4DANA

Crystal structure of the hexameric purine nucleoside phosphorylase from bacillus subtilis in complex with 2-fluoroadenosine
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
229
structure length
229
Chain Sequence
b'SVHIGAEKGQIADTVLLPGDPLRAKFIAETYLENVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMNRVAFGSVDFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYNDDSQIEKLAKYGVLGVEMETTALYTLAAKHGRKALSILTVSDHVLTGEETTAEERQTTFHDMIDVALHS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Purine nucleoside phosphorylase deoD-type
publication title Insights into phosphate cooperativity and influence of substrate modifications on binding and catalysis of hexameric purine nucleoside phosphorylases.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
total genus 84
structure length 229
sequence length 229
chains with identical sequence B
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2012-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4danA00
1YQQA 3DF9A 4YJKA 4GMHA 1RT9A 1TGVA 1YBFA 1PR1A 3SCZA 3UAZA 1RXYA 4NS1A 5B7NA 1JDSA 3EMVA 1PR2A 5CYFA 1XE3A 3E9ZA 4DA7A 3UAWA 1TCVA 4BN0A 4D98A 1Z39A 2I8AA 2A8YA 3F8WA 3T94A 1NC3A 1ECPA 4LNHA 4OGLA 4WKCA 4GLFA 1JP7A 4NSNA 1Z36A 4D8XA 1T8YA 4X24A 2QPLA 4TXHA 4QASA 1K3FA 1FXUA 4M1EA 3KVRA 3UAYA 3OF3A 4IP0A 3DPSA 3FOWA 1ZOSA 3LBAA 4TXLA 3IOMA 3FAZA 4G41A 2IQ5A 5B7QA 1A69A 1K9SA 4DAOA 1YR3A 5B7PA 1V41E 4F1WA 4E1VA 1VMKA 1Z5NA 1OVGA 1A9QA 5KB3A 5DK6A 1ULBA 4YNBA 4WKBA 4TYMA 3BGSA 4R31A 3NM6B 1YRYE 3P0EA 4L5AA 4K6OA 4D8YA 4H1TA 2A0WA 4JOSA 4D9HA 4QAQA 1CG6A 1A9SA 4OY3A 2XRFA 5F78A 1JDZA 1PBNA 4OJTA 2AI3A 4MCIA 1ODKA 3OOEA 1Y1QA 1V48A 1PWYE 4TTAA 4DARA 2P4SA 2PGAA 3E0QA 4L6IA 3O4VA 1C3XA 3NM5A 3KUKA 1JDUA 4JWTA 1T8WA 1A9PA 1ULAA 3OZCA 3KU4A 4YO8A 4WKPA 2A0YA 3EUFA 1RR6A 1JE1A 4TS9A 2HWUA 1Y1TA 4FFSA 1T8SA 3TL6A 4JP5A 4L5YA 4R2XA 2AI1A 1PKEA 1Z34A 2QTGA 1ZL2A 1QE5A 3KVYA 3QPBA 3U40A 4DANA 3OZDA 3OCCA 2OECA 1OV6A 4M7WA 1RXSA 4LZWA 3UT6A 3KHSA 4G8JA 4OF4A 3C74A 3OZEA 4UC0A 1Z5OA 5EUBA 1V4NA 4EARA 1PR4A 1PK9A 5CCDA 3E9RA 3PNPA 3NBQA 4TXNA 3P0FA 2AC7A 4GKAA 1U1CA 3NM4A 2BSXA 4QFBA 4YMLA 4MCHA 4WKNA 3ODGA 1Z5PA 1U1DA 3BSFA 4NY1A 5K1ZA 2OC4A 3O6VA 4BMZA 1RXUA 1Y1SA 2Q7OE 5EFOA 1V45E 1VFNA 4KN5A 1SD1A 1Z33A 2AI2A 1U1EA 2A0XA 1RFGE 1RYZA 4PNPA 1T0UA 2HN9A 2QDKA 1V3QE 5CXSA 3BL6A 2I4TA 2H8GA 1Y1RA 2OC9A 1LX7A 4OEHA 1RXCA 3PHBE 3GB9A 3GGSA 4ECEA 4F3KA 4GLJA 2ON6A 1TCUA 4M3NA 2B94A 4F3CA 4TXJA 4D8VA 3KVVA 5F7XA 3MB8A 3K8QA 4U2KA 1Z38A 5C80A 3FUCA 3UAVA 5F7JA 1M73E 1PF7E 4PR3A 1N3IA 1A9TA 1JDTA 4EB8A 4TS3A 5EPUA 1U1GA 1SJ9A 2OXFA 3BJEA 1A9RA 4DA0A 1NC1A 2QSUA 5F77A 4F2PA 1ODJA 1WTAA 3INYA 4L0MA 3IEXA 4BMXA 1PR6A 1LV8A 4DAEA 3OPVA 4OGKA 1G2OA 1RCTE 1CB0A 1VHWA 1B8OA 5F7ZA 2HSWA 4RJ2A 5CCEA 3DP9A 3PHCA 3D1VA 1ODIA 1RSZA 4LNAA 4TTIA 4TXMA 3LGSA 5F7OA 3DDOA 4QARA 1TD1A 3K8OE 1Z35A 2HRDA 1T8RA 1JYSA 1OUMA 3FWPA 1PR5A 1OTYA 1I80A 5IFKA 4TTJA 4I2VA 5IU6A 3ENZA 2RJ3A 1PR0A 4L5CA 1SD2A 1YQUA 1OU4A 4DA6A 2QTTA 3PNSA 5ETJA 5CXQA 1Y6RA 1Z37A 5F73A 1K27A 2ISCA 3FB1A 4DA8A 1ODLA 4QATA 4DABA 4R2WA 4LDNA 1LVUA 4P54A 1A9OA 1JPVA 4G89A 1Q1GA 1SQ6A 4F2WA 3FNQA 1JDVA 4MARA 1PK7A 1PW7A 1JE0A 5I3CA 3EEIA 1OTXA 4BMYA 3ONVA 5F76A 1B8NA 5FAKA 1VHJA 3OZBA 5CYGA 5B7GA 1NW4A 3EUEA 1Y6QA 2GUWA 3UAXA 4QEZA 3OOHA 4LKRA 1TGYA 1U1FA 3MMSA 4WKOA 3LA8A 5JPCA 3DJFA 1V2HE
chains in the Genus database with same CATH superfamily
1MZPA 5EJMA 3KT0A 1WUTA 2WD8A 3CZQA 2VHCA 3E9DA 4N5MA 1Z5ZA 2RAUA 2WWIA 4D9JA 2I2CA 4ZGWA 1OX5A 3J7TA 4TS4A 4W6ZA 2GM4A 3MBKA 1KFKB 4ZQGA 5EJ8A 1V8PA 1UMCB 1DFHA 2C5SA 2F3SA 2L42A 4NABA 3ZZ1A 1WO8A 4DUYB 1ZHOA 2QN8A 7GPBA 1EFPA 1S9DA 2X8LA 4OA5A 4CKZA 3EXEA 4B5LA 1WKBA 3LECA 4HATA 1W73A 2ABWA 4EITA 4MRPA 5BPFA 4M21A 4W1QA 3RVKA 3U1TA 1UQRA 2R00C 3JAKA 3OT5A 1KH3A 1XI2A 4EF5A 1NP7A 4M0FA 4QOJA 1I3KA 2FFJA 3TNJA 3LCVB 1SB9A 2RIPA 4CDRA 1QFZA 5EP3A 3FBGA 3BCRA 2R68A 2YN4A 4M9QA 4N0PA 3SF8A 4K2AA 4AIIA 3S70A 2EDCA 4OQFA 1SBNE 4P2BA 3UAWA 5LMZA 1N0WA 1PL8A 2GM9A 2QTZA 2Y1FA 4AJHA 4CV2A 1NF9A 2OAGA 5CM2Z 2GERA 4NJMB 2Z3WA 1LU9A 1XJ5A 4G2TA 4M49A 2MTBA 2IS4A 3IUBA 1AF7A 4LI0A 2CMKA 4BASA 2VTBA 1IWOA 1A95A 1P80A 1WDKA 1PG5A 4BKQA 1PJBA 1VIDA 3ML1A 2FPGA 2NTEA 3HVHA 4CM4B 5B30A 3KOWA 3L8EA 3S27A 5BYKA 1Y8CA 2DWCA 1XCGB 2R1ZA 4JR2A 4AI6A 1EE2A 3L6RA 2P4UA 3DWFA 3QBVA 5GVRA 2YHIB 3RF6A 5EJEA 3ETJA 3Q3IA 5IJZA 1A04A 3QVLA 2J9GA 4HLUC 4CLHA 2NSLA 2PGXA 5AW6A 5ILGA 3O1LA 1GU0A 3I61A 2VP5A 2WK1A 3QUTA 4JLWA 2HIHA 3OBIA 3R7LA 3RC7A 5JNTA 1KJJA 2B0CA 3U4AA 1OTHA 2ZBGA 4NSNA 1JI0A 4Q16A 1V5GA 4TMZA 1K6JA 2ZR7A 3BX1A 1E59A 1J5XA 1TMYA 2HSZA 2ROQA 5B58C 1DMRA 3BAZA 2ICAA 4KU4A 2Q27A 4IVPA 2EWMA 5EKTA 1UK9A 1W8DA 3CUKA 3PC4A 2QJRA 4X1KA 2HLDD 2QPLA 3HFSA 3ULKA 3W8DA 5JIBA 2H1OA 2ZM6B 1I5OA 1E3QA 1HX7A 1Z6GA 3PQ6A 5BOSB 1JGTA 1OZFA 3ZWBA 2BL4A 1W59A 4FDMA 4YWJA 2ZFUA 1JBQA 2YHAA 2B1QA 4P4GA 1UBRS 1Y9ZA 3UAYA 4HNSA 3JQFC 2IDMA 3A6GA 2R7KA 4LUCA 1AO0A 2BDEA 3FMOB 4X66B 3FYHA 4BTVA 4JKYA 1ZH2A 3LQYA 3IOMA 3MWEA 4U7JA 4WOKA 3JQGA 3K5WA 4FGUA 1JG6A 4YP1A 5B7QA 1M72A 1YC5A 1M66A 2GVZC 3NX4A 4YMIA 1Z75A 2Q99A 3DFMA 5AJYA 5L3RA 3WGJA 2OV2A 4EUHA 4ZYUA 5HZKA 4RGBA 3B6JA 3LC7O 2CXSA 4PZLA 3LL7A 4L85A 2OPBA 4XQEA 1PN3A 1KPGA 3THOA 1ABBA 3AM4A 4YACA 2LNDA 1D6JA 1E77A 2IIPA 2IYTA 3DBLB 1JVNA 3O4IA 5FL3A 4DIBA 2B82A 5DX8A 2HSGA 1T0HB 5JSHA 3FFAA 2Z1MA 4P5EA 4KR6A 1DWUA 1CYEA 2I6FA 4E0BA 4KTTE 1DQSA 1VLZA 4EKEA 1QP0A 3KIPA 2NSHA 3G2QA 3VO8A 1YFKA 3HSYA 1R8XA 4CDMA 2PA3A 2J9YB 3BGSA 1RHKA 2ZAGA 3GVPA 2UUPA 4DM3A 3SLRA 3HG7A 5FLEX 1E5LA 3K9GA 3NNNA 5G4LA 1QGUB 1PDVA 1PHPA 1TQDA 2QRUA 3CLRC 4O4IB 4L4SA 4D9HA 1V16B 1B0AA 2AFIB 2V58A 5D5HA 5IM4A 1GZDA 2AFIE 2CLIB 3INGA 3G68A 3FGNA 4J0FA 5IEBA 3SKVA 3WSWA 4A26A 2O8CB 5EE1A 1GPWB 1UIMA 1DBQA 2RH5A 4KQCA 4PRZA 3K70C 5D00A 2NYVA 1O95D 2ZE7A 1E99A 2QV7A 4A23A 1E6WA 2B8TA 4GSKA 4JLJA 4AG3A 4ZGBA 3EFOA 4ZDWA 3MIIA 4Z3KA 1TQ2A 1R18A 2XAAA 2ZSDA 1J2YA 5J2TB 3BMOA 4ZQFA 1XVLA 4NONA 4EMUA 3QJYA 2QMOA 3OE7A 4NQRA 1GXSB 1KU6A 1YUMA 1L7NA 1T2UA 3M6IA 4TTAA 1CW2B 3BXXA 2ZIXA 4TV8B 2OZLB 3RJMA 3ZY2A 5C8DA 3F3MA 4YRJA 1G5TA 1P17A 2D5BA 4HDMA 3OZFA 2FXVA 2IQIA 5I9TA 3V3TA 4D7AA 3E5MA 3M7IA 5L45A 4LVCA 4H3HB 3CRMA 1JBEA 1KO7A 3BUSA 2YVAA 3SYTA 3WJ7A 4EW3A 5IAOA 3S28A 3LT4A 3ABSB 2GJ4A 3VU9A 1CVLA 2DQZA 1Y1PA 5CA1F 4DB4A 3GJSA 1YS4A 2A0YA 3HPQA 1E2PA 3OECA 1E8NA 2NZVG 1LSOA 3FSRA 3JQAB 4GQIA 3G2PA 5IT4A 3KZKA 4X0EA 2X40A 2YY7A 4EPWA 1XHLA 3E9YA 3L02A 1YR9A 1GKLA 3WIBA 3FPAA 3KQOA 1YZ3A 3TLKA 4F4UA 4GICA 4OHYA 3NVAA 1TKRA 2PZKA 2V7QA 1L5SA 4L5YA 4LPKA 4CMAA 2FJUA 4FONA 1XXHA 1XNJA 4XCQA 3O8QA 4EK9A 3OKFA 5JBIA 3IVAA 1LS6A 2DRIA 1E2GA 3R0VA 4IH1A 4L4RA 3BMQA 1BDIA 1PKEA 4BX3A 4LJRA 4LF5B 4BEBA 1ILWA 1TKBA 4NBRA 1H4QA 1UBFA 2O2XA 1IXZA 1EYZA 2Q50A 4NENB 1IIRA 2RK3A 3KJQA 5JSKA 3K0BA 4LRUA 4BU0A 2ALJA 5DZSA 3SQLA 4L15A 2WAYA 3NXKA 2GDZA 2WW8A 4IKOA 3OPXA 4WACA 4X93A 3SP1A 3VOSA 3AZPA 4DG8A 2OGUA 2BFEB 1TE2A 4ZD6A 4F11A 4DM4A 5JVDA 3IOBA 3AEZA 3DW3X 4GMKA 4R9SA 1XPRA 5BQXA 4BNFA 1V5WA 1S3SA 3DMDA 5A3VA 1QIJA 2G63A 3R3ZA 3E3MA 1UBKS 2FFBA 2OA0A 4KQGA 3EG9A 1PJSA 2ETVA 2MJLA 4IJ5A 5EZQA 1ZRSA 3OX3A 5SY6A 3U9TA 3ED1A 4RK0A 2C3MA 1V5EA 4H7KA 3A6HA 3TUZC 2BGNA 1PR4A 4QXOA 1DOZA 1ZR4A 4RKQA 1DU4A 2AEMA 2POQX 3EYWA 1AUVA 2VP6A 2E3JA 4E51A 3IAAA 4IJWA 3S7TA 3RG8A 4TXNA 1IM8A 2CXQA 4W1RA 4DTCA 4DLAA 1DXQA 5H68A 4ZHQA 2HAEA 3R7NA 3ADOA 1QB7A 4BVGA 5JS1A 1UXJA 1XDUA 2B8WA 2GN4A 5A0TA 1X19A 3QFRA 3WK4A 2ZE5A 1DAEA 1HZZA 4WK4B 3ANXA 2PGOA 5F9HA 2QIOA 3NHAA 1N2SA 4LHVA 4MDHA 4BZQA 4R69A 4ED9A 1FYXA 3PV0A 4I50B 1SOMA 1ZESA 3RTAA 1HOXA 4FD3A 4DR6B 2R6HA 1Q0SA 1KI2A 3AHDA 4WLUA 3RS5A 3H5VA 3RABA 3VOTA 2IYUA 1U0TA 2PMEA 3GQVA 2OY0A 4U9HS 2JI8A 4OLHA 3L7NA 4JHLA 1OD6A 3FHOA 5FHRA 3TZEA 1TU3A 1CP3A 4B44A 4D5EA 3IKJA 1FJHA 3VH3A 5A5FA 1LUAA 4V03A 3M4JA 3P0RA 3QOYA 4FZJA 4FZ3A 4JZKA 1ECCA 3HO1A 1EGVB 3M1YA 3ZWYA 4Y30A 2VTEA 1ZAKA 1KC3A 1DS6A 5HJ5A 3KQVA 5L9AA 5C1OA 1JU4A 2ORYA 4RS3A 3PQ5A 2H5JA 4YXWD 1K7CA 5IUJC 2ZRKA 2BFBA 2WU1A 4ICIA 2CNWA 3M9WA 4PR0A 1EP1B 3BL6A 1IHDA 3NC0C 1SFRA 1VQ1A 1URPA 5K4AA 1HEYA 5T7BA 5GP1A 2VJMB 1DE0A 1KI1A 2C9MA 3PHBE 3JZFA 4JUCA 3HA2A 4N0MA 1JHDA 1BKDR 1NY6A 4BMOB 3I62A 3IPLA 4OHZA 1MH9A 4RTQA 4YO8A 4ZQBA 3RSLA 5LB4A 3RYCB 2BOVA 3NV7A 3TW4A 4AG5A 1UWCA 1PJ4A 4NQZA 2P2ZA 1NY5A 2XLBA 2Q4OA 3ROXA 2JA1A 4G37A 2G1KA 3LK6A 3UMBA 1E3MA 3ROTA 1BJTA 4P4TA 4BNVA 2B21A 3CIFA 2PT9A 1IPFA 4P7FA 1UUFA 2FDCA 3GCWA 4B3RB 4JP2A 4PAQA 1HL3A 5F7XA 5IVKA 3RAPR 3MB5A 1OH8A 1EB9A 1GGJA 4NU5A 2IYAA 2VLBA 3GFFA 2W0SA 4I1PA 3OJLA 1Y48E 4XFDA 1E9AA 1GVHA 1VIYA 2JHPA 1KR5A 4MTLA 5ENDA 2B3DA 4PR3A 2W2NA 3KPJA 1V11B 2ZS7A 2G4VA 1LRLA 1R4ZA 1WUKS 1ZLXA 2BAGA 3L5OA 3MRXA 1LI7A 3PXXA 2XB6A 1DB3A 4YRGA 2ZZKA 3AVOA 4NOKA 3DLPX 5T3YA 1NVWQ 2VZLA 5FUMA 3HJFA 2ZETA 2BY4A 4L8VA 1KYVA 2W2QA 2Z5GA 3QMVA 3WX0A 4D4KA 5AESA 3GA5A 5GOTA 4ENSA 4IZOA 3DA8A 4PLWA 1ZCBA 3A31A 2RG7A 3CLSD 4LHYA 4F3NA 5CB4A 5I3ZA 3ZVNA 4JKIA 1I9CA 4RH0A 1E0JA 2P9ZA 4EABA 2BFFB 4JJGA 5G0VA 5LA6F 2BH9A 5D3MB 3S2GA 3UHJA 4JJEA 4N5LA 4MR7B 2GCIA 5DLQC 1EIWA 3H5IA 2XT0A 3VNAA 4OGGA 5JNSA 3BB4A 1NXSA 3N2LA 1VDZA 2ZBPA 2XWQA 3BFJA 3CVVA 2ZI6A 2X3UA 5FBKA 1NMZA 3WNZA 1NHGA 2DFDA 3ZDRA 5K9ZA 1U28C 2JIDA 1MQSA 3QA3E 2IUSA 3QKTA 4KJZA 2J6IA 4ZOQI 3ADKA 1AN0A 4LYGA 5DEOA 3NBXX 4Q3DA 3I37X 1B8OA 5FOXA 1Z5UA 4PVCA 5I01A 1JHQA 1F6BA 1BD4A 2PRSA 3KPUA 4EG5A 2WWGA 1LSJA 3M1LA 1L7AA 2WEKA 3U7GA 4L0CA 3GWGA 4MXDA 4ZQIA 3ZTWA 2C4UA 2PNFA 3NT4A 3CVWA 4MUNA 1DCKA 3ROFA 3TLEA 2JANA 2QUKA 3WGLA 3WKBA 5KWIA 1PFWA 4UHDA 4C06A 4BIIA 2BGRA 1ZN9A 5AVJA 3D81A 3U17A 8LDHA 5TS2A 4GP6A 3VC7A 5KPJA 5JYEA 5KNDH 1P5JA 3IIEA 3R8XA 2BSAA 2H9IA 3DBHB 4NG5A 4W7HA 3IQGX 1TEZA 4CEJB 2QUHA 3DONA 4KN8A 4F12A 1Z5WA 2C1EA 3VYTB 3DE5X 3W2FA 4X8LA 5B1DA 3TI9A 3O8RA 1XDSA 2IYNA 1TYDE 2YR0A 4UUQA 4BVBA 4YRAA 4J03A 2RCYA 1Y8RA 1A97A 3OEHA 3ZGOA 4QO8A 4DY6A 2AV6A 1X1RA 1W4RA 2OQ2A 3EIFA 3ZD6A 3FR8A 4DLZA 3VSEA 1NI4B 5EVCA 4B5KA 1BVUA 3OKPA 3ZHOA 2FKNA 3RYFB 2PWPA 2DKNA 3EXFA 4X61A 1E3LA 3WXMA 4DN6A 3CEPB 1MVOA 1QUEA 1QRUA 3PHLA 2AJ8A 5A4KA 4LCJA 2D1YA 1JIUA 4YAUA 4ESVA 2XSZD 1XTSA 1S2LA 2EQ5A 2W43A 4FFBA 4NFHA 4Y2HA 2DUWA 5ALZA 3PDCA 4KQIA 1EQAA 4X95A 3VU0A 4DABA 1SURA 1VSBA 2EX1A 5K8VA 1RJEA 2IH5A 5KQSA 3UBMA 1W6UA 1GFSA 2LCQA 1I6KA 4HWGA 3DZJA 4NFYA 1G7TA 2R8XA 1F06A 4Q4DA 1C3OA 4RVHA 3MUEA 5FA8A 4YCLA 5AW7A 1JDVA 3EGWA 2EHJA 5FPTA 1Y3AA 2GQ0A 1RAHA 3CF6R 2Q2OA 4KLAA 3ZHVA 1NYTA 2NQ2C 3HBLA 5JRJA 1T2CA 1L4MA 1T8TA 2HO4A 4Y2PA 2RGAA 2ZBQA 2GWRA 3G0DA 4KV7A 4LOKA 4QQKA 5LMUB 1N3BA 3DZKA 2P9YA 1Q1AA 1VMDA 2R48A 3DOEA 3FYUA 3PITA 1HDYA 4M0PA 4V2IA 4BP8A 4ZI2A 1OAOA 1W85B 2GLUA 4RZXA 1CQWA 2WYWA 2Y9PB 3MYRA 1RJFA 2W6MA 1YTLA 3OWOA 4QBTA 5IBQA 2GAOA 4IHKA 3LHIA 1XD9A 1E2UA 2G72A 4PYRA 3X0DA 4D6XA 1E94E 1Z8NA 2C7BA 2CE7A 2VP4A 1JKXA 4DUGD 2C9ZA 3WIDA 3DM5A 2HQSA 4WLNA 1VMAA 2EZUA 1TGYA 2XADA 1XWIA 2BEUA 1T3GA 1WCIA 2H1VA 2LIPA 5TE9A 4UQLA 3VKFA 2XBMA 1PZFA 1G291 1GKUB 2E5WA 1WCV1 4YYZA 1BFKA 1BX3A 3HJCA 5ALGA 3JAMA 4UHCA 1YB4A 3H2BA 4CMKA 3IPAA 2F3QA 1XRLA 3EZGA 4K05A 5DYTA 1N78A 2EKZA 3AR9A 5DWQA 2AE1A 1WEHA 3P4UA 1E58A 3IUNA 1ENPA 4HRXA 3NETA 4GMHA 4KLCA 4QGGA 1OH6A 4C4PA 4PYOA 2CLLB 4RY9A 4YRMA 5EIOA 2GPAA 1NJ5A 1M2VB 1L5LA 2VA9A 3TL3A 4NZPA 2PK3A 3HV2A 1Z82A 1A8SA 5TX7A 3V1TC 1GD1O 3ZGVA 3Q0TA 1RMTA 1PSDA 3CLVA 3O73A 4C0HA 2NSDA 1PO7A 1NZFA 3LYLA 3Q7EA 2M6LA 1M2WA 3C4QA 2Q2VA 3DSRA 5FR1A 4NH4A 3RSSA 1FE8A 2QMYA 3KOXA 4XR9A 1Y1KE 4UTXA 3Q4GA 3S4YA 4Z7QB 3E9ZA 2Q1YA 3IOYA 1Q7RA 2QI9F 1ZCFA 4LXTA 4V0LA 5TV2A 2FUG1 3PIDA 4J1SA 4Z2AA 5KTTA 2ERCA 1HYBA 1G8AA 4QHSA 4TYNA 1BS1A 4BEJA 2XCQA 3MWFA 2ZYTX 5JSFA 3P8ZA 2VUSA 4QDXA 4B8ZA 5ALXA 3TPZA 2LZ0A 3QK7A 2A8YA 2RGNA 3H2YA 4FBGA 3QE0A 3BJMA 4JVOA 1VM6A 4MAAA 4NI5A 3T38A 3GLGA 4NXNB 1CDOA 5A4FS 5KSWB 1E1LA 2JI7A 3H5AA 4M36A 3K9WA 3VZDA 2HV8A 4B4WA 1U0HC 5K0TA 1HT2E 2QX9A 3SQNA 2VDUE 2GPJA 4D0RA 5LUAA 4BUJA 2H4YA 4L7QA 1GCOA 3H18A 4TLEA 5DNVA 3X1YA 1KZGB 3EG5A 4YP7A 3EGVA 4V0MA 4FPXA 4ZN6A 2W37A 5B57C 2AH5A 4WKCA 2J6BA 1RZUA 4M8KA 2ZUWA 3QLVA 4QUGA 4DV3B 1YAHA 3QXSA 3F6CA 4F0JA 4GKBA 2JD2A 5HG0A 3QWFA 3CLHA 3DDCA 4OXRA 4UHKA 3U4GA 2QTVB 4JUFA 4B6EA 3J7AC 2BEVB 2PZAA 1QOZA 2JBWA 4RMNA 3H9BA 1JKJA 3AOEC 4GPTA 4TQ9A 1DJMA 4NICA 1DI0A 2OO5C 3ST7A 3TQRA 3QGMA 4ZICA 4RTOA 3E61A 5JARA 2FV8A 2FUEA 3I9V6 1NF2A 2I8LA 1TMOA 2VJYA 3IBFA 1JB1A 2CXPA 4QBFA 5HSGA 4GPIB 3I39X 3GDGA 2WMDA 4R7ZA 4IP0A 2FE1A 1T0JB 3FXAA 1EUCB 5HYVA 2ONCA 4M0EA 4XGKA 4LY9A 2DF8A 4W6QA 4NDNE 4P8RA 2PZJA 4FUQA 2PZEA 1O8CA 5BW4A 4U7HA 3O94A 4LV5B 2G7MC 1FYWA 4YP6A 1NR7A 3DYVA 3EZ2A 5EQDA 5BQPA 5K2OA 1QVAA 4CV1A 1MTOA 3N28A 3PC6A 3PENA 5FI1B 2WVAA 4JL6A 3G85A 2Q3FA 1C30B 1U2RA 3IP1A 4ZOEA 1N9GA 1P1IA 2X41A 4D5GA 3TMAA 3MQFA 1K63A 3GLKA 4P7GA 3ZIUA 1L7DA 1QIGA 5I6DA 3HRKA 4QPNA 1CX9B 3KZMA 4ZARA 3TNLA 2J8ZA 4ZRDA 4DQKA 1MRSA 3VR5H 1F2DA 5FBQB 1FNNA 2OBMA 2ZUSA 3USZA 4OK3A 1U11A 3DLIA 3H7IA 4KQJA 1MO2A 1PI3A 4YRCA 4CTMA 1Z83A 5IK2A 5M3BA 5TMBA 1CULC 4GLOA 2XUGA 4FTWA 1EAYA 4XGIA 2CHVA 1YULA 2F6RA 3N8NA 4L78A 1A9ZA 3LRXA 3FM9A 5CJJA 4PPNA 4DEYA 5ELMA 2R87A 3QVXA 3PX7A 1UFKA 3C3YA 1ZH4A 5E4TA 4CL0A 4P4NA 2O2YA 3KEFA 1PFQA 3PRHA 4H7FA 4ZALA 4CCSA 1XMOB 5HNKA 2O0LA 1DEHA 4D3DA 5GV7A 1P2TA 4MV0A 3OJOA 2BZ0A 1A50B 2XNJA 3DO6A 3MW8A 2SKDA 3QTBA 1SKMA 2PRKA 3TOCA 5IRCD 3EIHA 2ZPAA 2JCVA 4Y2JA 3PEYA 4GR5A 2WYIA 3F4KA 2NXWA 4ZMBA 4MIOA 1O9BA 4OHFA 1ID8A 5AH0A 1DAPA 2HQOA 4OJQA 2C61A 2C5BA 5A9TA 2HRBA 1CUHA 1UM9B 5FYDA 2HWYA 1ZMTA 4H0FA 5LQDA 2WYUA 4K3VA 1X7YB 3OD5A 1QKJA 4C7KA 3V4PB 1SHUX 4ZU1X 1QGZA 2ZYHA 1QAQA 2BW0A 4AZ3B 3WGMA 1TAUA 4WUTA 3E0QA 4FDVA 2DX7A 4N5NA 4WKGA 3W5HA 2ZUUA 1XZQA 2LCFA 3FCAA 2W6ZA 2C3YA 5A02A 3RKRA 1REQB 2DBZA 3I9MA 3T61A 3ZV6A 1RVDA 3TDNA 1G3MA 1X1SA 1IK6A 3H6GA 2N9UA 2YHUA 1E2EA 1FQKA 1NP3A 2CKMA 2DECA 1U2PA 2FOLA 2WIAA 3ZIAD 1NF3A 4HX5A 5IYZF 2IL1A 3VOAA 5DX0A 2GFIA 5FBRB 4RESA 4LRXA 1ANKA 3V4SA 2C97A 1R4AA 3HJNA 4H4EA 2XCRB 1PR9A 2JPDA 4MIYA 1O97C 3QUAA 3FPKA 3IQDB 5EZ5A 1WEKA 5IAGA 2AWOA 2BISA 1HE3A 2QNIA 2SBTA 2VDNB 4DRXB 1R9NA 1XVVA 2Y0EA 4YPVA 3ISVA 1PT7A 5CX1B 5A6SB 2XMBA 2EDAA 4ZMSA 4C0LA 1UFQA 2UUOA 3FJOA 5DO9A 4L9WA 1DHTA 1NN1A 2BELA 4EX7A 2OVFA 5DI3B 4YUYA 3GOQA 2G9ZA 1BX0A 2X3YA 1M2FA 1N9ZA 2IDKA 2EU8A 2J0EA 3ROMA 5EHZA 3OY2A 5T4HA 2WT4A 4O4IF 2VHUA 3OPYB 5EEHA 2AOXA 3RTBA 2YYSA 4DVGA 6AT1A 1ZIOA 1B6TA 1RWKA 1P72A 2D2EA 1IEXA 3ACDA 4TMFA 5LLSA 2JJ1A 3VH2A 4KXQA 2CXNA 2PT5A 1Z47A 3DULA 2QX8A 3AJEA 4ZVNA 2HHAA 2XV1A 3H86A 4AICA 1VOTA 3CTMA 3O3CA 1C1XA 1E1CB 4R2IA 4U0KA 2TSYB 5BYJA 4C1BA 5BN3A 3CE6A 3B5IA 2LXNA 1G17A 4QXQA 2NZ2A 3C39A 4G1BA 3UAGA 5EIBC 2BV3A 3KJXA 1H2WA 3MLEA 4MVWA 3AUXA 3P9XA 4D43A 3IELA 4U2GA 2JLVA 1I3NA 1SU6A 1P19A 1PNTA 3VDXA 5J1SB 5FLXA 4MX8A 1V1MA 3CPSA 3O4FA 4ENRA 2OENG 3ZCXA 3KDAA 2FOXA 2C4MA 1KI9A 1UOOA 3L18A 4TSFD 4EG0A 5FFMA 2RD2A 1OIVA 3I52A 1KOGA 4GGMX 3HZRA 1N4DA 3PNYA 3OZGA 4U39A 3NHSA 3FTCA 3ILYA 2WG1A 1ORIA 3IBYA 2ST1A 4BNMA 4CT4B 5GADl 4CF6A 3LUAA 2WWVD 3TSYA 4R84A 5CDYA 5E6UB 1E92A 3RJTA 3TFWA 4LF9B 4YV7A 1JR3A 2IHBA 2BSXA 1WE2A 3AU9A 3PGMA 4JUIA 1FP6A 4PM4A 1U7WA 2O52A 3Q87B 4BO9A 2X4IA 2BFOA 3E7WA 3AU8A 4FR2A 3PVSA 1P4GA 1KYTA 3A1WA 4Q7MB 4RH3A 1JLSA 1J8FA 1ZUNB 1H2HA 3GAAA 2DHQA 1R37A 3A6LA 3WRWA 5YASA 2C1ZA 3CNOA 1YACA 3HA5A 4ZXPA 1CUUA 1C7EA 1CIPA 3C43A 3EXHB 4S0XA 2YBEA 2B8EA 4P53A 5EIWA 1XBTA 1YJBA 2CHFA 3Q1KA 3M49A 4IMPA 2Q1XA 4BMVA 1MG0A 2ZSJA 2HMAA 4KXFB 3ZX4A 1ZK1A 5E9WA 3KTDA 2PGLA 1YMVA 2B7LA 4ZCIA 1CUWA 4IJKA 4NEQA 1N57A 4D3XA 2XTJA 4EDFA 2Y1EA 3LHSA 2X4GA 3DLTA 5AIAA 1WXIA 3P0JA 2EL9A 4OQDA 1P6UA 1OZHA 2AE2A 4KQ6A 4CGYA 5L51A 3O8OB 1ZM4A 4KXUA 3ZVKA 1GM5A 1V3QE 2C92A 2ILVA 2I1LA 1C8VB 4WFIA 3UM9A 2WHYA 1SB8A 1E2LA 1NZDA 1YS7A 2F3RA 2R7LA 2WIDA 3LDFA 3LVFO 4ZV7A 1DC3A 3NG1A 4F85A 4F3KA 4P82A 3LS2A 4AQ7A 4BUCA 4D44A 4HEJA 4GLJA 4KDEA 1FUKA 2GXAA 3W34A 3OU2A 3L7BA 3PGJA 5DM2A 1ZJ5A 4JMPA 3JD2A 5K3SA 1XQYA 1ZI9A 1Z5VA 1QQ5A 4HDSB 1M2HA 4X63A 4GM1A 1I3MA 2X1MA 2WG0A 1RQ2A 3OC0A 4QHYA 4D8VA 3GJ0A 3G5TA 4XEUA 3L92A 1M2JA 4K8RB 4MP8A 4C7JA 2RGEA 5K0BA 2IUTA 4JELA 1ITZA 4C0AC 2IP2A 3CEMA 4FYHA 4UCWA 4JZYA 2AX3A 1FYFA 3W5IA 2D0OB 3BF7A 3IDAA 1R0CA 7MHTA 1VIVA 2Z04A 3JQQA 3RRFA 1P0QA 3A2MA 1H94A 1WXFA 4U7DA 2A1UB 1IU9A 4JVSB 4O4JA 1T5OA 4ZVKA 4DLNA 3L46A 3CQ9A 3DQZA 4DV5B 3ZCQA 5TJ9A 1DWPA 1Q1BA 3CCFA 3NEYA 4I50F 1AA9A 5JSYA 1UFOA 3P1JA 4J1TC 1SOAA 2Q46A 2Q28A 4J8PA 1DAIA 1PV4A 3D1JA 2RFLA 1Q7EA 1UCFA 5AM0A 4ZOLF 5J2UF 4TM7A 2QSUA 4CKWA 3TTXA 1G4UR 2GJAA 3WWEA 5EJ5A 1IZZA 3DT6A 3DMNA 4Y2GA 3T54A 4YAEA 4CQLB 5LD2B 3BAFA 4UNIA 4YA6A 1W19A 3RBZA 1ES9A 3IDQA 4TV9F 3SFTA 3RSHA 3TLCA 4JI2B 3WLIA 3UJ8A 2BR3A 1VL2A 3HU1A 3NBFA 5JPIA 3WLOA 3GCDA 4I0WB 4JJZA 4FYMA 4Y2QA 5JXWA 2QUIA 1Q16A 4CQJA 4Z4GA 5FWXA 3Q7IA 1CF2O 2H52A 1RAFA 4HX9A 2WY2D 1WUJS 2YWEA 1Q11A 3ELYA 5HIJA 5KMGB 4FOSA 3TW6A 2WVGA 1C8LA 2ZQZA 4RH1A 4MCJA 2XGGA 4RTJA 1XR3A 1X2EA 2OV1A 1SM4A 4DV2B 2JIZA 4C7MA 3FB4A 2IDZA 5IT0A 1P7PA 1RCFA 4GMDA 4JJAA 3QKSB 4B35A 2BRUA 1SBTA 2VUUA 3FY4A 2I4RA 5K8JB 1L2TA 4K86A 3ZY5A 1C0KA 3MOSA 2NU9B 1WAMA 3SJ7A 4AKEA 4X65B 3THXB 1LFDB 5ELXA 4DQLA 3D1VA 3BS4A 1ZUIA 4GPAA 4B6FA 2DUJA 4J3NA 5KSYA 5GZ6A 5A7HA 3B12A 4IDEA 4K7JA 1OXXK 4MWBA 2HK8A 2GPWA 4CT0A 1G5RA 1QOPB 2OP0A 3PEUA 1KVRA 4MEAA 3TFQA 4F4DA 2CNKA 5JCZA 2VJDA 2XXJA 2ZYIA 4AJ2A 1CUVA 4BMPB 3CV3A 1L9KA 4BAGA 2Y27A 2C59A 2HKIA 2VDWA 3BXGA 1OXTA 4L0QA 5TY0A 4LE1A 1I4EB 5EE3A 3EJ6A 4H15A 1ACLA 4B8WA 5A0FA 1IXKA 1P2GA 3C85A 3BQNB 2PUTA 2GKSA 1E2HA 2W6ID 2YH2A 3AUAA 2FWBA 3IKMB 4KWIA 4AU1A 4UAJA 3SDSA 3FCYA 1JQDA 3IVXA 2XHEA 1P9OA 3PNSA 2W2XA 4LY0A 1JIVA 1QF7A 2MR6A 1AUOA 1H05A 4URUR 2L17A 3NP9A 4RKFA 5KPDA 1MHTA 2DQYA 3V8EA 2BTQB 3ELUA 1MC4A 3DF7A 1T3HA 4TKUA 4PPQA 1W8IA 2O7QA 1ESMA 1JSCA 1PD1A 2JGDB 1NKSA 2DG2A 5HEKA 4KKXB 5LSAA 5JZ9A 1CERA 1XYVA 2OV6A 4XFKA 3RRXA 1QOQB 2F1JA 2KE5A 3H97A 4JGBA 2H1IA 3P2EA 3CT4A 4YCCA 1QFJA 4NMXB 3KLNA 4QPJC 4ZO6A 1TQ8A 4LG1A 1E60A 3HMQA 3GEEA 3WLAA 3CU5A 1G6KA 1Z06A 2WHEA 3DVSX 2BKXA 2WHPA 3VBCA 2CSUA 1D7AA 5JMPA 1JTFA 4OV6B 1U8TA 1XWFA 3WZ2A 4ENVA 1R3UA 2JIBA 3FDXA 5GOZA 3EEIA 3I42A 3R0ZA 3RVBA 3CWCA 3X1DA 5G0SA 3CZ4A 1Y8QA 1C9EA 1V25A 5DWVA 1PWXA 4LX0A 1ZIPA 3O8BA 4RJIA 2GYUA 3TLXA 1GRCA 2MU1A 5KNBD 2CHQA 3CKLA 3RARA 3SMQA 3GRVA 3W8FA 2XD4A 5K6RA 1OPRA 5CB0A 1VPDA 4D1YA 2I9PA 4UFOA 2FGKA 3KCQA 5AHXA 2I4LA 1FNBA 3BJIC 4L22A 4XYLA 1F9EA 2NU7B 4N03A 4JYCA 2R8RA 1UMCA 2R4TA 3Q9LA 3C87A 3BD9A 2O3RA 5CH8A 3ONFA 3KZXA 1HNXB 3R3HA 1EX6A 1HE1C 3JU3A 5HIMA 1U0BB 3VZSA 2VUIB 1P9WA 1W52X 5ECGC 4EI2A 2IIQA 2HPAA 1JYEA 2FAXA 2P62A 3TZLA 4JLAA 4MPTA 3ROGA 3V8PA 5LB2A 1JWLA 1PDWA 3TGPA 4MGHA 4INAA 4EHJA 2BE9A 4N0QA 3ILVA 3RU9A 1N6NA 3R0XA 4R2HA 4QPPA 1K7XB 3WBJA 4V39A 3EQ7A 2W2PA 1NJ6A 3G2MA 3KYBA 1TMGE 3BIXA 3V1UA 3X44A 4YAIA 3P4XA 2X2PA 4NZYA 2JH3A 1RXYA 4O3FA 4UAGA 2GYYA 3D64A 4XCXA 4XAQA 4NJMA 4Q15A 2BM1A 1FTNA 3F6YA 5DCYA 4C3VA 2B1IA 3GLTA 1R9MA 5HM6A 4GBMA 1W49A 5ERGB 4CM4A 2ZR9A 3FVWA 3QVGB 3VVLA 3L0OA 1WCWA 3IEUA 2FR0A 4TTPA 3OQOA 4JHXA 2XEDA 3LAWA 4E3ZA 3FWKA 4FR0A 2HZ7A 4RHUA 1SVKA 2WTEA 4RACA 3WFJA 2ZRBA 2YHIA 3LUBA 3L7YA 4JC5A 3F78A 3QQ5A 3H04A 3QLUC 3NC4A 4BN0A 1QHNA 5LP6C 2QXYA 1GUBA 5DW3A 4JXKA 2BHNA 1Q95A 5AKEA 2XH8A 5DH9A 2SHKA 2O8NA 4GP7A 4MB0A 4U7FA 4UD6A 3VKHA 3DR3A 4RNCA 1KOJA 1EDEA 1YL6A 4BBZA 6ADHA 4GVXA 2EZTA 2HQ1A 4UAVA 3T9EA 3FFXA 3JR7A 4IJMA 2R25B 4Z51A 2OCAA 3P5SA 5AM2A 2YC4C 3HXMA 1NPYA 4D41A 1T6ZA 1D07A 3D8HA 4RXTA 4URHA 4OGLA 3REFA 1DJQA 5BOSA 1YGPA 2TMGA 4TM8A 4U6SA 3RV4A 5JPDA 2ZSFA 1SUDA 1GGNA 1JLLB 1VRVA 5H81A 5I9BA 4Z6KA 1M54A 3IB3A 2NZWA 1YDFA 4GG1A 2XEXA 4I1VA 3Q15C 3SQXA 2WFZA 4IQFA 2EHDA 4JFRA 4CNBA 3IA7A 4F56A 2QZSA 3G02A 2DP4E 1UKZA 1V1RB 4H18A 4K6HA 4CMIA 3DGFC 1H6AA 4CLEA 4DIMA 1TFUA 3R6TA 2Q45A 2I2AA 4QASA 4MWSA 2O3QA 4L8WB 1UJ2A 5KVSA 2B8NA 4C2TA 2OR3A 3CZMA 5AJXA 1OXVA 3OFKA 4AW9A 5H8WA 3GJ4A 3I45A 1S8NA 1XDWA 3ETNA 1B7GO 3CNQS 3IA2A 3NHWA 4BMNA 4MH0R 3PC8A 4ER0A 2Z43A 3G1TA 2FQWA 3MUFA 3OM0A 1N5RA 1PU2A 4XOUA 5JALA 3MJHA 2C8JA 1SCAA 2YXEA 2YY6A 1KMCA 4XFJA 5BWBA 1MX3A 2AOTB 1WRBA 2ODQA 1KMNA 1TVKB 2ZI3A 3MBOA 3O9VA 4AF7A 1C7QA 3M6VA 4IDGA 2PL5A 1KZYC 2DH5A 2JFZA 4G41A 3EMDA 3RFTA 3ZW9A 3H2JA 3HB7A 1KETA 4EFNA 5AUOB 2R60A 5SYMA 2Y77A 3SR3A 3T8YA 3EOAI 4N18A 4KQ1A 2I34A 4JC8A 1PUIA 2JFFA 4B31A 2FYTA 4JXXA 2OHFA 1OI4A 4DWJA 4XGQA 5EHQA 2C99A 3BGDA 4DXAA 1B4DA 2IX3A 4EA6A 2JJ8A 1X7ZB 4E1VA 5JU6A 1QGUA 1IY8A 4O4IA 3I9V1 1RMYA 1V16A 4KI0A 2YFKA 2FQ1A 2AFIA 3VTFA 1OVGA 4GRDA 3A4IA 3G1UA 4C87A 4HL6A 5HFAA 3UTDA 5DK6A 4DC1A 1PJAA 2KHZA 3FKJA 3K1YA 2PRZA 3TI7A 2J3MA 4CLDA 3A6DA 4R6WA 1UKCA 1G8MA 4Z4FA 2O3TA 4AP5A 1YRYE 1UEIA 3I3OA 3UK7A 3X43A 3DHNA 2R8ZA 4H1TA 3BB3A 3ZHCA 4DSAA 1L5VA 3WLQA 2RCNA 1GXSA 2HU5A 1Z0SA 4TV8A 2GEBA 3SZLA 2XIJA 3QU9A 1QQBA 2QTCA 2QVXX 1UAAA 3K72B 5EAIA 1H0RA 1O95A 3L7MA 5K3CA 1CJVC 1CRQA 4D0SA 2Q8PA 1XCBA 3TKAA 5IVPA 1YB2A 2PXXA 9GPBA 4FFDA 2PU7A 1YE3A 2YQZA 3PPXA 2WE8A 4L4ZA 4YAOA 3C8DA 1G7SA 1KARA 1BHJA 1P62B 4JENA 1V35A 1RYYA 3AUUA 3OOEA 5EPEA 1E64A 5AHOA 3WQSB 4LSGA 1GCUA 4Z1MA 1IYZA 1KFBB 1EEXB 2ZAMA 2A14A 1H4VB 3AF5A 3AUTA 3TD6A 4NZMA 3SR4A 1BGVA 2P4SA 1CY1A 4U7TB 4MO2A 2HA7A 4Y2XA 1XRNA 2H7XA 2WPDD 2WYVA 4GQBA 4OHXA 1J1UA 1K8QA 3HB9A 4BLWA 1OWMA 4LXHA 4WK2B 4DLPA 4IIBA 5E3JA 4CLXA 1LJLA 3GJZA 2PLRA 4QJ5A 4R8RA 4EHDA 5A1JA 1BDJA 1YR7A 2IOYA 1F5NA 1TQ4A 4KIJA 1U0EA 2HBRA 2Q4RA 4N8DA 4XUDA 2R7MA 3ZE6A 5D5PA 4KTVE 4WJLA 1U4SA 3KU4A 3PJGA 1EK0A 4CEHB 3VNSA 5KNLA 2QRMA 3UGJA 1LW7A 1TLFA 1JE1A 4BNXA 3AFNA 1QIMA 1VJ1A 4X00A 4DZTA 4YFYA 2H48A 3ZOKA 2O59A 1TMKA 1SA0B 1CZRA 1SUFA 2G9VA 2JCSA 2JIQA 3PNMA 4NENA 2OGSA 5LDGA 1VZ3A 4YJHA 1TEXA 4B76A 5IN4A 2YJTD 2IVFA 5L53A 2AJBA 1NRJB 4JP5A 1DXYA 2HK9A 2PKQO 4DNOA 4E70A 2BFEA 4YRBA 1Z0ZA 3HXQA 2CB0A 4Q4AB 3A9CA 2CJXA 5LBTA 2QJOA 3ICQB 2XZDA 5H4GA 3C7AA 1L3CA 2CNBA 5J47A 1BA3A 1VGQA 3KB8A 1IWBB 1WVGA 4JFAA 4MRMB 5ESRA 2QYHA 3TX2A 3HDHA 2H4XA 2FNAA 3PZRA 3U3KA 2VSFA 7REQB 1V39A 2XRZA 4OLBA 2APJA 4DMLA 3D8SA 2I3AA 3STVA 4RA6A 5JAMA 1DJLA 4HYEA 3B53X 4HADA 4Q93A 4A92A 1HY3A 5ESDA 1V6CA 4QA9A 2DY0A 4P84A 3K3PA 3R8CA 4B6PA 4W5QA 3CBQA 3OZEA 3RVLA 3O8LA 1UPTA 4HGYA 3PHHA 5DTMA 2KSQA 4F5YA 5F2OA 3ZKAA 3E3NA 3UXHA 3ZU6A 3O9ZA 2V1XA 3VJKA 3ZV5A 2OBXA 3I5XA 4BQIA 4PPGA 1GQOA 2GEDA 4HFNA 5AYVA 3GGPA 1S2OA 4L2IB 4RELA 4FNOA 3KNZA 3Q9SA 1NOIA 3RYTC 5HJEA 4I50A 5MFZA 3ECCA 3VR5A 4RTKA 3F5QA 4Q02A 4H6PA 1NMSA 1UQUA 2BMJA 3HWRA 3NEAA 4UVEA 1KO4A 1OXUA 5K6AA 5J2UA 2XMSA 4UHHA 3QYAA 1A8PA 5IABA 2AC7A 2I2BA 3PHGA 2AMLA 2IHUA 3K2IA 3D6JA 4DJDC 1G38A 2C03A 2GXUA 2YVKA 5AOAA 3MAAC 4XDHA 2QY9A 2ZJ8A 3GLQA 2XECA 3K05A 4RAQA 1NVVR 3TL2A 1Q77A 3LXUX 1FVXA 1ZW6A 2QT1A 4IZHA 1JKFA 2VJLA 3QFHA 3D7LA 1Z5PA 1U1DA 1B2RA 4L28A 4OK6A 5DFAA 4YIHA 5A05A 2PSSA 2QX4A 3FUUA 1T26A 2ZIWB 1QH1B 3Q6IA 1TVEA 2WUDA 4TWRA 1MVLA 6GPBA 1DADA 1JPNA 3EIXA 3KOZA 2XNHA 2CJWB 3BD8A 1H85A 5FOTA 1OCEA 1VJ0A 1I0IA 2WIJA 2P75A 4M1OA 2OCYC 3AW9A 4A8JA 4E5VA 5M34A 4N7JA 5CT5A 2P2SA 4BMSA 5LQKA 1KAHA 3RYCA 2GS9A 1KRXA 2PX5A 4HVCA 2YBDA 2V9CA 3EN0A 5FFNA 1CK4A 2BVNA 1RYZA 2EF0A 3I0NA 1GA4A 3EVGA 4WEQA 4HNUA 1T0UA 2FQQA 4OX9B 5CRIA 1TAQA 1IN8A 4D0NA 2PSJA 2VF2A 3GT4A 4XIFA 5IJ9B 1F2TA 4F6RB 4E11A 4YQEA 3AIIA 4MR9B 3ANYB 1KE1A 4YK7A 4LRTB 2G17A 3OCVA 4FMDF 2VUTA 5EHIA 4AYTA 1Q1NA 3I6YA 2QW8A 4RJKA 4Q9HA 4BWYA 4EEKA 4FLFA 3ZWCA 1V11A 3F3SA 4R1MA 5EIFA 4EY8A 5C9ZA 1YZKA 3VZCA 3WGGA 3HXKA 4TXJA 3WB9A 4EP1A 2RARA 1SBZA 2ZS8A 1OWPA 4EI8A 3F4BA 3KPWA 1JWBB 5F3DA 4YUZA 1JA9A 1L5KA 3BCSA 2DFVA 1ZVVA 2QD3A 4QGAA 4TMTA 1U0SY 3KC2A 1RPNA 3B2QA 3FSGD 3OWXA 4H1UA 1TLTA 3H1EA 5F7JA 4MICA 1IUPA 4UVIA 2CJFA 2PMCA 3L40A 3LXXA 2Y05A 5LC1A 2BFFA 2QTWB 3B6MA 3GU3A 5D3MA 4RDIA 2XCOA 2ZJOA 4MR7A 5HGJA 3AR6A 1TAGA 2OV3A 2EBFX 4AMBA 2PBFA 4D92A 4FR5A 4J4TA 2QT9A 2O1XA 4TS3A 3BPSA 1XRJA 5BMVF 4ZREA 3HWWA 4G0VA 1ENZA 2VPYA 5JATA 1SMKA 2OFXA 6CHYA 5KJFA 3VNVA 2WZCA 4MRRA 2NADA 2QTBA 3NOXA 4OH7A 5H82A 3RQSA 3QVSA 1WMEA 2BHSA 5KNCD 1AHIA 4R1SA 4KR2A 4LWQA 3N0RA 1JA1A 2EWWA 2BGIA 5FUWA 4EG4A 3ESAA 1WTAA 2FXIA 3INYA 3MJSA 3PWZA 1OLOA 3IQXA 4E5YA 1JILA 1DRKA 1UBTS 1KEWA 1XZLA 1ZC3A 2EF1A 1Y5NA 2I03A 2YXBA 3CVJA 2BLLA 2PVSA 2GPSA 3H84A 3KHTA 2MINB 4YUVA 3A9SA 3EQ2A 2KLBA 1OAAA 2G71A 3GJRA 4OGKA 3ZH2A 5IDXA 1H8HD 4JEHA 1SKYB 4FC7A 3KZCA 1SKYE 1Z4PX 1ZVJA 1QTQA 3FTNA 4CR6A 2FSIA 3QXXA 5IYZB 1RQGA 1KRWA 4E6EA 3DBHA 5CLHA 3LBNA 1D0SA 4FEGA 4B6GA 1XVUA 5BWOA 3QNMA 3ZI4A 4CEJA 4DR4B 3L8DA 2V4UA 2VZEA 4YHBA 3F4LA 5JXGA 2AN3A 1KEVA 3ZDXB 2QY6A 4D2IA 3VR1A 1EXVA 1J25A 1NNI1 2GCOB 1T2EA 3FF1A 4R3UC 1RLTA 1J9ZA 1XQ6A 1C7JA 2XODA 3IPRA 4PQFA 1LLUA 1QMPA 2DHEA 2IUUA 1DC4A 3G2LA 3MTDA 4R0VA 5IT9A 1F7UA 1XHEA 1ZBDA 4MPJA 1NI4A 2WDZA 3A6FA 2ACVA 3LDHA 4Q3NA 3I53A 1X1TA 1LRKA 1WQ1R 1YXMA 4QQRA 3RYFA 4B0PA 3F1KA 3OP4A 1Z4NA 5LYJF 1DIBA 2NZXA 4I55B 1WSDA 3LPAA 3A11A 3KJZA 4FWIB 3ZXYA 2WF6A 3EK2A 5CT8A 3IJEB 5J59A 1AXRA 4X85A 4BOYA 5IZ4A 1ZBQA 3IUJA 3CEHA 1TYEB 2OPHA 1CQJB 1TK9A 4HNHA 3CVXA 3C45A 5A2GA 2DJIA 3IUYA 3OX4A 2ZUEA 3BBLA 4LJ9A 1YVEI 1KYXA 2CUNA 3KYJB 4QYMA 1DIOB 1BZYA 4WH0A 4IMRA 4KVZA 4MQEB 3ND7A 3N39C 5K20A 1BH6A 4EJSB 3A6ZA 2IW3A 5CYOA 2E6KA 4OXXA 4XQ9A 5CXQA 4S2UA 1W76A 3S99A 4XPZA 2NSYA 1SK8A 2TYSB 3JZMA 1BXRB 3ZGLA 4HDCA 5CITA 3DAYA 1LB1B 3ER8A 2ZB7A 2RMKA 1AQIA 1W85A 2I6TA 4RZHA 1TM4E 4BNYA 3H4IA 1QWOA 1UR5A 2AQIA 2IPLA 5ADUS 1UOQA 1MT3A 2VF8A 4RQUA 4I4LA 3MJDA 4UEJA 2JFYA 1MC1A 1PK7A 3BGIA 3N07A 4Y67A 3RJ9A 2IH2A 1QHHB 3DDNA 3DQQA 4BB6A 5BXQC 3GLRA 5AVWA 4TT8A 4FYPA 1EESA 4X84A 1ADGA 1IK4A 1OLSB 3UJDA 1DAOA 1XSEA 2I7DA 3M5WA 3HRHA 4AROA 3LP8A 2PEZA 3AVXA 1Q0RA 1EAMA 1ST2A 4KXXA 5FBLB 4ZEVA 2HSEA 2QM0A 3O90A 2ECPA 3HBAA 5BNFA 1GRVA 2QN7A 1W0JA 4Y2VA 1WKVA 4C6SA 5JFOA 1ZU4A 4HDKB 4PZCA 2W2LA 1P4SA 3HLKA 4J0CA 3STWA 2CSXA 4FYKA 5H70A 4NK4A 2K5UA 3G9UA 3PNLA 5FWYB 3DAGA 1MCZA 5AKIA 3VPFA 4O4LF 4DKJA 2DBQA 1LPSA 2X23A 3PXUA 1M2VA 2DT5A 4KSYA 1YJQA 3AONB 2YJ6A 5K3DA 4C29A 4DLTA 4L74A 4Q37A 5C5EA 2OHOA 2FPSA 2I55A 3I04M 4O1HA 1CJMA 1CZUA 4DSOA 1QH8B 3SSNA 1S4QA 1BVHA 1SC6A 4A1FA 3GZNA 4I2NA 2Q8QA 4C21A 2ZXUA 3GUCA 2BKAA 4A2PA 2IZZA 1VBNA 3RO7A 4DJFC 3BE6A 3CH6A 4NVRA 3WFZA 1IRIA 2OAQ1 4G6ZA 4C7OB 1WDTA 2PKXA 2YWHA 3H42B 1UZLA 4N12A 5DLPA 1L7BA 1XXLA 4R7GA 4ESEA 2VK8A 2FCRA 1C9KA 1GCIA 2JVJA 1U65A 4FEYA 1ZI8A 2ZROA 4UNNA 1I4DD 4W4TA 4YCAA 1SG0A 2BBSA 4X90A 2UV8A 5JY6A 1K08A 2IXBA 2XF2A 4RKWA 5IXYA 2QRQA 1XZCA 3HE3A 2EFJA 2WD7B 4HN9A 2E5LB 1XX6A 1Z3CA 3DOFA 3LNTA 4G0QA 3F3YA 1J39A 1JU3A 1FSGA 3FWYA 3VR6H 1A7UA 3NO4A 1EFRA 2EVWX 1G18A 3PDJA 2HO5A 3QYJA 3OMWA 4H08A 1X6VA 4QIHA 3VZRA 5HUHA 1XQ1A 1EJ2A 4ZYWA 1CKEA 1CUYA 2QZJA 1V0JA 3SLKA 5F1KA 1O1YA 4Q9DA 2ZRHA 3PC8C 3HFRA 3AHHA 5CM9C 3RSZA 2F3TA 2QUAA 2JFOA 2V3VA 2EBHX 3W2TA 2KW5A 4EKDA 2QTVA 2BEVA 3UMJA 1D03A 1PEKE 5DCUA 2IV7A 1NR1A 3KSRA 2QZ4A 1ZCZA 3R6GA 3X1ZA 3FTFA 3C5EA 2DCMA 2FLKA 4U00A 3KD2A 2JK0A 2R1UA 3B9PA 4QPCA 4RF2A 3DTTA 1P4JA 2AX4A 1JRLA 5FPHA 1Q2XA 4H2DA 4DQXA 5DHFA 2C0CA 4ZVUA 2H3EA 5L6MB 1L1QA 1L4NA 1MP0A 1PG0A 2JFQA 2OMEA 4J1QA 4JDUA 4QWMA 3S3TA 3WWPA 5AVSA 2RC6A 4YV1A 5E9QA 1ZWLA 3KELA 1Z36A 1EUCA 2B83A 5LQJA 5FO0A 1B6GA 3JD0A 4C07A 1QONA 2PM8A 4MDFA 5EJ6A 2H63A 2WTAA 1F2UB 1I51A 4JSRA 4DY4A 4LI3X 1E98A 1XA4A 4NYIR 4X24A 1ML4A 4Y6SA 2D06A 5HFJA 3UWPA 3AWDA 3W4IA 1FU8A 2VO1A 1EK1A 4PV7A 1R0XA 5D6OA 1EGQA 4CL3A 3RFVA 4HX2A 1AQUA 5DYIA 1ISMA 2D0IA 4Y8VA 3T4PA 1A4IA 2W58A 5ELLA 3VI3B 3OIGA 3UQZA 1XCPA 3HDGA 4ZJZA 4Q1BA 4RGYA 4ZEWA 3ZWNA 3A6EA 4EMBA 2E2WA 3LTNC 4B3DA 2AF4C 4LKOA 1T4MA 1ZOOA 3QX8A 4MAFA 5TPZD 3VI4B 4AO6A 4FWBA 4J0JA 3KJGA 5LZ5A 3MD0A 1T9DA 2OQVA 5AVZA 5UKDA 3GPLA 3DBRB 4AURA 1M75A 2IQ5A 3NTLA 3O3MB 1A69A 1VLVA 1OU0A 2Q0SA 3HACA 4K6GA 4RPIA 4AUNA 3K2BA 4PCAA 4DCUA 1YR3A 3B78A 2O8EB 2YUTA 1MH1A 5FO1A 1OGYA 5IBPA 1AQLA 3KVOA 1KAQA 4GBED 4GOKA 4W5OA 2GPBA 1EFDN 1DO8A 1K88A 2OLEA 2QGZA 2WZQA 3WNDA 3H5WA 1A8IA 1YONA 5CVUA 4L50A 1VMKA 4Q6BA 3FOFC 1CBUA 1XTUA 5K2MA 2ZJBA 3FVQA 4QC2A 2DWPA 1ARZA 1RLIA 4H7HA 3Q41A 1VYUA 4WZAB 1CVIA 2PX8A 4AN0A 2HCBA 2C7OA 2QA5A 3COJA 1QK4A 3Q8WA 4OD0A 1NVXQ 4I8IA 2QM8A 2Z5VA 1KFCB 4Z9BA 2WFAA 2JH8A 2OCXA 4FLMA 4ZEXA 4BHTA 4LGCA 1UM9A 1I33A 2C5FA 3Q3HA 4ZQHA 3RE1A 1UXHA 2AFHB 4D46A 1XYGA 4OOFA 2AFHE 4MUEA 3H0EA 1TIKA 2H1SA 2YMQA 1NVDA 1E5VA 4JOSA 1X7YA 1A5BB 3MTIA 3SQWA 4N3CA 5DDIP 2PQ2A 3RKUA 4HAIA 4AZ3A 2QB5A 4EPRA 1ZO8A 5EVJA 1TJNA 3B38A 4DBZA 3GGDA 4M0LA 4PXYA 4MRSA 3EPLA 5LVAA 4Z7JA 3NLLA 2J3IA 3LCRA 2EZ8A 3ELBA 1REQA 1K92A 4YV0A 1OHHD 4JYBA 2J3HA 4KBGA 1I3OA 1O58A 1JEQB 4AKIA 4AS2A 2JA2A 4NV3A 1XQVA 4RABA 3HPRA 2C4VA 4OYLA 1K5HA 3GT3A 3DDUA 4MDEA 2YV5A 2YV3A 4BFWA 1J70A 1IEWA 3H8VA 2Z3VA 3WOVA 1PGPA 1GNPA 4QEDA 4E32A 4HXEB 4IXNA 4ZT6A 4R1TA 4WE3A 1U2EA 1TQ6A 1Z7YA 1ZD4A 3F6EX 4HWTA 4DRXA 1TFRA 2Y1OA 2Y93A 5CX1A 4YUWA 5A6SA 4Z99A 4BYMA 1J0AA 1JLHA 2IIBA 2P9EA 3D59A 4MINA 4PY2A 4UD2A 4M53A 4A4DA 1XNQB 2J3JA 3BH7A 5ERXA 1PKXA 2QF7A 4HEA6 2D0PB 3IULA 2EBWA 1NQVA 2OD7A 4HD8A 1NJ2A 3K0FB 4XX0B 4CKEB 1XYYA 2FSVA 2JAXA 3RIGA 4UDNA 3LUPA 1J5PA 1R00A 1TC1A 2JZOA 3OU7A 3OPYA 4G5OA 4MVJD 5DK4A 3ZDQA 4C3ZA 2X58A 3K4HA 1OX4B 2K87A 1S89A 2HZBA 2OD9A 3FNBA 5B2ZA 4I3HA 1Y1TA 4S1WA 1ESNA 2F1OA 1BEEA 2WHRA 1T8SA 1U8EA 4M0MA 3HP1A 2XQVA 4S1PA 4BUZA 1P3DA 3ANSA 3LBHA 1ISPA 1SXJD 1U6IA 4QLOA 2ZJAA 1R6DA 1E1CA 4P36A 5K3AA 5KKAA 5AM3A 4ALLA 1AGYA 1VE6A 3BSSA 3HUDA 4GE3A 4R83A 2W6OA 2SECE 2X6RA 3KTOA 4UOQA 4ALIA 421PA 1NMEA 4EA8A 5JEDA 1I7QB 4US2R 3AKZA 3R9KA 4UNSA 2A67A 1TZ2A 3N7TA 3RFFA 2QQGA 3NVMB 3JV7A 3NYWA 2EP8A 3L0IB 5J4HA 1GCAA 3W9UA 2CUKA 3B3AA 4R8VA 3W3AH 1OV6A 3GI1A 4DLUA 3LKZA 4CMCA 2MDTA 2AYXA 1D0VA 2OWDA 4HB2A 4GRIA 4HPXB 3E03A 3TOVA 4DCCA 4LJSA 5LZ2A 2JK1A 4G8JA 4L6CA 1F20A 4V38A 4IJ6A 1BAPA 1KDPA 3TQIA 2X1HA 4KQEA 3TFOA 3QKRB 3KQUA 4GPD1 3U7FB 3MTAA 1VYTA 2MSWA 3LG2A 5E6UA 2X5OA 4UJ3A 3RSGA 3NFYA 1OKKA 5A71A 3HXOA 1RW4A 1T2FA 4M8NE 1Q19A 1RM5A 1FNDA 2NV2B 1HNWB 4OL0A 1JAIA 1ZUNA 1KZ6A 2LUOA 2FUCA 3K9BA 1F3OA 4HOYA 3FYTA 1FPQA 3UV3A 1PK9A 2MSDB 2ZJ0A 1T2DA 2Z2KA 4MUBA 3UT5B 1PQWA 1N2IA 3EXHA 2BKEA 3QE9Y 3L01A 4LRYA 1CTQA 4RUKA 3V7YA 3TAXA 4L51A 2UZIR 2ZBVA 2ZSBA 2G9NA 1YCGA 4PVDA 5BV1A 2V0NA 3HDQA 4DCMA 5HTOA 3G8CA 3VRHA 2PRJA 3WWYA 4OLJA 4YDRA 3D8RA 3WQRA 2VC2B 3ORFA 3M4ZA 4WZZA 4BMZA 3O8OA 1C9MA 3C3JA 3I5YA 5EE5B 4Q4CA 1H6BA 4KH1A 4LWZA 3Q7QA 1F8FA 1PSWA 1GZVA 4R8MA 5C8YB 3HHPA 4WXHA 2QWXA 4B3MB 1ZXXA 2Q3BA 4PRLA 1SD1A 1B6RA 2RG1A 5IJWA 2NP6A 2OK8A 3ZNQA 1EDDA 1ZN7A 5HF5A 2NU6B 4GX0A 3NV9A 5JMWA 2XUQA 4HDSA 5LLDA 1B26A 2EJCA 3EWIA 3AO0B 1KWKA 2HN9A 5A9RA 1N5OX 1Y7LA 2A9FA 1VDMA 1G7CA 5E7QA 3DS8A 3WSTA 4OP3A 4G25A 4GT1A 3BGWA 3HO8A 3KB1A 1GRQA 1PNVA 2OC9A 4UBLA 5H3LA 4D3ZA 1A77A 1EVJA 1LI5A 1V7QA 2VL7A 2JGKA 4FW9A 1NXOA 1U2GA 4PC6A 2MT9A 3GGSA 2C96A 2PWBA 3AERB 4L3WA 2CDNA 2L18A 2RI1A 3OQMA 4ZOBA 3H17A 3MCUA 1RWXA 1HYQA 2G70A 2QL6A 5KU1A 1NNUA 2HLHA 3JQBA 4BKMA 1E1QD 1L5QA 4M86A 2A1UA 2PBZA 2P9FA 5DF1A 1OLUB 2B94A 1I01A 2ZRMA 1IN6A 1E3EA 5EMHA 1BDBA 2NO5A 2LR0A 3LC2O 1KVUA 1EH5A 2PS1A 3CJRA 1RIFA 1VKRA 5BW6B 3OP1A 3ZN2A 2E4ZA 4FCWA 4JSYA 3RWMB 5TMPA 4DNQA 2G6TA 2YINC 3EDMA 3T5GA 1J24A 1PUJA 1MJGM 1UDBA 2QR2A 3ABIA 1LV7A 3GRCA 3HB1A 1Z38A 2AZDA 3GHHA 3KTFA 3FUCA 3GGCA 4AY6A 3N2KA 3JS5A 4A8TA 1M73E 3TD2A 2KMLA 4CPDA 1U9CA 3WRXC 3NJRA 3CRW1 1OXKB 2I6QA 2VSNA 4FHCA 4OYYA 4YCDA 3U9SA 5H9VA 4YT4A 4CQLA 4ID3A 3SIPA 3UJAA 2UZ4A 3MCZA 1G8PA 5AR1A 2DBYA 4CFSA 2O8BB 2O6HA 4PW0A 1J1ZA 3RT7A 2YIJA 4QPDA 1SHLA 1SVWA 1ONOA 4OI0A 2YVQA 4U1RA 3EVCA 1D1SA 3CX8A 1RABA 3LI2A 1C7FA 1XMXA 4PBSA 4PNZA 4UM8B 5KSZA 1F17A 2DWUA 2HPHA 4F04A 1WSWA 1HMYA 4NCJA 1PZGA 5EPUA 1YZFA 5BV7A 5KQMA 3PFWO 5AW8A 1L8QA 1JIKA 1WZUA 1ACMA 1X7GA 1QYIA 1WNTA 2HCRA 3M6LA 2P9JA 3MSCA 4E3WA 2ETXA 1UC8A 4ZFNA 4WY2A 1WB5A 2Q6OA 1AB6A 4E4TA 3BIJA 1P2UA 4TMYA 4CEIB 3N8HA 3SS9X 2J0VA 3QKSA 1GUYA 1RI1A 1UADA 1NTRA 3WY9A 4O6VA 4ZO7A 5EJGA 1P81A 1Y1LA 4G5GA 4FGWA 1FW8A 4PF1A 2NU9A 2RHJA 2BFWA 1DX4A 1DO2A 1SU4A 4I8DA 1G2OA 1VJRA 2P2GA 3M81A 1HDZA 2DQSA 2ZIFA 5ESXA 4IUDS 1XCOA 3A2NA 1NI3A 2ACWA 1KSJA 2H54A 4NARA 4R41A 3P0IA 2O54A 5IWAB 2J5BA 3H2KA 4AY2A 4JL5A 5SZJA 5B53A 2HLNA 3G2OA 4R0MA 3MWLA 2VXBA 5EKSA 2XVZA 3GUHA 4PN7A 2Q7DA 2QD5A 4N7MA 3I76A 4EVQA 3ANNA 4RY0A 2HTFA 2HI0A 1JXQA 1P7YA 1WXQA 2QTRA 3PHCA 1KAEA 3QU7A 4GOMD 4TMXA 4DE5A 3UN1A 3OPMA 1O4VA 5LIRA 4JASB 5L3VA 3ESDA 3QKIA 2HUPA 2NGRA 4YRKA 4Q1FA 2X1VA 3TVDA 2EXXA 1BSVA 1S9HA 4KE9A 4B1FA 1M67A 4NIMA 1FS5A 2O50A 2FJPA 3FHJA 1QO9A 1CJCA 4LA4A 2FEXA 4JLOA 3VVBA 5E1MA 1SR8A 2HRDA 3HVKA 2UU9B 3CWZA 2HSDA 3ZHYA 1SCUB 3W5BA 2I6XA 2BTQA 2ZTHA 4BLSA 3GUZA 3EZXA 2X5NA 2JGDA 5ALPA 1VE5A 2Q4BA 4POOA 4AUEA 2W6IA 3AEKA 3GUUA 3O4RA 3E8MA 4R1UA 2X7JA 5A4JA 5DN6D 1L3IA 1YZNA 1CQIB 1G42A 3I92A 1NW3A 4BVKA 4CTNA 5JAUA 4K5QA 3UK6A 4DB2A 2WIGA 4KZKA 3L7AA 5I9MA 4ZT2A 3NHPA 3TE7A 3CSUA 2Y68A 3FCSB 3E53A 3V4VB 1CDZA 2WE7A 4GO1A 1Z2AA 4QTYA 2OV8A 4ITRC 2BMEA 5I5GA 2JFXA 1CETA 4DMKA 3CNLA 1XJQA 3A3YA 3FB1A 3PQDA 1BHQ1 1CQXA 2CLSA 2BFAA 2D8MA 2H4JA 2JHGA 2NUPB 3JD3A 3LP5A 4OP1A 4PZUA 4DLBA 4EY5A 4YJ3F 2WQ7A 2ZCVA 1F12A 4R2WA 3TDKA 1RM3A 2XGSA 4QXRA 4Z4HA 4FJ0A 1M7BA 5EESA 2HF2A 3G5MA 3JD1A 2P65A 4LGYA 2ZVDA 1JJBA 2IZ5A 5LMCA 1GN8A 2EEZA 1WF6A 5BNTA 1Q2UA 1SRQA 5KDOA 1NG1A 1FFEA 1SQFA 3BXZA 1OBOA 4OXIA 4ZJUA 1JE0A 2NU7A 4OQMA 2ENWA 3CPEA 4MWTA 2GTHA 4E2ZA 4BMYA 4R16A 5K0NA 1FDTA 1UK8A 2A1TS 1OFTA 4CMBA 3HMKA 5KNBA 1ZP6A 2I1QA 2L2QA 4O4HF 1M8JA 2NX2A 2R751 3T7KA 1P1FA 3W5AA 2W2MA 2IHTA 4RFSB 3K30A 1NLUA 2GILA 4K40A 4PO1A 4YHHB 2RGUA 1XB2A 4YTEA 1GAEO 1Q1ZA 2VBCA 3KAQA 4H27A 3D6UA 4J75A 2CC2A 1GITA 1MKYA 1GGHA 1VA5A 2JAUA 1SU7A 2PBLA 4QDZA 4Q1AA 4JJ4A 3GR6A 5KOHA 5HMMA 1L5OA 5I48A 3JXEA 2YW9A 4K81B 3U39A 1GZSA 3WI7A 1UWLA 5AW0A 1E2BA 3OZ7A 1AKWA 3QBDA 3I0MA 4D57A 3O2QB 3KQQA 2WZDA 3U44B 4IHJB 1V26A 4A8PA 2O5RA 2IXEA 2BPOA 1V1JA 5DASA 3ZWWA 4EPVA 3C3DA 1EKXA 3DT9A 3DOCA 3QVGA 4KSCA 5BN4B 3R74A 1B0ZA 2CBGA 3DZHA 4C03A 5FT9A 1K9VF 3WWOA 1GPBA 3IAEA 3E7FA 4MYDA 1SG9A 2J08A 3JYLA 4ZYTA 1DEKA 4UHFA 4BNTA 2CFRA 3U60B 2IKSA 1QTRA 2A5JA 2OCLA 5EJ2A 4ZT4A 1ISHA 2RKBA 1DFGA 3BEDA 4P81A 3NTXA 3QI2A 4P34A 4RMGA 4EY7A 5B7NA 5JSQA 4MUGA 4FYIA 3USCS 4RD4A 3UWMA 1KU0A 4HR7A 4MKRA 3ZI0A 1VJGA 1YQDA 3C5VA 1USIA 2ORWA 3EMVA 2F43B 4C5BA 1VIMA 2AMYA 1E0DA 2P5YA 3QITA 3G88A 4CLRB 3P2IA 3P9SA 5BVHB 3RUAA 3RVPA 1XZHA 1SOWA 2ONYA 2OAP1 3EBOA 4IIDA 5AUNB 4UJ5A 5L7WA 1YA6A 4JEIA 3UTCA 3QXHA 3VYVA 5GVSA 2GKGA 4OMDA 3UCEA 3DDHA 1TCVA 4WCVA 1M2EA 1VPVA 3SKXA 2BM8A 4PTZA 5HFNA 3FTDA 4D98A 2CWDA 1JLLA 5FWDA 4E5UA 5DV9A 3AVUA 3AF0A 4BDSA 2AYYA 3V8BA 3WL3A 1DMSA 3AFMA 3G7SA 5K0ZA 2O2IA 3C16C 4FFNA 1Z2OX 4MB2A 5EI5A 5EWMB 3L7KA 3U1VA 4XKJA 1JHOA 3NPMA 1LDYA 2FRVA 2VNJA 1VMEA 2VS1A 3H13A 5CK4A 4D45A 4E03A 5IPFA 3V55A 5A6VA 3V34A 1SCJA 1F8UA 1V1RA 3IEIA 3NNDA 3NTOA 4GAEA 4MGZR 2PUFA 4AG6A 4HB3A 1TF5A 2A6PA 2IXFA 4CV0A 3P9PA 4PYLA 1UBEA 3AHEA 1BCRB 1CWUA 1GL7A 4IO1A 5GY7A 5ALWA 1G8JA 3ZUPA 3SHTA 5CCBA 3FSEA 2JARA 1JJVA 3QVUA 3Q8LA 1BXKA 5CCXA 2BP7B 4LFAB 1EFKA 3ZBTA 4PYQA 5COBA 3BWMA 4P4SB 4PLGA 4RXUA 4WXMA 3L8MA 2ZI7A 3OQVA 2AOTA 2PEYA 5BSTA 1E62A 1TVKA 4Y1EA 1BA2A 4QBIA 1LSSA 3AJRA 4HQ6A 5FPYA 5TVKA 4II7A 2I3DA 2OMKA 4QDJA 3RVMA 3TUJC 3D4BA 1S4MA 3M5DA 4NCXA 5PGMA 3SJCA 5HHTA 4II2A 2NTJA 4KYVA 3A05A 2OLKA 1X7ZA 1C1DB 3KQTA 4YRPA 1MABA 5AOVA 4ASUA 5BV8A 3IP7A 1ZM7A 2ERYA 3CY6A 1Z62A 4QZVA 5K0GA 1YA8A 3KPYA 2QIPA 4K3UA 2XOKD 3O93A 4P0TA 3TRDA 3HEMA 3DL4A 3GOHA 4GXQA 3L1HA 1YD7A 1O5IA 2M6SA 2EJWA 3HKDB 1IONA 1FUYB 1CUCA 4FDLA 1D2MA 3MOGA 1VLQA 2XWPA 1Q1EA 2ZU0C 4EG7A 2VYQA 5A3SA 2AN1A 3GDHA 4M1MA 4C6RA 1GUFA 2RHOA 2AHRA 2V7TA 4EHBA 3BXEA 1KJQA 3FRHA 3L0ZA 4LSZA 4MYRA 4N82A 3ICWA 3TLYA 4A0HA 3AIKA 2AJLI 1KTVA 3DYBA 3HL4A 4I9GA 4U7PB 3AHFA 4BNUA 2QRKA 2QRJA 2P30A 1R9GA 3FCCA 1AKNA 1J0XO 4FMBB 5JCXA 1GQYA 2OQIA 3FLAA 1GPLA 1L5MA 1P7VA 4CF3A 1DBVO 4RJJA 4YAKA 2N75A 4Q3KA 4EF4A 4BX2A 4DBLE 4E1BA 1KAMA 1R5OA 3U61B 4B32A 1ZK3A 3BFVA 1NONA 1HNNA 3L8HA 4TKVB 4IXDA 1V4VA 4HPWA 4K6OA 4UZFA 3FNHA 4DGSA 1ZGGA 1DIGA 3DWGA 3OH8A 4UBNA 5JNLA 3IBCA 2PCLA 1CG6A 3GVIA 4N6GA 4NG4A 5DKFA 3GLIB 4GGPA 3M4XA 3GLIE 2VK2A 2RGWA 3T15A 1MR3F 3AEYA 2BGWA 1CD5A 1DTEA 3ZE8A 4X7BA 1T5BA 2C2MA 4LYDA 2I2XB 5TNXA 3PDIB 5ARDA 1JDZA 3R0IA 1EX9A 3DOJA 4PWZA 3AFOA 4JEUA 3C3CA 3HNRA 1OF1A 4B7UA 1O94A 3G9QA 2UUCB 3LPCA 5JASA 3QWHA 1BDHA 1G5PA 4CEHA 1JHPA 1V48A 2R5NA 4JB3A 4NEHB 3B3JA 1V9CA 2ZUDA 4NBLA 5IC5A 1OZGA 1ZK2A 2WPDA 2GMWA 5CBKA 3KQHA 3G89A 1SA0A 1VE9A 4N8EA 5EL0A 1MENA 5I7UA 2Z30A 4LTMA 3PCXA 2QN9A 2J9ZB 2W8ZA 4IINA 3IEMA 5JCOC 3E23A 1NLYA 4ME6A 1YB7A 4CE6A 1KI8A 5EXSA 4Q4AA 5C81A 5K01A 5CD1A 2II6A 1XWWA 5LJIA 4EI7A 4BECA 4KSBA 4WBNB 1QGYA 1B93A 2ZT5A 4MRMA 3UJHA 5IT5A 1PSZA 4ZOAA 3H0KA 3L2OB 2HSJA 2Y1KA 4QRDA 3ZWVA 4F45A 7REQA 2IEYA 4Z53A 5JROA 3MG9A 4YP5A 4AJOA 4AWAA 3KKEA 2YNMD 1Z26A 2VSOA 4KG7A 1ZN2A 4LDAA 3BDVA 3QENA 3E8XA 4D25A 1KVTA 4CF4A 2X8AA 521PA 3EXHC 2HDOA 4U9UA 2OKGA 6LDHA 5ALJA 1BXZA 5KI6A 2BT4A 4ROTA 3ZWPA 4HEQA 3FDIA 3CZCA 5BMOA 1BWRA 3WV5A 2JVKA 1X77A 4CFYA 4DCPA 2C7RA 2YN2A 1WA5A 3C15C 4BQOA 1GFIA 3L6BA 4HEA1 1RMQA 2IZ7A 3U4DA 4F5DA 1ZQ9A 4CWAA 4OL9A 4A6PA 2YJNA 2Q9BA 3RM3A 4EVIA 4L2IA 1QAMA 2CGEA 2QGNA 2RH8A 2HFKA 5HCUA 3BWYA 3KT3A 4UPDA 1Y9JA 4FYXA 4LQ4A 4MTCA 1Q3HA 4EZIA 3W6ZA 5JEEA 3AX6A 2VNAA 3LZDA 4OIFA 4JR0A 5SICE 1XK7A 2BR5A 1EE9A 2V7WA 1EINA 4QDKA 5CM8B 3H9GA 3KXIA 3UC9A 4A6XA 4I4TB 1EFLA 1TA4A 2J32A 5DLEA 3CBGA 2GZ2A 3H4VA 4D0GA 1MDFA 3P9NA 3EEOA 2O1EA 1Q92A 1V7CA 1VP9A 2D2XA 2QUZA 3D5QA 3LNCA 3GMDA 1R4NB 4QU9A 1AE1A 3KCNA 4HQ0A 1U6KA 5H16A 4D79A 5AIBA 1QH1A 3UAOA 2V54A 4BB9A 2V1UA 1K3TA 1Q20A 1W4CA 2VJCA 3E9RA 4W5TA 3WJ1A 4NFLA 3P9ZA 3PIRA 2CJWA 4XLLA 4EL5A 1NM5C 3QIAA 2B5OA 1ZH8A 5B3LA 5HF8A 3TN7A 1HFJA 3TOSA 4EKYA 5M7EA 1PIWA 2ZXFA 2POCA 3IV7A 3KPVA 2OORC 2ATCA 3AVQA 1PGNA 1YZVA 1PNQA 4G5QA 2AHOA 3OF5A 1I2DA 3L07A 4GXNA 4HQKA 3T4UA 1A88A 3ET4A 3QJGA 1MMFB 4K28A 2G83A 5F1PA 3BWVA 1KMHA 3BA6A 2G0NA 1GSHA 2NT4A 4FFMA 4CN9A 3ED5A 4B87A 1V3UA 3B8HA 4F6RA 1U8AA 1ZH0A 1MQ9A 4MR9A 3W7VA 4ENTA 3THSA 4K9PA 5L4LA 3QX3A 2AJCA 2ZYSA 4MVJF 1J97A 2NO7A 2O3UA 2R6R1 3MXTA 4C4TA 3I6BA 1XMPA 1Q3KA 5LD2C 3TQFA 2Y4OA 1QNLA 5A4DA 5C1BA 1SCQA 3HCFA 1N8SA 3IHLA 2ECOA 2VPWA 1ZEMA 1KO5A 3LMKA 3FAKA 1CJBA 4PNPA 3ND6A 3O4HA 5LL6P 4LYYA 3JVDA 1WPGA 3MOIA 3UJCA 3BHJA 4QSHA 4DLWA 3Q5EA 1QG2A 4RHTA 1ECLA 2QW1A 3HVJA 2XAUA 3W0LB 3PVZA 4ECEA 5L6LB 1TTTA 2DCUA 3K1AA 2FW8A 2WB2A 2NO0A 2G5GX 4IKEA 3FNGA 2I65A 1DXHA 1ZSYA 4E4RA 5AOBA 2R86A 4U6NA 1U3VA 5AI4A 3RUEA 2QG9A 5K0FA 5I7HA 1I9GA 1NRIA 1O54A 3P4YA 4MYCA 2XQJA 1NX9A 4W82A 2JJ2A 3GFVA 5DISB 1HT1E 3MWDB 2WJ4A 4WVFA 3ZCUA 4QQFA 2JEYA 4WGFA 5I7WA 3OG9A 5KS2A 3TTVA 3FSGA 4JYAB 3GRYA 3IMEA 2YNMC 5D8DA 4MW1A 4R6XA 4EQ6B 3MYYA 5DT9A 3LQKA 1PHRA 3NHRA 1UT6A 3JTEA 1LWOA 5DIZA 3ZUGA 5C37A 3PJFA 4OA8A 1XMSA 2OZEA 3EWNA 3QMWA 4N3GA 5AD1A 3HDJA 2X2FA 5KOJA 4HJRA 4FMPA 1QZZA 3ASYA 2IY8A 2CXTA 4OSEA 3ZVRA 4YJ3A 5E4FA 1U2QA 4JLDA 1QRRA 2MINA 2CD7A 5IVDA 3G3EA 3WYAA 1QR2A 2HU8A 2AG8A 3DKIA 5U4QA 5CVTA 3AKYA 3HABA 3IS3A 5A1TA 3BE4A 4WLFA 4BJ1A 3W3AA 2VSQA 5A4MS 4TQGA 5DMHA 4F2PA 5JJIA 2H2IA 4G0ZA 5J4LA 1TVCA 4JBIA 1GPJA 1T9ZA 4EENA 2CK3D 1N6IA 1VCMA 3L7JA 3L7LA 2RONA 3VR2A 3WK7A 5KQPA 3JQ7A 2YC2C 4BO8A 5KJEA 4ILKA 1KFJB 2WV9A 2CYBA 2GCOA 5I4KA 1H8HA 4TLLB 4V1CI 3GFRA 3RUCA 4LYJA 4ZVOA 1UBUS 1CR1A 1QLHA 4PCVA 4ETMA 1YQEA 3ONWA 1RC8A 1H1LB 2X15A 3CPHA 3O92A 1K6MA 2NV6A 1A8QA 3GLHB 3G49A 3M9LA 1G3QA 2Q9AA 5JC8A 1VSUA 3GLHE 3DUWA 1RHMA 2C77A 3FPCA 3WWCA 4J0KA 4C0WA 2GO7A 4I55A 3AYZB 2IW1A 4X1IA 3GAMA 3PQCA 2W6JD 5B64A 2ZRCA 4L3VA 2C5GA 1QXSA 4QE3A 4URYR 1I32A 4U2BA 5CGZA 4NP6A 4F38A 1KBQA 2MSEB 2KQUA 1CQJA 2G9RA 3JPWA 2PR2A 3LCMA 4GRAA 1HKHA 3SZ3A 4R3WA 1XT6A 4TXMA 3RK4A 1QANA 1H4TA 3PE4A 3DDOA 4QARA 4QULA 5DHUA 4BNNA 3THWA 3FWZA 4IICA 3A9WA 4QUHA 4R7TA 4EJSA 4QJIA 3M2PA 1NQWA 4E21A 5WRFA 4W9NA 4E1AA 2ZIAA 2AN9A 3B85A 2I8CA 3BIFA 4CXMA 1PR5A 3X2EA 3QPVA 4J16A 1CZLA 2HADA 3A25A 1BXRA 1NNSA 1Q7CA 1X9IA 2PN1A 2PVPA 2YHSA 3H1TA 1GP2A 4GOJA 4GW3A 1NYQA 3K96A 4H31A 4TTJA 4TT3D 1UBJS 3SE7A 3U81A 4CF5A 4Y6RA 4INZA 2ZYWX 1SXQA 3AG5A 2F9LA 1LGYA 3JVEA 1C4KA 3PFIA 4BO3A 5T57A 3ZDCA 4GXRA 5CTJA 3SLGA 1U2DA 1N3LA 4C05A 3HCNA 4TUYB 4UPVA 4ZVSA 3ZLJA 3FNRA 2VBFA 3OTIA 2GEJA 3L1KA 3RUDA 2YXDA 1H2FA 2ZIGA 2BONA 4IGAA 1T5LA 1QHHA 4NU0A 1K27A 1XZGA 3UZUA 3LA6A 1SN7A 2C3PA 1HRKA 1OLSA 1NPDA 4C3UA 4RNDB 4QFDA 2RGXA 2WAAA 2CNLA 1QG0A 2ZT6A 3I9LA 1G2QA 3OCWA 4UE3S 1P1BA 1QX4A 2PS3A 4R01A 4JLSA 2IKQA 3GRKA 1FFSA 1SQ6A 5FTJA 5DNUA 4V3BA 4HDKA 1WD5A 3COZA 3P26A 3IP6A 1NU8A 3RRJA 1DTSA 1SEVA 1R8QA 2AGVA 1GEGA 1M3SA 1Q84A 2X13A 1CR0A 4FQ8A 1I10A 4ND1A 5F5LA 1GVNB 5AW1A 3PC7A 5B6PA 3ZVMA 4I19A 4PSUA 3PZBA 2RI0A 1W0KD 1FBNA 1OTXA 2GHQA 1DQRA 4ZOCA 1XZPA 4IF4A 3QUQA 3T3EA 5KWEA 2EGUA 3LGXA 3MWEB 1A5ZA 1XLUA 4XPIA 2H2GA 4QGFA 2AD5A 5C35A 1HQCA 4B6JA 1QO7A 3NWBA 2IELA 1FC0A 1QH8A 3IP5A 3PE6A 3H9CA 4NNJA 3OT1B 1ZHFA 2XCUA 5B37A 3OIFA 2Q5HA 1PD0A 2IHJA 3QWBA 3WSVA 4OXNA 3IUSA 1P91A 4JNCA