3CX4A

Crystal structure of e.coli gs mutant e377a in complex with adp and oligosaccharides
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
476
structure length
476
Chain Sequence
MQVLHVCSEMFPLLKTGGLADVIGALPAAQIADGVDARVLLPAFPDIRRGVTDAQVVSRRDTFAGHITLLFGHYNGVGIYLIDAPHLYDRPGSPYHDTNLFAYTDNVLRFALLGWVGAEMASGLDPFWRPDVVHAHDWHAGLAPAYLAARGRPAKSVFTVHNLAYQGMFYAHHMNDIQLPWSFFNIHGLEFNGQISFLKAGLYYADHITAVSPTYAREITEPQFAYGMEGLLQQRHREGRLSGVLNGVDEKIWSPETDLLLASRYTRDTLEDKAENKRQLQIAMGLKVDDKVPLFAVVSRLTSQKGLDLVLEALPGLLEQGGQLALLGAGDPVLQEGFLAAAAEYPGQVGVQIGYHEAFSHRIMGGADVILVPSRFAPCGLTQLYGLKYGTLPLVRRTGGLADTVSDCSLENLADGVASGFVFEDSNAWSLLRAIRRAFVLWSRPSLWRFVQRQAMAMDFSWQVAAKSYRELYYRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Glycogen synthase
publication title Oligosaccharide binding in Escherichia coli glycogen synthase.
pubmed doi rcsb
source organism Escherichia coli
total genus 164
structure length 476
sequence length 476
ec nomenclature ec 2.4.1.21: Starch synthase.
pdb deposition date 2008-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00534 Glycos_transf_1 Glycosyl transferases group 1
A PF08323 Glyco_transf_5 Starch synthase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3cx4A01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3cx4A02
1AXRA 4MI9A 1RZVA 3HBMA 2ATIA 1GZ5A 1QKJA 2WTXA 4L22A 2G9RA 4N3BA 4FKZA 3GPBA 5TVGA 2C1XA 3S28A 3DZCA 4N3AA 1PYGA 2HY7A 1FTQA 2QN1A 3BD7A 1F6DA 1M5RA 1GGNA 3NC4A 4MI6A 3H4TA 7GPBA 3MRXA 3CUVA 2QN7A 5BNWA 3D1JA 2XGSA 4CTMA 4MRAA 2P6PA 3G2JA 2QRGA 3SYRA 3QHPA 2XMPA 3O3CA 2BGTA 1NOKA 3CUTA 1KTIA 2QN3A 1WW2A 4F97A 1IIRA 2FETA 1P4HA 3CX4A 6GPBA 1Z6PA 2SKCA 1L7XA 3HBNA 3S2UA 2QNBA 1FTYA 2XA1A 1JIUA 2VCHA 3L01A 4MHSA 1F0KA 3UYKA 3ZCSA 4XI9A 2KS6A 1HLFA 3OKCA 2XA2A 1FU4A 2PRJA 2BISA 5IKOA 2ACVA 8GPBA 2BFWA 2SKDA 1XL1A 5TMEA 3T5TA 3ZCUA 1GG8A 1K08A 3MBOA 4M60A 1P4JA 1B4DA 2ACWA 3MRVA 2GPNA 3MS4A 3E3NA 1JG7A 1NOJA 1FS4A 3S0JA 3BEOA 3OY7A 1GFZA 2F3PA 1Z6QA 2R66A 3E3LA 4HLNA 2F9FA 3C4VA 4AN4A 2ECPA 3S29A 1Y8ZA 1C3JA 1P4GA 4CTNA 1GPYA 2PQ6A 4LDPA 1LWOA 5TMDA 1H5UA 1UZUA 1JG6A 3MT9A 4YI5A 1UQUA 2XA9A 4X7PA 1SXPA 2O6LA 3TAXA 3C48A 2H1HA 2F3QA 2G9UA 3NCHA 4G2TA 3T3GA 3WAGA 5IKPA 2AZDA 2IYFA 4NC9A 1P2GA 1AHPA 3L7AA 2IUYA 1A8IA 3BCRA 3MRTA 5C1DA 3BCUA 1QM5A 4REMA 1K06A 1LWNA 3Q3EA 4YI3A 1XC7A 2AW3A 3TOVA 3MTAA 3E3OA 5D01A 1FU8A 1WUTA 4X7MA 2XGOA 3Q3HA 3OTGA 2R4TA 1WUYA 1NLMA 3VUEA 4N3CA 4XIFA 2QLMA 2GPAA 5HXAA 3T3EA 3NP7A 4BQIA 3G2LA 3RHZA 3BD8A 4EKEA 4NESA 4KQ2A 3RT1A 1XL0A 1L5WA 3CV3A 4M7PA 3T3IA 5GPBA 3ZCVA 1WW3A 3HBFA 4GZ6A 4EL0A 1FU7A 4YUAA 1EXVA 3T7DA 2R60A 4EKYA 3NAZA 1JIXA 4RENA 3OY2A 1C8LA 1E1YA 1L5RA 2PYIA 3DD1A 1GPBA 1L5QA 2IV7A 2JLBA 2AMVA 1PNVA 4X7RA 2IYAA 3VUFA 4BQFA 1XV5A 2QN2A 5I45A 4Z5XA 5JTTA 3MQFA 4AY6A 3TSAA 4NEQA 4WACA 4F96A 4RELA 2PYDA 2X6QA 3CUYA 1L5VA 3MT7A 1RRVA 2Q6VA 3D0RA 4QLBA 3CUUA 4GYWA 2IW1A 5D00A 1PN3A 3CEJA 4HWGA 3IA7A 3L7DA 1GPAA 3ZCPA 3NPAA 4EL5A 4GPBA 3G2KA 4N9WA 2ASVA 1XOIA 1P2BA 3D0QA 3COPA 1PSWA 1L6IA 2VSNA 4MHOA 4CDRA 3RSZA 3DDSA 2R68A 2X6RA 4AMGA 3HBJA 4WHMA 2VCEA 3Q3IA 3G2IA 4N39A 2QRMA 3CEHA 3OTIA 1JIVA 2VSYA 4PQGA 4GZ5A 1WV1A 2JJMA 2QRPA 5DLDA 2XCIA 2ZB2A 4RIHA 1P29A 4GZ3A 1NVKA 2GM9A 2XCUA 2VG8A 1YA6A 2G9VA 3GUHA 9GPBA 2X0FA 3IAAA 3L79A 2QRHA 3S27A 5DU2A 2OFFA 4KQMA 2X0EA 1Z62A 4AMBA 4LEIA 4BQEA 3C4QA 3MTDA 2R4UA 1FA9A 3MSCA 2G9QA 2FFRA 3CUWA 1NZFA 2FF5A 4AY5A 2XGMA 2PRIA 1ABBA 1VGVA 2C1ZA 4M83A 3OKPA 1V4VA 3NB0A 3EBOA 5DXFA 3L7BA 3G2NA 5JTUA 3ZCQA 4RIGA 2QZSA 2JZCA 3MS7A 3OT5A 3PE3A 5LQDA 3UYLA 1P2DA 2GEJA 1JEJA 2F3UA 1NZDA 4GYYA 1Y6FA 3SYMA 5TMBA 4RIEA 1C50A 2GPBA 2GT1A 4CTOA 1BX3A 1L5SA 4EJ2A 2QRQA 3FROA 1E4OA 3T3DA 1Y6GA 3QKWA 3CEMA 1UQTA 1IXYA 3MS2A 1FTWA 3BDAA 3BCSA 4RIIA 4KQ1A 2SKEA 4WADA 2IEGA 1WV0A 3WADA 1RZUA 2BGUA 3OKAA 4RBNA 3MT8A 3VDMA 2X0DA 2IV3A 1O6CA 3BD6A 3EBPA 2F3SA 1FC0A 3ZCRA 1Z8DA 2QLNA 3OTHA 4MI3A 3ZCTA 3AMVA 2C4MA 3G2HA 3T3HA 4F9FA 2AV6A 2YJNA 4BFCA 2GJ4A 1YGPA 4X6LA 3L7CA 1J39A 2QLLA 1SXQA 3MTBA 4RIFA 2H1FA 2IEIA 5ENZA 3NP9A 2QN9A 3DDWA 2QN8A 2GEKA 4MICA 1C8KA 3H4IA 4W6QA 3PE4A 4FZRA 1NOIA 1EM6A 3VDNB 3RSCA 2C9ZA 3WC4A 1XKXA
chains in the Genus database with same CATH superfamily
4AFNA 1G66A 2P6RA 2PT5A 4AN1A 1XO1A 4PZLA 2YJ6A 2AX3A 4WX2B 5KB3A 1ODSA 1UF9A 2QE6A 4DIUA 5BXQC 1IN7A 2Q1WA 1Y4SA 2KJQA 2XNCA 4WZ6A 3WLQA 4YAKA 1FUYB 1T4CB 5HKLA 4PRLA 3R7SA 5LPNA 4DR5B 1YKFA 2DECA 3THXB 2WM9B 4Y7DA 3H3FA 3ICEA 3EZ2A 3IKJA 4FKZA 3OZBA 4JJEA 2Z4SA 4PQEA 1CX9B 3CRZA 4LK3A 2O0MA 2PBFA 5EESA 2B8EA 1KKMA 4RTOA 4FFNA 1FLDA 3FUTA 4MUMA 1LCIA 1V1MA 2G0NA 3EODA 1UZNA 6ABPA 1V6CA 3BD7A 1DRJA 1F6DA 2ZAOA 1TW3A 3CNLA 3JS5A 1RTTA 4S0ZA 1UEIA 1WXIA 1ZISA 3CY6A 4DR4B 4KN9S 1JN0A 1QTNA 2YXNA 1DBSA 3GNLA 4MARA 5DSZA 1Z35A 2JLUA 2CCJA 3JZDA 3V8NA 4BNDA 1F8XA 1VHDA 1ZKMA 5CJ2A 3GY0A 1IONA 2H31A 5AW4A 3GPLA 1JS1X 3N8KA 1Z2PX 2DJIA 1HMYA 4FGZA 5LNK6 1SBZA 2LCIA 4MUFA 4DJAA 2QRUA 1PGNA 4TSFA 1HE8B 4RQUA 1XZ8A 5E6RA 5HS4A 4B7XA 2V5VA 3ZXYA 3NNDA 1NFQA 4LOLA 1XU9A 4F6RB 3PQFA 5IJ0A 1SD2A 3MGKA 3N2YA 4NCHA 3OZWA 4MJXA 4BKUA 4D9GA 1XTVA 1L5FA 1W73A 4HNAB 1YUMA 3TLYA 3GP5A 2SKCA 2CVPA 3C5CA 1QYXA 2NOAA 5FQOA 3OJFA 1FTYA 1BKDR 3P2JA 1NE7A 2XA1A 2FMHA 2QIPA 4HN9A 3LUAA 2IDJA 3FN4A 3O3NB 1AKRA 2CYBA 5B36A 1FDIA 3DDHA 3C6BA 4Q4DA 1DO8A 1L7NA 2PU7A 4FW8A 2BFFA 3BA6A 4V0SA 5DBFA 2N3ZA 5IC6A 2FDCA 3LD9A 3SXPA 3V1UA 4GGPA 2G4LA 5AHXA 3RREA 2FE1A 3ZHTA 1P2UA 4IIFA 2ZCVA 2CHVA 2GKSA 5JFTA 3H84A 3K0CA 1XDZA 2DUWA 2GXAA 4AP5A 1CULC 1DARA 3DOCA 4RUKA 5B64A 4PY2A 4OHXA 3D7RA 4RVGA 1KOLA 5CDTA 1R3DA 3ETJA 3N0XA 2QKYA 1P17A 1F6WA 1PX0A 1KR2A 1UC4B 2YHBA 1AS2A 4FI3F 1PG0A 1Q1QA 4UEOA 4X1IA 1KDRA 4DEVA 4BPBA 3T12A 3ZQJA 1Z8HA 4UVHA 1X19A 2XXAA 2R48A 1DDIA 3Q7SA 4M60A 3N7AA 3GJ0A 5D7BA 5TB5A 2VTDA 1EH5A 4JBLA 2BMVA 5CDFE 3E3NA 1LQ2A 2PVCA 3WB9A 4NNJA 1NOJA 1U6IA 3WK9A 3P27A 1CZKA 5WRFA 2INGX 4C06A 3LOUA 2FAXA 1EG7A 3VR2A 4F4UA 1U0BB 1FVHA 4LZAA 2PRSA 1O97C 3UZUA 2FG6C 1R0RE 3L93A 3NDIA 2PKWA 1G8SA 1K89A 3EC1A 4Y6OA 1T35A 4JHXA 2HNKA 5EIHA 4F86A 1KK3A 2DMRA 4FNGA 1CEEA 4I9UA 4OUDA 1XCMA 3R6DA 2WKRA 2J4CA 3BICA 3AERA 4G37A 2QPLA 3L04A 4W6ZA 4WLOA 1BKSB 4BXOA 2WV9A 1PCXA 4DG8A 4I08A 3RQIA 4H6VA 1XX6A 1KU0A 4Q48A 2W9XA 1GYQA 3A9SA 1AHNA 5DYTA 4EJ0A 4O4LB 4D2IA 4TLAA 4RD3A 4V0NA 1NN1A 2FLVA 3PITA 2RHJA 4ZYYA 4CV1A 2P3OA 3LTEA 4LJYA 3V4SA 3ZH9B 2H57A 2O4CA 2QSUA 1CUIA 3ZGVA 1TA4A 3L8DA 4EQ6A 1LBHA 2IE8A 4TS9A 3AJ9A 3S2IA 3SQLA 2Q5HA 3FPLA 2C2ZA 1GG9A 3LA8A 1ZMOA 1KJQA 3OTQA 3U3MA 2UYOA 4A5OA 3OPMA 4MQEB 5C1DA 1K97A 4N8SA 2WIFA 4NPHA 5KX5F 1KWKA 1N7HA 1N7JA 1XEWY 4DA8A 1LBSA 4Q3DA 4M88A 2H06A 2GO7A 1K06A 3KJXA 5LQCA 3V7WA 5JS7A 1YQWA 1DG3A 4BX0A 1I8TA 3BD9A 5KYXB 5JZ9A 1DKUA 1X2EA 4GOKA 3M33A 2PUCA 1NW6A 1KA9H 1NATA 2HDNB 2WFLA 1EIZA 3KM0A 1K4MA 2FCAA 1QKIA 5AI9A 3WLKX 3ORRA 3ZGXA 2EU8A 2B4KA 1EBBA 3OTGA 4XQ0A 5L45A 1G4HA 3VUEA 3G0HA 2EATA 2OTCA 3INGA 3O73A 1DQYA 1O96A 1W0KD 2XYPA 3ETHA 4PYNA 2WVAA 3WHIA 4DKXA 3S81A 4OHFA 2GO1A 4HLUA 1W93A 1G8PA 1ZK0A 2YIVX 3D7LA 3G7UA 3NHLA 3RRXA 5AXAA 1GKIA 1K7CA 6REQB 4AJOA 4EKDA 4G0WA 5DNAA 5GPBA 4BTEA 5HRUA 5L3QB 3N59A 2Z6VA 3HBFA 5CFLA 3FLMA 3RIXA 1RZRD 5JLAA 2XUKA 5A6SB 3KOUA 2MJLA 2OEPA 1Z13A 3DZKA 4RQAA 3VDQA 4JYPA 3KLPX 4UHJA 2J07A 2V1UA 2IU4A 4DGSA 5JCJA 1CJKC 3GWZA 4EGAA 4DWWA 1SXHA 1LPOA 2O8NA 2R6R1 2JJQA 5FL7A 1QIFA 2AD5A 2E18A 2KPOA 2QAGB 2JJ2A 3LT5A 4FWIB 1GD1O 2C03A 2WJWA 4OLFA 3SI7A 4FR0A 2PPVA 3ILXA 3P8ZA 3TCKA 1NC1A 1K4YA 1Z26A 5EI5A 1BOFA 2A5FA 4J7CA 1P9RA 3WK6A 5I3CA 2JVKA 2VP0A 2HBZA 2ZIZA 5E4YA 1Y33E 1DC7A 3FCSB 4M8SA 5SYMA 1JEYB 1H05A 2NQTA 2PRZA 5GVSA 4HUQB 2XUAA 5GMOA 2EVWX 3LO5A 2M32A 4FMPA 2GZRA 3R0QA 4CF7A 4KXQA 4Q47A 2CHEA 2Q7XA 3NT2A 2GLUA 1NXPA 3QWFA 4O2BB 1T9KA 1XVVA 3MPOA 3LU1A 1Q21A 1R37A 3F2IA 1N8SA 4ZVKA 3WOHA 3WVNA 4MQFB 1Q11A 5KHLB 2DBZA 2ZDQA 1T6YA 1KPIA 2XNHA 4RXMA 5LBIA 3UWSA 1YCGA 2BSAA 3VUFA 4G4JA 3LBIA 4DDKA 1MAAA 2RB4A 3B13B 5I45A 1SZJG 2YZGA 4DLUA 5J58A 3E5NA 2BCJQ 2O3TA 4MEJA 2QP9X 3DMHA 3TSAA 1H0SA 4HTFB 4GHWA 4X1YB 3G5UA 3CLSD 4FYPA 3R74A 3AP1A 3NNNA 3U7JA 4L5CA 4N0EA 3I5MA 5JRDS 4PYRA 1Z4QA 4I50B 5BSWA 3BT7A 1GILA 3L7JA 1HORA 3NHFA 4N0PA 1A8PA 1E3QA 1VIMA 1JVBA 3BIOA 4V0OA 3WK7A 1GGMA 3QEBZ 3ZCXA 1QPZA 3CUUA 3JWJA 4JGBA 4G0ZA 1CZNA 1OAKA 2OGUA 2UUOA 3DB1A 4Y2TA 4HH4A 1E2JA 4JSYA 1ABFA 3HSKA 1SCBA 1WCXA 4QOJA 4E2WA 1PJBA 3CX6A 4WBNF 2QK4A 5KSOA 2PWYA 3P0EA 1YOVA 3HXKA 4MWCA 3GEDA 2D59A 1Z73A 1A76A 3ZU6A 4R7GA 3P96A 2J5RA 2RHCA 2AZTA 4WOBA 4KKXB 1SCAA 3ZBPA 3SSNA 1W7AA 1K0FA 2DWCA 1YZKA 4EMSA 3AHEA 3IVXA 2EQBA 4H08A 4JFRA 4WCFC 1H2FA 4B82A 1G8FA 1VGQA 3K96A 1UUFA 2DZDA 4AMGA 3HYTA 1TO6A 3I6MA 3PGXA 4ND4A 1V8PA 2VDUE 3LCMA 5EZ5A 4IIXA 2ECFA 4N1AA 3MZ0A 3A1UA 1DLIA 3O0DA 3GUCA 3M4YA 4JKIA 3JZFA 5F1YA 2P7HA 4AB1A 4B8WA 2F55A 5GJBA 4AQYB 1QRTA 1BHSA 4LX8A 3CEHA 3OTIA 1UPAA 3CHYA 3LUDA 2NPIA 3HLTA 3R3JA 4IF6A 4EYOA 3FPSA 2WF5A 3D8BA 3HRIA 3NYWA 4ZJYA 5CA0F 2C2KA 4ND3A 2G5TA 1L6RA 4LX0A 1NVKA 5LOVF 1N3BA 3GUZA 1ODIA 1X8KA 3CZ9A 3QWIA 1ZU5A 5JH7A 1OYWA 4KSBA 4N03A 3KTAA 1X94A 3FTPA 1DOHA 1MP0A 2HIMA 2XDQB 5FPTA 4BQQA 3H5TA 3Q41A 2X0FA 3SBXA 2GYUA 5DX0A 3K1JA 3PLAE 4IOLA 4J3FA 3W7BA 1SHUX 3JRXA 2X0EA 5JCZA 4KFTA 3H19A 3QX7A 2W0MA 4M9RA 3TQSA 1JQ3A 4ZKDA 1KH2A 1I13A 2H9YA 2CYCA 1T8TA 4P83A 2J9YB 3NWJA 3O2NA 2NN3C 1HT1E 1GARA 1AGYA 4ZVNA 4M1QA 4XM0A 3O92A 2MINB 1AQNA 2ZBFA 4Z0HO 3IP1A 4PR0A 4DIMA 4L5YA 4JQZA 1DQRA 3PD1A 3A2MA 2PTHA 1K5PA 2VLBA 4A82A 1XP5A 2D1RA 5KREA 1PL7A 1OZFA 4P84A 3O4JA 1ZJ5A 2VF5X 2B5WA 2ZCUA 1F9EA 1FSZA 4I4TF 2ZJ3A 4CKCB 1OKKA 2ZT7A 1WSWA 4HC4A 3TQRA 4E5YA 5F35A 5JFGA 2LBPA 3EMVA 3DVSX 5F64A 5HKKD 2WWTA 3IVMA 5H7XA 1JWAB 4LQCA 2VUIB 2C57A 1T9CA 2EERA 1JIQA 2Y9MB 4FUTA 4HGNA 5ENDA 3VPCA 4JYMA 5ER9A 5DHRA 2IUEA 5CTAA 4U00A 5C1PA 4OBXA 3OEHD 5TPWB 3CPJB 3ROKA 2JLSA 1ENOA 4X94A 4KYUA 2GJSA 1FYDA 1MBZA 4ARVA 3ZZUA 4GYYA 4LVUA 4EUHA 1P3JA 2WIGA 2VEDA 2J59A 4PCAA 3O94A 3TD6A 2C8JA 2J7KA 3QJYA 4O4HF 2BDTA 2W2PA 4ZCQA 3W8EA 3C85A 1JE0A 4R1PA 1D1SA 4X1OA 3QE0A 3ZHRA 4E32A 4YLYA 3EHEA 4ZC8A 5L9AA 1FUIA 3FROA 3MWLA 5KTKA 2WU8A 1GDDA 4M1EA 1TL7C 5DW0A 3OESA 1N1MA 3GJYA 2A5DA 1BVUA 4ZZ2A 4BMPB 5ULLA 4G24A 1RQRA 3FG9A 4QQRA 4O2LA 5FKJA 3BGOS 3I12A 3OI7A 5BT9A 1BYIA 2XUIA 2H18A 4M1WA 5E8JA 2H4YA 2M98A 5I9IA 2G7MC 3L5KA 2OCLA 1FFXB 1SC3A 4RIIA 4YY3B 3QEMA 4NMWA 3K0HA 5KYVA 4YAJA 3FFTA 1QIHA 2VKTA 2XXBA 3GAFA 3EGXA 2C2YA 3ETGA 3H8JA 4B9AA 2A1TS 3TIVA 1WV0A 4KIJA 3H2IA 3OCUA 5DTEA 1T9AA 4Q6WA 4HUJA 5HFNA 4BN0A 3P9QA 3ZV6A 2JRCA 4QHYA 4TTTS 4HB2A 5ESDA 5K0FA 5IAGA 3OZTA 3ENKA 5D3MA 1VPEA 4GI5A 2BN4A 4V1CA 2VDKB 3PPWA 2XYQA 4RA9A 2E4UA 2N1BA 3IAS6 2YXLA 2YWXA 3ISTA 2DGDA 5KAPA 3WFJA 4FYMA 4B6RA 1DKPA 3LKDA 4JI7B 1JDJA 3WISA 1EXDA 4NFSA 2GLTA 2QLTA 3DMDA 2B1GA 5T8KA 4D98A 4KE7A 2WAMA 4AZ0A 2YVKA 3MTJA 5TS2A 3QBEA 2A33A 2UV8A 1FC0A 3MOIA 1U8UA 2A59A 2X1MA 2O54A 3T94A 3JQRA 2PYZA 4MS1A 4PCVA 2P2LA 3S5JA 4Q4JA 2BJWA 1SK8A 1MJ5A 3TL2A 2P11A 3I0NA 3MJHA 1XN1A 4K8OA 2ERXA 5BPHA 5KJ1A 2ODPA 4IZHA 1NURA 4XB1A 3HMQA 1N6IA 6YASA 4KH1A 1HNWB 1Q91A 1W5BA 2DBYA 4FYIA 4IXMA 3UG6A 4U3JA 4HLUC 1ZN9A 2JD2A 4EPVA 2PGNA 4NARA 5EYPB 4LF7B 2DPYA 3BM5A 1NBMA 2B83A 3AF3A 5DGXA 4N41A 4I3FA 5E4JA 5KS2A 1SXQA 1OC4A 3A1WA 3PEUA 3TF5A 3MTBA 1Q3HA 4HDOB 4IG9A 5HF6A 4CM8B 4LC0A 2RGRA 1V8DA 3I04A 5ENZA 1RPZA 1KP3A 4UPVA 1L4HA 3BMCB 5A5DA 3V9PA 1A27A 1QQ7A 1BWRA 2GZMA 3WWYA 1P1JA 3JTMA 3NOQA 3W8NA 2WA1A 4Y2PA 4FBLA 3GRKA 1A4IA 3B51X 2E4AA 4CMIA 5KNDD 1N3IA 1YJ5A 2ETVA 2JK1A 3TLBA 1X92A 4BQNA 5BSHA 1IZ9A 1ADFA 2WVJA 2B34A 4U0KA 3E8XA 3V32A 1DUSA 5L40A 1WXDA 5EWMA 3OZGA 4P92A 1REQB 3NHPA 3BH7A 2Z2ZA 1I7NA 4XPIA 4IHJF 4ZD6A 5DHFA 1ILWA 4YLEA 1BCRA 2EBWA 2GHRA 3NG1A 3MF4A 2HLDA 4L5BA 4TKUB 3NHKA 4UNQA 4X8OA 4YCMA 1XDGA 1WD5A 2VYVD 1EYZA 2NU6B 3ZBUA 3QPUA 3TIGA 3IEUA 1EIWA 2MOKA 1DIAA 1VE9A 4HI0E 4BWFB 2MSNA 5DGIA 3MOSA 4L7VA 3HU1A 4RGQA 2CFIA 2OZEA 2XW6A 3E9RA 1QHIA 3GPBA 3ZWAA 1MJGM 3CQ9A 4RJJA 5TVGA 3C6KA 2NPOA 4PC2A 4XASA 2I3GA 1AF7A 3LPMA 3LGAA 2AFVA 2VP4A 2NU9B 5EHQA 4JN6B 4GI7A 3UNXA 4FCCA 2ORYA 1KARA 2IHZA 3L02A 2C3UA 4B2IA 5CDGA 1BVHA 3A31A 9LDTA 4R41A 4IDFA 2J45A 1GGNA 3MGGA 3DMTA 2O3QA 5HQTA 4OB7A 1F06A 4PO3X 4I3HA 1C7ZA 4EK9A 1GGJA 5ALMA 2ZWVA 2PV0A 5EXDA 1RWXA 2OV8A 1ZR2A 2K7FA 1V11B 3DAGA 1HE2A 1S8NA 1SKQA 2Q8QA 4ON9A 3VR3A 4EKNB 1Y8QA 1C1XB 4JNCA 4N49A 4QWMA 3KXPA 2R47A 1ULUA 4ARAA 3BE8A 3G2MA 1RZ3A 5E3IA 2RONA 3O31A 1V8OA 5G02A 4QM6A 1Z0JA 2H65A 1C9KA 4X41A 3SQMA 1BW9A 1Z5VA 1GQOA 1B3RA 2KWIA 4JUDX 4M21A 3CUSA 4RVDA 3OD1A 4JODA 4ZODA 1TD9A 2D7CA 2FETA 2MR5A 2FSSA 2P5UA 4RL6A 3UW1A 3AEYA 4LIPD 3W7AA 4Y67A 1Z6PA 5DBEX 1EUQA 1I6WA 3SQWA 4KXVA 1MAWA 1XSEA 3HGMA 4HMQA 4M99A 4TUYF 3A6HA 3UY4A 2WT9A 2EZUA 4J29A 4QXMA 2VCHA 2Y66A 2HPZA 5JJBA 1WVIA 4MINA 4O2AA 4BMNA 2ENWA 2WSYB 4DQKA 2JZOA 3PSAA 5FUMA 1M34B 1Z16A 1RU3A 3PFNA 4KOAA 4LZPA 1RE1A 2WI8A 2XA2A 3LSTA 4EKIA 5CCBA 3AH8A 4YRDA 4BEWA 3BL8A 1V2HE 2O4UX 1NXXA 1V3UA 3SDSA 1ZJWA 3AFNA 2GAOA 3EIQA 4OSPA 4P4SA 1NLYA 1N0VC 1V26A 1OX6A 3B5JA 4Q7JB 4RXUA 3TTWA 4M0LA 2VPQA 4JC4A 3SVTA 2Y1LA 4YMTA 1GG8A 3R6WA 2V98A 2C77A 4GBMA 3IELA 3I1IA 3M8KA 3TVDA 3W5UA 4E7PA 3WICA 2OC9A 2JIBA 3MBOA 4FCTA 4NZMA 5BR8B 3GZJA 1D2HA 3GQVA 3ZDQA 4CL8A 4CEHB 4DZTA 1RYYA 2ZYHA 4UFOA 1U28A 5GM1A 3RUIA 1EFCA 4TMWA 3ZI7A 4LNHA 4LGCA 4DRYA 4EFDA 5CB6A 2HSWA 4Q3CA 3HR8A 4BATA 3KT8A 4BECA 5BR7A 3P2YA 3DMYA 1ISPA 1UANA 2IYPA 3AR7A 2H9IA 4B73A 4Z7NB 5LQNA 2Q0QA 2YN2A 1XJ0A 2X5XA 3DBHA 4Q18A 4UBLA 1U2SA 5IEBA 2LXNA 5B7PA 3FRHA 2DHEA 5H82A 3AHHA 2J0UB 2QY6A 5KYUB 4X24A 2W6JA 1GPYA 1L1EA 3DO5A 4PGFA 4PHFA 4EA7A 1ZNXA 4IGKA 4OJYA 1EVJA 4O6VA 5KQLA 2D0OB 4LE1A 1H5NA 1ULAA 3ED5A 1UZUA 5CK5A 4YJHB 3CX8A 5EMHA 4WBNA 2XCRB 2O8BA 1AKYA 3IAM1 1V35A 1U4SA 3IDZA 4ER5A 1S9HA 1T5TA 5EUMA 3BUSA 5U9CA 1S7GA 3PXBA 3VR2D 1EVZA 3NBYC 1HQKA 2QBYB 3AEZA 3FHCB 1RYBA 1WVGA 1MV8A 1OX5A 1QNFA 2Y92A 5IHPA 1P9WA 3A6FA 1FBNA 4KPUA 2C8KA 2W6ID 2XMZA 3S2EA 4L75A 5GP1A 4C7OB 1Z4KA 4JLDA 1U94A 4NC9A 4AJLA 2QPAA 5G0VA 1AHPA 3L6BA 4GXRA 5JJLA 4LHXA 2IUYA 4RF3A 4PC7A 5JWHA 1ZM9A 2VH2A 4BNYA 5C37A 1FK8A 3FFWA 1PJZA 1BXRA 2VRCD 2X9GA 1IBRA 1V6AA 2CLHB 3IAFA 3GA0A 3OSZA 1KERA 1UBTS 3WGLA 1CBUA 1CQZA 1IAQA 3L4EA 4PZEA 1RM0A 4I4CA 1K8RA 4U2KA 5CA0A 3SG0A 5LVAA 3CEPB 5FOWA 2G9ZA 1IBMB 4DDVA 3T0GA 2AWNA 3O74A 3WDMA 1YFLA 1ILEA 2PBLA 1KZ6A 1QWOA 2Q8PA 2XUHA 3JR7A 3S1LA 3SEZA 3T7IA 3E3OA 4D3XA 2WT4A 3HUEA 1DO2A 1QZUA 2OYSA 3CB4A 3ILVA 5ALJA 5F5XA 4OLHA 3PC7A 4N3CA 5LMNB 4B3FX 1WMSA 5AW6A 4ZMRA 3KZXA 5HXAA 3UHAA 4OHOA 3V1MA 4RF2A 4L9AA 4Y0AA 4YRCA 4ZVSA 3A6PC 1O0BA 3ZV4A 3B5EA 2CKMA 5AVOA 3AV3A 1Z12A 2FRXA 3C3YA 1DPFA 2C0QA 1K5GA 1NJ6A 1YJQA 1TAHA 3O90A 3OLWA 1BNCA 4HNQA 5GJWC 4EHHA 4J0KA 4OJNA 4GX5A 4P3OA 3X1MA 2QX8A 1Q2UA 1HXHA 1QIDA 2DWOA 3N58A 4JLNA 2Z1MA 4GZ6A 2GZDA 3NDPA 2O05A 1ONOA 1U0JA 1YS4A 1R0YA 4FI3C 4QUDA 3OTOB 3WNBA 2HJRA 2WMNB 4I4TA 4G85A 4R69A 3PHHA 2X77A 4MRPA 4MCJA 1ZG3A 4OJQA 2AVDA 4WNAA 4ZREA 5MFZA 3VKGA 1TKRA 2I2FA 4MR9A 4MP6A 5KJFA 3ZDFA 5LZ8A 1G8MA 1M6YA 1JEQB 3THWA 4M1KA 1RYHA 2O8EB 1BWQA 2XQVA 4PYMA 3D6MA 4X85A 5EJ5A 2XXAB 3RADC 3GAAA 1Z0DA 4V0LA 1G17A 3CCCA 4JXXA 3CT4A 3LYAA 3MAGA 4UNRA 4ZT2A 1K6XA 1SZDA 1KZYC 4K9OA 1OWNA 3FA2A 3PC3A 5AW9A 1PT8A 2GKGA 3G49A 4HEHA 1GFSA 3B6ZA 4YYZA 1QHGA 2P41A 1US8B 4O4HA 1AXEA 5FCDA 4MQ6A 1XZAA 2W90A 5EP3A 3I5YA 3U1VA 5CD9A 4L0DA 5KOJA 3MHTA 2B2CA 4R51A 1TYEB 2VUSA 4HNTA 2ONCA 2MSWA 4RA6B 1X77A 4XCQA 2CFRA 5AKZA 3B6EA 1G1AA 3G3EA 1XHLA 3LUJA 3RVPA 5FV4A 1PWZA 1DEAA 5BVHB 3KDSE 4DVJA 2QSJA 4Z54A 5ELXA 1V1RA 3N6VA 4TL7A 3V8EA 2GNPA 4QAQA 1GU7A 4WOPA 3W6OA 2ZJ6A 4P2GA 3ZW7A 3JQCA 3PXDA 1GQRA 1WMBA 1XU7A 4NPCA 3GMSA 4MV0A 1R0LA 3L0OA 1HKUA 1OLUB 4BO4A 1DOAA 1R3UA 2R4QA 2WIBA 3ZR4B 5F3WB 1FQOA 1BXZA 3CH5A 4O08A 4QLBA 5BOSA 1P1CA 3JPWA 1BH6A 3Q11A 1Z4JA 1TADA 2IY8A 2WM3A 3LHKA 4RVNA 3SFTA 4GKBA 1JU9A 4B74A 3E0QA 1RJWA 3TLZA 1U1EA 2RD2A 1BHQ1 6ADHA 3PTAA 3PG5A 3L82B 3D9QX 4IDEA 3GLSA 4A8JA 3NPAA 5CDYA 3UMFA 3TAHA 2OYRA 5DNEA 1P2BA 1LVHA 3PDCA 1FQKA 2YHIB 1R88A 4ITUA 4ZAWA 3RROA 5LMUB 2W7TA 1M2OB 5KU7A 4ZCSA 3VXKA 2JBHA 2EBUA 2ESRA 3OQPA 1GQYA 4GMXA 3TUJC 5IANA 4PHGA 5ITVA 5BT8A 1FJ2A 4NG5A 1L7QA 2A3RA 2AR7A 3G5AA 2Z3ZA 4M0KA 2L18A 5BNTA 2WTAA 3F9RA 2NSJA 2OR3A 3UAYA 4M7OA 3G1TA 3UICA 4NFLA 4U7DA 3OMXA 1VPTA 16PKA 3VYWA 1MIOA 4RLQA 1MXFA 1P77A 4D5EA 3BB3A 5E1MA 2CLLB 4TOIA 4H6PA 421PA 4Z4CA 1IN1A 3QPBA 2CZGA 2X0JA 5BN3B 4WDQA 1C1DA 3BF8A 3IUMA 1GR1A 3PZBA 1BS1A 3SIPA 3V8BA 3HUDA 4D45A 4W1QA 1VM6A 5TGZA 3RJTA 1P1IA 2NV0A 2FV8A 3WKCA 1IEXA 1WCV1 1XZEA 9GPBA 5KMGB 5JNLA 1V71A 3A3NA 4DWVA 2QRHA 1EM8A 3GCXA 4FW9A 2Z57A 3ABOB 3U0BA 4OHCA 3P32A 2LE0A 1RT9A 4RQTA 1K4KA 2B9EA 3IT2A 4PQFA 1M74A 3A9CA 4F2WA 1FA9A 1Z7WA 4ZIRB 3JYNA 4WD3A 2WWWA 3O0TA 5EWJB 5JU6A 1BA2A 1NZFA 4IHJA 1O03A 2X8BA 1N2EA 2ZYWX 4KDCA 1SHKA 4GX0A 4O0LA 1H8EA 1OFGA 2OZPA 5E6RB 1I7DA 2CXPA 4URWR 5BYAA 2XRZA 2AKAB 4O1MA 3QPAA 3EBOA 4YJ2F 1B14A 1FF9A 2JW5A 3CNQS 1EJ6A 3QELA 4IDAA 2DE0X 1ZW1A 2QJTA 1E3SA 1R0XA 2QRJA 1A9SA 3N74A 4RPLA 4YRQA 3DBVO 4CFYA 4OB8A 2BUBA 2CC2A 4DRXB 4IGIA 3TLEA 4XD2A 4ZPJA 4C3VA 5AJUA 4RHUA 1PVDA 4FPXA 3TOSA 3FYUA 4COOA 1V96A 1CUYA 1YDFA 2KSQA 2YVAA 4G86A 4KV7A 1U28C 2HMAA 4Y9TA 5GJVC 3QUAA 4ENVA 3EXEA 5I9TA 1L7PA 2JGMA 3KXIA 1DAPA 5KHAA 3MWGA 3UT5B 3PENA 1SWWA 5C4GB 3TH5A 3WS7A 1K3FA 1OI7A 4V2UA 1E9FA 3PDWA 4TXLA 4URVR 1QOZA 4Z7OB 3OAAD 1G7SA 1QX4A 1E2GA 1LF5A 2NO6A 2IYTA 4NS4A 5I8PA 3N0WA 1AQUA 1NX9A 4FYXA 4PIVA 5COAA 3VGPA 2YQ5A 2ZE6A 1QZZA 621PA 2Z9DA 3EASA 3RRZA 3T41A 2BFEB 1EX1A 1BX3A 1FXSA 1PNOA 2XNDA 4HZIA 5E8RA 3OCJA 3RNOA 2C7BA 4XEHA 4X1IB 3D02A 3ZVMA 4C5BA 2G08A 1EFUA 5K09A 3DL4A 3ZQKA 4GM4A 1QORA 1Y7IA 3ITDA 1Q14A 1Z34A 2PO7A 2V4ZA 3X1KA 1D4OA 4OHZA 1BO6A 5EZSA 1RYFA 3SNHA 4WN9A 5DP2A 4AO7A 1WM1A 1XEWX 1RAEA 4JLMA 1L8XA 2RAPA 5FPSA 3LDFA 1H1DA 4J76A 1U4NA 3PDJA 5A3JA 3GQBA 2BSXA 3ENNA 1EVKA 2I3ZA 4PIPA 4RV4A 2WZBA 4TTSA 4BJ5A 4WTOA 4TUYA 3H0KA 3RF7A 4DR6B 3DAPA 3HUFA 4L5JA 4FU0A 1C9EA 3A05A 4JY7A 4EI7A 1KYTA 2HZBA 3VH4A 5JS8A 3NTLA 4LRYA 2FPOA 1CFZA 4NATA 5ERGB 2ZRNA 4MGKR 1NSTA 4CLDA 1IC6A 3G23A 5JYCA 3IFSA 5C52B 1WB6A 2Z8YM 5C8YF 2ZVJA 4KK4A 1QP0A 1VE6A 2WTMA 1P9NA 3EISA 3HB7A 5AOVA 3DUWA 2F3SA 1X7GA 4GMDA 1UODA 2VT6A 4P5EA 1NBHA 1M0TA 1XTTA 1J0DA 2YN4A 3D8NA 4GPTA 2OXIA 3W6PA 5JOQA 1HFWA 2Y0EA 4NVRA 3C16C 2ACKA 5E3HA 3RUDA 1ZOIA 3KR1A 3PGLA 1NR5A 2DCMA 1JQJC 1SC4A 4GSKA 2COUA 2HDOA 2OUIA 2Q5FA 2W8BA 1D4AA 2O2ZA 3OA0A 5D8DA 2NSDA 1AZTA 1PO7A 3SX0A 2OO5C 1ECBA 2II6A 5AJHA 3WL3A 4CE6A 2WK1A 1ORWA 1JYEA 1GT6A 1RCTE 1FXWF 1X87A 3F5MA 4NCKA 5FRDA 5TT1A 1K3TA 4B4DA 2UU9B 1C9NA 1VRCA 2RG1A 5B1IA 3KVRA 3W04A 4GU5A 3VVBA 3PI7A 4FR5A 5JD4A 1H1TA 5KOHB 3B6IA 3KU1A 5GONA 1VDMA 2GCOA 3GVPA 3PDHA 1LTKA 2XWQA 3EEOA 4KTVE 4LMAA 4GOOD 1IHYA 4RTJA 1B16A 5C4MA 2IYNA 4MICA 2WFLB 2ZB4A 2BKVA 1XDSA 2C4UA 2RARA 3EDOA 4LBWA 4W6QA 3V55A 5B6PA 3FHTA 3K16A 3CNHA 5KUTA 1NVXQ 2RH8A 2X86A 5G4LA 1RQ2A 3BRCA 4D5GA 1LPSA 2I6SA 5CM8B 4XCXA 1HOXA 4PXYA 3N0RA 3VZCA 1N5LA 1COWD 5G1PA 1ELOA 4FHGA 3CZPA 5F7ZA 4F04A 1MX1A 1Z0UA 3GFTA 4DV2B 2WV7A 3GVCA 3ZJYA 1AUPA 2JIZA 3K0SA 1W1WA 3V4RA 1ML4A 2ZIWB 1FRVA 1E89A 1TCUA 3GUUA 2PX5A 4FDLA 4G4SP 1JKXA 4MPRA 1ONSA 5KO2A 3EZLA 2C9DA 2WUDA 3F4KA 4MAFA 4OKNA 4ZQGA 4KXLA 1KEUA 2Z8ZA 3NBZC 2NX2A 5KYKA 2C99A 3D64A 3L4BA 4CZ2A 6Q21A 4GXQA 5LLSA 1A2QA 1ZCAA 1C9MA 3PA6A 5FBVB 1STOA 2R6GA 1QG0A 4LVNA 2Q0XA 2ZE5A 4ALMA 1U2QA 2H29A 5G3ZA 1T2EA 3AVOA 2ZETA 5EMJA 5KSWB 4BO9A 1YIOA 4P54A 1AB5A 2PS9A 3OOEA 4KLZA 3FIJA 1N9GA 3EDMA 4M8LA 4NZPA 5C51B 4MS4B 1RNLA 3U61B 5H80A 3HJCA 4CT4B 3KQHA 1WQ3A 2CV2A 3OLVA 4FE4A 5JAIA 2DQKA 2ODEA 3HL0A 4E15A 3CRW1 1EINA 4FDVA 1IBKB 1TA0A 5BSVA 3QYAA 4IDGA 4ZO8A 4GKJB 4LRQA 3CUVA 4Z7JA 1NR1A 2FZGA 5EJ9A 4QTYA 3K1TA 3ZGZA 3VC7A 3FMFA 2PFKA 4CM9D 3K6SB 3I2JA 2CJWA 3R5XA 1A5AB 2JCXA 4MRAA 2QLFA 5INTA 2OBMA 4KWHA 4DXDA 1BAPA 1P5FA 2ERYA 4WEQA 4BNGA 4E5NA 3T4XA 3AJEA 3TQQA 4MW7A 2EJVA 1TVMA 3DFFA 4PS0A 1VL8A 2QYTA 2WFZA 3DWFA 3PNQA 4MKXA 3UN1A 2XITA 1HDOA 2XDAA 1IXRC 2XUFA 4RANA 4PO1A 2M6KA 2E2WA 1A4XA 4QLOA 1IHPA 5CURA 3SSAA 1EHIA 4D3FA 4DJ5X 2B36A 2GH1A 1SCNE 2IXFA 2QMHA 1HYQA 4FNOA 1ZGHA 2ODQA 5J2UF 1CS0A 2QNBA 1AKWA 2J9FB 4NCJA 5GINE 3H65A 5EMMA 3F9CA 1TLFA 2CLSA 2Z30A 2B7BA 1G3RA 4JSRA 5FBRB 4QGBA 5KKAA 2LCQA 3ZD8A 1E2QA 4U8HA 4MHSA 3SX2A 2I4TA 4ZCIA 3QXSA 1W4CA 4M2LA 5CIWA 3HV0A 3C14C 3UYKA 2QF7A 1NL3A 3ZCSA 8ADHA 3GGDA 5JDCA 1KVQA 1GAQA 1JQLB 2QNRA 3AESA 1MH9A 3W34A 1JI0A 3FMIA 1T1RA 2XAUA 3E7DA 1TIBA 3N1UA 2JL1A 5K6AC 3M6FA 2GETA 3QVXA 3RFFA 2ACVA 3MTGA 5BQ5A 1XCBA 2CHQA 1UMBB 1S2MA 4LZLA 3JWGA 3KG2A 3MMSA 4QXPA 4CT0A 3GRFA 3SVLA 2VHZA 2DQYA 4Z99A 2OORC 1M2HA 2HHJA 3NM5A 3TWOA 5HCUA 5TMEA 3DTYA 1VC2A 3PP8A 1UJ5A 4K2AA 1H4VB 4U6NA 1HUQA 3VOAA 4C0KA 5HR5A 1MGPA 2W42A 3B5IA 5DNVA 1ID1A 1WAMA 2C20A 3IOYA 3WGHA 1K8QA 1HTTA 1UFKA 4UCWA 5A1JA 5FEMA 4DEXA 1NZJA 1NI3A 4FXPA 2EZ4A 1BEZA 5D3ZA 5EJMA 1L8LA 2LZ0A 1RBQA 2Q49A 2QMYA 2WOJA 3PR3A 2WJYA 4RWZA 5DNYB 3U4HA 1FMLA 3KYDB 1SB9A 3HKBB 3NQ41 3E7FA 2EW2A 3GRUA 2DH5A 4YMSA 4XVUA 5DM1A 4JHLA 3F7MA 4X1KB 4L28A 2CF5A 2I62A 2JASA 3L5OA 5SYAA 2RG7A 3OM1A 5F2KA 5JH7B 4WLNA 1E3WB 2G0AA 3BWEA 4FS8A 2C5LA 3M2PA 4KLNA 3FYUC 4XB6B 5G4KA 1FS6A 4HAXA 5ALVA 5EL0A 2WWVD 4CMCA 4C4ZA 1AH2A 2H1CA 4IZ6A 2FPUA 1LTHR 5AKKA 5GAJA 2J6BA 4AJNA 4Z0PA 3QVWA 2REQA 1F4VA 1DC6A 1K9VF 2EBFX 3K5IA 3CZQA 4TM8A 4UU0A 1O8CA 4YFYA 4YI5A 2K6GA 3OZXA 1GZSA 3KUDA 2RK4A 2O6LA 3IMKA 2Q3CA 3K3PA 1Z74A 2W70A 1SXPA 3N5KA 4M7WA 3EVGA 3QMPA 3NFRA 3DW1X 1PIWA 1UFQA 1NE2A 4Z6KA 4P6VF 1KHTA 1PJ3A 2C5GA 3EA5A 4RH1A 3UK1A 3S8YA 1E77A 4YRTA 2D5LA 3GNQA 4XYBA 3A1EA 4YAWA 5AYVA 1UPXA 2HOQA 2GUWA 3FLAA 2Q2QA 2N0SA 2DPGA 4RC9A 3DEFA 3IE0A 1QH1B 1RFGE 4YIHA 2JBAB 3KQNA 4Z4IA 3UUFA 2P9CA 2JPDA 5EE9A 2IQ5A 4JOSA 4QDOA 3VR5H 1QOPB 3KJZA 3OVMA 2JFQA 3IPRA 4BEVA 3F90A 4LKRA 4MKIA 1EPUA 3I73A 1G5TA 2OXTA 1IE3A 1ND5A 4S1TA 4FM9A 1J21A 1IN6A 1RQXA 2A94A 4Z86A 1VI5A 5IH3A 3FPFA 3PE6A 4MJ3A 2IZ1A 3WTCA 2CJPA 3ETLA 1E66A 1Q19A 2HHAA 5FYDA 2HPHA 2VNHA 2MYNA 2YTZA 4LG1A 4RKQA 4DT1B 5FA5A 2BGMA 5C4IA 2WQZA 4KNWA 4ND1A 2I4LA 4D9CA 2VNIA 4BVKA 4X20B 4F9TA 5GGXA 5IPFA 3VR6H 5DNUA 4OYLA 1RRMA 2BDUA 1CR6A 1P7ZA 1XAHA 2YOHA 4ZT3A 1S3IA 5H4GA 4Z9FA 1DTSA 3W4IA 5MFPA 3STWA 2X42A 1V5GA 4NESA 4CKBA 4KFRA 4RF5A 3VISA 3IPAA 2V97A 3H7AA 4M9SA 1OT3A 1P19A 3LO8A 1B6RA 2HLHA 2AMYA 4UUQA 3SLRA 4OJKA 3RYIA 1H4TA 4YJ2A 2PU5A 3RC8A 3UAGA 4DIEA 5A04A 3TGPA 2Q28A 2QI9C 3P2MA 3QEMB 4HJRA 3U39A 2QG6A 3A11A 4MVJD 1HC7A 5DMXA 3UM9A 1HWYA 3A3PA 2EKQA 1Y8RA 3E5RA 1J0AA 3H5IA 2PSFA 1X0XA 5JADA 4ROSA 3CIFA 2AJCA 1VKHA 1NXWA 3OO1A 4FIZA 1B6SA 2EX0A 4K6MA 1P0FA 2HWKA 4RO0A 3USCS 5IT9A 3KHTA 3W9UA 2E85A 4CI9A 1U9JA 1HZJA 1L7VC 4Y9RA 3I28A 3IKLA 1O54A 3IOBA 4ZCLA 3K20A 5MDHA 1Z36A 4CCAA 1HETA 2I3DA 3BTVA 2QTAA 4D8WA 4XIYA 1NUSA 2VVTA 4G0NA 4GMGA 5FOXA 1E8DA 2BVNA 1LJLA 4RGYA 1ACJA 4Q4JB 2QRLA 1Z37A 4JD5A 1IY2A 3INNA 4BC0A 4CEJB 2R96A 2XNSA 4HRXA 4IZIA 4RH0A 1OI2A 3DEYX 3LIIA 1NONA 2Z5VA 5TQVA 1RRCA 2AN4A 4LDNA 1JLLB 2J87A 2P2NA 4A73A 3QVKA 3PYXA 4EHKA 3FFXA 2JJ1A 4AZ3B 3EGCA 2EFDB 2Z04A 2J9XB 4PGGA 3WK4A 4LDJA 2GJ9A 1YK0A 2VI5A 5I5GA 1ZK2A 4EJ6A 3I45A 5IDVA 3PZRA 4IMRA 3LKZA 4JWKA 4CDGA 4POOA 4WQMA 2WKWA 3NXSA 4B3CA 1SUDA 5LLTA 4YMIA 2VNJA 1I5OA 2XIJA 3SKVA 5G53C 2OLEA 4URYR 3RU7A 3TD9A 2OCBA 1WE2A 1QH0A 3EPRA 3MJSA 1OHHD 3SS7X 5K05A 1KYZA 3ULKA 2IW1A 2H51A 2R5NA 3JQ7A 3MGBA 1BJKA 3NKFA 1T13A 4NAVA 1K3UB 1I24A 5LP6B 2RGGA 2DQSA 3BKWA 4DJDC 2HJSA 5LWQA 1WO8A 1LDGA 1H1LA 3Q10A 1LLUA 3K1AB 1PZHA 1W47A 2BR4A 2G9NA 3FOFC 2J0SA 1NN3A 1JR3D 4FYKA 5AM0A 2PZLA 3TPCA 3UHOA 3C3MA 3P2IA 5ADWA 1S2IA 5CHEA 1SM4A 3MBKA 4MVCA 1VKOA 5DK4A 1EZ1A 2QZ4A 3CPHA 10MHA 4QULA 4H3HB 1JQEA 4BUZA 1OZ0A 3H4MA 4AVYA 4DV0B 4C3UA 3P20A 4MOWA 3SHQA 3BWDD 1DQZA 2AA3A 1GQSA 1YRWA 2FX3A 3IH5A 5F2EA 2EKPA 3SBDA 5EUQB 4Z2AA 1MT0A 5BQPA 4ZU3A 3NBUA 1M6EX 1YXMA 3Q3IA 3H1AA 3E48A 1K6EA 2VDNB 5IS2A 1I4TD 3BSWA 4DA6A 4Q1BA 3BB1A 3OC0A 4J03A 1WV1A 4PEVA 4JEMA 1O9GA 2PUAA 3FHOA 1WSAA 3RNLA 4WGGA 1GCAA 1KEVA 3M3PA 5BVGA 4RFSA 3GVHA 1Z5NA 2IQIA 2XQGA 4JNKA 1ZJYA 4MK4A 2VG8A 4C7BA 1NN0A 3LGSA 2IHTA 1SG9A 3LRXA 3BRSA 4J0IA 4XR4A 3CUKA 4JBNA 4MVYA 3Q3GE 4ZVOA 5I9SA 3KYIB 3V1KA 3IUEA 4FFVA 2FXIA 4P3NA 3VPXA 3FTFA 1TUEA 3BMOA 1S01A 4GUDA 5EG5A 3OQNA 4JZYA 3EWSA 4JEHA 2YXEA 4FCVA 5TGTA 1YQTA 3VDXA 1JPNA 1XRMA 3LDUA 2LCFA 3QYJA 3EDQA 3VC2A 3EUEA 4AJKA 1PL0A 2UUPA 4IIJF 1H85A 1ZC3A 1J09A 2B21A 1ZMXA 1GUAA 1Y8QB 3I9NA 1PK9A 3KTOA 3MFYA 3PF9A 5LLDA 1E9BA 1FUUA 3WL6A 1E1QD 3QUBA 3L77A 1XTKA 5A2GA 2HXGA 2PZKA 4EHDA 4YT8A 3CEAA 4HWTA 4J49A 5B58T 3GC6A 1ZC4A 2VSFA 2ZIEA 5AW7A 2IS6A 5J23A 1V9LA 1UBCA 1XZCA 2OFXA 1V8ZA 1FNDA 3REOA 3WNDA 4DREA 3CINA 2VDRB 3D54D 4NDNE 3UHPA 5CFZA 4BPRA 3PRJA 1M33A 4D9EA 4AMZA 1N5KA 1X7ZB 1SA0B 4D74A 1ODJA 3L05A 4NE7A 5LN1A 1SBIA 2Q2NA 1T8SA 3FAZA 3JD1A 3IQXA 4O2AB 4C1NA 3TZCA 4ZHQB 1PAUA 1G19A 2C61A 2JI4A 4I8XA 3B8HA 4XQEA 4ZXPA 3X1DA 1F4PA 3CKLA 3M4XA 4Q1DA 1FPMA 4ZK2A 3HPQA 3GEPA 1HDYA 4GSLA 1C50A 4WLUA 4N0DA 2BCEA 3I64A 4XWWA 3X0DA 3W7VA 4OYYA 4AZSA 2B1QA 4P7KA 1VI6A 4B4WA 2RC5A 3KD3A 2FPIA 1QAOA 1T1SA 2AYZA 4HRYA 4U7WA 1A9PA 1BWSA 1GZ6A 5AHWA 1S8FA 3B85A 2H85A 3KTFA 4QUKA 2F9LA 1CR1A 4OHKA 4UTXA 3GU3A 3D3WB 4YH1A 1NBOA 3RS3A 1Z5OA 2C4KA 2N1MA 1FX1A 4F5YA 5MGBA 1MVNA 1HYBA 4C43A 5A4JA 1FYWA 2BZGA 2IP1A 3BTSA 1UC9A 1I3LA 3WGJA 5D86A 1KO4A 3PPIA 2NYAA 5F9FA 4OGFA 2JLVA 3LFTA 4UBIA 1DC4A 3UO8B 4CT5A 1RXUA 1PBNA 3DOHA 3OA2A 4HVLA 5A9SB 3DL7A 1U90A 2J3JA 2Q9AA 4FZ3A 4C0JA 1Z63A 2O19A 2R1UA 1E1KA 3NM4A 2KLHA 5ESXA 1WBJB 4JU8A 5FI5A 3UJ6A 3SMQA 2BMFA 1QAMA 5J2UA 1QYVA 4TYYA 1O94D 2A58A 3GI1A 5I7UA 5EQDA 5BMVF 4L4UA 3OJ0A 1FPQA 5E1OA 2PLNA 3VAZA 3H2HA 3QTLA 4HHEA 2Y99A 5I9MA 1EAMA 5F52A 2KX7A 2Y1XA 5JI2E 4YRPA 3UMSA 2GXUA 3TB6A 5KVAA 3KVVA 2QMQA 1EWTA 1LV8A 1SH7A 3E2MA 5DHUA 4IVQA 3GPIA 1GKUB 2NXNA 4BE9A 2O8BB 2BYTA 1M2VA 1E7WA 4PBRA 5AKGA 3PQ2A 1L0BA 1U3TA 1DO0A 4KX5A 2YVLA 2P75A 4LCEA 3OTHA 2Q62A 5HNKA 4LV8B 2JLXA 1SO8A 1L7AA 3ZD7A 1OU0A 4KXYA 5CEFA 1XTPA 3G2HA 3MYRA 1JTEA 4HB0A 4JH0A 5AUPB 1E63A 1E6LA 4LY9A 1E2KA 2B92A 2L69A 2YJNA 4CF3A 1XZBA 4QXOA 3GLGA 2IKQA 3Q7TA 3PFCA 1WWKA 2SBTA 3JALB 1H6CA 2X13A 2RIPA 1RJFA 3M5WA 1RKVA 3EYAA 3PHCA 4IOMA 3WIEA 4D80A 3JZMA 4G1CA 1AO0A 4F8JA 1WD7A 2BHLA 5FNZA 3Q1LA 3TL3A 2BFBB 1BHO1 1U0NA 5B4VA 2Q3LA 3O4VA 4BN4A 4DV7B 2HCFA 5K0GA 2AFIB 1OLOA 3AVWA 3WYGA 1R1DA 2IEIA 1D5CA 1XQ9A 3W1WA 2ZYSA 3PNBA 1CIPA 4RV9A 1U81A 1COZA 1G0OA 1LW6E 2Q4OA 1RS0A 1DRUA 2ZUCA 5F98A 1DIBA 2PKCA 4XFDA 3LH5A 4BLTA 2IEAA 2AGVA 2GR9A 3IOEA 3F96A 2P5TB 5B57C 4OQDA 1ZN7A 4K03A 3TTSA 2AHRA 3VHLB 5HVNA 3QPWA 4OQXA 4EB6A 5FBQB 5DNCA 1T24A 1XZHA 2PSDA 3NYQA 4L27A 2FHSA 2OBLA 4NE2A 3V8MA 1QOQB 4A1FA 5ITZA 2EIHA 4L8FA 3HCFA 3RRYA 3EVCA 4XGKA 5C1OA 3BSYA 5CH5A 3ICWA 3WGIA 3FDJA 4MJLA 1AXRA 3PK0A 1RDFA 2ODAA 4M1MA 2WTBA 3ZUPA 3E9EA 3M9WA 5E7MA 5FUWA 4YRBA 1FFCA 3ES9A 1WU7A 2JFXA 2FOXA 2FMUA 4KQ6A 2FZ4A 4R2KA 4GWLA 4BHTA 2Q50A 2OXRA 3NGMA 2CLFB 4KVGA 4M9XA 1PT7A 4HLCA 1UBMS 3ND8A 3A0UA 4JU9A 4LXUA 1EFVA 5JSKA 2QAIA 3L43A 4BNHA 1GQ2A 2X9NA 4N3BA 1SR8A 4GZMA 2YINC 3NKVA 2FW8A 2RGXA 3TMYA 4L3VA 1IN8A 2WM2A 4OFWA 4UTNA 1SXJE 2H1IA 3WFIA 2TRSB 4LHYA 1YD7A 2Z5GA 4MR8B 4QVGA 2HJVA 1PNTA 4JBIA 4YP6A 4KQGA 4OOEA 1D1TA 4EITA 3F73A 3SXUA 3HN7A 4QU8A 4UD2A 3QRWA 3S68A 2FUNB 1Z6XA 3NC4A 4Z49A 1M2FA 5CDHA 1UXJA 3EFOA 3QKSB 2PUDA 3P0IA 1EFDN 1JQDA 3MG9A 4DNPA 3NT5A 3RSSA 3BK1A 2ZSDA 3F46A 2P9EA 4JKOA 3U3ZA 4IILA 1XTQA 2F90A 3A36A 2VJLA 1I2DA 1YB2A 1ZD2P 3K53A 4IIUA 4QFBA 5K3SA 3LQ1A 3HG7A 1GIAA 4BRZA 2DLDA 4PSUA 4CTMA 2MT9A 2WPDA 2Q5OA 4GDMA 1VRWA 4OHYA 1FB5A 1T8PA 3CLTD 4OMDA 4G8DA 2QB5A 3P5SA 3G2JA 1YBAA 2QRGA 2FLWA 1JAHA 4QFCA 4K9QA 1NBAA 3V7FA 4EY8A 3HABA 5EVCA 4BO6A 1LK5A 1DBWA 3I6BA 4X97A 1CR4A 1JWLA 2OL4A 5M29A 2GK6A 1KTIA 4D0NA 4ADSG 3TVYA 3L2OB 3TLGA 4B31A 2JC3A 2V7UA 3K0KA 4TWBA 2PIAA 2WF8A 4FN5A 4JC8A 1YQ9A 2ZYAA 1ZRHA 3MJEA 4P1ZA 4WNCA 5EJFA 1CRPA 3HO6A 4II7A 1X9IA 2R7LA 3LQQA 4BKMA 3CVYA 3WMEA 1QS0B 4RD1A 3VZBA 2WAXA 1M7BA 5BOSB 3ED1A 4FSHA 2A5GA 4FNMA 5FR1A 1I36A 2OP1A 2JHPA 3TO5A 2FPRA 3T5AA 3ELBA 2A9VA 3PXCX 2QX7A 3TRDA 4F3YA 4FYYA 5FBWB 1U9CA 3ZU5A 1HLFA 5HX7A 4DMLA 4ZAZA 2DWQA 3SEFA 1PGJA 3GLHA 2ODNA 2WYVA 4E5VA 1USGA 1E2LA 4UXJA 3TOCA 3IBFA 3QVSA 4MROA 1C29B 2P77A 1OXKB 3SR4A 4AIIA 1I32A 3NTUA 3MAJA 5ERXA 3MINA 4MV3A 2UXCB 4HXEB 1GTMA 1CYDA 3VJLA 1AF4A 1ZI8A 4BFZA 4E14A 5C5IA 1DCFA 4N5HX 3DH0A 1IVSA 1JQBA 1ZOPA 5L6MB 2X7HA 5L6LB 4JYAB 4ZAFA 1YK1A 3NHZA 5DMHA 3R7AA 3EB9A 1NVWQ 2D1TA 4MUJA 2P9ZA 1RYNA 4DTIA 3U7IA 5DM60 3O8CA 3AO0B 2E4VA 1X15A 1F60A 1UDAA 2VC2B 4UAJA 4PN7A 2VQFB 2XNKA 3MRVA 3MS4A 5E9JA 5FL3A 4ARCA 1PZNA 1FOEB 4RLHA 1FIUA 3U3JA 4F11A 4UARA 4Y98A 4DIOA 1G5QA 1M10A 3ZBQA 3S0JA 3EQZA 4XE5A 1XCOA 1XKLA 3VJKA 3OIFA 1D8TA 3ZKAA 3GRRA 3RUHA 4EVIA 1RQLA 2Q29A 1P9OA 4JLVA 1GL3A 3TW8A 4ZJPA 1LLCA 3BMNB 3EMKA 3PQDA 2AL7A 4GG1A 3JQEA 3IPLA 7ABPA 2H1OA 3G0GA 4F84A 2P6OA 2WHYA 3CPEA 4DSAA 2AUNA 3C2QA 3O38A 1EM8B 2XKJE 3Q7PA 5CITA 1DCKA 1RXVA 4RWEA 1EFLA 3NORA 3JR3A 5AM5A 2E3JA 1E18A 1Y0BA 4HDSB 5IDWA 1GTJ1 2Z6QA 4I55F 5DJ5A 3TRFA 1DIOB 1CZRA 1UQUA 2I67A 3ZWKA 3I9JA 3OCVA 1U7XA 3DT9A 3P94A 5IXYA 5DF1A 4K6OA 1R50A 4B48A 3HYNA 5THQA 3ICPA 3KUXA 3FJ1A 2WY2D 2W6OA 4FEEA 3SF0A 3WZLA 2VAMA 4ABTA 2JFHA 4IRUB 2JHCA 3USZA 4E2ZA 1XI2A 1YWGO 1YVEI 2AR0A 3AEKA 1WMDA 1R0CA 4PQYA 5F1KA 3R7WB 4DBZA 5JAUA 5KCZA 4MHTA 3R9WA 2VJAA 1WOMA 1D2GA 4OHVA 3ZKWA 4GVLA 1I1HA 2QVYX 1UMDB 5P8WA 4WA8A 4TXHA 4UHDA 1P2GA 5JPDA 3DFIA 1BVYF 3UTCA 3NTOA 1UQRA 4WZAE 1A8IA 1JH9A 3KKEA 2ZS7A 2OLKA 4HQOA 6AT1A 1Y81A 3A1NA 3GX1A 4XDYA 1RFLA 5ICCA 1DBRA 2HIGA 3QOWA 2XZTA 1O89A 3V97A 2ZCJA 3SX4A 3N3AC 1T91A 1GCOA 2P4SA 1QHHB 4QTXA 1NYQA 4CDNA 2J41A 5D6NA 3D5EA 4B83A 2AFHA 5LMCA 2D00A 4ZTUB 2J85A 4LNUB 1XD2A 1CEXA 1FU8A 2XGOA 2LTAA 5LBUA 1YR6A 3WL5A 3UUEA 1NG1A 1NMYA 4JT8A 1PEAA 4M9UA 2X41A 1WUYA 2Y3IA 4ZYTA 4GOLD 4OXKA 1X8LA 1V8BA 3M1AA 2QS9A 4HEA6 2VZ0A 3HY3A 3UMCA 5KVCA 3GLFA 3LWZA 3LW8A 3ELYA 2JEYA 4D79A 2FSFA 3NFYA 1YBVA 5CM9C 3C8UA 1CPYA 1S7CA 4IIJA 2H7YA 4R1UA 5JV5A 1EVLA 1CIVA 2J6CA 4V1CI 1DXQA 1UL1X 3R44A 4K46A 1PNQA 3W1VA 3DTVD 4XJVA 2IT1A 4OM8A 4K7JA 1WW3A 4U9IS 3HHEA 1JMYA 1OPXA 1U1GA 2CCKA 5D3KA 4MGYR 4TMVA 2Q9BA 3LXXA 1DKOA 5A06A 3C74A 4Q0MA 4YJFA 2VAXA 3GQBB 5LR6A 2KB0A 3LC7O 1Z39A 1EFHA 2WU0A 2PGJA 5LQKA 1EXVA 3SWWA 3BHJA 3KE9A 1DTWA 2VYND 1BC5A 3OEWA 2VBIA 2IEBA 4GM0A 5ESRA 1S2LA 2SHKA 1SPXA 4F38A 1MRZA 4KQ9A 3ROTA 4ZAVA 3FSGA 2IPMA 1QP8A 1ZS9A 2VTBA 4DSUA 3QE4A 4HD8A 3N8DA 2IH5A 2QUAA 2ON6A 3D8TA 1C2TA 2QLJA 3OF5A 4GQIA 4JLBA 4A03A 1YR8A 3Q9NA 3F8WA 4TLCA 3AT1A 1RIIA 2QN6A 3KSMA 5K45A 4CEIB 2J3LA 2UVPA 2F4VB 1FTGA 3CA8A 1BMFA 1Q22A 4K6FA 4GYKA 1AQLA 5FWYA 4R8SA 5DM4A 2IXEA 2PBZA 2HRBA 3FDIA 2C96A 4A23A 2CEKA 1BU5A 1V47A 4TT3A 2KQUA 3ID6C 2Z43A 4PAWA 4BO2A 3DD1A 2TMKA 3U4GA 2I2DA 2D3TA 5A2QA 2Y93A 4Q66C 2AF3C 4A10A 1T0IA 3I9LA 3F8SA 1UM9A 3T4EA 3TPZA 4ARIA 3KFLA 5A4IS 1R16A 2IBMA 3NS7A 3G9ZA 2I3BA 4Q4AA 3CLVA 5FV7A 5CFMA 2ZBGA 4CV2A 1WCWA 4AX4A 3K5PA 1T8WA 2B3TA 1L4FA 1H42A 1KYIA 1TZBA 4BMSA 4JP3A 2GCIA 4R9NA 3QVGB 4GBGA 2Q21A 5GONB 4Z51A 1DC8A 3CUYA 4ZQFA 1GITA 1KY5A 2ZUSA 3BGWA 1RWOA 1G20E 1C2YA 3ROQA 3H1BA 4CF5A 3G59A 1GTSA 1Y80A 4YC7A 4LHZA 5BMVA 1CUVA 1U7PA 2QMEA 1QK4A 2WICA 4QXQA 2RBGA 1KZGB 4Y6LA 1QBGA 1CUWA 1IQUA 1PN3A 1M73E 3BSFA 4OP2A 4GFDA 4PLYA 2BMDA 1G21A 1KMHA 3WRYC 4B3HA 3GD7A 2NTNA 5IBRA 1QHEA 1FNNA 4RM2A 3BORA 5JVDF 1R0BA 4UOZA 3MUFA 5FYQA 3R0JA 4KSCA 1ZMTA 2YL2A 1M7HA 5B37A 4F8YA 3AW9A 4HT3B 1SUFA 2WSBA 1Y34E 2YCBA 2ZAYA 1R5OA 3MBIA 1KOFA 4XOIA 3SZMA 1K1EA 1NMZA 1CZUA 1KE2A 4MV6A 2DEUA 4KXWA 3IDSA 4QA9A 5SYNA 4XQ9A 4Q3KA 5EPEA 4LJSA 1CZHA 5A5GA 2QVZX 3KYCA 3ICCA 6CHYA 4PNZA 1KJIA 3RSZA 3WQQA 3DDSA 2FP4A 4X62B 5AVQA 3EC2A 1PU2A 2ZRMA 4RJIA 3ZNQA 4IM7A 4HEJA 4W5TA 1SULA 13PKA 1N6NA 2C0PA 5EIAA 5EXEA 3GBPA 4KRXA 2W2KA 3DBLB 2OAQ1 1IH8A 1WHTB 2QRMA 2R44A 3N0TA 2Y27A 2VSYA 3CS3A 4K1LA 3E4DA 4NOMA 4PQGA 5CX4A 1XBTA 2HSDA 2XVXA 4TV8F 2V6IA 2WLSA 4WRRA 3JAMA 1MB0A 1XVAA 1QR6A 3OICA 4NY1A 4DL9A 3MA0A 1U1CA 3F5SA 2XCUA 1GAWA 3HI4A 2QVGA 2AXEA 4B7ZA 1FLVA 5KNBA 1T43A 1Y6ZA 4URHA 4DLNA 4NFYA 1ZIXA 3GN2A 4XPZA 1E6CA 4MS3A 1J4AA 4NLLA 5E9AA 1NM5C 1RLJA 5JNRA 1JKJA 2IIPA 2GBPA 2O1XA 3KJNA 4KV9A 5JHHB 1JU3A 4X84A 4ERXA 1Z07A 4IHKA 4LPKA 5B3AA 1VLMA 1EA5A 1R4NA 4BQEA 2QGZA 4PXSA 1TU3A 2HU8A 3JQAA 2CJWB 4ISCA 3RFXA 4OV6B 4CL3A 1C0PA 2DSNA 3ANXA 5H3HA 1DXYA 3O91A 2DBVO 1S89A 4FOSA 5JS1A 3WLFA 1MO5A 5BWNA 1S1CA 4FSDA 1YKGA 2AJTA 2R8RA 3AM5A 5I7AA 2Z58A 4C03A 4JA0A 4Q5IA 4PG4A 3P52A 1Q83A 1WABA 2XQKA 1VMEA 1JILA 2QTZA 4WK0B 2ABWA 4W7SA 3SS9X 1R66A 1XFDA 4FFWA 2O1SA 4UBMA 4C22A 5ALFA 4FB5A 2Q3BA 3HVHA 4NJEB 3BZWA 2GEUA 4MDFA 4GS5A 1DOZA 4C6RA 2YXDA 1P73A 2R7NA 5FAKA 1ZIOA 5DLPA 4KR9A 1Y1KE 3MERA 3PJFA 4M1TA 1KAQA 1SXJA 2ADOA 2YN0A 3JQDA 2OHJA 1CKEA 1I7LA 3EXFA 4LJ7A 2JA2A 3QWAA 4GP7A 5BYBA 4CNBA 2AMJA 1BJRE 2WBLC 2IF2A 4IVNA 4UCFA 3MCVA 4ZZ0A 3NIBA 2A4KA 3AESB 1EHYA 2QJOA 1XVIA 1E61A 3H2GA 1X8JA 2FWRA 3JVVA 4DLTA 1GSOA 1GNRA 3SYMA 3ZHZA 4MZXA 4I1PA 1D6SA 4DR3B 3OIVA 2WU1A 3AXSA 1C1YA 1HEUA 1W5TA 2PHZA 4HXFB 3FVWA 4HDQB 1BS2A 3QLTA 2HWYA 2JGAA 5C32A 4G4GA 3HN2A 1BVRA 3D5TA 4UDYX 4ZQCB 2BH9A 2R86A 5JARA 4JITA 4BCCA 4CLRA 1LBEA 3X43A 4JMPA 1GRQA 2MWMA 2ZXEA 1P39A 3GFGA 3LY5A 1GUDA 2Y1EA 3ZE9A 1XTJA 3C3XA 3WO1A 3ZS8A 4Z4QA 1KDVA 3RRNA 3ZDDA 4FK8A 4R6XA 5FWDA 4CN8A 3EMDA 3JQ9A 3WV5A 1RMYA 4J90A 4I6EA 5AK5A 3UW3A 1H2RS 5FLEX 3QJ5A 5I01A 5E95A 4JI1B 4C0BA 3RYFB 5HHTA 1Z29A 2SKEA 3JTEA 1EFRD 3RTBA 3HDJA 3SQNA 3HVJA 3PPYA 2B4TO 4G1BA 3SLGA 2PCLA 4YNBA 1O6BA 4N6OA 5K0NA 5ALSA 3LXRA 3PEVA 2NU7B 3PQ3A 4M0UA 2NYRA 5G4KB 5YASA 4EX6A 2GZAA 3EFHA 1C81A 3M83A 1PGQA 4B85A 3W5IA 3IKMB 3UMMA 1N2HA 3EQ9A 1FSSA 3KR2A 1Z5GA 4PX5A 1TTPB 4NEGA 1Z06A 1P72A 2Q7DA 5JBQA 1U4OA 3EEBA 4P0PB 1P1RA 1VJ0A 4G65A 4TQUS 3IO3A 4WXPA 3DF9A 1VG0B 5JZOA 1Y82A 2P65A 2QUKA 2W2OA 4P81A 4YJGA 2A4MA 3T9FA 3KL2A 4NH4A 5THKA 3GRCA 4QNMA 3BXHA 4NV1A 1C4XA 1CUGA 2CB9A 4RZIA 1Q6ZA 3P4YA 4LOIA 3FIUA 1ECPA 2J08A 1VLQA 3LFHA 3ESYA 2QTWB 2F8LA 1T1GA 4XJTA 3M49A 3TOXA 3OZCA 1JAYA 1U7ZA 1QLHA 2FPGA 2IHYA 4N8DA 2H8KA 4CI0B 4FN4A 3EVTA 3VVMA 1TC2A 3S8EA 2QU8A 3EGIA 4RY0A 4NSNA 2EDCA 4QJ3A 1OU4A 4F4HA 1GNTA 3Q0TA 1GWNA 2E48A 3L92A 4Q9NA 4YAOA 1QHNA 5G41A 2DHCA 1VLZA 3NXKA 1NPDA 3PGMA 1L5GB 5A9RA 3K2IA 5DFAA 1BD4A 1OVGA 1XZLA 1OBCA 3W5AA 4JGIA 5BWLA 3W9YA 1QYDA 1OMOA 1WMEA 5EJ8A 1X7YA 2ZRFA 5JWOA 3VU1A 2ZTLA 3QUTA 3FE2A 3EHDA 3AG5A 4Z0NA 2EDAA 1B8UA 3T4UA 3NRJA 2B37A 5GZ1A 3H3XA 1XZGA 3H0CA 3I9V1 3QX8A 2ZW9A 4BQPA 3G9UA 4N40A 2ZBQA 2FR8A 5FUYA 2CFSA 4I55A 1E9AA 1Q7GA 4L0CA 3H5AA 5GIPE 4D9IA 1HYGA 1G5FA 1U0OC 3C3DA 1SUWA 4G5QA 4MEAA 1QYWA 2I4OA 4PGMA 3RU3A 3I6QA 5JNUA 2WTEA 3BJIC 5KSYA 1CQIA 4OU5A 1P91A 2WNSA 4X54A 2F59A 3DV9A 3F74A 4RJLA 2BFDA 1DKQA 4F3CA 1QKJA 2YOGA 4BNUA 4JUIA 4OI0A 3T06B 5LYYA 2G9RA 1ENYA 1UBKS 2X15A 2PJZA 4LRXA 4ND6A 4WZAA 4C5CA 1OLXB 1XJ5A 5ECDA 1J8YF 4ZYZA 3KVOA 5AUQA 3PXAA 4HVAA 2OQVA 1QDUA 3K35A 3MXTA 1C4OA 3LJKA 4ZPXA 4CU2A 1UT8A 4K9SA 4LHEA 3RBZA 4ZI7F 2HY7A 3KFVA 1FQWA 1FTQA 2VATA 4Q01A 5AK4A 3X2EA 1F8FA 2A8YA 1SC9A 2NXEA 5K1ZA 3ZU3A 3Q3VA 1B15A 4OK6A 4Q05A 7AT1A 1PWXA 2GBGA 4MI6A 1LDEA 3D7MA 4HDKA 5CCDA 4KDFA 2OGWA 3W0LB 3ABZA 4N7JA 1JDTA 3AG6A 3QUSA 2FK7A 3OM0A 1L1FA 1MX9A 1W5SA 3OZVA 3IR6A 5DLQC 1UKAA 2CLDX 2FRDC 4OLAA 4LFAB 4FGJA 1PS0A 5CCXA 5HIMA 4P33A 4ZAGA 1GKLA 5CAEA 2Q4BA 3U4CA 5IAEA 5I47A 2PUVA 3K70D 2FTKE 2JVIA 4YPOA 5DTQA 4I46A 3CW8X 4PN3A 2G8LA 4IUYA 3TIIA 1GVHA 4MQ4A 4FFPA 2QN3A 2Q1SA 1YB4A 4MP8A 4NBWA 5CH8A 1MCZA 4DJTA 4CPDA 4E11A 3SD7A 3EVZA 2EJTA 5FTMA 3QNWA 3MTEA 4C7MA 5JCXA 5EA2A 3RC7A 1WIWA 2POCA 1B0PA 3P26A 3OWHA 2HIHA 1GUZA 4KUGA 1R9NA 4B75A 5I4IA 5LD2B 1LF0A 5EIXA 4LN1A 2HT1A 3A1DA 3L01A 3DYIA 4DNOA 1O3YA 2CN1A 4EPYA 2G70A 2HEGA 4RE6A 3NCTA 1ISFA 4KPFC 1ZIYA 3V3KA 3O3OB 4BO1A 4NXNB 3QOYA 3GLTA 4WJKB 1ZW6A 3KPUA 5BR1A 1TPYA 1CB7A 2ORIA 2DT8A 4G09A 1VTKA 1UWVA 4LFCB 3KUCA 3MT0A 4D97A 1D6JA 1C9JA 3C8ZA 3MCAA 5JC8A 4IHQA 4P3XA 3E9DA 4ARUA 4C2AA 1LVGA 3QVUA 4LOJA 4N47A 1GXSA 1H4QA 1DKLA 1XL1A 1A9TA 1A7UA 3NDJA 3PD0A 2P68A 1ZVVA 2BFAA 1D2RA 5EHXA 4EHJA 2Q3HA 1EE9A 3CF6R 2VHUA 1FMJA 4WKCA 4LY0A 2XBUA 1ZNQO 3AY7A 3AZOA 4X6XA 4U2BA 2I2XB 2G17A 3FYTA 1ETHA 1LVUA 1JSZA 3K0AB 3LIPA 4RK0A 5T64A 5BQ3A 4ZC1A 2JFNA 2YDYA 1FMFA 3RSHA 2R6HA 3RAEC 1ZHFA 1JNYA 1R5JA 1W4ZA 3B53X 3HWWA 3ZGOA 1FS4A 3GMIA 2B98A 3NPMA 3P9CA 4MB0A 4QYWA 2X0KA 4R81A 3HKCB 3GZ4A 4X6YA 4WZBE 4WUTA 3E03A 1T2AA 3UJBA 4IDNA 2FUEA 5JAZA 1R0SA 3FFAA 2BEUA 1G20A 5HCNA 3FYDA 2OD7A 3A10A 3RGWS 2QJWA 3P71T 3DT6A 4DABA 1O94C 3T3MB 5BV8A 221PA 1JYSA 1XQWA 2JH8A 4JJZA 4CTNA 4QOFA 2ATXA 1Q20A 5CW2A 3UF0A 1EGVB 2P6UA 4R7ZA 3U9LA 3DE1X 3ML1A 3C4JA 2FGKA 4X5OA 1X74A 3KEOA 1JB1A 2H7CA 5FT9A 5K3BA 4MVJP 1GVNB 3RWBA 4AURA 1E6MA 4JT2A 4GOXA 3OOYA 3EZ7A 3CW9A 1ODTC 3L8ZA 3C6YA 3PDIA 3QPDA 5LYJF 2AHOA 2Y9PB 1XZPA 1KEEB 2ADFA 3IQZA 1Y3FE 5TY0A 2DFPA 2FEKA 4JJKA 5EE0A 1MX5A 1NXTA 4WCFB 4MEBA 4A0RA 1E8NA 1PP4A 5EFZA 1J99A 3NX4A 4GGOA 3KKZA 1NVGA 3OOHA 1O5TA 3P97A 1DWQA 4ID3A 4OQQA 3K9HA 1JF8A 4XGNA 1U2TA 4OQPA 4UEQA 3F7TA 3AY0A 3D3NA 1R0KA 3QFTA 4J9VA 3M9XA 5IYZF 4KRGA 1E7SA 3JQ9C 4G07A 4XLZA 1M0EA 1XNHA 5FJJA 3FHLA 2J7PA 4UKDA 5KYYB 1FP6A 2A0XA 2Q5EA 4G9EA 3U81A 3U09A 4J7AA 1A9XB 3EVNA 2QYHA 1UBSB 2WAAA 2XWPA 3EF1A 4LZWA 2Z4RA 3SIWA 2GBIA 5JEDA 2VH5R 1TKCA 1OJLA 2PANA 4GMFA 5FPPA 1ZJ6A 4YI3A 1TZJA 2ONKA 1D1PA 3WE7A 2OA0A 5MGNA 1GZ4A 2JI9A 1YRYE 3C3WA 1I4WA 1QF7A 3HJNA 1HY3A 4H6WA 3TJZA 1ZI6A 5ALLA 3WXMA 1H66A 2IUTA 3H17A 1YJ8A 3VZPA 4CCYB 1IQPA 3GT3A 4OQNA 3Q5GA 1ZBQA 1CJBA 3BGDA 2I7VA 4MKZA 4P0TA 4XIFA 2ANBA 4R5HA 4XIIA 4IR7A 1NT4A 1P45A 2HFJA 1JI3A 3I5AA 5E3JA 2AZXA 1WXXA 1YZFA 5A7GA 3G68A 2FPKA 2WJGA 1M66A 1VJCA 1GGHA 4HZUA 4MRMA 1SCQA 1P1BA 3VU9B 5TQJA 3DDNA 2A9QA 1XL0A 3EZ6A 5CM2Z 1QU3A 3CV3A 3IHTA 3BFJA 4MGEA 2V74B 3V42A 1DGQA 3A4YA 3C3JA 4EY5A 3VMMA 1X2BA 1XYVA 5AKXA 1EVEA 4II3A 4ND8A 2ETXA 2HZ7A 3U7QA 3WTBA 4BWVA 3Q9SA 4AJ4A 5CVDA 3ZHOA 4EATA 2DFTA 3ZWWA 1TAQA 3B1FA 3T7DA 1JHDA 2I4NA 2ID7A 4IO1A 4IMPA 5AVJA 2QE7A 5FA6A 5T4EA 1CY2A 1ZUD1 4DN6A 4ZU1X 3O83A 1U04A 2WJZB 4MNTA 3B3JA 3TTVA 5LU9A 3VR4A 1W4AA 5C8YA 2A7XA 4J1NA 1JTFA 1WY5A 3R7BA 4YHHB 2FQXA 4QYXA 4ME6A 4Q1VA 2FEOA 2WJAA 3AB7A 3PA8A 3RO7A 4Q03A 7MDHA 2OCKA 1JWBB 1AJEA 1JEEA 4CM4A 4S1WA 3VNSA 1VHWA 2C8LA 1HNXB 2OCIA 3FHJA 3EFBA 4ZT6A 4L3OA 4HRVA 4KIGA 5EZYB 1PBTA 1QC5A 3LZDA 4DV3B 2MDTA 4P9NA 1EGAA 4Y1FA 4YCCA 2ZPTX 3DE0X 5KNDA 3AVTA 1R10A 4ZOCA 2HLNA 4XVCA 3I3SR 3PT9A 3PIDA 1O08A 3ORHA 4JBXA 4YUVA 3L4JA 5HQ3B 3K6JA 2CVOA 2HREA 4F56A 2VNKA 2A5JA 5JROA 3LWDA 3PIIA 1CF9A 1F5SA 5IJ9A 1B1AA 1XQ1A 4DS3A 1OE0A 4ZZ1A 3LTNC 1ZU4A 2R11A 5B58C 4K87A 1G4AE 4KG7A 2CUTA 2IZ0A 1QH8A 2P5SA 2JLCA 2VAPA 4JQSA 1OI3A 4QGSA 3IC5A 4H17A 2PYDA 1UZAA 1YS2X 4KPEC 2YVUA 3HK2A 2ZUBA 4K0RA 1NKSA 4GBJA 2VK4A 3D81A 2UUBB 3OQ6A 2WJPA 4YEDA 4FINA 4HFMA 4MLZA 5H9WA 2IOFK 3D4OA 4MB2A 2H63A 2PWPA 5K2MA 1N1DA 4R5MA 1IQRA 2NV2B 1UDXA 1M1NB 2G40A 2I9PA 3CR3C 1B73A 1YVRA 2F43A 3BVPA 2YHUA 1YTUA 2Y1CA 1CE8A 2HF8A 3LECA 3ETEA 2CVHA 4FYHA 1J8MF 1F2TB 3COZA 3WDKA 3PHBE 5AJYA 3WL8A 3DZIA 4C89A 2PMDA 2XCQA 2IJGX 1XYGA 2F1KA 2WWYA 1LS1A 2BEVB 2PSEA 3NT4A 3R5TA 1RJDA 3RS2A 3WOVA 1GAXA 2YXPX 5JPIA 3CTPA 3WLNA 3R9XA 1A8SA 1PI3A 1W8DA 3K72B 2HO4A 4FHFA 2I76A 1RP1A 4BMCA 1IHXA 1YV9A 1R9GA 1Z9BA 3DVAA 3L0CA 1JRLA 1DAKA 1VI2A 1W1UA 1OGJA 1VBNA 1ZK4A 2EX1A 1QVWA 4RMHA 5L7WA 1M54A 4WK4B 1B0UA 3TNLA 1GM5A 4UFNA 2DH6A 4XYEA 1FDSA 2CLOB 3KALA 1ZGGA 4XX0B 2YBDA 1P29A 4QUHA 4GZ3A 3OIUA 1E1LA 1V7CA 2GILA 2AI3A 3D4LA 4M1ZA 3C3EA 4QQ8A 3SXUB 3GUHA 3R3WA 1W2GA 4FGWA 4F21A 1G5HA 1BMDA 2G06A 4I2NA 3CXUA 3MJTA 5KJCA 2DPLA 2DFKB 4BUCA 2IYEA 2Z5LA 3STTA 5A4AA 1X80B 2OD9A 4S3MA 3RVDA 1Y98A 2BBWA 4O4LF 4Y6GB 5KU1A 1KKLA 2DYKA 5BSRA 2YZKA 3C4QA 3UENA 4N12A 1SKBA 3A8TA 2HEIA 2HADA 4LF6B 4TLEA 2QVBA 4LY6A 4Z1MA 2EP5A 3SYTA 4JI8B 1M9NA 5CX1B 4TVSA 4KB5A 3GOQA 2DERA 2VPWA 3NB0A 2JKYA 4PC3A 2PAFA 4E2XA 5HUHA 1YMQA 2V6FA 4HN2A 4KI0A 5DXFA 4DMMA 4NK5A 5DCYA 3EW7A 2YICA 3DCNA 3WQRA 3T5CA 5EFOA 4U5QA 2BI8A 4OQZA 3R9IA 3SSOA 821PA 4HCJA 3AGQA 3F78A 2OM2A 1PJQA 3LQ2A 4GLOA 3ESXA 3V5NA 3VR1A 3N2ZB 1V5IA 4AQ7A 2BKUA 2H1RA 3KR9A 5ALOA 3UYLA 3GNTA 4QDXA 2NVUA 4ZI7A 1QGOA 4KWIA 1PJCA 1U65A 2C2HA 1SBNE 3AFGA 2XMQA 4WESA 4CU5A 3ZZMA 2D2XA 1GA6A 3A04A 1N77A 1N2CE 3B1JA 2VPYA 2VT2A 4BV2A 3FI9A 3SM3A 1C9DB 4ITVA 3PXGA 1VIDA 1OA1A 3OBBA 3MINB 1BMQA 4GI1A 7REQA 1WTAA 4UEJA 3QQPA 3Q9UA 3H9UA 3T3DA 3FPHA 4FE7A 1XIVA 1QIIA 2X2PA 4CKEB 3OFVA 2OD2A 3OQVA 4JWTA 2F1HA 4DIKA 4UULA 1KH3A 5BNFA 3TG8A 4FT2A 1A50B 1ZZEA 3O1JC 4HDMB 2DU8A 2MYTA 1UKEA 4J0FA 2SCUA 5D5PA 3E15A 3UKOA 3JARB 1UJBA 3ILYA 4MGHA 5TJ9A 4A7PA 5HG0A 1F8UA 1YUNA 3D7NA 4EVSA 2W4MA 1VBFA 2C04A 3BX1A 4N54A 1NVVR 1G3UA 1MTOA 1Z0IA 4DADA 2W6IA 2ZB3A 3I62A 1N6LA 4ZQIA 1GLGA 3LDHA 3NO4A 4TSRA 2H2FA 3ZE1B 4BAGA 3NOOA 5ENVA 4PHHA 4ZOLA 1SVUA 3OTWA 1V39A 3ZHUA 3OCZA 3NWOA 4DW8A 2ILTA 3IJPA 3HKEA 1GR0A 4MMXB 3KJIA 2BOVA 3KQWA 3EGDA 1R6UA 3QM1A 4FWBA 5DSXA 1S3FA 3RVKA 3LWNA 2NTYC 2IH2A 1LQUA 2PXHA 2VRCA 2WLTA 3UJ7A 4DYVA 2I03A 4P2BA 5AW2A 1BD3A 2FG5A 4O2BF 3UHJA 5BN4A 3CVUA 1EUCB 2VHVA 1R5BA 1XP8A 1O5IA 4AMUA 1HL3A 1MTZA 4RKEA 3NM6B 4KXUA 5CYFA 1JDPA 3CRQA 3EZ9A 3NAGA 3NEJA 3OFKA 4K1XA 5JC1A 3A14A 4OSEA 1TUBA