D8TA 5LZ2A 2YXEA 3HKCB 1HYQA 1WXXA 4EELA 1Q83A 3Q3JB 3AWIA 1I1QB 3F7TA 1XVUA 2G25A 1G21A 5D00A 4ZZ2A 2GJSA 3GELA 1FQJA 1KQOA 1X7HA 3PEFA 5JC8A 2BLNA 4CV2A 1M0WA 2V54A 3QENA 1JPUA 3ZDDA 1PCXA 4V39A 4MRAA 4XDZA 4D4KA 4RQBA 3WV4A 3A1FA 1TCVA 3AVQA 1V9CA 3L8GA 4K88A 3EWNA 4BLPA 1TCCA 4LYAA 1ZJ5A 3NBXX 3D02A 1D1PA 1GTRA 4QC2A 4CTJA 5KDLA 2VJOA 2R48A 3A4NA 4JR2A 3HR8A 1FSPA 3G2LA 3STVA 3NNDA 1PL6A 1WF6A 3TW0A 3VKWA 1I8TA 5LKAA 2XT9A 3HDYA 4WOKA 1BKSB 4C05A 1AKMA 3HA2A 1I36A 2P77A 1MX9A 2IOHA 3ZDQA 1T4DA 3BCHA 1HNWB 3CEHA 2P1ZA 2X86A 3BJMA 4U02A 3RBZA 3PBKA 3PIDA 4EVSA 2EKQA 2GSWA 4ZYWA 3OWHA 5E7IA 2C7RA 3HJNA 1W76A 1VGVA 2JEYA 1YL7A 4W8GA 4I5FA 4ZQGA 5HIMA 1WKVA 1RTKA 1UBRS 1UEJA 2BGRA 4WWHA 2C2KA 2HK8A 3U37A 5A9SA 1GWNA 1QQTA 2HRZA 1TM2A 1I32A 2WBLC 1ULZA 3CRRA 4FEGA 5CCXA 3BFXA 1TKBA 2XE7A 3DZIA 3QA9A 3ZHUA 1R5NA 4UBJA 3W5AA 1KIFA 3QUSA 4R3UC 1QZ3A 3OWOA 4LOLA 5TS3A 4CMJA 3BIXA 1VKNA 2ZYAA 2GVZC 1J0EA 2EFHB 1Y4ZA 2LIPA 4U00A 1G5PA 3JQ7B 4AC9A 1EVQA 5FF9A 5FBLB 1OYWA 4OREX 1RXIA 2O48X 5BY2A 1I7QB 5IN4A 1YQ9A 5JHGB 2PZFA 3GN1A 1KP9A 4NEHB 4A5OA 1BEZA 1KJ9A 4FYYA 2QU7A 4HLQB 3HB1A 2O2GA 4N9QA 3SHVA 1Q0LA 1M6HA 5A4JA 2WG1A 5JJKA 4EMTA 5HIJA 5KYVA 1NLUA 4PYIA 4FJ2A 5A03A 3PFNA 1OXVA 3O9MA 4LQCA 1ID1A 1TU4A 1NSTA 2X7HA 5HNKA 4BLWA 4EQ6A 2ZUSA 1SU8A 4JSYA 1L5HB 4LHSA 2PL5A 4JUDX 3DR3A 1MDBA 4UKDA 4YXWA 3ZBPA 4F45A 1R7RA 3CEAA 3T3OA 4UHCA 2AFHA 2QD2A 2Q6IA 3K9WA 5AXCA 4DA6A 5EIXA 1DLIA 2IYEA 1VKOA 4OHMA 3DXFA 2WFAA 4RGVA 2OCKA 2XDQA 4L73A 4UMFA 1SU4A 4O1MA 3U4IA 4AK9A 4UOEA 1FW6A 5E9AA 2RB5A 4NCIA 3NHWA 2UYYA 3OIWA 3T7CA 3NVKI 1MF7A 1O03A 2ZJ6A 3MN1A 3DUFB 5K8UA 3TZ6A 2QQ0A 3CLTC 3MRTA 3TQTA 3IQFA 1W5BA 5IW8A 1T5LA 2ORED 1I5EA 5CFNA 3TG8A 3OEWA 3DZ8A 4ND6A 3T5AA 1X1RA 1UJ4A 5JHHB 4N3NA 3ITDA 4EO4A 1JXAA 3F5SA 5DN9A 3YASA 3EFOA 4R84A 3D4OA 3KZNA 5E8JA 1JHUA 4B73A 1SIWA 4R6XA 4C30A 2FSSA 3CJRA 2FSUA 1CVRA 5HJ5A 2IHNA 3EY4A 3O26A 1UMKA 4HGNA 4W5WA 5LQCA 3M1YA 2Z43A 5EJ4A 1T15A 3BHNA 2XCLA 5FLKA 3RRBA 1C9MA 4BY9E 4CL3A 1X13A 5TR9A 3H11B 2AN1A 3RO7A 4MHSA 3DVAA 3DMGA 3KALA 2H1FA 4HNAB 3D0RA 3WSWA 2Z3VA 5CDTA 2IY7A 3MOGA 5EP1A 2BM0A 3KT0A 1TLFA 3FMFA 2AT1A 2QDXA 3FE2A 3VJLA 1PYGA 4IEEA 2BFPA 2YV5A 3MZ0A 4H7KA 1GGEA 4K46A 5DXFA 2PCJA 4TQUS 4PSUA 3IP5A 3Q10A 2VHJA 3AIOA 4RMHA 3BCUA 5KDOA 3UJ8A 2BUBA 1JFVA 4G1UC 3SG0A 1GZVA 3C6YA 1KNXA 5DBIA 3BEDA 3ZWWA 3A28A 4FD3A 4JB8A 4NMHA 5AOCA 1G7RA 3B6JA 1WU7A 3FJYA 4KXXA 5ILQA 1SXJD 4EKDA 5EXDA 3T9CA 2DFPA 1U9IC 1VJTA 1EGQA 3R0ZA 4M1YA 4NQZA 2XDYA 3AF2A 1AGRA 2B6HA 2F9FA 3D4LA 5ALUA 5EUMA 3BZBA 4JXKA 1ZG3A 1U2DA 4LFBB 3T3EA 3HKCA 3KFLA 4XRRA 3QLEA 2IUSA 2G83A 1U94A 2FPMA 2YWFA 2I66A 4NV1A 5EHGA 2MHCA 3AC0A 4D02A 1R6UA 1FUKA 3QX7A 1XLVA 2NO6A 4CTOA 1R3DA 5ED0A 5CK5A 3R76A 5IAOA 3O4FA 2JGEA 4TTIA 5F12A 3D81A 2RARA 1X7DA 1X7WA 3WIBA 2W11A 5IM5A 1XYGA 4HQOA 4UTPA 1O97C 4RFLA 4UDOA 1ZISA 3UQZA 3FHCB 3VOTA 2GBLC 4I36A 4PG6A 2HAEA 2JFWA 1WSAA 2L18A 2EGGA 1GQQA 2BKVA 3OPNA 4LWQA 3V1NA 3AVYA 1M9NA 3R5XA 3R4CA 1PWXA 1PW7A 2NIPA 3IERA 4WOPA 1KS2A 2XUJA 3PEVA 4IZOA 5DHAA 5LBIA 3UANA 3VZSA 2Y1EA 2YIJA 3EVAA 1IBCA 1BVRA 3RJ5A 1X7GA 3OQJA 2XV1A 1G8HA 2CHEA 1WEKA 1FVXA 2GZDA 2IYXA 3AL3A 3GY0A 2WSYB 4I6EA 2HR1A 2NN3C 4QU8A 3SJAA 3AUKA 5EQFA 3JQ9A 4G07A 2WPDA 4IVPA 1PGNA 2I2FA 2H00A 4FR5A 5DB4A 3GZJA 2ODWA 3LX6A 4POOA 4Z49A 1SBHA 3HU3A 3O84A 2Q4OA 4J16A 4MVJE 3U1BA 3E1KA 1YE8A 5AVZA 4TRJA 5DHPA 5EIAA 4QEZA 1KZHA 3HJRA 4X85A 1SKUA 3ENWA 3MS2A 2D1SA 4HATA 1FJHA 1B3BA 4XGIA 4A8JB 1DAHA 4N5LA 4ENTA 1ID8A 1IOVA 3PRYA 4DMRA 4NY1A 1I9GA 3SF0A 3JQ7A 4GEKA 3LC0A 3G5UA 4QATA 4WSOA 5TMBA 2IEYA 1BGWA 2QDKA 3FWZA 3NV9A 3RREA 2VQEB 5IJZA 1K0UA 1W9MA 1W2GA 4US1R 4CMGA 4PO1A 3IVRA 4DUGA 4P0QB 5ERYA 3ABOB 3BK1A 2Q0XA 2XQIA 4MV9A 2WVJA 1C9JA 3TFQA 2PIAA 4RADA 4XEUA 1NJ2A 2NXCA 1SZJG 1S5PA 3VVBA 1OFHA 5K51A 4C2TA 2I4IA 4JP8A 2WABA 3ROTA 2KBEA 1EQUA 1QWOA 3CIOA 4YWJA 1FMLA 5IUNC 1L5HA 4HLUC 1AN0A 4AX8A 3C6BA 3B2NA 4NLLA 1G20E 3C7CB 4JLSA 1NMZA 3LC2O 4IIHA 4P4UA 3UMYA 4A15A 3G13A 1QNFA 3E82A 1VE6A 1M2FA 2NZXA 1RJGA 2QXUA 2QWXA 2J3DA 5BNWA 3EVFA 3FB1A 3NB0A 2W2VA 5DTQA 2R5NA 3ZOZA 4MITA 1QH1B 4EKYA 3RI3A 5I7SA 3HVRA 4HX9A 2XT0A 2NWQA 4KPEC 1JIJA 1OGYA 2P9TA 1SC1A 2HCFA 1GL9B 3TUJC 1DX9A 1SC3A 2WWTA 3DDUA 4D8UA 2XRZA 2ZANA 3DUFA 4MRVA 1J5PA 5GOTA 1Z28A 2JJ1A 4PTYA 1OWNA 2COUA 1TDJA 3C8UA 3L0ZA 3DPSA 4UBNA 1XL1A 5AI9A 1VE7A 3V4RA 3AF3A 3COSA 1VDZA 5U4XA 1GPMA 1D4FA 3D3QA 1G98A 4E5UA 5C2JB 2YJ4A 2ZBUA 2PYDA 4OI4A 2W93A 3R09A 5LU8A 1QV6A 4MW1A 4BNXA 1YHNA 4XQ0A 3W9UA 1N0VC 1ZEMA 3IJ5A 1M73E 1RADA 1VCIA 4O4LF 2J0SA 2E3JA 2DY1A 4QDXA 1OWLA 2YV3A 3C85A 3PFFA 1HO3A 2W43A 1TEZA 3I9NA 2B98A 4MUKA 4GVPA 1SN7A 1U9JA 1L5MA 5K2MA 4EWLA 3EEFA 3H11A 4XB1A 4A03A 4HNAA 1N2HA 3FXAA 2X5OA 3HFJA 5E2IA 1Q1AA 2GAFA 5FAKA 2N1BA 5HF6A 2G9QA 3OVMA 3I83A 1UQUA 5TRTA 4OP1A 3AF6A 3CRQA 4PPFA 1G6OA 4M7PA 3DFMA 1IHUA 1H8EA 1OLOA 1DTSA 2FW6A 3ZGYA 1Z7BA 3JRNA 5G2OA 4PF1A 4FQ7A 1PF7E 2Y71A 4KAAA 3BBLA 3WYEA 1HG0A 1Z5ZA 2NGRA 4DC0A 2OHOA 4F6RA 3KVOA 3QPWA 3VPXA 2X19A 5FR1A 2CF6A 4IHAA 5K3BA 4U7JA 4R8VA 3FLEA 4CF4A 5JMTA 4Y2YA 4UU8A 1KSHA 3EFHA 3QHPA 4WZAE 1EBUA 3Q0IA 3U0VA 4G5YA 1YL6A 1CB7A 3JQDA 1OW3B 1DO0A 1SM4A 2AW5A 3MGBA 1NWHA 3TTWA 2FCRA 3V1TC 3OA0A 2RAPA 3S3TA 2PUAA 4L0CA 3MK31 2GAOA 4P5EA 3V55A 1K7EB 1NQUA 1GNQA 3RF7A 4H77A 3HFGA 3PHCA 2BKLA 3K8OE 1AUXA 4PIPA 4XJSA 2Q5FA 1BVUA 2G9ZA 5KNDA 1WB4A 2J3JA 1H4SA 1AXRA 2ODQA 2ZJ4A 1Y7TA 2WWHA 3NS7A 3L1VA 3LPCA 5COBA 2D54A 2FPLA 3TZCA 2CXTA 1JA9A 1AK9A 3WP0A 5JYEA 2CF5A 5DK4A 4Q7LA 1V5IA 3WDKA 3QZUA 1BX1A 1MFPA 4KSBA 1XZIA 4EHFA 2FLKA 2IQIA 2OO5C 3OEEA 4RDXA 3JD1A 3ZEIA 2FN4A 1SZDA 2E4YA 2GKOA 2C7BA 3B3JA 5BYKA 3GRUA 5DLDA 2V4UA 5CXXA 4UM5A 4KBGA 3R9XB 4K6KA 1PTKA 3V1LA 2ATXA 3T35A 2NO0A 1C80A 2GBFA 2ZSBA 1QONA 3H5IA 5H9VA 2I34A 5K45A 3QXCA 1AA9A 1F6BA 1YQQA 4Q9JA 1ZD9A 4EG6A 1CCWA 3PUKA 1UEXC 4EJSC 1N6IA 3CNHA 4M0CA 3W8FA 2IOFK 2V6BA 4KO8A 2Q1UA 1ESZA 5CNIA 4ZCSA 2XIQA 2Z8XA 3VSCA 3G5MA 4TXHA 1Q7CA 1AZLA 1P0PA 2REBA 1U81A 4LV6A 1DELA 5AH0A 4GE3A 3HZZA 2HWYA 1L5WA 3WJ7A 1N5DA 1LK7A 4A8JA 1VSUA 1TA4A 1O0CA 1T8RA 5HQ3B 3EH1A 1NKSA 3GYGA 3IDAA 1AU9A 4HPJB 1YBHA 3WLRA 1EDOA 4OHFA 1CUHA 4OGKA 5K8IA 3KLOA 1L8OA 3PWTA 3ETDA 2EW2A 1NRIA 2A78A 2QX6A 4HEJA 1I3LA 2IEBA 2FPGB 3MGCA 4MLPA 2GBCA 1IAVA 4B3XA 1JXMA 4BLSA 3E1GA 5M34A 1L4LA 3JYLA 2EC5A 4N9WA 2AOXA 2PBLA 1DJPA 1GUAA 1VMDA 2HTEA 1SBYA 4ZZ0A 2FEKA 4M1MA 2QF7A 3UV7A 3AJAA 3VQTA 3ZGZA 3LF2A 3I6BA 3G9TA 1ONOA 1BKDR 1G5HA 1CJTC 2AF3C 1ES9A 1FQOA 1H69A 2O8VA 2QM0A 4QULA 2JI8A 2Q49A 3ZDZB 1VHLA 3W77A 1R6AA 1NONA 2R6HA 5JQGA 1O8CA 4ZI2A 2WYVA 4J0QA 1W1UA 4X91A 1DRUA 3OZIA 4X8OA 2GCIA 2R8XA 1QH1A 1XPJA 2XE6A 5A3RA 4IKOA 5HZKA 2D7JA 4YCDA 4MWBA 2ALJA 3KNZA 4PLYA 4BB5A 4F3YA 2YZNA 4JQCA 2C8VA 5IMSA 2OB2A 2DBZA 2XZPA 2R6JA 3FDJA 3L2OB 2ZT5A 2FMKA 3SX0A 4BVLA 4DG9A 1RTTA 2NO7A 3MJTA 2PGLA 1S3FA 2OESA 3K71B 5K09A 1Q1EA 1E66A 3FPBA 4ZT6A 2CVQA 3AQIA 3LWDA 1GNVA 3QWHA 1FNDA 4MZDA 3LS2A 1K0FA 4TQGA 4LF8B 2B5OA 3AVPA 1LCIA 4L7VA 3UKOA 1BMFD 3WGIA 1HI9A 1EUZA 2GLXA 4RVFA 4X3CA 2BUAA 3CZ5A 4DSAA 2V4ZA 3H5LA 4DN6A 3LZ6A 1IEQA 2PYZA 2HNKA 2H31A 1LX6A 5FORA 5FI5A 3L4JA 3TGWA 1MC8A 4S1OA 3U13A 1EXWA 1ACLA 3DBIA 3F6EX 3QBVA 4PBRA 3K96A 5E3IA 2JJ8A 4TSFD 621PA 3Q9SA 1J8VA 2O0LA 1DCMA 1MAUA 1W581 2ZVDA 3NBZC 4MQMA 4RYLA 1CWUA 4EY7A 2G36A 5DX0A 2CUZA 3U7RA 4R83A 5SYMA 1E2IA 3CX8A 1PT5A 1NW8A 1G4AE 3GEEA 1T5BA 2OORA 4HAYA 4OMUA 4R1UA 3BL6A 1V0JA 2B1JA 3Q11A 3ZXYA 4L4YA 1KH2A 1P7VA 2WAAA 3BMXA 1NUSA 3FUUA 1XT6A 3X1DA 2HRCA 5JFGA 3H3JA 3BGIA 2IZ7A 1W4LA 4IV5A 4MI3A 5LP6B 2BTEA 1EDEA 1QCYA 5FUXA 5DHFA 4GMDA 4L5BA 3KYIB 3E9MA 1QE5A 3HGMA 4UMDA 5FI3A 3U0BA 1VMAA 4MV4A 4F1KA 1DKRA 3RIHA 1ULBA 2YMMA 2JAHA 1KRWA 2ZRFA 4U4AA 1USVA 4OHPA 4RK7A 1YGPA 3BOSA 4OXQA 4WDRA 4I5DA 4GEGA 1SXJE 1W36D 3DZFA 1NYTA 2CJFA 3UA3A 4L8GA 3OWXA 5AIAA 1AQLA 3OFKA 3S27A 4L75A 1JH9A 1KAQA 3B82A 4EA7A 5LZ7A 4KN9S 4P22A 4JI3B 1H6AA 5JLAA 3CR7A 2XUIA 3GEGA 3JALB 3S70A 2PJRA 6YASA 3QFRA 2RHGB 2WQ7A 3PDCA 4OV6B 1OWMA 1WULS 2X8JB 3CX6A 1PUXA 3BQNB 3E9ZA 3LBNA 5DNDA 5LLSA 1IIRA 2PRKA 3NLLA 4ZI7F 4MKGA 4PSDA 5LL6P 4TWZA 1WUYA 3R5HA 4Z54A 4RHYA 2F3TA 1IN5A 1EB8A 3G02A 2Q46A 3VPDA 2C0CA 1E77A 3QUQA 1Z0SA 1S2OA 2X9LA 1ADFA 1DPGA 3E3MA 3MJHA 4KQIA 4CW7A 1E4EB 3B1WA 3DYIA 4IDEA 1BS9A 3VYSB 3NHZA 4TXLA 3GJ6A 3HUUA 1VL1A 3R9XA 4Z99A 4UPDA 2FH5B 4AS2A 1R27A 5JO9A 5K3OA 1NJSA 2PZBA 2OK7A 1CJSA 2VHXA 2AEEA 1B8VA 4OG2A 3LVBA 4OIFA 3NM4A 1MAAA 4EFNA 4QHYA 3L92A 3WWEA 1OXKB 2A5FA 3JVUA 5DV9A 3W90A 2DUNA 2JFFA 4R9UC 1FA9A 1QBKC 1WG8A 3GNQA 2FEXA 5M7EA 1FUYB 1AHNA 4DLTA 4YS6A 4ZOLA 4EFLA 3Q5EA 1XDDA 1O57A 1R8JA 2CNBA 1JHYA 1QLWA 2PV0A 3QKUA 4QDOA 4RD0A 5TF0A 3WOHA 1ISIA 2I6TA 1UP6A 4DOMA 5HQ3A 3I28A 4ISBA 4FEAA 3DDSA 3D3NA 4LBWA 5ALVA 4HKTA 1B15A 4M55A 3UH0A 1BFKA 1SCKA 4EQZA 3F7OA 3N87A 3P9PA 5E6SB 5BV8A 4KFCA 7ABPA 2FPGA 1F2DA 3AONB 3ESRA 5DHTA 4LNUB 2IJGX 1DC7A 3K0EA 2ZYGA 4XQCA 3QU5A 4BFXA 3GRYA 3E2PA 1PDVA 2VOEA 2QN3A 1SQGA 2C78A 3MEQA 4WHMA 3U7IA 4BO2A 1J5EB 3QWIA 2ODPA 5HZGA 1K1EA 3CUSA 5SICE 1SC6A 1GU7A 1FFGA 5C7LO 1JAZA 1JJFA 1BN6A 3FSGD 2IXDA 1NQVA 2R47A 3KBBA 5FYQA 3MJFA 2CLDX 3VPAA 2ZPTX 3HQ4O 2J7PD 1SOAA 1LNSA 1O6CA 3BA1A 2ANBA 4S0XA 5H68A 2P4QA 5JSKA 3BK7A 4IW3B 1DEHA 3EODA 3BVPA 4KVFA 3U56A 4NF2A 4V38A 1ZHFA 3ABIA 4BECA 3R40A 4G9BA 1Z13A 4PE5B 5C37A 2HLDD 3OPQA 2C59A 5LBTA 2J32A 2R751 1HT0A 3EGWA 1T26A 5EHXA 4ZICA 3I2JA 1VOTA 4L4RA 5E3HA 4AKHA 4HZUB 2IZOA 4QUDA 1I2ZA 1SD2A 1HNXB 2VRBA 4NBWA 3SE0A 1KZGB 4R71A 3UUEA 3ZY4A 5EFZA 1PWZA 2C2HA 4I3FA 4U2KA 4OQYA 1H2ZA 2EBFX 4MR8B 4H08A 1H2FA 2WWXA 2IIVA 1F38A 1U3UA 1U98A 4A0RA 3HZRA 2HBYA 3IP3A 5C8XA 2YFHA 3CS3A 1R6TA 1I4TD 1XEFA 2BMFA 3CVWA 4YIKA 3MTBA 3IQXA 3OFNA 1Y4AE 3PTAA 2YXBA 3QFTA 2PBZA 3TN7A 4JUIA 1ZITA 2EHDA 2DBVO 3BDVA 2O06A 3K70B 2HK6A 1VSBA 4DREA 3IQZA 3VAYA 3QELB 3ZW9A 1JA0A 2Y0EA 3EPRA 2E5FA 2Q0SA 3DFUA 5BWMA 4RPGA 4L9AA 1N6RA 3ROZA 3G89A 4GFDA 2XNJA 4Z3DA 1MV8A 1WMEA 3EGCA 2FWAA 3ZI0A 4W9RA 2NUPB 5FA5A 4L5YA 1A7UA 4XM2A 4AZSA 1BHJA 3RBXA 1YR1A 2FY8A 1J23A 1WNTA 3FF4A 1E6KA 4HDKB 4QPNA 4XX1A 2P0EA 3KZCA 2EX0A 2G5CA 2IHBA 4BC0A 2F1RA 3G8DA 1AK1A 4BLTA 1HYHA 1EZ1A 5LP6A 3A0UA 2ZUTA 1WW2A 4NYIR 1U2PA 4JC8A 3ZZ0A 3ER8A 2Q5HA 4DC1A 1ZD8A 3NBAA 1NNI1 1NFRA 1HL7A 3K9QO 1ADJA 4B5LA 3QU9A 4R8RA 5LDGA 2PD6A 2ERYA 4OP2A 4MJ7A 5EMJA 4D8WA 1DTWB 1M6NA 1ZH6A 3RKUA 4J0FA 2QUBA 4FYXA 4TYMA 2G77B 4IXTA 4A7PA 3LO8A 4CM8B 1XWFA 1U5CA 1TQ8A 5J40A 2NO9A 1HSZA 3MCAA 3R3UA 4DMCA 2QENA 4QFBA 5JD3A 5G0VA 1F6WA 5AJUA 3MCUA 3JALA 4KNVA 4ROTA 2E37A 3WX0A 1V7QA 2DX7A 4F1JA 1W85A 2P5UA 2X8JA 2Y1XA 3CLUC 5DH9A 5C81A 3K6RA 3C4QA 5AVJA 4AZVA 2VP2A 3K72B 4IO0A 4EL0A 2VLBA 3AERB 1XJ5A 2I65A 5COAA 5FBHA 4EPTA 1XEAA 1KMCA 1JECA 1KH3A 1XZBA 4IQ0A 1YR7A 1YNOA 2XA2A 3AFNA 4LRWA 1H9BA 2JZOA 2I1VB 3MGGA 3R3SA 4UE3S 3OJOA 4WKNA 1UZNA 2M6LA 1DOZA 3IEKA 1Z3CA 5K6RA 1E4EA 2ZI5A 4WY2A 2H4WA 4D9KA 1V26A 3IVCA 4O0MA 1GUBA 3P9XA 3LHKA 4ETNA 3BHMA 5J47A 4YRBA 1VFPA 3QTTA 2O5RA 1E6LA 2QU8A 4Z4IA 2IYUA 1A5BB 4DQLA 4QJ3A 3GDHA 1JR3E 2CLEB 2CKMA 1OX4B 3V1KA 3A6EA 4DWJA 1HBJA 2FCAA 3E2MA 1DKMA 3HMQA 5AMXA 3RS2A 4DLUA 1GPAA 1J22A 4L8YA 3A2MA 4OHOA 5BSEA 3SM9A 1UM8A 1RRFA 1Z6TA 4MA4A 2QLMA 2G4CA 3DDZX 1TD1A 3G5TA 4J7XA 5K3FB 2WT4A 5JBQA 1DGQA 3A05A 2AMYA 2D0IA 5BMVF 4YBZA 2ZI7A 1QQAA 4CF7A 3TTSA 2BMVA 2E4XA 1SVSA 1VP3A 2VP5A 5IS2A 4RTPA 3KB8A 3OQ6A 4EJ2A 2IYWA 3K9LA 2Y1GA 4ENRA 5BWNA 1O6BA 2R87A 4P34A 4EVIA 2R9VA 3H8SA 3ZCRA 5JWHA 5CIQA 3AI3A 5E6SA 4PZDA 4QTUB 1DJOA 1GLVA 2CFIA 3QBJA 4W8HA 4X8HA 2D0OB 4AO7A 3A31A 2YVLA 5DNUA 4LNUA 3RARA 2ZB2A 1LA2A 3C3DA 3HFSA 3SPXA 3WB0A 1R6VA 1Q17A 2RHDA 3EUFA 3EXG2 4IRUB 4OQDA 4QPPA 4F8EA 4EF5A 1U2DC 3B2QA 1NNSA 2EG9A 2OP1A 2N46A 1QH9A 1SKYB 2YDXA 2ZQYA 3AY7A 3OF2A 2E4ZA 4ID9A 2DSTA 5FUVA 5TGTA 3ZH9B 1CSEE 4ZDJA 4GQBA 2ZXUA 2HKIA 1UXIA 4O5OA 5ALXA 4CM9A 3MJSA 4RKYA 3PYLA 1U3TA 4LEIA 2ZR8A 4D99A 4EY5A 4XAQA 5M3BA 1XCGB 3NP7A 1XDZA 2W6JD 3HLTA 3BERA 1P2UA 3L0CA 3NQ41 4MP6A 1SB9A 5DI9A 4DLXA 3Q1KA 4U0JA 3K09C 1ZQ9A 2BMDA 2YXLA 1Z0JA 2P9CA 3DVLA 3JV7A 3LF1A 4P0TA 3ZWXA 4BGUA 3HH8A 4ZZIA 5TEWA 1AHPA 4LOAA 2RB4A 2JDID 4G5FA 3FLMA 1RWPA 2XH8A 4JHXA 1Z2OX 5IJ0B 5KEIA 3WB1A 5E3JA 3I61A 4BV2A 4MDFA 4C6RA 4UTNA 3AUSA 4IOLA 1KJQA 4HZUA 5JYBA 3DTTA 2YWBA 2DHCA 3C5HA 4YJKA 4IJWA 4YCJA 4LXGA 3LDFA 2PZEA 1QVWA 4MVXA 1Z5VA 3L0YA 3QBEA 1DEOA 2IHJA 4WDQA 1Q22A 4MR8A 3VMMA 4ER6A 3FDXA 1EUQA 5HKOA 1Z9BA 3JQ9C 5KDDA 1MZPA 4MWGA 2SICE 1DCTA 3R7BA 3PA6A 1FNCA 4O25A 2A1TR 4J16C 4MH0R 5FPKA 2V6GA 1DIHA 2GRAA 2VYQA 4Z1MA 3PFKA 4AY3A 2UUAB 1CR2A 2BGNA 4AURA 4PZEA 4Y2UA 2Q2WA 1YQEA 3KXLA 1XQYA 1EFPB 2WM8A 2Y0DA 4TN1A 1IYZA 1T24A 2Y6VA 3QELA 4HYTA 1GCAA 1BTOA 1UFRA 4Y6OA 5A06A 4YCMA 4WLVA 2Z98A 3NATA 4S2EA 3P19A 3UGKA 4YI3A 4G0WA 4J03A 4MROA 3V4OA 5JCPA 3BXPA 3CBGA 2NUPA 1EK1A 4KXLA 1RD4A 4P5DA 4UREA 1RHJA 5J2TB 2ODTX 3H2BA 4KQEA 2VAPA 3W7AA 4TTJA 2CW5A 4DCPA 1K66A 4HDKA 5L53A 1YJXA 2AKAB 2HOQA 3C74A 3ONWA 2IHVA 4D5EA 3I73A 4MAFA 2FEOA 5FCDA 4JSRA 4BYMA 1A04A 4TSKA 2GS9A 3CU5A 2O9JA 3BHJA 4OJNA 4LHWA 4YASA 2GCPA 4EFKA 1RQXA 2W6PA 3U5ZB 3MS4A 2AMJA 1J56A 2QLNA 2BSQA 4MGKR 4WXRA 2Z8ZA 4COOA 3KXKA 5IMBA 4ZODA 5KIAA 1CETA 1DTWA 2VUTA 2VZ9A 4ZP1A 1WE2A 2WJIA 1SRQA 3A27A 3UUGA 4IIJB 1E2HA 2KX7A 2CXSA 2BR5A 3INYA 4PQYA 3M2TA 1W0KD 1YE3A 1ZMOA 2ZJ7A 3JRXA 3OTHA 4GOLD 1EXDA 3VU1A 2QN8A 1QHFA 1Q1BA 5T6BA 2JFHA 3IP1A 3F7MA 1CE8B 1ZA2A 1KHHA 3K3PA 5CTAA 5BYJA 3LRTA 1SULA 2IYVA 4UBOA 2EFJA 1FIUA 3DCYA 3M9XA 2CWWA 5DMHA 4JUFA 3OQMA 2C7OA 4IH1A 2XR1A 3WIUA 1MCZA 5G1PA 3AERA 3RROA 1ZK2A 2D1QA 4KRGA 1E61A 4IQFA 1AZSC 3A6GA 1JEDA 5IULC 2O1SA 5CLQA 2RBKA 4X92A 3ZKWB 1FFHA 3CF4G 3SM3A 3G8BA 3ZLJA 4WZ6A 1ADYA 2M6KA 3GLGB 1CT9A 3OQIB 4P93A 4NS4A 4NWIA 1B0PA 2H17A 2J41A 4NU8X 4ENUA 1GPKA 3T3NA 2HL6A 4DCJA 3DMNA 1ZS9A 1OX4A 1JG7A 3O03A 3LPAA 1ULUA 2Q29A 1PZMA 1ENYA 2P5SA 1KVUA 2E18A 3LOPA 4QBHA 4P84A 4IOKA 3SMVA 2X15A 4F5DA 5JPDA 5A71A 3A7DA 2W6IA 1E9BA 2ZCUA 3DULA 4IV8A 4GX0A 5CGZA 5K3FA 4F4IA 1XU4A 1KORA 4IIUA 1AURA 3DOHA 4DAEA 2JLVA 5KOIA 4LK2A 3PFHA 4PX3A 2JCYA 3BF8A 4YO7A 2B99A 1DC3A 4URZR 4WCVA 4DA9A 3K9NA 5CB6A 3ZS8A 4DIMA 3CUWA 1HETA 3O93A 1Z75A 4B8WA 4NVRA 3D6TB 4XKJA 4DCCA 2JD0A 4MV5A 2D5AA 5K0GA 1OU4A 4DE5A 3GAFA 2OHIA 1EA5A 1I9CA 1VE5A 3HYSA 2DT5A 4BJ6A 2R8YA 3L49A 3ID6C 4WADA 4EYKA 4E7PA 5GINE 3BG5A 2B9VA 1CUBA 1H65A 1IC6A 1PZEA 4K05A 1PDWA 1XXHE 4D81A 4BBZA 3R8XA 3HB4X 4G5SA 4MQ6A 4UM7A 3I5UA 5IK2A 5ITZB 4PLCA 1D6MA 1QKKA 3GT0A 3PPYA 2FDRA 4NFHA 4UM9D 5T64A 2LV8A 3RJZA 1XAIA 1KZ9A 3LE8A 1HC7A 1SUIA 4OXNA 1GQOA 3WC4A 2BR3A 3W5HA 3HDHA 1GA6A 2RDMA 4OK5A 4TL6A 4U2CA 4EUNA 2EFEB 3N2LA 4JBYA 3IEUA 4L0DA 3RC2A 4QQ8A 2YMPA 4G1MB 1HPLA 3JSXA 1M83A 3B2EA 4BN0A 4Y3UA 5IJ0A 2IOFA 1H2AS 4R1QA 3DMYA 4DLNA 1Z22A 5CFZA 7YASA 1T6XA 1Q21A 1W6UA 2P2CA 2HV8A 4ARVA 5L3VA 5DEOA 1GSAA 5GIPE 1U0SY 3HDJA 3N2IA 1UK9A 1XDGA 1ZH0A 3DKPA 4DPMA 1GYPA 3VR2A 3ZU3A 4BZXA 2P7IA 3JYQA 4H35A 1D4ZA 2B2XA 3IBYA 1N57A 1OXTA 2AG1A 1N6LA 3FPEA 1OA1A 3KZVA 3QLVC 4MS4A 2OFFA 1S4QA 3VO9A 2GM4A 3OPYB 4TRNA 3URKA 1ANKA 1GJRA 1QLJA 1S6YA 1W34A 2VP9A 3DHVA 3DJYA 3QUAA 1QIDA 3P96A 4LYGA 5DXJA 3T7EA 1HT2E 4J43A 2YV2A 1DBIA 3MUEA 5F2OA 4R1OA 3SE7A 3V3KA 4N18A 1O94A 2YBDA 4C4SA 2YHAA 1K6EA 1N5RA 5A0FA 1EFPA 4OB6A 3GLTA 3SEAA 1G1AA 1SKMA 2BW0A 5FPSA 1SQ0A 5EJ6A 1QHYA 4OBWA 4A8JC 3I8XA 1Y4SA 2PX5A 3HU5A 2EEZA 5J2TA 4NXNB 2W9XA 4I9UA 1MJNA 3H2JA 4Q93A 2NYRA 1I6WA 4FLMA 2DRIA 4AP9A 4A9AA 4C03A 2JBHA 3AB7A 5JQGF 1OUMA 3A6LA 1JSLA 4QLOA 4URHA 4RTQA 4S04A 4PGMA 1GAEO 2XCTB 1XZJA 4QYSA 5HRUA 3GAZA 1K2WA 1U0GA 3ZWPA 4DR6B 2I7DA 2PX0A 2Q50A 4BB0A 1LRKA 2HDWA 2G1JA 4PYNA 1AKEA 5GAJA 1P2VA 3WAGA 5A5VA 2PX4A 4HGZA 4S3MA 2XBMA 3V8QA 3EVGA 4BCDA 2RIPA 2B78A 4C0KA 2HQOA