2OGWA

Structure of abc type zinc transporter from e. coli
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
282
structure length
260
Chain Sequence
b'AVVASLKPVGFIASAIADGVTETEVLLPDGASEHDYSLRPSDVKRLQNADLVVWVGPEMEAFMQKPVSKLPGAKQVTIAQLEDVKPLLMKDFNMHLWLSPEIARATAVAIHGKLVELMPQSRAKLDANLKDFEAQLASTETQVGNELAPLKGKGYFVFHDAYGYFEKQFGLTPLGHFTVNPEIQPGAQRLHEIRTQLVEQKATCVFAEPQFRPAVVESVARGTSVRMGTLDPLGTNIKLGKTSYSEFLSQLANQYASCLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords High-affinity zinc uptake system protein znuA precursor
publication title Structural Analysis of ABC-family Periplasmic Zinc Binding Protein Provides New Insights Into Mechanism of Ligand Uptake and Release
pubmed doi rcsb
molecule tags Transport protein
total genus 88
structure length 260
sequence length 282
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01297 ZnuA Zinc-uptake complex component A periplasmic
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 2ogwA01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 2ogwA02
2XY4A 4MO9A 2WHYA 1N4DA 5KOJA 3AEUB 1M1YA 3PDIB 5GGXA 4WNAA 4TKVA 4M7OA 1QH8B 3CX3A 1TOAA 5M29A 4HMPA 1K7SN 5HDQA 1EFDN 4DBLE 3TLKA 3AEUA 1N4AA 5JG7A 3PDIA 5BVGB 1XVLA 4OVKA 4ND8A 5KOHA 3HH8A 2R79A 4HMQA 2MINB 3ZK8A 3ZK9A 1QH1B 1G21A 5BVGA 4FKMA 3LHSA 3PSAA 5BVHA 5I4KA 3ZKAA 4OXQA 4UDNA 2MINA 5M34A 2XUZA 4UTPA 1QH1A 1ESZA 2O1EA 2Q8PA 4G07A 2AFHB 2PS9A 5JPDA 2M6LA 4HMOA 1M34B 4PAGA 3AEQB 4WZBB 3EIXA 3U7QB 1KAEA 2AFHA 2XDQB 3MWFA 4FNAA 1M34A 5B58T 1QH8A 2OV3A 3AEQA 4WZBA 5M2QA 1N2ZA 4H0FA 4WN9B 3U7QA 1MIOB 4B8YA 5HX7A 1K2VN 1QGUB 2XDQA 2X4LA 3AEKB 4WN9A 2AFIB 1MIOA 5JJ5A 1H1LB 1QGUA 3MFQA 4G09A 5JOQA 4GICA 2M6KA 4FILA 2PHZA 2OSVA 2OV1A 2PRSA 2RG7A 4XPIB 5KHLB 4INPA 1KAHA 4IRMA 3R5TA 3NU1A 3BE6A 1H1LA 2ETVA 4WESB 2OGWA 2R7AA 4UTOA 3AETB 4BBPA 4K3VA 4XPIA 5M3BA 4N01A 3ZK7A 3GI1A 3G9QA 4OXRA 3TNYA 4WESA 3ZTTA 2XQVA 2YNMC 3HXPA 5CR9A 3AETA 3LI2A 1K75A 1L5HB 3R5SA 5KOJB 1PQ4A 1M1YB 4MDYA 1N2CB 4FI3F 2XV1A 3AERB 4NNOA 1KARA 3HJTA 4CL2A 1L5HA 1M1NB 3AESB 3PSHA 3UJPA 2PS0A 2WI8A 1N2CA 4ND8B 3TEFA 4MX8A 5KOHB 3AERA 3AEKA 5FLYA 2AFIA 5GGYA 4NNPA 2XH8A 1G20B 1M1NA 3AESA 3BE5A 4H59A 4INOA 1G21B 5CX1B 3K1AB 3MWGA 2Q8QA 3MINB 4LJSA 5BVHB 1K0FA 4HN9A 4WZAB 1FP4B 2PS3A 1G20A 4TKUB 4LS3A 5CX1A 3K1AA 3MD9A 4UDOA 5AFSA 3MINA 4MLZA 4WZAA 2QI9F 4PM4A 1FP4A 1PSZA 2YNMD 4TKVB 4TKUA 4WNAB 3EIWA
chains in the Genus database with same CATH superfamily
4S2UA 1HMYA 1M8KA 3WMFA 3QYAA 3ZE7A 1R50A 4LA4A 2WM3A 3UUGA 3C24A 4W5QA 1WB4A 3WJ7A 3RVDA 2HJVA 1FLDA 1DC4A 2A5LA 2MOKA 3R0IA 3VGJA 5DM60 4ZHQF 3ZJVA 5GJBA 2JLXA 1YR1A 2FCAA 4HK4A 3F4KA 1UQUA 1EZZA 2YH2A 3OKPA 1BCSA 1XD2B 4Y6LA 2G8LA 2ZRHA 5CT9A 3PE3A 4YCDA 3FKJA 3S8YA 3BMQB 5JQGF 2NQ8A 3EDRA 2WZDA 4LJ4A 4J0DA 1Y9DA 3AZQA 4QZVA 1QQ6A 4B6EA 5KB3A 2A0WA 2C61A 1MEOA 4RD3A 2QGNA 4WKPA 4H6WA 3V1UA 4KQ9A 2GXSA 2ZYRA 1UPCA 1LNSA 4Q4DA 4XYEA 4ZHQA 2EYUA 3BWDD 2CZQA 4JZKA 3C97A 3LLMA 3ZX5A 3Q8MA 2JJ2A 1O6GA 2P2GA 5D1NA 2PGJA 4U7HA 2H1IA 1DQNA 4IS3A 2F3PA 2HXGA 5EESA 3DBLA 4CL0A 8LDHA 2QAIA 4LYEA 5JQGA 4E14A 1NMQA 4ZZ1A 1MVOA 4JBWA 3FKSD 2TMDA 5THKA 2I6GA 4RF5A 2AN5A 2CBXA 4XVRA 1NBME 4L75A 2VPTA 4XB2A 3T35A 3RGGA 2FX3A 1GA6A 2TYSB 2W93A 4MKXA 3DS8A 4YNBA 2I22A 4AZWA 2B21A 1YWGO 1QTNA 3C5EA 4Y6GB 1RJ9A 1OE0A 3NHPA 1X1RA 4WNIA 4JDUA 1IHXA 1QVWA 3FOAA 3DUFA 4OHOA 2A0XA 4UBKA 4U7JA 4ENWA 3UK1A 4EF6A 3O93A 4FHEA 5DNEA 4LNAA 4RMHA 3CRRA 3OIYA 4IMJB 4AJLA 4BCBA 3BVPA 3EVAA 1EBFA 1MX9A 2G1AA 4KDRA 2ICAA 3QOXA 2H1VA 1P7WA 2J9YB 2TMYA 5DN6D 2YUIA 1NTRA 1W2GA 1FFHA 2W5UA 1QVVA 5TQVA 2J4CA 3L7YA 3PNYA 3HXPA 1EQ2A 2RCYA 1RYNA 2YIDA 4R2HA 3EQ8A 1GQQA 1PGQA 4ZKDA 5ICEA 5DM2A 3PFBA 1MABA 3NTXA 1BE8A 4DJJA 1I0ZA 4QNMA 1C3OB 4JB8A 4AYTA 5D3ZA 3TTVA 1LBIA 2NADA 3K16A 3R5KA 2X9LA 4ZI5A 3GG2A 3U3ZA 5AWFC 3WLLA 4UUQA 3J81A 4KLAA 2HX1A 3S2FA 5JW6A 2XCQA 3FI9A 4UJ5A 3TEFA 1RPNA 2G7MC 3FKSA 3NEJA 3D6HA 3R9WA 1AGXA 4U6NA 2JAOA 3DXYA 1SPBS 2O8DA 3BSFA 1W19A 2FI1A 4U0KA 1F4PA 2X4GA 1WHSA 3IVCA 1N7HA 2FEMA 3Q3EA 4BNUA 1ODFA 1T9HA 3DCJA 3MINB 4PLWA 4HUJA 1NVWQ 2OMEA 1XTKA 2YFHA 4J4HA 3F7MA 3JVUA 1N9GB 5J2TB 4HAXA 1MIHA 2RBKA 2VT6A 2DG2A 3IT0A 2Z8XA 2ZIAA 3M3HA 4IZ6A 3KYDA 4O2RA 1X1BA 1I5OA 3AKZA 3MB8A 2MYNA 4R5MA 2WQ6A 2BVNA 2BKEA 1E3WB 1QM5A 2YZGA 3ABQB 3L0BA 4NFSA 3TQOA 4YMUA 1Z9BA 2ODAA 3CBQA 3GUYA 3DO6A 1XTBA 5ECYA 1MB0A 4Q03A 1NQOA 3NNDA 5DPMA 4N6NA 5HQTA 1W5SA 4XTCS 5A4DA 4A1OA 1E99A 2W00A 2V8BA 3EQ6A 5FAXA 1IJEA 2O5RA 3RRNA 2CE7A 3LYLA 4KDEA 4M87A 2QUHA 5F51A 2VDKB 5DN6A 4AXXA 1BKDR 3J7TA 5BORA 2HH9A 3MJSA 2BKXA 1CQIB 4E15A 1YJXA 4CI0B 3SZUA 5LMUB 4B6PA 3GARA 3H2HA 1OUMA 4ZO9A 5I9IA 5AW8A 4HS9A 1G8GA 1ZGBA 1A9QA 1A9XB 4V02A 3B82A 3H9QA 4EF5A 1I8TA 3JVEA 2RJOA 2CXUA 2QU7A 4UU8A 1UZLA 2C88A 1JMKC 1YQEA 4YA6A 4A91A 3OQMA 2MSNA 4FMPA 1KJQA 3QEKA 1LLDA 5JD5A 4XIFA 1G7SA 4E2WA 5F23A 2O3QA 1UMDA 4YYEA 1JHUA 2AE2A 5A4JA 2JZCA 3GGOA 3ILVA 3RG8A 2PZ8A 1T0JB 4DA8A 2I2FA 2FJ0A 3EF0A 4HGZA 1ISPA 4ECEA 5KVAA 4I4NA 1QVRA 3DC2A 3KUXA 2A5JA 2H1WA 3GMTA 3RB8A 2XXJA 1XZJA 4Q4CA 1P1HA 3DKIA 3BJRA 2WHPA 5DOZA 5C2JB 1C1HA 1T2NA 5LDDC 4CYMA 1TLFA 5HZHA 1YVPA 3Q3IA 1B1AA 2AQKA 1N2CE 2EG5A 2IJGX 1PGJA 2PVPA 4ZVRA 4HGQA 3VH2A 2OV3A 3VNUA 4K40A 4EF4A 4PTYA 1KBOA 4IO0A 3FWZA 4UXIA 5IAGA 3E0QA 4C78A 5K0ZA 3FPCA 1UDXA 2IOFK 2DFLA 3V8VA 1H0HA 1T8SA 4Z0TA 5F9FA 1C2YA 4Z4QA 4PYNA 1XRJA 4UTXA 1T6XA 2A5DA 4Q18A 4K9LA 5KTSA 4UVGA 1ZDMA 3LXXA 3R6GA 4QU9A 3IQHX 1DJLA 4RETA 5LD2C 5IMBA 4L8LA 4PU0A 1TU4A 3QXJA 5ALSA 1E63A 1QHGA 2CDBA 4OUKX 4PONA 3ML1A 4M1ZA 4QXAA 1JPNA 4BFLA 1SC9A 4F4HA 1NRWA 1B0PA 5IX8A 1V6CA 2I62A 3SZLA 3NDJA 1P7ZA 4KG7A 4IG9A 2CW5A 3OY7A 3IQZA 2B69A 1I3KA 1ATIA 2PKQO 2CLDX 4WKNA 3UY4A 1RXWA 1L0BA 1PTJA 4BNNA 3IV9A 1QLJA 1Z0ZA 1UDRA 3E53A 1K75A 2RSLA 4RFSB 4DDTA 2A4MA 3RF6A 4MS3A 1PFYA 4FWBA 2QP3A 4AP6A 2L0XA 4M1YA 2IYVA 1NYTA 1ADJA 1QWSA 2GGSA 3HACA 1UKEA 3I9LA 2QVBA 3BF7A 3GLUA 5FRDA 5D7NA 2L69A 1LU9A 1A2QA 1KU0A 3LWZA 4EVQA 5IPFA 1IBLB 3QVVA 5CXUA 5C5IA 1NYRA 2IY9A 3TUJC 3E22B 4K2HA 4E13A 1CRZA 3LT4A 5EHQA 1XMQB 5CLFA 1TD1A 3AIIA 3CNHA 3N74A 3W4KA 3J80A 2CSXA 2ZS9A 3VZPA 3IEIA 1T8PA 4M0FA 1LK7A 4QVGA 1SXJB 2WU3A 3DP9A 4O4JF 1P9OA 3AU8A 4DV6B 4BKOA 5DYGA 1Q0ZA 4N5NA 2QRHA 2I99A 3LBFA 4V2IA 5JSQA 1C0KA 1O1YA 5CJJA 3HBNA 5FA5A 2O14A 2HUNA 4ZPJA 4OFXA 4NMMA 1GSAA 3NNSA 1IM2A 2CZCA 2H1RA 1Z4JA 3IPYA 4LGMA 5BSKA 3COWA 2FSHA 2Z1MA 2RGYA 4D8XA 1PV1A 4AJOA 2OBYA 3KKEA 3TSCA 3DBHB 3UAZA 2D06A 5KTNA 5BT9A 2LZ0A 3PRKE 4YR7A 2Z4TA 1E0KA 2F3TA 5JR3A 5K8IA 4BVHA 4O4JA 1U2TA 2ZRQA 4NBVA 1OX5A 1R0WA 3K9GA 4DOMA 4YAIA 2CMDA 4TQ9A 2ZOSA 2J9GA 4RKEA 2DUUA 4G24A 3QE0A 5CEEA 3OMXA 3U3XA 1V1MB 2E5WA 4QTXA 4RVGA 2Q0XA 4L1KA 4BLUA 5JWOA 4C1NA 2W58A 3OTGA 1RD4A 3LW8A 1X7ZA 4CLEA 4EQ6A 5TPWB 5AK5A 1RE1A 1ZXBA 2WPDD 3PSAA 1T4GA 1PFWA 4L8GA 4OMUA 1SC3A 2GO1A 3JWIA 5EE9A 4ZIRA 3L0OA 3W2HA 5KOIA 4C2UA 1VJGA 3NJ4A 4CGZA 3PWZA 4RTRA 1MF7A 1JBKA 2OBFA 3M6WA 4HBGA 3PXGA 3ANNA 4WX2B 3E9EA 3ZCVA 2QV0A 4US0R 1AGRA 2I2WA 4HB4A 4ARSA 5JC1A 5LQDA 4FLMA 1BE0A 2FSIA 4X65B 2CXTA 2PX6A 5IBPA 3Q2KA 3IAS6 2VWGA 4CFSA 5IJWA 5AM3A 1W0JA 1DXOA 3NOQA 3PC8A 4HDKA 1MAWA 3OIGA 3AC0A 1CERA 4Q24A 1U0SY 2CWWA 3LBHA 1OLXB 1BFKA 3MN1A 4DHEA 1XALA 3K9NA 4I4CA 4OK6A 1MB4A 1XL1A 3CLSC 4IX1A 1US8B 2BTOA 3L8GA 4I4LA 3ZX4A 1M10A 3ITNA 4XJSA 4YQFA 4PO3X 4MV8A 1FQKA 2RHGB 1V1RA 1K08A 3N2YA 4FZ3A 1TC1A 1JR4A 2NVUA 1E79D 2VJLA 3LD9A 4C0AC 1P4JA 3AEYA 1QHHA 2IP2A 1EDDA 1T1GA 2PYZA 1TYCA 4GICA 2VH1A 2OXFA 3N8GA 4R9RA 2HJRA 4FUQA 3D4BA 3DM5A 5BQOA 1INLA 1XOIA 2JLCA 2ZJZA 3WTCA 1FYDA 1KSHA 1JAZA 1Q44A 2GM5A 3AI7A 3U17A 4KP7A 4H15A 2LBPA 4TKMA 1B7GO 1YSCA 2VSYA 2YR0A 2XUDA 4TROA 2FQ1A 4DXAA 4P3YA 4L7VA 4N12A 5EXEA 2DWCA 2V0NA 2WPDA 4N3BA 4X20A 3MS2A 4UAJA 3G1UA 1KXZA 5A5VA 3TSAA 1N2JA 1FOEB 3SC3A 5KNLA 2B3DA 3S5JA 5D1HA 1J09A 3GFGA 1JKJB 5AK3A 3SJUA 2GZSA 1LJUA 1P44A 1JEQA 2AX4A 1OTHA 2HCTA 3AV0B 4GXNA 4ND7A 3TG2A 4FCTA 2RHLA 1E6UA 1IATA 4RJJA 4AIIA 4RENA 3CLKA 1KJIA 2FXIA 2XYVA 4YGYA 3EW7A 4DRZA 2REOA 4YRBA 4A73A 4X66B 1ETHA 1JUDA 3R6WA 4PWZA 3TD9A 3KUCA 4EG6A 2H4JA 4AAYA 3H1FA 4BVJA 3DMTA 4MMZB 4QU0A 3WL7A 1GARA 2A5GA 2NW6A 1ZM4A 3NYQA 4AS2A 5BMVB 3I5XA 4UUMA 3PK0A 3KHTA 1NMZA 3OKCA 3WIBA 4QGGA 2XZDA 1OA0A 2FZEA 2PX2A 1BWPA 2GEBA 1NKTA 4C43A 2QP9X 4NC9A 2QV7A 4TPKA 1E79A 4RV9A 1HUQA 4Z9YA 1GTJ1 4PE5B 4BX9A 4EZIA 3RSHA 1CS0A 4LJ9A 3TQIA 3IQFA 3WB1A 4GM1A 2ILVA 3HNPA 3M1LA 4PAWA 4WIAA 2DJ5A 4IOJA 4KR3A 4QRHA 1C1YA 2O23A 3HL0A 4BNYA 2VXCA 1BJRE 5KNDD 1F4LA 5AW4A 2MT9A 5EKDA 1RHRA 5CBKA 2YXEA 3WLNA 2EKZA 3RJMA 3V00A 3U3OA 4ER5A 1G6OA 5C5EA 4L22A 4JLAA 4IDAA 4GU5A 3R7WB 5BN4B 4CBVA 2FUCA 3B1FA 1F60A 4U1RA 5JYCA 2C0QA 3L0IB 4E1AA 4X1IB 3IRVA 1U8AA 1WEKA 2W98A 1Z5ZA 2OHJA 3VVMA 1JJAA 3TBHA 4GPBA 1UMKA 5K6AA 1TK2A 3KL2A 4QGSA 5JADA 4NQRA 3TQRA 2J3HA 4W9RA 3KOZA 1SA0A 2PQ0A 4RX1A 2ZRCA 1RXVA 5IVHA 2O8BB 1KZ9A 2I65A 3ZEIA 1GLVA 3MRTA 3TOCA 1LLQA 1Y34E 4FZRA 4UXJA 1WTAA 4BBZA 3ODGA 3DBOB 1KBQA 4D74A 2IUEA 1NOKA 3U37A 4G01B 3H2BA 3TKAA 4C7MA 2XEXA 5LIPA 4JJZA 3FOFC 3JYPA 5FTMA 3ZZ0A 4YCMA 2E4ZA 5ER6A 2C5LA 1XN4A 4WLEA 4XQGA 2DFDA 3UFXA 4RLFA 1P3JA 4JI7B 5C3UA 5TMDA 3NS7A 2OVFA 2CVQA 4AG6A 1C0EA 2J32A 5F7JA 5CPFA 5BWMA 5KNDA 1R0BA 1AURA 3ZTYA 4J1NA 2AZXA 1Z0AA 2ZUDA 4QLAA 2BLLA 3LZ6A 4JELA 4RZIA 5BWBA 2FRXA 4WNCA 3LP5A 4JJ7A 4OHYA 4IHKA 2GAJA 3EYAA 4ZOCA 1NRXA 3JVDA 4IIUA 4JXJA 3VU9A 4BGUA 3PG5A 4B2YA 1E60A 5NULA 2BWJA 2E85A 3RAPR 1GPKA 1KYIA 4WZZA 3EH2A 2P62A 4RTLA 2OZPA 2ZSEA 2XKJE 2W70A 5DU2A 1OASA 3BRWA 3EGEA 2C2HA 1J8FA 1NONA 2J5KA 2R68A 4ERNA 5AVVA 2WNHA 2GXUA 1GNQA 2A4KA 5A7GA 1EXDA 1QTIA 4QPCA 2JFZA 1TDJA 3T3OA 3I2HA 3KYJB 4OBBA 4BO4A 4DMUB 2OHXA 3AM4A 2DY1A 3Q6MA 3TLXA 2DB3A 3VO9A 4V39A 1N2CB 4KI0A 3LO5A 3NAQA 4HPJB 4Y2HA 1WOYA 4JNCA 5I8PA 2H31A 5BR1A 2CLSA 1PAUA 1Z4OA 1XCPA 3T5AA 2HWXA 4L16A 5LM3A 5K51A 2ZPUA 1A1SA 3LHIA 3TMYA 1DEHA 4P8RA 1RYFA 3GLGA 2YBEA 1O9HA 3HZOA 1NVBA 1JNXX 1GAEO 4J0EA 3I52A 5L6LB 1XYYA 2Y6UA 1T5IA 3MLBA 1N5JA 1QB8A 1CHDA 1GCAA 1BYUA 2ZVJA 3VR4D 1ZNXA 5CH8A 3AV3A 1IIBA 3I2IA 4PSDA 1R0KA 3EK2A 1YDEA 4M1MA 1N2HA 4L8FA 7REQB 5LN1A 1T2FA 4NK4A 2AQIA 4YDRA 1ST2A 2C77A 3N8HA 3PNSA 3N2GA 4XOIA 3ENNA 5KYYA 1CXZA 2QNIA 2BM8A 1KIAA 2V96A 1AA9A 4KPUA 2ZKIA 2C92A 4H18A 1ZSVA 4RIGA 4RJKA 2PFKA 5DM70 3V4RA 2H2DA 5CYOA 3BSYA 2W2QA 3OU7A 3KLNA 5TLSA 1MW8X 2YJ5A 1QBGA 2OP0A 3ZWNA 4EOGA 3PP8A 3NYIA 5BOSA 3A1EA 3AEUB 2F9MA 5CJPA 2C1XA 5CA0B 4E5PA 1WUIS 1EM8B 3FG9A 4H3SA 3U0BA 2O5CA 1EIZA 2OR3A 3FFBA 1L4HA 3TLKA 2WWFA 3IESA 3ASUA 3BA6A 3QFTA 3V1TC 5I51A 3KLOA 1K3UB 3RKRA 3SXUB 2V7TA 4CDGA 4CKCB 1GZSA 3V7NA 2VR1A 1NW9B 2FPIB 1LEHA 3FLMA 1FFYA 3GWZA 1Z8NA 4GYJA 2WF8A 4J43A 4K05A 3TQHA 5EIAA 5EE1A 1XD2A 4GPD1 3G2QA 2Q46A 5K8TA 3OCUA 3QPAA 3QVGB 5BV7A 2PKYX 1CVLA 1M1ZA 2OUIA 1Q14A 4KRGA 3D5TA 3C8DA 1EFRD 2C95A 5JPIA 1PYDA 3KKMA 2VTDA 4KRXA 5CLQA 3QVKA 2JFQA 2CMFA 2G77B 1ULAA 5H59A 1XIVA 1K92A 4IL5A 4GOKA 4M9RA 1W9HA 1XP8A 3HCFA 2ZT7A 2GHIA 2PIDA 4UMFA 4YUVA 2V9ZA 3ZWDA 1QDEA 5KOYA 2QL6A 4C1BA 4Q9DA 2XCRB 4ZQHA 1NI4B 3GWGA 1OZHA 1E3EA 1ODCA 3ETGA 5D6NA 2BMWA 3ZQ4A 1NLZA 1BD3A 2JEZA 4TN1A 3DHNA 2G25A 2Z43A 3PDHA 3ZD7A 1HYEA 5JMTA 1V2HE 4OHXA 2CLEB 1QIDA 3GJSA 2QLBA 2NM0A 3IDOA 2AN3A 5CJ2A 4BVLA 1Q84A 2B6NA 1MRSA 1O95C 2COEA 2C1ZA 2IYZA 1NOJA 3C3AA 1PJLA 3HHPA 3JR7A 3PGA1 4KAJA 1KIMA 1O4WA 1RNLA 1U5BB 3C3KA 5E2AA 5KWIA 2EQAA 1YDFA 4NATA 3BAZA 3JV7A 5EGSA 1UFVA 2VAXA 1DO8A 1O54A 2V7XA 2GNOA 3I6YA 4QIHA 4BNXA 3ZWQA 2QR5A 4OP3A 1AKMA 1IXKA 5CFMA 1WBDA 1JHMA 3GDFA 4BN5A 5LQMA 4NICA 3FYSA 2PYIA 1W52X 4ZP1A 4FE4A 1T9DA 1ZL2A 3EZNA 2V65A 3II6X 2PNFA 3EULA 2QPAA 2ONJA 5C1BA 3CFYA 3GFFA 4K3VA 2DFTA 3UHFA 4OQEA 4H4EA 4EFNA 3ADCA 2ASEA 2K7FA 3K5PA 1VCIA 2AKAB 3TGPA 1EFRA 1RP7A 1Z22A 3WGHA 4ARAA 2IXDA 2BMFA 2WYWA 2KHZA 3DLCA 4WCVA 4BASA 1ZHHA 2DR3A 2SCUB 2G36A 1Y7PA 1WO8A 3HJNA 3VZQA 1MOQA 5C35A 3VV3A 3CZAA 3TB6A 4GOXA 3TLJA 5IBCA 2E9SA 2V3VA 4HDMB 2YQ5A 3L82B 1KKUA 5J2TF 2XDAA 4IHAA 3EVEA 4OHVA 1V3QE 4ZYUA 3WNBA 3GUVA 3CZCA 1ZI6A 1WPXA 1HTBA 3QNUA 4PC1A 3H1TA 2OZKA 3B1XA 2EZ8A 3ESQA 3LA8A 3MWGA 3TR0A 3W9YA 4BB5A 2O54A 1TQ4A 4BV2A 3AR9A 1ZCJA 1PRYA 4P7KA 4DS3A 1FXSA 1B8NA 3MINA 4EPXA 3ZHZA 5T8KA 5J2TA 2HCFA 1UPAA 2CXOA 2FWMX 2X13A 5IP5A 4P92A 2P3SA 2X58A 3DOJA 3ZLUA 5I45A 3QW4B 4PZEA 1X19A 5I3CA 3DOIA 5FADA 5DCLA 2NG1A 3AO0B 2HBRA 2GK7A 4CR6A 4ARCA 3DUWA 5KVQA 5FB3A 4BFWA 1IEXA 1E0SA 1JB1A 3KQOA 2JJQA 3ILXA 1UM9B 2IELA 1IHUA 2PXAA 1CQIA 1HFEL 3NJ8A 1QYDA 4DCOA 3ELYA 1C4OA 1GNVA 1WSAA 3ZDEA 3E15A 1ZVKA 2QR2A 2VF8A 3K3PA 3MQ4A 1RRGA 4MVJH 2GF0A 4HFRA 3W7VA 3WS7A 4JU8A 1VG9B 4UTPA 4HZUA 3EUAA 3CGWA 2F2TA 1MBZA 2FE4A 2Q7OE 3B7WA 3ITKA 1KHTA 4Q4HB 3RS5A 4F2GA 5JC8A 1Y7TA 1YB7A 1ZS9A 3HEBA 4L9WA 5BNFA 3KQSA 4ES6A 5JUWA 1WG8A 2WSBA 4TTVA 3VNBA 3D3KA 3RSOA 2EFGA 2NT4A 2PLFA 3A11A 5DISB 3WGQA 4DQDA 5HKBA 1E59A 4PR3A 3BGVA 2G71A 2D8AA 4CMGA 2EERA 3VC3A 4HB2A 1CZRA 2ERXA 1Z62A 4MRNA 3RYTC 1RPTA 2LP4Y 3M9XA 5ITVA 1RRVA 1CUXA 1RYYA 4EELA 3JQ6A 4JCCA 4A8PA 4MR7B 4YT5A 1QBKC 4XLLA 3NIBA 2FF7A 3OQNA 4Z99A 1XR3A 5TQ2B 2P0EA 3KXKA 1DUIA 4XDYA 3O2JA 2VDVE 4WA7A 1K8RA 4YRNA 2VRWA 5IABA 1X8LA 3CSSA 2R48A 5BNIA 4F04A 2VN8A 3PUWA 4AULA 1Z74A 3ETDA 3D6FA 4M60A 1ID8A 1MB9A 3QITA 1UZAA 1RXSA 2M6KA 1V3UA 1VL2A 2ZSUA 3KQHA 2BGWA 1RHKA 4X54A 1A69A 1RQLA 2VKTA 2YWHA 2O07A 1RYMA 1UBGA 4FHGA 4JX8A 2HBZA 5EQDA 3U4DA 1R5NA 1Q22A 4OYYA 2VHZA 1T3LA 3EOZA 1SN7A 2QTLA 5CLHA 4RADA 5DYYA 3WWDA 3IPRA 3QEMB 1BN6A 1KDPA 2A3RA 1TMOA 1UQTA 2HNBA 3GDOA 2MTBA 3FYCA 4QE3A 2Z6UA 5JS1A 3H1EA 3OF2A 2XQKA 4BE7B 4FD2A 3OA2A 5D01A 5KOJB 4HYQA 4BNIA 2C3UA 2OUKA 3UXMA 1P0IA 4M0LA 1NN5A 3OM0A 1VCNA 4RFSA 1VL6A 4QSMA 1Z2EA 1FXWF 10MHA 2ID4A 4M0UA 3PUVA 1E3QA 4PNPA 4AK9A 1AIPA 4S24A 4TL7A 4D0NA 1L5QA 2MSLA 4IKPA 2AFIA 2OV4A 4JZYA 1T29A 2I6SA 5ALIA 3VDMA 1A5AB 3IR6A 3A3NA 3O1JC 1THTA 1ZNQO 4LTMA 1KFBB 1EG7A 4CCSA 1VI2A 2OQRA 3P0JA 2FSPA 3B1WA 4PCLA 2Z5FA 2PA0A 1DBPA 2C42A 1U9IA 5H3LA 3FOZA 2UUAB 2C9YA 1GUBA 1SXJA 3D1VA 1CUEA 4URWR 3L4BC 2C4KA 4P32A 4OJNA 2VLBA 4J7CA 3CGGA 3A4TA 4FB4A 1E8DA 2ZRJA 1IN6A 3D5QA 4UEOA 4TLMB 3C3BA 4LMBA 2I3BA 1U4NA 3F5DA 1ZIXA 4ZV9A 1BFUA 3R7AA 3ROTA 2D0IA 4B75A 3CVWA 5FOUA 1U1GA 4ID9A 4R8VA 3CW2A 2B99A 5CU7A 1URPA 3UC9A 5AKGA 1HXHA 1I3LA 1Q77A 1N0UA 3P2KA 3DBHA 3X1KA 3T5PA 1JTEA 2YXLA 1E20A 3NV7A 4FHDA 1Q15A 3WGMA 3I64A 3ZU6A 4E5SA 1ECBA 1WMFA 2PSFA 2VH5R 4J16A 4TSFA 1PL0A 1EGMB 5JXIA 1IUNA 3OU2A 1QH1B 4Q1CA 3T7RA 3F96A 4I1IA 2ERCA 3BL5A 2O2DA 3K0CA 2Q5CA 4D0GA 5CEFA 3TKYA 3R0QA 1GPH1 2VZ8A 2BLNA 3BRQA 3PI7A 3VHLB 1KK1A 3DMRA 4YCLA 4C4YA 5E6RB 3HXMA 1GPWB 4U00A 3RHZA 2M6LA 2FG6C 3V1MA 1T1RA 2QUAA 3E2IA 3OO1A 5AW0A 1P7YA 4MW7A 4NS1A 4MGYR 5FIUA 3V4ZA 1ZW1A 2IEDA 4G0MA 1ATZA 3U7QB 5L3SA 1KAEA 3OQ1A 3CKMA 4OLFA 2F3UA 3TQTA 4D45A 2BRUC 5E7QA 5J4VA 1JXOA 1NBMD 1XZKA 2P27A 4KN8A 2FLVA 3A58B 5ES4B 4X7MA 1DKNA 2X8WA 4GT1A 1ZH6A 4JKYA 4E7OA 1RCTE 3OBIA 3SYTA 4B33A 3D8BA 1N0WA 9ATCA 1WXDA 4KBGA 1SHLA 1GPYA 3OUUA 1TQHA 3E8XA 5EMMA 3FYTA 1YGPA 4PYOA 3W9BA 1P1FA 1FFWA 5B4UA 3F0TA 4G0OA 4URHA 3ZBPA 1HYHA 1JSRA 1OLXA 1SCKA 3AL3A 2GN6A 3BDIA 4IDOA 4IR7A 4TRNA 5A9SB 1G21E 1US8A 3AVXA 3LY9A 1D6NA 2WNSA 1BX1A 1VLLA 3R6DA 4HLDA 2PUDA 1DAGA 3HKEB 1KPHA 4QBHA 5FX2A 1KS2A 1DBWA 1THZA 3QUQA 4JS0A 5DM1A 4NESA 1OB2A 4CIDA 3RC9A 3ZQ6A 3GMDA 2JKYA 2K7ZA 4BL5A 1X1QA 5JWRA 3X1JA 3WK7A 3P9ZA 1MX5A 3M81A 3PUXA 1I2ZA 2VSNA 3LBYA 4IMRA 2QD1A 3FN4A 1JX6A 4EL0A 4HYEA 1TAHA 4FS8A 1KKLA 2YXDA 5DASA 2IYFA 5BMVF 2DRIA 3ENVA 2B1GA 2UUCB 4JQSA 1I32A 3ZDRA 4PGFA 2PMWB 1NP3A 5CW1A 3VSDA 4A7PA 3PC7A 4CF7A 1JKJA 3CUVA 4Z4EA 3E4CA 1AC5A 3PJGA 4I1SA 1NBMA 5FOXA 3M4NA 3BM5A 2D7JA 4L4RA 1ZQ1A 2EF1A 3AJEA 3ZCQA 3I12A 4RXTA 3TH5A 4MICA 3OG9A 4CMBA 1YBHA 2GJ9A 4F5ZA 5DBEX 3UT5B 4CQJA 4WBXC 3E5NA 5JNSA 3VU1A 3VA7A 2VZLA 1UBSB 2WV7A 5BMVA 4BWVA 3KAKA 3SYLA 1A5TA 4KN6A 4S05A 1CIVA 5CGQB 2XI4A 3FSRA 4V0OA 3RW9A 2FF5A 5L7TA 3LRTA 3F8SA 1G7CA 3KAQA 4PM4A 3TNJA 4C4OA 4BKMA 4KMMA 3AF6A 1DRVA 2AQHA 3GLFE 3T1VA 2GHTA 1BQEA 1GRCA 4ZVLA 3SJZA 3T0IA 3WQQA 4NABA 4D6YA 3R8CA 3WLKX 1J0BA 1GTMA 3FGNA 4V38A 1YQ9A 3O21A 3TMAA 3LLVA 3HZHA 3TEJA 1O8CA 3NI2A 5HDQA 2VATA 5BV0A 3KYIB 5F1YA 3WKBA 1X94A 3HXKA 2ZS7A 2I1VB 5JJBA 2ATIA 4I6EA 5KTYA 4LX8A 1QTQA 3LPAA 5EZ6B 2IX9A 3WYFA 1UAGA 3K9WA 1O9GA 3R7WA 5BN4A 1FRNA 4Z51A 4E1VA 2VJDA 2SKEA 3E9YA 3NTRA 1WD7A 2J0QA 3UC5A 4TV9B 4X1IA 5K0GA 1WD5A 1ZGZA 1ZO8A 2DUNA 3MS7A 2HEGA 4D8VA 2NSHA 2P69A 2XMPA 3V7UA 2H4FA 1V71A 2HMAA 2XODA 3HWWA 4RUKA 4R4JA 5FPSA 4IHJB 4M21A 5JBQA 4NRDA 4QA9A 3NYRA 3W79A 1L5YA 5HVNA 5CDHA 4WY5A 2CT8A 5JS2A 2EX0A 3HVKA 2YZKA 3LMKA 4UHJA 1WB5A 4XZ3A 3F74A 1WHTB 1G8SA 3UGQA 4YMVA 3KSUA 5K3AA 3E2PA 3N87A 1DIRA 5BXQC 5JH7B 1DKPA 1EVIA 2JHPA 1HKHA 5IEBA 3Q7PA 3DDUA 2WG2A 4LECA 1H3NA 1S8NA 1U0HC 4H0FA 2NUAB 4KTTE 4Q19A 5CURA 1GQFA 1NUSA 2D5LA 3VNSA 1PJBA 2SECE 2QM8A 1Z8HA 4F97A 1G4AE 2BGJA 2XTJA 2I4NA 1XJ5A 4QM6A 1VL8A 1YNOA 2CUZA 3CJQA 3IT1A 4L28A 4UDXX 1X1DA 4OATA 3MG9A 1CUWA 1G20E 4DSUA 2ZLBA 2L82A 1H1LB 3BFKA 3PLNA 3IVRA 4HZGA 2ZIUB 1ACLA 5H02A 2QMEA 4RNDB 4X64B 3DKKA 2XBMA 1HURA 1I4TD 1RWWA 1C0LA 5EHNA 3F6CA 3AVVA 1TVCA 1YC2A 2VP9A 1PFGA 3UF0A 1DEXA 2PRKA 3IIKA 1VL5A 1RCFA 3E05A 1P33A 2EL9A 2RHRA 3CRQA 5FORA 4BQSA 3FJ1A 4PNEA 4MI9A 3D81A 3WR5A 2GZDA 3TJZA 1Y8QB 2WD9A 1LFDB 4BBJA 1DKQA 4AN0A 2ZUFA 3MSCA 2IEYA 1B42A 2CCGA 2ZJBA 3RRJA 1L7NA 1PT7A 2XQVA 4WXEA 3B3JA 2HW8A 3LI2A 4E07A 1NXOA 1CY8A 4G63A 4F3RA 2VXYA 1E4YA 1PQ4A 3ZGNA 4I1RA 3G0DA 1WXFA 3IP5A 2EIXA 3L8FA 1RDFA 5DHFA 3K09A 3HDTA 4IIXA 3MWLA 4PRLA 2FWAA 1PT6A 3BKWA 3ID6C 1AGPA 4J9VA 4DBZA 1ULZA 1SMKA 3ROKA 1VMKA 1DB3A 2FX2A 2OGUA 3LC7O 4JVNA 1N2CA 1UP7A 5G3ZA 5LZ9A 3U5TA 3V4SA 3QA9A 3PL5A 4DUYB 4FFPA 5I47A 3UG7A 2IHUA 1F8YA 1WXQA 3FMPB 2G4CA 1MGOA 2EZ9A 4B3TB 2GQ0A 1NHWA 4OHWA 4J0HA 3U1VA 2FW0A 4US2R 3E3OA 1K86A 3CEJA 3QF7A 2AZMA 2Z5GA 3RROA 5CA0F 3INGA 1GU0A 1XTZA 1VKRA 3GGDA 3WYNA 4BGEA 4AI6A 1IOWA 1E3JA 2C57A 1U81A 2ST1A 2OXCA 3WLTA 3DEZA 2ZE8A 1VCHA 3O8DA 1T9GS 3FB4A 1CS4C 2OKCA 3PPWA 3H17A 5B58C 5TGZA 4FOLA 2NXEA 4LSWA 1BXGB 2WHYA 4KWHA 1M74A 3OZTA 2M32A 3TCNA 3C1OA 2NVBA 3C7AA 3OP1A 4O1IA 5JAPA 3QLEA 1XMOB 1B8PA 1MR3F 3EFBA 3JQCA 4CM6A 2I66A 3EHDA 2ZYUX 3AEUA 1CR1A 1M66A 4IPTA 4LOHA 2GUWA 2VL7A 4Z9FA 2QQGA 5CA0A 3WL8A 5KHOC 1EM8A 1T4CB 1WMAA 1WUJS 4JH0A 4O8ZA 3W2GA 2F62A 5AVQA 2FMTA 3LU1A 1VYVA 2QSYA 4UFNA 3SXUA 3GAMA 4CKCA 1VJCA 3BXXA 4US1R 5CNKA 5C0OE 4OJQA 3IRUA 1D7OA 2B20A 1Q1AA 4EKGA 1JIXA 1RLOA 3I01M 4HLUC 5L4LA 3TLEA 2FETA 2R8ZA 4NBKA 1PV2A 3VYVA 3DEAA 1R9MA 3FMFA 5DYIA 4AP5A 4PG8A 3OPMA 1OH8A 2DWQA 5E3JA 3UPUA 2FP4B 4QNRA 1RHMA 3QVGA 1TAQA 1A9TA 1S7CA 4MRMB 1NC3A 3WRYA 4B3IA 2IUTA 2Z4SA 2A9VA 4TV8F 3SHTA 3IV6A 4MLDA 4ZRMA 2JZOA 4EY8A 5HR5A 1A7AA 3WA7A 3NH9A 1TFUA 1XWWA 1F06A 1V25A 1Z45A 5JMWA 3MGGA 4LXXA 1IBCA 2CJWA 3NBFA 4DLNA 3PD7A 1DT5A 1NI4A 3P45A 1IUKA 1JQJC 1ZMRA 3TBFA 2WAXA 3BF8A 1FCJA 5FUXA 1Z4QA 3H42B 1FNMA 5JSUA 2RK4A 1KQ3A 3EIQA 4UEQA 2WT4A 3A36A 3QKTA 1B6SA 2IYPA 4HNRA 2WJ4A 3O91A 4ZT3A 2G1JA 2WICA 3IVGA 1JSCA 4UTVA 4TV8A 1VMDA 2WUEA 2RGCA 1YHYA 2ONYA 2ZCUA 1XQVA 4EG5A 1EXMA 2HK9A 2WTBA 4FLFA 4KN5A 5EUMA 3DMGA 3OOJA 5HRUA 4YHBA 1UFKA 3JQAD 3O74A 1Y4AE 1RKBA 1T9CA 2MYUA 3E2MA 4XCQA 4ZQFA 4EY3A 1RZRA 4JI4B 1KXJA 5LQKA 3OFKA 1OAOA 2FG5A 2Z2ZA 3PXEA 5AVYA 2IWHA 4OLHA 3ZOKA 3ZI4A 3SYNA 3HCAA 1R5OA 4CE6A 2ZSAA 3DE7X 1BCRA 2G7ZA 3O8NA 4RZSA 5J4YA 2JLBA 3S40A 4AS1A 3RUHA 2YRXA 3MTIA 2HV9A 1CUGA 2VYFA 4JGIA 1TECE 5CTJA 3MBKA 3TFOA 3OQVA 2AMVA 1EK2A 2VPYA 4JOSA 4FVTA 1A8UA 3G0BA 2JFOA 4A6DA 1A71A 3SOZA 3EA4A 2WB2A 4YV7A 4W7IA 4HQ6A 3EGIA 4FEGA 4R31A 4RPKA 4WOCA 1M6YA 5I9SA 2SCUA 4MX8A 4C29A 1W93A 3NXSA 4LXUA 3FGZA 5IH7A 1JFTA 1QR6A 3T9CA 1ZM7A 1V48A 4PRZA 4HDMA 1G21B 2GBLA 2GZ2A 3VHXB 2E4WA 2HWYA 4KIJA 2XCSB 4JXZA 2J3IA 2O3SA 1QFXA 4YHHB 1ZKDA 4Q7JB 3DTNA 2YN0A 3CMMA 3KC2A 4MVYA 1M5RA 1YS2X 3HEAA 4Q16A 3SDSA 4FMDB 4BNFA 2PE5A 4EG1A 1R3DA 1AF4A 4Y1FA 4ZV7A 4CN9A 3PJRA 1BG6A 1BKYA 1FW8A 3ZY2A 3TZCA 3KYCA 2J5BA 1T1EA 4QODA 4NZYA 3CUUA 4YWJA 1UEXC 4HCJA 1JQKA 3BQNB 2X5NA 2V45A 3JAKB 5DFAA 1Y9EA 3EIHA 4HZIA 3ZLVA 1TGYA 1GJRA 4PZ9A 1SR8A 4QG7A 1CRWG 3QI7A 1SELA 5LPNA 2VHVA 3LV8A 5GJCA 3EXHC 3C3WA 5CK4A 1M6VB 4AF7A 2FWPA 4X00A 1M7HA 3KDAA 4BQRA 2GESA 1TA9A 2DT8A 1E7WA 2Z3WA 4ENQA 3HGTA 2I3AA 2Z83A 1LTHR 1S2DA 4EZEA 1N5LA 5B7QA 3WIDA 5T41A 3T7AA 1XA3A 4B81A 1IBRA 1V8PA 5K0LA 4UVIA 3TRDA 2R2GA 1DFGA 3L6BA 1UM9A 3GJQA 4PO8A 4ZRDA 1ODLA 4QUEA 4ZWNA 4DLPA 1P1CA 5SY9A 1CQWA 1L8OA 1DO0A 1TRKA 3CTMA 3WOHA 1PYGA 2PS9A 1D4OA 1VMIA 4XSVA 2C5EA 1M2WA 3FFXA 5HEKA 2JCVA 2Y8EA 4I9FA 3D6VA 1HT1E 4XX0B 3WYDA 2DBRA 3K92A 1KAGA 4V2UA 3WKEA 4U3JB 3ZJ4A 3GLFB 4K9SA 4Q4HA 6REQB 2KBEA 1J39A 1LS6A 3PA8A 1BGXT 1UDAA 1W87A 3OIFA 4FNAA 1T91A 4FR0A 2QW0X 5LCXA 5A7FA 4WTOA 4M37A 3PNMA 4TT3D 4M98A 3B6JA 3IAAA 3OIUA 3ZE2B 2DKNA 3OZGA 4B9AA 1J22A 3GUUA 3GPBA 2VG8A 2ZAOA 1GL9B 1NF3A 1ZXLA 1YB5A 4U2KA 3W5BA 2OD2A 4M0CA 2YC2C 5K6AC 1ML4A 1BA3A 1JLMA 1WPGA 2WPNA 4MR7A 5IZCA 2ZZNA 4W8HA 4JR2A 1E89A 5TQ2A 2YXNA 3DT9A 1GZ6A 1S4QA 2H7YA 4Y2VA 1JU3A 1UXOA 3PNKA 1ZK0A 3M1YA 3EXEA 3QNMA 2DWOA 4GX0A 2ZBDA 3PNBA 3D3WB 1GU1A 2XSZD 1KDZA 3ANMA 1DKLA 4H4DA 4LI3X 2X3YA 2NXNA 3FGOA 3ADDA 2OESA 3F46A 5DF1A 1SVKA 2M6SA 3FXAA 4RLQA 4NE9A 2XVXA 4ZO8A 5A02A 3SVTA 3MPOA 2DKFA 4QPNA 1XLTC 2VA8A 3MTJA 4N41A 4GR5A 4IDQA 4KBFA 3ICPA 3G8YA 2H1LA 3KS9A 2YJTD 1QK3A 4C0LA 5IAJA 3BA1A 3GFVA 4K5QA 3T9DA 2WKRA 3N70A 4AYWA 4NYIR 5E6UB 2O2EA 4NIMA 3PC4A 4QARA 5SZKB 4C87A 5EIEA 3L7DA 4I1OA 1W5FA 2P79A 1GU7A 2EBUA 3R9IA 4RCVA 4RYDA 3UGTA 4WADA 1XTIA 4C3UA 4G1VA 2UZAA 3BD6A 4LY0A 1E64A 1YZ3A 1SUDA 3WGZA 1DCMA 4GOJA 1E6KA 1LX7A 1G20B 4S1OA 4TT3A 2G07A 4NDNE 2CNNA 1V7PC 4GP7A 4HWPA 2Q2VA 4BLPA 2P3QA 3BMOB 3NUQA 1E96A 1FNNA 2QTTA 5CHEA 3UHOA 3BJZA 5CDSA 1EDZA 1LB1B 4H2DA 1U04A 2J31A 3HY4A 3F8WA 4NJEB 3BXZA 2Z5VA 2C8VA 4QAJA 4ABTA 3RS7A 1M7BA 4X7RA 3WISA 1AQLA 1HEUA 3ABIA 5EJ7A 2PQ6A 2OB1A 2XSZA 4QKQA 4KPEC 4AY3A 5DE3A 2M98A 2Y9MB 3AR8A 3CZMA 5D84A 3UMJA 2JJ8A 2F00A 2QVCA 1WUKS 3PXAA 2FVYA 2WHRA 3KVOA 1NQUA 3ZDQA 1EK0A 2JDID 5DK6A 1ACMA 5GV7A 4CM8B 1OU0A 4DJ5X 4RKQA 4MVJI 2ZEJA 2XF8A 4CU5A 3LVFO 3G0HA 1MG5A 5TGDA 5JFTA 4G1UC 3UOGA 3NASA 1A27A 3MSXA 1I2CA 5ERGB 1LBTA 2EW2A 4QXRA 1C7IA 5AMXA 3X1MA 2OENG 3ZK8A 4HQKA 4W9NA 1XNJA 5IG2A 3RVQA 1G42A 3IUQA 1CQJB 4IWXA 2ZM6B 4S2EA 2VJAA 1F8XA 5B1HA 3RJ5A 5M7EA 1QH1A 2Z57A 5IJAA 1G2IA 1Z7GA 1JKXA 3G9ZA 4OYHA 3V1NA 2R4UA 1T36B 5AHRA 4BTLA 4D9NA 1B16A 2C9MA 5AJTA 1XVUA 4WK2B 4ZVTA 3NHZA 2QMZA 3T99A 1JWLA 2GVNA 2PXXA 2OFFA 5AKIA 5E6RA 3ZQJA 5IT0A 1I36A 3HCCA 1KQNA 3BRSA 5CBPA 2RE8A 5F76A 1ZU5A 5FFMA 1EGVB 5TDHA 2RARA 2FDXA 2VZ0A 1MX3A 3I1FA 1Y48E 2XAAA 3D2LA 3DCIA 2J5QA 3L0ZA 1UBJS 3U7QA 4A6XA 4JIGA 2IY7A 4GRAA 4ZCLA 4BMSA 1T8YA 2HAEA 3QM1A 1KEPA 2I55A 5FOQA 3A1NA 3OPQA 4D4LA 3WWPA 3AP1A 3IVAA 2VHYA 4Q6BA 3RIMA 1QPBA 2Z8YA 4TTSA 2EV9A 3MW8A 3SC6A 2P11A 3QU5A 4ZO4A 1JB9A 2AH5A 2JJ1A 3C3PA 3E9RA 1B8OA 1N6IA 1T2UA 2CEKA 3IMEA 4Q4JB 2JDIA 2B4QA 2NNWB 2QD4A 4LK3A 4YMHA 4F96A 1V5FA 2RI1A 3NAMA 4AX4A 4HOYA 2FZKA 4UHKA 5G1NA 2RD2A 4DPKA 3RV3A 3IUPA 2ZSFA 5A9SA 2JIZD 2HA3A 3C0KA 2IW1A 4UTOA 3RRBA 5AM4A 3KJFA 4ZGBA 1O6BA 4EJ2A 3HKEA 3BHNA 3DNFA 1AD2A 1O03A 1L1QA 2Q0SA 4BX0A 3GT7A 2LCFA 2HHCA 1I7PA 2J48A 4MV3A 4L7QA 3U4IA 3AY7A 4KC0A 4YEDA 3UMFA 4EG0A 4GHWA 5HJ5A 1F5NA 4U02A 1SGWA 3DXFA 4P7FA 1ZCBA 4Q47A 5H9WA 5PGMA 4DLLA 1SVNA 5J4KA 1Q5PA 2V59A 3EAQA 3G5UA 1HA3A 2CUNA 1GLNA 2J5RA 2Z3VA 3E35A 4U9HS 5SYMA 4B2IA 3CLUC 3PFCA 5KOHB 1PW7A 5DGIA 1X70A 3PQ5A 3ZV7A 4W5HA 3RFTA 3WRWA 4IHQA 5GM1A 4V0ME 1JJIA 2ET6A 3A0UA 5DP1A 4J6FA 5DTJA 4OLBA 4K9OA 1N5RA 1J0CA 4CRWB 2JKVA 7AT1A 1GILA 2YJ3A 3S2UA 4AMBA 2XTZA 4AMVA 6CHYA 3DEFA 4I6JA 4DJTA 2Q3EA 1GVHA 4ZOEA 2ZRMA 3IR5A 1AK9A 2IS1A 3Q10A 3UT5A 4DJEC 1K5GA 4W4TA 5HDBB 4RLSA 2JAQA 4Q9IA 5FL3A 4JBNA 1DBIA 2GJSA 2FZ4A 1U31A 4V0SA 3L0SA 4WFQA 3QLTA 1PT9A 1KZYC 2ZBVA 3T94A 3Q4GA 2JIZA 3UHPA 5I3ZA 3NBUA 4XYBA 5REQB 3T3HA 1JFLA 1FRFS 3WC4A 4O2BB 4BKQA 4MP6A 5KMGB 2HHAA 1NM5A 4HRYA 3LSTA 3S68A 3VTKA 3WSWA 3FSGD 2C4WA 2JG3A 2GEUA 4MK4A 3HDYA 3U7GA 2Z95A 4OB6A 3GCXA 4B2PA 1Y3CE 2QJWA 1CP3A 4HRVA 4RKWA 1BEZA 2YV5A 1JYSA 3KBOA 3PC6A 3W6NA 5DYWA 4IHJF 2HDWA 2ZT8A 1JFRA 4XYGA 2H4WA 5E3IA 3N0WA 3W6UA 1FXUA 3O2NA 4LVUA 3DL0A 2WJIA 3PHJA 4X1OA 2X2FA 1M0SA 1N2OA 4GQAA 1NJ1A 2PL9A 4LXYA 2B8NA 2XE4A 4B17A 2CUKA 4EYOA 2VK2A 4Y7CA 4AUEA 5JH7F 2B1JA 1X7XB 1HRDA 2IF2A 1ST3A 4UHFA 3BFPA 3RVOA 1HDEA 4DMGA 2JLAA 3FVTA 3H9BA 3KV1A 4MRRA 2O2GA 3FDIA 3R20A 5HIKA 1OPRA 5ESWA 4IHJA 4YT4A 3DEIA 3JSXA 1EFTA 1WDTA 1EFKA 3OMWA 1CUDA 2RFLA 4FXOA 1CDDA 2FW1A 3T3IA 1XQ9A 3T52A 1JE1A 4Q00A 2R62A 3ZGZA 1SG9A 1WHTA 5F9MA 1QJCA 1Y4SA 2OO5C 4MV6A 4WAUA 5AI8A 5HS6A 4AKSA 4F7DA 4MVJE 5JH7A 5JU6A 3SJAA 5HMMA 3H04A 3PXDA 2WRZA 1O6ZA 2NAFA 2NUAA 4I66A 4PX3A 1QHEA 2VDJA 3HZRA 4WRRA 4DQVA 1I7DA 3HXLA 3FSGA 4E2YA 4RK1A 3DZIA 2AC7A 2POCA 4KAAA 1P19A 4CV1A 1UC9A 4XJTA 1H1LA 4EO9A 5BV1A 3NTQA 4IXNA 3GDGA 4RC9A 1YDHA 4P2BA 1T9ZA 2BCEA 2CE2X 4N3NA 1W1WA 4JJ8A 4BTVA 3AKDA 1F0YA 2QZ4A 3RC3A 1KOGA 1C9EA 3SLKA 4XUEA 1QWOA 5JD3A 1MB3A 5JSYA 3LUHA 2ZIEA 3TF5A 6PFKA 1T4DA 1X1SA 2XWBF 1L4YA 1ND5A 1ORWA 2FK7A 3QVXA 3SQDA 1XEWY 4M0EA 4DJDC 2AXQA 1BU8A 4H60A 2IA5A 1XFDA 3R5SA 2YVAA 3ZUPA 2I4TA 5BQ3A 5INTA 1NWHA 3GGGA 4G36A 1JJ7A 1CJBA 5J40A 4G0YA 1K8QA 3ORYA 4LXIA 4O33A 1IONA 4DG5A 1G5QA 5BO5A 3W5UA 1XQXA 2Z56A 3A25A 5L3VA 2P9QA 1GSHA 2WJAA 1YKGA 4F0JA 4ZQCB 4YCJA 4BE4A 5BYKA 2R8EA 2G06A 3K30A 3R23A 4A0HA 5A4KA 1KQFA 3OO0A 1PS0A 1FFEA 2EL7A 1QP8A 2IIBA 4I8IA 4GMDA 1C7RA 5AH0A 3U61B 1X7YA 3A0RB 3MBOA 4YY3B 3L0CA 2YFYA 3PFFA 1D1SA 4LHSA 3I9JA 4ZTZB 3ET4A 3NJRA 3U6KA 1XXHE 4RV5A 6NULA 4JLSA 1YVEI 3STYA 2GEKA 1SCDA 4PZPA 2EJTA 2VYVA 3Q98A 1I7LA 4U5XA 1KQPA 2PM8A 3EJWA 4FN5A 2P9BA 1QIEA 3OP4A 1QHFA 2N46A 3P9QA 2QUKA 1NJ8A 3OHSX 3T7IA 2UZ4A 2BUBA 1MA0A 5FPPA 4XVUA 2Y2VA 3GT0A 3RSCA 1BXGA 2JANA 2Z0MA 3N8KA 3F97A 1NLUA 5D5HA 3H3JA 4D9EA 3T1YB 5G1PA 1BVYF 3A4IA 4BO6A 1CY0A 3INRA 4II7A 5FUQA 4J8PA 1UK9A 2AUMA 3JQRA 3OPXA 3ZYZA 2ISQA 2R47A 4K88A 1PJTA 4DEXA 3T7EA 2JFHA 1RYHA 2I1WA 2PS1A 3BL6A 4Z2AA 3PEYA 1KK3A 4Q0MA 2F1IA 4FE3A 1SZDA 1T4CA 1Y1QA 4M1SA 1VIVA 2VCYA 4UARA 5H70A 3MMSA 5LB4A 1MVLA 3K0AB 2BEVB 4KB5A 5HZKA 5K03A 4QJ5A 4Q3AA 2R5WA 4OGLA 1E4VA 4G9EA 1WXEA 2HREA 5T64A 1VSVA 2DSTA 4DLVA 2IYRA 3I23A 2AXEA 3I9MA 2GWHA 3PEUA 3GCDA 3BS4A 4Y67A 1RQ7A 2IHVA 3LDFA 4TOIA 3IOMA 3HB0A 4IAOA 4X1KB 5CM8B 4KOAA 2DF8A 1R10A 3JXEA 1L4KA 3IKVA 4KO4S 3ZGOA 4MEBA 2MWMA 4S1TA 5BR8B 1LPBB 3SIPA 5A4AA 2FP4A 2CV1A 1BEEA 1SOMA 1Z25A 1NE7A 4IDBA 4MRMA 1P6UA 3ILHA 2YTZA 1Q50A 5J1TB 1RMQA 2V7VA 3JWEA 3PCXA 4PYLA 1SU8A 4YLYA 5J43A 5KYNA 5CIYA 1PR4A 1QC5B 3CNNA 3CRZA 4P38A 4P7BA 5D87A 1PK9A 1OVGA 2IHBA 3ZWBA 2FSUA 5CG2A 1E0DA 1JV2B 2I7TA 4N0EA 2H17A 4J0CA 2O1WA 2P1ZA 2SBTA 1WDKA 1C9KA 1DAEA 2FHPA 2ZJ1A 3WQBA 3TXXA 1Y5LA 1J8VA 4XM2A 2J41A 3WMRA 1GGEA 5B2ZA 1LWOA 3AB8A 1BHO1 1NSFA 3G8DA 2A9RA 4HEHA 1KJNA 2LVBA 4QQKA 1P29A 2F9FA 2Q9AA 3HY6A 3A9RA 3F47A 1E2QA 4TMFA 1KAMA 2RHBA 3LDHA 4CLHA 4ZREA 3PQ2A 1S7GA 4DLRA 5E9JA 5K3FA 4B34A 3IULA 4D97A 3P9CA 5EPEA 3ON5A 4ZEOA 3K6SB 3NNNA 5EXTA 4E5VA 4MUNA 2QN6A 2YYSA 1EVYA 2IOFA 3V6MA 4EKDA 4MQMA 4JK3A 1P91A 3CLSD 4QBKA 4QRDA 3IP7A 5HKKD 1WLSA 1E9SA 3ZE1B 1MAHA 4FMDF 4GX1A 3ZWCA 3ZDDA 4RSRA 2HU7A 4Y18A 1OGJA 3COZA 3Q8KA 2BM0A 3RQSA 2ZP1A 1WZEA 2LKDA 5T3YA 4AB1A 4UW9A 4CM4B 2E37A 4LYHA 3D6AA 3RVBA 5DGDA 1P4HA 2AUTA 2C3YA 1MRZA 1SC1A 1WA5A 2OWEA 1WCYA 4G4IA 4H77A 5A0TA 2FG7C 3D59A 3UHJA 1J9ZA 2B1IA 4JI5B 4YN3A 2REBA 3GRUA 3QBDA 2C0PA 3VHXA 4QOSA 5KTKA 1KSJA 3CB2A 1GOTA 3ICOA 1ILEA 4R2XA 1HMPA 1QZ3A 1K3TA 4CNQA 2FZ5A 5LLSA 2RGBA 3TQSA 1H0RA 2H85A 1T1IA 5AIBA 4MW5A 4BNHA 3QVLA 1Z37A 5A06A 2BPOA 2IQIA 3N2LA 3WHLA 1FBNA 3QH4A 1L5ZA 1ZJ6A 5JWHA 1RI4A 2FNAA 1MUUA 1BH6A 1KY4A 3JAKA 1BIFA 2ZXEA 4XD7D 4ESVA 1S0UA 2E89A 1HC7A 1JSLA 1V1JA 1A76A 5HJ2A 4JL6A 5CMLA 1DRJA 4MW1A 4PS1A 4RK0A 2O2YA 4NBNA 1M6VA 1Z4MA 3WYGA 1JLRA 1TYDE 2VJOA 2L17A 4J0QA 4U8GA 1OOEA 4X6UA 3T5TA 1BWQA 3KB6A 4Q02A 4Y30A 5HKKA 1ZOOA 1E2PA 1PZFA 1R0XA 5JJLA 1Q0LA 4FKBA 4MWGA 3RVRA 4GXQA 1DP4A 2TMKA 4QYTA 3WIVA 4LK2A 5EIFA 3ZBQA 3BCSA 4G65A 4C07A 2INGX 3QZUA 4MIOA 1XZDA 1V4BA 4OQYA 3FNIA 2GHRA 3CNLA 4H1UA 3BDVA 3LPDA 1UMCB 2FEWB 5K3EA 3SF0A 2E4AA 1RJWA 1SKUA 3BHJA 1OI2A 3ISTA 3QQPA 4GE0A 4Y2UA 2GD6A 4XX0A 2E4YA 4OJMX 3W7BA 1PJZA 3EBLA 3RLFA 3PPXA 4A0GA 6REQA 4NCIA 1ZMOA 2E1RA 1DE0A 2VQ6A 1M2KA 4DEYA 4AQYB 1XZFA 1UINA 4LOIA 3T4XA 1WP4A 4B4VA 4MUGA 4F6CA 3EA0A 3N58A 1ISMA 2PRYA 3R9XB 2D2IA 4MGZR 4PC6A 4B48A 1SUAA 4PAQA 3AMVA 1U1EA 3KU1A 3E8MA 4XD7A 4CLRB 1Z4KA 2XUQA 4WZAE 3FTFA 1EESA 2DZDA 1SD1A 4EA9A 1W30A 1Z7YA 4JYPA 3TZLA 2NXCA 1O6FA 2DJIA 4FTWA 3AETB 1WE2A 5FUYA 3EXAA 1T3GA 3USCS 3WRXA 3D3WA 1CNFA 2HHLA 4REMA 3ROXA 1T2CA 4XCVA 2JFFA 2QN2A 3UA3A 5ILOA 1NE2A 3CZQA 5KCMA 2K2QB 1GFIA 2JGRA 3N39C 2UXCB 1QNFA 4GZLA 4O3FA 2DPXA 4M2LA 3FWKA 2CL6X 1L4GA 1DX6A 1WKBA 4AICA 3NBMA 4UD6A 3C6MA 2BI4A 5SZHB 2QY6A 3KQQA 1IBSA 2WI8A 3SS7X 1Z08A 2XYGA 1UDBA 5E38A 3ZUGA 1NSTA 5C81A 3LS2A 3QWAA 4EJ0A 2HA6A 1YA4A 3KR0A 4RIFA 5E6UA 1RWPA 5HILA 2OBLA 1SNYA 1R4ZA 4TT8A 1DAMA 3FYDA 1G8MA 4G0PA 4IX9A 5FPKA 3WLMA 3I8XA 2ZWOA 4ZK6A 2VDLB 2XCTB 4Q9KA 1WKCA 4O4IA 2Z9BA 1KFJB 2RI0A 1G20A 1F2TB 1U1CA 2WHXA 2XR1A 2VSQA 3FUCA 2ZTUA 3I6ZA 4MMYB 1LWNA 3QJYA 1OJ7A 2CKDA 5A3JA 4QQ8A 1U2GA 1TZJA 3BMOA 1N5DA 1YONA 2A30A 4UKDA 1WM1A 4PGMA 2EGGA 5E3HA 4HAVA 3VU8A 4NJEA 3SFTA 4R01A 2Y3IA 1ZD2P 4CU2A 4B3MB 1N75A 4FZVA 2ERYA 4P4SB 2HNKA 3DOOA 1G7RA 1RI2A 3LUGA 1OFHA 1X7WB 3F7OA 1YT5A 3MHTA 3OTHA 1PUIA 3M2PA 5ADHA 4C7OB 3L84A 4MVJG 3L4SO 5H83A 4BC1A 1Q3KA 3HSYA 5CPBA 1PR9A 3G5LA 1SB9A 4M88A 1HDZA 3KZXA 4NV0A 5LMCA 2BSAA 4CM8A 1VDZA 4WKGA 1FP2A 3FYUC 1J6UA 2QAGA 2ZR0A 2WWWA 4MV5A 4FBLA 2CXNA 4PW0A 4WINA 5FOTA 2QTBA 5K0SA 3MM4A 5EWMB 5FKJA 3UBMA 1MHPA 4EKEA 1XV5A 4DC1A 2IY8A 2G04A 4KWTA 2XVZA 4TTJA 4TTQA 2H4YA 4XSGA 1WQ1R 4YWHA 1TF2A 2VSOA 3ROEA 3ZWPA 1RFLA 5HK9A 1SJ9A 4QHSA 4A92A 1K7XB 1XXHB 4IV8A 4E3ZA 1CQJA 3BB3A 5JCOA 1BE1A 2H7CA 5KNBH 5AJWA 4LHEA 4A23A 4LF8B 4XXHA 2YYAA 1FFAA 3SX2A 4TSRA 5EINA 2HCJB 1I01A 1T36A 3I2YX 3W0LB 1Q1EA 4EFLA 4UU7A 5AXBA 2Q9CA 3GA5A 3BPSA 3EUEA 1N7JA 4K9QA 4WWHA 5IKMA 2JA2A 3QJGA 5C8YB 1VOTA 1E61A 2VQSA 3A05A 1IQUA 3E1KA 3KLBA 4RV4A 5EE5B 1M2EA 2YVLA 3AKYA 5LBUA 2BZGA 4TZKA 4U2DA 3Q3VA 4DLSA 3TRFA 3KQKA 3EXIB 4UBJA 4P35A 4PVDA 2WG0A 4O0MA 2JATA 3NCHA 4PINA 2ZZMA 3A6HA 2HRCA 5AUOB 3ZWAA 4DSOA 1KEVA 1RKVA 2M1XA 4RD0A 2UYCA 4YGXB 1DO2A 1MTZA 1N7IA 3KHKA 4XSHA 1UFOA 1JLKA 1Z0FA 5TRTA 4CV3A 4LC9A 4FQ7A 2W43A 1WRBA 3GF4A 4RMGA 1L6IA 4DQ0A 5HOQA 4GGMX 1QRRA 3BWEA 1P81A 2C4TA 2OGWA 1SUWA 1P0QA 1Z7WA 4RWZA 3E48A 1LPOA 2ZW9A 1OTYA 1Q83A 1UMBB 4P4TA 4QFDA 4EPTA 2JRCA 3OE7A 2YZ7A 3ORQA 4H7JA 1CU1A 4N8DA 1CLUA 2NZVG 4QHYA 3V6LA 5IDXA 2AJTA 3MF4A 3NAZA 1WLYA 3COSA 3TTXA 4D0RA 4JB3A 1O95D 2ODTX 4LGCA 3BGDA 4K9RA 1WCXA 1F2VA 3CNQS 3U40A 4RZQA 1H05A 3GEEA 4H7DA 4IIBA 4MQFB 1QIHA 2PMCA 2XWPA 4PSAA 3QFHA 5ADWA 4Z0HO 3EISA 1VE6A 1N57A 1ZL0A 3I6QA 1ZRNA 2Y4NA 1GNPA 2AFRA 1VPWA 4OK3A 3TZQA 2ACVA 1Y6RA 4RPLA 4B3BA 5L9AA 3A2NA 3ADKA 1RQXA 2RGNC 2DPHA 2YHIB 5J2UB 1ABFA 3WHIA 1WX1A 1YZQA 1HEIA 1EP3B 3CXUA 2P65A 3MXTA 1HK7A 3CPEA 3DDOA 3KCNA 2GUGA 4O2BF 4OHPA 4QYSA 2UDPA 4WASA 5CFOA 4YFYA 1E62A 1L4EA 4HNUA 1YZFA 3A1DA 3IVXA 4C04A 1RS0A 2ACEA 2QIPA 3OPVA 4KFSA 4BDTA 1SQFA 3GVPA 3QXXA 1NBHA 5BWLA 1N2XA 5CITA 2KMLA 2Q99A 2Q2OA 5K8CA 3E27A 1YR7A 4RQTA 1GV1A 1MMFB 1JG7A 3QMMA 1AN9A 1EQAA 3SM9A 1KS9A 2ZYHA 1Z83A 4CL8A 1U94A 1VPDA 3PLRA 5REQA 4TLCA 1XVLA 2P5TB 1JHZA 2CLHB 4O2BA 1WZ2A 1FRVA 3MAAC 4F2PA 1EJ6A 2OCXA 2F90A 1HSZA 2HNAA 3L7OA 2FDCA 1XTTA 4LKRA 1S96A 3VKHA 1PZGA 3A1FA 3OZVA 2V6IA 1B8UA 3TL6A 1EXWA 5G3YA 2J4FA 1D6JA 3U1TA 3WBKA 2Q50A 2B0CA 1KVRA 5JS6A 3BCHA 4J4BA 1P3DA 4LOKA 4LSZA 4ZVOA 2PK3A 1M73E 1PO7A 1YZTA 2BFBB 1GRNA 2VJNA 3FJOA 4XWOA 1JDSA 2A14A 2EBWA 2WJYA 2IXTA 3SE0A 2ZI3A 3EN0A 4TMKA 4FU0A 5EY5B 1X8XA 1BKSB 1F2DA 1X7XA 3BK7A 1EK1A 4MWCA 4QDXA 3SXJA 4WFKA 4GDFA 3BJMA 4GRDA 3WMEA 3X1DA 3EY9A 4R3WA 1MD9A 4HY3A 2IHKA 1BQ3A 1Z16A 2B8JA 1JHRA 5JNLA 1ZRSA 2HSEA 1NR1A 2WV9A 3E23A 4ZA2A 4V3CA 3DW1X 4YB8A 3T06B 3CXRA 3VH1A 1ZEJA 4D3SA 2X5XA 4Q1VA 4K9NA 3KJXA 2YZNA 4EBBA 3EC1A 4GWGA 3VU0A 3AHCA 3BWBA 1T24A 2J6IA 2V98A 4YP0A 5HWSA 5F78A 4YRCA 1WDMA 3ASVA 3STHA 5AW6A 3FR7A 5HKOA 3KT8A 3RTAA 1WVIA 5LL6P 3JQ9C 3CUEF 2NPFA 2OV8A 4D9CA 1G9TA 2X42A 2X22A 3RHFA 4FR5A 1U5AA 3X1ZA 2YWRA 3GYGA 5ADUS 2OV6A 3IILA 4UZSA 4P4UA 3QBTA 1C9DB 2NX2A 4YASA 1CY7A 5FI1B 4EFKA 1LQ2A 4Y2PA 4KNYA 3OWXA 3QFRA 1RM0A 4Q3OA 3HQ4O 1L5HB 1E7QA 3QXGA 5H1YA 3CO5A 2PWAA 1T9BA 2AYYA 3A4LA 3EXHB 1IULA 1TVEA 3EUWA 3V7YA 2AC2A 1ZAKA 3THYB 3JRXA 3ESAA 1MLDA 3PS9A 2FXVA 1FTQA 2WE7A 1RJGA 3FSEA 3T38A 2OPHA 3A6DA 3CYFA 3FX2A 5F21A 3B7GA 2QTVB 3FJYA 4L76A 2FV8A 2JGDB 4YVFA 3G1WA 3IXQA 1KDRA 2XA1A 2QZZA 2Y1WA 1HT3A 3AUSA 1YI0A 3O3CA 4RE5A 4WZAB 2JIQA 1KWKA 2PUBA 4FHCA 1UODA 1M2OB 3GRFA 4L5AA 5TR9A 4AROA 4BNJA 3JX9A 4FHZA 4KQ6A 2HA4A 1SVOA 1TEHA 2ZWVA 4BB6A 4PZ0A 3BIOA 3OLQA 5IEJA 1PIWA 3ENWA 4IIDA 2QVZX 1P5ZB 1G4UR 2VTEA 4J91A 5FJJA 5H4GA 4QQRA 1TQ6A 3W77A 4N1AA 5L3QB 3CISA 4FGLA 3CO0S 1A9RA 1R16A 1RKUA 2P2CA 4N5LA 1PS9A 4J0IA 4JSYA 2FFHA 3DYBA 2J7PA 5DOVA 2Q2QA 1J00A 4Z9BA 2GDZA 4R40A 2HZ7A 2WWXA 1G8YA 1HFJA 2OLEA 3S0JA 4JA0A 2PTHA 3P4YA 2BYTA 1X8KA 1ZC3A 1E9BA 2A33A 1GG9A 3ZH9B 3FETA 1L3CA 2QUJA 3MJFA 1ZW6A 4RCYA 3S4YA 1NU8A 1CJVC 2OFPA 1B73A 1M5TA 3OQIB 3X1XA 4D9JA 5JNRA 5J1SB 4F5WA 3OQOA 4WLNA 2ZQ5A 4DL9A 1T8UA 1UQRA 4D2IA 2O0HA 2EP8A 3DULA 3F71A 5GONB 3VYTB 4XWKA 2G4VA 4WE3A 1PJAA 2W6ZA 3MJVA 3RQIA 1CF4A 3BIWA 4GKBA 1B0ZA 4H27A 3K0AA 1VECA 2BEVA 4FUTA 4QT4A 2CVOA 4HDOB 1PR1A 5TJHA 2EP7A 1H9AA 2P35A 3VUFA 1USKA 3FNGA 4TMVA 1N8SA 1VXOA 1WOMA 2Y1LA 3ORFA 4W8OA 3ZDAA 3PI6A 5H68A 1PEYA 2HO5A 1U0FA 2PJZA 3B3FA 4X1KA 5LVAA 1L3IA 2W2LD 3JYHA 4PFKA 3EZ9A 1Z88A 2VHTA 3FWNA 4CJXA 5KIAA 2HT1A 3IAEA 3AEXA 1KI1A 1RC0A 3ZE6A 2VQDA 2J9FB 2DXIA 3E3LA 3KZ1E 2WVAA 4YJ3B 2QSJA 2AHRA 5CT8A 2EZUA 4EVRA 3OOHA 4I5FA 2DPYA 2XMSA 1QC5A 3CUTA 4JLPA 4WLOA 1DLIA 1NW4A 1BYIA 3OT1B 4YRLA 3WXBA 4BJ6A 4NCBA 5DLYA 2QD3A 3RK4A 4GX5A 2IYYA 5ICMA 1U02A 4XPIB 4JUIA 4GEGA 4QLOA 1P4GA 1YBAA 6GPBA 1RWOA 1RLTA 1U63A 2XWJI 4PHGA 2RGAA 2DQZA 3FLBA 4B7UA 5AW7A 5FUVA 3VXKA 5DTQA 4BBPA 4ALIA 3AFGA 2GVDC 3GZNB 4II2A 3RU2A 1P39A 3IAS1 3RU9A 2OM6A 4GVLA 3WSVA 5C8ZA 4N9WA 1ZESA 4DYDA 4IW3B 5HNKA 2Y92A 1UKYA 4E4TA 3NPMA 1OV4A 2CHEA 3ND5A 4G85A 4BAGA 4GPZA 2XV1A 4HQRA 4KN9S 3RJZA 3SX0A 1B15A 1ADGA 1O58A 2OMKA 4IFEA 1KDVA 1ZICA 5C32A 3I2JA 3B6IA 3JS5A 3B9PA 3UCXA 3WAGA 3K6SA 4BECA 4H1TA 4GX2A 4G0WA 3QPBA 1JLSA 3GOHA 3RSLA 5BW6B 1HDRA 5ALZA 1Q17A 5GGYA 2W2LA 4P2GA 1PBNA 5TEWA 3T1HB 2WF7A 3K1AB 1JEOA 1MAUA 1SBZA 3OE5A 5KJ6A 1TA0A 5J4LA 3O1LA 3DAGA 4NBSA 4YDQA 5B2EA 5EZYB 4X93A 3CONA 1N3IA 3MGBA 2DLDA 5JISA 3OCYA 4CTOA 2XNCA 4UULA 1W5AA 4CM4A 3DOHA 1VJ1A 3HJHA 4MUIA 3K8YA 3TTWA 3G2IA 2OHVA 3GBPA 5DSZA 1Y9JA 5IJXA 4DIUA 4Y7DA 2QRUA 2ZR9A 2GI4A 3ZQKA 2WJPA 3V3TA 4WZBE 2DERA 1Y1TA 3AR4A 2HWUA 3M6IA 4BQFA 1LSUA 4KO8A 1LUAA 4L02A 5AM0A 2QZ9A 3GFBA 3EIEA 5E4TA 1EYZA 1N3BA 1YUBA 4FFDA 3W04A 4PV7A 2H7XA 2ZROA 4JBIA 2CBZA 4W1PA 5M5BA 3MCVA 3G2HA 4Y2RA 1RMTA 2BRUA 4I1YA 2OD7A 4XD2A 5L3ZA 4I5EA 4EATA 2XCUA 1VLHA 3VTZA 4ALKA 1JXMA 2B9EA 3HH8A 3OQPA 5DSXA 1IE3A 2XMZA 4E11A 4F92B 3IYLW 2B2CA 2J33A 4B74A 4BMPB 2O7QA 4EVSA 4YAGA 2ESRA 3K9HA 3E9QA 4AZ3B 4WJLA 2HRBA 1I1NA 4NZNA 1CR2A 2IVFA 2C2XA 4V0MA 3L5OA 2NUTA 4P4GA 3WWOA 1F2UB 1GL7A 4UUNA 2A58A 1TM4E 5K8UA 1L5VA 5B1DA 3D7KA 1A4RA 4HAIA 1H3EA 1GQ2A 4G8JA 1PD0A 1R0CA 4ENTA 1KH3A 2YICA 3RBXA 2D1SA 4AKHA 1H23A 4PQYA 1G55A 1VLMA 4DYVA 4A9AA 2GBCA 2P7HA 3ZJ5A 1EDOA 1IZ9A 4H6XA 4EPWA 3HJGA 1UMCA 4OGFA 3I76A 3QIAA 2IZOA 4MVJD 5EKUA 2F48A 2YMPA 4OLJA 1OT5A 1YOVB 2GNPA 3TW4A 5IFKA 1PD1A 3ECSA 4JQYA 2B7BA 5F4BA 5H3CA 1YDGA 3ABSB 4KI7A 4PPNA 2I2DA 2KB0A 4YRPA 3NW9A 1GUDA 4LZJA 3I1IA 1NUHA 1E92A 1NHGA 2BHNA 1I1OA 3IJ5A 4FDTA 4YP7A 5JOQA 1X7HA 5B4TA 3HL4A 4QPZA 5I7VA 1DSSG 2OCYC 4QGHA 3QHPA 2R65A 3EAGA 4DKJA 2FEXA 1QVAA 2ZI5A 5IT9A 4YUYA 1JA9A 3RG2A 2ORED 5A05A 1E1KA 3LQ4A 3B6ZA 4CLRA 5AUQA 2GN2A 3CCBA 1I4OA 2RCNA 5AJVB 1PTJC 3JU3A 4G0QA 4MVJF 1LLCA 3AETA 5K3DA 3BE8A 1G8FA 3H5RA 3G2LA 5ALTA 2WAOA 1Y4ZA 5FO1A 1X9GA 2CVPA 3U3KA 4DG8A 4R6XA 3PXUA 3C3DA 4DNFA 3NEYA 1ZMXA 3STWA 3TN7A 1YACA 2CUTA 2W8BB 3KT6A 5H82A 5UKDA 4YCCA 3GEBA 1JDBB 1XSEA 3OESA 3O84A 2ZBQA 2RGXA 4LXTA 2QX8A 4O5AA 2WSMA 5GY7A 2P6MA 4DTCA 5FBWB 1YTUA 2AMLA 1R6VA 4KXFB 1S3FA 2BDEA 3QUBA 5A9TA 1UC5B 2GVZC 5TJ9A 2OO7A 4M1TA 4KIWA 4N0MA 5HCUA 4YQEA 4D99A 2EVWX 3ER8A 3P8ZA 1JG4A 3DEHA 5JXHA 3OJCA 4L73A 1DKUA 2CJPA 5A5FA 1E8NA 3N28A 4FLEA 1GT6A 4MW6A 3PR1A 2D5IA 3TRIA 4DZZA 4JVMA 2IBSA 1RJDA 1NBIA 1TAGA 2G6TA 3OX2A 4ROTA 2IYOA 5ALNA 1RM3A 1XT6A 4KFUA 4B87A 4GF5A 1F2TA 2ECPA 2FOIA 4DB2A 1GFZA 4RVFA 1IZ8A 3FMOB 3E8SA 5KAPA 4RMJA 2NUBA 2RHHA 3GAFA 5LKAA 1AVTA 4UNNA 1E2DA 4V1CA 2GR9A 3F1KA 3R8XA 4MJXA 1DKRA 5FLKA 1AN0A 5JG7A 3LQRA 2EW8A 2PUWA 3M1IA 4P4SA 3M6XA 4QFCA 4N0PA 3G82C 1X7WA 3KT3A 3PRHA 3ETEA 4Q3BA 3EDQA 4KOEC 3ROQA 2WUDA 3ZW7A 3R3HA 2CLMB 3A2KA 4C7OA 4RH3A 5LYYA 2UZ0A 1U90A 3LUDA 3SSAA 3ZY5A 5I7RA 3IT2A 2F8TA 3AL0C 1X2EA 1E0JA 2HQOA 3CVOA 4FGJA 4LBVA 1N5IA 3RLIA 1TT7A 4NAVA 1U99A 2Q6IA 2YYYA 1MC8A 4LVNA 3UM9A 1E5VA 5FHRA 4D9MA 4EI8A 1SQSA 4JEMA 3PNOA 2ZT6A 5EWMA 4ZGWA 5C8YF 2WTUA 3FDXA 5FL7D 3I3OA 2H08A 3RT1A 5HUJA 5LQAA 3AL2A 4PAGA 5E7MA 1QQTA 3WDKA 2J0UB 4DZRA 4EGAA 1JDUA 3JQGB 2A0FA 1XXHA 5KVSA 1HT2E 3GLQA 4WDQA 4ZI2A 2Z6AA 3GFSA 1AQ6A 4ED9A 4HAYA 2JIDA 2OXRA 4QBTA 1P2UA 2H48A 2A59A 3SN6A 4B8ZA 4X3PA 2H5LA 1VE3A 2VDWB 3A6JA 3LQYA 1OXSC 2A1TR 4GE3A 2WHQA 3CLTC 1OF1A 2QRLA 4V0RA 2VPXA 1YQQA 5TVGA 1QSGA 2PUGA 4OM8A 3N3AC 2ISCA 5C8YA 2DH5A 2F3SA 2JLZA 4PSKA 1ZIPA 3G2PA 5C7OO 2KWIA 3K96A 5DV9A 5K4AA 1H65A 2R8PA 3EXIA 3BWCA 3GEIA 3I0MA 5AKZA 3OFND 4CCAA 4PBTA 2NZJA 3ANSA 4FKZA 2ONCA 3UXHA 4GPIB 4LYFA 1QG2A 5JFGA 4WCFC 3V1YA 4ROSA 3W5SA 2NTVA 4JGGA 4XX1A 1R4NB 1IB6A 2O6LA 2ZDHA 2ZQZA 2OAGA 2Q3CA 3G7SA 1T6ZA 1M1UA 2X9GA 3M4YA 5I8ZA 1VIYA 2ID9A 5CEJA 1AJEA 2PGOA 1D2CA 1LY1A 2VNIA 2YNMC 4YAJA 5LR6A 3CMCO 1N33B 1L7OA 2O2JA 3I4CA 1KU6A 1P4AA 3FA2A 3QG5A 3UV7A 2EX1A 4MDYA 4Q1FA 2XE6A 4WMLA 1F3LA 5D85A 1UMBA 2EGUA 2Q5EA 3DFZA 4OFZA 2XUHA 2YVKA 3AHGA 1W85B 4PC3A 5EPUA 5H81A 3ZIUA 1SBYA 4C0QC 2QW1A 5KKCA 1P7VA 1RPZA 3GU3A 3GJ6A 2FW9A 4P82A 2Q62A 4RELA 4DCVA 4LI0A 2W9XA 4YAFA 4QLBA 2RDMA 1NFRA 2BELA 3D7NA 3SEAA 5J2UF 4O02B 5K3OA 3FCAA 3DMTC 3LUAA 4KJZA 1MAVA 2V4UA 4AY5A 1PEAA 1VRWA 1RIIA 4I9UA 4DMLA 3OOYA 1M1XB 4HT3B 1E2EA 4PHCA 3P52A 2ZJYA 3SJBA 2VP5A 5JNWA 4M9UA 3SHWA 1CKEA 1JAIA 2G9RA 3MD9A 2XITA 1T2DA 4I9NA 4JKIA 3DCYA 2WDZA 4ZD6A 1GHTA 4BO5A 2IH2A 1EBBA 2XTAA 2N75A 3CA8A 3QKRB 3QU2A 3LW7A 3P27A 1MOSA 2YHIA 4K0RA 3CR8A 4WNAB 4EG4A 1NN3A 2HXSA 2QTCA 2XBLA 3UKOA 2JEYA 3QPVA 1ZUD1 3MPUA 3H5AA 1N3LA 4YACA 1B2LA 5T4HA 3HWX1 4D9KA 4JBYA 5CX4A 3N6XA 2LKCA 3I2FA 3OPYB 3B6KA 4LDPA 1TOAA 1H3FA 1PUJA 4G5GA 2I54A 2WMYA 4RA6B 4DQKA 1FZQA 3T5CA 4WW0A 2H8KA 3ZV5A 2WF5A 1PWYE 4TMZA 2VYQA 4FX2A 5IT5A 1ZOIA 2CFIA 4QUJA 1E7YA 1QQ7A 5ARBA 5F3RA 4PICA 2ISSD 3EGDB 4R5HA 4X84A 2BMEA 4LQCA 1AF7A 2RG1A 1K9SA 1X87A 1M6HA 1QV7A 3VYWA 5DNVA 4EUFA 2PSHA 2PGLA 2P30A 4PXSA 1RAGA 2JHAA 4M86A 4TTTS 3NYWA 5IASA 4WQMA 1I51A 3CV3A 1E1NA 1OKKA 5DNYB 3K8QA 1L5NA 3NC0C 2GB4A 1U0OC 4CMHA 3E18A 4ECAA 5B3JC 4WZBB 2O3UA 2FW8A 5IAKA 1Y5IA 3LIPA 4ZOLB 2PPLA 2C2MA 4JB0A 4QBIA 2PSDA 4ZQGA 4ABYA 1RWMA 1SXHA 2XVYA 5AT1A 1DFIA 1XZIA 5FUBA 5EKTA 1TYZA 3AI3A 3KAJA 4LYYA 4DSNA 1FMLA 4EBFA 3OTIA 4QXPA 2QL9A 4DVGA 5JSKA 4KVZA 4DDUA 1DQZA 3VAZA 2TMGA 2B0JA 1WULS 4B3RB 5AOAA 1GNTA 1Y89A 1A8HA 2P9ZA 3G9XA 4LYJA 2RMKA 4EMUA 3WAJA 4RF4A 4MXDA 2EJVA 2DLNA 1JU9A 1RC1A 1EGAA 3GD5A 4LBZA 4OA5A 4QPPA 1ADFA 1Q1ZA 4C89A 3KJNA 3AUTA 1E4EB 2YY6A 2CJXA 2Z30A 5D5QA 3HMKA 4GLLA 4DLWA 5JAOA 2W42A 1WXHA 5G0VA 1C7JA 3WVNA 2Q4RA 4JJFA 1JZSA 1ZN7A 2JFNA 3BGWA 4JWKA 5DI3B 1TVMA 2D2FA 3DZBA 2IF0A 4HH1A 2H0QA 2IE8A 1L7EA 4WA8A 2ZJ8A 1XVTA 1XU9A 1WMDA 1YBFA 3O82A 2VEDA 3S2EA 2B1RA 3KHUA 3FD8A 1FY2A 1G2QA 2VF4X 4PX2A 5A1TA 2R1UA 4BMDA 4OSEA 3FF1A 3G2NA 1H8HD 2G5GX 4BMYA 4RXMA 5DM4A 4F3CA 2ZXFA 2W22A 4RL6A 1L5HA 3A26A 4CKEA 2QL5A 4J7XA 4KSCA 5AHXA 4Q5IA 4ZAXA 1UBNA 2H1FA 5A3QA 4ZV4A 4TGLA 1H42A 4HAWA 3CF4A 4YXWD 1Y42X 13PKA 1F0KA 1Z6PA 1D5CA 3THYA 3F2VA 1SXGA 3NLLA 4FDUA 3WRVA 4CKBB 1E58A 4V0NA 1EX6A 1SCQA 3I9NA 2KM1A 1ML3A 2FFJA 3F6RA 3IA7A 5KQMA 3VH4A 2QTVA 4D4IA 2JGDA 1YQXA 2PZFA 4AKTA 1KYTA 1TKAA 4QC2A 4TTRA 3TIIA 1SBQA 3MWKA 4XM0A 4MW9A 4WZAA 1CYDA 7MHTA 3WK4A 3OECA 1M2OA 3RNOA 4PPQA 4D82A 4YJKA 2I71A 2IPLA 3O9MA 1PJQA 4OXIA 5IN5A 4Q7QA 5A5GA 1X7GA 2FA9A 2XMRA 1OU4A 2UYQA 1P4SA 2FLKA 3PFHA 1QIIA 3PIIA 3WJ1A 3UMMA 2C07A 4ZO6A 2IBTA 2Q0QA 3SCZA 4DBLE 2QMOA 1K4KA 4BDSA 4K3UA 4L3VA 3GZJA 2QUBA 5L3QA 3G8BA 4O4HB 4P93A 4OVKA 5FQNA 5GONF 4QBFA 1BQ4A 2F6RA 2QRPA 4R1PA 3ZNOA 1TF7A 1TLTA 2V97A 3AUAA 5AJHA 4WKBA 1M2GA 1Y82A 4URYR 3RYIB 3S5UA 4LTNA 2WK1A 4YECA 3TRJA 5BUZA 3S99A 1SKMA 1C29B 3C6ZA 3QVOA 1XUOA 3T1TA