4DANA

Crystal structure of the hexameric purine nucleoside phosphorylase from bacillus subtilis in complex with 2-fluoroadenosine
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
229
structure length
229
Chain Sequence
SVHIGAEKGQIADTVLLPGDPLRAKFIAETYLENVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMNRVAFGSVDFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYNDDSQIEKLAKYGVLGVEMETTALYTLAAKHGRKALSILTVSDHVLTGEETTAEERQTTFHDMIDVALHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Purine nucleoside phosphorylase deoD-type
publication title Insights into phosphate cooperativity and influence of substrate modifications on binding and catalysis of hexameric purine nucleoside phosphorylases.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
total genus 84
structure length 229
sequence length 229
chains with identical sequence B
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2012-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4danA00
3UAZA 3C74A 1V2HE 5F7JA 3K8QA 1TGVA 4QAQA 3FOWA 2OC9A 1RXUA 4KN5A 1ZL2A 4YNBA 4R31A 4JOSA 1T8SA 1T0UA 1ULBA 1Z33A 4OJTA 1OUMA 1YQUA 5F76A 1PK7A 4TXHA 4LNAA 4DA0A 4YJKA 3FWPA 3OZDA 1JE0A 1OV6A 1Y6QA 3MMSA 2A0WA 4F1WA 1V45E 4L5YA 3FAZA 4OF4A 1VHWA 4QARA 2OECA 4QASA 1YRYE 3BL6A 1Z34A 5DK6A 3PNPA 3NM5A 1JPVA 2AC7A 5KB3A 1Z36A 3IOMA 1VMKA 3OF3A 1U1CA 3P0EA 4OEHA 1JDZA 1ZOSA 4LNHA 1Z39A 4DARA 1CG6A 2HWUA 3FUCA 1PR4A 1XE3A 5CCDA 2B94A 3UAWA 4P54A 3PHBE 3KHSA 1ODJA 1U1GA 5CXSA 4F2WA 5F73A 5B7QA 2GUWA 1TGYA 4D8YA 3KU4A 4M7WA 3FB1A 2HRDA 1SD1A 1PR2A 4EARA 1A9QA 3DPSA 4D8VA 2QSUA 4RJ2A 4TS9A 4H1TA 4UC0A 3KVRA 1Z5NA 2ON6A 2QTTA 4BMXA 2I8AA 1PBNA 4EB8A 3NM6B 5B7NA 1RCTE 4X24A 4LDNA 4D9HA 1YBFA 4BN0A 3GGSA 1JDVA 3OPVA 3GB9A 4NSNA 1Y1RA 4MARA 1A69A 1OTYA 3BJEA 4JP5A 4GLFA 3QPBA 5FAKA 1A9OA 4U2KA 4WKOA 4NS1A 2BSXA 1A9TA 1U1EA 1YR3A 4YO8A 1ODIA 4TXNA 1C3XA 3OZCA 1Y1TA 3D1VA 5EFOA 1ODKA 1RYZA 1V3QE 1B8NA 4F2PA 4M3NA 3DJFA 3NM4A 4BMZA 5CYGA 4K6OA 5JPCA 4LKRA 3LA8A 5ETJA 3PNSA 4OGLA 1VFNA 1RR6A 1JDUA 4WKBA 1OVGA 4OY3A 1Z35A 1PKEA 4TXJA 2A0XA 3FNQA 1N3IA 4PNPA 3U40A 4JWTA 4DA7A 5F78A 3E9ZA 1TD1A 4L6IA 5B7PA 3K8OE 3O6VA 1RXCA 3IEXA 3BGSA 1K9SA 1FXUA 1SQ6A 3F8WA 4DA6A 5K1ZA 1G2OA 3INYA 4F3CA 5B7GA 3BSFA 2RJ3A 3EMVA 4L0MA 4NY1A 2A0YA 4MCHA 3EUFA 3OOEA 4WKNA 1PWYE 2PGAA 1OU4A 4BMYA 4DABA 4ECEA 1B8OA 5F7XA 1A9PA 1JP7A 1PW7A 4FFSA 1T8WA 3ENZA 4MCIA 1PR6A 4GLJA 1SJ9A 4TXLA 1Y6RA 1V41E 1QE5A 4DAEA 1Z38A 1K27A 2Q7OE 4QFBA 5EUBA 3KVYA 1V4NA 2P4SA 2I4TA 3LGSA 1ULAA 1RXYA 4YMLA 1Y1QA 4TXMA 1LV8A 5CXQA 3E0QA 5C80A 1T8RA 4WKCA 4TTAA 1OTXA 1RSZA 5EPUA 2AI3A 3KVVA 2QTGA 1JE1A 4PR3A 1Y1SA 3UAYA 1ODLA 4E1VA 1YQQA 3NBQA 4D8XA 3KUKA 3P0FA 5CYFA 3E9RA 4G89A 1V48A 3DP9A 1JYSA 3OOHA 4I2VA 4WKPA 3OCCA 2AI1A 1Z5OA 2HSWA 1CB0A 5F77A 1LX7A 3ONVA 1TCUA 4DANA 5IFKA 1WTAA 4OGKA 3MB8A 4D98A 1PR1A 1I80A 5F7OA 5I3CA 1NW4A 3UAVA 1PR5A 1JDSA 1TCVA 1PF7E 1A9RA 4TTIA 2OC4A 2OXFA 1PK9A 4GKAA 3ODGA 4R2XA 4GMHA 5F7ZA 3EEIA 3LBAA 5CCEA 1U1FA 1U1DA 1NC3A 4LZWA 3EUEA 1VHJA 1M73E 4L5AA 4TS3A 1ECPA 2IQ5A 1K3FA 1SD2A 4G41A 3SCZA 3UAXA 4TTJA 4R2WA 1Z37A 1T8YA 1Q1GA 2QPLA 3DF9A 1RXSA 4TYMA 2ISCA 1NC1A 3OZBA 2A8YA 1JDTA 1LVUA 5IU6A 1A9SA 4QEZA 2HN9A 4QATA 1RFGE 1RT9A 4IP0A 3UT6A 2H8GA 4DA8A 4F3KA 2QDKA 3T94A 3TL6A 1Z5PA 4G8JA 3DDOA 3OZEA 3PHCA 4DAOA 4L5CA 2XRFA 2AI2A 4M1EA 1PR0A 3O4VA
chains in the Genus database with same CATH superfamily
4G09A 4Q34A 4C01A 3I3OA 1UADA 2V6JA 4GXNA 4HTAA 3V3TA 1ZESA 3OEWA 4LRTB 1EBFA 2HIMA 3FOCA 3M0EA 3VM6A 2VJCA 7REQA 1S2NA 1GU1A 1I3OA 3BFJA 4D9KA 5JOQA 1GTG1 3HCEA 1KBZA 2IL1A 2L0XA 3HYLA 5DHTA 4AZ3A 1DCTA 1Y1KE 3MJSA 3IOEA 3FA2A 3H7IA 1MD9A 4V3CA 2XJ4A 4B40A 1ZD8A 3ZGLA 1NOIA 1IQ0A 2D0OB 3JW8A 1WPRA 4XARA 4Q9JA 3S1AB 3SEAA 4EKEA 3HBAA 1YL5A 2Y9MB 1AKTA 4WZAB 4RTQA 1U99A 4R9NA 1QKKA 3HI6A 1YRWA 4PYJA 5JI3E 1Z33A 2C5LA 4R54A 2GGSA 3DL0A 4I6JA 3GH1A 2X14A 2WP8J 3ZTTA 1W4LA 1EUCB 1HT2E 4NMMA 1OXSC 1U3CA 2VQDA 3PEEA 3VHQA 1RBYA 2H4XA 1P9LA 1QIKA 3NHFA 2QUBA 3FFBA 3SHVA 3DFMA 3WLEA 3I1YA 1O89A 4HMPA 3C7DB 2BL4A 1RQNA 3L7MA 2XADA 3WICA 5KYYB 3IKLA 2JBAA 4DYHA 3ZI0A 1W59A 2CFSA 1WXWA 4GVPA 4NULA 2Z08A 2VF7A 3LOUA 4OUKX 3WKDA 2FR1A 1T43A 4C5BA 4C07A 5ECWA 2VT3A 3I30X 4DNOA 1M75A 4J0IA 4K28A 1ADBA 1QPGA 2VJPA 2FETA 4C0WA 1T3TA 2GS9A 2ECOA 5KYGA 3KEGA 1VLJA 3CW8X 5E9JA 2OV4A 1F8GA 2ACEA 3KSBC 4IDBA 1Z5VA 1ZQ9A 5DIZA 3DBRA 1E0SA 2MSNA 2Y67A 3FDXA 3O31A 4CL3A 2E18A 2WP0A 4KMSA 2ZI3A 2CLIB 4D97A 2ZXUA 2PRKA 3F90A 3VX3A 1LTHR 2DQ4A 3W4JA 2F9FA 3W8DA 1BE6A 1LI7A 1N7JA 1A2KC 1Y9AA 2P6RA 1I2MA 3WYDA 4DJAA 3V9PA 2P5YA 1D2CA 3F5DA 2YYAA 4NBUA 3X1YA 2X8LA 2VEOA 3H99A 1AX9A 1MR3F 1QGUB 3DV9A 1DG1G 3BJIC 1UM9B 3QU9A 2A33A 4ND8A 3QLVA 1PP4A 2B94A 2DECA 3FHOA 3LWDA 4W9NC 1NFQA 3CIOA 3PHBE 2ZSDA 4C08A 3UT5A 1U5BB 4R84A 1C9DB 4GE0A 1AE1A 3O4HA 4L50A 3EDQA 3FUXA 3AUSA 3HLYA 2NO4A 3UJAA 2RH4A 4MRPA 3WMWA 4EA7A 4MYTA 3LK7A 2WMNB 4MRMA 2A1UA 4JEUA 1C7QA 2BMWA 2OBYA 4KYUA 4JBXA 2NV6A 2GUWA 4Q02A 2AIRA 3IBGA 4HRAA 5B7QA 4GXTA 2I6UA 2SKEA 3R0VA 5BUSA 2X86A 2XNJA 1J2JA 2ZYWX 3KU4A 1YZ3A 2JGMA 2ONJA 2OXCA 2PKYX 4B17A 5AM5A 3I4LA 5REQB 3KR1A 3BTUA 3ADPA 3KC2A 1WUIS 1XXHA 4F3RA 5JJKA 1JJVA 2W58A 3H3FA 4XLZA 3QXCA 1DMRA 1AUOA 1PTJC 3A1NA 2PGXA 3RRBA 3O03A 2KLHA 4BLSA 2PBZA 1UK9A 5C2JB 5L3VA 1WPXA 5U4QA 3ICEA 3KJZA 1NUAA 3HPRA 1AHHA 8LDHA 4GDFA 2H2FA 3LPAA 3HYTA 2IFTA 3D0QA 1Z5NA 2REOA 4L73A 4KVAA 1JSLA 4EMBA 1H0HA 3F6CA 1FMJA 2QBYA 1X8KA 1D6SA 4GKKB 1PQWA 4PIMA 2BISA 3PRYA 4UREA 2CEAA 3GLIA 3TQOA 1IIBA 4EB8A 1AZWA 1P8AA 1WB6A 2GHIA 3GLTA 1DL5A 1ZNWA 4DR5B 3WB2A 2RG7A 4KQ6A 1F2VA 5C81A 2VDRB 4JLKA 2FZKA 3KSAC 4JP8A 4R9SA 2VZLA 2VDMB 3VZCA 4DBZA 4ZWNA 4HEA1 3E22B 3GGSA 3QG1A 3QMPA 4NYJQ 4QEKA 5KVVA 1RWKA 3GLFB 3OY7A 1P61B 2FSFA 4UJ3A 2E5FA 2HJGA 3B38A 3G88A 3TAXA 4CRWB 2A84A 4HMQA 4N0MA 4MARA 3WWDA 5KYWB 4JASB 2IPNA 2QPAA 4MRAA 2DM6A 2X0DA 1T29A 3SBOA 2Q3DA 1TFUA 1E1DA 4KXWA 4RIHA 2H7YA 5C9ZA 2W2NA 5DCYA 1AXRA 3JQAA 4CGYA 4PZ0A 5HZGA 2IOQA 4NXNB 4W9NA 4FYJA 5AI0A 2OGUA 4YGYA 5ICFA 5AVOA 4UNNA 1QF7A 2GN0A 4GX5A 3L7BA 4JI1B 2ZKIA 1U0OC 3AVVA 2XUIA 4KYTA 2ZBRA 2OHOA 1JIUA 1NMZA 1V3UA 4MWEA 4URYR 4X54A 3V2GA 3ZZNA 3FXAA 3PPXA 1J00A 4ESOA 3DBVO 3H6KA 4L4RA 4CM3A 2QD2A 3JXEA 4QGHA 4ZT6A 3RD5A 4FWIB 4RSHA 5LB4A 1NN1A 3TRFA 1NYLA 3D1VA 1S7GA 1DBQA 2D62A 4U6NA 1ZKDA 1TO6A 3DAGA 2B1RA 4HDRA 1RXIA 2X0KA 4FSXA 3JQFC 1TJ3A 1QHNA 1GFWA 2QUHA 1B8NA 1T34A 3CRNA 4R9RA 5B53A 1DFGA 2WNIA 5DCUA 3AIOA 3HU1A 5IN4A 2QD1A 4BMZA 4DYDA 5AM2A 2LR0A 4JLUA 5K3OA 1PTJA 1IWOA 4GX0A 1XIVA 1OLXB 1DAKA 2XLCA 4IHJA 1BFUA 2DT5A 2WVHA 3V8MA 4PS0A 4O4LF 2AHOA 2YWFA 1MABB 2H1HA 3BZUA 4J2OA 1B0UA 5IP5A 3ZVMA 3CWCA 4XVHA 5CVEA 4HUQA 4KWHA 5DISB 3UHJA 3BORA 5LDGA 4KFTA 3V4PB 4N41A 3DJYA 3OZXA 2VH5R 3UCEA 1AKWA 4EA8A 2HW8A 2BRUC 1T2VA 2MINA 3DEHA 3ENNA 1FP7A 4TXJA 5ALMA 1N3IA 4EW3A 3L4BC 4E6EA 2QXTA 5E4JA 2FPLA 4EI9A 2QQGA 3ZGZA 2ZIXB 3JZAA 4F11A 1Y5IA 1W85B 1JR3D 1XDUA 2IDZA 3F1KA 1JHUA 4DNXA 4G9GA 4NNOA 4RA9B 2AFHA 1JDPA 3AV3A 5FFFA 2FPIA 3CN7A 1QCDA 4XQEA 5LYYA 2VO1A 1YKSA 2AN9A 2W6MA 2WOOA 2ZB8A 5J5AA 1SRRA 3HGTA 3NRJA 1EAMA 3PF9A 4MA0A 2VRWA 3PRHA 3P52A 5COBA 4LVUA 5JAQA 1WX1A 1FP6A 3GNLA 4CHTA 3P9IA 4YRBA 3WMGA 4B6RA 4IUDS 4CIVA 5K0JA 5JXHA 2C4TA 3H9UA 5AT1A 4E1BA 4NATA 1SXHA 3LNTA 4JMPA 4OATA 1EP3B 3F98A 2O2SA 2BHSA 4MGEA 1N4DA 3PR1A 4GSLA 2GRAA 2NSDA 3LH5A 3NWJA 4O63O 4EYKA 1CUGA 3U7QB 1YQ9A 3GPDG 5A3JA 5LMNB 1RPNA 2RIRA 2XHZA 1XZEA 4NFSA 5FOXA 5FTWA 3WYBA 1CFJA 3CLRD 5H1YA 2W00A 2D7JA 2EFEB 1REQA 4X60A 3M33A 1IRIA 2OHGA 4DGQA 3WLTA 3F5QA 4MW2A 4WOJA 1YVPA 2J0UA 3G1WA 3MYYA 3L46A 4B2IA 8MHTA 5JATA 1WU8A 5FKJA 4F7WA 3GO4A 4C14A 1OZ0A 1TYBE 4QWWA 3SXUA 2FVXA 4ECEA 4PGFA 1RAGA 1B8OA 2H2HA 5B55A 1TMYA 1YQDA 4I4TA 5HDBB 3SIWA 3GLQA 4OHKA 4A7PA 3DV2A 3DE6X 4HSEA 4N0PA 4N7JA 4OXRA 3KUCA 3URMA 5E2AA 1CEQA 2SCUB 3JQFA 3NHKA 3Q3GE 2E4AA 3DMNA 1CR4A 4IJWA 1L5VA 4GPBA 1N6IA 4FNAA 5FWDA 4CKBB 3RS8A 4EG6A 1KVRA 1BC5A 1QB8A 2AOWA 4MIYA 2VHXA 5H83A 4PC1A 3YASA 5F98A 5K3FB 3OJFA 3GELA 2FCAA 4CMKA 4JLWA 1T1GA 2Z83A 4ACAA 2QN6A 4XYEA 2BH2A 5C18A 5D5PA 3WNCA 1N7IA 1SQSA 1XEXA 2UUPA 2ZBVA 5E9QA 2PY6A 1J0AA 1JL3A 3AP2A 1M34B 4QVGA 4R0NA 1KSFX 3QMWA 4S3MA 4YAFA 5EUQB 3FVTA 3IJEB 3Q5DA 3RT7A 1Z8DA 3MS7A 1K7CA 2B9VA 2BRUA 2D3WA 1KZ9A 2CYAA 3WKEA 4C87A 5KX5A 2XB2A 1GYQA 1N2JA 4RM2A 2FZ4A 1Y7PA 1KBQA 4KO8A 3TMAA 5CLLA 3V46A 2GKGA 4BDSA 3E7WA 1VJ0A 5GZ6A 4DM3A 3SG0A 1W5AA 3B1JA 3ITEA 421PA 2WDPA 3QXGA 1W36C 2IPOA 5KS2A 5HFAA 1RWQA 1QWOA 2NU9B 2CUTA 4WNAA 3E5MA 4LYGA 1CVRA 3FGNA 4G1FA 3IRVA 4HVCA 2EP7A 1GZ7A 5IEJA 2PUEA 3QQPA 4PLZA 3DDSA 3LY5A 3DEZA 1E0JA 2YXNA 2W8ZA 5MFZA 4YMLA 9ATCA 4X0EA 1OXVA 5FNVF 1MP0A 1BQ4A 1XTTA 4FYKA 4B5LA 1RD4A 4HYYA 4LJ7A 1L5ZA 1I2BA 4NCXA 4CFYA 4KXUA 1T8PA 2DBYA 1K8QA 3EGXB 3R7BA 2PAAA 2QOEA 4HCJA 4DLNA 3MRTA 1TKCA 1BEUB 4X00A 4UVDA 1WMBA 4JWKA 5DN6A 2O5RA 1TX4B 1VBMA 3V48A 2J3KA 1IQRA 3B6JA 4EHIA 1F0KA 1FP4A 1Z0FA 1RSZA 3DZBA 1EHIA 3UMGA 3ANXA 1IHYA 3TINA 1GPDG 1YZFA 1Y34E 4PR3A 3P96A 3UK1A 1ST3A 3VHLB 1EJ2A 2I6QA 1JNYA 2GCOA 4MWBA 4QL3A 3VNAA 4DCOA 3OM1A 2XVYA 4UULA 5BWNA 2IITA 5I7AA 2R4UA 3VMMA 2GBGA 4BKRA 2V7QA 1PR9A 3UJCA 3TPFA 1N1DA 1S7CA 2ZSAA 1J5XA 1ECJA 1SOVA 4MVJE 2VXOA 4PSVA 3KD2A 4BO6A 4CMGA 4NJMB 2PV0A 3TMKA 2FLKA 3ISJA 1ZRNA 1D2RA 3NATA 3ZV7A 1XZBA 3FSJX 4G89A 4KFCA 2E4ZA 2X77A 4EZIA 3ZCXA 4DGSA 4GQIA 2WZCA 1E62A 2G17A 2J3HA 1YDGA 3HR8A 5FV7A 4CZ2A 5C3UA 3U4IA 3CUKA 2C58A 1NLZA 3G0IA 1XRRA 1Z3IX 3NHLA 5EGNA 4KDEA 1PQUA 2FEWB 3IQDB 4RTOA 3IHKA 3U4QB 1WRBA 1ETHA 3AWIA 4FGUA 1BWSA 1BHJA 4YACA 1IOZA 5BT8A 5IJ9A 1RIFA 4TX1A 3WJAA 4W5NA 1NP7A 1T25A 4LHVA 4HP8A 5AK4A 221PA 4L07A 3S2IA 3U4AA 3GJ6A 1KIFA 3JR7A 3L82B 4GOKA 2QYTA 4O1IA 3TW0A 1YE3A 4O4JB 3WLMA 1I24A 1S96A 4HYEA 1QANA 5FHQA 2R25B 4YRRA 4BV9A 1SUFA 4R83A 5KINB 1NBME 4G0PA 3W6OA 1JDSA 3DTTA 4OJQA 3A3KA 2QN2A 3X44A 4DEVA 5I4IA 1KFKB 2BN4A 3R7NA 4QXQA 2I03A 5LQDA 1J8DA 3E2PA 2QLNA 3WOVA 4YASA 4WV3A 3KEFA 3IIJA 4ZYWA 4I7EA 4RZ2A 4R7TA 3ENQA 5EXDA 4JQYA 3RWBA 1T4CB 4YRFA 1FFXB 1F1BA 2IYZA 2WJ6A 3EGDB 1OXKB 1ZGCA 2JIOA 3L0IB 4RLSA 1T9GR 1ILWA 5K4AA 4BXOA 3LBAA 3NHPA 1UKBA 4US0R 2QN3A 2H1OA 3I9NA 3TRHA 2CMDA 4QJ3A 2PFKA 5MHTA 4OUDA 2ZJ4A 1KI3A 3D6TB 1JQKA 4KQKA 3TI9A 4EW2A 1NC3A 2NSLA 3T38A 2LXNA 2HHHB 1VHJA 3FYDA 5COAA 1WF6A 1ZJJA 2ZROA 1BCRB 1NZJA 4GYYA 4NV3A 2X22A 4DC9A 1EU1A 3FNIA 3T1TA 1SD2A 1PG0A 4HDSA 2GPYA 4G41A 4WUVA 4ZT7A 3OQMA 3O74A 5DLDA 3IR7A 2ZBGA 1AZTA 2DPLA 4I8XA 2WF7A 1ACLA 3RTCA 1E58A 2WD7B 4WCFB 1KSHA 3SHOA 1VLVA 2ZRAA 3RUFA 1UWVA 3JD4A 2ESRA 2XYQA 4Y0NA 4KDCA 4OYYA 1DKPA 1NC1A 4RVOA 5EJAA 3RQSA 4QXRA 1GTMA 4LMBA 1B2LA 5L4SA 3C6MA 2OAGA 2XCQA 3F0TA 1KI9A 1W30A 3TUJC 4R8KA 3TN7A 5E3HA 2AN1A 4HGOA 4BU0A 1P44A 4K6GA 4UXIA 3LHFA 5IJZA 4HKTA 2BEKA 2H9IA 3HSYA 1NL3A 4EECA 3U7JA 4FOSA 5BV8A 3NU1A 3EF1A 2FPGA 4BZZA 1Y6JA 3A1FA 1QDUA 4HDKB 1T91A 2N3ZA 4JLOA 4WOKA 2YWGA 4F3KA 3GV0A 1M0SA 4KCGA 5H68A 4BO8A 1MAHA 3HU5A 5SY4A 4RHUA 3IUSA 1UJCA 4IXNA 4K6KA 2B2XA 4KQJA 3T3MB 4A0RA 1BDMA 4OD0A 4OG2A 5DO9A 5CB8A 3WQSB 4B4DA 2PUDA 4FD3A 3X0DA 2YHUA 3FPCA 5LA6B 3STHA 3STWA 2HMSA 821PA 1UC4B 3LLUA 1R16A 5BVGA 1ZNXA 2O2EA 4YRGA 4MCJA 2B34A 4S05A 4B3TB 4LX0A 3BIFA 1C2YA 1GGKA 4DR6B 4MR7B 2HSJA 3K5PA 5EP2A 5FWXA 4RGYA 3Q5EA 3FLMA 3LY7A 1A4UA 3MRXA 3PUIA 3IAM1 3WQHA 2XMSA 3LIPA 4TMZA 4IJKA 1RXUA 2WV9A 1SVIA 2Z98A 1ZL2A 3DXZA 3LO8A 4UNIA 2AEEA 1QYXA 3TG2A 4ZXFA 1Z73A 2X1LA 4MS1A 3NEPX 1H85A 3JRWA 1FE8A 1E59A 4CMIB 2PPVA 1RHQA 3MW8A 4UCQA 2ZIGA 3ZXYA 2ISSD 2ZAMA 1NN5A 4XYBA 5JS6A 1FP1D 1E20A 2AOXA 3F6RA 3AO0B 3MHPA 5LQUA 4XYMA 3T9DA 1YQUA 1DXHA 1EE2A 3V2IA 1K6XA 3DMFA 4D3SA 2OY0A 2VOJA 2YMMA 4UHJA 1MB9A 4LAFA 2XNKA 3K96A 4MGHA 4WOBA 3B36A 4U02A 1JA0A 4XB6B 4ZO8A 2AFRA 3KBBA 3A4MA 2ODBA 4ZVVA 3KQTA 3CU5A 1OV6A 1N2XA 3WLSA 5I7VA 3QI7A 3SJ7A 2DUWA 1RZRD 2X9VA 3HV2A 3PFGA 1LLQA 2DVMA 5CVCA 3H5LA 5DU2A 4E51A 4EYSA 3K9LA 4I50A 3C4JA 5KYXA 3MAGA 4ZOAA 4FJ0A 3REQB 3AF3A 3DZ8A 2SICE 2ZDHA 2IEIA 3B78A 1XTSA 2CLDX 2C3OA 3IQWA 1NQOA 2J67A 1B1AA 4J7AA 3Q9UA 4XIIA 3TTUA 5A9SA 3Q8WA 1EX9A 3LWZA 2XGOA 1ZM2A 2MJLA 4WX2B 2PKWA 5EZYF 1C0LA 1CNEA 5CU7A 3F7TA 2ETXA 5ITVA 1EVIA 4YWHA 3VTAA 3WK8A 4RKQA 1MXFA 5A0TA 4HXFB 4ZZIA 3EC2A 1J70A 4V0QA 2B2CA 3QWBA 4LRQA 3JU3A 4RPJA 3BRWD 4L0CA 1W4ZA 1SHTX 5IDXA 5KTRA 3ZE0B 1K86A 2OL4A 2R5FA 3A9VA 3OF3A 3N3BC 3BIXA 2CNKA 1VPWA 5F1PA 3ZIAD 3H1AA 3KQLA 1V9SA 1Z39A 3LPNA 3OMLA 4PY2A 4YEDA 2Y68A 4OQDA 5DBOA 3ZHSA 2JJYA 4DARA 4PXYA 2HWWA 1KRXA 3OFVA 2GD1O 4MV7A 4IVQA 3RFFA 1BE8A 4E07A 3P0JA 2BJHA 1B6GA 1XE3A 1WKBA 3BXOA 5HF9A 4D9BA 3TECE 5AESA 2IU4A 2H1SA 2WIJA 3ND5A 4RKYA 5CH3A 5AM0A 3DLBA 1VG8A 5AH0A 3V8VA 3LS2A 3PE6A 4HPJB 1Z9BA 2P3QA 3BWEA 2GEJA 3PQEA 4LUCA 2HA7A 5LMUB 3MQ2A 4UEQA 3P2EA 1YJBA 1QP8A 2CL0X 4KXNA 5T67A 1PL8A 1VIMA 1ZCZA 1TYAE 4QBGB 4YLEA 5F73A 2AF4C 4DCGA 4INPA 4P98A 5A2QA 2AFIB 3Q7TA 4AJ9A 3NTVA 5BNWA 4TRRA 3W7VA 2F8SA 4HWSA 4D8YA 2Q2OA 1E9RA 3ZIDA 2VAVA 3IUEA 4YQFA 3KZOA 4WVFA 4NENB 3K0FB 5M5BA 4AY2A 2G40A 2ZTLA 4U7TB 4M0CA 5I51A 1Z75A 3EZXA 2EEZA 3MINB 4NYIR 1B93A 1HF3A 3I9JA 3V1YA 1LBHA 4Q4LA 1EUDB 3OHMA 4IV5A 4B7ZA 4ZEMA 1TEZA 4I81A 4D8VA 3SC3A 5TGDA 2C00A 1Z4JA 1DXOA 3E82A 3SFZA 4QA9A 5JSQA 5E0KB 2R84A 4M76B 1CUZA 3PBKA 1KI8A 2O2HA 1EWTA 1HK7A 2R65A 3HB0A 3JALB 4MPTA 4CDGA 2RHHA 2IEZA 5FWYA 1TK9A 1F9EA 2HK7A 3OAAD 3PQ4A 5AI8A 4NYMQ 1XROA 3AFNA 1JJIA 1KDPA 2NXEA 4U7JA 4CYMA 3ZDFA 4X24A 2QN8A 4X8MA 4IIYA 5L7YA 4O2BF 2KB0A 2PH3A 5DMXA 3FHTA 3I28A 1KYTA 4K8RB 4XB2A 3UEOA 2B69A 4ZFNA 1P1BA 1RHUA 3AL2A 3G3EA 3C6QA 1RHMA 2OFFA 3HP7A 2G77B 3GF4A 4GZ3A 5JRDS 1SBQA 2HU8A 2WFMA 2X9GA 2Q49A 1JKJA 3DWIA 1OBVA 1SVLA 3LGXA 3VNQA 2PQ6A 1ECGA 2EG5A 4KRYA 4C20A 3U1VA 3H6HA 4ZVLA 4AZTA 2YUIA 5LLSA 2EFGA 3B9PA 4PHCA 3ZOKA 4A03A 1WHSB 3JV7A 2WWGA 2HBZA 1T2AA 4HAWA 1CZUA 3RSQA 4UFNA 4U2KA 3HFJA 4UHHA 4IR7A 1FFGA 2A7XA 4HS9A 5B6IA 4PTZA 3WDLA 1UDXA 4IX9A 4Q4JB 2I91A 4IAOA 3EEBA 4DPLA 1MT0A 4LSGA 4FEGA 3ZN2A 4N9QA 1QVZA 2IKSA 2PYDA 1VKRA 5CEFA 4ZZ1A 3S70A 1G41A 2ZUSA 1AG9A 4FUQA 1DNPA 4XJVA 3S1AA 1VSQA 3BKWA 2IHVA 4CKZA 1MB3A 3VJRA 4ABYA 1Z0DA 4EEXA 3NBUA 4RJTA 2Z5VA 2Y66A 3D6VA 3OJXA 4ZTUB 2X5JO 4OLBA 1EUCA 5IKMA 1CP3A 4IZIA 2IP2A 4F2PA 1U65A 5G1PA 3KPJA 3QJYA 3JZIA 4K6OA 5EIEA 3N1UA 5GZ3A 3V7YA 5AIAA 4MUNA 4FYVA 4JOBA 5BN5B 1DAIA 1PG5A 3O4IA 2OZLA 2CFOA 3HUEA 1B14A 3TYXA 4DLPA 4YIKA 2ODPA 4XDYA 1AS2A 3UUGA 1CF2O 4WPGA 3T0GA 5A4KA 4UHCA 5B1SA 2JVJA 4EB6B 2PLRA 2ARKA 4DA4A 2VF5X 4H2DA 2VPZA 1BX0A 4QTZA 3A28A 1IHDA 5EI5A 2L69A 2CXHA 1G21E 3A1DA 1BMDA 3GIDA 3HJGA 3JWEA 5JZ9A 3B6KA 4J9VA 1QGED 4CW7A 1EINA 5F2KA 1NMYA 3IVMA 4L8LA 4JI4B 4CCSA 5B7PA 3NBXX 3LT5A 1C2TA 4P4TA 2V45A 1J0CA 4RLQA 3MIIA 1FUYB 4NCKA 1Q21A 4RMIA 1US8B 4MTLA 1H5QA 3HACA 3E0XA 4JJGA 1JFVA 1NNI1 3R76A 1R27A 4RM3A 4XAQA 2FOLA 1CJVC 3L7AA 3C2QA 3U3MA 3L8MA 3R44A 3AVXA 1K7EB 3RBXA 4JBLA 1A7JA 2ZPTX 2BFEB 3LUCA 1NG1A 4NK5A 3L0DA 2QMEA 1ONPA 2HCRA 1J0BA 1UM9A 1L4FA 2IU6A 5DEOA 3SKXA 1I3NA 3HJTA 1WS6A 1WDMA 2NSHA 5HR5A 4REOA 1VP3A 1Y5NA 1U5BA 2XAUA 4EFDA 1YFJA 2R6CA 3OEED 1ZY2A 2FQXA 4GPD1 2VAPA 4PPYA 5CLIA 1JEDA 1R9MA 2AT1A 4RDXA 1L8OA 1RI2A 3IDZA 3PIIA 5JVDF 4IINA 4IFIA 2HJHA 1T1IA 1WXIA 4XQ9A 4KZPA 5ENDA 5DNCA 4TKUB 3X2SA 3OUZA 3P2KA 3SZOA 1ADGA 1E3LA 2A0FA 3UM9A 3ECCA 1U94A 4HAOA 5KSPA 5HWSA 4MDYA 1VBFA 3O95A 2W2PA 5DNWA 1IHUA 5H4GA 1U2DA 5HGJA 4MR9B 5REQA 1X3LA 3EGEA 3N5CA 4DLAA 3WQBA 4NOKA 3EWSA 3LFUA 2X58A 3RTDA 4YRCA 4X63A 2X23A 1H2WA 1PR6A 2H5EA 1VE6A 4UQLA 4JJZA 1UXIA 3NT5A 2R2GA 3DC2A 1AUXA 1GZDA 4HATA 1GQYA 1GPAA 1WXQA 1N3LA 1R6AA 4JFAA 3UPUA 1IY1A 4BGUA 4PLYA 4NXMB 1SURA 4BQEA 2X6QA 4QDZA 3I2JA 4B4KA 1HA3A 3I58A 1KJJA 3ET5A 3ANYB 5D1NA 2EL9A 4U0KA 1Z0KA 1IUOA 4IXTA 1M1XB 1X7WB 1H8HA 4URWR 4NV1A 5A2GA 3NQ41 3DD5A 5K6AC 1PEKE 3WMFA 2WKSA 3G2QA 3AJRA 2F55A 3E22A 3GLFA 2QRGA 4NF2A 1CZRA 3KOUA 3A6JA 1SXJD 2CNWA 3T1NA 4DUGD 3MWGA 2BEJA 1DI0A 1GXSB 1SUCA 4Y9DA 1Y4UA 3WRWA 4U3JB 4PGHA 5C8ZA 1GZ6A 1C0PA 1XNJA 5KYWA 3P2YA 4FE4A 1P0CA 4GE3A 4RQUA 5H59A 3WBKA 4HNSA 4CODB 3BQ9A 5I3ZA 4KV9A 3G5UA 3ZY4A 2GRUA 2VCEA 2INGX 2KSQA 4XTCS 2Q6TA 4HC4A 3L4JA 1T3LA 1W1IA 5D84A 1FNSA 3LY8A 1DAPA 4K3UA 2R2AA 4XD7A 5ALWA 2OYCA 1T9AA 3H0KA 2CF6A 5EJ9A 4FILA 2W70A 3UJ6A 2DFKB 4D9GA 4UFPA 2QG9A 1LTKA 1JXMA 1WV1A 4AULA 3KQQA 3KJNA 3DLPX 4A8TA 4UHDA 4TUYF 1T1JA 1TZKA 2R1TB 3I0ZA 4F4FA 2G36A 3BXHA 4U63A 5MN5A 1NP3A 1QXSA 2C7GA 4RTKA 5G4KB 1K6MA 1PG2A 4LDJA 4MMZB 4UDNA 1M72A 3OPXA 3AIKA 3IUQA 4IKPA 2Q9UA 3AR5A 4KMMA 5EG5A 4X7MA 5TPZA 3COVA 4Y2TA 3GPCA 4PR0A 1W581 1SBCA 5KYNA 1CF9A 5FTJA 5AVVA 3F4KA 2PZJA 4FYMA 1Y4DE 1QQ6A 1M2OB 3A4VA 3FN4A 4MVCA 3RV3A 3WNBA 3LLMA 4PCLA 4P4SB 3I5MA 3WGLA 2ZSBA 5C7LO 3PD7A 4XIFA 3QUAA 4BGDA 1QTRA 1G5HA 5A5DA 1SEVA 1MABA 2ZJ0A 5EIBC 4O59O 3KYCB 5C4GB 2CBZA 2E48A 5HKOA 3CGWA 1K7YA 1KO5A 1TUGA 4OLHA 1XNHA 3OCCA 4X1KA 3H8JA 4CQJA 4JYPA 1NRIA 4B3DA 1QHHB 2NIPA 4ZDKA 1D2NA 2XKAA 1NF2A 1UBOS 4IEIA 1DU4A 1MC4A 1QAMA 2VJNA 3I53A 3LSYA 5GJVC 1Z68A 3AM4A 3TCNA 3ILXA 1WMSA 1Z2CA 2EKDA 3N53A 4N7RA 4AY5A 2C8VA 2AN3A 2GCPA 2ZIXA 4J43A 1SN7A 2NNWB 2HO5A 1YB4A 1DTWA 3FGPA 4D98A 5HSGA 3HY3A 4RA9A 3A6FA 2G9QA 2RAFA 5K6AA 5JMPA 4B75A 3E3MA 4M46A 2AVNA 4RD1A 3PR3A 4R8RA 3WYEA 5ALTA 1V1RA 3M3DA 5MGBA 4OLAA 3DZGA 2O6HA 1Y4SA 4V3BA 2IIVA 3IODA 3PD0A 3RS4A 3T7RA 3TZ6A 2AR9A 4A0SA 4E5MA 5B30A 1ZITA 3A9WA 5L3SA 2IGTA 5TIIA 5ITZB 1Z0UA 1RVDA 3UJ9A 3AZPA 4Y9UA 5KDLA 2V0CA 4NRDA 2VDOB 4HNTA 1GFZA 4UMVA 1N77A 3U7QA 1UC9A 1WSWA 3A6PC 4E7PA 3FD8A 4JGGA 2A59A 1T5DX 3D43A 3E1KA 5B1YA 5DGIA 3X1ZA 1U7HA 1OZHA 1Z82A 4S1VA 2CHEA 4PX5A 3NBKA 4I8IA 2JAHA 1V6CA 2CC2A 1KEZA 3O84A 2X2OA 3EZ7A 1JMYA 3HCDA 4OQFA 1IMOA 4RJIA 3FPGA 4KJXA 2UZ1B 3AXSA 2NO9A 4RTLA 1WPQA 3Q6NA 1W25A 1WR8A 4PWZA 3H9QA 4DVGA 1R8JA 1Z5WA 3GCZA 3KKOA 1ODSA 1G5FA 1L8LA 3L7DA 1N5LA 2QX8A 4E31A 2Q5EA 1TW2A 1IN7A 4ZODA 5L95A 2PGJA 1YK1A 4KPFC 5K2OA 2AG5A 2R8XA 5A4IS 2PWBA 1GRRA 2EHDA 5BW4A 3GW8A 3IE0A 2SCUA 2FDXA 4GI3A 3K15A 4WA8A 4R3NA 3R7WA 1MV5A 4RIIA 1CSEE 5CBPA 5D00A 4CKBA 1XJWA 1ZDMA 2VDKB 2OOSA 1ZJ4A 3RSSA 5K3FA 3ISTA 5KSWB 5BPFA 4BZXA 1FW8A 4KUEA 2Q5QA 3EAQA 1EFLA 1QNLA 3RUDA 5CPFA 4AICA 1K97A 1N9KA 2FF7A 2YZGA 2Z5FA 3DFZA 4K9SA 3RAJA 5BWLA 1NV9A 4DXAA 2HF9A 5ICCA 1D09A 3EW9A 3SS7X 1DUIA 1TXGA 2N0SA 2RH5A 3ASYA 1U3WA 2Y1WA 1M34A 1MJFA 3FWYA 3ONEA 4Z9YA 5HP4A 1E9VA 2FZEA 1HNNA 5F5XA 1KY5A 1RADA 3D6FA 4MDEA 1V4BA 1DMSA 4IYRA 5B58T 3BB1A 3B8EA 4U7HA 3NFRA 3R7LA 3N28A 5AUPB 5LDHA 3PEWA 4GOMD 2XXBA 1NN0A 2UZ3A 2O3RA 4GO1A 4B6GA 4XR9A 3FX2A 4BFUA 1Z83A 3GEDA 4UUPA 3T5PA 2HNAA 1F8XA 4BO0A 3COJA 2WG2A 4A27A 3V4FA 4DLKA 2P6NA 3QH4A 4RF4A 1F0NA 1R4MB 4U0JA 1QIFA 2G70A 2NU9A 3I6ZA 3KRTA 3N2NA 2A57A 3F49S 1M33A 1ULUA 4Q12A 1UT8A 3GXOA 4AUKA 4BEJA 2BUBA 4XE5A 1E2DA 3OZTA 4ZP1A 4PZCA 2BI8A 2I2CA 3D8RA 2VPQA 1VGRA 3MFQA 2CWDA 2JI4A 4RIGA 2YINC 1DIBA 3IXLA 4QAQA 4I4CA 3DHEA 3PWTA 4X1YA 3IAM6 1A2BA 1QFJA 3IDAA 4PHHA 2GX6A 4RO0A 3RU2A 2FSGA 1HRKA 2IY9A 4HS4A 2AZDA 3SKYA 3ZV6A 3ZW8A 1AIPA 1QYRA 4BBAA 2RHWA 1J4AA 1PLJA 4IRXA 3SC4A 4M54A 4WHMA 1V7ZA 5FI0B 3WE7A 2WSSD 5GOTA 1MJGA 1I4OA 2JGFA 3OIFA 5LXTF 5I7EA 1CT9A 4OJTA 4WWHA 2J9XB 1U0NA 2OD9A 4PSDA 4QDKA 2DKOA 1RS0A 2J59A 4BRZA 1NQUA 2QNRA 3GBPA 2D5BA 4KXXA 3KUXA 3T3IA 4RTSA 2Q5JA 1TTPB 2VQFB 2YXEA 2C84A 5E6UB 4C4TA 4P1ZA 3PFCA 1UKYA 1J39A 1CJTC 1BZYA 1F4PA 4F1WA 1V45E 2NUBA 1C3JA 4R8MA 1R0ZA 1IFXA 4LXXA 4F45A 4WCFC 1KE1A 4F2HA 1X0VA 1BG6A 2CLSA 2NXNA 3N6XA 4NJMA 1J8YF 1WB9A 3F3KA 3KVNA 4ODIA 3C6KA 4EI2A 4QVIA 4G0QA 3DOUA 5LP1A 4JCOA 3PUJA 4G1BA 1JSRA 4BJ6A 2F8LA 4B3CA 2GK4A 4JI6B 3RR2A 3TLKA 3U4CA 2LCQA 5DK6A 3M4XA 2JLBA 3FROA 3I76A 4RHCA 2PEZA 4QUBA 1AUVA 4EHJA 3EPJA 3U4QA 4IRMA 3H8VA 1MOPA 4ZAZA 2WR8A 2EFHB 3X2FA 4C0AC 5DGDA 3L8DA 5C5DA 5DHAA 1BWPA 3JAKB 5E4YA 1VMKA 3KJEA 1DDOA 4ZAXA 4ZDWA 4UHKA 4Z9AA 3FWNA 1BOOA 4NDAA 3NMUF 4GUAA 2QM8A 3LQ2A 4D81A 1G3MA 4O4JA 3S2FA 3UJHA 2E4XA 2W2VA 4K40A 2P1DA 4LFAB 4ZAFA 2O7SA 2FSHA 3IVGA 2WKRA 5JS7A 3N2ZB 2Q3FA 2GNAA 3S2EA 1OXUA 2GEBA 2Y1OA 4CDRA 3CLSC 5IUKC 3WKAA 1E18A 4RPKA 1GNQA 2JLWA 2ZRLA 4POAA 3JWGA 3OZAA 3QEKA 3IKVA 3HZHA 4M8KA 4BNUA 3PD1A 4DWWA 4RTPA 3ZDEA 1DDIA 3T54A 1S3SA 2XNSA 1I1QB 2YIDA 4JA0A 4D0GA 4ZI7F 2GK3A 2JAPA 4L16A 1T4CA 4P93A 5A3SA 4RADA 3EGDA 3V8EA 1SKQA 3GLKA 1U5AA 4E11A 3ILHA 4MKXA 2QTLA 4XQCA 1JEAA 1N2ZA 1FDUA 1IPFA 1L5KA 3MTAA 1MV8A 3VHXB 4TKVB 2ZYVX 3C70A 3SBXA 1RAHA 4I14A 4QLOA 3KKPA 4R9VA 3W2GA 5TT1A 5LPNA 4H6VA 1BCRA 1XTZA 3C3AA 5JSHA 4Z3OA 2O8CB 2BOVA 4DUPA 3R8FA 3KD3A 3CWQA 4X95A 3DEAA 4FIZA 3SSAA 4DRZA 1A9QA 1CLUA 5K8VA 4CF6A 4H4DA 2NZVG 4QZVA 2UKDA 3FAKA 3RKRA 2VJAA 3RQIA 4DR3B 1FFCA 4H1TA 1CEXA 1GZHB 3HJHA 4KWTA 1GR0A 5HCIA 2B8TA 4L9RA 3G5LA 5GVRA 3HYCA 1T4GA 3KVRA 3ADOA 4TKMA 4WCFA 5L3RA 5JH7F 3K6SB 4ILKA 3T9AA 2Q4BA 3IX7A 3UQZA 1XVUA 3ANMA 4QOGA 5KHLB 4FOTA 1TLLA 2B6NA 1HLFA 1Q0TA 2VJOA 3N2GB 3GRFA 4LXTA 4MS4A 3U80A 2Q9CA 5CT4A 3PFWO 3HY4A 5CDSA 1C4KA 2DAPA 4PLCA 4X6LA 4A8JB 3ILYA 4CKYA 5DK4A 3MAAC 3Q98A 3SYTA 3SLRA 3NYQA 2B4TO 1E1NA 1YJAA 3RROA 2FR8C 4QDJA 1TECE 1SVUA 3TLCA 4WECA 1J5PA 2AC2A 2X1HA 1Z4KA 3B9BA 3D2LA 4AURA 3UO8B 3ED5A 4GOJA 3O8QA 1K06A 4H16A 2WUFA 4ML3A 2JJ1D 2ZPAA 4G0OA 2EVWX 3P9KA 3WBJA 3E2MA 4PAMA 1IMJA 4UUOA 1OB5A 1UT6A 4DNPA 1KQFA 1Y1RA 1XDBA 3EXFB 2HK6A 2M2IA 3FTCA 2G82A 2PD4A 2V1XA 4ZREA 3T9EA 1OJ7A 2F67A 4UUQA 1GJRA 1Q1EA 5CFPA 1TLTA 2DR0A 4JB8A 1J9ZA 1R15A 2XB6A 2ZRGA 5JNWA 3EYAA 1W4RA 3ADCA 3O2QB 2J4FA 4O8ZA 4R1TA 3PIRA 3DUFB 5C37A 3VO9A 4WKOA 4RDHA 2FW0A 3EHDA 3EVTA 4TRJA 5ESWA 5D87A 3SE7A 5KKCA 1EX7A 4Q19A 3KXIA 4RK4A 1N6LA 4MR7A 2DTDA 5T3UA 1YQTA 2P9FA 5JU6A 3VOAA 3D6NB 1HQYE 1ML4A 1PYGA 4URFA 4YO8A 1E9AA 4L2IB 3LDGA 4JBNA 5CVDA 1OYWA 4F97A 1ODIA 2YASA 3BFXA 4ZQCB 5EQJB 5FNVB 3CXUA 4EFNA 1ZIDA 3R77A 3WADA 4C5CA 2ZLBA 1K5DA 2VSNA 1DV1A 1XTUA 2XV1A 1QV6A 2PA0A 3MBKA 1RBZA 4FN5A 4FDMA 2HEGA 2HF7A 4R51A 3K8YA 1NMSA 1N2BA 1V16B 4P58A 4RMNA 3CZ5A 5EFOA 1LBQA 1OBCA 4UBJA 1HMPA 3WGQA 3WLQA 4DBLE 2CXUA 3HVKA 4NBTA 4ZOLA 2H1WA 3SQXA 1G4HA 2B3DA 2XKBA 2X8JB 4LC9A 3LX4A 1CB7A 1ZUNB 1KI1A 2D1QA 4JL6A 5HE8A 3I8SA 4HNAA 5LC1A 2I6TA 1YH3A 1P39A 2FFJA 4JLSA 3LCRA 1LVHA 2HTFA 5AVKA 3PC3A 4Q9IA 4GBGA 3BWCA 1RM5A 2HOQA 1Z4NA 2I4MA 4UXHA 3REQA 3EC1A 3DDHA 3PSHA 3OM9A 3C97A 2XVZA 2PMEA 4Z9BA 1KMMA 3QX8A 1Q20A 4XB1A 2NXWA 4F9EA 3V6LA 3I62A 1EFKA 5DCWA 3VPAA 1O3YA 1G17A 1S4QA 3ZD9A 2C7OA 5A3QA 1CRPA 3A2MA 5FJJA 5DX8A 1GPLA 3N0XA 1RWVA 4CNBA 4TYNA 2FR8A 4F4HA 2PFSA 1MJ5A 1MRZA 3DOEA 1R4AA 1W49A 4MP6A 1RXCA 1IBRA 3G8BA 3E9NA 2R7MA 3BGSA 3G02A 2GN2A 2HRRA 2O5VA 3QEOA 3NYIA 2GPAA 1SVSA 4H35A 4JBWA 4K6HA 1SK9A 3IAS1 4WK2B 1OYVA 4EHHA 1FCJA 3C8UA 2E37A 2I65A 1ZM9A 2P6OA 4ZDIA 3S40A 5K8CA 4WA7A 1SQ5A 1HURA 2QJTA 3HFRA 4I6EA 3OE7A 4CXMA 4QYIB 2AS0A 4BQOA 3RHFA 2Z1DA 5KNDA 1ZR2A 4E5PA 3IALA 4YAWA 2FPXA 4UE6A 1Q92A 1GAXA 4MCHA 2ZDGA 2VN8A 1J1IA 1LNZA 4AWAA 1CQJB 2CK3A 4I19A 1E9FA 3EFOA 1RFLA 4R2MA 1GGFA 1S01A 2YOGA 3MPOA 4IIVA 1IJFA 4ZC8A 4YV0A 1XI2A 5JFTA 4RHEA 1SCIA 3PXEA 3DE4X 4E03A 2I99A 1L4MA 5B3AA 2O1WA 1OA1A 1HNXB 2R3SA 3PF8A 2P40A 1V35A 3TR0A 1ISHA 4KEAA 3PC7A 3ZHOA 2O8BA 4ZK2A 1VI5A 4NENA 1B6TA 1MDFA 3KU1A 1HQKA 1KDOA 2EERA 3NYRA 4ZPXA 3MINA 4KR7A 1DWQA 1P91A 1NHWA 2YC2C 2RONA 4QOJA 1EUDA 1JEYB 5IAEA 2FA9A 2XMPA 1LPBB 1YIOA 3QXJA 4J8PA 2AR7A 2Y92A 4IF6A 5C5IA 2FP4A 3GRVA 4EO9A 3FDFA 4BKOA 1MEEA 3HCFA 1U3DA 4RL4A 2QI9C 3BEOA 2ZTSA 3AY3A 3LFHA 4P3PA 3JALA 4GZLA 2O2YA 4WACA 2DTEA 4M8NE 5GY7A 1Q17A 2P69A 5EP3A 1LZKA 2PUWA 2ZITA 3V2HA 5DLEA 1Q77A 3MMXA 1ABBA 2GZ2A 2GHTA 1K98A 4F4IA 2YDYA 3GLHB 4TSRA 1RQPA 2H16A 3KKNA 3OLWA 3ZWVA 4RKRA 2Q21A 4TWBA 4FKBA 1G9SA 2QYOA 3IBFA 1MIOA 2Q7OE 3G49A 2B4YA 2XYHA 4RL6A 2TMYA 5JV5A 5IM5A 4QT4A 3MZ0A 2CCKA 4J6EA 4M0MA 1VYUA 2XDQB 1RJGA 2ZXEA 1E1RD 2DETA 4EG8A 1DQNA 1MLDA 3MCTA 1HDYA 2DHDA 3Q0IA 1LPMA 4KGDA 1OXXK 4CIWA 1J1ZA 1DKMA 1U81A 1GGJA 3P5SA 3NR2A 4NJOA 2FP3A 2V6FA 4M0PA 4R1PA 4TLEA 1JDBC 1NLFA 3GHYA 5JNRA 1ZM3A 4CJXA 3LI2A 2VCHA 1XPRA 2Y1DA 1KQPA 4LZAA 5DNAA 1KJQA 1FSFA 5AW4A 3E8MA 5KJ6A 4Q4JA 1PEYA 2QZ4A 4HUTA 4PTLA 3GX1A 2JLQA 1BMFD 3LK6A 4ZVMA 3ZCSA 1DOAA 1A50B 4JELA 1O77A 1FY2A 2H85A 1QMPA 3VZRA 1HR0B 2H1RA 3MXOA 4RD4A 4LE2A 4KAJA 1TVKB 1L5WA 1IZ7A 1GAWA 2ZFUA 4IIFA 1LK0A 2EZTA 3U44B 4G5GA 1L1FA 4DMHA 4EUNA 3ZDBA 4KREA 1XEAA 2RB4A 2AMLA 2WQZA 2PX0A 5FPTA 1OW3B 1V3TA 3AJ8A 3NVAA 5AW9A 3F5SA 1OFHA 3I5UA 2CYBA 3MTQA 3AM1A 1NX6A 1ODLA 2GOYA 1FLDA 2QE7D 4HPXB 3JQCA 4JI3B 3KB8A 1GTSA 2P9JA 1FMCA 3LUHA 3BWMA 5H82A 1UK6A 4IIBA 4OJMX 1AM4D 1N2SA 3CVWA 3ZD6A 4G86A 3OBIA 4QNNA 3FFAA 1ZHHA 1RYHA 3IV7A 3BILA 5AP9A 4EGQA 1GDDA 1UEIA 4CR8A 3C41J 2Q5FA 4F7DA 1ZONA 3EGIA 1QBGA 4W5RA 3C43A 2AKAB 1FQOA 2GF2A 4EY8A 4XQ0A 3Q9LA 4OPMA 3K20A 4S1OA 4WKPA 5DE3A 2JEOA 2JH9A 3U2QA 5FPKA 2EXXA 2FEPA 1R74A 3DUWA 4PYOA 3IV6A 1GTZA 1NF3A 2A78A 1KK3A 1I2CA 3L40A 4L8VA 4RGQA 3U37A 3U3DA 4UM9B 1VFPA 3PJEA 2CHQA 1KWKA 3EXHB 3U19A 3RSLA 3V33A 3RS5A 1E8NA 5C8VA 3OCXA 2VWQA 1QQ5A 4OHRA 2YZNA 4WADA 2OLKA 1DTSA 4H4EA 3MTBA 3GPIA 3K1TA 3VPFA 2I1QA 4XLLA 4UNQA 2BR4A 4R6WA 5EZYB 3RF6A 5LQRA 1YZTA 2IZZA 2VK8A 1A9RA 5K0LA 1US8A 4EDHA 2VKQA 1NPYA 3AOGA 4X90A 4MLCA 5JD3A 2OC4A 1ZVJA 3THWB 1M3SA 2NZYA 4YXFA 5DFAA 2ERXA 2PZLA 5ED0A 5AO9A 5E7QA 2WWVD 1T26A 1YDWA 3BGWA 1T9GS 1VL0A 2BFEA 1MDBA 4UCWA 2UVDA 2WHEA 4EL0A 1T4DA 4E5NA 5H3LA 3W3AA 2D4AA 1F0YA 5ALKA 5P21A 4JLJA 4PZEA 2Y1CA 1MF7A 2BF4A 3CURA 4LZWA 2OGTA 3K31A 1LV7A 1QRAA 2PUHA 1W5FA 3WK4A 3QLJA 1WBJB 3H4IA 3ZKWB 5EWJB 2XE6A 1Y9JA 3O47A 1Y5LA 3AU9A 1SKYE 4ILEA 4P7JA 1U2RA 3GVHA 5JYBA 9MHTA 2VDLB 4LJRA 3PHGA 2J9FB 1I4TD 4PX9A 4DSZA 3CJRA 1Y5MA 2C20A 5CDHA 4M0KA 2W48A 1T8YA 1E9DA 4G8DA 4MR9A 3W2TA 1Y82A 2FPUA 3D54D 2R97A 3BMOB 2DSNA 5AVJA 3RH0A 1K8YB 1UDWA 4P7GA 4TVKA 3CLSD 5ALPA 4NG4A 3PFBA 4C2AA 3DYVA 1FXSA 5B1HA 3TTYA 4RQAA 4XGKA 4NBLA 3BHNA 4P84A 2JGKA 4DDWA 2QROA 2V58A 2ZZMA 3VBCA 1SEPA 1YVUA 3TNLA 3GIWA 4Z7JA 4C4OA 1NW9B 2AW5A 3ESRA 1KPHA 4C2BA 3MVEA 3Q7EA 4QG3A 2LZ0A 4GMXA 3OJCA 3WJ1A 4NCNA 1HWYA 4I6GA 1ORTA 2ZUBA 3PGLA 4IP0A 3HKBA 1T5LA 2X0FA 2XQFA 3P9RA 3U0VA 5C5EA 4DMMA 5JD4A 4GBJA 1APBA 4I9FA 4JN6B 3GLGE 3ELYA 4K6CA 1CX9B 1H2EA 1X7WA 5EYPB 3BE8A 3DMTC 3N8DA 2J45A 4B6EA 2YFKA 3EMBA 3KKMA 1V7CA 4MPJA 4RE6A 4BVFA 2H00A 1C8VB 1ENPA 3T5AA 5BN3A 4CMHA 4COKA 1I7DA 2C59A 2WZDA 1N1GA 3CSUA 3GZNB 4B71A 1E1QD 2XBUA 4L51A 4BPRA 5C34B 4YJ3F 1GXSA 2X0EA 2I7VA 2ILVA 2PXCA 3PNQA 3IT1A 4LXGA 1U7TA 1TA4A 1UMCB 5EVCA 1WZ2A 1KMNA 1AQIA 1FL9A 3A04A 3ND8A 3R20A 4PGMA 1FYEA 2I2XB 2I33A 2Z09A 3GBSA 3OSUA 2VG8A 3QP9A 4HAIA 3B20A 4CMCA 3RF7A 3H1GA 3AEUA 5AHWA 2PMBA 3F5MA 1MUUA 3L79A 3TOCA 1W19A 3MCZA 4GZMA 4L85A 2OSVA 2VQSA 4D4JA 5HYVA 2WYHA 1K7FB 3MS4A 5DOVA 3F97A 4UUNA 4A0FA 5HF6A 1X1QA 4BVJA 3A9TA 4JLAA 1M54A 4NTZA 3QXXA 4RNCA 2PU5A 5DTJA 4FEYA 5F76A 1KDTA 1UAGA 2R1TA 3FR8A 2AZ4A 2ZJZA 1UC8A 4PGAA 5K9ZA 4M87A 1EVEA 4UTVA 2ZWPA 1QS0A 2ODNA 2XB8A 621PA 4FCCA 2PLAA 5K0BA 4ZOBA 1XNRB 5JWHA 1PGPA 1HEIA 2QTAA 1WXGA 5DTEA 1LPAB 2PM8A 1Y48E 4OMDA 5JUWA 1SELA 1OBHA 2QMZA 2ORYA 4AWXA 3V1KA 1GDHA 4GMKA 4O3FA 3KAKA 2GJ4A 2Y0CA 1WABA 1A72A 2HA3A 2JLCA 4MV9A 3SF0A 4W5OA 1EBUA 3RBVA 1Z0SA 2ZT7A 3QFFA 3A9RA 2I4LA 4P4SA 2QRQA 4Y9TA 4CM4B 1P33A 1J24A 3NBYC 5LNK1 1CP2A 3AIIA 2X0RA 3DM9B 1ZH0A 4XEUA 4FGKA 5KTSA 1MW8X 1KEUA 1TO1E 2YH2A 3A26A 3UQYS 1G42A 3NALA 1NU8A 3KOXA 1YOVB 2WTNA 4GX2A 1LU9A 5F2EA 1KSGA 1XPOA 1U8ZA 2VP5A 3UVEA 3H0EA 4RZSA 3A2KA 1V5EA 2ZS8A 2PLNA 5J59A 3STYA 1L7RA 1QHHA 2DLCX 4WXPA 1IEVA 4X65B 3RVRA 1QGAA 1M76A 1TK3A 1SA0A 3EZLA 1GA6A 1TTTA 3NO4A 5HS6A 1U1CA 3MQFA 3T1VA 1PS0A 1ZOSA 4HQFA 3VSAA 1M83A 5DNDA 2IXFA 1I9CA 3DMTA 2GUGA 2PMCA 4MZXA 1CG6A 4BQSA 4LHEA 4GM4A 4QU5A 2ES4A 1OBOA 2XB4A 2ZCVA 1E4EB 3GMDA 5T64A 3RVJA 1BGWA 2XRMA 1RWWA 5CP8A 3FZEA 5ALZA 1T9CA 3P9CA 1YZKA 4IXDA 5ITZA 4MWSA 3GP5A 3GZTB 4PRLA 5EE5B 1OWMA 1Q0PA 2Y93A 1U8EA 2CB0A 1O03A 1TQ4A 1E3DA 3CF4G 3GRUA 3LPDA 4DOMA 2QL9A 3KSZO 4C30A 2UUAB 5F3WB 2O4UX 5L3SB 1INLA 3VVBA 4ZT3A 5A4JA 1OPXA 2ATXA 5IAGA 1LY1A 1PFYA 3E9QA 4MITA 1RE0A 1ZK4A 1Y1PA 4G0MA 3WB0A 1KAMA 1QU2A 1JZSA 1Z06A 3F7MA 1E2IA 4G5OA 5AJXA 1LWNA 4J7CA 1E3TA 2XSZD 3V8BA 4UDOA 2UZ1A 1GRCA 4CCAA 5JYCA 1W0KA 2W6CX 1QQ7A 2XF8A 4Z1MA 1SD1A 4YRIA 3OMWA 2GZHA 1BMQA 2Q6LA 2VTVA 2W8BB 4MV6A 4OQLA 4UVEA 3RKSA 3UXYA 3ML1A 1W0JD 1HI9A 1MTOA 3BMCB 3MT9A 3BREA 5JVDB 1O4VA 1MA0A 3Q3EA 1AMNA 4W9RA 1RQGA 4MX8A 5IJ0B 1DX6A 2HJSA 2PYIA 4MKGA 1MU0A 5JAIA 1MTZA 3MOSA 4MWCA 1ZO8A 1LFAA 1QJ4A 1A9ZA 1M7HA 1WZUA 2ZUFA 2QN9A 3MTJA 2C9ZA 4GU5A 2VDQB 3ZHBA 5ECYA 3VR3D 1RLIA 2ZJBA 5H9VA 3EA0A 3R0ZA 3LRTA 2DG2A 4FGSA 4CL8A 1WD5A 3SVTA 4DNQA 4P38A 1P1CA 3FUUA 4ZHQF 4EY4A 3HYSA 3TX6A 4NK4A 2GCIA 5LZ5A 3S99A 1HDGO 2XQVA 2Q41A 4QUJA 4PNHA 1XU7A 1W48A 2QUKA 4DCMA 3GB9A 3HCWA 5DWQA 1KEPA 2NYVA 2XMCA 4WTOA 1J0EA 4I9GA 4LDPA 1ULHA 3ER6A 4QNMA 3ZWXA 4DLVA 3NHSA 5JJCA 2P2GA 1IAVA 1ZPDA 2N42A 1AUQA 3D3EA 2OBBA 1NR5A 2MSLA 1PCXA 3MUFA 2YX1A 4LGYA 3OPQA 5G41A 4D9IA 2O54A 1Y7LA 2WKQA 5FAXA 3MTEA 1PR3A 5ARDA 2G1KA 2DHRA 3EOZA 1C50A 1GT91 5F33A 4BNDB 1I6MA 1Y4ZA 4ZCMA 3UCXA 4FFDA 3I73A 4GWGA 1DWOA 2VJKA 1O1YA 1FPQA 2QVZX 2CUNA 3DO5A 4HNRA 4V0NA 4DLXA 2ZWOA 1CEEA 1C7EA 2MMCA 2JGDB 3NOOA 3QW2A 5CX1B 2Q5LA 3S2YA 4FT4A 3K1ZA 1JXOA 5HQTA 4DVJA 1Y0BA 3L5KA 1A5BB 1O87A 1XJCA 2XMGA 3CUSA 3HFGA 2HGZA 1PX2A 1AB6A 1NQAO 2NYRA 2O2IA 2QLTA 4O5OA 4RF2A 5AI6A 2JI7A 1LA2A 1QTIA 3KQMA 5BP7A 1V6AA 3WWCA 1GCAA 1EQAA 1JVSA 3OI7A 4NARA 2NNLD 5J9FA 4A6DA 4B5KA 4CFZA 4X7PA 1EB8A 2CJFA 2V6IA 2IXTA 3G8CA 4LDZA 2V74B 3NOXA 5AI4A 5E6UA 1EXVA 1JR6A 4TWRA 3FJYA 2QD5A 1H66A 1E66A 1TTHA 4GMDA 3R6LA 4LE1A 3ORHA 3OT4A 1FLAA 4N3BA 5CB0A 4AG5A 3HS3A 5U4XA 3DM5A 4KI0A 1TI7A 4NZ9A 1QLWA 4Q47A 4Q9HA 3RB8A 2FG5A 1PVDA 2F9LA 4NZPA 1ESNA 4LFBB 5BNFA 1W6RA 1QTNA 2HRZA 5KJFA 5EJ7A 5I7RA 3VR1A 2UYOA 4BFLA 3QKRB 4EA9A 2A0XA 5EHQA 4RJKA 3WSWA 4DMFA 5I7OA 5LDDC 3RADC 2V4ZA 5BY2A 3KR2A 4GRAA 3CLTD 5F78A 3OU2A 1SUAA 1VZ2A 5AUNB 1KP9A 1PNVA 1I5RA 1DV2A 2EGHA 1QE0A 4O4LA 1L2TA 1TPZA 1EIWA 1L1RA 3CQ9A 1E6MA 3JAKA 3O6VA 4WLFA 3QVXA 1W96A 4CPDA 5TJ9A 3EPPA 1V5GA 5BR8B 1U9YA 1AOXA 3G0OA 3L0ZA 1KQOA 4IJ6A 3IAS6 3TEJA 3JVVA 3ZZMA 3ESQA 3EIHA 4EUSA 1VQ1A 4JBHA 2MSEB 2JFWA 5K0SA 4WOPA 5TMPA 1XWIA 3WIBA 2DQZA 2V7VA 5D51S 3AQ4A 5JNTA 4QO7A 3HDHA 2QTVA 2A88A 1OIXA 3VNBA 3PVZA 4JUDX 2AOTB 1BE0A 2UVPB 2CHGA 4QJIA 3VU0A 3P9XA 2FFAA 2G9RA 3VKGA 3LT0A 1QIMA 3QFHA 2C0PA 1W75A 3RGGA 3SIRA 2ID7A 1LSJA 3OLYA 5AVRA 1YKFA 3CS3A 3EYWA 1JAHA 2Q2NA 4WAUA 5PNTA 5KNDH 3UF0A 4RAQA 2OV8A 4J0CA 1GR1A 5KKNB 4XH9B 3QBEA 5GINE 5KZMB 4DB4A 1GPNA 4B8WA 4EDFA 1Q2XA 3VHXA 2JIBA 3TSWA 1CK4A 3L93A 3PZBA 1OFIA 1GU7A 1IOVA 4G4IA 4YCCA 1E9BA 3ORYA 1WA5A 1JAZA 2WPDA 3FZYA 1PW7A 4ZALA 4EUFA 4W99A 3PC2A 1NULA 3GA5A 4N0DA 1T8WA 3H2ZA 5JG7A 1ZGJA 3T0FA 3UWSA 2J0EA 1CUVA 4MJLA 1N5RA 4AQ7A 3CPHA 1ES9A 1BGXT 1YS9A 4OXYA 3NNNA 4XQGA 4AN0A 4ES6A 1CY7A 1NVMB 2V6GA 1SKAA 1NJ2A 2BMFA 3D5TA 3NDJA 3SR0A 4CQLB 1Q2UA 2OV6A 4Y6LA 4B9AA 2W4QA 5EIXA 4RPIA 3RRMA 5DSTA 5JEEA 3CR8A 3CE6A 4L4UA 4MGYR 4M1MA 4EHNA 2PL3A 3SMVA 2O0JA 3N2GA 1KH3A 4XPIA 3QRWA 3M5PA 2IE0A 3O75A 5J4VA 2XY4A 2GPTA 2RJNA 2MSCB 1QK4A 4G56A 1Z5GA 4RGBA 3OMXA 2BKXA 3DCNA 4JB2A 1H0RA 2C1ZA 2PQ0A 1KAEA 1QWSA 2YV3A 2NTEA 2VYVD 4KB5A 2CLFB 4B46A 1YQXA 1PJTA 1Z18A 2ODQA 3JY6A 1P6QA 4H9GA 2DJIA 2VHEA 2B9EA 4RDCA 2O8NA 1JEEA 3K0BA 4Q00A 4HWRA 2OCBA 4ZRMA 2QP4A 4Y6PA 4EK9A 4L0QA 2WA1A 4GKJB 1CR1A 1U28C 2JW5A 4RENA 3WO1A 4INOA 3RRFA 3WXMA 3EXFA 5DDIP 3LT2A 1KQ3A 1SPBS 4M6WB 2I3GA 3BCUA 4RVFA 2HYIC 4FI3C 4D1YA 5JIBA 3G68A 1GVNB 5DHRA 1ECFA 3ZCPA 2CMKA 4FDLA 4BLUA 3DUFA 3AINA 4IPTA 4N40A 4MVJD 2HQ1A 2CL6X 2PLWA 2XYVA 2AJCA 4YMIA 2JF0A 3AC0A 4PG8A 2O3JA 4P3KA 3KJXA 1U80A 1ZH4A 3B5JA 3SC2B 4B09A 2IYTA 4L2IA 2XE4A 2QTGA 1RQXA 2PZGA 4A9AA 3E5NA 1ISIA 2F3UA 4NOLA 2JAUA 2D54A 5FNVA 1Y1SA 3FPJA 3K9FC 2PBLA 2V9CA 4PZUA 2CV1A 3SE0A 5FO0A 3DGFC 1TF2A 1NKTA 2YMPA 2DF8A 2ODWA 3QU7A 2QAGB 2YXLA 3HKEB 3BH6A 1ARZA 4JJ4A 1JIJA 3BWYA 3C3CA 3LDFA 2ORED 2EARA 5GM1A 4E4RA 2O2XA 3LUBA 4O6VA 2ZSFA 2PR2A 3ZUGA 2XMBA 2JCGA 3CN9A 3CG4A 3G9QA 3RUCA 3QPDA 4BGEA 2LDBA 2FQYA 5B3KA 4WZBE 1COWA 4Q1CA 1HEYA 1P0IA 1NBMD 2OZPA 4L3OA 4QPZA 1WDWB 4KZKA 4DR7B 3BD6A 3M89A 1RI4A 1DSSG 3DOJA 2IYUA 5FWAA 1J0DA 3KPYA 1ZSVA 1GAJA 3C5WP 1RRCA 4E30A 3V80A 4N9WA 1UEXC 3TLEA 4LW8A 4CM6A 4RLHA 4EEKA 1U11A 2BBOA 1HH4A 2JIRA 1II8B 1P73A 1KWGA 1JDNA 5FUXA 2AX4A 5FOTA 1N5OX 2SKCA 1K5HA 4JLDA 1YQGA 4MR8B 1ZR4A 2JA2A 1KYYA 3TLMA 1OTHA 3HUUA 4AP5A 3H19A 5AK6A 1DO2A 1FQKA 2EC5A 4G8CA 4OYRA 1IHPA 4DIBA 3NONA 4C2TA 4LHZA 1YS1X 1H42A 4Y9SA 3ZGNA 2H3EA 3BDAA 1YRHA 1TEVA 2V4UA 4TTIA 4IG9A 4K26A 4BNLA 2VDWB 4UHFA 5JCOA 3G7SA 1U28A 1E2UA 1Q74A 1HY3A 1RLUA 4FLEA 1PK9A 4I1PA 1DJOA 1ECBA 3EDRA 4BLQA 2Q0QA 3NDBB 1XFAA 3P2OA 1CRQA 1ISFA 1AV7A 2O2GA 4QYIA 5HBGA 1HDIA 1BOFA 8AT1A 2AYZA 5GPBA 5IANA 2WI8A 3TKLA 1KRHA 2Z4RA 4M86A 1U1IA 1RPTA 1IY2A 1SBTA 4DJ5X 4IS3A 1CUIA 1M2KA 2XQKA 4X20B 1CQJA 1E2JA 2O50A 3VJLA 3W8NA 2QXUA 1L7BA 3B5IA 3DZHA 1VYVA 2BGJA 5KWIA 3EUEA 4DKXA 4B3IA 3OLZA 4LDAA 1QYVA 4QBTA 4TS3A 1VCIA 2BEWA 2XH8A 5EMLA 1ECPA 3COSA 4AB1A 4XXHA 3PC4A 3W3AH 2W6ID 3EISA 5D01A 2DQKA 2DU8A 1K3FA 3EY9A 3HWWA 3BL5A 3B2QA 2WWWA 1V8ZA 3FR7A 3L0YA 3NTQA 3QJGA 4RD2A 4TTJA 3SCZA 4Z49A 4H1WA 2J7PD 3GFGA 3TFOA 5IF9A 3B7PA 2WUWE 4HVAA 2XI4A 3HXLA 3WDKA 2H7CA 3LHIA 2VJMB 4C7BA 1TQ8A 4BC1A 2A3NA 3CO5A 5CLQA 4YRPA 4DRXB 5LWQA 1SQGA 4EBBA 2W71A 1CIPA 1CPYA 4NBNA 4LJAA 1JEYA 2IV3A 4FR2A 3DEJA 1V5FA 4DM4A 1UDRA 2GRJA 1SAYA 4C03A 2IS1A 4KLAA 1PUXA 2FPWA 3PTZA 1QPBA 1GEGA 4TYPA 5EESA 2GPBA 3CEPB 3JQDA 1KZYC 3UA4A 3VH2A 5KCZA 1WBDA 1RAEA 2ID4A 2LNDA 1UINA 1NM5A 2HLNA 3M4JA 3AGQA 2EIXA 1GU0A 4PSUA 2X5NA 3LKVA 2XUKA 3PCRB 5ULLA 4F6RA 4YLYA 2X4LA 4RTNA 1Z12A 1T1SA 3PFIA 1JHQA 3CF6R 3MGCA 5JH7B 3DF7A 3KM0A 3N86A 3EXHC 4RMGA 4V2IA 5AVSA 3AVQA 5JAUA 5IVDA 3TK1A 5FADA 3WVNA 4QBHA 3RRJA 2V1UA 4JT2A 4MRVA 1Y7IA 4ZV4A 3H1BA 1H3FA 3IDSA 4I1SA 3ZQJA 2X9LA 3Q7RA 2MDTA 4PIPA 2WEKA 2CXSA 2XDQA 3DXXA 4XIGS 1EGVB 4U2FA 2VBGA 3EVCA 2H06A 3ZNPA 4HN9A 3H1PA 1KAQA 3RC1A 2XKJE 1AKMA 3FM9A 2G5PA 1C4XA 4ARBA 3ESCA 4FOOA 1BWRA 1E2KA 3UAZA 4YAIA 5CXUA 2P0AA 2P6PA 3PQCA 3HE3A 5DZSA 4EUEA 5HIKA 1WU7A 1P9RA 1LGYA 4IOLA 4JVLA 1B3BA 2HF2A 2YJZA 2YR0A 3IMEA 4MQ5A 4OREX 4PYMA 1KJ8A 3ROQA 4DLTA 1POXA 4OO3A 3W1EA 2DQSA 1RWBA 1ZGGA 1BA3A 1KR5A 1RXEA 2VPYA 4R31A 5JSFA 4RACA 3AR7A 2IJGX 1NGSA 2QENA 4U2BA 5C5CA 4JOSA 2EX1A 2HMTA 3GH3A 4IUYA 1SHUX 3SY8A 4RIEA 4ENTA 4IGAA 1YS7A 3PJDA 1TVKA 2BKEA 3U60B 1FFHA 3JWPA 3U44A 2REQA 3FBWA 5FUVA 2HBRA 1PK7A 4EPYA 5IWAB 3QYJA 3M4NA 4WBXC 1U7PA 2XCOA 4YJKA 4R41A 2R87A 2JB9A 1J8FA 1GZ4A 4D74A 4XEHA 1D0VA 2QSYA 3QU4A 4HH4A 4RK7A 3GJZA 5JLJA 3Q3CA 3LQ4A 3SOPA 3IPRA 2A5GA 4G9BA 4GZ5A 4YV1A 2Y99A 1P7WA 2XECA 3FUVA 4WXEA 4YQZA 3WNDA 3SNKA 4G8BA 1PAUA 1Z56C 3GARA 3HBNA 4FYPA 1O4WA 1ZGBA 4IIUA 5TS3A 1E6LA 4YN3A 5KUTA 2QD3A 4RETA 5LNK6 2XYRA 2Q7XA 4GPEA 5LLDA 1PGJA 2WJ3A 4ZO9A 5DWVA 2JLAA 5TY0A 4TWAA 4LNUB 3MXTA 4BDTA 2FTKE 2C97A 1Z8NA 5KAMA 4I9NA 5JZOA 4YWJA 3KKKA 1HPLA 3JVEA 2OCKA 4PQEA 4F5YA 2B6HA 4WXHA 5DI9A 4YMGA 1YR8A 3P7MA 5HIIA 5C52B 4DV2B 5GWXA 5IT9A 1RPAA 4LJSA 4CLXA 1M10A 1J9GA 5I01A 5KDDA 5AVUA 4FD2A 4JB0A 3OO1A 4ZEWA 1UXOA 3E15A 4KIJA 5DYNA 1P9WA 3LLSA 4A26A 5B6JA 2Y1KA 5MF6A 5HRUA 1HTBA 4R2JA 4A91A 3EXHA 2OR3A 3F73A 5BYKA 3WNQA 4AKHA 3PHIA 4MAAA 1JHDA 1EE9A 3JQQA 3JWIA 4KKVA 2Q8NA 4K9NA 4II2A 4TQAA 2Q99A 4BJHB 3TL2A 5ELXA 2QRPA 3IESA 3IP3A 2L19A 5LBUA 3N7UA 4TN5A 3I2IA 4NU8X 3KS9A 5EZYA 3V7UA 3VR6D 3TXYA 2IPAB 4XFKA 4Z0HO 4A6XA 4DHWA 4UM5A 5HIJA 4FC6A 2F3PA 2IZ6A 3GYGA 2PE5A 3HLKA 4KMRA 3V1MA 2P1ZA 4G5QA 1N5KA 1OJLA 3MBOA 4FFMA 1EKXA 3ZK7A 1UPFA 3BXXA 6ABPA 3NASA 4HZIA 3GYBA 1WVIA 5F3RA 3ND9A 2HHLA 3C85A 1U9IC 2C3UA 3OC6A 2JGNA 2WYWA 1AB5A 1KP3A 3M4ZA 5ANRB 5LKRA 2Q0XA 1IN8A 3F67A 3JQ7B 1Y8RB 4Q4DA 5EC8A 2I22A 4OL9A 2ZTHA 5SY9A 1NUUA 4JP3A 2D5CA 4FC7A 5EWJA 1B43A 1QFSA 4B3FX 2G1PA 4MQEA 2ASEA 4P7BA 3LVBA 3NRBA 4YV7A 4DCTA 2GZDA 4OXXA 5LP6C 3RYTC 3S5JA 1O6GA 3TQIA 2NT4A 3GN2A 5DJ5A 1MB2A 1YFLA 1DZ3A 1MN6A 2O0LA 3G9ZA 1T0JB 4B6JA 1E8MA 1ZKMA 4UC0A 4ER0A 4OHCA 3W04A 3GRKA 3BMOA 3ETHA 2QTTA 4BTVA 2MSKA 5FRDA 2C98A 3D2CA 4BMXA 1QMGA 1MO3A 4P4LA 1PWZA 3VR4A 2PPLA 1U0FA 2GVDC 1QCYA 3D4IA 1THGA 2IYAA 3WL8A 1GUDA 1ZK1A 2WWHA 3HUFA 1TU0A 4G4SP 3ZJ5A 3TFQA 1RCTE 2R8ZA 4F9TA 5K6RA 3DWGA 3FHCB 3OJWA 4B2PA 3CO0S 3GY0A 2DWOA 2GXAA 1QO0A 1GADO 2IYFA 4IQ8A 2FFQA 4DIUA 1M0EA 4BN5A 5A5FA 1UC5B 2XNCA 4BNVA 3GGGA 3K5WA 2FKAA 3GUVA 4OBBA 4XTRA 5HKKD 1B6RA 3D0RA 3MSXA 3IHLA 3TLXA 4C0KA 2EWWA 1AKRA 5FPHA 5B64A 4RXUA 1NI3A 2QXYA 4IJMA 1TT5B 3A0UA 2WY2D 3RTAA 1EFDN 1ESEA 2R8RA 4ATNA 2VHYA 3K9GA 1W5BA 3P0IA 4A2PA 3DAOA 3M6XA 2IP1A 2R11A 1ZGAA 2ZG6A 4AJHA 5JMTA 4ZV9A 4EYEA 2DFNA 3GZNA 4XI9A 3ZK8A 1VLMA 4Z5XA 3KFLA 1F2UB 4U4AA 4BX2A 5DH9A 3EFHA 4O2BA 5HG0A 1U6JA 4P2GA 5LIPA 1VKZA 1VSVA 3AETA 3OJLA 4R1NA 5IJXA 4B35A 3SIPA 4DXHA 2YZKA 2IVFA 4OB8A 2TYSB 4OU5A 4K3VA 3VFDA 1Z26A 3K35A 4X3OA 1MRNA 2RGYA 3DTVD 3PGXA 4MKZA 1A8SA 4OSEA 3TQFA 1K89A 3PLAE 3ZJ4A 1Q3KA 4RH3A 3PL1A 3WRXC 3TRIA 3ECSA 4H7HA 2OQRA 3K09C 2YWCA 3HCBA 3HCRA 2C7QA 3EEYA 4H7KA 4GH5A 1BN6A 1U9IA 2EGUA 3JYOA 3LUPA 4HRVA 2A9FA 4F3NA 4PO9A 3S2GA 1WULS 1XEWY 1TUBA 5J4YA 4BLRA 4PG5A 3KSDO 2QAIA 3H2JA 4U00A 3TKYA 3UXMA 2VZ0A 4IF4A 4FGZA 4YUVA 3WWYA 1XTRA 2X7JA 1NWCA 2QNIA 3K0EA 1UP7A 2HCJB 3BIWA 3IR6A 2I7DA 5ALYA 5FA5A 3WBBA 4AF8A 2Y0EA 4BL5A 3P27A 1QYIA 5JLAA 2GO7A 4K1LA 4KAFA 4NKRA 3S81A 5LP6A 3WRYC 3ANLA 4FT2A 4CLRA 1ABFA 1G4UR 5DP1A 3GNTA 3A6ZA 1LNQA 1KVTA 4NZMA 1EGHA 2Y71A 4WBNA 5EHGA 5TXGA 4OGLA 4CUKA 2CNDA 4KL8S 1AK1A 5IAOA 2GHQA 3ZHUA 4A2QA 4D80A 1IG0A 2R5WA 3C7CB 1ADJA 3AYXB 2N9UA 2ZSEA 5JRJA 3HWSA 4D4LA 3C1AA 5E7JA 1PV1A 1N2HA 2QNBA 3I1JA 1JT9A 4KH1A 4UQOA 5CLFA 2HCTA 4FHZA 2XIQA 3VKWA 5IHPA 1ADYA 5D86A 1SOUA 3GHHA 4FS8A 4IDHA 3GRYA 1PJRA 1P5RA 1AF4A 1FS5A 4GF5A 2OSBA 2ADOA 2VP3A 5JI2E 2E87A 2NP6A 2BHTA 3AHFA 3ZWWA 4AYXA 1TM5E 2HT1A 1FMTA 1C81A 4YLGA 2A86A 3IEXA 1ZEMA 4KAAA 4LZZA 3OZ7A 2QW1A 4BJ5A 3RK4A 4DV7B 4KPEC 1IL0A 1FDTA 4D46A 2VYCA 2V9PA 2W2QA 3LO5A 3NUQA 3EULA 1WXHA 4W82A 1FF9A 5DHQA 3R3JA 1CY1A 3RREA 1PRYA 4JL5A 1CNFA 1GCGA 1L5SA 2BGKA 3LVRE 2W6JD 1CJBA 4PLHA 2G9UA 4BO1A 4TTQA 1VLQA 1KAGA 4H3SA 3O3CA 3S68A 2C4MA 4WD3A 5B5SA 1XJ0A 3IP1A 1XTVA 4J4TA 3CRMA 3HVRA 5IH7A 4XVCA 3FYTA 3BTSA 1BE1A 4L5IA 1HEUA 1KAOA 3F6PA 5AVTA 4KPGA 3FI0A 1SR8A 1IRXA 3BCRA 1ZCJA 2JAXA 3K09A 3L6EA 3HA2A 4JDPA 4Z3KA 1XYYA 1XALA 1XXHE 2R8BA 1MPXA 3MEQA 3NANA 4XUEA 1Y8QA 3AESB 4Y18A 3L1HA 4PHTA 3E6AA 4HAUA 4CIBA 1RRVA 1JWBB 1WCYA 3F96A 3NETA 1NVBA 5JZVA 1U4OA 1NJ8A 3K92A 2PS0A 2X7XA 3B2EA 4GQBA 1NONA 3L7IA 2QTWB 2W8BA 3FMIA 4GOND 2JK0A 1FSGA 2BZ0A 1G7CA 1I2DA 2ET6A 3BMCA 4M1QA 4Z4HA 4R0VA 5D5QA 3MCUA 3WRYA 3VV3A 4DBLC 1W2GA 2BC9A 4S0XA 5BRAA 1KDYA 3LNCA 3ROGA 1FLVA 1QZ3A 3PXCX 4Y67A 2JFYA 3L5OA 4GMGA 3WLPA 5J2UF 3P4YA 2IPLA 1LBSA 1KMHB 4FFOA 1BHO1 5FDFA 3KT3A 3AI2A 3TM4A 2R7KA 5H3CA 4DZTA 5DGTA 4F6RB 4PN3A 3UXHA 2B4AA 5G0UA 4BAZA 3HP1A 4CV0A 4RA6A 4L5BA 3TJMA 4QGAA 3WMXA 3LV8A 4YP9A 4DV3B 1OE0A 1Z3CA 1J21A 2FFRA 1IBKB 3BS4A 4YA6A 1UOPA 1ESZA 3RRNA 3DOCA 1EA5A 1DIOB 1GSHA 3OIUA 4AYWA 1JWAB 2FU5C 1OXBB 2Q6OA 1KYVA 4D41A 1DBWA 2FPOA 5H8WA 5F1KA 1H93A 3M3HA 3LGSA 4PC7A 1ZWLA 2IRWA 2Y2UA 1DUSA 1ZG3A 1IOWA 4DY6A 1R7RA 1SBHA 2E1PA 4LOIA 3NB0A 4Y7CA 2H4HA 3FBGA 4PFSA 4EMTA 2TMDA 4Q1VA 3QFTA 1E5DA 4FKMA 4D3DA 3DB1A 4FB4A 4LDRA 4S1NA 1RIIA 2K5UA 2PXAA 1QYDA 2M6LA 3DR5A 4G0YA 5BR4A 3AM3A 2O8DB 3KZMA 2A94A 3W8EA 1IM2A 5C3MA 1NW6A 1Y3HA 2FYTA 3SR4A 2RI1A 1G6KA 3KT0A 4XSGA 1OXMA 4L4XA 5HIMA 3LQRA 3C3YA 5C35A 1ORDA 1DEAA 2Q50A 4YJ3B 1LZLA 2PNFA 4HR7A 2YUTA 2JGDA 3KT8A 5CX1A 1D2AA 2I55A 4B81A 3IPYA 5ALSA 3A70A 3BQNB 4R01A 3LCVB 4NU5A 5AKLA 1R12A 4ZAWA 4EVSA 4YMHA 3L7OA 2ZWIA 4HTFB 2PL1A 1IBSA 4PPGA 3KR0A 1GYPA 3D7RA 4HQKA 4LI0A 4KQXA 1HZZC 1W8IA 4P0QB 4HDOB 5KYYA 1XDWA 3COYA 2ZRDA 3OEHD 1SQ0A 1U5CA 3LYHA 4F4DA 3KE9A 3MJHA 1LRJA 3Q85A 3WYCA 1LLFA 3RWOA 2BGTA 3ABIA 2OV1A 2FN9A 4I4IA 4PQGA 1V48A 2P68A 1J0XO 3MMNA 3MJDA 4TUYA 1JYSA 1VJ1A 4W6QA 4F86A 2CLOB 1UR5A 4C4AA 4N5NA 4YONB 1OHHD 4I4NA 2WWIA 3FKSD 1U7ZA 4Q01A 1EG7A 1QP0A 2WJIA 1RKBA 4WN3A 1SHKA 1YI8A 5F5NA 1CERA 4EJ2A 3MWEA 3UK6A 1YDEA 5F77A 3EUWA 4O29A 1WM1A 3O8LA 4L1KA 1HYHA 1R0WA 1Y98A 3A6KA 4QYMA 4YK7A 3TL3A 4F92B 3JQRA 4E1VA 1WTAA 4X71A 1IE3A 1T0HB 3RCBA 1UJ4A 2TRSB 2OYSA 4P5PA 5JD5A 3E7FA 5CVUA 2J9ZB 3KTFA 4OMUA 2ZSUA 5FEUA 1OMOA 3A31A 3RV4A 4BP8A 4V38A 4BVKA 2FWAA 5D85A 4LJYA 2IYEA 1ZP6A 1M66A 4DIFA 1LDYA 2AMJA 1G20B 1NBEA 3ONFA 3CPEA 3H2YA 4S24A 4HDMB 1GG2A 4R1OA 5A02A 2RKBA 1X9HA 3IIEA 4ITVA 1RU3A 1K6IA 1KL7A 4E21A 4M9RA 4BUZA 2BDUA 2QTRA 4KYVA 3N39C 2KLBA 4EVIA 3C8HA 4HGPA 3ACCA 2RHMA 2RGXA 1U31A 4MW0A 1KI2A 2VSXA 4GMHA 2AOTA 3OOSA 4RPCA 1QHXA 1LSSA 5C1PA 1BDJA 3AEKB 3V8QA 1JFSA 1J8VA 1QOZA 3ICQB 3JYHA 2EX0A 3WIOA 2VF4X 3KCQA 4Q4CA 3CZMA 1WVGA 2QA5A 2IKQA 1P4SA 3DKVA 1IZYA 3EWAA 4HNGA 4TT3D 1QO0D 4WZ6A 4ZEXA 2F17A 1KY4A 3D6UA 4NU0A 4YCSA 2PMFA 1M1YE 4FPXA 2XZLA 2PD6A 5KPDA 4LXYA 4A1FA 2R1VB 1X1EA 4EFKA 4Q6WA 1H2YA 1AQYA 2ID8A 3QUTA 1YRLA