2PZEA

Minimal human cftr first nucleotide binding domain as a head-to-tail dimer
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
228
structure length
226
Chain Sequence
SLTTTEVVMENVTAFWEEGGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCSQFSWIMPGTIKENIIFGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLDFSSKLM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cystic fibrosis transmembrane conductance regulator
publication title Structures of a minimal human CFTR first nucleotide-binding domain as a monomer, head-to-tail homodimer, and pathogenic mutant.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 76
structure length 226
sequence length 228
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2pzeA00
3A8TA 1AN0A 1JR3D 3TBKA 4JKYA 2QAJA 4M9ZA 3T15A 3WYGA 1L4UA 4HYYA 2GBLA 3CNOA 1R5NA 2BBOA 4N1AA 1A5TA 3AF3A 4M0LA 4P4SB 2ZRHA 1N6OA 2RCNA 4TLBA 1SVKA 4F92B 1U2RA 4TYNA 1EFRD 5E4FA 3WNDA 4PXAA 4BGDA 1P4SA 4KLZA 5FOWA 2GCOA 1NLZA 2C99A 2JIZD 1E1RD 2QN6A 5FUVA 3IPXA 1N0WA 5IK2A 1U81A 3O8BA 1YHNA 1YZUA 4AURA 2C03A 1VKJA 4IRUB 2CEAA 2VSOA 2Z0MA 4PTLA 4I1UA 1QG4A 2QM7A 4M2LA 5KSOA 3KTAB 4RVCA 4M8NE 4PAQA 4D6PA 3SN6A 2SHKA 3W9YA 1W1WA 2CCKA 1H65A 1H8EA 1NRJB 3FVQA 3QG1A 4P4TA 3SBEA 1WBDA 3NBXX 3LV8A 1D2MA 1YZQA 4IVPA 3RVBA 5FR1A 1TU3A 1X3SA 4TQUS 4XH9B 5BXQC 1XB2A 2JCSA 4PHFA 3C4JA 1KGDA 1Z2AA 2AX4A 2B21A 2GNOA 2ZAOA 4B3GA 1TNDA 1S3GA 1AIPA 1NMYA 1E9DA 2BEKA 2ATXA 4LI0A 1II8B 2ZROA 3LH5A 3Q7PA 5UKDA 4GMXA 2UZIR 1CJVC 5JS7A 1GNQA 2WJJA 5KSPA 2DPXA 2YOGA 3GJ5A 2WJHA 3NBFA 2UZ3A 2QSYA 4DLVA 5FL7A 1P2VA 2ZRNA 4ACBA 1OXTA 1S4QA 1ZBDA 2J0VA 4DSOA 4LBZA 3O8RA 5D3QA 2CHVA 2XXAA 2X77A 1HH4A 5JWRA 5JJIA 3SYNA 5JRZA 1D6JA 1GL9B 4D0NA 3X1DA 2ONJA 4UXHA 2J0UB 1E4VA 3TUIC 1UJ2A 3THWA 1QHYA 3FPAA 4LJ6A 2GEDA 1QHSA 2ZVQX 3AB3A 4LHYA 2OT3B 1TTTA 2WJGA 2ODNA 3TR5A 1G8YA 1P72A 1DG1G 2OCPA 4KFRA 3JZAA 2AK2A 1CULC 5HTKA 4QBFA 3ZVLA 4X8HA 1VYVA 4BZPA 1R5BA 3RANA 3EWAA 3AEZA 3A37A 2ZYUX 3G82C 3N5CA 4A1FA 1SVIA 5FTMA 3GLHA 1RJ9B 4BFSA 2BMDA 3H86A 5TY0A 3SEAA 1XCMA 3BGWA 3TKLA 1COWA 2ZRGA 2VPPA 3JVUA 3FMOB 1G6OA 4PFSA 4BLSA 1GVNB 2EWVA 3QKSA 3F8TA 2P5SA 3RAPR 4ZDKA 5FPTA 3A1SA 3S1AA 3WMGA 4NL4H 1Z0IA 1OIWA 4Q4HB 3EARA 3GJ4A 1Z3IX 721PA 4AYTA 3ICQB 1DAMA 1W36C 2BMEA 4DEXA 4Z8XA 1T3HA 1JEDA 1UDWA 4FWIB 2F55A 1JAHA 1LNZA 2EFHB 3BK7A 3OIWA 1N6LA 2WJIA 4HZIA 2VH5R 4LJAA 4OHXA 3ZS8A 2DFTA 3FKSA 4YMTA 3PUYA 4TSFA 2FFBA 5FBLB 2PZEA 2ZR0A 3BFVA 3ADKA 5FTLA 2H5EA 1KY3A 1GL6A 2QE7A 3BFXA 3SNHA 1IM2A 2ORWA 4ZIRA 1QG2A 2XTNA 5AUQA 4H1UA 1UM8A 1KK1A 1COWD 1Z6AA 1VCMA 2ORVA 1SHKA 2WIAA 3A1VA 4RCZA 4ZKEA 4TZ6A 4GDFA 1HT1E 1U8AA 3THXA 1IN5A 2VHTA 1AGPA 4D82A 4X8OA 5LBIA 3NEYA 2VSFA 4XSGA 1OXXK 5J4LA 1OH5A 4BLQA 2BWJA 2YWEA 2J1LA 3W90A 3L43A 4WZ6A 3GJXC 1SXJC 1ZCBA 2IYLD 3RS7A 5H1YA 5FPYA 1RFLA 5C4GB 5AUOB 4LWZA 4PANA 2JLUA 2QM8A 6Q21A 2BHRA 1IXZA 2QZ4A 4TSFD 5E7IA 3RS4A 3NEJA 4TMWA 1IN8A 2VHQA 3GCGA 4EAQA 1G3MA 3CRMA 3AVXA 4KJZA 2H17A 1TEXA 4GP6A 4Q7MB 2REBA 3QJYA 3TRFA 2YHSA 3QF4A 1OW3B 2AXPA 4Q9IA 1HV8A 2ZSBA 1KOFA 1IY0A 1EFTA 3TUZC 1HY3A 4PPNA 3I1FA 3IKJA 3X1ZA 5CITA 4Y0AA 2PEYA 2NOAA 4CEHA 4LJ9A 2Z5FA 4TT3A 3X1YA 4ASUA 2GCPA 4A82A 4C4PA 4ESVA 1ZINA 5FOTA 5JWOA 1NVUQ 3Q9LA 4XVRA 1IHUA 1YZTA 1AM4D 3BORA 4PSAA 4ABYA 1G8GA 3CH4B 4P33A 3WHLA 3GJ0A 4RD4A 3GLGA 4EJSB 2BBTA 4GOKA 1ODFA 2FOLA 3VR4A 4X8MA 4HAXA 4ACAA 2E9SA 2BJWA 4B2IA 2REXB 5EXTA 5KPDA 2CK3A 2ZI7A 1MO4A 3HPQA 4GMDA 5FTNA 1EESA 821PA 1QHHA 4V03A 3ADCA 3NDBB 2G9NA 4DDTA 1T3LA 3U6KA 4Q48A 1Q22A 1IJFA 3C15C 4EPXA 2YNMA 3I5XA 2H18A 4W9MC 1OJLA 3WNBA 4P4SA 3EIQA 1W44A 4GL2A 4I1SA 3MUFA 1GKIA 3L0IB 3PUVA 4QFMA 3GLGE 1U8YA 1VMAA 5TB5A 4FIDA 1LVGA 2QROA 5B64A 4D0GA 3CRRA 1Z28A 4IVQA 2C9YA 3NBYC 3E70C 4QNRA 5FPSA 4DT1B 1NVWQ 1XTQA 4LK2A 2XNDA 4RFVA 2CK3D 5GJVC 4DUGA 2ATVA 1VECA 3I72A 2PJZA 4B3FX 1MO3A 2JLVA 3LNCA 2MMGA 3TAUA 1D8TA 1W48A 4LY6A 1ZUNB 5G40A 3MSXA 2OM2A 3T06B 3AUXA 1XMIA 1ZM7A 5A5GA 3AGPA 1TU4A 5HR5A 4BFUA 3K0FB 2WWIA 5FFMA 1SGWA 5BN3A 4ZPXA 1AQYA 1ZIOA 2F1RA 1N6KA 4Q1AA 4WVFA 2V9PA 5BYKA 1Q1QA 4BEBA 2CVFA 5DHAA 2Z4RA 1AKEA 3TE6A 5J4VA 1W2HA 2WPDA 2IF0A 1E99A 1II8A 1ZM9A 5J40A 1GRNA 3E5HA 2VF8A 4IDNA 4DUGD 1HQYE 1NBMA 1N5KA 5AJXA 3D8BA 1XFAA 2PX0A 2J59A 1TQ2A 3EZ6A 3W3ZB 3UATA 2QL6A 5KYKA 1G8PA 3P26A 1J99A 4B71A 4HLDA 1E0KA 1KHTA 4IHQA 3KQLA 2IEYA 1VCOA 5BW8A 3O8CA 3AP3A 4TL6A 4JLPA 4OQLA 3B85A 3KQHA 4AY2A 2J0UA 4J0QA 3L0SA 3CNNA 2FX3A 2CHGA 2BMFA 2FF7A 5GJWC 4TN1A 3TR0A 2P5TB 4CGZA 2P6RA 1DAGA 4DSNA 5JJKA 4L15A 1NBME 1XPRA 4MH0R 4UNPA 5B58C 3EPKA 2F1IA 2AN9A 1VG0B 5EZ6B 3IO5A 3IEUA 4F4CA 2ZYVX 4FMDB 5H8WA 1A7JA 2IL1A 2OAP1 1FX0B 4AG6A 4A2QA 2OG2A 2PJRA 3QOFA 3I92A 1PUIA 3CX8A 4GT1A 4KYIB 4QGFA 5AJZA 3W5IA 3OAAA 1RJ9A 4OK5A 2N1BA 3MWYW 1XJQA 3QXHA 4QL3A 4TTPA 1E94E 1JXOA 3AV0B 1OSNA 2IX3A 4KO8A 4O25A 2ZREA 1G3QA 1VG1A 5DI3B 3GP8A 3MRSA 2VIIA 3T34A 3TQCA 4DXAA 1VG8A 4EPRA 2AD5A 2OCBA 2E1RA 2XSZA 2R8RA 2ZRIA 2ZJ2A 2JJ2A 3K9LA 4Q4HA 4XWKA 3I5YA 2J3EA 2GESA 1CLUA 1NLFA 2BKUA 2ZRBA 1NY6A 4M22A 4IOJA 3AP1A 3OFNA 4I1OA 4Z51A 1E2JA 4WBSA 4URUR 1JI0A 5DN6A 5K8IA 1GDDA 3A36A 4B6FA 2ZE8A 4B47A 2ZR9A 2J0QA 1EWQA 2W58A 3UMFA 3ZVMA 4YDSA 1KO5A 5G53C 4QC2A 4A0HA 1N0UA 5KPJA 5J4HA 4V0NA 1RRPA 1KKLA 3B1VA 4M1OA 3BERA 1VHLA 3BH0A 4Q1CA 2CL7X 3CWQA 3RRYA 2IYRA 2IBMA 3T61A 3ZZTA 3GLIB 3VQTA 3BXZA 1GAJA 4G0NA 5KSZA 3BOSA 4BWYA 4JZKA 2CBZA 3EAQA 1G4UR 3AH8A 1NJFA 2ZJYA 4EPWA 1SVOA 2A9KA 2OBMA 4RJLA 3UWOA 4NYJQ 2AHOA 2G88A 4G5QA 5DN6D 4I1VA 2IYQA 4IDHA 2BBSA 2IF2A 3UG6A 3TSZA 1KO1A 1Z8FA 2QP4A 4JBYA 2HUPA 2VP2A 1VDZA 1CEEA 4PC7A 1MR3F 2XITA 3U4QA 3A6PC 4AKHA 4TMXA 3TW8B 2PT7A 1NN0A 2HLDA 4R98A 1CJTC 3DZDA 5CYOA 2WV9A 1EX6A 3I4LA 5GJBA 1FL9A 1JQLB 1M7HA 4BZXA 3ZD7A 3OESA 4QGGA 4QBIA 1ZC3A 3C8UA 1OLOA 1FMJA 2ZRAA 2GF9A 2AR7A 5HKKA 2X2EA 2B8WA 4US0R 4NONA 4EJSA 2ZS7A 3FTQA 4LC0A 1IN4A 1G64A 4JVMA 1P9WA 3VKHA 2HYIC 4URVR 3R9XA 2ONKA 2QNRA 3KKOA 1A1VA 2RHMA 1KDOA 1N5IA 3OZXA 3V4FA 1OH7A 1E0AA 2F43B 1KYIA 1QBKC 2HLDD 1XD8A 1N6NA 1GKUB 1X6VA 1RIFA 5BN4A 3QPWA 4Q7KA 4F93B 2LKCA 2WSSA 2FSIA 2FA9A 1OPXA 2GXUA 4LYAA 3TK1A 4RZ2A 1DAEA 1GP2A 1MH1A 2BMJA 1HYQA 2R44A 2G1JA 3VR6A 1NLYA 5A4JA 2JLWA 1YU9A 4B2PA 4UJ5A 1E2EA 4CVNA 2DFKB 4JVNA 2AL7A 1GZSA 1M7GA 3HWSA 3W8NA 2B92A 4KITB 4BFXA 2PEZA 5KOYA 1W2GA 4M1KA 3MWKA 4V02A 1Z0KA 2EU8A 4D2IA 4DT1A 2PLRA 1JQJC 3QF7A 2CHQA 4XVUA 4AI6A 2FFAA 1M74A 1UADA 3WRXC 1FQJA 5M04A 5DI9A 3RWOA 3T1VA 4LBYA 5LD2B 1OFUX 1WBBA 4NYJR 3KX2A 4WOPA 2WSSD 4I4LA 4HAYA 2QAGA 1R10A 4WXPA 4R9UC 1GRRA 4TQ9A 4F4IA 2W2TA 4U00A 3B9PA 3K0FA 4A8JA 2OFXA 1ZUHA 4R71A 2FPLA 3B5JA 3KQNA 1RRGA 5CIQA 1E9CA 4G3XA 4P0TA 3QXCA 1II9A 2W6IA 2ZE7A 4LHWA 4TYPA 4TL9A 5CM9C 5EUMA 1RRCA 2FSGA 3FYHA 1XJCA 1BMFD 2MSDB 3AF2A 2AFIE 3U7GA 3MFYA 4L16A 3DKVA 1NNEA 4Q01A 3QVUA 1V5WA 1VYUA 3NHAA 3BD9A 3K0AB 1ZMXA 3X1WA 2CJWB 1NKSA 2ODEA 4RZ3A 1VTKA 2VP9A 2CL0X 2Q9CA 5CB6A 1A82A 1S96A 3SU8A 3FHTA 4HUQB 2GAAA 4IOLA 1U0JA 2WAYA 1XEWX 3QI2A 3L0OA 4FINA 3CPHA 1YRBA 4NCNA 4Q03A 5EJEA 4QBHA 3RWMB 1YJ5A 2EVWX 2ZS9A 3NIBA 2G83A 3DEFA 4PHHA 4B44A 4UQOA 2C95A 1FPMA 5HZKA 4GZLA 3UANA 1II0A 4URWR 1EK0A 5HZHA 2R6GA 2QT1A 1YQTA 1ETUA 3EPJA 4RZXA 1PZNA 1FX0A 2CE2X 3KFXA 5K8UA 5L3RA 2AKYA 3FMPB 5KNBA 1DPFA 2YYZA 4NP6A 4TMKA 5DO9A 3R7WB 1E32A 4BZQA 1EX7A 2NGRA 1OE0A 3ETLA 1AZTA 2WKPA 4JL8A 4QJ5A 5DI3A 1DO2A 2G0NA 4IW3B 3A1WA 1FNMA 4OHWA 2Q6TA 3M6AA 1KI7A 2VBCA 3EZ2A 3ZVRA 1NG1A 2ERYA 1R2QA 1ZU4A 4ON9A 5G3YA 2WTUA 1Z63A 1GRQA 1NJGA 5KDLA 4CIDA 4UJ3A 3J81k 1T9HA 1E6CA 2JAQA 4IDOA 2P0EA 1X8LA 1UBGA 2ZRKA 5TXGA 5IHPA 4JLMA 3RC3A 1LV7A 5AUNB 2F3RA 2RGNA 5JS8A 5JRJA 5JJLA 2OLKA 1YR9A 1E1RA 1Q57A 3P20A 2NQ2C 4JL6A 5TV2A 4DLRA 2O0HA 3HR7A 2V4ZA 1P62B 3MGCA 4PX9A 1QHNA 1XTKA 4DKXA 3DKPA 3HPRA 2WBLC 5TMPA 2QQEA 2C78A 1QHHB 3GLIA 5AJVB 2Q21A 2IYVA 5EUQB 1EGAA 4IOMA 1RW4A 1CP2A 4JLDA 2QU8A 1XD2B 3KJGA 4QJ3A 3K0EA 4Q7LA 1BYUA 3TVTA 2IYWA 4B73A 3CBQA 3PR1A 4TQAA 1W4BA 1OH6A 1TF7A 1U8ZA 4C0LA 2GJ9A 2C98A 3LBNA 4L9WA 3VU9B 4MYTA 3KQUA 2D62A 4BE7B 1JB1A 2RB4A 4DCUA 1N6HA 4MKHA 4B43A 1JAIA 3I32A 4WIAA 1XZQA 3U44B 3KB2A 4IDQA 8OHMA 3GLIE 3UWKA 3NH9A 3TUJC 4PAMA 3B60A 2KSQA 3T12A 2H16A 4PPGA 1RYFA 2HDNB 1M2OB 4Q5IA 4W5HA 3EPLA 2J9RA 1FP6A 1KMQA 1NIJA 2QUZA 4DRZA 2ZUCA 2GEVA 2A2ZA 1WB9A 2P3SA 1L4YA 5FBVB 2WWWA 1WXQA 2GJAA 4IJMA 1E69A 2CE7A 2A5DA 1DARA 2NO9A 3QEJA 1E1QD 3UXMA 3T1QA 2BVNA 2C04A 1ZNZA 3QQ5A 1F2UA 4FD2A 1NN1A 1YZKA 1U90A 3VNUA 1E9EA 2F43A 4HDCA 5E7JA 1EFUA 2ZSDA 2ZIAA 1XTJA 4DCTA 1Z6TA 3RSLA 2J46A 1UKZA 1W4RA 4DCNA 4UNSA 2HT1A 1WMSA 3OIYA 1KY2A 5HE9A 1G6HA 4TWZA 4D80A 2OCYC 2EQBA 4HDOB 3BB4A 3SBDA 3LQQA 2QRZA 1AGRA 2F3TA 1LW7A 1AKYA 1S2MA 4P32A 3B6EA 1OB2A 4TYYA 1GL7A 3REGA 1N3BA 3IEVA 1KJZA 2D2EA 1XP8A 2ZUDA 2D7CA 1S0UA 2ZU0C 4LHXA 4PHTA 2YOFA 2HF9A 4G5SA 3ICEA 3MWLA 2O8EB 3H0KA 4D4KA 1XBTA 5HCIA 3B82A 3LDAA 1OF1A 1ZD1A 2E87A 4Q1DA 2FEOA 1CU1A 3Q7QA 4OL0A 4DEYA 5IRCD 1KI4A 3RYTC 3FMFA 3CR8A 3U7EB 4EJSC 1I4LD 2IC5A 3SDZA 4TL8A 1ZNWA 5DLQC 2AD1A 5JFGA 5JHHB 2UKDA 1G16A 4ZCMA 2Q9BA 2ZI3A 4GFDA 4GI7A 3SJBA 1Z0FA 2FU5C 4Q4JB 4L5BA 1B23P 3CF0A 1EXMA 1QDEA 1XJ0A 4FI3C 3QE0A 1WA5A 4DDWA 2WWYA 3KUCA 1G3IA 2VHCA 4KCGA 2RGEA 4B33A 2O8BA 2A5YB 3HR8A 3K0AA 5EE1A 2CJWA 5DE3A 3SHWA 2GJKA 1AS0A 2AKAB 2DR3A 1U0LA 4HUQA 1T6NA 5DH9A 4BEJA 5J47A 4KBGA 2VP5A 1YR6A 1E4YA 1M8PA 3R9IA 4QXAA 1JPNA 1O3YA 3B7GA 4LGMA 4DLSA 4OJKA 2O5VA 2GEUA 2QMOA 2OAQ1 2CNWA 4E09A 1PLJA 1AS3A 5EXSA 1Z5ZA 4B76A 1ELOA 1KK0A 1X1SA 2OO7A 3BIFA 2ZJZA 1HQCA 1ZJ6A 4O3MA 1E9SA 1XWIA 2IYXA 4IEIA 3FOZA 2A5JA 5EP1A 1XXHB 2QMHA 3W8RA 4AK9A 4CDGA 2V8OA 3E2IA 1LTQA 3EXAA 2QAGC 4EQ6B 4TLCA 4ZV4A 2FWRA 2QI9C 3DHWC 3O47A 1P6XA 2ZJAA 4A8JC 3R7WA 1HA3A 1E0JA 2NZJA 2YINC 2Z83A 2FSFA 2W0SA 5EE3A 4TLDA 4KODA 3QEOA 3U4QB 1GWNA 1FTNA 2VF7A 3C5HA 2Z4SA 5EXPA 2CNWD 1GNRA 3D3QA 1P5ZB 1G41A 4LBWA 1HT2E 4WZBE 1E79D 2BDTA 1JEEA 3R20A 1DELA 4MUBA 1RZ3A 2IXGA 1HE1C 2XTZA 2I1QA 3CKLA 5C4MA 2ZI6A 2VP0A 4OK6A 3D7MA 4WA7A 1S9HA 2XJ9A 1OXUA 2QTFA 4LV8B 5DISB 3AP2A 5KU1A 5GADl 4FMBB 5P21A 1KDTA 1ZM4A 1Q3TA 3L8ZA 1TADA 5E95A 1VCIA 1G7CA 2Z43A 4MKGA 5AJYA 4BLTA 1TF5A 1C9KA 2F1HA 1N0VC 2C9OA 1IY2A 1OIXA 2ZAMA 3BRWD 4Q18A 4R2IA 3TAHA 2YKGA 1A2KC 2XOKD 3U7HB 1E2NA 1OIVA 2YWFA 3DMNA 1TX4B 2VHJA 2JLSA 5FI0B 4H1VA 2ECKA 1DO0A 3RS3A 1Z08A 3SI7A 4NMMA 2Y8EA 2ZI5A 1ESNA 2ODWA 4DB2A 3E1SA 2PBRA 1FNNA 1XD2A 4EPVA 1IXSB 1E2MA 4RKEA 3W34A 1FUKA 1QHXA 3TGPA 1TMKA 4DIDA 3F0TA 3VU9A 2ODBA 1S3SA 3NTUA 2YC2C 2MSEB 3DM9B 4C2TA 2ZRMA 3UMSA 4JL5A 1BH2A 4MGIR 3KDSE 2WKQA 2ORIA 3BB1A 4II7A 4BPBA 1G5RA 3U44A 2J5XA 4BFZA 4NZYA 4LC1A 3BB3A 3CRQA 2V54A 3GEIA 4HI0E 4JVLA 2RKOA 2BM0A 1XEWY 1TAGA 2GK6A 5FBWB 1UKYA 4UXIA 5DSZA 1R0WA 1F60A 5D3MB 1W46A 3CUEF 1NY5A 2QAGB 4JJKA 2JLRA 3TW4A 4A0RA 4UKDA 4F91B 3K70D 4B2LA 1E2GA 2RGNC 4NCIA 4A8JB 2B8TA 2JLZA 4M4SA 1IY1A 5KNDA 4GRAA 5CK4A 2B6HA 2V7QA 1WP9A 1RC8A 2DFLA 2RMKA 3U2QA 5SZKB 3PITA 3U61B 1OKKA 1KNXA 4KLNA 2ZYTX 1VYTA 3TNFA 4KXFB 2X1VA 1F6BA 3K1JA 1FZQA 1Q21A 2P6UA 4MYCA 4ZCIA 2XTMA 3FFAA 3LO5A 3AQ4A 5E3HA 2JASA 2BCGY 1QHGA 2NO1A 1DS6A 2A30A 2HJVA 4JSYA 2H7VA 4IXMA 3AF4A 4G5GA 2C9CA 2LWIA 3GFTA 2QORA 3TH5A 2VP6A 3WXMA 3IBYA 4DBLC 4WAUA 3TMKA 1HE8B 5KUTA 2A78A 3LVQE 4C0QC 3IO3A 3L82B 1KI8A 2XZPA 2BBWA 3ZLJA 5JBQA 5LPNA 3KZ1E 3OIVA 1F2TB 2V7QD 2WZQA 4E22A 1ZAKA 5C1BA 2OFWA 1OKKD 2FDCA 1QVAA 3TIFA 3AVOA 2BKEA 3DZ8A 2D7DA 3DM5A 2J0SA 5KDDA 3CIOA 1G9XA 3GD7A 1X8JA 4LOAA 4DLXA 2XB4A 3C5CA 4XIGS 2NG1A 1E2KA 2O8EA 3FHCB 1R7RA 2VO1A 5JZVA 1VIYA 3H1TA 1H8HD 1KIMA 3GEHA 2KJQA 2GCNA 5K8TA 1CJKC 3QSYA 1N6PA 3Q3JB 4QG7A 3SJAA 4OQNA 2ZRCA 1W0KA 5FH9A 4LJ5A 4YXWD 1Q12A 1YR8A 5AUPB 3QKUA 2VRWA 2GJ8A 2QPOA 4EFLA 4PR0A 221PA 2IXEA 4TMVA 2HT6A 4BFTA 2DHRA 4Q4JA 4B3CA 2C8VA 3W6OA 5DYGA 4A0GA 5H68A 3KUDA 4LPSA 1MRNA 2VEDA 2ZTSA 5FUWA 1XD9A 1G7SA 4IEEA 3VHXA 1Z2CA 2ZI9A 4BRWA 4LYJA 5TARA 2XAUA 1QVRA 1ZUIA 2AWNA 2HCBA 5AR1A 4ESHA 4IOKA 2OE2A 4QOSA 4L9SA 1W0KD 4MYUA 1RYHA 1KO4A 2KI5A 2ZVPX 1CR2A 1K8RA 4MRNA 1Q1BA 2J87A 5A0FA 1LS1A 2D06A 2FSHA 3CO5A 4JLVA 4QHSA 4E03A 3CZQA 3NC1C 1TUEA 4UNNA 1YKSA 2IYTA 3IHWA 2DY1A 1U98A 4OHVA 4RD0A 2YVUA 4V0OA 3NDPA 4F38A 5JI3E 4E5UA 1U94A 5LD2C 1TL7C 1GIAA 2GRJA 1KTVA 4W5JA 1XXHA 1XPOA 3D6TB 4XSHA 4KSCA 2XZLA 4EQ6A 4A15A 3EZ7A 2FEMA 1XEXB 2GILA 2WJYA 1G3RA 3WBKA 1XTSA 2GETA 4GBMA 621PA 3DL0A 2GVDC 1S1CA 2ZJOA 2J7PD 3LAWA 4A9AA 4DCVA 2L0XA 3MMPA 3QNUA 4MGZR 4Q02A 2GHIA 3C14C 4D4LA 4LJ4A 5C18A 4QGAA 3H4MA 3SOPA 3A1UA 3A1TA 4PSVA 3KL4A 4XTRA 2PMKA 1T5IA 1TQ6A 5SZJA 4E07A 2IUUA 3U7FB 4LHZA 1N5LA 4GOJA 2ZEJA 2VYFA 2ZSEA 3H2YA 5CB8A 1W5TA 1M1YE 2NZ8A 1YZLA 3NHBA 2PMDA 4EPYA 3CX6A 4Q1EA 2IXFA 1XXHE 3RHFA 1FMLA 1T4GA 1W7AA 2NMVA 5BN5A 5FTJA 1NVXQ 4CRWB 2P6NA 3GEEA 2D4HA 3R9WA 2EW1A 4L8GA 1BS1A 2QG6A 1S8FA 2KWIA 2ZJ8A 1R0ZA 2IW3A 4OI2A 4DIEA 1GFIA 1C4OA 5ANRB 3W6NA 1E3MA 3A58B 1TUIA 1HUQA 4MQBA 1EG7A 4JS0A 5DHFA 1Q1EA 4RCYA 4A4DA 2UVQA 4LYFA 2MMCA 1VCNA 4OI4A 2QMEA 1D9XA 2IWRA 2JGNA 1F2UB 2RGGA 2YC4C 4K81B 4KFUA 3AF1A 4KFTA 3ZYCA 2FV8A 2RGXA 3NWJA 3A4MA 3VX3A 1WRBA 2ASEA 2CMKA 5TDHA 4FN5A 1KK2A 1Z0DA 2PZGA 1AJEA 4NBSA 3B1YA 2ZJ5A 3BS4A 1JBKA 1KO7A 1LS6A 4CF7A 3FE2A 4ZDIA 2KBEA 2QRNA 2DBYA 3L0PA 3N70A 2WVJA 2JJ1D 1E2FA 2ZU6A 3I62A 5EE9A 2QT0A 3BH6A 4MKFA 3KFVA 2FFQA 2GKSA 1FFHA 1BMFA 3CF6R 1AQUA 3TVDA 3OEEA 1OFIA 3T1TA 3AVUA 3B2EA 4LBVA 2WICA 3LLMA 2OILA 1Y3AA 1FTSA 3NKVA 3QPUA 3KKQA 3IBGA 3EX7C 2F9MA 4WXRA 4O0MA 1YVDA 5D3MA 4DSTA 4URXR 1E2QA 1UF9A 1TQDA 3ASZA 1SVWA 2GWHA 3V00A 4FCTA 3CZPA 4GZMA 1V43A 4LJ8A 5CLLA 4D0LB 1Q20A 5E7MA 1P7CA 2OXRA 2QTHA 1JPJA 1CR1A 1O87A 1BYIA 1VIAA 3BWDD 1SVSA 2CLSA 2GZDA 3MAAC 3K0CC 2NO7A 4XVQA 5AWFC 3PQCA 1X1RA 1VG9B 3LRPA 2V1UA 1LFDB 4PPFA 4LYHA 1M34E 1CR4A 1YRAA 3IPYA 4M1SA 1IONA 3OEED 4A92A 3ECCA 4PO1A 5J4KA 1W36D 3LBIA 5JEDA 2NO0A 1SZPA 2O8BB 4OQXA 3D31A 2WJVA 1ZVQA 4HAVA 2V6IA 3SYLA 2GXAA 2O8FB 5F98A 4TTQA 4IDPA 1Y63A 4ZI2A 5G3ZA 2FPKA 2EFDB 1OYWA 1Z0JA 2EFGA 1T0JB 1XCPA 3WMFA 1GUAA 3P27A 2GF0A 2O0KA 5FOUA 3VFDA 3RABA 4EUNA 3AVYA 2FZLA 2FZ4A 4NYIQ 4QM7A 1PLKA 1NMZA 2RGBA 3LX5A 1F2TA 1G8HA 3B78A 2HF8A 4YLGA 5JEEA 1CXZA 4OHZA 1U9IC 3ZQ6A 1G4AE 3KXLA 2IA5A 2O8DA 5C46F 4HAWA 5EXXA 1L2TA 3UG7A 4JYCA 2G3YA 2J41A 1FUUA 2A3RA 4OBEA 2ZM5A 4FWTA 2HEIA 2V6JA 4NCHA 5DYIA 4NHOA 2X19A 3IDQA 4DB4A 1S1MA 2IS2A 1CS4C 5EP3A 5L3VA 3RS2A 1WDTA 2O8CB 1Z29A 3WHKA 3IQWA 2WAXA 2A7QA 3GMTA 2C5LA 2B7CA 1SVMA 5TVKA 2ZXUA 1P2TA 3B8HA 1CR0A 2YV5A 4Z54A 2WKRA 1XTIA 2OFOA 4Q19A 2I3BA 4EDHA 4AC9A 1Z6XA 4NCJA 1EWRA 4PC6A 1WF3A 2G1KA 3I61A 3AF0A 3ZVNA 2D3WA 3SS8A 4QGHA 2RH5A 1D9ZA 3FWYA 4DCSA 4UNQA 1X8KA 2DWPA 2FGKA 2Q3FA 4EPTA 2ZE5A 4S35A 3U3JA 3Q85A 2VL7A 1N2CE 1RRFA 1OYYA 2EYUA 4Q00A 4W5WA 1ZC4A 2KE5A 3SC3A 2H57A 4HLCA 1MV5A 1GTVA 1F48A 4M21A 5F9FA 1ANKA 1KAOA 4Q1FA 3CH5A 4M9XA 5HE8A 3LXRA 2R2AA 4PQRA 3FFBA 2ZYWX 3VKWA 1ZYUA 2H92A 2REOA 4ZKDA 3QIAA 1DOAA 1E2HA 4BLRA 1XPUA 4OJQA 5L3SB 2GXQA 3PUWA 4KV9A 4MKIA 1R4AA 3VHLB 1MO5A 2PL3A 2QTVB 1QHIA 5FOVA 2C77A 2CLCX 3HU2A 521PA 4EFNA 3VR3A 2XX3A 1CJUC 2YOHA 5BQ5A 2QGNA 4UXJA 4AYXA 1LB1B 5CJPA 4BRUA 2O8FA 5LB4A 4JMPA 1XEXA 4JT4A 5FBQB 3K70B 2NTYC 2QP9X 3IHLA 4LPKA 5JSZB 4NYIR 1P73A 2IUSA 3K0SA 1R8SA 3RS5A 1F5NA 3VX4A 4D4MA 3HJNA 4G5OA 5JCZA 4D81A 3RRNA 4V0KA 1CIPA 1E1QA 2ZRPA 1KO8A 2V55B 5FPKA 1D2EA 3G5UA 1GILA 2PCJA 3LBHA 4OQFA 5GVRA 4URYR 3X2SA 4HB2A 5CLQA 4C7OA 3TLXA 4BLOA 4Q47A 1Z06A 2AWOA 3N2IA 2WHXA 1G8FA 4YMVA 1YR7A 4RD3A 4A6PA 3PG5A 3MWJA 3CPEA 4Q9JA 2AFHE 2QQ0A 5B57C 1FW6A 1C1YA 2CXXA 2GDJA 5EE5B 3CB4A 2W6JD 2GAOA 3CRVA 3MD0A 1ZM3A 1ZM2A 3PUXA 4HSEA 1CKEA 1OHHA 1T0HB 1Z0AA 2IT1A 4DDVA 3KB1A 3CW2A 5CYPA 1BOFA 1XU4A 1G18A 3LW7A 3VR1A 4AKEA 4QKQA 1XMSA 2FMXA 2NO6A 3KXIA 4X8LA 4YONB 1PV4A 4U02A 1Z07A 3AUYA 1K5DA 4OYHA 1BKDR 3ZIAA 1CF4A 3TSOA 4UNRA 4LHVA 3GJ8A 4W7SA 2FGJA 2ZQ5A 2HXSA 4CT5A 3IIKA 4GPTA 5ELXA 3KJIA 1TF2A 4MUAA 1SVLA 2PX3A 4ERNA 4JLBA 2HCJB 2I1VB 2QGZA 2GA8A 1OHHD 4C30A 4MDEA 3LW8A 1AZSC 3GJ6A 3LA6A 3DO6A 3KXKA 2F7SA 1G3UA 2IK8A 4JYBA 4XTCS 5FOXA 4EFMA 2R9VA 5IK2D 3CLVA 4ZO4A 5FR2A 3T5DA 1JNYA 4CYMA 3BH7A 4B75A 4PSKA 4Q1BA 4AYWA 1Z6YA 2H1LA 3LWNA 2V1XA 4HZUB 4C9BA 5CK5A 2WWHA 1TEVA 4IVRA 3ZIAD 3AKEA 1KSFX 2ZJBA 4QNMA 3PIRA 3OF5A 4TTRA 5GVSA 2J7KA 1PJRA 4XWOA 1HURA 4U5XA 4FXPA 4HLUA 2ANBA 3PEUA 2WM9B 4PPQA 4HATA 1U99A 1H8ED 4Q4AB 4HAUA 5EE0A 1EFHA 3BAFA 2OSBA 3QBVA 3GLFB 1P3JA 3I3SR 5FBRB 4M1MA 2YWGA 2R6FA 3REFA 4QHTA 1NL3A 2ZI4A 2B7BA 3THYB 4OQMA 3ADBA 1P61B 4RY2A 4NTZA 2VLIA 3WP0A 1Z47A 2NPFA 1J90A 2IYZA 1SKYB 2BC9A 2EFEB 1NKTA 1CRQA 5EZ5A 3T1OA 1JR6A 1KZ7B 4Q21A 4PHGA 1KI2A 1IXRC 2ZRDA 2GZHA 2ZR7A 4PZLA 4Q7JB 5DNYB 3O8DA 3P4YA 1W49A 1NF3A 1XEFA 2FH5B 2QPAA 2KBFA 2YWHA 3PEVA 4PC1A 3SZRA 3EZFA 5FL7D 3ZH9B 3JZMA 4JT2A 5GJCA 4YMWA 2QEQA 5IF9A 1IOZA 2PZFA 1CRPA 3C7KA 1P75A 2Q0HA 2CVHA 1DTSA 3GFPA 2CDNA 3KKNA 4PQFA 1R0XA 4URZR 2RHDA 1XNJA 2WWGA 4NCKA 1OFTA 1E2DA 4NE2A 1KDPA 3GQBA 1KI9A 4M9SA 2IS4A 1G7TA 5FI1B 3WP1B 3SJCA 2QSZA 3UMRA 1E9FA 3OIUA 4DZZA 4AIIA 1J7KA 1HTWA 2RGCA 1E79A 3BC1A 1MOZA 2C2HA 1KZGB 4RD2A 3L8YA 3U3OA 1XRJA 4RKFA 4LV6A 3RDPA 4B34A 3GLHE 5K8LA 3CWZA 2A5FA 5AK0A 4BFYA 1A2BA 2XJ4A 2H8KA 2R6DA 4Q9HA 2O8CA 3W6PA 1I2MA 2HYDA 5C2JB 1NN3A 1KSJA 1NIPA 2OV2A 3K9HA 3HYTA 3BE4A 1KSHA 4RD1A 4US2R 3ZZ0A 2AXNA 2BJVA 1NSFA 1SHZA 1KKMA 5L3QB 3AVWA 2C96A 5CIWA 5CDFA 4MRSA 1G7RA 1AK2A 4TL7A 3LVRE 2XOKA 4JLAA 1UBEA 3UPUA 4MITA 4FMCB 2WWFA 2JLXA 3U3RA 4Q4LA 2IS1A 3ZJYA 3R8FA 5LDDC 1NSTA 4Z1MA 2WMNB 3NC0C 2NPIA 4RD6A 3B13B 1IN6A 3CRW1 3FKSD 3MG9A 4V0MA 4YMSA 3RNLA 5IDVA 1L7VC 2JATA 2ZRLA 4R2HA 4F7WA 4AKIA 2Q3MA 3ASYA 4CEJB 121PA 1GM5A 3EC2A 3AGQA 2QE7D 3HP1A 4CW7A 1UKEA 1R0YA 3AKCA 3MCAA 2ZRJA 2FNAA 1VPLA 1KSGA 3CM0A 3K0CA 3QXXA 5CDFE 2IHYA 3I8SA 3Q72A 2VQSA 3NBZC 4N0EA 3ND8A 2QY9A 4NPHA 5L3SA 4JLNA 4JLKA 4GP7A 1KNQA 1UKVY 5KDOA 4LUCA 3RRMA 4KFSA 4RFSB 3NXSA 3QVVA 5J4YA 4PAOA 4V0ME 4QBGB 2P2LA 3F5FA 4Z1MD 1P9NA 3RS0A 1DAIA 3K09C 3MJRA 3EA5A 4CEIB 3PEYA 3MJHA 5JSZA 2ERXA 1EFCA 2QPTA 3ZGXA 1XX6A 3BBPA 4V0LA 1SKQA 4L4UA 3HYRA 3C16C 1FQKA 1KAGA 1P60A 1XMJA 1KJYA 1CTQA 2XZOA 2VTKA 3K53A 5IT5A 3QKRA 1U9IA 4HDQB 3PXGA 3G0HA 4M1YA 1OXSC 5SZIA 1W36B 5EQTA 4FMCF 4TT3D 2EWWA 5KHOC 1UAAA 3VKGA 4OKSA 4ASUD 4B74A 4FW9A 4G1UC 1TPZA 4TLAA 1SULA 3CPJB 4IXNA 3QBTA 4PC2A 4HEJA 4A0FA 3B1XA 4YDHB 2ZE6A 3CNLA 3IQXA 4CT4B 2QMUA 2IS6A 1N25A 4TMTA 4M1TA 1E9BA 1ZNXA 1W47A 4DDUA 3ZQJA 2OEPA 1GITA 3SJZA 4OHYA 5JI2E 3U6BA 2DYKA 2TMKA 2VSXA 2ZS8A 2RGDA 1SQ5A 1AS2A 4DC9A 4ZCLA 1GSIA 4OK3A 5CM8B 3KTAA 1DAKA 1I4DD 3P1JA 4JKIA 4DSUA 2QBYB 1WCV1 4NYMQ 4BUJA 3ZS9A 1ZIPA 4O2RA 1SXJB 3KQKA 4B3BA 1UEJA 1H8HA 4GSYA 4C0SA 4MRVA 2W2XA 5DGXA 2FG5A 3CX7A 3B1ZA 2N42A 3DPUA 4WW0A 1I4TD 1KI3A 2VHUA 4YXWA 2ZUBA 1KI6B 1P2SA 1LY1A 2ZANA 3CR7A 1DE0A 2O0JA 2GK7A 3GJ7A 1R5OA 2OLJA 3N2EA 2OCAA 4HAZA 2XGJA 1T8UA 3IIMA 4NDZA 3WYAA 1IJEA 2PT5A 4JIMA 1F3OA 2WOOA 3U3MA 2CL6X 1D2NA 3EIHA 1DG3A 2XNDD 5B2ZA 5HPYB 1G291 4KI0A 4HZUA 2HXYA 2R62A 2O8DB 1W4CA 4KVGA 3ZZUA 3DOEA 4PC3A 2GBLC 1G5TA 3A4LA 3B1WA 1G20E 4Q66C 1RKBA 2HJGA 2FE4A 3LX8A 3THOA 4OI0A 1L8QA 4D25A 1ZW6A 2WIBA 4Q4AA 4B3DA 5FPHA 1JECA 2X2FA 2KB0A 3CF2A 4WZAE 4ZDJA 1KMHB 3GLFA 3P4XA 3PEWA 4I99A 3TQFA 3BJIC 4HB0A 2IUTA 5KSYA 4H9GA 3EC1A 2LKDA 4Y0VA 1R6BX 3THYA 3C41J 2MSCB 1US8B 4JBXA 2OBNA 1MO6A 2IYYA 2HV8A 5F3WB 2WPDD 2OHFA 1YE8A 3PUZA 4FCVA 4PO8A 4A2WA 1NBMD 1MABB 1DAFA 4ARZB 2RGAA 3W5JA 3KKPA 3AVQA 5HCNA 3EZ9A 4A2PA 1Q3HA 4LV5B 3WRYC 4QM6A 4PQYA 2IYSA 3T35A 4GOXA 2EYQA 1LF0A 3GLFE 1E2LA 2D2FA 1Z83A 2J7PA 2W83A 4DLTA 5FOSA 3AVTA 2ZITA 3EWSA 3JVVA 4IFEA 3EG5A 3WYFA 4IFBA 3GFOA 4P3YA 2DFNA 4MDFA 4G01B 2PLFA 2Q9AA 1GOTA 4JVSB 4XJXA 1WE2A 4NYMR 1E9AA 1SKYE 4C0KA 4DLZA 3VTKA 3DMDA 3EASA 3R8CA 1E9RA 4MGKR 4AKGA 2P65A 3T5GA 4HLUC 3AVVA 4A6XA 2GZAA 4A36A 1PUJA 2IHBA 1YZGA 4M9QA 4C3ZA 3QG5A 3OAAD 4K8OA 1AA9A 2X8AA 1NI3A 3VR5A 5JECA 3W3AA 1PLLA 2R6AA 2BEJA 2ZSAA 3OEHA 4AD8A 1P9RA 4HB4A 1BO6A 2CLDX 2VP4A 4FCWA 4LJ7A 2JA1A 1NVVQ 1OFHA 2GJSA 5JLJA 5L3QA 1UBFA 3MLEA 4LJYA 5JMTA 1J8YF 2XSZD 1WQ1R 2CCGA 2JJ2D 1QF9A 4C7OB 4AWXA 1KDRA 4EKDA 3RRZA 4KU4A 1KI1A 2R65A 1LF5A 1GG2A 3IGFA 4US1R 2ZETA 4P4UA 3F3YA 3DDCA 1UEIA 3OFND 4FMDF 2W00A 3QUSA 4QHYA 4TLEA 2DB3A 4NU0A 4NKRA 1MT0A 1UFQA 5L8VA 4D4JA 1D5CA 1R8QA 2GTPA 1JALA 1J70A 4CEJA 2JLYA 3ZD6A 1DADA 2K5UA 3QY0A 2GCOB 1J2JA 2NIPA 4NH0A 3ZDQA 1N6RA 4LSGA 5F9HA 3OEHD 3FMIA 3AKDA 2JJ1A 3QENA 1ZU5A 4N3NA 3GJ3A 2FJUA 2QP3A 3NG1A 3DVLA 5FUXA 1XZPA 1HEIA 1K6MA 5JWHA 4QJ4A 3UK6A 1NMXA 2R6CA 3VR2A 4BASA 1QRAA 2PH1A 1OXVA 4F4JA 1NP6A 3M4YA 2OUKA 1IQPA 2OBLA 1XMVA 2IEZA 4RFSA 3CONA 5J5CA 3SQXA 2WSMA 4CZ2A 3SR0A 4B6EA 5AJWA 2BIFA 3I8XA 4JJZA 4Q9KA 4BFVA 1OH8A 5F2EA 3LY5A 3KJHA 1GKYA 1I2DA 4PZZA 4CEIA 4B35A 3ND9A 1IAQA 4TMZA 5KO2A 4QRHA 1UBCA 1N6IA 2QENA 3DOFA 4ITRC 4KYUA 3SHFA 4HUTA 3WMEA 1G1MA 4PZYA 1Q1ZA 3U5ZB 3OE7A 1G17A 3VMFA 1ZP6A 2DWQA 3EIEA 3M1IA 1MKYA 3GPLA 2XNSA 2O52A 2OXCA 2W0MA 2IYUA 4P31A 3UIEA 1DEKA 4B48A 1B0UA 1QZXA 4C2UA 3OHMA 2GXSA 1N5JA 4JLJA 1NN5A 1JXMA 5EP4A 1E2PA 1W0JA 2ZSFA 3LQRA 3VAAA 2WMOB 2XXAB 4MGYR 4S2EA 1FOEB 1W4AA 5HKKD 2D74A 5JHGB 1E0SA 2BCJQ 3RSOA 5SZHB 1G19A 2V3CC 3IILA 4KBFA 4DWJA 1JJVA 1IBRA 4ZDWA 2G77B 4LDJA 3FHOA 1NVVR 3A4NA 2YJTD 4XOIA 4KHZA 3THWB 2DWOA 1M7BA 3BFKA 3LLUA 3Q5EA 5BWMA 2N46A 4M53A 1E96A 1PVOA 4C0BA 3OE7D 4B3XA 4KVAA 1DBSA 3KJEA 5EP2A 2RAPA 1DAHA 2QBYA 5FL3A 1K5GA 1UDXA 3K9GA 3RC8A 1SXJA 1BIFA 3PCRB 4OI1A 4ZI3A 1FP7A 3EA0A 4K46A 2FFHA 1P2UA 3SQWA 2ANCA 3K8YA 1W0JD 1ZD9A 2JJ8A 3GLHB 3QXSA 2Z6VA 3I73A 4Z8YA 2P67A 4BFWA 3K70C 1KI6A 1U0HC 1XTRA 1TQ4A 4JSTA 1ESMA 4C0AC 2F1JA 2BV3A 3AM1A 3ADDA 3LXXA 3SE0A 421PA 3FDIA 4RSGA 2G6BA 3QKSB 1X86B 1KK3A 4GNKA 1NG9A 1VHTA 2FPMA 5KNCA 3EW9A 4KAXA 4BECA 2JEOA 4TYWA 1OV4A 3S1AB 4YQFA 3ONWA 1W5SA 1T91A 2WOJA 5B30A 4R7ZA 2F6RA 3X1XA 2GVZC 3P32A 1SXJE 3NH6A 3AKYA 3SFZA 4HLQB 3EPHA 4YMUA 3V9PA 2XEXA 3M0EA 1SXJD 2LCFA 4XWAA 1RVDA 2CCJA 3U60B 1T3SA 3Q8XB 3WNCA 4B32A 4LX0A 4EIWA 2BM1A 2I4IA 4G5RA 1KMHA 3PV0A 4XD7A 2Q3HA 3K09A 3LD9A 5LB2A 3K9NA 3SFVA 3WY9A 4DLWA 2OESA 4ZIRB 2F9LA 5JCPA 1ONBA 2WWXA 4RZUA 5G41A 1OB5A 3LFUA 2JLQA 4I81A 1US8A 1XCGB 2W6ID 2YZ2A 3THXB 1T5LA 1E98A 4LZZA 1T8TA 5DIFA 3H84A 3IUYA 4MA4A 1E2IA 1IN7A 1G21E 1CJMA 1MABA 2PCLA 3KKMA 3TSWA 4ARZA 4HB3A 4TYQA 3SYKA 2QA5A 5BYJA 1ZRHA 1A4RA 4C0JA 2AK3A 3L2OB 4D26A 1ZNYA 1XF9A 3PVSA 4MYHA 3Q5DA 3UKDA 2XB2A 1Q0UA 2ZPTX 4XD7D 4N0DA 3NVAA 4KSBA 1MRSA 3VNVA 1Q44A 2BOVA 4BQSA 4MRPA 3FGNA 4DHEA 2JDIA 2FN4A 3QF4B 3QKTA 3U3KA 1DVRA 2G0TA 1S9DA 3AVPA 3FB4A 4C0HA 4BLPA 4TZ0A 3HDTA 3PENA 1J8MF 2W2VA 4O2LA 5KTYA 3QPVA 2IWHA 4DLUA 3HU3A 3RLFA 5FTKA 1JR3A 1KJWA 4PO9A 4CEHB 4Q9LA 3QXJA 3IIJA 4POAA 4DLYA 4JBWA 2ZRFA 4ILEA 2OZEA 1ZCAA 4U7DA 3FKQA 1M6NA 1XDBA 1YZNA 2DCUA 3V4RA 1OT3A 4AG5A 1Z6GA 3PFIA 1EFRA 1GNPA 2W6JA 4YC7A 4MRRA 4IKEA 5FUYA 3GLGB 4LRWA 2J45A 2JIZA 2A5GA 1RPZA 1JJ7A 3PJRA 5CJ2A 3TJZA 4DJTA 3B9QA 1CBUA 1Z22A 1ZD8A 1G5PA 4DVGA 2JDID 1UPTA 1RE0A 3HU1A 4JLOA 4LCBA 2VA8A 5H70A 3WBJA 4M1WA 2EFCB 3QKRB 1JR3E
chains in the Genus database with same CATH superfamily
2NUPB 2HJSA 1AN0A 4G2TA 4L73A 5DHSA 1FDTA 1EBBA 1JR3D 2CDRA 3IJ5A 3TBKA 1RR6A 3A9VA 3QLJA 2G67A 4O63O 4OHBA 5CVJA 3UQZA 3CNOA 1DL5A 4INPA 1R5NA 2BBOA 3WLTA 4CU5A 3AF3A 1O94A 1N6OA 1UH5A 4ITVA 1GTL1 4MQ4A 4ZVSA 3I64A 3D43A 4J03A 3RUPA 1Y1LA 2CVOA 2F4NA 4PXAA 1P4SA 4QPPA 4ZYYA 5DBHX 4MQ6A 1UBMS 5IMBA 1H3EA 1E1RD 3IPXA 5LP6A 4BMVA 2QTMA 3BILA 1ORDA 5EMMA 2AA3A 2ZDQA 3P8ZA 5FULA 1U2QA 1I2CA 1NULA 5GGXA 1VKJA 4MINA 4WY8A 4PTLA 2FMFA 2NZ2A 2N1MA 3ZI7A 4RTLA 1QG4A 2QM7A 1U8CB 2EOAA 4ZEOA 4BO4A 3OU6A 4RBNA 1I6LA 5IN4A 5B3LA 3O8OB 2R87A 3HL0A 3P94A 4IO1A 3OHPA 4L1KA 1G20B 2L2QA 2LNDA 4QT4A 2JK1A 4RL6A 4P4TA 3D3WB 1O95C 3ZHSA 3GGOA 3GZJA 1YH3A 4WBNF 2JCXA 3FR8A 2ONYA 2J67A 2QXUA 2PAFA 5HM8A 1H4SA 4Z3KA 2X5XA 3KQVA 4L5IA 4XH9B 1XB2A 2JCSA 5BXQC 3VPGA 5I5EA 2AX4A 2GNOA 4QX6A 2PNFA 2XVZA 2CFCA 4ZT2A 4YWHA 4M7PA 3HJGA 2BEKA 1AIPA 4LI0A 3R7LA 1II8B 4FQ8A 1YJ8A 4REQA 4CF5A 5DNEA 3MJVA 2A1UA 2CYAA 2Q1YA 5EQDA 3W6ZA 1CJVC 1W35A 2Z57A 5JS7A 3TNDA 2GZRA 1FK8A 2JIRA 2JC3A 5LWHA 1L4MA 1OVMA 3NBFA 4EG7A 1PL7A 4RKRA 2X9NA 5FL7A 4N49A 3NYRA 4F4HA 1OXTA 1LRJA 1QX4A 1ZBDA 2J0VA 3CINA 4LBZA 2VYVD 4DSOA 5L51A 4RPLA 3KHSA 3UUGA 2JFHA 3JD0A 4QU0A 3SYNA 5A5EA 5JJIA 1GL9B 4CQMD 4D0NA 3ASUA 4AS2A 5KJCA 4JC4A 2JHFA 2NVOA 2OK7A 2XQJA 2RAFA 1E4VA 3AERB 3GVXA 3IL2A 2J4CA 2V4MA 4F85A 2ZVQX 3D8NA 1ZRSA 4BGEA 2FE1A 4KGVA 3GEBA 4LHYA 2C88A 2W93A 1TTTA 4M46A 3TR5A 3Q4GA 1P72A 3B1KA 5J58A 3OC0A 1BS2A 1RXCA 1C9NA 2COUA 3JQBA 2O2GA 1ACJA 2CHEA 4WFJA 1KEEA 4X8HA 1VYVA 2G0AA 1KU0A 2VUSA 2IH2A 5LXTA 3EWAA 1PSDA 3AEZA 2RHRA 2VJBA 2ZYUX 3HACA 1Z62A 3G82C 3N5CA 4DIBA 2NP6A 2E4YA 4MRMA 1RJ9B 1U9JA 5TMDA 4MI1A 2XNJA 3ZNNA 4BFSA 3B3AA 4X94A 3SEAA 1K9VF 1XC7A 1UIRA 4R8KA 2H2DA 1COWA 1UKAA 3LG2A 4WNCA 4H16A 3I2HA 3IVAA 3RH0A 5AW2A 1L5QA 1WTAA 2P5SA 3OCJA 5AM1A 3K5PA 4BX3A 4ZDKA 3MYRA 4E5YA 1M2EA 3WGMA 1I13A 2QN7A 3EARA 4LVUA 4Q4HB 1SBCA 5CYGA 4XCQA 3ICQB 1W36C 2CZCA 4FUTA 2XB8A 2I67A 3KKKA 1U1GA 2O3TA 4CTJA 1ZR4A 1C1XB 1XVUA 2EFHB 4HZIA 2DPYA 2WJIA 5JNWA 2VH5R 1YRQA 4B4UA 4E4YA 5CDUA 1TIBA 5KTRA 5FBLB 2NXCA 2FMTA 3ADKA 1YQUA 4U3JA 4YRTA 3ZQUA 1H5QA 2WT9A 2QE7A 1JEAA 2YBEA 3BFXA 4GMKA 4AJNA 4ZIRA 3R40A 3TLGA 1QG2A 3SX4A 3K30A 4QA9A 2UYOA 4XDHA 3ZIUA 1SHKA 4YPVA 2A3NA 4GDFA 1DBIA 1OU0A 1UP6A 3D0OA 1AGPA 2B1QA 2RDMA 1BAPA 1QV6A 4XSGA 5AHWA 2GAIA 5TNXA 5GM2A 3Q12A 2BWJA 2QU7A 2J1LA 1IWPB 2JGRA 3OCCA 1GUYA 4H2DA 4WZ6A 3TD9A 5IMSA 3GN1A 5JBIA 3ZDAA 3RS7A 1UQTA 1JIJA 5BVGA 4HEA6 4PLHA 3GGGA 1NVGA 5FIUA 7MHTA 4PANA 2JLUA 4D3FA 1P0MA 1JKJA 3V1YA 4O4LB 4TSFD 4CMAA 3GFRA 1Y89A 3NEJA 3UAGA 1IN8A 3EIWA 3GCGA 4IXWA 4ZU1X 3RRXA 3ZDEA 1KXZA 4HNSA 1TECE 2W2KB 4IV0A 1TZBA 3OPNA 4WK0B 5AIBA 4CUJA 2REBA 2Y1GA 5K3CA 2FQQA 2VPTA 1KE2A 2YHSA 4F6CA 2AXPA 4JA0A 4JLSA 2WVGA 4RAQA 3S1SA 1GA6A 1WPXA 1DWOA 1JIXA 1EFTA 1ZOOA 3WKAA 4R7TA 3IKJA 3KYCA 3BCSA 2PD4A 3C3AA 2R86A 4HUJA 4MO2A 3INGA 4Y0AA 4ZVMA 2B7LA 1WB4A 4BCDA 4EFDA 1I24A 3FPGA 1N4DA 2JAPA 2JFBA 2QVZX 4X0EA 1NVTA 3X1YA 4BVBA 3B3GA 5FOTA 5JWOA 4XVRA 3WG9A 2OP0A 1IHUA 1Y7HA 1AM4D 3BORA 2VDUE 4X60A 5AD1A 5AHOA 3PCXA 2D0PB 3EDQA 4JGIA 1AMUA 3V46A 3DKRA 3EXEB 4WERA 5KAPA 1XZHA 4DCOA 4EJSB 3L6RA 3WSVA 3FNRA 1Q19A 3F97A 1TCCA 3VR4A 2FOLA 3AUFA 3PCTA 3B51X 2MSKA 4HAXA 4ACAA 2E9SA 4B80A 3I8OA 1ZJYA 4L50A 4O02B 4B2IA 1RYZA 3I42A 2JAWA 3L07A 4BNJA 4C4RA 3A1CA 1P2GA 3EGWA 5C53B 1PNRA 1BGVA 1MO4A 3DTNA 3O74A 4GMDA 3CVXA 4FD3A 3R7DA 3ADCA 1QJCA 2QR3A 2G9NA 4EGJA 3LUBA 3DBVO 3RFTA 4LE0A 1YKFA 4Q48A 1O57A 5EINA 3UVEA 3DPIA 1OBOA 3RKSA 4C14A 1CEYA 3WBBA 1Q22A 2X7HA 1IJFA 5ALIA 4UCFA 1GZVA 2P9JA 2XCUA 2P9HA 1TO6A 1Y1PA 2A33A 2AUNA 3P9QA 5EKSA 3IKTA 3I5XA 3WNBA 4P4SA 4ZMBA 1ESCA 1L0BA 2PR7A 3VZRA 1WV0A 1W44A 3BA1A 3VR5H 4JEMA 3PUVA 1WMEA 4TM7A 2R8BA 4O4LF 5B64A 3EUWA 2Z2YA 3DL7A 1RTKA 4D0GA 5EHQA 1Z28A 4OB7A 1YZ3A 3DFZA 3MRTA 2VJYA 4D0SA 5ALLA 3TL3A 5EG5A 1TMOA 3FN4A 1Q16A 3N0TA 3T3OA 4TN5A 4D42A 1H0HA 1MB3A 3HV2A 5GJVC 3I72A 4KBYA 2BMWA 3GZNB 1GKKA 2VHYA 3LP5A 3GH3A 4L28A 5TJ9A 1WD5A 5G40A 1FJXA 1IATA 1VZ2A 3OU2A 1SO8A 1I80A 3MSXA 2DHQA 2V6GA 3P0EA 3T06B 5CD9A 1CDDA 5JD5A 2A0FA 3WGNA 5C8YB 3AGPA 1TU4A 1W5BA 1Y9EA 2HF7A 3FCOA 3Q6NA 4AG3A 2BL4A 2VZ0A 4P86A 3IB6A 3TM5A 1Y6FA 2EX0A 2PUJA 2Q1SA 4JD5A 2NAFA 2OQ2A 1TVKA 3KVVA 1CNMA 4ZPXA 4ZAYA 5BN3A 3HTXA 2D7JA 3AEYA 2V9PA 5EJMA 2OZKA 5J2TA 2O5CA 3ET5A 2QTCA 1FU7A 4YDRA 5CVCA 4AY6A 4RJIA 1P1CA 3WK8A 4H6VA 2B3TA 2SNIE 5GGYA 4CODB 3HRKA 1VL1A 4YV7A 3D6HA 4LZLA 1GRNA 4FI3F 2YFQA 2J6HA 1YJCA 2D5CA 2EC5A 3HUDA 3OJOA 5COAA 4C4TA 2J59A 4AJPA 1H3NA 3G17A 1IIRA 2QL6A 3PFWO 5KYKA 1G8PA 2VH1A 1O94C 3GCXA 3KELA 3NWEA 5FYQA 4AZ0A 4DCCA 3TX6A 5JMPA 3QELA 4N8SA 3H18A 3PWZA 1J2YA 1L7BA 3F78A 3AP3A 3M6MD 3B85A 3FWHA 1H2RS 1ZA1A 3L0SA 5LP6C 2EJWA 1WXHA 3FBWA 3I5AA 4WT7A 1F4LA 1WQ3A 1GDHA 1C29B 4JV5B 1DIAA 5CVTA 2R751 2R1TA 4TN1A 5CCEA 3PLAE 3TCKA 4F6RB 3EZLA 4ER0A 2QQFA 1K8QA 3C5VA 2P6RA 3DVQX 3COYA 3LTEA 1ZJ4A 1CRWG 3FNBA 3Q87B 3TINA 4RKYA 3EPKA 2F1IA 3EFEA 4N3GA 1O0BA 3QGMA 1ZD2P 2AN9A 5AH0A 4A73A 4DOMA 4BQRA 1EG2A 1N7JA 4ZI7A 5C80A 1KJIA 3LUFA 1Z4PX 3CQ9A 3UEOA 1B00A 1HDCA 4O3MA 2OG2A 3PNOA 1C0LA 3QOFA 1IEQA 2QD1A 4MUHA 2LCQA 3UFXB 2CHFA 2H0RA 1X1DA 1FTGA 2H1WA 2REQA 3E6AA 1TM2A 3W5IA 4NV3A 4MR8A 1DMRA 4M0MA 1T8YA 4R2LA 1K3UB 1FB5A 1P0FA 2AC7A 3AV0B 4FONA 5DX1A 5AVRA 2F64A 1LSSA 2GKOA 2KM1A 2X40A 3ETGA 4BJ1A 4GAEA 4L51A 2PKRA 3MRSA 2H8GA 3GJRA 3E2MA 5EJAA 3SJ7A 3U13A 5KTOA 2GERA 4PBTA 4QE3A 4OBWA 4EPRA 1FSZA 2AD5A 2WLSA 8ATCA 1OLSA 3N1UA 3H6GA 3LHFA 1JNXX 3H5OA 2E1RA 2XSZA 4DMFA 1VL8A 2JCYA 4B9AA 2J3EA 3R5XA 4R8LA 3JPYA 5E9AA 1JYFA 4INJA 1JUDA 2CD7A 5INTA 1NY6A 5D7BA 2H51A 3JZFA 4WK4B 2YV4A 1QU2A 1EVLA 4I1OA 3E0XA 2P2SA 4Z51A 4F5YA 2DLNA 3P9YA 4KXVA 4RJ2A 1JI0A 3UTCA 4WEQA 4G4GA 5K6TA 4A6EA 2IXBA 1D07A 1YR3A 3UAYA 2J0QA 1JLSA 2HA7A 4MRAA 4ZXPA 5KOHB 5D1HA 2O3JA 1H1TA 2ADOA 4GD3Q 3PE6A 4C7KA 3ZVMA 1GAEO 4IIHA 4A0HA 4QC2A 3UHPA 1N0UA 3BIOA 4YAFA 1UJMA 2O2ZA 3UT5B 4E94A 5KNCH 1M2NA 2V5AA 3E5RA 3NC4A 2M6LA 3BERA 1VHLA 3G2MA 3ZZTA 3BEOA 4V1CB 5JAMA 2XXJA 1NUQA 1IQ0A 3N7AA 3N2KA 4B6OA 4AY5A 4PM4A 2V6BA 3BOSA 4CU2A 4HL6A 1C30B 1GL3A 5K2OA 4HVLA 3KB8A 1SIOA 2A9KA 1LSUA 4RJLA 4XX0A 1AB5A 1OVGA 1VC2A 2I4NA 3FCAA 2B8NA 3NNDA 1WNFA 1WB5A 1ZONA 3WIEA 2XKBA 3R5JA 2XNHA 1MIOB 2IYQA 1YL6A 1ZG3A 2C2YA 1E9VA 2IU4A 4IXTA 3TSZA 2WAOA 5T6MA 1VKNA 2OBXA 1P6QA 4Y98A 3UJCA 2XITA 1QCDA 4ZMRA 5LP6B 3U4QA 2PNJA 3A6LA 4TMXA 3C3XA 2CXRA 4N9WA 5DMXA 1E1NA 3JQ7B 3TW8B 3CA8A 3E4DA 4WXMA 3X43A 1GPJA 3AY3A 5JC1A 3HVKA 5GJBA 1M54A 3IERA 3GUHA 1M7HA 2C0PA 3SCZA 1ZC3A 3G1TA 1IWBB 2D2XA 3A9UA 4BJ5A 2C3PA 1FMJA 3G0GA 3QMMA 1Q0PA 3EJWA 1SBZA 2EBUA 2EW8A 2I3GA 2PT6A 1JHRA 2FFJA 3HSKA 4IMIB 4KQGA 3S70A 3VZDA 4IDEA 2I2FA 1W1IA 2CFSA 3D6NB 2XT0A 5T64A 2BEUB 3CHYA 4LC0A 4AMUA 3EWIA 2VZLA 1G64A 3ENZA 5SYNA 1P9WA 3VKHA 1RHUA 4RADA 1U7HA 3R9XA 2QNRA 3KKOA 1A1VA 1TC1A 5E1OA 2C5FA 3OZXA 3KQPA 4HS4A 1DG9A 4K9PA 2G07A 4KH0A 2F43B 4RXUA 3REOA 3PPXA 3T3EA 3TPCA 1QBKC 3I1YA 1XD8A 4REQB 1B3RA 3PQ5A 5JSFA 3AESB 1P39A 2VDLB 2WSSA 1N32B 3AUKA 3CURA 2ZWAA 3UGKA 2J3HA 5I51A 1MH1A 2BMJA 1HYQA 2YUIA 3M4JA 1PL6A 4B2PA 4UVEA 3H8JA 3KDAA 1SBHA 1FRQA 3K9WA 4QQKA 1GZSA 2A1TR 1Y1RA 3W8NA 1M2JA 2OXTA 3ED1A 4BFXA 5B1YA 5KOYA 2TYSB 2FX2A 3MWKA 4GO1A 3LXUX 4V02A 5JSQA 1NI4B 3G89A 3HBFA 4IJQA 1UMDB 5JPIA 1BHQ1 2MYUA 3WAJA 3Q3EA 3I83A 2CHQA 5HRUA 1VPWA 1T1IA 2FFAA 3DEAA 3ZGOA 1J9GA 5I9MA 1EK6A 5KVVA 5KTPA 5M04A 2GZMA 1QP4A 4KQFA 4PG5A 4BO1A 1OFUX 1WBBA 1YFJA 1R64A 5C31A 3KX2A 4PIVA 4WOPA 4FKZA 3T7EA 3AWDA 3ZHYA 1X13A 1RCTE 1ZUNA 3AI7A 3OQBA 1C8LA 1SH7A 5LXTB 5A9SA 4TQ9A 3RIGA 2CKMA 2HNKA 3K0FA 1A8IA 1L4LA 1ZESA 1CF9A 3C5WP 1KWGA 2AXEA 4EA9A 4S1WA 2M98A 4CN8A 3W2EA 1FSGA 1TYZA 2XKKA 1M2HA 3A32A 3QLUA 1ZMBA 2VI5A 4GEKA 1RRGA 1H23A 1MW9X 2C07A 2H4HA 5CIQA 3AL3A 3T4PA 3BZWA 2W2QA 4LHWA 3M89A 3PNVA 1X1CA 2FSGA 3PDHA 3DVAA 2UDPA 1BMFD 2P41A 4JUIA 3UBMA 4DLBA 5CEFA 1M2FA 2AFIE 3IEKA 5HJEA 3T4XA 4OGGA 4YRZA 4U2GA 3PU6A 4P36A 4Q01A 1Y82A 3LPMA 1V5WA 1VYUA 5AVOA 4JJ8A 1ZK1A 1CETA 2VSNA 1DV2A 3X1WA 2HH9A 2OWEA 1QOQB 3BXEA 2ODEA 4RZ3A 1FU8A 2Q9CA 2F2TA 3A28A 3FCEA 4NCXA 4BMCA 5DYYA 4BP8A 1NONA 1UJNA 2E21A 5AXDA 4DLKA 4DQLA 4FHEA 1QE5A 2HKIA 3C6KA 1EK5A 1BW9A 4BAUA 4RU1A 4RF5A 4XARA 1R0KA 2Q7DA 4Q9DA 2YCLA 4NCNA 4XA8A 1Y98A 4L0QA 3TOZA 5IDQA 3GRZA 3NS7A 1B8UA 1KETA 1ZVKA 3LCCA 1Y9ZA 2Z04A 2ZS9A 2G83A 3DEFA 1LUAA 4PHHA 1KR5A 3FTPA 3KSDO 3JALB 4GZLA 3DNPA 2Q3BA 4I8DA 5EKDA 1EK0A 3LL4A 3GUVA 1N7GA 1KOGA 5A02A 3L02A 3VHQA 3NRJA 1FX0A 1R4MA 3H2BA 1Q77A 3KZNA 2AKYA 3FMPB 5L3RA 1I7DA 2YYZA 4LWOA 4RH0A 3UC9A 1ZN7A 2HK9A 1AKTA 2P9CA 2PYDA 3ELWA 4AUMA 4ZPJA 3KJNA 1SCQA 5EJGA 4BE4A 4P4LA 4PV7A 1LPBB 4ZZ1A 3FCXA 1T8PA 4WUTA 5DI3A 1E1DA 3ZK8A 2LIVA 1O9HA 3CLUC 4TRNA 5E9JA 3UXHA 1Z4OA 3VTFA 2VJNA 2UUCB 2FB9A 2AQKA 3H1PA 3QPBA 1U0FA 5DXFA 1QFZA 2Y77A 4GBED 4O4HB 3KYCB 4PNHA 1D7AA 1KI7A 1NW7A 1QC5A 3ZVRA 3NJ4A 5ABPA 2FWBA 4EO4A 3VOBA 1R2QA 2ZR8A 4G36A 4M3NA 3OWOA 2X4LA 5MFPA 2YJ5A 1GRQA 1NJGA 2NWQA 1WZUA 5KDLA 1MHPA 1UPCA 3O4FA 3BXGA 4CIDA 1T9GR 1JAZA 2JAQA 4ZHQF 2EBHX 2W98A 3AETB 1BROA 2AIRA 3IX7A 4BDSA 1X8LA 5TXGA 5IHPA 3RC3A 2WQZA 4JI0B 5JRJA 1CVRA 1Q50A 2OLKA 4PU0A 4L5YA 1YR9A 3P20A 4DLRA 2NQ2C 1QXSA 1UWKA 2FWNA 1OU4A 1P62B 1PV1A 1G5QA 1HE5A 3DLTA 4PX9A 4WLUA 5IX8A 3JQRA 4QGSA 2MCFA 1FFEA 1X80A 2H4WA 1HDOA 4FYPA 4V3BA 3GLIA 5AJVB 3WIOA 2AH5A 5I7FA 2IEAA 1OT5A 3HK2A 2UUAB 2I78A 3H17A 1RW4A 3PGVA 3BREA 3M2TA 3T9EA 1Y7IA 1MAWA 1ZGAA 1XD2B 1K8YB 13PKA 2H6EA 3HCFA 3FAZA 3JQAB 4HQNA 4Q7LA 2W8BA 1V3TA 4RZQA 2IYWA 1QYVA 4HQRA 4J29A 4WL0A 3RAEC 1OH6A 3G0IA 5ALJA 1TF7A 3VR0A 4KP7A 5LIPA 2E4XA 1BN6A 4C0LA 4RY0A 4UBIA 4BBJA 2C98A 4FZ5A 2FW7A 4L9WA 1JHPA 1IY9A 1IMOA 3NIGB 1DTEA 4MWZA 4RMJA 1EGQA 2PSJA 2GYVA 3C6MA 3DW1X 3GRRA 4UEKA 5F51A 1SXPA 4DCUA 2R6ZA 4B43A 1ATZA 1HG0A 4FEAA 3K9QO 4UFNA 3TJMA 1RBYA 2GSDA 3KJZA 3PSAA 3KB2A 4NPAA 2IH4A 3SAJA 4UHFA 1EDDA 1QK3A 1YRHA 4P3OA 4QAJA 5FWAA 4AZVA 2PGXA 1W30A 1GGVA 4EGCB 2UYQA 3GT4A 3P96A 4L6CA 2H16A 3G1WA 4QO8A 4PPGA 3W2GA 2PANA 3ZHXA 1A9ZA 4MUEA 3MWEA 1U9YA 1XMPA 5ESXA 2I2DA 2NLOA 1QMGA 1YKGA 3BK2A 2B1GA 5HF9A 2QUZA 1IBMB 3V6MA 3VGJA 2GEVA 2Q0QA 3D81A 4FFMA 1N2HA 2BP7A 2P3SA 2VK4A 4QQFA 4PY2A 4C05A 4DHWA 1A97A 1G42A 3DW3X 3TPZA 4HDMB 3ZLBA 5K0ZA 2MT9A 3QX8A 1DARA 2EQAA 3QEJA 2O1XA 3RRJA 2EKLA 4CF4A 4GLJA 1C0EA 3WLLA 4UE3S 3AUTA 3EIOA 5FYDA 2BVNA 1MJGA 3HSYA 1F2UA 2C4KA 4KXWA 3SK0A 4ZICA 4HDCA 5E7JA 3NBAA 4HH3C 1YQGA 3QVSA 1E1KA 2R8PA 2RCYA 4FFBA 1J8VA 2R8EA 4YTEA 4WKBA 4H27A 2J46A 1CZNA 4B2YA 2HT1A 2ODAA 3A05A 3OJLA 1E4EB 1KY2A 2VSQA 4MWSA 1U3UA 5GINE 3FUXA 5DTMA 3CB2A 4YQZA 4E5MA 1UK6A 5F3DA 2YVLA 5EPUA 1ZSNA 3WL7A 1L4NA 3ETJA 3GNLA 5AVYA 1XCLA 1YBMA 1NRWA 3B6KA 1GCAA 2F3TA 4P0PB 1AKYA 2OLEA 1P1FA 2OBYA 1WDMA 3QW4B 4D98A 3O3OB 1IIBA 4R8SA 1MDBA 1OB2A 4TYYA 4QAQA 1KJZA 2D2EA 5HF6A 2C2ZA 3NDRA 2IQIA 3O6VA 3ONVA 5KWEA 1FP4A 3E9QA 1KZHA 1S0UA 2ZIZA 4E1VA 5BNTA 4PHTA 1HT3A 4G5SA 2X0DA 4MMXB 4D4KA 4U0JA 1XBTA 2MWMA 2EX1A 1KARA 1K7EB 1NJ1A 2R7MA 3SIRA 2ZT5A 2E87A 2FEOA 1CU1A 4FFWA 2PVCA 3ELDA 3KJFA 6GPBA 5TT0A 2HPHA 3RROA 3SDSA 2VHVA 1SUCA 3THSA 3WLRA 4D6XA 3U4MA 5L6MB 3U7EB 1AMOA 3A2MA 4EI7A 4M87A 3OMWA 4P53A 1AO0A 3D6FA 2YXBA 2PQ0A 2Q5EA 1VSUA 4Y2PA 1ZNWA 1FX1A 5DLQC 1ML3A 4ZCMA 5DSXA 1EQAA 4GI7A 3IT0A 2Z1NA 4A10A 1DQPA 4WZZA 3SJBA 4EF6A 2IZ6A 4L2IA 3D6MA 3FYUA 1UDBA 4GE0A 3T9CA 2PIDA 1QWSA 3ZX4A 1N2BA 3KUCA 3B1FA 3HA5A 3OFSA 2E82A 2FEWB 4XUGB 3G8YA 5F7JA 1G8JA 3S2IA 5G4KA 2RI0A 3DDWA 1IUKA 1V7ZA 3WYBA 1GA1A 2GJKA 2DR3A 2IODA 1U0LA 4HUQA 4RVNA 4V39A 2FUNB 3MSCA 2G28A 4BEJA 5J47A 1U0EA 3K4QA 3UK7A 5JT1A 2VP5A 5AVSA 5ALTA 1MJGM 1YR6A 5C7YA 1L5ZA 2I8LA 1M8PA 1SQSA 4M1ZA 4QXAA 2RJOA 3G02A 1PJ8A 1M6EX 4ZK2A 4DPLA 4DLSA 4OJKA 2O5VA 3VC3A 5JTTA 2OAQ1 4NJOA 4RTNA 4B76A 4Y8VA 1JU3A 2YYSA 3KSZO 2OO7A 1N34B 2G6TA 2W8ZA 3F47A 2F90A 5DM70 3A9SA 2ZJZA 1HQCA 1Z13A 4OMCA 1M1YB 2IELA 1DDGA 4G8BA 1T4BA 5J43A 2FPPA 2FLWA 2GTIA 4KWCA 4YJHA 2PGDA 1N1DA 2K2QB 4MWEA 2P69A 1IN1A 3WWOA 3I05A 4MDHA 1LTQA 1E3QA 2O7NA 2QY6A 2I6SA 4XX0B 1A9TA 5G2OA 4ZV4A 5AW0A 1R1DA 2QD2A 3C3CA 3IP3A 2GHTA 3RE1A 4E46A 4HEQA 4OX9B 3FOAA 3GIDA 3IELA 3O47A 1MQ9A 2ZJAA 4EHIA 1KRHA 3R7WA 1BWSA 1JR2A 2IHVA 1Y3FE 1HA3A 3KKEA 4XWYA 4K3VA 1THGA 2Z83A 5A6SB 4NWIA 2FSFA 2PS0A 3D9QX 4K40A 2VXYA 4J90A 4LI3X 4IQ4A 4AJEA 4TLDA 3BRWA 2OVBA 3MJ4A 3RASA 2GHRA 3WMRA 3U4QB 2PBLA 2CUNA 2Z4SA 3AHHA 4P3XA 3V8VA 5EXPA 5ALWA 2CNWD 4Y6SA 3R9KA 3RK1A 2EZTA 1ZS9A 4LE1A 2I2AA 2XA1A 3KYJB 4DGSA 4DR6B 3TQIA 2BDTA 3R20A 4MB2A 4DREA 2ZAYA 2GA9A 3OFVA 2IXGA 2WU0A 3ACCA 4J4BA 4YAWA 3NT2A 3WJ7A 4EVIA 1KFJB 1J2RA 2B0CA 2I1QA 5J1SB 2JIPA 2VDWB 2VP0A 2ZI6A 1Z2PX 4WA7A 1DWQA 1D2GA 1S9HA 4HY3A 2QTFA 5DISB 1Z37A 3AP2A 4LRTB 5KU1A 4B8ZA 3PYXA 4Q39A 3NHZA 1YS1X 5M5BA 3Q3VA 3TE7A 2H3HA 1TADA 3L8ZA 5EJ9A 4XLZA 1V9LA 4P5EA 1EB8A 3CXRA 4BLTA 4EG3A 1LDMA 1KIFA 3BA6A 3CRNA 4JWKA 3IDOA 1NYRA 1QAQA 4U0KA 1UXJA 1UBUS 2YKGA 4LFAB 2YCBA 1U0GA 1A2KC 3ETCA 4DLAA 4P4GA 1X7YA 1E2NA 4PRKA 4FGLA 1GNLA 1KZ4A 3PNKA 1TX4B 2VHJA 1INLA 1W34A 5EXDA 4PYIA 2PX4A 3H4IA 3OFJA 4GE3A 4NMMA 4NQRA 1ESNA 4HVCA 2O50A 4DB2A 1LSOA 5FEMA 2PBRA 2TMDA 3G1UA 1A9OA 4G0QA 3NONA 2JFGA 4HNAB 1UXOA 1BNCA 3I3OA 2UZAA 1ZH0A 3C8HA 3W34A 1QHXA 3M1AA 2GOYA 3CNHA 1UANA 3PNSA 2B4AA 4QLBA 3U9TA 2DX7A 1F14A 3GFBA 3UHJA 5LKAA 1VI6A 2P3OA 2RK3A 3TQOA 4JL5A 4ANFA 3KDSE 1F0KA 3EFOA 3G79A 2YUTA 3BB1A 4IUYA 4II7A 3WDMA 2NZWA 3TFQA 4C4OA 1Z5UA 3A9WA 4G6ZA 1G5RA 2C92A 4I9GA 2I76A 2OOKA 2YHIB 4OQDA 2O1WA 3RGGA 4DQXA 3BB3A 4HI0E 3W5SA 2XUKA 3A25A 3NOVA 2IKSA 2NVBA 1XEWY 1TAGA 1N1GA 5LQRA 5FBWB 1DB3A 1R0WA 4E5VA 2CB0A 5AJTA 4Z3OA 3GMIA 4JJKA 4UKDA 1A71A 5BORA 1Z4KA 4TRRA 3PJFA 5CR9A 2RC6A 1UC9A 3HWX1 4NCIA 3ORQA 1IPFA 3COZA 3ENNA 4HKTA 4RK5A 4KK3A 5A62A 5IZCC 1IUPA 2V7QA 1RC8A 2RMKA 1W96A 5SZKB 2P90A 4U7PB 4RGYA 1OKKA 3RFXA 2FZEA 2G9ZA 2HBQA 1MQSA 4K7JA 3TNFA 2IY7A 4G07A 1PEAA 1VLVA 4FLFA 3AB7A 2PMFA 2ZVJA 2KLBA 1SUAA 2P6UA 1V7CA 3DMTC 2XTMA 2H07A 4TXMA 1CZRA 3B12A 3EXFB 4I5EA 3TRHA 2CT8A 2ACVA 3HYSA 2JASA 1M75A 2DTEA 4ONEA 1UBNA 2X4DA 3RKRA 4K03A 1N9GA 2CF6A 2VF2A 1DS6A 2A30A 3DJFA 3EVCA 1RI4A 4UCWA 2CJXA 2CXQA 4YO8A 3LY7A 5H9VA 1XJ5A 2ZBDA 3UJ7A 4L8VA 1ZN9A 1K27A 3JQPA 5EZYF 4II2A 2EF1A 3D0RA 3RCBA 3WXMA 4DBLC 1XZNA 4DV3B 3QWFA 1HE8B 4H0NA 3LF1A 1PR6A 4IZ6A 4WESA 4AJ2A 2IRWA 2JANA 4LWQA 3UOAB 2EG5A 1MQ8B 4OOFA 4E88A 1W93A 1NQUA 4XFDA 3OIVA 1F2TB 1WKBA 1L7RA 2X13A 1KF0A 2WZQA 4OATA 2NU9B 4W5QA 5EJ6A 4G4JA 3ZLTA 2FDCA 2XT6A 2GO1A 2NZVG 3AVOA 1I7QB 4XWWA 2J0SA 5A7FA 4FX5A 4CKBA 2UAGA 5CVEA 1QKJA 3SBXA 3W2HA 3CIOA 1C9EA 2Y67A 1XAHA 2TRSB 4GI1A 4KV7A 3ZH2A 4DA9A 2I2XB 3FHCB 4Z4FA 5SYAA 1W73A 1R7RA 3W5HA 1WUHS 1VIYA 3H1TA 1H8HD 4GPD1 1DQZA 4QXMA 3VJKA 5JZVA 2Q6IA 3UT0A 1NOKA 2GCNA 3H4TA 3WB0A 1P44A 1D1TA 5IYZA 2ODTX 4OQNA 1HFJA 2ZRCA 4DADA 4HWOA 2E2WA 2GUGA 3JXEA 2PMBA 1A88A 5D00A 4NEQA 1FVOA 4H7FA 2AYXA 1UBLS 4EHDA 2VOEA 4HD8A 4EMUA 4GOOD 2QPOA 2FPWA 1IHYA 2IXEA 3F6BX 3ELUA 1L9KA 4BFTA 2X9LA 4Q4JA 4XAQA 3S4YA 1LLDA 2ZUWA 4NG4A 3Q0TA 3N2YA 5H68A 3TCNA 2IHJA 1DAPA 3QQPA 4N47A 4AQDA 1XD9A 1U6KA 2NYUA 4ZYWA 2IHNA 1YS4A 2X6QA 1USGA 2BF7A 3CZ9A 3K8ZA 3M83A 3E5NA 3FNGA 1VBKA 4IJKA 4OHRA 4RE6A 1DIOB 4YPFA 3VHXA 3KWJA 2ZYGA 4LYJA 2BUAA 2YMLA 1ZUIA 3RTCA 5AR1A 3DHVA 1GRVA 2OE2A 4LQLA 4NFHA 4N4AA 4F0JA 2WU1A 1W0KD 2A35A 3O3NB 1O8CA 1H6BA 4MYUA 2F59A 1T4DA 1BS9A 1YOVA 3UNXA 1JLRA 1K8RA 3H1AA 4MRNA 1C4XA 1LTHR 4UZFA 2QRMA 1RWNA 3KBOA 5H59A 4JH0A 2RARA 4BLWA 4D9CA 3SZUA 1Y3HA 2AFRA 3PJEA 4QHSA 3OM1A 3CZQA 2P3LA 2RE8A 4E21A 1Z75A 2OZVA 1ADBA 4RD0A 1XL0A 4E5UA 3TLAA 5LD2C 1KTVA 1Z0SA 3WB1A 1I7PA 1XXHA 4CFZA 3IP9A 4EY5A 5JO0A 1X92A 3DEKA 4ZV9A 5C8VA 3QWHA 4XDGA 3NOQA 2DULA 2QMQA 5B6JA 5B2EA 4D9JA 4I50B 2FEMA 4ZAXA 4PYQA 2OCXA 4ZJPA 2PA3A 1FFBA 3CWCA 1BQ3A 1TO2E 4HXFB 4TWRA 5B7NA 2BD0A 3LKVA 3LAWA 3RTEA 1J8FA 4LJSA 1BDBA 4CT0A 4KLCA 2FG7C 2GHIA 1MN6A 1LWOA 3H4MA 4RV5A 3A1TA 4GYJA 3GOQA 3KL4A 1L7QA 3GGSA 1Z8DA 2PMKA 3N0XA 5JYEA 2VXBA 1GPWB 5AHRA 3BD6A 3L4BA 1RTTA 3DF7A 5J9FA 2ID9A 4PW0A 2CSXA 3FYUC 2H2AA 4LHZA 4GOND 1XQWA 3U7FB 2ZBQA 1Y8RB 2ZSEA 1Z0ZA 3COVA 3H2YA 4GWLA 2NZ8A 3GP3A 1I3KA 2PMDA 3CX6A 1K2WA 2IXFA 4L4RA 1JT9A 4Q1EA 2WIGA 4WLVA 1FMLA 3RHFA 4ETIA 5JR3A 4BO8A 1W7AA 2D13A 2H0QA 5BN5A 3AMVA 5LYJB 4UHEA 3MWEB 2GEJA 3FJYA 2D4HA 5ALUA 2EW1A 1XDDA 4JYAB 1BS1A 2YWRA 3HKEB 1S8FA 2KWIA 4IKOA 1PG0A 1PV2A 1FFAA 1C4OA 3F1LA 2D1FA 4RJJA 3W6NA 4BNDB 4TXNA 4L5CA 4OAQA 4ZVRA 4JS0A 3RVPA 1IVYA 2EHDA 5EIWA 1MGPA 3W7AA 4F72A 2R6JA 3PR3A 5AOAA 1USIA 3CFYA 2GK3A 1F2UB 2E3JA 2QM3A 1UFOA 2RGGA 3PQ6A 4K81B 3PA6A 4XPZA 5TMEA 2WM2A 1NUSA 1ZY2A 2R7NA 3MVEA 2CV0A 1I1NA 4UDNA 1XMOB 1H2FA 2ZBPA 2WJAA 4L75A 4C5AA 3IQFA 3UH0A 3I9JA 1TPYA 3AHGA 5K99A 4I19A 1V1MA 1WRBA 2ASEA 2X76A 2PMCA 3N87A 4G65A 4E2YA 3HBAA 1AJEA 3JD2A 5BQOA 4I50F 1XCJA 2GPYA 1BKYA 3ND6A 3RREA 3DFIA 2BM9A 1QFJA 2C7GA 1GQRA 2FW9A 1KJJA 2Q49A 4EJ2A 1KZ1A 1DZ3A 4OIFA 2YFHA 5ITZB 2WVJA 4W5RA 4IDFA 1T6YA 3GG9A 2JJ1D 4KHPB 3BH6A 4KRXA 4U7FA 2BPOA 3ORHA 1O6GA 1RE1A 1R4NA 3CR3C 3HB4X 4NOJA 1V8DA 3VYTB 3B2EA 4CLRB 4K05A 4CLHA 3O90A 4EKIA 1Y3AA 2HDWA 3Q3IA 4KR7A 3NKVA 4QFDA 3E9MA 3KKQA 4C88A 4MB0A 3CGGA 5CCDA 1ZLXA 4O0MA 2ZTUA 1GHTA 1E2QA 2A6PA 1L7MA 2XBUA 1QS0B 1TQDA 1GPUA 3PQ2A 3V4OA 2YJNA 1EUQA 1KMMA 1SVWA 2YIVX 3O8QA 3JQGA 4QFBA 3V00A 4GZMA 3U62A 2DT8A 1MOPA 3PFCA 2OXRA 3FPHA 2YN4A 1QUFA 1DRKA 2H2GA 1JPJA 1CR1A 1P1RA 1VIAA 3FNQA 2PUFA 2V0CA 4YQYA 2CLSA 2FAXA 2XODA 2EHJA 3MAAC 2NO7A 4WMLA 3ESBA 4XVQA 3PQCA 3OLQA 5AWFC 4AY4A 1V8PA 3USZA 2JVKA 3C24A 1V11A 2WY2D 1SRQA 3WVNA 5IJZA 2NTJA 1YRAA 4N5HX 3VJMA 5J4KA 4YX9A 3ECCA 4HRAA 5FLXA 3MC1A 4V24A 1W36D 3LBIA 3LY8A 5JEDA 5M7EA 2NO0A 1SR8A 1QYWA 1TI7A 3AEUB 2P2GA 2GXAA 3D31A 2WJVA 1ZICA 2AI3A 3S0JA 1BHJA 4TTQA 5BT9A 4MV5A 1GG9A 4OBXA 3UAOA 3SF0A 4DG5A 3A3YA 3G9ZA 4E5NA