2P5TB

Molecular and structural characterization of the pezat chromosomal toxin-antitoxin system of the human pathogen streptococcus pneumoniae
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
251
structure length
244
Chain Sequence
IQDYTDSEFKHALARNLRSLTRGKKSSKQPIAILLGGQSGAGKTTIHRIKQKEFQGNIVIIDGDSFRSQHPHYLELQQEYGKDSVEYTKDFAGKMVESLVTKLSSLGYNLLIEGTLRTVDVPKKTAQLLKNKGYEVQLALIATKPELSYLSTLIRYEELYIINPNQHHDFIVNHLVDNTRKLEELAIFERIQIYQRDRSCVYDSKENTTSAADVLQELFFGEWSQVEKEMLQVGEKRLNELLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords fragment of PezA helix-turn-helix motif
publication title Molecular and Structural Characterization of the PezAT Chromosomal Toxin-Antitoxin System of the Human Pathogen Streptococcus pneumoniae.
pubmed doi rcsb
source organism Streptococcus pneumoniae
total genus 86
structure length 244
sequence length 251
chains with identical sequence D, F, H
ec nomenclature ec 2.7.1.176: UDP-N-acetylglucosamine kinase.
pdb deposition date 2007-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06414 Zeta_toxin Zeta toxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2p5tB00
1TF5A 4XD7A 1G7RA 4TYYA 3EZ2A 3L0IB 4PXAA 3ZQJA 3MLEA 5KSYA 4MKHA 4F38A 3OZXA 3A8TA 4DZZA 5DO9A 3NHBA 4DWJA 4IFBA 1ESNA 2FPKA 4D2IA 4RFVA 5CJPA 2AHOA 3WYAA 4ZI3A 4GP7A 3PUYA 4GMDA 1ZD9A 2QENA 5DN6A 3AF0A 3WNBA 5J47A 4G5RA 4LBVA 1UEJA 1X3SA 4V02A 5CYPA 2JLRA 4CRWB 4B74A 1DAFA 2KJQA 1CJKC 2BBOA 1T0JB 3RSLA 4HSEA 1Z6AA 5K8TA 3LBIA 5J5CA 5EQTA 3TAHA 5AUOB 2HJGA 3QKUA 2JASA 1XZQA 3LY5A 1NLZA 3ZYCA 1N0VC 5J4LA 1NJGA 4EPVA 3DM5A 2YC4C 4Q7MB 1KI7A 2GTPA 3C5HA 3TQCA 3ADBA 1G5TA 2F43B 3CR7A 2E9SA 1G9XA 1RVDA 5JLJA 2EWWA 3A1SA 4JLJA 2AX4A 4D25A 2WOOA 2BMDA 4W9MC 5IK2A 4JBYA 1Z83A 2WWYA 5G3ZA 4DB4A 2P65A 2QA5A 2X1VA 1CJMA 4BE7B 1KO4A 2GEDA 3LRPA 4G0NA 4URXR 4OI2A 3HU3A 1WDTA 2JIZA 3AVYA 4O0MA 1RYFA 3W9YA 3Q5DA 2ONKA 4MKGA 1R5BA 1G7TA 1CXZA 3R20A 3AB3A 2XITA 3EA5A 3CRRA 4I99A 3ZS8A 1KSFX 4A1FA 3BAFA 3GLIB 2AWOA 2R6GA 1I2MA 3QJYA 1A2KC 3SYNA 4B3FX 1Z2CA 2QMUA 2BM1A 3T06B 3RYTC 2AD1A 3PFIA 4XWKA 1E2HA 3VR5A 4IDNA 1EFHA 2J1LA 3U3RA 3DMDA 2QI9C 1EK0A 1XU4A 4MGYR 4O25A 5CLLA 1IN5A 1YR7A 4IRUB 3MD0A 4AYTA 4BZPA 2C98A 1SKQA 3EWSA 4JL8A 1TQ2A 4YLGA 5HZHA 2J0QA 4W5WA 3L0OA 4TYQA 4P4SA 5FPSA 2WPDD 4LHYA 2C77A 3RC3A 4UNRA 2ZREA 4JLAA 3IUYA 4N1AA 2QL6A 2ZEJA 1IJFA 1KK3A 3DKPA 3KFXA 4ZV4A 2HXYA 1G8HA 2WTUA 2QQEA 4X8HA 4QFMA 2Z5FA 1SXJA 1UF9A 2IXGA 4BFUA 5E4FA 4FIDA 3TBKA 1CLUA 3B78A 3EIQA 4BQSA 3PEVA 3BIFA 5L3RA 2FEOA 1G20E 2ZRFA 5H68A 1NI3A 2IYSA 1UBEA 3M4YA 3C8UA 4TWZA 2C9YA 2MSCB 2D7DA 4Z1MA 2REBA 4G3XA 5KNCA 2PCJA 1DG1G 1TAGA 1YZLA 3CM0A 1G8PA 1TQ4A 2YINC 4HLQB 4WZ6A 1E2QA 1MH1A 2XOKD 3FKQA 1HH4A 1ZU4A 2F1IA 2FSGA 3SC3A 4LBYA 4URUR 3BFXA 4X8MA 4NYIQ 4RD2A 5CIQA 4AKGA 5AUNB 1JBKA 5KDDA 1X86B 3PR1A 3NC0C 1XJCA 4DSNA 4OI4A 3CNOA 4NZYA 3GJXC 1A4RA 4CF7A 3N70A 2EYUA 3EPLA 3GP8A 4HLCA 1XTQA 2XZLA 1QBKC 3VKGA 1E2JA 3IKJA 4DCUA 3QF4A 1ZVQA 4XWOA 3X1WA 1ESMA 1NNEA 2DB3A 4QHTA 3GFOA 2A2ZA 4PTLA 4KV9A 3U6BA 4MUAA 3MG9A 2XSZD 1U8ZA 3VU9A 2B8WA 1JNYA 3ZVMA 3B13B 4A6XA 4BUJA 2I1QA 3BH6A 4QBIA 1OH8A 2XTZA 3QXCA 3CKLA 1UKYA 5EZ6B 2GF0A 5H70A 2QROA 3NG1A 1S96A 1FP6A 4F91B 4JSTA 3I5YA 2QZ4A 1TEVA 4KITB 4HATA 4URVR 2ZJ8A 4N0EA 5JCZA 4LHXA 1L4YA 1KO1A 1DAHA 1WF3A 4IXMA 1QHHA 4QJ5A 3RRMA 4DLVA 3IPXA 3GEIA 1A1VA 3NDPA 4TQ9A 2OFOA 5DH9A 1G8YA 1A5TA 4PHTA 3KX2A 4QXAA 1ZP6A 2H1LA 1SKYB 4MDEA 3OIWA 1G6OA 4TZ0A 4QBHA 3O47A 4NYMR 3CPJB 2RGBA 4UQOA 2GEVA 1DO2A 4L9WA 3JVUA 3K0CC 4DKXA 1X8JA 4A0FA 1TQ6A 3AVWA 1GRNA 2VHQA 2QGZA 2CL6X 1II8A 3JZAA 4B3CA 4LK2A 2QY9A 1FUKA 1BYIA 1GZSA 1Q0UA 3B1ZA 3A58B 3IILA 4KSCA 4MRRA 2QSZA 2WJGA 1MO3A 2CXXA 1MO6A 2OBLA 4Q7LA 3OIYA 2Q0HA 5CYOA 1QVAA 4CIDA 2HT6A 5DHAA 3RABA 3IBYA 2ZRNA 1NVWQ 1D9ZA 1E4YA 2GZHA 3MJRA 1XP8A 3AVUA 1LF5A 2BMJA 1LV7A 5JSZB 3BH0A 2A30A 3FMOB 4TLDA 1XZPA 4IDPA 2G3YA 1HTWA 3GFPA 4OQFA 3EZFA 1IN6A 4KFSA 3THYB 4RD0A 1JEEA 1GRQA 3WP1B 4LBZA 5ANRB 4JVNA 1KDPA 1ZCAA 2IA5A 1MRNA 1L7VC 1N6IA 1CBUA 2OCYC 2R6AA 4IKEA 1P75A 1VIYA 2ZM5A 1E2LA 2IEZA 3FKSA 4IVRA 3P1JA 2JLYA 3VHXA 3UG7A 1DE0A 4OJQA 3T15A 2W6JD 1FPMA 2ZUBA 3U2QA 1CKEA 3EC2A 1N6KA 1P3JA 1XFAA 5E7IA 4DUGD 8OHMA 2FFHA 2G83A 3SQXA 1UAAA 1UDXA 2JDIA 1XCMA 4A0HA 2FSIA 2D2EA 1JJVA 4C0JA 2ZRCA 5A5GA 2IF0A 4DCNA 4B48A 3CX8A 5IRCD 1SVIA 4EUNA 1ELOA 1XB2A 2IHYA 2R62A 4TLCA 5E7MA 2CHGA 4NCIA 2YWGA 2J41A 1LNZA 3ONWA 5FBLB 3RWMB 2GJKA 4OHVA 4FMBB 4DLTA 3UATA 1S3SA 1ETUA 2AKAB 3MWKA 4MYCA 1UM8A 1ZRHA 5EUMA 4BFYA 3U44A 1E0JA 4OI0A 4HB4A 2ZE8A 2W6IA 1UPTA 3Q5EA 4M9QA 5FOSA 2W2VA 1GM5A 1ZBDA 1WP9A 2XXAB 4AI6A 2P2LA 1KMHA 2AK2A 4LHWA 3ASZA 3TUIC 2FF7A 1QHIA 4OKSA 5LBIA 1ONBA 2JGNA 3CF2A 3IIKA 2C95A 1QG2A 4JYCA 4YMWA 4LHVA 2ZSBA 2P6UA 2FU5C 1U94A 2BEKA 2J46A 2QRZA 4QL3A 3PQCA 2VPPA 3AVPA 3QXHA 4CEHA 1JR6A 4NHOA 4UNQA 5FL3A 3Q85A 3TVDA 3GLHB 2WV9A 2DFNA 3EASA 4EIWA 2CNWD 4AD8A 1Q12A 3NC1C 4B47A 2J0SA 3F0TA 2J7PA 2X2FA 3K0EA 1NMXA 2OSBA 4UNNA 5P21A 4S35A 2V6JA 1QRAA 5HKKD 1EX6A 1GAJA 1OYYA 2NOAA 2NTYC 2LKCA 4Q4HA 1ZNYA 2REXB 1E0SA 2VP0A 3CO5A 3IQXA 1WB9A 2ERXA 2PT5A 4IEEA 3SI7A 1C4OA 4URWR 4Q9KA 4EPWA 1E9SA 3EZ9A 4A9AA 4ZDKA 2CMKA 5FBWB 4EDHA 3SJAA 4MGIR 5KOYA 3ZIAD 3EIEA 3GJ3A 1RJ9B 421PA 4E03A 1P2SA 5DI3A 3UWOA 2WHXA 2OILA 5K8LA 2VP5A 1N5LA 3QBTA 4AC9A 1G18A 4A0RA 1OT3A 3ICQB 2G77B 3LXRA 2WKRA 4MRNA 821PA 1RE0A 3K0AA 2P5TB 4JLKA 4Q47A 5HCNA 4CEJA 2BJVA 1OIXA 4DLYA 4QOSA 2VL7A 3BWDD 3UXMA 3O8BA 2ONJA 3TIFA 3QF7A 4C30A 2VQSA 4XIGS 4JL6A 3EIHA 2GJSA 2ZRLA 2ZSFA 2A5GA 1IM2A 3QPVA 4C7OA 3L82B 5J4KA 5ELXA 2YWFA 1TL7C 4RZXA 2QTVB 2WKQA 3AGPA 1AKEA 2DWOA 5IDVA 4K8OA 2BKEA 3Q3JB 1F2TB 1U9IA 3QQ5A 1AS3A 3NBXX 3CB4A 4M21A 1ODFA 4WIAA 4UJ5A 4DLWA 2AKYA 2AN9A 1W36B 2RAPA 1M74A 4IFEA 3RRNA 3NXSA 3TUZC 1EFRA 1KNQA 3GJ8A 2KSQA 4IW3B 1JAHA 1UBFA 1NJFA 3T1VA 1W4AA 1NKSA 2PMKA 1BOFA 4TL8A 3LA6A 3QG5A 5JEEA 3GLFE 2IHBA 1XTIA 1GL6A 1OE0A 4BLSA 3I61A 4QNMA 4JLOA 3PITA 4MGKR 4MRPA 4BFWA 2FOLA 3QOFA 1E2IA 1YVDA 5SZJA 4DCVA 1E1RA 2R44A 3ZJYA 3NH9A 2C78A 1SHZA 2FJUA 3Q7PA 2WWWA 1JQLB 2GBLC 3MCAA 4QKQA 1M1YE 2YHSA 1GUAA 1VG8A 5CITA 3KKPA 4Z8YA 1XCPA 3RNLA 1X8KA 1UKZA 1HT1E 4PC3A 4RZ3A 4LV8B 3TUJC 1DAGA 3SNHA 3OEEA 4JMPA 1Z22A 4NYMQ 5FL7A 3DHWC 1Q21A 3ADDA 2QMHA 2ZETA 2BVNA 4FW9A 1HYQA 2V55B 4QGFA 3KJHA 1CIPA 1FX0B 2QUZA 4RZ2A 3VQTA 2O8FA 2ZVPX 1VMAA 2ZYTX 1G7CA 3OFND 2ORIA 4UXHA 3R9XA 1KSHA 1GSIA 5J40A 4BECA 3QKRB 1A82A 3DKVA 4LJYA 4IOKA 1Z8FA 2FZ4A 2NQ2C 1N0WA 2X19A 3PUXA 1HURA 2CE2X 4U5XA 2HT1A 1KDRA 3PENA 1G3RA 2OXCA 2MSDB 5EUQB 4PQYA 3SFVA 1XMIA 2CK3A 2QM7A 5TMPA 3IGFA 4ZIRA 1NY5A 4LPKA 4YDHB 3CONA 4XTRA 4PC7A 1H8ED 1ZM9A 1NBME 3IIMA 1U0HC 1GKYA 2WJVA 2QQ0A 3AKDA 5KDOA 5HCIA 3QKSB 2V7QD 3I92A 4AY2A 2N46A 5BYKA 2KB0A 3GLFB 4OHZA 1R4AA 4F4IA 3QBVA 4GT1A 1T8UA 3OEHA 5D3MA 4JLDA 4HAUA 4JLMA 1W4BA 3P26A 3B1WA 4B33A 3SJBA 5JJKA 4DRZA 1CR0A 4PANA 2DWPA 1XD2A 1M2OB 2ZRJA 3AKCA 3BFKA 3LX5A 3QY0A 4A0GA 3CUEF 1UDWA 1OFIA 5JWRA 5KU1A 2PEZA 1WE2A 5IF9A 5J4HA 1JR3A 2GJAA 3BJIC 1Q1QA 4Q4JB 1E2GA 1S0UA 2F9MA 2GNOA 4AKEA 3THXB 4TT3D 3KTAB 4FINA 4NU0A 1AGRA 1T5LA 1VCOA 2F1HA 2QPOA 1NKTA 1XPOA 3RSOA 4JBWA 1U90A 1XD9A 2NO7A 1JPNA 4C0KA 1OIVA 1T4GA 3S1AB 4BLRA 4QBFA 2ZROA 2HDNB 2A9KA 1FFHA 4BRUA 5TDHA 4EJSA 1N6HA 1MABB 3KKOA 4EFMA 2FFQA 3LX8A 2IYRA 4BLOA 3LW8A 4WXRA 3MUFA 4HAXA 2OFWA 2WZQA 4B35A 5EP2A 3AP3A 3QNUA 4YMSA 1G3QA 4ZPXA 4HZIA 1ZM4A 1NN5A 3CR8A 2V4ZA 1Z3IX 1GITA 4X8LA 4PQRA 2NIPA 5F9FA 4GZLA 3FHOA 2HCJB 2ZYUX 4BRWA 1XMJA 3SFZA 3I3SR 1DO0A 3LVRE 4BEJA 4ZCMA 3C15C 3THOA 1ZIOA 5JEDA 3RWOA 2FGJA 5FUXA 1JI0A 2WMNB 4A8JB 3EPHA 1QHSA 1E98A 1SHKA 4ZDWA 5FOVA 2RGNA 4GI7A 2D74A 2JATA 2QT1A 4D82A 3NHAA 3N2IA 2E1RA 1HEIA 3ZGXA 3U60B 1W44A 4US1R 2D4HA 5L3QA 1MRSA 3AKEA 3GD7A 4JBXA 1OHHD 2CCGA 2FN4A 1ZD8A 4ZKEA 2BMFA 5L3SA 1Q44A 4R71A 4LYJA 2ZRMA 121PA 1KO7A 1DEKA 1M7BA 2IS4A 1IY1A 5K8UA 3QXSA 2FSHA 5D3QA 4Q02A 1KY3A 3W90A 2Z4SA 4LV5B 3A4MA 5EZ5A 1IQPA 3HU1A 3FMFA 1JEDA 2RHMA 4DEYA 1FMLA 4S2EA 2P5SA 1Z6YA 5M04A 4O2LA 2JLSA 4DT1A 4DVGA 1HV8A 2ZAOA 2CLSA 2QM8A 1SXJE 2ZPTX 4LY6A 4PPGA 4B3DA 1D2MA 1OH7A 4BLQA 3VX3A 4LJ5A 1XJQA 1XRJA 3CNLA 1I4LD 2V1UA 1T3SA 1LFDB 2CBZA 3OAAA 4FMCB 5KNBA 4MRVA 5DYGA 1BMFA 4EAQA 1XTJA 2FZLA 1ZAKA 2F1RA 3CRQA 2GVZC 1Z6GA 1C9KA 2HEIA 2QPTA 2G88A 1KOFA 3IHLA 3B2EA 4UXIA 2QE7A 3VFDA 4JKIA 4QM6A 2YOHA 3BOSA 4MITA 1OFHA 2FNAA 2JLWA 1E69A 3OHMA 1W36C 1P60A 2H16A 3A1WA 2IUSA 3TQFA 1SVOA 1YZQA 4EFLA 5GJBA 2ANBA 2EFCB 4ZO4A 4HYYA 4M1MA 3SR0A 1P9NA 2O5VA 5H1YA 2QAGA 3R9WA 1YE8A 3T1QA 3MWLA 3CNNA 4M1SA 3VR2A 3KFVA 1RRPA 1GIAA 2A5DA 3BH7A 4YMUA 2P0EA 4HLDA 4NL4H 2DFLA 1OSNA 2EW1A 2RCNA 3U3MA 3KZ1E 5EP3A 5GJVC 3REGA 2AFIE 1LW7A 3LH5A 1II9A 2XNDD 5BXQC 4XH9B 1ZYUA 5HTKA 1BIFA 1M7HA 1OXUA 4WOPA 1SVWA 4B34A 5LD2B 4UNPA 4B6FA 3Q7QA 4BFZA 3K1JA 2ZRBA 3ZZ0A 2VBCA 4NKRA 5KDLA 3NBFA 5CM8B 4P0TA 4PZZA 1Z6TA 1XEFA 3GJ4A 5DGXA 4TSFD 1I4TD 1VG0B 4F92B 2R65A 1E79D 1SXJB 4JS0A 4LYAA 4TZ6A 3FHCB 1FUUA 1T3HA 2ZI6A 4O2RA 4EJSC 2WIAA 1P2TA 4PHFA 3KXIA 4HEJA 4LZZA 5JRZA 2PT7A 2JJ2A 1JALA 1VHTA 3BS4A 2NO9A 5E3HA 2OCPA 2FPMA 2VSFA 1KO8A 4PPFA 3OIVA 4YQFA 2ZS8A 5CB6A 3SBEA 3PUVA 4MQBA 3D7MA 1W0JD 4JLPA 1VCIA 2ZU6A 2CVHA 2W00A 3QG1A 4C3ZA 5JS8A 1N0UA 4AYWA 4DDWA 2KWIA 1WBBA 4B2IA 3OF5A 1ZU5A 3D31A 1LB1B 4QNRA 3B1YA 1G64A 4C9BA 2YKGA 2OCAA 1OPXA 2G0NA 1XMVA 3L2OB 1TEXA 1EWRA 3C7KA 2OE2A 4KVGA 1U2RA 1US8A 3FB4A 3K09A 2O0KA 4RKFA 2ZJBA 2OZEA 3O8RA 2RGAA 3M1IA 4XJXA 3ICEA 1NP6A 1QHXA 1X8LA 2PCLA 3BFVA 1R8SA 3Q9LA 5SZIA 2R6DA 3A4LA 4A82A 1OW3B 1XTSA 4NCNA 2IYQA 4CDGA 1V5WA 2I3BA 2FV8A 1M7GA 2G1JA 3IO3A 4AYXA 1NG9A 3KL4A 3VU9B 3K0FA 2O0JA 1FP7A 2EFHB 5IT5A 5UKDA 4ASUA 1N5KA 4Q19A 4PPQA 4ARZA 1KY2A 1N6RA 1WMSA 4PX9A 2BMEA 4OQLA 4Q1FA 4P32A 3U4QA 3DPUA 2FG5A 2V6IA 1P2VA 3WRYC 1KNXA 2GDJA 4I4LA 4WW0A 1XF9A 4W7SA 4EQ6A 1ZINA 4LWZA 5DNYB 2WAXA 4DJTA 3CX6A 2N1BA 4W5JA 1DAKA 1D6JA 1XJ0A 1QHHB 4Q1DA 4GDFA 2VLIA 4C0QC 2W2TA 4OK6A 1EWQA 3MAAC 3QXJA 1XXHE 2FPLA 2ZI9A 1VCMA 5JJIA 3RVBA 3I32A 3R7WA 1NLYA 4LJAA 1TNDA 4V0LA 2C8VA 4NE2A 4CEIA 1OH5A 1FMJA 2YWHA 4A8JC 3P27A 3TGPA 1IY2A 3BRWD 1W46A 4IDOA 3NEYA 4OHYA 1IXSB 1II8B 1DPFA 5C18A 1ZC4A 4Q48A 4RY2A 2XZPA 2CEAA 1KI2A 1W2GA 3W5IA 2PLFA 2BBSA 2QTHA 3K70B 2ZI4A 2QAGC 3ADKA 4POAA 3CBQA 4PFSA 4Z54A 1IXZA 2EYQA 2KBFA 1AIPA 2PZFA 3MWYW 4ON9A 4M4SA 2IF2A 3RHFA 3DOEA 4A15A 1E2DA 4EPTA 4OI1A 3PEWA 4AKIA 2ZI7A 1Q3TA 2CL7X 3K8YA 3I1FA 3FE2A 1XX6A 1CS4C 4KHZA 2WPDA 1FNMA 2GXAA 2NZJA 1I4DD 3AF1A 4TL9A 2OESA 1G7SA 3SJZA 1ZUHA 4TLAA 3QEJA 4DLRA 1G3MA 1F5NA 1PLKA 1P62B 2XTMA 5EE5B 2W58A 4Q9LA 1EX7A 1F60A 3TW8B 5G3YA 1JXOA 2G1KA 3O8CA 2RH5A 3KJEA 3KQLA 4NPHA 4NTZA 1RIFA 4PSKA 1Z06A 4OBEA 3FOZA 4V0ME 2J0UA 4PO9A 1MT0A 1YZTA 5E95A 4BLPA 2XOKA 3TK1A 4Q03A 2WWFA 4QBGB 4LHZA 5JMTA 2JLQA 2BV3A 5DI9A 1YR6A 2AD5A 1KI1A 2VF7A 2ZRDA 2BKUA 3ETLA 1E9FA 4QHSA 4D4MA 3G0HA 2CJWA 2VIIA 4OHWA 2W0SA 2QU8A 3U44B 5LDDC 4TMWA 3PV0A 1E4VA 1QVRA 5AJVB 1KJYA 4IDQA 2RGDA 4BFVA 1TPZA 4XVQA 4LGMA 3B9QA 5C1BA 1KMHB 1GTVA 3PUWA 2Z6VA 3U7EB 3VKWA 2FDCA 2WOJA 5JBQA 2O8EA 1EGAA 2DFTA 2ZE6A 2VHJA 3RLFA 3BGWA 1EFCA 3I72A 3KKMA 4PC6A 4LDJA 1CJTC 1ZM7A 2WJHA 3K53A 2PL3A 2XSZA 4JJKA 4JKYA 4KLZA 2ZRKA 1FTSA 3SZRA 3H2YA 3OESA 1VHLA 3PIRA 2FA9A 2OBMA 2ZR7A 3FPAA 2OLKA 5EXSA 1S9DA 2YC2C 3ND8A 1VYVA 5LD2C 1P4SA 1F3OA 4TL6A 4B75A 1OXVA 1JJ7A 4TLBA 1RPZA 5JHGB 4MYHA 1WBDA 4XVUA 2ATVA 3DEFA 1IOZA 1D9XA 3LXXA 2O8BA 2JCSA 3AVTA 4JJZA 3X2SA 4EPYA 1NSFA 1OFTA 4M1OA 2GWHA 5KTYA 1CF4A 3WY9A 1Z0FA 1SXJC 3P4XA 3BD9A 2CLDX 1DELA 2D2FA 1W0KD 1XNJA 4Q4HB 1M6NA 2N42A 3NTUA 2ZITA 4XSGA 4KAXA 4DLSA 4FMDB 3TSWA 1P6XA 3B60A 4HAVA 1RRFA 2GCPA 2QGNA 1KSJA 1Z08A 1KKLA 4BLTA 4B44A 621PA 2C03A 4CZ2A 1XXHA 5TY0A 1E3MA 4DIDA 2QMEA 2WAYA 4F93B 5J4YA 3U6KA 5DI3B 1YZUA 1E94E 1U0JA 1PV4A 3R8CA 4Q4LA 3EAQA 1G17A 3U7HB 1MKYA 3K9GA 2VP6A 3B1VA 4I1UA 4JL5A 1S3GA 1ZC3A 4Q1CA 5JHHB 1HA3A 4MKFA 1AA9A 1KJZA 1CR4A 3K0AB 4NCJA 4F4JA 2FX3A 4CEJB 1ZJ6A 5EXXA 3TVTA 1SGWA 4EKDA 4R9UC 4Q4AA 5FTLA 3VR3A 1JB1A 3PVSA 3OE7D 3W3ZB 2QBYA 1KZGB 5IHPA 1G8GA 4DB2A 4H1UA 1E0KA 3KDSE 4CVNA 4JT2A 1OXSC 4D80A 1A7JA 1W49A 3V00A 2ZRAA 3KB1A 1L2TA 2QT0A 3EZ6A 5DYIA 2EU8A 1ANKA 4RZUA 4C7OB 3PEYA 4EFNA 4RFSA 2XX3A 3IIJA 1RZ3A 1E1QD 3B8HA 1NN0A 2DFKB 2FSFA 3W5JA 3W6OA 2OBNA 5CB8A 2BEJA 3AVOA 1GWNA 4A6PA 3SHWA 2IX3A 1V43A 1PJRA 3EA0A 1G21E 2ZJ5A 3UANA 1GNQA 4D4JA 4TMKA 2P6NA 2V1XA 4Q00A 3IEVA 2J59A 4L5BA 4KI0A 4G5SA 3G5UA 2WWHA 2IWRA 4M9XA 2ZR9A 5JSZA 2WJYA 2W6JA 1DARA 3RS7A 4DUGA 4LOAA 4KFUA 2W83A 3H0KA 1G8FA 4B76A 2VP4A 5FBVB 3EG5A 4BFXA 4KCGA 5FOWA 5AJXA 3CIOA 4XOIA 2ZTSA 4V0MA 5DLQC 1E2MA 1R6BX 3T5DA 1FL9A 1JR3E 5B30A 3MMPA 1KAOA 4YXWD 2O8DA 2C04A 5B64A 4NYJR 2MMCA 1BO6A 3C16C 4WAUA 2ODNA 1I2DA 4OK5A 5CLQA 3V4FA 2VTKA 2R6CA 1OKKD 4RD6A 3VR1A 5HE9A 3VMFA 2H57A 3WXMA 2H92A 4KBFA 4MH0R 3RANA 3ZQ6A 3X1DA 4DHEA 3ZZTA 2EFEB 2DCUA 2J5XA 2F1JA 2FGKA 2O8FB 3K70C 2K5UA 4GOKA 3AF4A 1ZM2A 3SS8A 2G6BA 1H8HD 2RGXA 3QSYA 1FTNA 4D6PA 4NP6A 4KYIB 1YU9A 2H17A 4RD1A 5C2JB 4PO1A 1EESA 3SE0A 2D3WA 3W8NA 4C0BA 4FCVA 5KSOA 2AXNA 1JAIA 3DZ8A 2DPXA 1ZCBA 3HP1A 3RRZA 2CNWA 3HDTA 4IDHA 1W2HA 4G1UC 1S4QA 2WSSD 4DCSA 2Q9AA 2IT1A 4F4CA 1NMYA 2C2HA 4R2IA 3NEJA 3HR8A 2IYVA 3GFTA 4RJLA 1T5IA 4TL7A 2PBRA 1G6HA 4FD2A 5AWFC 3N5CA 3E2IA 3FWYA 2ORWA 5D3MB 3VHLB 1U99A 2B7BA 3DM9B 2V9PA 3AQ4A 3BB4A 2UZ3A 3FFAA 2CK3D 2AL7A 2F55A 1XD2B 2Z0MA 1NN3A 3QENA 1W36D 1TU4A 1D2NA 3SN6A 3W8RA 2ZE7A 1G41A 4BWYA 3IHWA 2RGGA 1ZIPA 1AS2A 1GRRA 2LKDA 4WVFA 1TADA 1P72A 1HY3A 2H8KA 4A2WA 2O8CA 1F2UA 2ZRIA 3LW7A 3WBJA 1Z0JA 5KPDA 1W4RA 5TVKA 3DMNA 2D06A 4IHQA 1TUIA 1XPRA 4OHXA 5JRJA 4ACAA 3I62A 4URZR 2CL0X 1T3LA 4YDSA 3D3QA 3WNCA 2RMKA 4EJSB 1EFUA 4F7WA 2GK6A 4I1SA 4IVQA 5HZKA 1E2NA 1QG4A 3LLMA 1E2PA 4IVPA 3K9NA 2Z4RA 4BFSA 4Q9IA 4L8GA 4QRHA 2GJ8A 1T9HA 2IS6A 1TF7A 1KI6A 2CVFA 1G4AE 1COWD 3ADCA 5CJ2A 1AJEA 2OXRA 4TTPA 3SBDA 2ZVQX 4UXJA 4CT5A 4G5QA 1Z2AA 5BN4A 1Q1ZA 5L8VA 3MRSA 3NBZC 5G40A 4TLEA 1S8FA 2YNMA 5KYKA 2RGEA 1J99A 2CHVA 2OT3B 2CHQA 1E6CA 1E2EA 1G5RA 3MWJA 2J9RA 4PAMA 1SVLA 5L3QB 1CEEA 2WM9B 5FR2A 4XSHA 4E09A 5GJWC 3AVXA 3WBKA 2KI5A 1ZM3A 4JLBA 2OLJA 2B8TA 1DS6A 2GA8A 4JVLA 5L3SB 2R8RA 4GSYA 1VPLA 2Q3HA 1Y3AA 2JJ1D 3FFBA 2J3EA 2PX0A 3CRMA 4QC2A 4P4UA 4B3XA 5G41A 2VSXA 3GLGE 1C1YA 4P4TA 4C0HA 4ZI2A 3WMFA 2A5JA 5E7JA 4HUQA 4RD3A 1X6VA 4C2TA 1MO5A 2P67A 1O87A 3B1XA 4LJ4A 1YQTA 1TTTA 3EW9A 2B92A 2RB4A 3B82A 1XMSA 4DT1B 4JLNA 1ZUNB 3OFNA 2GILA 1KI8A 4A4DA 4G5GA 3I5XA 4M1KA 4FWIB 1HUQA 3FMPB 1KAGA 4LC1A 4ZCLA 1J70A 4QM7A 1Z0KA 1QF9A 3GQBA 2HLDD 3V9PA 1L4UA 4TYNA 4DLUA 1Z0DA 4JT4A 1NF3A 4C0SA 2FMXA 3WYFA 4Q9HA 1K5GA 1E32A 2ODWA 4GFDA 1G3IA 3UG6A 2GF9A 2QAJA 5BQ5A 5JECA 1H8EA 1Z28A 1U9IC 3I4LA 3CZPA 3GJ0A 2HCBA 2VH5R 5GVRA 5AJWA 1W7AA 3FHTA 1NLFA 2IYWA 3DL0A 2V7QA 5SZHB 4Y0AA 3VNUA 3T5GA 4C0LA 2ERYA 3LD9A 5FTMA 1Q1BA 1X1SA 2A78A 3AVQA 3LV8A 3F8TA 1O3YA 4PHHA 1DG3A 1OIWA 1U8YA 1W1WA 4DDTA 1Z63A 3RC8A 4EPRA 2QAGB 1NY6A 3U7FB 1CULC 1MV5A 2FH5B 2J7KA 3EPJA 2G0TA 3ZDQA 1AQYA 3BERA 4GNKA 4HB2A 2P6RA 2IK8A 2BBWA 3B6EA 2QE7D 5FBQB 1OXTA 1ZMXA 2HYDA 4KFRA 4LI0A 3TSOA 4KJZA 2JLVA 3A4NA 3X1YA 1IN7A 1MOZA 1TQDA 3CW2A 2ZS7A 2CCKA 3BE4A 4TT3A 2JLZA 1GVNB 4Q01A 5EJEA 1NBMD 1X1RA 1U8AA 2B6HA 3GJ5A 3KUCA 3PEUA 1VYTA 1JXMA 4OK3A 3K0SA 4NYJQ 2REOA 3RDPA 4XD7D 4FCWA 4WZAE 1KYIA 2BC9A 3AEZA 4MYTA 1CR2A 4P3YA 2WWIA 1KZ7B 4Q21A 3TAUA 4W5HA 3EX7C 1LVGA 3PXGA 4GOXA 1J8MF 3L43A 1KHTA 2DBYA 3NWJA 5FPYA 2KBEA 2GKSA 5JZVA 4Q4JA 2PJZA 2AK3A 5TARA 4WBSA 4A92A 4JYBA 1UKEA 5JI3E 5DN6D 2JJ8A 1S1CA 1UBCA 1WCV1 3KTAA 4DIEA 1XEXA 3MGCA 5BYJA 1Q22A 3FTQA 3PJRA 5CDFE 3IBGA 1VG1A 4M1YA 4FWTA 3W3AA 3SQWA 3F3YA 3S1AA 1ZNXA 2CDNA 3KJIA 2VA8A 1F6BA 2XGJA 1OJLA 1VG9B 3BC1A 4R7ZA 1S1MA 2IL1A 3AF3A 3U3KA 2ZR0A 4AURA 2GVDC 1R5NA 1XBTA 2QEQA 1IONA 2AWNA 2YOGA 1R2QA 1US8B 3KXKA 4PAOA 1OHHA 3ZVRA 4Z51A 2JJ2D 5TV2A 1NIPA 4B43A 4QGHA 5CIWA 3T1OA 5IK2D 3AUXA 3FVQA 1LS1A 3ZLJA 1N2CE 3SHFA 4ESHA 2JAQA 4ZCIA 2VHUA 1FOEB 4NCKA 4D81A 1B23P 2JIZD 1SVMA 1VIAA 1XEWX 2GCOA 3GLIE 1P9WA 3GLGA 3E5HA 4HLUA 5AUPB 4DBLC 2NZ8A 4DEXA 4LUCA 3K0FB 2J0VA 3H1TA 3HU2A 1Z0AA 3PCRB 3TR0A 4DDUA 2HYIC 4MDFA 1Q3HA 1GP2A 3AGQA 2XJ9A 3HPQA 4P4SB 5C4MA 4ARZB 2DHRA 2CLCX 3C14C 1KI9A 3U4QB 1W48A 3ZS9A 3U61B 5AJZA 2QP9X 3X1ZA 4AG6A 5F9HA 1XCGB 2F6RA 2P3SA 4EQ6B 4PPNA 3QXXA 1IY0A 4HAZA 2WVJA 1BKDR 1B0UA 4UJ3A 4HZUA 4BGDA 5KNDA 4OL0A 4OJKA 1RC8A 1IJEA 3JZMA 2IWHA 5FFMA 3RAPR 3W6NA 5C46F 3D8BA 3O8DA 4KLNA 4JIMA 5AUQA 3THWA 3P32A 4ASUD 1YJ5A 1IXRC 2HXSA 3P20A 3R7WB 4HUTA 1YZNA 4ZDIA 4G5OA 3DO6A 2F3RA 5FBRB 1KSGA 2QTFA 4AWXA 4CEIB 4Q9JA 1R0ZA 2HUPA 2ZYVX 4V0OA 2AXPA 1G19A 1GOTA 3FMIA 4LSGA 4TTQA 1SXJD 2W0MA 2RGNC 4QHYA 3CX7A 5HE8A 3A36A 1K8RA 2I1VB 4ZKDA 4PO8A 3L0SA 3K9LA 2XNSA 1D5CA 4IXNA 3QF4B 1Z29A 1N5IA 3H86A 1KJWA 1ZUIA 2XB2A 4Z1MD 1OB5A 2BCJQ 1AK2A 2XNDA 3FYHA 4B3BA 4TMVA 1ZD1A 2OEPA 3K0CA 2OV2A 2QG6A 3GMTA 3TSZA 2XZOA 3SYLA 3UMFA 3GPLA 4R2HA 5GVSA 1NVVR 2PJRA 3TE6A 1IN4A 1DOAA 1HE8B 2GAOA 3WMEA 2NMVA 3CWZA 4GPTA 2XJ4A 5KUTA 5FOTA 2OG2A 1R0YA 1K5DA 5EE3A 1Z5ZA 4HB0A 4TSFA 2V54A 4OYHA 1OXXK 3J81k 2ZJAA 1E79A 1LF0A 2ATXA 5A4JA 2WKPA 2OFXA 4Q5IA 3M0EA 1NMZA 3BORA 2HF9A 5F3WB 5FPKA 1UKVY 4YMVA 4E07A 3WMGA 1KDTA 2GXQA 5EE9A 4MRSA 3T61A 1QDEA 2J0UB 2JEOA 2YYZA 2MMGA 2GAAA 1VKJA 1W0JA 2I4IA 4U02A 3IDQA 4DSOA 1MO4A 2ZU0C 3ZD6A 3B9PA 3WP0A 5CDFA 3L0PA 4HAYA 4XVRA 2ZI5A 2IS2A 2PZEA 2F43A 2CJWB 3PG5A 4HDOB 1T6NA 4H9GA 1G1MA 1A2BA 2R9VA 3R8FA 1M8PA 2Z83A 1DAEA 3QE0A 4KSBA 2A5FA 3HWSA 2LCFA 2ZIAA 2ZJ2A 1SKYE 3E70C 3U7GA 3T35A 3TKLA 2ZUDA 4LCBA 4LPSA 4GBMA 2OAP1 2O8EB 2PLRA 4QG7A 1AM4D 4NH0A 4X8OA 2GHIA 2Q3FA 4Q7JB 1AS0A 4HB3A 1BS1A 2IW3A 3LWNA 4RD4A 4LJ8A 1ZNZA 1UBGA 1N5JA 1OF1A 1VTKA 2ZSDA 4HLUC 3GLIA 3EPKA 3LLUA 4JLVA 4B2LA 2EQBA 3HR7A 1N25A 3QVVA 3TRFA 4UNSA 2SHKA 5K8IA 3MFYA 2ZYWX 3K70D 4M9SA 5JWHA 3D6TB 2O8BB 3BK7A 2IC5A 2LWIA 4M53A 4NCHA 5L3VA 4A36A 3EZ7A 3LDAA 5A0FA 1TMKA 3NDBB 2Q6TA 4N3NA 3NBYC 4ILEA 4M2LA 4GRAA 3QPUA 5CK4A 2A3RA 2QORA 2PZGA 1GG2A 3LVQE 3SDZA 1CP2A 1Y63A 2NPFA 1IBRA 4DDVA 1R10A 2ZXUA 4DLXA 1GKIA 4QGAA 2WWGA 2PX3A 3SJCA 4E5UA 2RGCA 3MSXA 3N2EA 1U81A 2QNRA 1II0A 1HQYE 1XXHB 2EFGA 4BASA 1DAMA 1PUJA 3VKHA 2VP2A 4LV6A 3UK6A 3WYGA 2NGRA 1KGDA 3FKSD 1W4CA 4L16A 1Z47A 1N6NA 5KSPA 2WMOB 2D7CA 2Z43A 3SEAA 3EXAA 4CT4B 4E22A 2VRWA 1PUIA 3QPWA 3K09C 2ZAMA 1KK1A 4DC9A 4Q4AB 1EXMA 4RSGA 1Z6XA 2JDID 4LYFA 2RHDA 2L0XA 2QBYB 2BM0A 3ASYA 4KFTA 3WNDA 3RS2A 2HJVA 5FH9A 2F9LA 2WWXA 3B7GA 2PMDA 4RFSB 4QJ4A 3CPEA 1CTQA 3LBHA 3UIEA 1T91A 3WRXC 3ZH9B 3ZZUA 3Q8XB 4D4LA 1L8QA 3W6PA 5JI2E 2NO6A 5FI1B 2ODBA 4CEHB 2VP9A 1DBSA 2H7VA 1PLLA 2FWRA 2GZDA 2ZS9A 2X8AA 4KYUA 3KQHA 4A2QA 1IAQA 1S2MA 2W6ID 4JVMA 5DE3A 2ZJOA 2C5LA 1NL3A 5FI0B 1R0XA 2D62A 5B58C 3F5FA 1ZNWA 2DWQA 5EP4A 3HJNA 5FTJA 1CR1A 1SULA 2Q9CA 1CJVC 4FMDF 4AG5A 1DAIA 3CH4B 3GEHA 2UKDA 1YZGA 3GLHE 3BXZA 4V0KA 5FPTA 5EP1A 2IEYA 3IQWA 4YONB 3LAWA 2FE4A 1AKYA 2VSOA 5F98A 2GXUA 2ZANA 2O8DB 1FQKA 1GILA 4H1VA 1W47A 2OAQ1 1XDBA 2ANCA 2QSYA 2JA1A 1WQ1R 1UJ2A 3GCGA 3NIBA 2QPAA 3I8XA 521PA 1XTRA 2J7PD 1D2EA 4DSUA 1KI3A 1P61B 1J7KA 2Q21A 2UVQA 4ABYA 2XTNA 4Q1BA 1JQJC 3CRW1 1RW4A 2AR7A 3QI2A 2EFDB 5FUWA 2GBLA 3EWAA 4DSTA 2O0HA 4LX0A 2C9CA 4B32A 3QVUA 4C2UA 3KKQA 1JPJA 1TX4B 3H4MA 3CPHA 2W2XA 3SOPA 5CK5A 3RS3A 1RKBA 4KVAA 1R8QA 5DHFA 1FW6A 3TMKA 3LO5A 1KO5A 2QP4A 1TU3A 2MSEB 2VF8A 1U0LA 4IOMA 4RCYA 2NO1A 3VR4A 3L8ZA 3DZDA 3NKVA 4ERNA 2UZIR 4N0DA 4CGZA 2EVWX 2VEDA 4U7DA 1WA5A 2IYUA 2ORVA 2IYTA 2BDTA 4YC7A 1NVVQ 5JCPA 3HYRA 2C99A 1YRAA 2FEMA 2NPIA 2WIBA 1P9RA 1KKMA 1OYWA 3C5CA 1XEWY 4M9ZA 4NBSA 2V8OA 2IXEA 2Q3MA 5J4VA 1QHYA 1QHGA 1RRGA 1W0KA 1NVXQ 2GETA 2CCJA 1SZPA 4RVCA 5LB2A 3HPRA 3UKDA 2B7CA 1DVRA 3PUZA 4LJ9A 3RS0A 1EG7A 2R6FA 3THYA 3AF2A 4DXAA 2B21A 3A1VA 2IS1A 3CH5A 4MUBA 1RYHA 1NIJA 2Y8EA 2TMKA 3JVVA 5F2EA 1Q20A 2O52A 2VO1A 4PQFA 4XWAA 4KODA 1N6OA 3QUSA 1N6LA 1EFRD 3V4RA 2EWVA 1F48A 4OQMA 2ZJZA 4TTRA 5BWMA 2NG1A 5FTKA 3KJGA 1GKUB 1AZSC 4I1OA 2O8CB 3CWQA 1F2UB 3L8YA 1U98A 2A7QA 1E9BA 4D0LB 4NONA 3ZD7A 4FI3C 4URYR 2QMOA 4WXPA 4YMTA 2ASEA 2ZRGA 3OE7A 4XTCS 4BFTA 4R98A 1UFQA 1S9HA 3KQKA 2BJWA 4B3GA 1E1RD 4IOJA 2BIFA 4D4KA 3A6PC 1GNRA 1D8TA 1KIMA 3U5ZB 4JSYA 1E1QA 1HE1C 2ZRHA 3QIAA 1E0AA 4Q1AA 2GESA 3LFUA 3X1XA 3KQNA 5LPNA 4GP6A 2GEUA 4V0NA 3R9IA 1KI6B 3A1TA 2X2EA 4PZLA 4AKHA 5B2ZA 3B85A 3CLVA 3OEED 4ZIRB 2XXAA 5FL7D 2KE5A 4OQNA 2ZUCA 3VNVA 2BCGY 1OB2A 2YVUA 1JECA 1R7RA 4FN5A 5HKKA 4HAWA 4ESVA 3C41J 1KK2A 2IUUA 5FOXA 4WA7A 1G5PA 5EXTA 221PA 2DR3A 3MJHA 3K9HA 1UADA 1R0WA 4D0NA 5FOUA 4RKEA 4PZYA 3WHKA 1CRPA 4D26A 4AK9A 1GL7A 4YXWA 3AH8A 4IJMA 3VX4A 3GLHA 1CRQA 2YZ2A 3ZIAA 4PR0A 1KI4A 3KUDA 3TW4A 1H65A 4MA4A 3LQRA 1G3UA 1E9RA 1FNNA 3SU8A 3OIUA 1OKKA 3IPYA 4QGGA 4HUQB 3QEOA 3UMRA 1N6PA 1AN0A 1PVOA 4LJ7A 2ODEA 1PZNA 1E96A 3TH5A 2GCNA 3AM1A 1IHUA 3M6AA 5KO2A 3TNFA 1PLJA 2ZJYA 4PHGA 2GJ9A 5TB5A 3OEHD 1H8HA 3IEUA 1QHNA 1VECA 2E87A 1IN8A 4TMZA 4M0LA 2XAUA 4KO8A 2GK7A 1KDOA 3BBPA 3LNCA 4G01B 1NG1A 2OHFA 4K81B 3KB2A 1FQJA 1RJ9A 2OUKA 2X77A 4GMXA 4L4UA 721PA 1NVUQ 1P5ZB 1TUEA 2YOFA 1JR3D 2GRJA 1UEIA 3TLXA 2OO7A 2ZSAA 1YZKA 4DCTA 2A5YB 2OM2A 4AIIA 3Q72A 1OLOA 1TF2A 3CRVA 1BH2A 1CU1A 4M22A 3ZVLA 4LYHA 3TR5A 1YR9A 2H5EA 4UKDA 1RRCA 2FFBA 3H84A 4B73A 2ECKA 2WSSA 3HYTA 3UWKA 5HPYB 1J90A 1E9DA 1GNPA 1P2UA 2F3TA 1G16A 2YV5A 4NDZA 3NH6A 4KBGA 4Q1EA 1BYUA 4PAQA 3UMSA 2FFAA 1WXQA 4O3MA 4TMXA 5KPJA 2JLUA 1KMQA 1T8TA 2GZAA 5G53C 4ZDJA 3TJZA 4TYWA 1GFIA 2NO0A 1YKSA 5CM9C 4BZXA 5FR1A 2XEXA 4PSAA 2PH1A 3AP1A 2C9OA 1F2TA 2IYLD 3AUYA 4Y0VA 4V03A 5BN3A 3B5JA 1KK0A 2CE7A 2HF8A 2V3CC 3CZQA 4US0R 5FUVA 4P31A 1XD8A 5C4GB 4DLZA 3NVAA 5KSZA 1E9AA 3AP2A 4US2R 3QKTA 1SVKA 4RCZA 4WZBE 4MYUA 5TXGA 3RS5A 1J8YF 4HDQB 3REFA 4QJ3A 4A2PA 5FUYA 2J45A 3RS4A 4GL2A 4ITRC 4OQXA 1Q1EA 2DY1A 4LBWA 4GZMA 4LJ6A 4B2PA 5GADl 3GJ6A 1G4UR 1YRBA 3AKYA 3FGNA 4HI0E 4Z8XA 1XWIA 2J87A 1AGPA 1YHNA 4IEIA 1E9CA 4KU4A 1DADA 1N3BA 3VTKA 4M1TA 5AJYA 4PC2A 4BEBA 2WICA 4GOJA 4LC0A 4U00A 2WSMA 1OH6A 2ZRPA 4Q7KA 3KQUA 5FPHA 2IYXA 1Z0IA 1EFTA 3UPUA 1COWA 2Q9BA 4I81A 1NN1A 1XEXB 3T12A 3GJ7A 4FXPA 3I8SA 4TN1A 5DISB 1HQCA 3ECCA 1E2FA 1FX0A 1Z07A 2ZQ5A 4TQUS 1HT2E 3FDIA 2IBMA 4L15A 3A1UA 5DSZA 3VAAA 1LTQA 2ZE5A 1NRJB 5EE0A 4B6EA 3T34A 4D0GA 3BB3A 1AQUA 4PSVA 4CW7A 3QKRA 3P4YA 1W5TA 1FZQA 2HV8A 3BB1A 2IUTA 5JJLA 4TYPA 1AZTA 4NMMA 2WJJA 4M8NE 3OAAD 3CF0A 1BMFD 2PEYA 4NYIR 4Q18A 3U3OA 1M34E 1SVSA 2QN6A 3E1SA 3KKNA 5AR1A 2VHCA 4B71A 5H8WA 2F7SA 2JJ1A 1XPUA 3LQQA 3I73A 2DYKA 2IYZA 3W34A 3AV0B 2GCOB 4JVSB 3QKSA 4C0AC 1P73A 1OFUX 3GLGB 3WHLA 5BN5A 3RRYA 3GLFA 3LBNA 1GDDA 4BZQA 4LRWA 4PC1A 3DDCA 4L9SA 2IXFA 1P7CA 1QZXA 2YWEA 1T0HB 1CJUC 3KXLA 5HR5A 1RFLA 4JZKA 5SZKB 2H18A 4FMCF 3A37A 4ACBA 2HLDA 3C4JA 2ZSEA 1XTKA 1LY1A 3G82C 4J0QA 3VR6A 5JS7A 5DIFA 1OV4A 3IO5A 3U3JA 5KHOC 1E99A 2QP3A 4M1WA 2BOVA 4I1VA 4HZUB 1W5SA 1R5OA 2C96A 4FCTA 4Q66C 6Q21A 3THXA 5B57C 1E9EA 5JFGA 5FTNA 3DOFA 4C4PA 1DTSA 2ZI3A 2JLXA 4TMTA 3SYKA 3THWB 3T1TA 5JWOA 1E2KA 1KTVA 2WBLC 1Q57A 2VYFA 4KXFB 4IOLA 5EXPA 1MABA 4TQAA 4II7A 1ZW6A 3CF6R 2YJTD 3DVLA 4MGZR 3GEEA 2QRNA 1G291 1NSTA 2RKOA 2GXSA 2XB4A 4P33A 2R2AA 5LB4A 4BPBA 4MKIA 4EPXA 2BBTA 3ND9A 1GL9B 1SQ5A 1VCNA 4CYMA 4K46A 5GJCA 1MR3F 2BWJA 1LS6A 3EC1A 1YR8A 5AK0A 5BW8A 2OCBA 5EE1A 1VYUA 4HDCA 2AFHE 4A8JA 2WJIA 3ZVNA 1K6MA 1J2JA 1NBMA 3AVVA 2IYYA 3EARA 2G9NA 1VDZA 2BHRA 1WRBA 2VHTA
chains in the Genus database with same CATH superfamily
1W88B 4MW4A 1BFKA 2Z9DA 4RBNA 4XD7A 1UFOA 3EZ2A 4MV3A 1WB4A 3WIBA 1JHOA 1QHEA 5IC4A 2GAJA 3MLEA 1M54A 5KSYA 3E05A 4H27A 4MKHA 2WMYA 4LQ4A 1EJ6A 1C80A 1Z6ZA 2PV7A 2PRJA 2OHIA 3TOZA 4DZZA 2Q2WA 4F38A 4YAKA 4ZMSA 3RYIB 3DZKA 1HKUA 2VXBA 4IFBA 1YZYA 5HDQA 4DWJA 4IJUA 5A6VA 1GU7A 2B8JA 1ESNA 3QX7A 2JFQA 1H5NA 4HDNB 4GPBA 2DQSA 2I7DA 4RLFA 3BWMA 4WNIA 4ZT4A 5IYZF 3ZBUA 2QENA 5L7TA 3ME5A 3ZW9A 3AL2A 3WNBA 4YV7A 4L95C 3GZNA 2JLRA 2VHEA 3IOYA 2ZSHA 3LZ6A 2QRGA 3PUIA 4O4JA 1DAFA 2GJ4A 2KJQA 2BBOA 4BQOA 5B55A 5C7OO 4NG5A 2A1UA 2JH8A 1BCRB 1CUCA 1QP8A 5K8TA 5EQTA 3MIIA 2GT1A 3A28A 2HJGA 4YRZA 3QKUA 4IVNA 2D5IA 3EQ6A 3LY5A 4UARA 3ZYCA 4WTOA 4AJOA 5HIKA 2CB0A 3K9WA 5COAA 2IYFA 1JN0A 1B3RA 1UBMS 3RC1A 5IJ9B 5FNVF 2PSSA 1XNQB 2C0CA 4C06A 3UHJA 1G5TA 2DJ5A 3CR7A 2QOEA 1Z4NA 5LJIA 1E3WA 4Y6SA 1U28A 2O1XA 4JLJA 5IDYA 1REQA 4D25A 3SR4A 1T6XA 2BMDA 8ABPA 2XT9A 2FVYA 2X4DA 4IQ0A 4LYGA 4X44A 2WWYA 3EZXA 3QPAA 5G3ZA 1J1ZA 1CJMA 4KVFA 4YY3B 3LRPA 3PX3A 4EJMA 1D2GA 3ENKA 4OI2A 1B8PA 3H8VA 2E5WA 1M34A 3MRXA 3F74A 2G7MC 5H59A 2FZEA 4IIEA 4IG4A 4NOLA 4TZTA 3W9YA 2AA3A 2F8LA 3Q5DA 2ONKA 5DM0A 4MKGA 1WMEA 4UPDA 3HCBA 5CVVA 3UK1A 5BMVA 4CMKA 5G0VA 3QFTA 3H2HA 1WABA 4RKRA 2UYCA 2O7VA 4HQFA 1H6DA 4TKVA 4UULA 1WVMA 5I7VA 3C6ZA 2DX7A 5IARA 5F1OA 4DZRA 4Z4CA 3WGVA 4CMAA 2F8SA 2AJLI 1H2WA 3PR3A 4IYRA 2J1LA 4XYGA 4ZXPA 3WNVA 4CUZA 1XROA 3DA8A 3U3RA 3SVTA 2NUAA 3C1AA 4MGYR 5CLLA 2JHAA 4AYTA 3MD0A 5ISMA 2C98A 4ZT7A 3CZ5A 1HEYA 4YLGA 4TMYA 2DU8A 5AW9A 1F2VA 3L0OA 1R8XA 1U4SA 3U39A 4ND5A 1TJYA 4QIHA 5TNXA 3QMMA 1NF8A 2WPDD 4TKUA 5FPSA 1CR6A 1U7PA 3RC3A 4JLAA 2E48A 2QL6A 2HXYA 2YHIA 4I9GA 2Q3EA 2MYPA 3UT5B 3F4LA 4G56A 2PKYX 1CLUA 1Q1AA 3NETA 1QH0A 4Y2PA 4B17A 3G7NA 3H65A 3LWBA 2C2XA 2V03A 1KWGA 1TD1A 1UBEA 5F7XA 3I76A 2H2FA 1YBFA 4TWZA 5LU9A 5ALNA 3WQQA 4Z1MA 3E3OA 2REBA 4G3XA 4J2TA 4M6WB 3WGTA 1QZZA 2UVDA 2DQZA 1YZLA 4V38A 1G8PA 4CLOB 1XAHA 2V3VA 2Q6LA 4OP1A 3LPLA 3P5SA 4IDEA 2XOKD 3FKQA 1HH4A 3ELDA 2FSGA 2C2MA 2IHUA 3SX4A 2QLNA 3LUHA 4IDAA 3WZ2A 5CIQA 4L72A 1DZ3A 2PBLA 1DC4A 3MQ4A 1SBYA 3RYHA 2BE7A 1DHTA 1N75A 3V8RA 1A4RA 2MSLA 1HDIA 3N70A 4CF7A 4NZMA 3EPLA 4NZ9A 4MIOA 2Q7DA 1J0XO 2I7XA 5HIIA 1XTQA 1JIXA 4GS5A 1QBKC 1QONA 3AXTA 2FPGA 1Z5UA 1UJNA 2XRZA 2JIOA 4KE7A 1JG1A 4Z86A 5DTJA 3S44A 1JLLA 1M0SA 1KZ4A 3GWZA 1E1YA 3HUFA 4EF6A 2CGEA 1NNEA 1BTOA 2E4VA 4OQYA 3T7CA 5EINA 1G98A 4KO2S 4JUIA 1R9MA 1E6WA 2IXAA 1E7QA 2AFIA 3B2QA 4N8DA 4QXQA 2CXUA 5FV4A 2EKLA 1M3SA 2QVZX 3E3AA 5L95A 4OMFG 3B13B 5K20A 1V1RA 3LQYA 2CXTA 1FSPA 4DR7B 4ZOQI 2ZSIA 3QXCA 1I5EA 4HH3C 2XYRA 1XTZA 4PG5A 1UKYA 4FR5A 4G4GA 5TEWA 2GF0A 1Z2OX 4DJFC 3EDRA 1PR1A 3SQNA 1B0PA 2VDWA 3RVMA 4KITB 4HATA 2XUGA 2A14A 5THXA 3DVRX 2J5BA 2A7XA 1M1NB 3GT3A 2OL4A 3NHSA 5KJEA 5JCZA 2YUTA 1IQRA 4F71A 1DAHA 3PLNA 2OENG 3DAGA 4BL5A 2GKGA 2WYUA 2XOEA 3NDPA 2OFOA 2WD9A 1BW9B 1YVPA 1G8YA 2XTJA 3ANSA 3JW8A 1UBOS 4P98A 4PHTA 4W8HA 1JSXA 2PMFA 4YN3A 1VRVA 1YMQA 4FU0A 2Y0EA 1SKYB 1NYLA 3UY4A 4BZWA 3ZTTA 2WE7A 4TZ0A 4C43A 4QBHA 4TQGA 3CPJB 1JT9A 2RGBA 2C20A 2PHZA 4UQOA 4D5EA 1XMQB 1RQNA 4XUDA 3ZV6A 4F7DA 1J7JA 3GIDA 4C4RA 2AZMA 1HNZB 5KTSA 1ISGA 2X7XA 5G0WA 3I58A 3KAJA 1TJ4A 1TQ6A 4AJHA 2QMYA 3QLVC 1BE0A 2CL6X 4FHGA 4B3CA 2Y2VA 1IPFA 1A8PA 4C4YA 1TYEB 4DR4B 3IQGX 3B1ZA 4XR9A 1MOPA 2AQHA 4KSCA 5IHXA 1T2EA 4MRRA 1E59A 2WJGA 3BXEA 2CXXA 3PPVA 2OBLA 2RAVA 4Q7LA 3IE2A 5CYOA 4HFNA 4AL4A 3OCUA 3RABA 3ZGYA 3IBYA 2X8LA 1ZSNA 1NVWQ 3U0VA 5CTAA 4ZVSA 3RHTA 5HWSA 4ZYZA 2FUG6 1P91A 1LJLA 1LDEA 3IUJA 2JRCA 5BW6B 3ZWKA 3BH0A 4MIKA 2A30A 2P7IA 2PVSA 3IAAA 1T5HX 3AEKB 4JI3B 5B6IA 1XPJA 1N4DA 2B98A 3OD1A 3EZFA 1KDZA 3THYB 1OU4A 1R16A 2UVPB 4Q9DA 3ZH2A 4CQLA 2W22A 1WOYA 5EIBD 1DWUA 2WF5A 2HK7A 2IA5A 2VPWA 1L7VC 4II2A 4OYLA 4X7PA 4BXOA 4GPAA 3KTDA 2QTAA 1U7DA 4NBWA 4YROA 2WSIA 4C0XA 4F9GA 3AJAA 2FUNB 4TVBA 5HM6A 3BHMA 3OIGA 2OBXA 4KPUB 4PTZA 1G2PA 4IHAA 2AZDA 3ZPXA 5D6OA 4ZI5A 5TJHA 3T15A 2C0PA 2ZUBA 5HOQA 3WA7A 1BA3A 3GDFA 1M0TA 4HVLA 2G80A 2H08A 1STOA 3F5MA 5DASA 3TLJA 1ZS9A 3SQXA 1W96A 1PZHA 3IRVA 4CM1A 5MFZA 3SM3A 5C37A 2FPPB 5A5GA 1F0PA 2C2OA 3CF4A 3H1PA 4FFOA 4KKXB 2L69A 3G49A 1UXJA 3HBJA 4PQEA 1K75A 5L4NA 4KPYA 2V6GA 1ELOA 5DBOA 4TLCA 2O57A 2FX5A 4YCBA 4NCIA 2YWGA 2J41A 1F6DA 1RI1A 4L76A 3HCAA 3VPGA 4FMBB 3ETHA 2JIPA 1YR1A 1ETUA 1CQIA 1CQZA 2PKEA 2RFLA 3OWXA 1ZRHA 4I08A 4QUKA 5FHQA 3U44A 1A8UA 1E0JA 4DA4A 1NE7A 4OI0A 4HB4A 4M9QA 2IOFK 1NKVA 4CMIA 3IUBA 2XA2A 5EIFA 5IABA 3V9AA 5KQRA 1GM5A 2XXAB 2P2LA 3MMZA 2YV3A 4D56A 2XUPA 1UK7A 3P97A 4QDTA 4X95A 5AM2A 2LDXA 2AK2A 4LHWA 5FNZA 2ZBEA 1L7QA 3JYNA 3VU3A 1AUXA 1ONBA 3IIKA 3B6MA 1QG2A 1R66A 3DEAA 1GUYA 3LLSA 4ZRMA 3R7DA 3HVUA 1QIGA 3O90A 5BOSB 2P6UA 4JBNA 5I51A 1L8XA 2QRZA 1UBRS 1MNAA 4HHEA 1JR4A 3UOWA 2WPNA 4G1VA 1RCTE 2P9YA 1F20A 2NUPA 4IP0A 4JMLA 5FL3A 1R6AA 3Q85A 5CYGA 3GLHB 2WV9A 4FFLA 4Y1EA 3HDJA 1TIPA 1QAQA 2DFNA 2WUWE 3EASA 3GEPA 2VS1A 2Y1EA 4KTVE 4M8KA 2CNWD 4NBRA 4BOYA 4EIWA 4ENUA 3OUZA 2J0SA 5ITZA 2PGNA 4KLRA 4PEVA 1TEHA 2P75A 4IICA 1YE5A 1QF7A 2OSBA 5P21A 4B46A 1U4NA 1TT5B 3R7LA 2NOAA 1ONPA 2ZYAA 3AHIA 3IHKA 3OY7A 4Q1VA 3GLUA 5KVSA 4JV5B 4N39A 1GZ6A 4OL9A 5MDHA 4WESA 3LVFO 1WB9A 5AM4A 3SX2A 4WOCA 2NSJA 4FC7A 3SCZA 4BBAA 1MEOA 1FX1A 4URWR 4S0ZA 4ZDKA 2R5NA 1E9SA 3EZ9A 4A9AA 1TJNA 4EDHA 1HDEA 4IMJB 2YMLA 3EIEA 1IRXA 2EXXA 4BQFA 3UWOA 1S6YA 2HCFA 5CEFA 4FFWA 4WY5A 1MJGM 4NU5A 4IIBA 5CLIA 5K8LA 5GQSA 2VP5A 1N5LA 4AC9A 4BVJA 3L8MA 1LDMA 2ASVA 3SYMA 2FP4A 4E32A 4FDAA 4D8TA 1RE0A 2P5TB 4JLKA 1NU8A 3GAFA 4KVZA 3NKLA 4KG7A 2MSWA 1H6CA 2P9EA 2WD8A 5JXWA 9ATCA 2VL7A 4UAVA 3OURA 5EZSA 4BKUA 3LK7A 3FYDA 3F6CA 4ECAA 3TIFA 1GAEO 1I9CA 3EIHA 3KDPA 1NXSA 3DOUA 2XE4A 1B6RA 1OLUB 3G89A 3FW1A 5F12A 1DNPA 4C7OA 4ITUA 5ELXA 3E8XA 2C2BA 3OJ0A 1A76A 1U11A 2WKQA 3LP5A 3FJ1A 3AGPA 1G0OA 3L6DA 5FBKA 4LSZA 3O74A 2VAVA 1NP3A 2E2WA 3QQ5A 4DLWA 3CISA 3IT3A 4K6CA 5MN4A 3RR2A 1C8LA 2AKYA 4YRRA 2RAPA 1EDEA 4CKWA 3P2YA 1I3NA 1EFRA 4DXDA 2KSQA 3KUKA 4Q15A 2GR9A 4L5YA 1XJ5A 4BKRA 3JATB 4KH1A 4TL8A 1AHHA 3N8NA 4RJTA 3QG5A 5JEEA 1TI7A 4ZODA 3HVKA 2NXWA 4OH1A 3B70A 4S12A 2RHOA 5EMKA 1YUBA 3PDUA 3IKTA 1OE0A 3DQZA 3Q3IA 4YCNA 2QYSA 4JLOA 3R9KA 3BILA 1N2JA 5J2UA 3IE0A 3WLHA 2G5GX 1SUIA 3BMCA 1E7YA 1PI3A 4GD3Q 3QOFA 5HIAA 1G55A 2BSXA 4F6RA 3P0RA 1YVDA 1PFKA 1A27A 2C2KA 1E1RA 5IVDA 2AOTA 2H63A 4KAFA 3TPZA 1OLSA 4JBIA 1CX9B 1FSSA 2C78A 4R5MA 1URPA 1E66A 2D1SA 4J7UA 4K7JA 1M1YE 2PA0A 1P31A 3EC7A 4OAOA 3RNLA 3BF7A 2V9CA 5K7SA 4UEWA 1N7JA 3EVBA 1UKZA 2FR8C 3VO2A 4OM7A 3V3KA 4UM8B 3NCHA 4M55A 4NYMQ 2ZETA 2BVNA 3IV9A 3EVFA 2Z9CA 4YQEA 2V55B 1ZSVA 3KJHA 1CIPA 1GN9A 4RZ2A 4JI4B 2ZVPX 4JOBA 2QMQA 5ER6A 3GCDA 4JT9A 4RZSA 1YL7A 5DNUA 3ZU4A 2ORIA 2PKQP 3U7IA 4UXHA 4CV1A 2QM0A 2QV0A 4G09A 4HKTA 3FVWA 5J40A 1EFKA 1E5VA 1GYQA 3NIWA 1U5CA 4BECA 1A82A 4J0KA 5DLDA 4Q7QA 3JZIA 4LJYA 3BDVA 3OQIA 4XJSA 2FZ4A 2QRLA 2NQ2C 2X19A 2GN9A 2NXNA 1BXGA 1RADA 1VIVA 2IYOA 3PUXA 2CE2X 4M0DA 5JY1A 1KDRA 4M54A 4EGFA 5LP6A 1ZD3A 2AMFA 4TV9B 2EEZA 3PI7A 1MC5A 2QR3A 2HDOA 2IELA 3FWZA 3CONA 2OMEA 1K8ZB 2XIQA 1ZM9A 1C30A 4A73A 1NBME 2POQX 3IIMA 5DEOA 4Y6RA 1U0HC 3ILXA 1PTJA 2W8ZA 1XRSB 2WJVA 3F9IA 4M8SA 1QQTA 3ZE0B 1R15A 4KNYA 1MEJA 4P4LA 1TKCA 3KT8A 2ADMA 3IAS6 3QKSB 1L1FA 4OJTA 1OUMA 1KQPA 2HI0A 3HB0A 2KB0A 3PDIB 2ECOA 4F4IA 1NUUA 4GT1A 4WVLA 4BX8A 4EMSA 5A1TA 5JTUA 3F9CA 1UDCA 4HAUA 2F9FA 1FXWA 4FPXA 4JLMA 4OUDA 3E48A 4JJFA 3A9SA 4YUZA 4RPLA 3CV3A 3RWBA 3ZKAA 4P5PA 4IWXA 4P92A 1M2OB 4IAOA 1A77A 3Q88A 3QY0A 3ZJVA 3CUEF 3I9MA 4C3VA 1UDWA 4WERA 4GUDA 1C50A 2YBEA 3VH1A 5KU1A 4PVDA 5BV2P 1RXVA 1PFYA 2HWUA 4EG3A 1Q1QA 1J2EA 3WFZA 4KR2A 1WULS 3MWGA 5ILQA 3JARB 4MS3A 3THXB 2R1ZA 1YS6A 3KTAB 3NGLA 4FINA 4JHXA 3KEMA 3QTLA 1AGRA 4ZQBA 1VCOA 2VJMB 2F1HA 1AF4A 1NKTA 2FPIA 4R8SA 4KQEA 3LT1A 1I30A 4JBWA 5CLFA 1SIUA 1V4NA 1XD9A 3NW9A 3P4UA 5CHYA 1T4GA 2ZROA 2BGGA 1YDMA 2HDNB 4ZQFA 1FFHA 4BRUA 4CHGA 5A2GA 1O9GA 1FDSA 3L0BA 4H18A 1N6HA 1MABB 4P84A 4RACA 3U48A 4AMYA 2IYRA 2HA2A 3LW8A 2SKEA 1CERA 1HXHA 4WXRA 1AC5A 1XVIA 1EP2B 2WLTA 4L5JA 5IC5A 5KX5B 4CMHA 3AP3A 1H1LB 3MD9A 1IUOA 4ZPXA 5KKAA 5D84A 1ML4A 2RG1A 3W78A 1Z3IX 3IT2A 4AXXA 3OJOA 3AY0A 4X8LA 5EIHA 1R6TA 2HJ9A 4GZLA 5DT2A 1YFKA 3TVTA 5AJHA 3NV9A 4C4OA 4MWEA 2NP7A 4EX6A 2LW7A 4O6VA 3TF5A 5CR9A 4QPPA 3I3SR 1IE3A 3E15A 1T8PA 2PQ0A 4QJIA 3TGWA 5JEDA 4HNAA 10MHA 1T1EA 5F73A 3R4CA 3DR5A 4JEHA 3WK7A 4A8JB 5B3LA 1ABBA 3HBMA 3T7IA 4NOJA 1SHKA 2AW3A 5FOVA 1AUOA 2C9ZA 4ZDWA 4ZZ0A 3TGLA 1FFCA 3WWOA 2JATA 1N4AA 3LC1O 3KLBA 3LUDA 4HWRA 1Y7TA 3VPBA 3U4DA 3U60B 2FOIA 5DIZA 1PFWA 1MRSA 1VZ3A 3BULA 5F4BA 4BY9E 3AKEA 2QZZA 3GD7A 1MCZA 4MO2A 4P7GA 4JBXA 4RGVA 1QH1B 1OHHD 4DWWA 4MP8A 1ZD8A 3OOSA 4RDCA 5L3SA 2XCIA 1P5HA 1Q44A 3A1EA 2OWEA 4M0CA 4FHFA 3ANMA 3V1LA 2DLDA 2G1AA 1Z7YA 2CHFA 4KGZA 1Q19A 2EFJA 4R84A 2WHEA 3NV7A 2QVCA 1EFDN 1XQ6A 1IY1A 2NX2A 2YZKA 3ABQB 3CZ4A 3QXSA 5F78A 3S40A 3N6VA 2FSHA 5ICEA 4M9CA 3W90A 4LV5B 4QSMA 4H6WA 3FMFA 4G1EB 4YRIA 2VVTA 4FYWA 2IEGA 4J0GA 4D9JA 1WJGA 5KC9A 2P5SA 4Y2GA 2PZAA 3LFTA 4O2LA 4RETA 1RBYA 4XQEA 1FDUA 5F1PA 1HV8A 1ILWA 1ZUNA 1Y7LA 3TM4A 1GO2A 3AOGA 2CLSA 2Y67A 1KEVA 2BUCA 3K9BA 3N76A 4M1EA 4BWFB 1RWWA 4LY6A 4F4FA 1OH7A 1TGYA 4BLQA 1Z18A 1NGSA 2FQQA 2JZCA 1XRJA 1ZD2P 3FYUC 4BX0A 4KEAA 3UAOA 2W48A 4PX3A 4BP9A 1J5EB 2G7ZA 4FMCB 4PHCA 5CFMA 2AXQA 3LS2A 5E2AA 4P35A 3EAGA 2WHPB 1U7ZA 4B4UA 1NJ2A 1RZVA 2AF3C 1DC5A 1N0HA 2AZTA 3GFFA 3SC4A 3AUKA 3B2EA 3O3OB 4Q12A 4QYXA 2WUVA 3BA1A 5CCDA 1ZD4A 1DMSA 1IB6A 1RABA 2VJLA 4MR9B 3ZHSA 3C7AA 5DXFA 4P7JA 4E88A 2Z2YA 3EGWA 4X0EA 2PYIA 4QU5A 3BYZA 4PLHA 3A1WA 2P1ZA 1HI9A 1SVOA 1YZQA 2JI6A 1M1ZA 4EFLA 3QU9A 3A6KA 2ANBA 2FRVA 3EXG2 3OIFA 1UBSB 4YRFA 1KRWA 3GRAA 2C7RA 5A3QA 4L8YA 2B94A 4UBLA 1JLKA 3ONEA 2Z09A 3HDGA 4BWVA 4ETIA 2QAGA 3ZWBA 1DXHA 3WGMA 5AVWA 3MWLA 1EE9A 3WWDA 2OZLB 2JFFA 1Z0ZA 2A5DA 1EZ1A 3BH7A 1N8TA 5A3JA 5EXEA 3TRHA 3AL0C 3THSA 2ZXFA 3HZRA 1WU7A 1QRRA 1ZCJA 2BFFA 4NICA 3C0KA 3LH5A 1BFUA 1KR2A 4AZ0A 1MJFA 1RM0A 1V3TA 1ZYUA 1HT0A 2YZ7A 3NO4A 1VYHA 3OOHA 4EBFA 1A2QA 4L3VA 4UNPA 1VI2A 4QICA 3M5WA 1Z68A 2BFEB 4B7UA 2B37A 3F4BA 3Q7QA 2QHXA 3Q6MA 3GPCA 3K1JA 3M2TA 3ZZ0A 1JDNA 4BIMA 4NKRA 5A3VA 1OFVA 4OFBA 2PU7A 1F17A 2NZ2A 1SC3A 1VE6A 2VJNA 4Q05A 1C9YA 3GJ4A 3WLEA 1I4TD 2X14A 4HDMB 5FWYB 3FDZB 5BSHA 1VG0B 1E79D 1SXJB 1FUUA 4EJSC 2CWDA 3JQFA 1WKCA 5FJIA 4PHFA 1CEQA 2VPXA 3A1FA 1AMOA 1M6WA 4LZZA 1K5PA 4CUJA 1OAAA 1O5IA 3LQFA 3H9QA 5TRTA 2JJ2A 2I1LA 1VHTA 3X1KA 5IYZB 4L6IA 2OCPA 2FPMA 2P8JA 1KO8A 4YQFA 4OB8A 3B89A 5CB6A 3FG9A 3S99A 2PMCA 5K9ZA 2BF4A 3NWPA 4MQBA 5HBRA 1YNSA 4IIJF 2C8LA 3EXFB 3AINA 1TAUA 3QG1A 2W00A 3FUVA 4GE0A 4OMCA 4P2BA 4C3ZA 3ORHA 3HM2A 2FK7A 3LK6A 3OF5A 4XVHA 2IU4A 3SD7A 4KV7A 5DLYA 4ZV9A 1C3XA 3GY0A 1G64A 3IUSA 1RQGA 3W7BA 4ENTA 3IQIX 2AFHB 3UK0A 1QIFA 4I5EA 3X1MA 1O95A 1H3EA 1TEXA 4E2ZA 5FNVB 4J2OA 1US8A 3K09A 1UP6A 5FJJA 2ZJBA 1K97A 2OZEA 5A4IS 4ESEA 1K88A 2EF1A 3O91A 3GNSA 3WIOA 3VSEA 2JFUA 2VTBA 4FD3A 4XJXA 3KP1A 1KYTA 5DBFA 5EFOA 1QHXA 5GV7A 3D6HA 5KNBH 5KBYA 2ODTX 3WC4A 3Q9LA 1R8SA 1XTSA 2EKQA 4FXOA 3SC2A 3CBGA 2FN7A 2Y4OA 2QX6A 3BSSA 3QLJA 3G6KA 1AB6A 3HSSA 1AURA 4XDGA 5C51B 1DINA 2I3BA 4C5BA 4G2NA 4ARAA 4MUMA 2G1JA 3L0YA 1PAUA 2FLVA 2AUNA 2CVZA 4AQ7A 4AVYA 2O0JA 1FP7A 1JXAA 3BJMA 2IOYA 2B2NA 2O59A 1GA1A 2X0NA 1VJ5A 2A35A 5UKDA 4JR2A 4ODIA 4RE5A 4Q19A 4ASUA 2BFBA 1BJRE 5IAOA 4PPQA 5ALTA 4ARZA 1SN7A 1KY2A 5CVJA 1WMSA 1JKMA 1T1IA 2XE8A 2Y1OA 3W05A 4IJWA 4Q1FA 2ETXA 3JU3A 4EHFA 2AKEA 3U4QA 4QEZA 1M2NA 2FK8A 1P2VA 1ISPA 5KYXA 2GDJA 1GPMA 1VP9A 3TG8A 1XF9A 4W7SA 2EIHA 1ZINA 3GMDA 4Y67A 1OXBB 4WL0A 16PKA 5CM2Z 4YK7A 5AOVA 2DT8A 2N1BA 4W5JA 4E6PA 5JQGA 3HKEA 1DO8A 4ZU1X 1T9GS 1UC4B 1XJ0A 3MLAA 5I8WA 1QHHB 4Q1DA 3PA8A 1DZIA 3ZE9A 4F5EA 2AI1A 5DHSA 3W9BA 3H5IA 2PMEA 3I0MA 4IJQA 4ZOLF 3WWEA 3MAAC 1XXHE 5JJIA 5AOBA 1W5EA 1ZA1A 3RVBA 3T54A 3H2BA 3R7WA 3KEFA 4MVXA 5F64A 1TNDA 2PS1A 4BAUA 1TYBE 4D6YA 4KPFC 1QO7A 3VRHA 1FLNA 1IH8A 4YYZA 5LNK6 1UMBA 3KKEA 1BWSA 1EEXB 1UIMA 2EQAA 1UZMA 2YWHA 1U0FA 3I9NA 4FEGA 4JR1A 4RA9B 1IY2A 4RZHA 3TGPA 3ID6C 4YRJA 3NEYA 1X8XA 3DB2A 2NUTA 1IXSB 5JIBA 1II8B 5MN6A 1DPFA 1G0NA 2H0QA 1PP4A 1W8DA 4RY2A 1MU0A 3WKAA 2CEAA 1SNYA 2PXXA 1X1BA 2GPJA 1W2GA 2QIOA 3O94A 2DMRA 3AEUB 2CNLA 3C3CA 3ADKA 3WKBA 4CM8B 1I94B 4R2KA 4Z54A 5DBEX 4B09A 2Q0QA 1XWWA 2EYQA 2KBFA 1AIPA 2ISSD 3MWYW 3PFKA 3QVMA 4GEKA 4MLDA 4MMYB 2XUOA 2Y1XA 3IMEA 1JLHA 4HWPA 5JASA 1E2DA 2OB2A 3QFCA 4OA5A 1S7CA 3A9RA 3R5TA 4XCVA 2NTEA 3L1IA 3IS3A 1XTPA 3I5AA 1UBUS 3TJRA 4W5OA 1CS4C 2XPCA 3HWWA 5F33A 1YBVA 3EDMA 4B2YA 3FTNA 3OF2A 3GXOA 3AF1A 4D79A 1X39A 4F5YA 1Y37A 4MVJP 4Q0MA 1I13A 2Q4EA 3KQTA 4NDNE 2AJBA 1EUQA 3HN2A 4TLAA 4PX2A 3U40A 3V7FA 1PLKA 4YAOA 2XTMA 1U9JA 4P81A 2XF8A 1ZZGA 1EX7A 4PAGA 4UEKA 5G3YA 5IVHA 1QCCA 2RH5A 3EXIB 3HP4A 2C3MA 2NYVA 3VHXB 1TC2A 1YV9A 3CLSC 1BEUB 4NPHA 5AXAA 1UUFA 3G2KA 3QVKA 2LVBA 5JMPA 1WUYA 1Z06A 5LDGA 3WL3A 4E08A 1HDCA 4F2WA 3U5TA 1THGA 1U28C 3F6SA 1JH8A 1B7GO 4TXLA 4KR7A 4YP9A 4ILKA 4PO9A 1MT0A 4EY7A 3V97A 2IPOA 2QL7A 5E95A 4C2BA 3DYIA 3C1UA 3RU2A 1WQ4A 2FPRA 5FLYA 6ABPA 4EGQA 3EEIA 4B6JA 2IVFA 4Q03A 2OOSA 3D7NA 4LHZA 4QBGB 4HMPA 3PKIA 2JLQA 2XRFA 4EY6A 4RTPA 2W6NA 3K2IA 4YXFA 2XUHA 4V1CB 5E4TA 5ED0A 4QHSA 3ROTA 3QEAZ 1H5UA 2MSKA 2XY4A 1FQWA 1Z34A 2AJCA 1R88A 3DF7A 4NAHA 3LBAA 3PV0A 4TGLA 1W5FA 2Y68A 3KQWA 3AC0A 3KWMA 2I4NA 3LHFA 4C6TB 3UMMA 3ELUA 3QFHA 4IDQA 3K20A 4QASA 4BFVA 4L74A 1TPZA 4XVQA 4LGMA 4UMFA 3B9QA 3ZEAA 1SCUA 2JZNA 1KMHB 4MQ5A 1GTVA 3PUWA 4YGXB 3U7EB 3V7YA 3N7UA 2FDCA 1XDDA 4CKXA 2O8EA 2VHJA 4LRXA 1J06A 4OQPA 3BJRA 4JEMA 1CJTC 2WJHA 2XSZA 3DQQA 4JJKA 3KYJB 1ODIA 4JKYA 4MHSA 3SZRA 3OESA 4L51A 2HU2A 4C01A 2FN9A 2R6ZA 3KYCB 5J2TA 1L8OA 5JC8A 3VISA 1YACA 3EVAA 1YDFA 3R1IA 4M36A 4Z4GA 1XQ9A 3BMXA 3N2KA 3AUFA 4TLBA 4DARA 4EL5A 2W6PA 4QWWA 1EVQA 5ENDA 1P45A 1IOZA 2HIHA 3DEFA 1D9XA 2X9QA 4ZQGA 3QWIA 1KR5A 3T0GA 5I7RA 2C54A 2FG7C 3F7NA 1MXFA 1YK0A 4Q93A 3G23A 3GGOA 4UD2A 3LP8A 1MAAA 5DGHA 4YH1A 5AKYA 4CQMA 1OFTA 4M1OA 1XZJA 2GWHA 4DRXA 2AZXA 4HO1X 3Q1LA 3R5SA 4DHWA 3FCUB 3X2FA 5CT4A 4ALNA 3B53X 2AIRA 3D0KA 3AERA 5F23A 4PIVA 4FIZA 4XSGA 3NTUA 2N42A 3F2IA 1HZZA 3REGA 1AHIA 4PG8A 4DLSA 4LECA 1QNFA 1RRFA 5CVDA 3IPCA 4FGLA 5IKOA 3ZXXA 5AJUA 3W2HA 4RY0A 4FB4A 1MB4A 1DLJA 3LKBA 621PA 4IO0A 5C8DA 4MX8A 5AW5A 2FN3A 5KCZA 2QMEA 1H2FA 4JI6B 3PHGA 5EWMB 3EMVA 4JP1A 5CVTA 2ZBQA 5D51S 1NZJA 1E94E 4MUJA 2Q9UA 3L6UA 4GUAA 4LAFA 4Q4LA 4WXHA 1AKWA 4JL5A 2VP6A 3OX1A 5JHHB 3U7HB 1OVMA 3ZJ5A 1CF9A 5DP1A 3AR4A 4BJ3A 4Z0PA 4IIHA 1THMA 1C4KA 3GDHA 4HS4A 5DCLA 1GNSA 3DQPA 5AKXA 1OBHA 4QXPA 1LSSA 1SGWA 4Z7JA 2PUFA 4Q4AA 1H4QA 1QP4A 2O4UX 3IXQA 5AXBA 3VR3A 4Z7NB 3PVSA 3BRSA 3OE7D 4FSXA 1H66A 2QBYA 5IHPA 5L7YA 4CVNA 4JT2A 1OXSC 3RVNA 4BQQA 5KMGA 1W49A 3M9XA 1GGNA 2QT0A 3GV0A 2HXGA 4RZUA 4EFNA 4A5SA 4RABA 4S1VA 3IIJA 3CW8X 3KPUA 3U3XA 5DGIA 4BP8A 1EUDB 1RLJA 2OBNA 4ALIA 2I91A 1DXOA 1BE8A 4N0PA 3WKCA 2XLBA 2ZQYA 1ZMRA 3JAKA 1WPXA 2PMBA 1FSGA 2ZJ5A 2OD7A 3PGMA 2FW0A 3UEOA 1PJ2A 1DUSA 2O8VA 2RJOA 3MQFA 4OXRA 4Q00A 3WGJA 5C7YA 5J43A 1FYWA 1ID8A 1QGYA 1VFNA 4N6NA 1UDAA 2I6TA 3CN7A 3HC7A 1F3LA 1B8UA 4HNSA 4L5BA 5AESA 1Y48E 2WWHA 4ZZIA 2NVOA 1QQ5A 3IXMA 4Y2TA 2GS9A 1EE1A 1SCBA 1YL5A 2XNKA 2ZR9A 4AAYA 4BP3A 2W6MA 1H2AS 4TS9A 5JH7F 4B3TB 1DARA 2A9RA 2FUG1 4M9RA 1V8OA 2W83A 1U2GA 1G8FA 1V39A 1P7VA 1CE8B 3BMNA 2ZTUA 5G0UA 5ALVA 3M2PA 2XYVA 4L2IB 5D87A 4GQBA 3D59A 2B34A 3IELA 1J39A 2DZDA 1E2MA 3V6MA 2J9FB 1EK2A 2WMDA 1ISRA 1GPNA 2C04A 3I1IA 2QB5A 3OCZA 4B7AA 4BKMA 4F0JA 1L9KA 1BVRA 4M76B 2ODNA 4OK5A 1GTJ1 2PH3A 1RXIA 2VTKA 2OORC 3NONA 3OEYA 4HTFA 4HEA1 1DRWA 2C4MA 1JDBC 1TK2A 3WXMA 1Y6FA 3JQCA 4UD6A 4GKBA 4E5DA 1M2EA 3KC2A 4KDCA 4LYEA 2YWJA 3ZZTA 4GM1A 1RP7A 3N8DA 1H3FA 2EFEB 1OFGA 4TXJA 4OGWA 2J5XA 5ARCA 2O8FB 4NFHA 4ZCMA 3AF4A 1KQ3A 1ZM2A 2PY6A 1W5BA 3SS8A 2G6BA 3DO8A 3TCNA 4OHKA 1ZOSA 4XI9A 4C7XA 5DGTA 1MW8X 3HCCA 1Q14A 4C1NA 4KYIB 4RDIA 2YJ4A 3DZFA 5C2JB 4X00A 3EEYA 2P3OA 1GUFA 1P9LA 1IZYA 1PG2A 2VBFA 1U5AA 3AEYA 1WUKS 5JR3A 2ZIEA 1JT2A 4UTVA 1SAYA 5JQWA 4PFKA 4LZNA 4JP3A 2DPXA 3COJA 4OIFA 3HDTA 4MW1A 3Q8KA 1CHNA 2PANA 3TLBA 5JJCA 4L8FA 5HMMA 5BRJA 3R0ZA 4MI1A 1TYAE 2Q9AA 1O6CA 3DLTA 4F4CA 1FQOA 4O4HA 3CS3A 4R2IA 3HR8A 2PNFA 1XAJA 3DVAA 2JKYA 4TL7A 1KEWA 3DE7X 2PBRA 1G6HA 2AEEA 3V8BA 3N5CA 4EVQA 1A72A 2DTXA 2M6LA 3PE6A 3K0HA 2R5FA 3AEQA 4KQCA 1LZLA 4E70A 1Z5GA 1P3DA 2B7BA 3DM9B 3PBKA 3PDCA 4OREX 3AQ4A 3UH1A 4KMOA 4R8KA 3VJMA 1N32B 5M29A 2CK3D 2AL7A 4BX3A 1MEEA 4QEKA 2Z0MA 2XDYA 1RJWA 2QVYX 4KBYA 4DWOA 3PVCA 4X71A 1D2NA 2RCYA 1Y3HA 2DHQA 2Q6OA 2QRVB 3IHWA 2OXEA 2SNIE 4DM7A 2J30A 4X45A 3ROZA 4WVFA 3DF9A 1QU2A 3QTTA 1U9YA 3C3XA 3E9NA 4A2WA 2O8CA 1TLLA 1F2UA 4KLAA 3OZFA 3W9SA 1ULHA 4AZTA 5KPDA 3DFMA 4JKOA 5EN4A 5JRJA 1UQUA 2EQ5A 1FRZA 3JYPA 4P7BA 2YHAA 1M76A 1UOPA 3KTFA 1T3LA 3T7DA 4EW1A 2B7LA 2UZAA 4L02A 2C94A 4U39A 1B00A 3LY8A 2GK6A 4FBMA 3WL7A 3UK7A 3HKCB 1B16A 2HCTA 3PFWO 1E2PA 2AFRA 4W1PA 3W2EA 2Z4RA 4WOBA 5DEIA 4OLAA 1L4GA 1V9CA 1E5TA 3D64A 2X0DA 3VI3B 1QK5A 5G4LA 3QELB 2ZDHA 4EITA 3DE6X 1KI6A 4K40A 3FGPA 2PO7A 3ZLUA 3UJ6A 1AJEA 2ZVDA 1N8NA 2RHWA 4LXHA 4UXJA 2VJAA 4G5QA 1ORWA 1VKOA 4L57A 1MX5A 2N75A 1Q1ZA 2QYTA 3FM9A 4INZA 3SHOA 4E4RA 5JE8A 2C3PA 1YA8A 2LP4Y 1EINA 4RVDA 2P68A 3S7ZA 2Z8XA 3C39A 2XW6A 4Z9FA 3W77A 4AZVA 3WJ7A 5BN5B 4CU2A 1E6CA 2J9RA 4PAMA 2AG1A 3CINA 3HA7A 1EUCB 2LTAA 2X0RA 3PQFA 4XSHA 3NWBA 4XVCA 3IVXA 1L7BA 4PFQA 4DV3B 1ZM3A 3UJHA 2B8TA 2N1MA 1Z5OA 3LA8A 5BSKA 1VPLA 1X7HA 3CLTC 4NESA 5IWCA 3FLEA 5CCBA 5EI5A 3H3JA 1Y3AA 3GLGE 1SBCA 4QC2A 5C32A 4H3SA 5G41A 5CA0A 3F6PA 1C1YA 3NATA 4JFAA 3VUFA 4YRDA 4C0HA 1E1CB 1YWGO 2A5JA 2JGJA 1U3VA 5DZSA 1M1YB 1DU4A 1D8AA 1MO5A 1O08A 5EXDA 1WBJB 3X44A 4CKYA 5CD1A 1DFGA 1KF0A 5HA5A 3ZUGA 5IH7A 4K6KA