2PZEA

Minimal human cftr first nucleotide binding domain as a head-to-tail dimer
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
228
structure length
226
Chain Sequence
SLTTTEVVMENVTAFWEEGGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCSQFSWIMPGTIKENIIFGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLDFSSKLM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Cystic fibrosis transmembrane conductance regulator
publication title Structures of a minimal human CFTR first nucleotide-binding domain as a monomer, head-to-tail homodimer, and pathogenic mutant.
pubmed doi rcsb
source organism Homo sapiens
total genus 76
structure length 226
sequence length 228
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2pzeA00
4QFMA 1GKIA 2QTVB 4US0R 4DT1A 1RJ9A 3CWQA 4JMPA 2IXEA 4ABYA 2WWYA 3TMKA 2ZYTX 1DAGA 2EYUA 3OE7D 3QPUA 2IS4A 1GUAA 1NI3A 1SXJC 3K53A 4U5XA 1QHIA 1HV8A 3DMNA 4IDQA 1XEXA 2WMOB 4C2TA 3AKCA 4QBFA 3FKQA 4IVQA 3CW2A 4URVR 2QAGC 1US8A 4NCHA 4BZQA 4Y0AA 4C7OB 2C5LA 3SFVA 1GNRA 2ZSAA 2WWWA 1L7VC 1OYYA 2GTPA 1G8FA 2YWGA 2IYSA 5FTNA 3F0TA 3QEJA 3HR7A 3OIUA 3BFXA 5EP4A 2WMNB 4V0ME 4MGZR 3NXSA 3P4YA 5JZVA 4QGFA 1C9KA 1E4VA 1QHHA 3HPRA 4KBFA 1DAFA 4PC6A 3GFTA 1EGAA 2WJGA 1NN5A 1SGWA 1TMKA 3Q85A 4U00A 1KY2A 4TTPA 5JHGB 4YMVA 2H17A 4CIDA 4CEHB 4EFMA 5IDVA 1KZ7B 1F2UA 3EC1A 4TTQA 1RRFA 3QVVA 3THYB 4TQAA 1E9EA 2EFGA 3IIMA 4TYYA 1FUKA 4LBWA 4N3NA 1T3SA 2AD1A 1Q0UA 3PEVA 3Q3JB 5EXTA 3NC0C 3IBYA 3OIVA 4BZXA 1E96A 3CX6A 4LYAA 2D06A 5J4YA 2IYTA 3WMGA 4FW9A 4BFVA 3FMPB 3AGQA 2DR3A 5KU1A 2OBMA 1OHHD 2IS2A 2XTMA 1T8TA 3AKYA 2ECKA 2L0XA 2AKAB 1S0UA 4US1R 2FJUA 2FZLA 3QF4B 4HLQB 1U0LA 4PC2A 4PFSA 1G1MA 1CJTC 5UKDA 4OK5A 1UBGA 2QP4A 4RZUA 2CLDX 5C46F 4EPYA 5BN4A 5CJPA 4BLPA 3RWOA 4DIEA 3L0PA 4PZLA 3QEOA 2ANCA 1UADA 4E5UA 2XSZA 5DYIA 1GL9B 3IIKA 2DWQA 4OBEA 4M0LA 4EUNA 2IBMA 3GLFE 4H1UA 1KTVA 4BUJA 3LWNA 5FUYA 5ELXA 2PJZA 1XTSA 2Q9AA 1C1YA 1KJYA 2C77A 2V9PA 1DPFA 1WRBA 4A2QA 2X77A 1CF4A 5J47A 1NVVQ 3EIQA 3LO5A 1G5RA 1ZVQA 4TMKA 2IYZA 4BLTA 1FUUA 2Q0HA 3E1SA 3EC2A 5EP2A 2IX3A 3GFOA 4P4SA 1UJ2A 1ZCBA 3AH8A 2Z0MA 5GJCA 3KJIA 2KJQA 3FWYA 4B33A 1G64A 1E4YA 3P26A 3R7WB 121PA 3KUCA 2NO1A 2IHYA 4C3ZA 3BS4A 2R65A 4TYQA 5GJWC 3NIBA 4QGAA 1EK0A 2AFIE 3B6EA 2HF9A 4TMXA 1HURA 1W36B 1TU3A 3ZS9A 4DUGA 2P67A 1QHSA 1VCIA 4OI4A 2C99A 4B3FX 2PL3A 2B8TA 2WJIA 2UVQA 1QHYA 1SVSA 1PLKA 2OESA 4II7A 1NVWQ 1ZMXA 1TEXA 2ZRKA 1HT1E 4LOAA 4DLUA 2HUPA 3FPAA 1YE8A 2QMEA 5SZIA 4B71A 1AGRA 4CRWB 4QM6A 1HE8B 3SBDA 3WHKA 1XX6A 5CITA 1OXVA 1T3HA 5JRJA 1AKYA 2R6GA 3TW4A 1Z06A 4DCUA 2GDJA 2XJ9A 4HAWA 1KJZA 1V43A 2D62A 2OLKA 5KDOA 3DM9B 1JJVA 3W9YA 3VNVA 3RWMB 1W36C 4NYJQ 2VSOA 3CONA 4M9ZA 1XEWX 2YINC 2A5JA 2A78A 2F1HA 1HH4A 2H92A 2IEZA 4GOJA 4TYWA 2AXPA 3AVWA 4Q48A 4P33A 2IWRA 2HLDD 2FMXA 2REOA 3B1WA 4UNSA 4E09A 1XMIA 5J4LA 2FFQA 2O8DA 4Q7JB 2R2AA 1UKZA 2YYZA 4PTLA 5FTMA 3T1OA 4RZ2A 2NGRA 1RYFA 3OESA 3P20A 1F5NA 1G18A 2QMUA 4Q9JA 1AN0A 2W2TA 1R7RA 2GZAA 5FOTA 3GLFA 3REFA 3IO3A 2Z4RA 3PUYA 2B92A 4HI0E 5GVSA 1SHKA 4QJ4A 2DWOA 4EAQA 2E1RA 2ORIA 2KWIA 3ZLJA 2NO7A 4PAQA 4JL5A 4A0FA 3WHLA 4RVCA 1SVWA 3KQUA 4MQBA 2HYIC 4PANA 4P4SB 3Q5EA 1P2TA 2YVUA 3O47A 1GAJA 2VP0A 2DHRA 3NH6A 2BOVA 1GRQA 4AKIA 1XJCA 5B58C 3QI2A 4PSVA 3U61B 1LY1A 5G3YA 3LRPA 2DB3A 2FPKA 3MWKA 2WJYA 1H8HA 1FTNA 4PSAA 2GWHA 2QI9C 4ZIRB 4H9GA 1B0UA 1JAIA 4GI7A 1IN8A 1FX0A 2GAOA 4QL3A 3WNBA 2FEOA 3SE0A 2JAQA 2XITA 1AQUA 1IN6A 4IVPA 3WRXC 5AUPB 3UXMA 4IOKA 2ZJ2A 3WMFA 3DDCA 4PSKA 2ANBA 4PO9A 2FPLA 1UDWA 1GVNB 3K0AA 4IW3B 4XWKA 1KO8A 4EFLA 3PUVA 3PUWA 2XX3A 2IW3A 3NKVA 4D4KA 2W83A 2ZROA 2A5DA 2ZETA 1AKEA 1KDTA 1GRRA 3SZRA 4OK3A 1Z08A 4AY2A 4QC2A 3UWKA 4I1SA 5L8VA 2QG6A 4HB3A 1ZW6A 2Z6VA 2YZ2A 3EARA 4QKQA 3EAQA 4ZCIA 1JAHA 3B78A 1F3OA 1DO2A 2P6NA 3PG5A 1G291 2OCYC 3QXSA 4I1UA 3EW9A 4I99A 2FFHA 3Q7PA 4US2R 1N5LA 5C18A 1MRSA 4ON9A 3DPUA 1KI9A 1HYQA 2CJWA 4NCIA 4JBWA 3WYAA 2CDNA 5FI1B 3T1QA 2W6IA 1X8KA 4OQLA 1KMHB 3GLFB 1E94E 1XJ0A 1GNQA 3W34A 5JEDA 3GEEA 3QOFA 1QVAA 1JR3E 1G8HA 4XSGA 4KSBA 1D8TA 1E0KA 2BVNA 2C98A 4C9BA 3MFYA 1DE0A 2OSBA 4K46A 2DFLA 1WE2A 1FFHA 5FFMA 5CJ2A 2CNWD 2G1JA 4BE7B 2VF7A 3AF1A 4GNKA 1KI1A 4KLZA 5EE0A 3R9WA 3QQ5A 1P5ZB 2QGNA 1G7CA 3IGFA 4JVSB 3BH0A 1N0VC 4LC1A 1KIMA 3PIRA 2J59A 3M0EA 4NP6A 1VG0B 2ZXUA 5IK2D 1YU9A 1G17A 1E9BA 1AGPA 4B73A 1P3JA 1U99A 4QGGA 5DO9A 3RNLA 1FX0B 3CPEA 3VX4A 3IQXA 4MDEA 4IKEA 1Q57A 4Q1FA 1N5IA 1J99A 1ZAKA 421PA 1HEIA 1OT3A 3MCAA 3C41J 2ZTSA 2EFDB 3CPJB 5KPJA 1FQJA 1Z63A 2XOKA 1KI6B 4NH0A 5CDFE 1N6IA 3ZD7A 2LCFA 1W47A 3PJRA 3KKQA 5JEEA 5H8WA 2KE5A 3O8CA 1D9XA 2QQ0A 4Q7KA 2WWGA 5LBIA 4P0TA 2FN4A 4G5QA 1OH5A 4XH9B 1GRNA 2OG2A 1SVLA 5KO2A 2W6ID 1VCMA 4OHVA 4A9AA 4AG5A 2G9NA 1C4OA 1U8ZA 2W00A 2ZRDA 3HYRA 2IYYA 3SHWA 1CEEA 2CK3A 3HPQA 1Q22A 1Q1BA 3U7GA 3QG1A 5TVKA 2CCGA 2MSDB 3H86A 2KB0A 4BZPA 4YXWD 1EFHA 4DBLC 1QF9A 4M22A 3SN6A 4NCJA 3DM5A 2QBYA 4DCTA 1IXSB 3I5YA 2JCSA 3S1AA 1TPZA 1VECA 1DEKA 2AHOA 1E0JA 4JBYA 1MV5A 4UXIA 4M8NE 3X1ZA 2PX0A 5EE3A 4Z1MA 4AYXA 4Q4AA 1MOZA 5JJLA 2WZQA 1TQDA 3HR8A 4C0HA 3OEEA 4NONA 3B8HA 3IEUA 2AX4A 2XB4A 4HZIA 4GFDA 5HKKD 4BLRA 1Q44A 4FWIB 3X1YA 4A6XA 5EP3A 4DC9A 5JMTA 2ZREA 3I32A 5FL7A 2HXYA 4D81A 2GZDA 1SKYE 3FGNA 1KSGA 4ZDJA 2BMEA 2RGNA 4JYCA 1E0SA 1UBFA 3W3AA 4JLAA 1TAGA 4X8MA 5HTKA 4CT5A 1GP2A 1P75A 1OXXK 4JLDA 3QXJA 2WPDD 2VP4A 5FTJA 1EG7A 3IEVA 2FF7A 2WKRA 2BV3A 1CP2A 1DAKA 4I4LA 1OF1A 4XTRA 3X2SA 4M1WA 3UMSA 3QBTA 4FCTA 4BWYA 3ND9A 2H5EA 3QXHA 5J4HA 4JLOA 2QUZA 4YQFA 1OYWA 4RZXA 2IYRA 4URXR 5FUXA 3IO5A 3GLGA 2CK3D 1R8QA 4Q9IA 3GEHA 1T91A 3ICQB 3I92A 3C16C 1ZNWA 1KK0A 5E7JA 1Z6GA 4IXMA 3K0SA 4BEJA 2R62A 1RZ3A 3IBGA 3QVUA 4BQSA 1W0KA 1EWQA 4XTCS 2VHQA 3D3QA 4JLBA 5K8LA 4DSNA 3F5FA 4PPQA 4Z1MD 5D3QA 2VP6A 3Q9LA 5DI9A 1H8EA 2IUUA 1KI2A 4GP6A 3WBKA 2YJTD 4MRPA 1TF2A 3H2YA 2QMHA 4HLCA 4DVGA 3N2EA 2D2EA 1UDXA 2RKOA 4QG7A 5LB2A 3KTAB 4F93B 2XGJA 2P5SA 1G5TA 2WVJA 4MKFA 5AJXA 5FL7D 1UEJA 4OHZA 4Q4AB 1OB5A 3EZ6A 2EFCB 3QY0A 5E7IA 5AWFC 2QENA 5HR5A 3CNNA 2OBNA 3A4MA 2H57A 5IT5A 1U94A 4NYIQ 4E03A 2ODEA 4BLOA 4QRHA 3JZMA 3QKTA 1M2OB 5EUMA 3TUJC 2A5FA 5K8UA 3C7KA 3SQXA 4ZI3A 3ASZA 1OXSC 3CZQA 1QHXA 1OPXA 1X3SA 4TL7A 1Q1ZA 2PX3A 2RGEA 4QHTA 3TVTA 3MJHA 2QEQA 3RC8A 1NVXQ 1J70A 3CPHA 5J4KA 1M74A 1B23P 2BDTA 3U3MA 3SJBA 3LBNA 5FI0B 4YC7A 5JCZA 2WM9B 3TKLA 1Z6TA 4JT2A 4ZO4A 2P6RA 1XPUA 2ODWA 2YWHA 4X8HA 3TIFA 4UKDA 4JL8A 2WSSD 4LSGA 4BFZA 2D3WA 4IOMA 3A6PC 1NBME 5KSOA 1ANKA 1P73A 2GK7A 3Q72A 4D6PA 1QG4A 4B43A 3TR0A 4KBGA 3CLVA 1I4TD 4OI2A 1Z2AA 3KKNA 4LHYA 4KHZA 4PQYA 1OFTA 2RGNC 1ZIOA 4GMXA 1NNEA 2HT1A 2Q9BA 1DBSA 1YVDA 2EWVA 4FMDB 1TQ2A 1DARA 4EQ6B 4E07A 3RS2A 5HPYB 2O8FA 2JIZA 2OFXA 1WBDA 1OJLA 3TAUA 2RGDA 2GJ9A 1E2NA 4G5RA 5SZHB 1R5BA 3KZ1E 5KYKA 4R98A 3ETLA 5TMPA 4JZKA 1A5TA 3DOEA 1VG8A 1WP9A 4D2IA 2YC2C 1KOFA 1RVDA 4A2WA 2CCJA 3AVYA 4FMBB 3K0CC 3DOFA 2JLSA 4R9UC 3W6NA 4FI3C 2VP9A 1II8A 1Q12A 4Q47A 2N1BA 2F9MA 2FH5B 5KTYA 2AWOA 4KFUA 2UKDA 2QRZA 4UJ3A 3QXXA 1KAGA 4KLNA 4EJSB 3LY5A 3K09A 3EPJA 1P9RA 1R5OA 3F8TA 2F7SA 4B32A 2GJKA 3LFUA 2O8BB 3VAAA 1Z6XA 4P31A 2OXCA 1ZBDA 2KSQA 1LB1B 3AQ4A 4PPGA 2GBLC 2E9SA 5FBRB 3JZAA 4EPXA 4RY2A 5AJVB 3NC1C 4JL6A 3U7EB 2PJRA 2GHIA 1WF3A 1XD8A 4M9QA 4NDZA 4Q18A 1NJFA 4RFSB 3TK1A 4DCNA 3ZD6A 3TW8B 3U44B 2Y8EA 1XJQA 3AVTA 1IJFA 3GJXC 4XWOA 2BMDA 2OAQ1 3BOSA 4OHYA 4Q4HA 1SKYB 1MT0A 4EJSC 5BQ5A 3KB1A 2CXXA 1T0HB 3A1VA 1XZQA 4M53A 3NBFA 4G5OA 1SVMA 3OZXA 1W44A 1VIYA 3FKSA 1GFIA 3RRZA 3W5JA 4EPTA 1I4DD 2JIZD 4OYHA 1ZC4A 2AK2A 5G53C 3AV0B 1AS0A 3CR8A 2GRJA 5BN5A 4GRAA 4FWTA 3RS7A 2O0JA 1W46A 3NEYA 3WNDA 1Y3AA 1M6NA 1TEVA 3PFIA 4WA7A 4KVAA 3KXKA 4JVNA 2TMKA 4RKEA 2VSFA 3UIEA 3BB4A 2O8FB 1E9RA 3NDPA 4LC0A 4NU0A 4IHQA 3JVVA 3LD9A 4MRNA 1KSHA 2FDCA 2RMKA 1XDBA 2YWEA 3HU2A 3T06B 2ZSEA 2F43A 1SZPA 1HUQA 2CEAA 4OQMA 1Z0AA 1G3RA 1G21E 2J3EA 2FSGA 1II8B 3OAAD 2VIIA 5JWOA 3CRMA 2GESA 1R5NA 4B6EA 3F3YA 4GL2A 4QBGB 3LAWA 1E98A 5HZKA 3KKOA 2PMKA 4IDPA 1JB1A 1S8FA 2ZQ5A 2AKYA 4GBMA 2ZS9A 2C78A 2FZ4A 5E7MA 1N5KA 2CHGA 5DHAA 2FX3A 3M1IA 4U02A 5JSZB 2DWPA 4LRWA 2QTHA 4LJ5A 4LDJA 1QZXA 3ECCA 1GNPA 2A9KA 1KI7A 4IDHA 4TL6A 4QJ5A 4XOIA 5CYPA 2R6DA 3VKGA 3FYHA 2CE2X 1S1MA 1SXJD 3FKSD 4TWZA 3DL0A 3FHOA 4OK6A 2IYVA 4TMVA 2P65A 4N0EA 4A4DA 4RCZA 5JI2E 3TGPA 2REBA 3NG1A 3PV0A 1FPMA 4IRUB 4Q4JA 2FG5A 4PO8A 2ZE6A 1LVGA 2I1VB 3ZVRA 1ZRHA 4PR0A 2VA8A 2X8AA 4LPKA 1WBBA 1N2CE 3QXCA 1JEDA 1RKBA 4P4TA 2CVHA 2VSXA 1MO4A 4ARZA 1Z22A 4PPFA 1FQKA 2QA5A 4PZYA 1N0WA 1IXRC 2ATXA 3ADBA 2X2FA 2QORA 5EE5B 1KNQA 2ZJOA 2HJVA 4GSYA 4QBIA 5G3ZA 1WB9A 2R9VA 5EZ6B 4TZ6A 3CO5A 4D0NA 3SU8A 1G20E 4Q9HA 1U9IA 1XD2A 3V4RA 3CX8A 1MO6A 2ZRAA 3GJ6A 5FBQB 3U4QA 3WRYC 1JPJA 3BGWA 4C30A 1DAEA 3CZPA 2Q9CA 1UF9A 3GJ0A 4NYMR 5KNDA 1JQLB 2JLQA 4KAXA 3GJ7A 3MD0A 4LYJA 4XJXA 1CJMA 5CK4A 3U3OA 1RPZA 2FV8A 4B2LA 1DG1G 4PPNA 4ERNA 2ATVA 2ZRPA 1T4GA 2GCPA 3KJHA 1NIJA 1OKKA 1OXTA 2P3SA 1KGDA 3QJYA 4AIIA 4A15A 1UBCA 5A0FA 1RE0A 1GWNA 2G3YA 3LH5A 2F55A 1P60A 1RIFA 2PT7A 3NBYC 4HLUA 4ZDWA 1VYVA 2W0SA 3KJEA 5EXXA 4LI0A 3KL4A 4DXAA 1AJEA 1KY3A 5JWRA 1BKDR 2NO0A 2ZR7A 2DFKB 2FGKA 3L43A 4HB0A 4HZUB 2C9YA 4MKHA 4GP7A 3MLEA 4OJQA 4KO8A 5AJYA 2O0KA 4JVLA 3BH7A 1AZSC 2QT1A 3BK7A 1NSTA 2WAXA 3C4JA 4BPBA 5F98A 1NN3A 3FE2A 1T5LA 1II0A 1K8RA 1GDDA 2QTFA 1BYUA 3OIYA 4PX9A 2ZJ5A 1X6VA 1MABA 5F9FA 4TQUS 1TTTA 3I3SR 4EKDA 4QNRA 1G4AE 1XB2A 1Z6AA 5TY0A 3KDSE 4NCKA 3THWB 1N6KA 1ZYUA 2OT3B 4YLGA 2C9OA 1DTSA 2MMCA 2N46A 5A5GA 2J1LA 4DT1B 1RJ9B 2GAAA 4LV5B 4F7WA 3WNCA 4ARZB 2GETA 2WAYA 2AN9A 4FD2A 3AGPA 2G0NA 3PEWA 2ZR9A 3A4NA 4PZZA 3BIFA 2CL0X 2VTKA 4NMMA 4Z51A 1XEXB 2F3RA 3MMPA 4NZYA 1OIXA 2QPAA 4KODA 4BLSA 1OKKD 1US8B 1W0JA 3CM0A 4Q7MB 3VR3A 1U8YA 2CE7A 1JXMA 1KAOA 2GCOA 1TL7C 4B76A 3PUXA 1Z83A 4V0OA 1Q21A 3KQHA 3V9PA 2VQSA 3K9HA 3EPKA 2HLDA 1XCPA 1G7RA 1U0HC 1W2GA 4M21A 1GOTA 1R8SA 2CLSA 4GZMA 1QHHB 2IXFA 3LW7A 3SDZA 2V6JA 4IOJA 2O5VA 3CNLA 3T35A 4JS0A 4WXRA 3LV8A 3SNHA 3VQTA 3VHLB 3O8DA 3U7HB 3KX2A 1E2HA 1ZNXA 2GJSA 4NCNA 1F2UB 2DFNA 1VIAA 4C0LA 1UAAA 1E1QA 2PT5A 1Z0DA 3DO6A 4MUBA 3FMIA 5AR1A 4ACBA 1JEEA 2VL7A 1XTKA 1KK1A 2VEDA 1N3BA 1N25A 1NSFA 1GG2A 1PZNA 5HE8A 2DCUA 2BBSA 3CB4A 2HJGA 1E9AA 4TYNA 1UKVY 4LPSA 3WXMA 1XU4A 4ITRC 2ZRGA 2QPTA 2V54A 2IS6A 4MGYR 3SI7A 1E99A 4Q19A 3FHCB 4HATA 4JIMA 3CBQA 5KNBA 3CRQA 2FA9A 1QBKC 5DLQC 5KSPA 4DDTA 1N0UA 2FPMA 3FMOB 1E2IA 1KK3A 4QHSA 3CRRA 3C5CA 5FR1A 2YOFA 3ZVLA 2JLYA 4F38A 1W0JD 1G7SA 1YZNA 2GEDA 1JNYA 3FVQA 5TB5A 4LJ4A 2Z83A 4RJLA 2CBZA 5BW8A 1YJ5A 4WW0A 4IEEA 2IT1A 4C4PA 5D3MA 5EJEA 1NVVR 4Q4LA 5KUTA 3U6BA 2FE4A 3THOA 1KKMA 1FP6A 2GCOB 1DAHA 5H70A 1YQTA 1XEFA 1DELA 1N6OA 1G6HA 3KXIA 3QBVA 3QG5A 3K8YA 3ZDQA 5JECA 3NBZC 2C04A 4NKRA 1G16A 4V0KA 1CR2A 1ODFA 4KCGA 4UNPA 2AD5A 2VPPA 1E1QD 2OXRA 2JGNA 1CTQA 2BJWA 2QY9A 2JDID 2J5XA 5JS7A 2REXB 4DLZA 1CR0A 1E1RD 4OKSA 2ERXA 4PC7A 1IBRA 3OFNA 3TE6A 3DVLA 3PVSA 2NPIA 5F3WB 2OFWA 4RKFA 1JPNA 3EZFA 1F60A 1AIPA 5L3QA 2EYQA 5E95A 1Z0KA 4MA4A 1T3LA 2CNWA 5J40A 5FUVA 3X1WA 2CCKA 4DLYA 1LF5A 2X1VA 2IWHA 3UG7A 4HAUA 3CWZA 2ZVQX 2W2VA 3FFBA 4B2IA 2GVDC 3LBHA 2OHFA 5FPSA 3RC3A 4JYBA 4PC3A 3CIOA 1KO5A 2EU8A 5C4GB 3Q8XB 3QKSA 4OQXA 4PC1A 2NPFA 2ZE5A 4GZLA 2HT6A 5IK2A 3H84A 2V1XA 1MO3A 2BM1A 4RD1A 3RS5A 2YV5A 4CDGA 2GEVA 1RYHA 1N6LA 3TQCA 2XZLA 2W0MA 4FCWA 721PA 1N6HA 2QROA 1NF3A 1XFAA 4N1AA 5EUQB 4TQ9A 2HEIA 1G3QA 1GIAA 1QDEA 3DKVA 4HAZA 2I1QA 5FOSA 4EPRA 4LGMA 1AS2A 2ZS7A 3A36A 1UM8A 1ZIPA 5FPKA 5C1BA 3AKDA 2W58A 4NBSA 2ZVPX 3B9QA 1BYIA 2O8DB 4MKIA 1FP7A 2GEUA 4MYCA 2RGXA 5DI3A 1ZM3A 1QHNA 1YZKA 4S2EA 5L3SA 4JLKA 1GL7A 3DZDA 4LK2A 4E22A 3OFND 2ZYVX 2ZI3A 1GTVA 3SOPA 1A2KC 2ZITA 2UZIR 4KV9A 3WYGA 3KFVA 1TADA 1JECA 4BFYA 1E2LA 3MG9A 3P27A 3GEIA 4YXWA 1KO1A 1ZNYA 621PA 2Z5FA 4CZ2A 1G3UA 4IOLA 1QG2A 4L16A 2ZUCA 5FPYA 4KXFB 3B60A 3EZ9A 2V1UA 1II9A 1F6BA 3AP1A 1KDRA 3ZYCA 4HUQA 2VLIA 2J7KA 4MYHA 1AM4D 3PCRB 2EWWA 2ZRNA 4W5WA 5HKKA 4U7DA 1W7AA 3AM1A 5L3VA 3AVOA 2FSFA 2ZANA 1O3YA 4UJ5A 2HF8A 2VHUA 2CL6X 1TF7A 1KSFX 3AF3A 3K70D 1E2QA 4DLRA 2GVZC 1UKYA 3SQWA 3GLGE 2O52A 3LA6A 1NL3A 4JKYA 1R0WA 2R6FA 2WPDA 3K0AB 3HDTA 1X1SA 4V0LA 2ZJZA 3MWLA 2XJ4A 4TTRA 5H1YA 3ZH9B 3SJCA 1X8JA 3U5ZB 1UBEA 2RH5A 2PLRA 3SYLA 1CKEA 4RD2A 1OH6A 4MYUA 2XB2A 2A3RA 2WWIA 5BYKA 4K8OA 1WQ1R 4B47A 2H16A 5TDHA 5FL3A 2W2XA 1FMLA 1S9DA 1IM2A 4LBVA 4M1TA 2IYUA 4O3MA 3HJNA 5DSZA 3LLUA 3OF5A 2HCJB 3ND8A 1HE1C 4RSGA 3BORA 1MKYA 3CH5A 5KSZA 1NLZA 2CJWB 3BH6A 1CIPA 4ZCLA 4EDHA 1DS6A 1SHZA 2JJ2D 2JLZA 2WHXA 1SVKA 4LHXA 5BXQC 1BOFA 5F2EA 4BFUA 3IPXA 5DNYB 2IF0A 1R0ZA 3MRSA 1G3MA 4HDCA 4ZCMA 2ZS8A 1KI8A 3ZQ6A 4ZPXA 4BASA 2F1IA 4GPTA 1U2RA 4B6FA 3ADDA 2WSMA 3I61A 2ZJBA 1VPLA 1TNDA 2OCPA 4HUQB 3CRW1 3GQBA 2YWFA 3T12A 3VFDA 4R71A 2A5YB 1OLOA 1DVRA 2VHTA 2C95A 2MSEB 1XTJA 3THXA 1E69A 4MRRA 3RAPR 2D7CA 2H18A 3O8BA 3QPWA 3L8ZA 1NG1A 2G6BA 2A2ZA 3B1VA 3RABA 2GF0A 1NLFA 1NP6A 2PCLA 1IY2A 3QKUA 2XNDD 2ZUBA 2VHJA 3LX5A 4W7SA 2R8RA 3CX7A 1NLYA 5JRZA 2G0TA 5FOXA 3WP1B 5KHOC 2JJ1A 3U6KA 3TVDA 3VKWA 1L4UA 4OHXA 1KHTA 3VR2A 2WWFA 2F1JA 2A7QA 4UNNA 2WSSA 2GA8A 4A2PA 1XTQA 4Q9LA 4W5JA 1IN5A 3PXGA 3T1VA 3DEFA 1YZLA 3K0FA 5GJBA 3D7MA 2KI5A 4LHZA 1OB2A 4HAYA 3B5JA 3CF0A 1E6CA 4XVQA 1COWA 2Z43A 5JWHA 2QN6A 2ZRIA 4Q66C 5EXPA 4Q21A 4XWAA 3KQKA 4CYMA 4TL9A 3A37A 5BN3A 1EESA 3D31A 2QBYB 1XXHA 4PQRA 2PEZA 3S1AB 4UNRA 2ZRLA 3GLHA 1FZQA 2J45A 2FSIA 4G1UC 4ESVA 3VMFA 3U3JA 2O8EA 1IQPA 4CEIA 2JJ8A 2SHKA 2IYQA 4MGKR 3G5UA 1IY1A 2CL7X 4MKGA 2QQEA 4M1YA 2H8KA 5CM9C 5TV2A 4C0KA 1PLJA 1W4CA 2RHDA 1Q3HA 1VYUA 1T6NA 3W6PA 3N70A 2IXGA 2J0UA 5L3RA 4AYTA 1KSJA 2BC9A 3CNOA 1OFIA 4URYR 1E2DA 3NTUA 3EIHA 4LX0A 4R7ZA 2JJ1D 2A30A 1TU4A 2YOGA 2W6JA 2FU5C 1VMAA 3W5IA 1E9FA 2V8OA 4QBHA 1RW4A 1WMSA 4W5HA 1M8PA 1RC8A 2ZI9A 1MR3F 4WZBE 3MUFA 3T1TA 2JLRA 2O8CA 2ZU0C 3OEHD 2GK6A 2VHCA 4TN1A 2OBLA 2RGBA 5FTLA 4CEJA 4TZ0A 1OH7A 1XCMA 3AF0A 4L4UA 4PO1A 4BFWA 4DZZA 1COWD 2YOHA 3NEJA 3GLGB 3LQQA 2BWJA 4IVRA 4TLEA 1G6OA 3I73A 2EFHB 1DAIA 2QU8A 1FMJA 4UXHA 4DSUA 1Z29A 2D7DA 3FDIA 4JVMA 4A0HA 1L8QA 1J2JA 1XF9A 4IDOA 3QUSA 2V3CC 3LX8A 4PHHA 1EFTA 5G40A 2P2LA 5AJZA 1ZD1A 1I2MA 1NMXA 3RS3A 1YZGA 4HUTA 5A4JA 2ZU6A 3E5HA 3VU9A 1RRCA 3W6OA 4DEXA 3CRVA 1D2EA 2DPXA 4MRVA 1S2MA 1YZTA 1XXHB 3ASYA 5J5CA 2FGJA 3V4FA 1CS4C 2ZYUX 1EFUA 1I2DA 5FBWB 1K6MA 3B9PA 3GLHB 4NYIR 4A1FA 5DIFA 3RANA 1P7CA 2ERYA 2WWHA 1YR6A 4XD7D 3E2IA 4JSYA 2F9LA 5EP1A 1XPRA 1W4BA 3RS0A 2XZOA 3PQCA 2O0HA 3PEUA 3OAAA 4X8LA 5IRCD 1Z07A 2ORWA 4ZDIA 1R0XA 2V7QD 2W6JD 5FTKA 3VR4A 3PUZA 1E3MA 4BGDA 2ZI6A 3IDQA 1J90A 2IA5A 2K5UA 1LW7A 3GFPA 1KO4A 5CIQA 5B64A 1ZM2A 5LDDC 3K1JA 4YMWA 2J0QA 4DLVA 2PBRA 1ETUA 3ZZUA 3TLXA 1U8AA 4B75A 5CM8B 2Z4SA 5SZJA 2C9CA 2XNSA 1XD9A 5C4MA 1YHNA 2O8CB 4KITB 1CRPA 2YNMA 1SXJA 1Y63A 3W90A 3C8UA 5CLLA 5AUQA 3Q5DA 1VDZA 1M7BA 1N6PA 4G01B 3EA5A 3D8BA 4KYUA 1QVRA 2QAGA 2I4IA 5EXSA 5TARA 1M7HA 1NKTA 4F4CA 1S4QA 1GILA 3GD7A 3OIWA 2XTZA 1IN7A 3A4LA 3LVRE 1GKYA 1S3GA 1E79D 1JI0A 1K5DA 2OEPA 4LJ8A 2DYKA 2BBOA 1AQYA 3L2OB 1TF5A 4HDOB 4UNQA 3ONWA 3B7GA 3VU9B 4LHVA 4EFNA 1OFHA 2QE7D 1UEIA 5H68A 1TUIA 3QNUA 3T15A 3REGA 3GLIE 4BFTA 2OILA 1KKLA 3AEZA 3GMTA 2I3BA 1N6NA 2R44A 3QENA 4LY6A 5HZHA 4DLTA 5JFGA 1NN0A 2OO7A 4AI6A 1HA3A 4KVGA 5DN6A 1PLLA 3KXLA 3T61A 1F2TA 2LWIA 3AVUA 3QIAA 3U3KA 5KNCA 3VX3A 1AA9A 4RD6A 1LTQA 4AKEA 4CEHA 4M1OA 1FNMA 1O87A 2VP5A 1G41A 8OHMA 4YDHB 1SVIA 1ELOA 3THYA 4KFSA 3QPVA 4LJ7A 1BMFA 1D6JA 4Q4HB 2JLVA 3ZVMA 2B21A 3K09C 5F9HA 3WBJA 1KK2A 1S3SA 4AK9A 1XEWY 3U3RA 4Q00A 1TQ4A 2G1KA 4DDWA 4DLXA 1K5GA 2OM2A 3I1FA 4GOXA 2R6CA 4Q1CA 4Q02A 2C8VA 4PHFA 3I5XA 2GXAA 4FIDA 1QHGA 4NTZA 5AUOB 3SHFA 2BCJQ 4C0JA 2ODBA 3U60B 1Z5ZA 3R9XA 1LV7A 3I8SA 2WV9A 4D4JA 4OQNA 3RHFA 2QM7A 1G19A 1KMQA 3QF4A 1ZM9A 2PMDA 3DMDA 5GADl 1NBMD 4QNMA 4TMZA 1RRPA 4DSTA 1YR8A 1BH2A 4JT4A 1P9NA 2QMOA 3W8RA 1P6XA 2PH1A 1RFLA 3A1SA 2BCGY 2BEJA 4FINA 4AYWA 1T8UA 4D4LA 1JBKA 4EIWA 4ILEA 1WCV1 2R6AA 3AVVA 1WDTA 4B48A 2ZPTX 4KU4A 2F43B 4B3CA 1ESNA 1G8YA 1JALA 5DN6D 1AZTA 1E32A 1CXZA 1ZC3A 4F91B 3SR0A 4A6PA 2PZFA 4NL4H 1W2HA 4DKXA 3H0KA 4HEJA 5ANRB 1XRJA 3PENA 4FMCB 1R10A 3ZJYA 4C0QC 3BJIC 4BEBA 3B82A 2FFAA 3IPYA 5JI3E 3GLIA 5DHFA 2D4HA 2J7PD 4HLDA 2MSCB 1ZCAA 4AC9A 1NG9A 5KSYA 5FOWA 1VCOA 3LXRA 1BMFD 1F2TB 1SULA 3LBIA 4WBSA 4QM7A 1G5PA 2ZAMA 2ZUDA 1YZUA 2IL1A 1OIVA 3SEAA 4CGZA 3O8RA 1Q1EA 4A36A 3R7WA 2OUKA 4M1MA 4WZAE 1P62B 1MRNA 3VR1A 2WOJA 4CVNA 3QKRA 2ZE8A 2ZAOA 3FTQA 5AUNB 1U0JA 2NZJA 1LS6A 2P6UA 3EZ7A 4RCYA 4WOPA 3EX7C 4Q4JB 3GCGA 2EFEB 3EA0A 1E9DA 4BRWA 1H65A 2ONKA 4QXAA 1N5JA 2P0EA 3AP2A 4Z8YA 1D5CA 4LCBA 2HYDA 2XEXA 3NWJA 4JKIA 4ZV4A 4V02A 3H4MA 1ZUHA 1ZD9A 1VG1A 3L8YA 1FNNA 2JEOA 3A1UA 3TUIC 1EFCA 4EPVA 4FMDF 3EPHA 1HQYE 2HV8A 2OLJA 5K8TA 5KDDA 4L9WA 3BERA 3KB2A 1XD2B 1S9HA 3M6AA 5FPHA 1V5WA 3BC1A 3UK6A 4DEYA 1XBTA 2JLXA 3U4QB 5G41A 4ZKEA 1XP8A 4N0DA 1GSIA 3G82C 5JJKA 1NN1A 3KKPA 2QSYA 3WY9A 3LLMA 3FHTA 2FNAA 2WBLC 2BKEA 3K9LA 1A7JA 2RGGA 1XMJA 4D82A 2YC4C 3D6TB 4LYFA 5KOYA 1EX6A 2AR7A 1DOAA 2WIAA 2WWXA 2OCAA 4XVUA 5IF9A 1KZGB 2BMJA 2WIBA 4LUCA 4CF7A 2DY1A 3SJAA 2FEMA 4PHGA 1XMSA 2IYWA 4Q01A 2GJ8A 3B1YA 2CHQA 4JLNA 1U9IC 3VTKA 2NMVA 3GLIB 4Z8XA 2NTYC 2JDIA 3BD9A 6Q21A 2XXAA 2CLCX 1P9WA 1MH1A 1F48A 4GMDA 1E1RA 3BFKA 3L0OA 1Q1QA 4PQFA 3PR1A 5FOUA 3FOZA 2C03A 4JJKA 3B2EA 1XCGB 2ZRJA 4MH0R 2BHRA 4POAA 3B1ZA 2AK3A 2ORVA 2X2EA 1W36D 1PVOA 1A82A 1S1CA 4QGHA 4V0MA 4UQOA 4LJ6A 2GXUA 4V0NA 2ZI5A 2H7VA 1NIPA 2CVFA 2OE2A 4CT4B 3QKRB 3L82B 4P32A 1MABB 1PUIA 4HLUC 4KFRA 5B57C 4DRZA 2GXSA 4R2IA 5E3HA 4I1VA 1Z3IX 4C0BA 4WXPA 1AK2A 4ZIRA 3BXZA 2QL6A 2WKQA 3PITA 1JR6A 1NY6A 3TAHA 3VR5A 1T0JB 1VHTA 3WYFA 5LD2B 1A1VA 4RZ3A 2ZE7A 3T5DA 3EXAA 4JLJA 3I4LA 1CJVC 1Q20A 1IJEA 4WAUA 1YKSA 4B74A 4P3YA 4D0LB 2GZHA 1HT2E 4RD4A 5DYGA 5JCPA 1JQJC 1HY3A 2XSZD 3IIJA 1Z0IA 1XTIA 4XVRA 2VH5R 3QF7A 3KQLA 1CJKC 3VNUA 2PCJA 2B7BA 3BFVA 2WJHA 2OV2A 5FH9A 4JLMA 4JLVA 1W5TA 5LD2C 2YKGA 1YR7A 4L8GA 4D26A 2ZRHA 2JLUA 2ODNA 1VHLA 3A1WA 1E2MA 2C96A 2NZ8A 1EXMA 3AKEA 3B85A 3SBEA 3X1XA 4PAOA 3TH5A 2BBWA 1E2PA 2HXSA 4D4MA 1XZPA 1N6RA 3RRNA 1KMHA 3H1TA 3BE4A 1XPOA 5M04A 1IY0A 2XXAB 2JASA 5AJWA 2ZJAA 1OXUA 1NJGA 4BFSA 2IK8A 4Q1DA 1W4RA 3P32A 4LBYA 4DIDA 4ZI2A 2NQ2C 4AD8A 2J0VA 4AURA 1IAQA 4S35A 1RRGA 1U81A 2NO6A 3UANA 4ASUA 3RRYA 2B8WA 1I4LD 3DZ8A 2NOAA 4LJAA 3I8XA 4DUGD 1OSNA 4LYHA 1CU1A 1KJWA 2ZRMA 1VYTA 3V00A 2V4ZA 5KDLA 5BYJA 1A4RA 5P21A 4C0SA 5CB8A 2D2FA 4NYJR 2IYXA 3ZZ0A 2XAUA 3ADCA 1P72A 1CRQA 1R2QA 4BLQA 3GJ3A 4IDNA 1CR1A 1OIWA 1EFRA 4NPHA 1NVUQ 3ZVNA 3KJGA 2RGCA 2ZJYA 3GJ4A 3KUDA 3VR6A 1KI6A 4QHYA 3IHWA 2VF8A 4BECA 4URWR 3R8CA 5LB4A 1SQ5A 2VO1A 4AG6A 4DCVA 5D3MB 3K9GA 2IEYA 1ONBA 3BAFA 4Q1AA 1DO0A 2GCNA 4M9XA 4O25A 5HE9A 4B35A 5JHHB 3HU3A 4B3GA 1ZM7A 3RRMA 2WJVA 3HU1A 2ASEA 4RD0A 4IEIA 821PA 3SYKA 3U2QA 3CUEF 3ZGXA 3GPLA 1EX7A 4FMCF 2JJ2A 1NY5A 521PA 1ZM4A 1GL6A 2J46A 5KPDA 3W8NA 2UZ3A 1U98A 3JVUA 2IUSA 4ASUD 3R8FA 1CULC 4DB4A 4B3XA 1E0AA 4LJ9A 1Z8FA 3LW8A 3T5GA 2NG1A 2ZM5A 5HCNA 1NKSA 5L3QB 1DADA 3KQNA 2WTUA 3TNFA 4QJ3A 2LKCA 1J8MF 3IQWA 3WP0A 4DCSA 2F6RA 1H8HD 5JLJA 1OE0A 4Q1EA 3QKSB 2J87A 4TLBA 1L2TA 3EASA 3RVBA 1T9HA 1ZU5A 5J4VA 2QSZA 4G0NA 1EFRD 4OI0A 4NE2A 4FN5A 4OI1A 3SJZA 5FBVB 3TUZC 4URUR 4CW7A 4IXNA 3K70B 4JLPA 1OW3B 3HYTA 2XNDA 1E9CA 4DLWA 2PZGA 3EWAA 1ZUNB 3FB4A 4C0AC 4PHTA 4MRSA 1G8PA 3TRFA 4KSCA 2MMGA 2CHVA 1XXHE 1E2KA 1KNXA 1BO6A 3NDBB 4GDFA 2FFBA 2XTNA 3GLHE 3M4YA 1UKEA 2WJJA 3NHBA 4KFTA 4A8JA 3DKPA 3GJ5A 1CLUA 1G8GA 2QZ4A 4IFEA 5DI3B 5L3SB 5EE9A 3HP1A 4HB2A 1Z0JA 1IONA 3C14C 2BEKA 3KFXA 3MAAC 1P4SA 3Q7QA 5GJVC 3DHWC 5HCIA 1BIFA 4GT1A 4B44A 3K70C 4Q7LA 3NH9A 1ZUIA 3P4XA 1D9ZA 3QE0A 4ZKDA 2DBYA 2PEYA 1ESMA 1PUJA 3B1XA 3UMFA 2BMFA 4M1KA 1Z2CA 2AFHE 3CKLA 1HQCA 1GKUB 3N2IA 3NVAA 1NMYA 1J7KA 4F92B 4W9MC 1KI3A 3L0IB 2B7CA 1ZU4A 4HDQB 1W4AA 1X1RA 2NIPA 2QAJA 3KTAA 1Z28A 5DE3A 3TR5A 2WOOA 3EWSA 1E2GA 4G3XA 3A58B 3BWDD 4B34A 1EWRA 3I72A 3BRWD 1IN4A 4X8OA 3UWOA 1G9XA 1OFUX 3LQRA 5LPNA 2E87A 2Q3MA 2JLWA 2ZSDA 1JR3A 2JATA 3UKDA 3ICEA 4F4JA 4HSEA 1DG3A 4A92A 2V6IA 4HYYA 4KJZA 2NO9A 2XOKD 3B13B 3TSOA 4LBZA 3W3ZB 2IYLD 1SKQA 2OCBA 4C2UA 4XSHA 2OZEA 3K9NA 3OEHA 2BM0A 4Z54A 1D2MA 1Z0FA 2J9RA 4JJZA 3RSLA 2FWRA 1DAMA 4O0MA 5IHPA 1TX4B 3K0CA 5DH9A 1M34E 2KBFA 2J41A 2FSHA 3TSZA 4B2PA 3EPLA 3RLFA 4A8JB 2DFTA 2GJAA 2VP2A 3EG5A 2RB4A 4GOKA 4IFBA 3CF2A 4D80A 4D25A 1W1WA 4JBXA 1PJRA 1YRBA 5CDFA 5JJIA 1G3IA 1P2SA 1W48A 4OJKA 4EQ6A 3N5CA 2ZEJA 3MWYW 1GM5A 3UMRA 1KYIA 2QRNA 2GBLA 1VCNA 5DGXA 4TL8A 2D74A 1XNJA 4LV6A 2H1LA 2P5TB 2ZR0A 4G5GA 1TQ6A 3LXXA 5CLQA 4EPWA 5GVRA 3RS4A 2QT0A 3AUXA 3OEED 5EQTA 4DWJA 4DDUA 4TLDA 4XD7A 2CMKA 3T34A 1R6BX 3AP3A 4A8JC 3K0EA 4LZZA 3IUYA 1JR3D 4YMTA 4EJSA 3THXB 3R20A 5BWMA 1NMZA 2V7QA 1OV4A 2F1RA 4TT3A 1SXJE 1WXQA 2VBCA 4B3DA 3CF6R 2LKDA 2O8BA 3NHAA 3RSOA 1UFQA 3SC3A 4TYPA 5JBQA 1X8LA 1XMVA 4UXJA 1YR9A 2BBTA 3MSXA 3I62A 2JA1A 3A8TA 3LVQE 4Y0VA 4QOSA 3TSWA 4H1VA 4RFSA 3BBPA 3ZIAA 2ZJ8A 4ACAA 3U44A 2OAP1 4I81A 2IHBA 3AF2A 3AF4A 4DSOA 1W49A 2HDNB 4TSFA 2RCNA 1FOEB 1JXOA 1YRAA 3K0FB 1M7GA 4P4UA 4IJMA 2HCBA 1A2BA 1IOZA 1ZINA 4TMTA 2G83A 4K81B 1R4AA 4KI0A 4WIAA 4HAXA 1W0KD 4DJTA 4L9SA 5B2ZA 3OHMA 1MO5A 3ADKA 4R2HA 2GNOA 2ZIAA 3FMFA 1W5SA 4DDVA 2WICA 1VG9B 2ZRBA 4I1OA 4ESHA 2XZPA 1H8ED 1P2UA 5FR2A 1KDOA 1T5IA 3QSYA 1CR4A 1P61B 2GILA 1E79A 3BB3A 1IHUA 1TUEA 4NHOA 2QPOA 1BS1A 4TLAA 1SVOA 1G4UR 1Z47A 2IC5A 1FTSA 2EW1A 4M1SA 2QE7A 4MYTA 4DLSA 4CEIB 2O8EB 2V55B 1X86B 3ZQJA 1D2NA 3MGCA 3UATA 2PLFA 4YONB 2OFOA 4TT3D 2KBEA 4L5BA 5E4FA 4URZR 4MGIR 3NBXX 1S96A 3MJRA 5CK5A 3RYTC 1U90A 2G88A 4AWXA 1ZNZA 1XTRA 3SFZA 3TQFA 2J0UB 3ZZTA 1GZSA 1KI4A 1ZP6A 1YZQA 4M9SA 3X1DA 1LFDB 4TMWA 2QNRA 1XWIA 2Q3FA 2IUTA 5CIWA 4BRUA 1KDPA 2AWNA 4RFVA 3TJZA 3ZIAD 2BJVA 4J0QA 1E2EA 4V03A 2AXNA 2RAPA 1QRAA 2ZRFA 5JSZA 3U7FB 1PV4A 4F4IA 2FOLA 4TSFD 4DHEA 2RHMA 5EZ5A 3L0SA 2G77B 4Q9KA 4CEJB 1ZD8A 4D0GA 1OH8A 2EQBA 1E2JA 4MDFA 3CR7A 3TBKA 2QM8A 5CB6A 3G0HA 2ZI4A 3UG6A 2N42A 3FFAA 1Z6YA 5C2JB 3LNCA 3UPUA 1J8YF 1NRJB 4PXAA 4RD3A 221PA 1R0YA 3AUYA 4JSTA 1CBUA 5B30A 4WVFA 3SS8A 2EVWX 2GKSA 1VKJA 1FL9A 4WZ6A 3E70C 3AVXA 2X19A 5EE1A 3C5HA 1E2FA 4XIGS 1NBMA 3WMEA 1Q3TA 1G7TA 5CYOA 5JS8A 3PEYA 1E9SA 1UPTA 4MITA 2Q6TA 2ZSFA 4HAVA 2F3TA 1HTWA 2Q21A 4YDSA 3J81k 4C7OA 1IXZA 4HB4A 3GJ8A 3OE7A 5FPTA 3R9IA 4Q5IA 2A5GA 2GF9A 4FCVA 3EIEA 4M2LA 4TLCA 1L4YA 1GITA 3P1JA 3A1TA 2PZEA 3VKHA 1AS3A 2IF2A 4G5SA 4M4SA 4NYMQ 2RGAA 3ZS8A 4B3BA 4L15A 3GP8A 2ZYWX 3RDPA 4OL0A 2ZI7A 2J7PA 4A0RA 1FW6A 3AVPA 4FXPA 4O2RA 2VYFA 1ZJ6A 1LF0A 2WKPA 5K8IA 3AB3A 2GXQA 5FUWA 2VRWA 2BIFA 3KKMA 3IKJA 3IHLA 2ZSBA 3C15C 4OQFA 3BB1A 1M1YE 4LJYA 4HZUA 2IS1A 2ONJA 3LDAA 2J0SA 2C2HA 3SYNA 4AKHA 5AK0A 1SXJB 4MUAA 3AVQA 4LWZA 1P2VA 4O2LA 5DISB 3CH4B 5TXGA 2Q3HA 4LV8B 4YMUA 2AL7A 2QP9X 1LNZA 2YHSA 3IILA 4LHWA 3MWJA 4YMSA 4A0GA 4Q1BA 3HWSA 2QAGB 1JJ7A 2B6HA 5FBLB 3VHXA 4A82A 1WA5A 4DB2A 4Q03A 4BFXA 4PAMA 1LS1A 4KYIB 1KO7A 1CJUC 5SZKB 3THWA 3EZ2A 4AKGA 1OHHA 4ZDKA 5FOVA 4OHWA 2ZRCA 1VTKA 2QP3A 2BKUA 2QGZA
chains in the Genus database with same CATH superfamily
5EXDA 2P4EA 2X41A 3H0CA 4D4IA 3A27A 3CW9A 3KSRA 4OLHA 3USZA 3IAAA 3WYNA 3IAXA 4ZVUA 4ABYA 3TG8A 2AZXA 1VA4A 3A1NA 4I50A 3N53A 1PZHA 1NFQA 2V9CA 2YNMC 3DC2A 1GUAA 1NI3A 2O1EA 3OE7D 3K53A 3R0ZA 5IVHA 1HV8A 3OFJA 3PWSA 5I4CA 1XEXA 2WMOB 3P0IA 1G8SA 2P40A 3OHPA 3AKCA 1YO6A 2R60A 4JU9A 3TEMA 4AU1A 3HXMA 3KYDA 2X9VA 3E9RA 4BZQA 3CMMA 3ICVA 2C5LA 4LDNA 1GNRA 5A62A 2WWWA 1NT4A 1GPUA 1ML3A 2A67A 3DP7A 2YWGA 3B36A 3HP4A 1AXEA 2IYSA 4QRDA 3OU7A 5GV8A 1PQPA 3QEJA 1JDNA 3ZE6A 5CBKA 2ZATA 5HJ7A 1R4ZA 1V3VA 2HPHA 1C9KA 4KBFA 3ZE2B 1N2GA 5A05A 3FAKA 4J43A 1CCWA 1YQUA 2ZB7A 1EWVA 4P81A 5LUBA 3AZPA 1KY2A 2Q5IA 1M1NB 2NUTB 4HDSA 4TTPA 4PBTA 2HM7A 4U00A 1ZIXA 4AL4A 1RNLA 3DLAA 4P35A 4YMVA 5EJ8A 2C7RA 4CEHB 5IDVA 1KZ7B 1RLOA 3WAKA 1ABFA 1RRFA 3LPCA 5F78A 3LS2A 3BE5A 4TQAA 2EFGA 3ZQ4A 1JDZA 4LBWA 1VPTA 2G9RA 3PEVA 3DD1A 4LZJA 1ZHOA 2F67A 3HCCA 4WLUA 3VHQA 2PKQP 1E96A 4GM0A 3W5UA 4FOSA 4NCBA 4C4AA 4JSRA 9ABPA 1IB0A 2AZMA 3FMPB 4ZYLA 3QA3E 4BO5A 2R00C 4MROA 1OHHD 1DIGA 1WCYA 2AVDA 2XYVA 1MNAA 3FCXA 3LL7A 3WNZA 3AKYA 2IS2A 1ZN7A 2C5AA 2JPDA 3M6LA 3RVLA 2V5UA 3R3ZA 3AHEA 1FFYA 1ZRSA 2VT7A 1ESZA 4WBNF 3DAPA 1K88A 4XW2A 1CJTC 5UKDA 3NHZA 5C7YA 2R1TA 3FSGA 3VU1A 1VE5A 3HI6A 4CIVA 1HG0A 5C46F 4RTRA 2O07A 1U63A 4QU8A 3FTFA 3MGAA 3A32A 5JNTA 2QIPA 2E37A 2IBSA 2JJQA 1B8NA 3QEOA 2BGWA 1W25A 1JRLA 3QUQA 2I33A 4MCJA 5F76A 1ZLXA 3H1FA 1AVTA 3HDQA 4TLMB 4J3NA 1GL9B 2ADMA 4CLDA 2DWQA 4M0LA 1JZSA 4IUBS 3PGA1 2EG9A 4EW2A 3GLFE 1U5AA 2HK9A 1N2CA 2WF9A 3DT8A 2XBMA 1R0KA 1O97C 4RTNA 5AIAA 3TGWA 2IHJA 3L1IA 3CQ9A 4BUJA 1DJNA 4FGSA 5ELXA 2PJZA 5B1YA 1XTSA 2Q9AA 1HKHA 1SK9A 3I1YA 4Q16A 1ITZA 1RPTA 4REOA 4DJEC 3HS3A 1JDSA 4N03A 3TBHA 1KJYA 4MW1A 5K20A 4B8WA 4A2QA 4K87A 2G9ZA 1FJXA 3IAS1 1BE1A 2QX9A 3EUAA 2EDAA 3KSMA 4G6ZA 3OETA 3RYIA 3U62A 4D3FA 3QI7A 2Q6VA 5ITVA 2K2WA 2IYZA 5LQKA 1NGSA 2Q0HA 2QTMA 1AV6A 3B6MA 2C4VA 4KLRA 1GSOA 3PGXA 1SY7A 1VJTA 2NSJA 2WFLA 4P4SA 5LUAA 2BTEA 1BX1A 2Z0MA 4ONEA 5F73A 4WJLA 3PDUA 3RJTA 3H5IA 3K0KA 1DNPA 3KUCA 4G1BA 3RS8A 1A9XB 1HORA 2PWYA 3DZGA 1DKUA 3GW8A 3QOXA 4OXRA 5JANA 1E3TA 3K9BA 5JATA 3BS4A 2FW1A 4DXDA 1NXSA 2C8KA 2H6EA 2J8ZA 2YTZA 3NIBA 2X6QA 2AFIE 2GMWA 3JWPA 3PQ3A 3VJMA 2CLFB 1M0SA 1W36B 1WZ2A 3H65A 1TU3A 4MCIA 4MPRA 4M37A 1NFFA 4NMHA 2ZBQA 2YJNA 3G88A 1CWUA 3NT4A 4HMQA 1WMEA 4AMZA 4B3FX 2PL3A 2B8TA 2WJIA 5MFPA 1KFKB 4ARUA 4DV1B 3LHIA 1ISMA 4JMLA 3NIGB 1E61A 3TW0A 1HT1E 1P4RA 2PN1A 3BWYA 5KVSA 4DV3B 4JEMA 1UL1X 5SZIA 1NSYA 4U7JA 4YV0A 3TQTA 2GYVA 1PE0A 3PC2A 4BN4A 5JXIA 4KO2S 1KMMA 3WHKA 4CIXA 5C1OA 1XX6A 5A02A 4WADA 2REQB 5IXJA 1TIBA 2R6GA 4BNKA 4C6TA 4DCUA 5JRJA 3ER8A 2ADOA 2GDJA 2QZ9A 4HGPA 4DG9A 3A0RB 2NP7A 1KJZA 4IH4A 5EJ6A 5IDYA 5HUQA 2GN0A 2OENG 1JJVA 2WW8A 4J9UE 3RWMB 5ARDA 2IX3A 1H0KA 3CONA 4M9ZA 1UDBA 2VYQA 2H92A 2A78A 2F1HA 5B5SA 3T4UA 3M2TA 4RL4A 1KRHA 3W9UA 4JGBA 2IWRA 4YRAA 5CDHA 3TLGB 2REOA 2IOHA 3NV9A 4ENQA 4EYSA 3DAYA 2QJFA 2W2KA 3E3LA 4IUDS 4DQLA 2WUGA 3E22B 2O8DA 4HPXB 5LZ2A 1JYEA 4ZCPA 1Y33E 4RZ2A 2NGRA 1PEDA 1GG5A 3D8SA 1F5NA 1HSZA 1L5HA 5JISA 1AN0A 1I80A 1R7RA 1JTVA 2ZDGA 3TPZA 5KQLA 3IO3A 1W9HA 2Z4RA 2B92A 4F8YA 5GVSA 1SHKA 5CP8A 1JHUA 4M0DA 2YUTA 4QJ4A 1U8CB 4X5OA 2E1RA 3DW3X 3HJFA 1ZWLA 3R4CA 3LPLA 4KNWA 4K9QA 1YUMA 3IUQA 3QNWA 4ID3A 1A9OA 1L4GA 3PRKE 5BNIA 3AHIA 2H07A 5F51A 5H9VA 4OLBA 3O47A 4RJIA 1DKMA 3UK7A 2DHRA 4QEDA 2O2SA 1ZD3A 3GFSA 3M9WA 5HF9A 1LY1A 2JK1A 2HZ7A 5G3YA 5H02A 3MWEB 1X7XA 5DNDA 4WY2A 2FPKA 3SKXA 3KR0A 2GEFA 2X0EA 1H8HA 2VCYA 4TXLA 1KQOA 5JD4A 2GWHA 4ZIRB 1L5GB 3SAJA 1B3BA 4H9GA 1B0UA 1HDIA 4HZGA 1THMA 3OA2A 3T54A 5I9SA 1CHNA 2FEOA 2Q2OA 2XITA 4O4HB 4V2UA 3SE0A 5JSKA 4EHLA 2PH5A 3EUEA 4IOKA 4FFSA 3NTXA 3VU8A 3X0DA 2XGSA 4IGEA 1OZAA 3UWDA 2PUTA 4CUKA 4D57A 4AWBA 3PUWA 1NF9A 3HABA 1P45A 3NKVA 4RYLA 5AM0A 5A3VA 4D4KA 3DWFA 4QWWA 3VVLA 3ADPA 1RQPA 2VYVA 1YDMA 2CMHA 3BULA 2ZETA 3WAJA 1KDTA 4B4OA 1T2EA 1NNI1 3DB1A 2C4NA 4LJRA 3TZLA 1Z08A 4UHDA 4I1SA 1AF4A 2QG6A 1J49A 2GYYA 2QLBA 2XH8A 3BMNA 4QKQA 3KDPA 2OKGA 3B78A 4FN4A 2EJBA 4MAMA 4PX2A 3I6QA 1G291 3H04A 5F7JA 3RVOA 3BUSA 2HIAA 4MV5A 2BDUA 1AQIA 5IM4F 1N2IA 5KQRA 5LMUB 4EGAA 5B1IA 1R5JA 4XD2A 5C18A 1S2IA 1OTHA 2C1EA 2PSJA 3DCYA 3UKJA 3VMMA 4CUJA 2A58A 1RYDA 2HY7A 4QD3A 3MA0A 2CDNA 3ZOZA 3R0QA 5HK9A 3DE5X 3TFQA 2WINI 2JI9A 1XP5A 3B9RA 2GASA 2VNKA 1WKVA 3QLEA 2I78A 3OTWA 2O23A 3BM5A 3W34A 3GEEA 1LBTA 3QOFA 1PK8A 4ZAZA 3T0IA 3AT1A 4ZHSA 1ECBA 2Z04A 3IBCA 1FTYA 4Q6WA 3QLJA 1E7RA 3FSJX 3PC6A 3S40A 3L8CA 1DE0A 2GFHA 5DOVA 3WIVA 2H54A 4JJ6A 2CNWD 3IDOA 5CEEA 1EA5A 1QQAA 2Y71A 3AF1A 2I2WA 1KI1A 2QL7A 4K0RA 1UH5A 1ZA2A 4H3SA 4HNAA 1DTWA 3ZNOA 1EFVA 1WV1A 4LC1A 3LQ4A 5IG2A 5IBRA 1KJ9A 2HGZA 4IXDA 3LKVA 4NP6A 3M0EA 1VG0B 3RWBA 2R751 5K0EA 3N59A 3VKUA 3R3YA 4B73A 2ZPAA 5HG0A 1P3JA 4QGGA 4HY3A 3CLSC 3RNLA 4MDEA 3VYTB 2QTBA 4IKEA 3EFOA 3CE6A 4RV4A 3PQ4A 4YWHA 1SBIA 2B36A 1ZAKA 1AMUA 3WX0A 1GYQA 2AYYA 2GZMA 3A3PA 5DHQA 5ECYA 3V4SA 2FR1A 1HEIA 1JIQA 1GNLA 1OT3A 2ZTSA 1AC5A 5EINA 4R1TA 2XOKA 3NOXA 1Y6RA 1U5BB 2Q8QA 1LVUA 5KS2A 3B3JA 3EC7A 1FXWF 2LCFA 5CHYA 1W47A 4LCEA 2BJHA 3KKQA 3OQ6A 4BNNA 2PS1A 4S04A 5H8WA 3PJRA 1OREA 1C1HA 1MDFA 2C2BA 5DW0A 4B7XA 3UUEA 4YJ2B 4XA8A 2L82A 1N9KA 1UFOA 1QH0A 4AX4A 3NYQA 1WOMA 4XH9B 4EARA 1GRNA 2OG2A 1K08A 1SVLA 3V8NA 1YRLA 2FB9A 5KO2A 1W0CA 2INGX 5C32A 5H4HA 5EQFA 1IZ9A 3SC2A 4DCOA 3LGSA 4XX0A 3IULA 4F45A 2IYYA 3ODGA 3FNRA 3IMKA 2CK3A 3A2NA 4AZ0B 1M66A 4C05A 1F38A 2R97A 2JAWA 2CCGA 3CLHA 5JQGB 3H86A 3I5UA 4YXWD 4QYMA 3Q9SA 1ZVKA 2LE0A 5LQUA 1YVPA 1AE1A 3RUEA 3AIMA 1Q77A 4IPTA 1GXSA 4TKVB 2HB6A 3S1AA 1CD5A 1DEKA 4AM8A 1MV5A 4JROA 1RAIA 2VDJA 2OGSA 2PX0A 5EE3A 3X1ZA 1XNQB 1YL7A 3HVUA 1AN9A 2SICE 1PJZA 4QTTB 2C5SA 3ZG6A 1V7ZA 2V7UA 3JQ9C 4FNOA 4C4OA 2HWKA 4W99A 3IURA 2NV6A 1WHSB 4R9RA 2O7NA 1U4SA 2AX4A 4MW4A 5HKKD 5TMBA 3HRHA 3W5DA 3KDAA 1M2OA 1KH3A 4G2TA 1S2LA 4DC9A 3S2FA 1T3GA 5FL7A 2HXYA 1U9ZA 4D81A 2GZDA 2BMEA 3K30A 2B1JA 4MV8A 3V33A 1UBFA 1KPGA 1KAQA 3KK0A 4JLAA 5HTKA 1TAGA 4CM6A 4CT5A 3JAWB 2A4KA 1JHDA 4IHKA 1Z2EA 1QU2A 1PD0A 5FTJA 4OOFA 1EG7A 3OOSA 2J32A 3DZFA 4KWTA 4RENA 4GUDA 4MV7A 13PKA 1GGMA 2DM6A 2V7BA 4HAOA 4KX3A 1DAKA 3WMWA 5BRJA 2CWWA 2X8JB 3IJPA 4C4YA 3Q9UA 1OF1A 4O4JA 3ME5A 2AOUA 5DM70 3IP7A 5ESDA 3TKAA 4E1AA 3QBTA 4RGYA 1TUGA 2E21A 4BWYA 2HSEA 3TD2A 3QU7A 1T4MA 5HVNA 2VPYA 2F4VB 2BHNA 2GTHA 2FEAA 1QC5A 1R27A 3QLUC 1G5FA 2IYRA 3A9VA 4NH4A 2AOXA 4R41A 4RZXA 4BQEA 4E5KA 3IO5A 5CLFA 2YQ4A 2CJFA 1S2OA 2PKXA 3CSUA 1R8QA 4H0NA 4QJBA 1T91A 3HHPA 1SOAA 4Q9IA 4YFYA 3I92A 1CVLA 3C16C 2AZTA 3LUJA 4MKXA 1Z6GA 4PM4A 3D8HA 5E7JA 2R62A 4BEJA 5C8VA 1VBMA 2B2XA 3QEBZ 1JHYA 3CLKA 3QVUA 1ZHHA 3DMPA 4MS3B 1QH8A 1W0KA 3F8SA 4NESA 2H59A 4PGAA 4DS3A 1D07A 3PIIA 4XTCS 3STXA 2BZGA 2LP4Y 3WLMA 2P0AA 1V16A 4J7CA 4PPQA 1T9GR 1COZA 2O1WA 2VP6A 2R6JA 4KJXA 3WK8A 3RRFA 3U5TA 3BMQB 3O8QB 4GP6A 1N1MA 2BFOA 3WBKA 1BWSA 1Y0BA 1CV2A 1MAHA 1R66A 5M7EA 5G0UA 2C9MA 2C84A 4RQBA 3L3BA 4BO9A 3L0DA 3N2EA 1F2VA 2IPNA 3C85A 3KZCA 1JIJA 2XGMA 1KY5A 3KTAB 4QG7A 5LB2A 2P5SA 4LZLA 2B0JA 4KMOA 4MKFA 3M4ZA 5AJXA 1MGPA 5KTMA 1OB5A 2TMYA 2EFCB 1XTVA 4HQKA 5AWFC 4CKXA 4BIIA 2D6FA 3ZDFA 5HR5A 4YMIA 4JYPA 4K9MA 4HWPA 3KZOA 4CQLA 3A4MA 5IT5A 1U94A 4NYIQ 2P1DA 3O3CA 1V8ZA 1MQ8B 4IDAA 4O1IA 4XYEA 5EUMA 1N77A 1TZKA 2A5FA 2IPLA 3C7KA 3FWKA 3G0OA 3ELYA 4IG9A 3ASZA 4Y9DA 4C20A 4DQXA 4W5TA 3JWEA 4KZKA 2Q0XA 1OPXA 3DOOA 3I2JA 2V3VA 1Q1ZA 3VPFA 3EF3A 4FSDA 3VNAA 5KYUA 1K5PA 3RC8A 1LPAB 3AJ8A 3KQVA 1JDJA 2HO4A 1M74A 3H2SA 1B23P 3NPAA 4YDRA 5FI0B 4O4HF 2XUFA 2BSXA 3TKLA 2P8SA 1UAGA 2Q1UA 4ZO4A 5CA1B 2XB9A 1O6FA 2WU3A 3HNPA 2YDYA 2ODWA 3QVXA 4QUDA 3BWVA 5JC8A 4JL8A 4YASA 1ODIA 5DZSA 1YS1X 3PXDA 2RI1A 4IHJB 4IH1A 3L8GA 1ANKA 3E8XA 4G85A 5KVQA 3QX8A 4UAGA 3AOEC 1RYNA 3H9UA 3HUDA 4IZOA 5K9ZA 5LYJB 2OMKA 5EWJB 1I4TD 3A3NA 4I5FA 3RFCA 3DMTA 1JLMA 1JV2B 2C29D 4R2WA 4B4DA 1UPAA 4F3TA 5A5FA 2RGNC 2RIRA 2XE6A 4RU1A 1QO9A 4OUDA 3UJ7A 4BQOA 4C43A 5BN1A 1VHQA 1YVDA 2EWVA 1TLFA 4FMDB 2Q6LA 2HWYA 1DARA 3HY3A 1FDVA 4JI1B 1QCYA 4OHBA 3I12A 2RHRA 2VUSA 3R76A 4BVFA 1OJLA 4GQAA 3GEPA 1E2NA 1AT1A 2DT8A 1J2RA 5SZHB 5EZSA 5JMWA 3KZ1E 4EEXA 4R98A 1J0CA 1X1TA 5EHNA 5TMPA 1DQNA 1DT3A 3DOEA 1VG8A 4DCMA 2Q4EA 2NUBA 1BEEA 2YC2C 4DLNA 5AW8A 1YVRA 3BK1A 2CCJA 3G2KA 5DNAA 3UYLA 1ZSNA 2YKGA 2XKAA 5ALKA 1II8A 1GAXA 4Q47A 1U2PA 4DR7B 5EPOA 3UFBA 3PLAE 5KTYA 4OQPA 4PZEA 2UKDA 4KYVA 4LOLA 4OXXA 5IAEA 3MBOA 4I4TF 4JUCA 4R8RA 3K09A 1T1IA 4UTOA 1MJHA 1GTZA 3EY4A 2NQ8A 1P9RA 3WGNA 4C5CA 1G5IA 2GJKA 1L5YA 1CX9B 4Y2GA 3UC5A 1I9GA 4YGYA 2O8BB 3VAAA 5KX5B 3KYBA 1N5DA 2PO5A 1A2OA 5GQSA 1A4IA 1XO1A 3W77A 2V65A 3EDQA 4H0FA 4NJEA 2E9SA 4G09A 3HDGA 4EPXA 4BVHA 4RY2A 4GRIA 2HBRA 4NDZA 3ANMA 4RVOA 4YACA 4F2WA 3WC4A 2KLBA 2O2CA 4WNYA 3MNFA 1T0UA 3Q40A 1BWRA 1H2BA 1HQKA 2QN3A 3TW8B 2ZJ3A 1UBOS 2X2OA 2XYRA 4KXQA 4F2HA 2CFOA 4XWOA 4OHYA 1SKYB 1MT0A 2V6MA 2XEDA 5CXSA 4EJSC 2D8AA 2CXXA 1ONOA 1A71A 1ADJA 1T0HB 1UEXC 1XZQA 2J07A 3DHYA 4M53A 4BFCA 4OX9B 2QG4A 4G5OA 2J9GA 1KRXA 1W44A 1YS7A 1GFIA 3ZHBA 4EPTA 3RFUA 5TQ2B 5MGNA 3FUTA 3OU6A 2HRQA 4WZZA 5GZ6A 3VBEA 5A6SB 1QAOA 5BN5A 5AVTA 2GRJA 5DBIA 2FSSA 3ZCRA 4WINA 5JQWA 3G2IA 1M6NA 1TEVA 2PMFA 3PFIA 1P7YA 4QIHA 2HMWA 3AR4A 4R9SA 4C7JA 1K98A 3DFKA 4JI5B 1F4PA 3O4VA 5H0IA 2B4KA 2PK3A 4NU0A 5EZQA 3SG0A 5TJ9A 2EQAA 3DAOA 2D54A 3F73A 3JVVA 2QL9A 5I51A 2ZCUA 5JQGF 2CXTA 3HU2A 3R1IA 2GBPA 1RLMA 2A14A 4YRLA 3ZHOA 2I2BA 3HCNA 2I76A 1Z0AA 1G3RA 3D6MA 1G21E 3HGTA 5U1PA 5JWOA 3TJMA 3S27A 2GESA 1Z45A 2H06A 3UOAB 1JEOA 4B4UA 4B6EA 4FJ2A 4YP5A 4KRFA 5CG1A 1JB1A 1S8FA 2F59A 2PX8A 4X3PA 3K6KA 3OH8A 2FZ4A 1NXPA 2BY4A 4YCLA 2FX3A 3M1IA 2B1IA 3UCXA 2YIJA 3KEOA 3ICOA 4F4UA 5C5EA 1A8IA 1AGYA 1ONNA 4M38A 4AKTA 5KTOA 1XWFA 5K3EA 4IQGA 1QF7A 2P91A 4AWAA 5IARA 1H4QA 1YKGA 5KOJB 3ZC3A 4B3JA 1GNPA 2XHZA 2PXHA 1Y3FE 5CFMA 4D9KA 1FIUA 2DR0A 5CYPA 4U0JA 1U2ZA 2R6DA 1TJ4A 2VUHB 3A9SA 4JENA 2QX8A 4WLOA 1D09A 1Y81A 4XJSA 5F4BA 3FHOA 3L6RA 1QQBA 4MUKA 1WU8A 4JLWA 2B8EA 4TMVA 4MIYA 4N0EA 2CB9A 4A4DA 1KTIA 1WQ3A 3ZDBA 3F9CA 4G8JA 4UTXA 1Q0TA 1T2VA 2VSYA 3M5CA 3PV0A 4IRUB 5FAKA 4EJFA 4GDMA 2ZE6A 4WLEA 3PICA 2NZYA 1Z36A 4XB6B 4LPKA 1WBBA 4JDUA 2VC2B 4N5MA 1YA6A 2I2FA 1JEDA 4KE9A 5I7OA 1FP4B 2VSXA 5LLDA 1N8SA 4PPFA 2JLYA 2PZKA 1N0WA 1Q7TA 3CRZA 2PUFA 5EE5B 4MWSA 3B1FA 3L0CA 2HJVA 5K3OA 3GRKA 4DLLA 5IJ0B 2Z2XA 4MP3A 4M46A 3SU8A 1CRWG 1U9IA 1D4OA 1H42A 1EQAA 4IILA 1RQ2A 5FBQB 1BE8A 3ZHYA 1V1JA 3W7BA 3WRYC 8ATCA 3E18A 1S2DA 1JPJA 3GRYA 4DKJA 1DAEA 5FLKA 2Q9CA 3GJ0A 1IBLB 4ZYXA 4KAXA 4N6GA 3GJ7A 1DFIA 3MD0A 5BVGB 3DEKA 4DMFA 3EIWA 1KOGA 4EO4A 1VI2A 4LYJA 1CJMA 2NVUA 3U3OA 5ADHA 5HIAA 1CT9A 2FV8A 2NU9A 3ACCA 4B17A 1IXYA 1GZ7A 3S2UA 2ODAA 3U3DA 4E08A 1OKKA 4YRFA 4MHTA 2P3SA 1KGDA 1NNSA 5GOZA 4EYEA 3OQPA 3WIBA 1EM6A 1N33B 3QFSA 3PC3A 1PQUA 2G3YA 3LH5A 5BOVA 1RIFA 1MX3A 2YJ6A 2AJDA 2PQ6A 3NAGA 3T4XA 4O8ZA 1MMFB 3DT9A 1WZCA 2GBGA 5D5QA 1BKDR 4Z7QB 2NO0A 3MPUA 5ALNA 5ESWA 1AB5A 1SA0B 1V25A 1ZK4A 3MAJA 2VHYA 4NDAA 4A73A 5HS6A 1WZNA 3EHDA 2JGIA 4NCAA 2WMYA 1CQWA 2H4FA 4M0KA 2CN1A 3GD5A 1VGQA 1LPBB 4XRRA 1JKJA 2WQZA 1U3WA 2YXDA 5FA8A 2F1KA 3C4JA 2NP6A 1VDMA 3INNA 2UYQA 4CM9D 1U65A 1T5LA 3IUMA 1II0A 1D1SA 1K8RA 4LOHA 3C3YA 3AYZB 1RHMA 2X15A 1WPXA 3EGDB 1ETHA 3OTGA 2AEJA 1KZ1A 5LZ8A 4D97A 3FR8A 1X6VA 3NIDB 4IHJF 3W6ZA 3FWNA 1G59A 3GZNA 4K9PA 2PSDA 1BW9B 1UWKA 1G4AE 1XB2A 5FI3A 5LYJF 4I5IA 4LWPA 2VTVA 3AZOA 1N6KA 3OCWA 4XB2A 2O7QA 1GA4A 3MBKA 4UASA 4YLGA 4LX8A 1BD3A 2CY0A 2XIJA 3CZRA 5DOZA 3WNCA 1RWXA 4ARZB 1VA5A 2WZCA 4NBUA 3Q88A 2O2DA 4PZZA 1UPXA 5IWCA 1L4MA 4BKQA 2GSDA 2CL0X 2AW5A 2QTCA 4NMMA 1G2PA 4MWTA 2YN4A 3DMYA 3HDYA 1PT9A 5SV2A 1UPBA 5HDBB 3EMDA 1YDWA 4E2XA 4JB2A 1OIXA 4QVGA 4AUNA 4YRBA 3COZA 5LP6C 1BMDA 1U0NA 2PMEA 4Q7MB 1U8YA 2JA2A 1E8MA 2GX6A 4MPPA 3W9BA 4L9RA 3O4RA 4ETNA 3FCAA 1AKMA 3KQHA 4IJWA 2Q46A 4FKMA 1V5GA 1RMQA 4AQYB 5K09A 4OXKA 1U0HC 3ER9A 2QSUA 4TUYB 3DZHA 3LUDA 3DJYA 4B3MB 1QHHB 4M0CA 2R0QC 1W4LA 3SDZA 4BNLA 5CX1B 2VR1A 4CKCA 4MQ5A 2QW0X 2N9UA 2ODTX 4W1RA 3S0JA 1FFXB 3H9QA 1K2WA 2NAFA 3ZBTA 4UM5A 4XGQA 3A6DA 3KX2A 1MDBA 3EUFA 6ABPA 2A1UA 2E49A 2QG9A 1F2UB 2PT6A 2H1FA 3LUKA 5EJGA 1D4ZA 1N2OA 4TWBA 1E1QA 1HFJA 1MF7A 2O7RA 5B4TA 1MJGA 3FMIA 5AR1A 4ACBA 2YS7A 4ZZIA 3J80A 1I4OA 3AZQA 2Q6KA 1F7UA 2ZYDA 4WBXC 1Y1TA 3W9SA 1N3BA 3AY7A 3PPVA 4PW0A 4MQMA 5FRDA 5TT0A 5JNLA 5IKPA 2OV4A 2PSFA 2JARA 1U7PA 2WT8A 3CUWA 2EKBA 1ULAA 1EP1B 3DEIA 2XRYA 3IVCA 4IJ6A 4LXQA 3SSOA 4LPSA 4J6FA 4MRAA 3RTGA 3CLTD 3JWJA 5EIBD 5L45A 4X0EA 2IS6A 4MGYR 3DCJA 4LTMA 3K2EA 3WIEA 3AHJA 2ZT6A 3VR4H 1N2HA 1YU6A 2JB9A 2R7NA 4JIMA 2OXEA 3GRFA 5J5VA 3V3TA 1QBKC 4R84A 2FQYA 4OX9Y 1N0UA 3K1AA 2FPMA 3BTUA 4REQB 3VNRA 3O31A 4UUQA 4FFPA 5BN4B 3TGLA 1L7QA 1FDUA 3C5CA 4BAUA 1GGFA 1NW9B 2ZSKA 2BKVA 4UCXA 3ZVLA 1I1NA 2ZYGA 3ESQA 5L51A 5EKXA 1DC8A 2BGMA 3D1LA 1ZK3A 1G0OA 3FNFA 1E3WA 3TAXA 2GEDA 4C7VA 4N5HX 4U7GA 3FVQA 4DJDC 1QUFA 3ETNA 4HXFB 4FDUA 2ZUEA 2G7ZA 1QCCA 1MC8A 4LJ4A 1J9EA 1PNVA 3HNRA 3PNVA 4WFKA 5BW8A 1XGKA 4HPJB 4WW0A 2QB5A 2CNOA 3IP8A 5CM2Z 5G2OA 5LQNA 5HUHA 5D3MA 5E3JA 2PD3A 2HCRA 2VF4X 2FE4A 4ZU3A 4XVHA 1A5SB 1KKMA 3ONEA 3GDOA 1YS4A 3W7VA 1YQTA 5THXA 1WXXA 1G6HA 5JSUA 3O21A 2YS6A 3CCCA 4L4ZA 1XNHA 1G16A 1VSTA 1CR2A 4UNPA 1VKZA 4KCGA 5CT5A 1ISHA 1CFJA 2UYGA 3PFWO 5HJ5A 5JNRA 1RC0A 3OP1A 1MJGM 4DLZA 1CR0A 3ZX5A 6AT1A 2P7IA 2P1RA 1H66A 3BCRA 1IBRA 3U13A 1G2IA 4X6LA 4YRZA 3IQGX 3PVSA 3GJZA 1XTUA 1T6ZA 1SZDA 2CMDA 4CG0A 4Y2UA 3JQ7A 3LSYA 2HWXA 4B0OA 2IEDA 1QLWA 4CQMD 1MQAA 1YB5A 5JCOC 3C43A 4PONA 1AIPA 1XL0A 1ZK0A 3RIMA 1TUBB 3ABQB 3K1TA 3N1UA 4ZZ0A 2QS9A 1G5HA 1UJNA 2CNWA 1XZFA 4X1IA 5ALMA 3GFQA 5ETJA 4EJ0A 1LF5A 1QG0A 4XIFA 1SOUA 4NAVA 3L4BC 3UG7A 4E13A 3CWZA 5DBEX 3QFRA 1MX5A 3AY0A 2GVDC 3AJEA 3BSSA 3MBIA 3VZBA 5FXMA 2EU8A 4BO8A 4P8RA 4HBZA 3H2HA 4UE2A 4D80A 3BTSA 4HTFA 1A9YA 4TWRA 1O6CA 2ATIA 2XMRA 2ZB2A 1P2DA 1GZ6A 3FZEA 1XK7A 4FCWA 3CNHA 1UP6A 2QROA 5DYNA 3PFFA 3VUEA 3VV2A 1N3YA 1V11B 1Z8DA 3I9NA 1ADGA 5D51S 3UAOA 3N58A 3RJZA 1SUPA 4KG7A 3DKVA 4HAZA 5DTEA 2B1GA 4EPRA 3WGVA 3WL6A 1Y9AA 3HJBA 5BSGA 2C7OA 2ZS7A 1L5KA 1HTTA 3EVTA 3P9KA 4WSOA 4ES6A 1UM8A 4DARA 1DKPA 2FSPA 1JFFA 3RJ5A 5C1BA 4YUAA 4GR5A 3OJ0A 5HX7A 3MRTA 3B9QA 3AG6A 3QFTA 3N9IA 4DGSA 2HWUA 1E6UA 2RGXA 5DI3A 1NM5C 3E1GA 3ORQA 3RSGA 3W0LB 2YXNA 3AUFA 1GL7A 1ZQ1A 3DLIA 3GUCA 4RUKA 2BFWA 4MW7A 5HF5A 2OHXA 2XZDA 1R0CA 4HDNA 4DYDA 2RH4A 3IEIA 3EVEA 3GFVA 4QU5A 1CY2A 1A2KC 1SHJA 4LMPA 4RVNA 4WK6A 5GINE 3A4IA 1LRLA 3EE6A 3MG9A 3KQQA 3AX6A 3SLKA 4YXWA 1ZNYA 3EXFB 5FULA 2Z5FA 2HW8A 1F20A 4MS4B 4IOLA 1QG2A 2ZUCA 5FPYA 4AF6A 1NVMB 1PSZA 1UT8A 2FZGA 2IPOA 4KXFB 1II9A 3UTCA 3VNSA 3O2JA 4BB0A 4DCGA 4ERXA 1N7IA 4PSUA 3ONVA 1AMNA 3DOHA 5CLHA 2APJA 3MJ4A 4F3RA 1POXA 1UPUA 1I2CA 3M1AA 2VJQA 1JLKA 1BVRA 1HLGA 2FETA 1IJBA 4QJIA 4PU0A 2MJLA 4W5WA 1XDDA 5HKKA 1OLXA 3TCNA 2CDCA 5F12A 2XUIA 4DC0A 1X7HA 1CE8B 2HF8A 1PO7A 4PLYA 1TF7A 2PS0A 1E2QA 1UBUS 5EGSA 3IVXA 1HDYA 3RFVA 4Z0TA 2CFRA 1U5CA 1ZXXA 2WG1A 1Y9JA 2PX4A 4FHDA 4FLMA 4WN3A 4J7UA 5TX7A 4UBMA 2H2IA 1CUHA 4V0LA 2RD2A 2DHQA 2ZJZA 3MWLA 4TTRA 2FEPA 1M0TA 4MWOA 1KIFA 2XUOA 3GMDA 4O63O 1X8JA 3ZH9B 1Q91A 3LKBA 4BEVA 4BNDB 3EFEA 3RHTA 2X3FA 1XMXA 1DT5A 2FCAA 3IUSA 4XXHA 5E0OA 2X1MA 3BCSA 5FF9A 3ZJ5A 2XB2A 3ZE8A 3S68A 1X7GA 1ST3A 4K8OA 4BX0A 1Y7TA 2C92A 3SZ3A 1L4KA 2QUHA 2KX7A 1JBEA 1XVUA 1J0EA 3K2IA 4ED9A 4L95C 4LBVA 4LIPD 4HEA6 2CSUA 3BPSA 3BJMA 3PYMA 5JSHA 3GUVA 5B12A 1YQ9A 4BNFA 3WLPA 1GUYA 1NW6A 5F77A 2W2NA 3I52A 4J90A 1WU7A 3D6NB 1Z4OA 2JJ2D 3KPWA 2PL5A 4ND4A 4TUYF 3O94A 4JXKA 4CTNA 1JDUA 5L6MB 2PFKA 4BDSA 1WQ4A 1NE7A 1Z0SA 2IF0A 4N47A 1E2BA 3EDOA 3H19A 1G3MA 4BV9A 1Q3KA 3ZZ1A 5TIIA 1JN0A 1QIDA 2Q1SA 1F5SA 2UUPA 3BWBA 3NC4A 3PDJA 3UAWA 1SU4A 3ZY3A 4B3RB 4GPTA 2JRLA 1U2RA 1HDCA 2PLNA 3UMCA 1GV1A 4WASA 1NU8A 2YZNA 4X9XA 3QMVA 3PQDA 6YASA 2Z5GA 3B6IA 5WRFA 2I7TA 2WTXA 4HUQB 3LQKA 2YWFA 4EFDA 2A5YB 3IDFA 2QIOA 1HDOA 4DPLA 2KW5A 2VHTA 2YHUA 5CDUA 3WE7A 1J2TA 3FHLA 5AVKA 4E31A 1V8OA 1ZUD1 2PFSA 3G23A 4MRRA 2D7CA 1C8VB 2DC1A 3O8BA 5F5XA 3L8ZA 3RAPR 3X44A 3QK7A 1CZHA 1ZJYA 1SUWA 1VMIA 1BJKA 2RCYA 3AINA 1G60A 3QVMA 4PRLA 2A2ZA 5AQ1A 5CVDA 2SBTA 3FUVA 5INTA 3TQRA 2GF0A 1W5BA 1NP6A 1YQGA 1N2SA 1REQB 1W96A 2X5XA 3QKUA 4YQYA 4C3UA 4E3WA 1I5OA 1B93A 4I9HA 5BVHB 3LX5A 5JRZA 1ACJA 3WMRA 1H69A 2F3QA 1T25A 3D6AA 3TVDA 1AF7A 1ICIA 2GCEA 3VKWA 4OHXA 1USVA 3VR2A 1GN8A 2WWFA 4OUKX 1IZYA 3ZWOA 4AMYA 1IYZA 2A7QA 4DTIA 1I0LA 4UNNA 5LDHA 8MHTA 1R8YA 5KZMB 3PA8A 1XTQA 1GPMA 5EERA 4EB6B 5IASA 4UVIA 3PXGA 4HDKA 3SVLA 4JT8A 2XUDA 5E6SB 4RSRA 3CHYA 1I10A 2XOEA 1X9HA 2JBAB 3F6SA 4GU5A 3CF0A 3FWPA 4WBNA 1YJXA 2Q45A 2XCSB 1Z7GA 3UWPA 2OHOA 1IHPA 1YVUA 2P5UA 4ZAWA 5FA6A 1MNQA 1F7VA 5L7TA 4GVPA 2QN6A 2ZRIA 2PA0A 5EXPA 4DMCA 4C6SA 1F4VA 2DBRA 2I6TA 4MGHA 3KLPX 4XWAA 4ZC8A 4TL9A 3OZVA 3PNKA 2J3HA 1P77A 4GM4A 4O5AA 4PQRA 2QBYB 4MYDA 5DM60 1DLIA 3C74A 4Y30A 1M8KA 2NUPA 3ET5A 2GCGA 1XDUA 2IU6A 2VQ3A 2OQVA 4ESVA 1ZGAA 5ICEA 4HQ6A 1KERA 3C5EA 4ZGBA 2VK4A 1BJRE 2Z5VA 1JA1A 3GFGA 2SHKA 2OSVA 4MGKR 3ZZNA 4MJ3A 1RWWA 3JCZA 3BEOA 3I64A 2OKCA 4KNVA 2NTEA 2QQEA 2H8KA 1ZKMA 2AFRA 4MKGA 5TV2A 1PLJA 3TRHA 3V9AA 1YACA 3MRVA 3VOTA 1R6XA 2JIDA 4ESEA 2Z2IA 3CNBA 2XTJA 4BV2A 2XVYA 3ENWA 1GR0A 2GD0A 2J0UA 3AR6A 3OOEA 1CUJA 2BC9A 3CNOA 2A88A 3CEMA 1JEAA 3ENQA 2W2LD 3NTUA 3DQPA 4HLNA 3QYAA 4O0LA 4R7ZA 3ZHTA 1TU4A 5JIBA 1Z0ZA 3WIDA 1P1KA 1DHTA 1YK1A 1DWUA 1WMSA 1A96A 1KBQA 2MCFA 4PBRA 3VRHA 4CMIB 1CVIA 4BP8A 2XADA 4MVJG 2FXVA 4MQEA 4QYIB 4RDCA 2GK6A 1Z5NA 3CO0S 3EQ2A 4P3NA 2WKSA 4TN1A 1Y9DA 2GPAA 4XLLA 4JXZA 1A8HA 3RVQA 3KG2A 4C06A 1D1PA 3VVMA 4BFWA 1ADCA 1R00A 1RBYA 1V3UA 4DZZA 1YR2A 3ANLA 3LQQA 2BWJA 3NEJA 3DF7A 4IVRA 3JQDA 4WMLA 1E18A 1FMJA 1YQEA 4DSUA 2RJNA 2D7DA 2XDYA 2PX5A 5DHPA 4A0HA 1N2JA 3DQZA 1GUBA 3JAKA 4I4NA 4RW0A 5KJCA 4NFSA 3M2PA 1P18A 4MK4A 1Q0QA 5JPDA 4PHHA 2IHZA 3VH1A 1YDFA 3SZLA