2P5TB

Molecular and structural characterization of the pezat chromosomal toxin-antitoxin system of the human pathogen streptococcus pneumoniae
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
251
structure length
244
Chain Sequence
IQDYTDSEFKHALARNLRSLTRGKKSSKQPIAILLGGQSGAGKTTIHRIKQKEFQGNIVIIDGDSFRSQHPHYLELQQEYGKDSVEYTKDFAGKMVESLVTKLSSLGYNLLIEGTLRTVDVPKKTAQLLKNKGYEVQLALIATKPELSYLSTLIRYEELYIINPNQHHDFIVNHLVDNTRKLEELAIFERIQIYQRDRSCVYDSKENTTSAADVLQELFFGEWSQVEKEMLQVGEKRLNELLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular and Structural Characterization of the PezAT Chromosomal Toxin-Antitoxin System of the Human Pathogen Streptococcus pneumoniae.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Transcription regulator
molecule keywords fragment of PezA helix-turn-helix motif
total genus 86
structure length 244
sequence length 251
chains with identical sequence D, F, H
ec nomenclature ec 2.7.1.176: UDP-N-acetylglucosamine kinase.
pdb deposition date 2007-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06414 Zeta_toxin Zeta toxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2p5tB00
4UNRA 1FX0A 1XD9A 3R7WA 2OHFA 1KDTA 4NHOA 2A2ZA 1W7AA 3UG6A 4ZKEA 1SVSA 1W2GA 1ZM4A 1JEDA 3FB4A 5F98A 2V54A 2GDJA 3RS5A 1QHIA 4DSNA 2VA8A 1UJ2A 5H70A 4Q4LA 4EPVA 1KDOA 2J45A 2AXPA 1N5JA 3WP1B 1Z6YA 2W2XA 1FMLA 4KSBA 4A8JA 1TU3A 4AY2A 4PQRA 4AKEA 1H8EA 4LPSA 2QPAA 3VFDA 2XTMA 3IHWA 3X1DA 4RD6A 5AUQA 3EPLA 4RZXA 1XD2A 5L3RA 3Q9LA 5TARA 5AJWA 2EFHB 3LBHA 1Z5ZA 1E0SA 3KXLA 5DH9A 3W3AA 3ZZTA 2NMVA 1JQJC 5GVRA 4RY2A 1X8LA 121PA 2NPIA 1NLFA 1ZJ6A 6Q21A 5FUVA 3K0CC 4A1FA 4IVQA 4LJ5A 1T0JB 3AVXA 2IS2A 2R62A 2UKDA 4TMKA 4WZAE 5JECA 1FNNA 1D9ZA 1PLKA 2RHMA 4Q9LA 3TR0A 2ZI4A 1XEFA 4L5BA 1T4GA 2LKCA 1P60A 4HDCA 4PZLA 4W5HA 2GK7A 4DUGA 1FMJA 4WIAA 3D6TB 3A4MA 3NDBB 1SHZA 1NVVQ 3O8CA 3TQFA 4Z54A 3LW8A 1AN0A 3VMFA 2G0NA 3PITA 2CLCX 1WB9A 1A2KC 4Z1MD 3KJIA 3V4FA 5CIWA 4GOJA 2HF8A 3AUXA 2N42A 5BW8A 5FL7D 3ZIAD 3SU8A 4C0AC 5FPHA 2VQSA 3PXGA 2J1LA 1NMYA 3KQNA 1R4AA 2ZU0C 1IN5A 4HZIA 3OIUA 4DB4A 3R9WA 1DG3A 2R6AA 4AURA 1PUJA 2Y8EA 1CIPA 3R8FA 4Q4HA 4AG6A 1YRAA 4L16A 1JXOA 1E79D 5DIFA 4PTLA 2J46A 3GLHE 2WVJA 3CWQA 3HU3A 4LDJA 2AKAB 2F3TA 1TNDA 3LNCA 2BMEA 5AUPB 1YZUA 1IJEA 1B0UA 5IDVA 1P5ZB 4AYTA 2HCJB 3RC3A 1LVGA 3O47A 3RS7A 2H8KA 2QT0A 5FR2A 4OI4A 1U98A 2G3YA 5EXTA 4XVUA 4BFZA 4TSFD 4B75A 1E2KA 3LX8A 3FOZA 1KK2A 2FEMA 4UJ3A 5C4GB 1G6OA 4Q1EA 4WAUA 3AGQA 1E9AA 1Q1ZA 4US1R 1IXSB 2FNAA 3CM0A 4CEIB 4K46A 3OEEA 2DBYA 2LCFA 2PT5A 4E07A 1ZM9A 3GEEA 2QTHA 3TR5A 1RRGA 1T5IA 4V0KA 2QI9C 2ZS8A 4Q00A 4TT3D 4URUR 4DLVA 3ICEA 5JRJA 2R6DA 2YWHA 3ECCA 3TRFA 5JSZB 2DFNA 4RKEA 5JMTA 4G3XA 3DKPA 4FCWA 3S1AB 3KQUA 1MO3A 3VR1A 3KXIA 3QY0A 4B2LA 5CIQA 421PA 2NGRA 4O3MA 1OIWA 4YONB 1F2TB 3ZZ0A 2ERXA 3AF3A 3EX7C 3MWKA 4JMPA 4JJKA 4PQYA 4JLPA 4FW9A 4Q01A 2F43B 1OB5A 1E9CA 1G17A 2FSHA 3K70D 1KZ7B 3C8UA 1G3IA 4EQ6B 1IM2A 3UMSA 4Y0VA 4C0SA 3KB1A 4H1UA 4L4UA 1CF4A 1C1YA 3CF6R 1Y63A 2GEUA 3BAFA 3VKHA 2JLXA 1E2NA 3QXCA 2J7PA 1HQYE 1G3UA 2AKYA 1U99A 1TF2A 5FL7A 3ZIAA 2D2EA 1R8QA 3IHLA 1I4LD 1QHHA 5HKKD 2FWRA 3K0SA 3KKOA 1XCPA 1SKQA 2DY1A 4DDWA 1TMKA 1U9IA 2W6ID 2O0KA 2IC5A 1J90A 2O0HA 2BCJQ 4MUBA 5UKDA 4KITB 4KLNA 1EX7A 3BJIC 5L3QA 2ZU6A 3AP2A 4L15A 4D6PA 2A9KA 2F1HA 4D81A 4BEJA 2HYIC 2FDCA 1F2UA 2QNRA 4IRUB 2ANCA 4TMXA 4PC2A 1P9NA 4D80A 1ZNYA 1CTQA 2JDIA 3N2EA 4PPGA 2YOFA 1AJEA 3QKRB 4JLDA 4NE2A 5D3MA 4CT4B 3EG5A 1KHTA 1P4SA 5BQ5A 1G5PA 1SGWA 1SXJB 2YYZA 4M4SA 3SN6A 2VHQA 2ZRMA 3GJ5A 3BH6A 4LK2A 4PZZA 1G7SA 1XEWX 3AM1A 3F8TA 3ZZUA 1KDRA 3K70B 2QP9X 5C18A 1W36B 2ZR7A 2O52A 1MV5A 2H17A 2N1BA 3P27A 4HATA 1TL7C 3QVUA 1FTSA 2BCGY 1YHNA 3GLIA 2FEOA 5LB2A 2JLWA 2ZEJA 2OFOA 2ZRCA 2IYLD 1G5TA 2V3CC 3FMIA 1IOZA 3LXRA 3W90A 3MRSA 2WHXA 1G19A 3LV8A 2P3SA 1XTJA 2IYYA 4WW0A 3FGNA 5AK0A 2FJUA 3OEED 4OK5A 1DAIA 3WNBA 2Z43A 3EXAA 1XTKA 1XEXA 2C77A 4B6FA 2GAOA 5AWFC 5BWMA 3KKMA 2EFEB 4M9QA 4A2QA 4KO8A 1US8A 4LYHA 4NL4H 4D0LB 4TYQA 3V4RA 2GVZC 1XWIA 1IN6A 4CVNA 4M1SA 2J5XA 1KSJA 1PUIA 2R8RA 3GD7A 4MKGA 5GADl 1XPOA 3LD9A 1XBTA 2HLDA 4Q9HA 1E96A 1YJ5A 1KAGA 4HEJA 2FZLA 3PCRB 3NHBA 3VKGA 1OXSC 2OT3B 4A82A 2CVFA 2XX3A 3GFOA 1D6JA 2VBCA 4DIEA 4MGKR 4DJTA 5DI3B 1NY5A 1AKEA 2JEOA 3ZD6A 3T12A 2IYQA 3G82C 2R6FA 4IKEA 4WOPA 5TMPA 4TL6A 2W2VA 3QJYA 1TF5A 2WPDD 2ZITA 4CF7A 1W4BA 4B47A 4NP6A 4M0LA 3IEUA 3T5DA 4CEIA 2AWNA 2VF7A 1ZUIA 4NKRA 2FPKA 1ZP6A 1ZUHA 3RS2A 5EQTA 1E9BA 2X1VA 1RPZA 4FXPA 3K0FB 2NO0A 4QGAA 4JBYA 4A6PA 4MH0R 2WWIA 2XJ4A 5FTNA 2ZE7A 1I2MA 4TL8A 2JLQA 1XMVA 3ADKA 1MABA 1RE0A 3QSYA 2OG2A 3U61B 3NBZC 3GFPA 4TMZA 1SVWA 1YZNA 2KBFA 3FYHA 4ZDWA 2OLJA 3EAQA 3IKJA 2ORVA 1GNRA 4LOAA 4OK6A 1HE8B 1OXUA 4C7OB 1NJGA 3I5XA 2VF8A 4Q7MB 1JR3E 2I3BA 3V9PA 2JLYA 4JLOA 1ZC4A 1OXXK 4EIWA 5BXQC 3KQHA 1WBBA 2IEZA 3WMFA 3WYGA 2YOGA 221PA 3ZS9A 1FP6A 3AF0A 3TE6A 5ANRB 4PFSA 2EFGA 1S9HA 4GFDA 1XJCA 1MT0A 2ZROA 1N6HA 1Z0FA 1DAFA 4IOMA 3W3ZB 3CX8A 5KU1A 2EU8A 3OF5A 4AKHA 1OKKA 2IK8A 4B76A 4RD4A 5L3SA 1ZRHA 1P7CA 1JPJA 1P6XA 2AN9A 3QIAA 5GJWC 3W6OA 3VR6A 2IS1A 2MSDB 1N6LA 2Z6VA 4F4CA 1WE2A 1AS0A 2BBOA 4LHZA 2FG5A 2Q6TA 1K8RA 2YNMA 4OHWA 1UKZA 3AKYA 4MYHA 3BXZA 2ZE8A 5IHPA 2QTVB 3SC3A 3DEFA 4EAQA 3SQWA 5HZKA 1HT1E 1B23P 3UIEA 4KCGA 2ZQ5A 4NYIR 3HYRA 2F1JA 4IJMA 4BLOA 2RGNC 1KJYA 3MD0A 3QKRA 1WDTA 2XZPA 3WYAA 1TUEA 3OEHA 4KSCA 1OH6A 2ZREA 4JKYA 5SZHB 1AM4D 2XXAB 3THXB 1OW3B 1AIPA 1L2TA 3DZ8A 4NONA 4XJXA 3GP8A 3QKSB 4LHVA 1CULC 4V02A 1J2JA 4DB2A 1Q1EA 1QZXA 1UPTA 1W46A 3WBKA 4JJZA 3QUSA 2QE7A 3PFIA 1KMHA 4W5WA 2OSBA 5JJIA 5LD2B 2PCJA 2OCPA 3RWOA 3I3SR 4MKIA 2NIPA 4DLUA 3P26A 4NZYA 3A1TA 2D3WA 2WJIA 4D4KA 3HDTA 4NCKA 4MRNA 3F3YA 1SXJE 4BZQA 2NQ2C 1DEKA 2J7KA 5DO9A 1XTRA 5EZ5A 4ZCIA 1XF9A 2YV5A 4ITRC 4ASUA 3MSXA 2H16A 4PO1A 2D7CA 3T1TA 3GJ7A 2DFKB 2NO6A 3GJXC 4Q4HB 2ZAMA 1QDEA 1JALA 1OIVA 4QOSA 2GHIA 1K6MA 4ZCMA 5JI2E 2QBYA 1X8KA 2YJTD 3GLHB 3X1WA 2YWGA 4G5RA 2Z83A 3SOPA 2W6JD 1YZLA 3KQLA 5DHFA 5G40A 3LH5A 4G5OA 4AG5A 5JEDA 3OFNA 5JWOA 1IN7A 3FTQA 1W0JD 5EZ6B 1X1RA 3BWDD 2MSCB 2JLSA 5M04A 5AJVB 1J70A 4PPNA 4KBGA 3RANA 5JS7A 3TJZA 3LVQE 2ZE6A 1E1RA 2GA8A 4JKIA 1KI7A 3BIFA 3BGWA 1KMQA 2VP9A 3KXKA 5LD2C 1ZUNB 2B7BA 2RGXA 3M0EA 3UMRA 2BM1A 1XEWY 1P75A 2VSFA 4Q66C 4HAWA 4B3XA 1NLZA 4K81B 2HDNB 1R0ZA 1JQLB 3KKPA 3DPUA 5B2ZA 4WZBE 4BUJA 4TN1A 5J4VA 3ND9A 4JSTA 5KSOA 2MMCA 1H65A 3TW4A 4C2UA 1KIMA 2CK3D 3C16C 1VKJA 5KDLA 3LVRE 1GRRA 1W4RA 4DEXA 4F91B 1T3SA 1RYHA 1OFIA 4WXPA 4PSKA 3EA5A 1E9DA 2P6UA 4KFRA 4RJLA 5GVSA 4IVPA 1BH2A 4HB3A 2V6IA 3NKVA 4LYFA 4M9ZA 4R2HA 1DE0A 2CNWD 4NBSA 2QAGA 3ZYCA 2ZYVX 1FFHA 3NHAA 3QQ5A 5CYPA 3SHFA 1MO4A 4TYNA 1P61B 1EXMA 1XRJA 4RFSB 4RCYA 5AJXA 5EE3A 3VTKA 4GMDA 3GJ8A 4N1AA 1GG2A 5KSPA 1XTQA 3ADDA 3WY9A 2NTYC 1H8HD 2H5EA 2WMNB 2VP0A 3KUCA 1E2MA 3O8BA 3NH9A 3TKLA 1UEIA 4LV6A 4YMSA 2QPOA 2C2HA 4Y0AA 1CS4C 2VP4A 2ZANA 2B21A 4NYMR 4QKQA 1KO1A 1Z2AA 2ZS9A 1AQUA 4HAZA 2H57A 1NMXA 2GBLC 4H1VA 3PEWA 4TZ0A 1NY6A 4PC6A 3L8YA 4B2IA 3MAAC 1IY1A 4BECA 2QL6A 4UKDA 4D0NA 4DDVA 2DWQA 4DDUA 4N0DA 3U3MA 1G1MA 4MYTA 3Q5DA 2QZ4A 4Q7KA 1P9RA 1ZMXA 4B6EA 2AWOA 5CYOA 1T3LA 1XMJA 1TPZA 2PEZA 4LJ6A 2FN4A 2X2FA 521PA 4OL0A 2GKSA 4B43A 2XXAA 4Q19A 5A0FA 4HAXA 1R8SA 4TLEA 2ZRLA 3LW7A 1NJFA 4PSAA 5DN6D 2XOKA 4PX9A 1J8MF 3B2EA 3BD9A 3TSOA 2QQEA 4TLDA 2OCBA 3CZQA 3UKDA 4DXAA 1E2HA 1HQCA 1D5CA 1Q3HA 1XDBA 2IL1A 4TLCA 5FBRB 2IWHA 4TQ9A 4A0HA 2RGNA 3DOFA 4KI0A 1WRBA 4KVAA 3J81k 2HJVA 1M74A 1IY0A 3GLIB 5HCIA 1D2MA 5J40A 5EP1A 3EA0A 1COWA 2GEVA 1LNZA 1VG0B 2A5JA 3NXSA 2FGJA 1DOAA 2IW3A 4YLGA 1M6NA 2ZPTX 3THYB 4JLKA 1OLOA 3GPLA 3ADCA 2GCOB 2BV3A 4HB4A 4KYIB 1NI3A 2B7CA 3E70C 1XEXB 1SVOA 3A6PC 1Z6GA 3AF1A 2G83A 2YOHA 3NEJA 5DE3A 5JWRA 4D25A 4RFVA 1KI2A 4DRZA 3A4NA 3CONA 1KSFX 4I4LA 1VHTA 2IBMA 3ZVRA 1GIAA 3GLHA 3H0KA 2V8OA 2O8CB 1G5RA 4LC1A 1KSHA 4DEYA 4Q7LA 2GETA 4R2IA 4L9SA 1LY1A 1Z6AA 3WYFA 3AVTA 5D3QA 1C4OA 1G6HA 3B1ZA 4QJ4A 3SJCA 4QGFA 1BMFD 2IWRA 5JJLA 1AGRA 4TYWA 1XXHA 1M7HA 3NIBA 2VP6A 4ACAA 2ZM5A 4QM7A 3SJBA 2AK2A 4L9WA 3QBTA 4DCVA 4TTQA 1JI0A 1NBMD 3QKTA 4PAOA 5HCNA 1E32A 1VYVA 2CBZA 1LS1A 1KI4A 5F9HA 1F5NA 1Q22A 2ONKA 2WKRA 1CLUA 3EC1A 4CGZA 4XD7D 2Q9BA 4PR0A 5IK2A 4OI0A 4POAA 2GCPA 4F4JA 4EPRA 1R0YA 1AS2A 4DC9A 3WNDA 1OKKD 2Q3HA 1X6VA 3W9YA 1FX0B 1NIJA 3BFKA 4N3NA 5FPYA 5TVKA 3R7WB 2QSYA 3IPXA 2CCKA 4LJ9A 3QEJA 1VCMA 3AF4A 2VRWA 1OB2A 1KI3A 1CKEA 1SKYE 1G64A 3PR1A 3ETLA 2JASA 2A5YB 1OIXA 2BEKA 2R6GA 2WSSA 3KKNA 3Q3JB 4OJKA 5L8VA 1MABB 1TQDA 3B1VA 4M1TA 1BYIA 3VR4A 4HB2A 4D4LA 1N3BA 4OQMA 3T34A 2QMOA 3FVQA 2CMKA 1F2UB 3DVLA 2OCAA 4TWZA 5C2JB 2H7VA 3NEYA 4HLQB 2QAGB 4Q21A 1MKYA 3OIVA 4IDHA 4IOJA 4AI6A 2QSZA 3D7MA 1TEVA 1RYFA 1NP6A 2YKGA 1DARA 3TW8B 1UKEA 5G3ZA 4CEJA 2KBEA 4RKFA 1BIFA 3QKUA 1GWNA 2GWHA 4LUCA 3SDZA 2FSIA 2VPPA 1NN0A 4M2LA 2JJ2D 1COWD 5FFMA 4O25A 2ZI7A 4JLNA 2FF7A 1JECA 4URWR 3K0CA 3RSLA 3U6KA 1MH1A 4PHTA 3THWB 4BFYA 2ZRPA 3A37A 4E03A 3SE0A 3IEVA 2EFDB 4P4SB 4MQBA 2ZYUX 1DELA 3REGA 1NN3A 1CJMA 1OXVA 3C41J 4G5QA 3W8RA 1UKYA 1X8JA 4LY6A 5E3HA 2PT7A 3ADBA 3BFXA 3ZS8A 2MMGA 5KYKA 2AXNA 3DDCA 3CF0A 3NC1C 4MDFA 3CRVA 3PVSA 3MUFA 4P31A 4PANA 1E2DA 3CR8A 1TU4A 4EJSB 5DHAA 4B33A 2ATVA 4M1WA 2CCGA 2ONJA 1JAIA 2BMFA 3LA6A 5G3YA 1EG7A 3THOA 2A78A 4YXWD 3GJ4A 3EZ9A 5A5GA 5KNDA 3B13B 1KKMA 2X8AA 1Q12A 1Q21A 3CRRA 2Q9AA 3PIRA 5BYKA 4GRAA 2QM8A 3T5GA 1IQPA 5SZJA 1A4RA 4XD7A 5IK2D 2KSQA 2N46A 1HUQA 3OHMA 1G8YA 2A3RA 4FI3C 1KNQA 3MLEA 3K9GA 2GCOA 5IF9A 2Q3FA 3GQBA 2VP5A 3B1YA 3DZDA 5FOUA 3LO5A 4F4IA 2YVUA 1ETUA 1U8ZA 1WP9A 3HPQA 1OSNA 2ODBA 2X77A 3SBDA 1TTTA 2CLDX 5J47A 4PAQA 1X86B 3EZ2A 5EE1A 1D2EA 4DLZA 3UPUA 1T0HB 1N0VC 1Z63A 3QXXA 3M1IA 3SEAA 5GJBA 2REXB 4IXMA 3EW9A 2ZRKA 4DLXA 2CK3A 1DVRA 4LPKA 4ZPXA 2QT1A 2WSMA 3D3QA 2ZUBA 2MSEB 3K9HA 3HWSA 4ESHA 4GOXA 1VG1A 2JJ1D 4HLUA 3N2IA 1MR3F 5AR1A 3S1AA 5GJVC 3TUJC 1AGPA 3NWJA 2IXGA 4MKFA 3PUXA 1E2LA 1NKTA 4PHGA 4JBWA 2V1UA 1G7RA 1F2TA 3IQXA 3R20A 4V0ME 4DSTA 5FPTA 1WBDA 4QL3A 1DTSA 2DCUA 3LBIA 1OYYA 4G5SA 4I1SA 4TT3A 1XPRA 2BDTA 1QHSA 2GTPA 1ZC3A 5KOYA 2F43A 3PEYA 4BEBA 1OH5A 3HR8A 2FFQA 5E4FA 5CB6A 4EPYA 3QXHA 4JVMA 2VIIA 3I72A 5AJZA 4EQ6A 3ZJYA 5KUTA 4P0TA 3RRMA 4PPQA 1SHKA 1R2QA 2CE7A 2ZTSA 4I81A 3LWNA 1DAHA 3T1VA 1ZD9A 3UG7A 4M1YA 1LFDB 2PL3A 2Z4RA 3CIOA 1NNEA 2IUUA 1JR6A 2WAYA 3AUYA 1ZD8A 4LGMA 4EJSC 3SJZA 2WIAA 3BERA 3LLUA 3VNVA 1Z83A 2OM2A 1TAGA 4CW7A 3D8BA 4BLRA 2ORIA 4G5GA 3CWZA 4ON9A 1KO4A 2J7PD 4FCVA 3P4YA 4JYBA 4W7SA 2O8BA 3AVOA 1EWRA 3AKEA 4I1UA 2B8TA 2V7QD 4PZYA 4BZPA 4NYJR 4YXWA 3GLGE 1EFHA 3CR7A 1AZTA 1P72A 3FWYA 1RJ9A 5A4JA 1OH7A 5KDDA 1E2EA 5DN6A 3LX5A 4M53A 3B9PA 2ZRJA 2W6IA 1SULA 3SYNA 1E0AA 3O8DA 3T15A 1NVWQ 2I4IA 2P2LA 3GJ3A 3PUWA 1ZBDA 1PLJA 2A5DA 4QC2A 1JAHA 2CHVA 2FPLA 2OXCA 3GFTA 4C2TA 2WWXA 5TXGA 4OJQA 3TUZC 3K53A 3RC8A 2JATA 1Z0AA 2WOOA 4BQSA 1X3SA 1Z06A 1OYWA 2BKUA 4UXIA 1CEEA 1K5DA 2JDID 4QBIA 3E5HA 1AA9A 2GAAA 3CKLA 4EPXA 4QHTA 1YZGA 4F92B 3VX3A 1KJZA 1KNXA 2WBLC 5H68A 2FX3A 1JJVA 4C0QC 1VG9B 2O8DB 1DO2A 1YR8A 3I5YA 3AVUA 4DWJA 3MWLA 2ZR0A 4CEHB 3U7FB 4ARZA 1RFLA 2P65A 1E1QD 4OHZA 4DDTA 3K8YA 1TQ2A 2IYSA 4P33A 1QVAA 1UBFA 1FTNA 2V55B 2QBYB 4GNKA 5C4MA 2NG1A 1C9KA 5JCZA 2ZJ2A 2Q9CA 2EQBA 4LHYA 3TK1A 2G6BA 4ZIRB 1OFUX 3KFVA 5JCPA 2JLRA 1N6OA 4MITA 4ERNA 3GLFB 2JLZA 2C9YA 1T8TA 2E87A 2EWVA 4DHEA 2DB3A 2W2TA 1G8FA 2VHCA 2HXSA 3VNUA 2VL7A 4TLBA 4QBHA 1FPMA 1JBKA 2ZI6A 4UNSA 3CZPA 2ZRHA 4TLAA 4BFSA 4P4TA 1ZYUA 2ZE5A 2D7DA 4DT1A 1WCV1 1P3JA 4D4MA 4Z8YA 3PEUA 2G1KA 3GMTA 4QNMA 5K8IA 1G3RA 4E22A 1HE1C 1RIFA 5EXXA 3VKWA 3CX6A 3CPJB 2ZJAA 3T61A 3H86A 4F7WA 4I99A 1BYUA 2XSZA 4ACBA 1XTIA 4IDNA 4HUQB 1UDXA 3ONWA 1GUAA 2ASEA 2ZYTX 3FHTA 4YMWA 2RB4A 4Q4AB 1QG4A 3AEZA 1ZM7A 3BBPA 2PMKA 5EXSA 1NIPA 3I73A 1EGAA 2ZI3A 4HSEA 5TV2A 3IIJA 2WSSD 4Q5IA 1FW6A 4JZKA 4TSFA 4XWKA 5KPDA 3RDPA 3VX4A 2QN6A 2QQ0A 4HDOB 2V7QA 5FOXA 2AD5A 2IF0A 4IXNA 2OILA 1Z07A 2OBLA 2OESA 4QFMA 4U00A 5JWHA 1DADA 1WXQA 1NLYA 2ZIAA 3HP1A 2AHOA 1N25A 1Z6TA 2GXQA 2EWWA 3LQQA 4JT2A 4RFSA 1VIAA 1KK0A 1XXHB 2XNDA 4IFEA 4XSGA 3RS0A 8OHMA 5EE0A 4QJ3A 4DLTA 1I4DD 1MO5A 5FOVA 1GM5A 1I2DA 1KI9A 3X1ZA 4US2R 2A30A 2REOA 3ZQ6A 4RZUA 1XD8A 4JVSB 2EYQA 3CNNA 4ESVA 1L4UA 1OH8A 4FMCB 5E7IA 4GP6A 4DKXA 4C30A 4EDHA 2OFWA 5AUNB 3QF4B 1J7KA 3PEVA 1KI6B 5FPSA 2F55A 3T06B 1SXJC 2WOJA 5CDFE 4XIGS 2IYWA 1UFQA 4DSOA 4GMXA 4LHXA 4PC3A 2VP2A 1S96A 1XCGB 4Q1FA 1EFRA 3B85A 3KDSE 4ZO4A 3L43A 4GI7A 3U4QB 2BWJA 2AFHE 4CDGA 4TQAA 4B3CA 1OPXA 4K8OA 5AJYA 1F6BA 5J4KA 5CM8B 1GRQA 2UZ3A 3H4MA 2ZJBA 2O8BB 3IPYA 4HAYA 4DBLC 5B64A 5JEEA 2VHTA 3K1JA 2ZJ8A 3U44B 2IXFA 2QTFA 3QI2A 1OF1A 4GBMA 4PO9A 4F38A 3MFYA 4TZ6A 1XTSA 2OFXA 2C8VA 1Y3AA 2WMOB 2CHGA 2GCNA 1RRCA 821PA 1N6RA 1A1VA 2QP4A 3A58B 2QAGC 2RHDA 3HYTA 5KTYA 1JR3D 2A5GA 4CEJB 4QBGB 2F1IA 1KI8A 4BRWA 2VTKA 5JS8A 2FU5C 1L4YA 2C5LA 4ZCLA 3PUVA 3KJEA 1AZSC 4MKHA 2W0MA 2XSZD 4M21A 5CLLA 2ZRGA 1KZGB 5FI1B 1S1CA 3LRPA 2BJWA 2ZI5A 1PLLA 2O8DA 1HTWA 1KO7A 1YQTA 4DLYA 3KKQA 4P4SA 4JSYA 4OQFA 4YQFA 2ZJOA 1VHLA 3DM9B 5FH9A 1CP2A 2G77B 1P9WA 1MRSA 4TMWA 3ICQB 1HT2E 3FFBA 3FKSA 1Z22A 2BC9A 3RRZA 2X2EA 5FOSA 4F93B 3SBEA 3GLFA 2BM0A 4AK9A 2WWHA 1CR0A 3TAHA 2YWFA 1DPFA 3MJRA 1Q20A 5FBLB 1GFIA 2JJ1A 4PQFA 1GL6A 3LDAA 3D31A 2IHYA 2V1XA 1N6IA 4A6XA 3AP3A 4DT1B 3AF2A 1PV4A 2BEJA 2FH5B 3FPAA 4IOLA 2JJ8A 2JIZA 4B2PA 3MMPA 1ANKA 3RABA 4B3DA 4FMBB 2O5VA 3MJHA 2ATXA 4X8HA 4Q1BA 2WJGA 4LHWA 1WMSA 2ZVQX 3IILA 3H1TA 2QG6A 4JLMA 2ORWA 5BYJA 1EWQA 1Z47A 1VECA 4NU0A 4O2LA 4M1OA 1CJKC 3TAUA 4HLCA 4S2EA 1KYIA 2NOAA 3CH4B 4PC1A 1SVMA 1R7RA 3RYTC 4NCJA 3NDPA 1N5IA 2HT1A 2RMKA 4DVGA 1EESA 4OK3A 4HYYA 2OEPA 2XTNA 4LV8B 1N5KA 3UK6A 4V0NA 4GP7A 2RGGA 4MYUA 2IEYA 3IDQA 3UMFA 5K8UA 4LJ4A 4JL6A 1M8PA 4XVQA 4LI0A 4Z51A 2VHUA 2D74A 1W36C 2OUKA 2R2AA 1KDPA 2WZQA 1E9SA 2WJVA 2FPMA 2GBLA 1M34E 2QU8A 2KE5A 1N2CE 4BFTA 1NN1A 4BLPA 5HR5A 4B73A 1ZCBA 2Z5FA 3BC1A 1E9FA 4G01B 2YHSA 4BPBA 3IGFA 3UWOA 1E98A 2I1QA 4UNNA 3K9NA 2QENA 5EE5B 3U3JA 1LF5A 1P62B 2Z0MA 3BB3A 5KDOA 3BB1A 2IT1A 2ZSFA 5FTKA 5EJEA 3TSZA 4Q9KA 5E7JA 4B48A 1KOFA 4RD2A 4JIMA 1ELOA 2QMUA 4A8JC 2EFCB 3W5JA 1RZ3A 2JLUA 3IIMA 2QGZA 5FBVB 4V0MA 3KJGA 1UF9A 2C96A 2HUPA 3IBYA 2IS4A 1IBRA 2J3EA 1PZNA 4RD1A 2B8WA 1KO5A 2GRJA 2FE4A 2IYVA 4S35A 3U7EB 3V00A 1IAQA 1WF3A 2J0UB 3Q72A 3R9IA 1XXHE 2E9SA 1S3GA 3GJ0A 4BLQA 3TLXA 3TGPA 3IBGA 1JXMA 1YZKA 2RKOA 1HH4A 1IONA 1G4AE 1VCNA 3PUZA 4NPHA 1H8HA 1UEJA 2FV8A 4U7DA 3VR3A 2RAPA 1XCMA 4FWIB 4MUAA 4DZZA 4Q48A 3RLFA 3JVVA 1XMIA 2JAQA 1BOFA 4U5XA 4YDHB 4FWTA 3BE4A 5KSYA 4GPTA 1P2UA 2WAXA 3FHCB 1GVNB 1Z8FA 2G0TA 5JHHB 3VR5A 3IQWA 1GL7A 4BZXA 2XZOA 2PLFA 3NH6A 4NYIQ 3X1XA 2WTUA 4BFVA 1A2BA 1WQ1R 2AK3A 3TMKA 1CBUA 3CH5A 4OKSA 2SHKA 5CK5A 4AWXA 5KSZA 2JIZD 3A36A 2OAP1 1CU1A 1U2RA 5DYGA 3OIYA 1S2MA 3WMEA 3N70A 721PA 4EPTA 4XWOA 2ZRAA 1YE8A 1HYQA 5EP3A 2WKPA 1GNPA 2DFLA 4A9AA 4D0GA 1EFUA 4QNRA 2GZAA 2YC4C 1VYUA 5KNBA 1XFAA 1R5NA 2F1RA 1DAMA 2CVHA 4O0MA 1XJQA 1ZNWA 2ODWA 2CXXA 4YDSA 3EPJA 1YVDA 4ZKDA 4QM6A 1AKYA 2PZFA 3CPEA 3QXJA 4UXHA 1J99A 2RGEA 4UJ5A 2XOKD 2JLVA 1FUKA 3QENA 621PA 3L82B 1U90A 3EWAA 3KFXA 1R5OA 3EARA 5JI3E 5CM9C 3WXMA 1NKSA 4D4JA 1CJVC 3ZVLA 4M1KA 4PHHA 4AD8A 3RS4A 2E1RA 3TQCA 2YZ2A 4ARZB 2JCSA 1ODFA 4NCHA 2ZSEA 4AKGA 2BMJA 2L0XA 4G1UC 3PG5A 4MRSA 1TF7A 4BLSA 2J0SA 2DPXA 3NVAA 1CXZA 2J0VA 1Z28A 4ZIRA 2O8CA 3CBQA 1A82A 1IXZA 1M7GA 3HR7A 4JL8A 4Q02A 2D2FA 5HKKA 1V5WA 1NL3A 1OJLA 3EIHA 3SJAA 4FMDB 4LJ7A 5EXPA 4Q4JB 4RD3A 1XZQA 1E69A 4KHZA 3CF2A 4C0BA 2XNDD 4FN5A 1IXRC 2QUZA 3A1WA 1U9IC 1QVRA 2FFHA 1Z0KA 1F3OA 4W9MC 1OXTA 2CCJA 3AVQA 4BLTA 3G5UA 1S3SA 2OLKA 4HZUA 5FTJA 5LBIA 2ZJ5A 1G41A 1TADA 1VDZA 1M1YE 1H8ED 1KGDA 3TVTA 4GDFA 4I1OA 1FQKA 1QBKC 1VTKA 2QRNA 4OHYA 3PV0A 4OHVA 1XX6A 4GZLA 1G18A 1UKVY 1G7CA 2QMEA 1YKSA 4IOKA 4OYHA 5B58C 2HXYA 1MOZA 4FD2A 3I8XA 1E6CA 3AB3A 3U7GA 2VSXA 3C15C 1G3MA 4W5JA 4Q4AA 3BS4A 5FL3A 1U8AA 3KB2A 4QGGA 5TB5A 4JYCA 3DM5A 1V43A 2GJ8A 3QVVA 4OQNA 5IT5A 3QXSA 1FL9A 4URYR 2IUTA 3QPUA 3B9QA 1GKUB 1W0JA 2P6RA 3K70C 4B35A 1NBMA 2HCBA 3DMDA 1Z6XA 3L0SA 2IYRA 1DAKA 4Q18A 5DGXA 1RRFA 5TDHA 2G88A 4NH0A 2PH1A 1VMAA 3AVPA 4TL9A 3I8SA 4M1MA 3CUEF 2IHBA 4KYUA 4Z1MA 1YR7A 4JL5A 1T8UA 1RJ9B 5H1YA 2PZGA 2ZJYA 2ZRNA 1FZQA 1EX6A 2AD1A 3BFVA 4B3FX 4Q47A 2C04A 4LV5B 4TMTA 1T6NA 1JR3A 1GKYA 3AH8A 3W6PA 4C4PA 3U2QA 1IHUA 3GLFE 1DG1G 3WNCA 4BFXA 4PPFA 1UBEA 3X2SA 4DCUA 1NG1A 4B3GA 1RVDA 4PC7A 2ECKA 2WJHA 4V0OA 1E79A 1ZU5A 3IUYA 5DYIA 1T5LA 3Q8XB 3C7KA 3QPWA 4B44A 4LYAA 5J4HA 4BASA 4IEIA 1VPLA 4IEEA 2AL7A 2HJGA 4KBFA 3I32A 1ZW6A 2QRZA 4IDPA 1UAAA 2D06A 3THWA 1G8GA 1OFTA 3K0EA 3T1QA 1OE0A 3PQCA 4QHYA 5K8LA 2A5FA 3MWJA 1NSTA 1CR2A 1XMSA 4CEHA 1F60A 4UXJA 4O2RA 3U4QA 1SVKA 2GJKA 4LSGA 2ANBA 2DYKA 4NCNA 4FCTA 1F48A 3FKSD 4TTRA 4GOKA 4LBWA 1JB1A 4PO8A 4EKDA 4ZDJA 3OAAD 5FUXA 2PLRA 1FOEB 2AFIE 1YZTA 2QA5A 2GXUA 3H84A 1Q1BA 3OZXA 2XJ9A 4JLBA 3T1OA 3ZVMA 1VIYA 2CL0X 1EFTA 2FGKA 4EJSA 2OBMA 2RCNA 2QPTA 4AIIA 4OQLA 1T9HA 1UDWA 3CRW1 2P6NA 4TYYA 1TUIA 2ERYA 3Q7QA 4OI1A 3VR2A 2VSOA 2ZVPX 4ILEA 2ZSDA 3JZAA 3IO5A 2QGNA 1IY2A 1GL9B 1S9DA 4IDQA 1SVLA 2DWOA 1IJFA 3AKCA 3I4LA 3QPVA 2KB0A 1E9EA 4RSGA 3TUIC 4EFMA 2CL7X 1NVUQ 2XAUA 1AQYA 4MGIR 2RH5A 4R71A 1PJRA 1XNJA 1DAGA 4JS0A 4B71A 5FOTA 4HUQA 5TY0A 1VCOA 1AS3A 4OQXA 3R9XA 2WIBA 3AKDA 4FMDF 4TQUS 2CJWB 1GKIA 2GILA 3KTAB 2CE2X 2V4ZA 1HV8A 2FMXA 4QRHA 5F9FA 4XTRA 3L0OA 1YZQA 4NTZA 5SZKB 1UBCA 4MYCA 3VHLB 4KODA 1GP2A 1GOTA 1N6KA 4NCIA 3LXXA 3LFUA 4MRPA 3RS3A 5CITA 4CIDA 4A2PA 1Z3IX 1DO0A 3DHWC 3VU9B 4IVRA 4QG7A 2J41A 2ZS7A 2XTZA 1DBSA 4A15A 2J59A 1W44A 1Z08A 1W5SA 4H9GA 5E7MA 5JHGB 5LPNA 3RSOA 2K5UA 2F9LA 5P21A 2FA9A 3W8NA 3WMGA 4BFUA 2WICA 2OCYC 3FE2A 1YR9A 4LX0A 4BE7B 2KJQA 3SQXA 2UVQA 3DMNA 4D2IA 5FBWB 3N5CA 4QJ5A 2OAQ1 5ELXA 4Q9JA 1GZSA 5FPKA 2NZJA 1A5TA 4XWAA 2VLIA 3PJRA 2XB2A 2XITA 3E2IA 3A1UA 4XOIA 1I4TD 2OBNA 3W34A 3ZVNA 3ND8A 4KU4A 4XTCS 3KJHA 2ZJZA 2ZXUA 3BH0A 2W83A 3OEHD 5FR1A 2PX3A 4IFBA 1KAOA 3SYKA 3Q85A 1G9XA 1IN8A 2IXEA 2QAJA 3CO5A 1LW7A 1BS1A 2O0JA 3I61A 4R9UC 1JPNA 5B57C 3Q7PA 2QY9A 3WHLA 1BMFA 2XEXA 4LCBA 5JFGA 2BHRA 1ZD1A 4EUNA 3SR0A 4DLSA 3CNLA 4YMVA 2QE7D 4LJAA 2CDNA 2ZSBA 3DOEA 3OAAA 2H92A 3GLGA 5H8WA 3SNHA 4KV9A 1NG9A 5BN4A 1ZINA 1NRJB 3U44A 1UADA 2BBTA 2P0EA 3JZMA 3RVBA 4Q03A 2VHJA 4DLRA 3GLIE 3U5ZB 3EPKA 2WJJA 1KJWA 4GL2A 1XD2B 3EWSA 2AR7A 3AVYA 1NMZA 5D3MB 3SS8A 1G7TA 2C78A 2C98A 1R10A 2VYFA 2W00A 4WA7A 5J5CA 1GNQA 3SYLA 5DNYB 2B6HA 4BGDA 1G8PA 2LWIA 4CRWB 4RZ2A 3A1SA 3EZ6A 3B1XA 5GJCA 4M8NE 5BN3A 2WKQA 3F0TA 4ASUD 2ZRFA 2GJ9A 3ASYA 3OESA 1KSGA 4RZ3A 3I92A 5KHOC 3AVVA 1SQ5A 3K0AB 1S8FA 1VYTA 4A2WA 4LZZA 2FZ4A 2C95A 4WZ6A 1II9A 2C99A 2GESA 3DKVA 3UXMA 3CRQA 3HU2A 2EW1A 2ZETA 2AX4A 3TVDA 1NF3A 1SVIA 5DLQC 4XSHA 5CDFA 2Z4SA 3UATA 3OFND 4DLWA 2REBA 1E2IA 1E2JA 4P3YA 3L8ZA 2RGCA 4A0GA 2PBRA 2GF9A 1N5LA 3BK7A 3LAWA 4PSVA 1K5GA 4WXRA 1E3MA 1EK0A 2OV2A 4URXR 2EVWX 1E1RD 2IS6A 1U94A 3AVWA 1W49A 1L7VC 4QGHA 5FI0B 2WWGA 5JRZA 2WPDA 2PJRA 2Q3MA 4WBSA 5FTLA 1NVVR 3QOFA 2YINC 2F3RA 2OXRA 1ZM2A 2R6CA 1BKDR 3TH5A 2RGBA 4AC9A 5KNCA 2GK6A 5JLJA 1UM8A 2P67A 4TL7A 3B6EA 1KK3A 1U8YA 2C9OA 4JVLA 1RW4A 1TX4B 4KFUA 4PHFA 5BN5A 3CNOA 3K09C 2UZIR 4DCNA 5HE8A 3SHWA 2O8EA 3O8RA 1E1QA 1P2TA 4DIDA 1T3HA 2P5TB 3NBYC 3RRNA 1W4CA 2O8FB 2OO7A 1JNYA 1XZPA 3CLVA 4ZDKA 1T91A 1NVXQ 2ODEA 1OHHA 1KY2A 1QHXA 2CJWA 1CR4A 3UWKA 3K0FA 2V9PA 3C14C 4OBEA 3TBKA 4A0RA 4BFWA 3AV0B 2WWFA 1LV7A 2GJSA 4QXAA 5HZHA 2KI5A 1Q1QA 3M4YA 2WWYA 3L2OB 2XZLA 1Z0IA 3LLMA 4HAVA 4A8JB 1QF9A 3NC0C 4QBFA 4KJZA 4KFTA 5JZVA 4GT1A 3NTUA 5JJKA 1SZPA 4FIDA 5FBQB 4B32A 5FOWA 4LJ8A 3U3KA 3EZ7A 4EFLA 3E1SA 1G291 4II7A 3VQTA 4E09A 1OT3A 4Q4JA 2D4HA 3TSWA 1N0WA 4LC0A 3I1FA 5EUQB 1E0JA 3P4XA 3VAAA 2HYDA 4X8OA 1GRNA 1XJ0A 2BBWA 1W0KA 2CEAA 3SZRA 3TNFA 1Q0UA 3QBVA 3ZLJA 3OE7D 1E0KA 1ZCAA 4HLUC 4OI2A 5EP2A 5G53C 3U60B 2QM7A 3HU1A 3ZD7A 2GEDA 5L3SB 1EFCA 5EUMA 1GSIA 1SKYB 2GF0A 1Z0DA 4C0LA 2GZDA 1P2VA 3KUDA 3KZ1E 1XP8A 2GNOA 3L0PA 4NYMQ 4LYJA 2EYUA 2ZRIA 1GTVA 2H18A 2DFTA 2OE2A 5K8TA 4B34A 3QF4A 2YWEA 4C0KA 1KI6A 4DCTA 2PX0A 5C46F 1M2OB 5JBQA 1W5TA 2OZEA 2G1JA 1J8YF 4JLVA 2BVNA 1G4UR 3B82A 3BRWD 3FMFA 1FUUA 3SFVA 3A1VA 1KKLA 1ZIOA 3JVUA 4TMVA 3ASZA 5AUOB 3RWMB 5L3QB 4M9SA 2J87A 1NN5A 5EE9A 5FUYA 1S4QA 2BBSA 1LTQA 4CZ2A 3A4LA 1AK2A 3B5JA 5G41A 1N6NA 3Q5EA 3THXA 2IA5A 1IN4A 1TEXA 1GAJA 4EPWA 2ZI9A 4U02A 4UQOA 3QKSA 3X1YA 3QG1A 4LBVA 3R8CA 3UANA 4E5UA 3U7HB 1SXJA 4NDZA 1O3YA 1ZVQA 5LDDC 3U6BA 1FQJA 1XB2A 3K09A 4A92A 1KMHB 2QMHA 4GZMA 1W36D 3AGPA 1S1MA 2XNSA 5HE9A 2ZR9A 5J4LA 2NZ8A 3WBJA 1FNMA 3G0HA 3GCGA 4L8GA 4HDQB 4NYJQ 4M22A 4RVCA 4V03A 1D9XA 1G21E 1W47A 1VCIA 2WM9B 5CB8A 1U81A 4P32A 4BWYA 4DCSA 3WP0A 4XH9B 4LRWA 3WRXC 2NO7A 3NG1A 3K9LA 4YMTA 1TQ6A 5CK4A 2W6JA 2W0SA 2F6RA 3QNUA 3MWYW 3B8HA 2ZUDA 4KLZA 4LBYA 4WVFA 5KO2A 3B7GA 1W2HA 5DSZA 1Q44A 2C9CA 3B1WA 3HPRA 3RRYA 2HEIA 4OHXA 2NPFA 1ESMA 4ZI2A 4V0LA 2PJZA 2J0QA 1YU9A 1D8TA 1R0XA 3A8TA 3BB4A 1ZIPA 1LF0A 1QHNA 3C5CA 3PUYA 1II0A 2FOLA 5DI9A 1MRNA 1NSFA 2IYXA 3GJ6A 1L8QA 2R44A 1MO6A 1QRAA 1ZU4A 3LBNA 3PENA 4J0QA 4N0EA 1KO8A 1X1SA 4LBZA 4A4DA 2B92A 3AQ4A 3MG9A 3P20A 2O8EB 2O8FA 1XPUA 4Q7JB 3SI7A 1ZM3A 3DL0A 1W0KD 4X8MA 1P73A 1CRPA 2KWIA 5DI3A 5FTMA 1BO6A 2GXSA 4IDOA 4P4UA 2WV9A 4HZUB 4R98A 5CLQA 2FFBA 4B3BA 5SZIA 4CT5A 1E2FA 4KAXA 1U0LA 3NBXX 1E2GA 1II8B 3EASA 2RGAA 2WWWA 3M6AA 1QHGA 2DR3A 1Q57A 2J9RA 1DS6A 4AKIA 2CNWA 2TMKA 3BOSA 1R0WA 4MGZR 4UNQA 4HUTA 1ESNA 3CW2A 1QHHB 3KTAA 1KTVA 3FKQA 4FINA 1CR1A 3OIWA 1A7JA 4TYPA 4C0JA 4ZI3A 3FFAA 1E4VA 4GSYA 2IYZA 2ODNA 2ZAOA 3CB4A 4MGYR 4URZR 3RHFA 1U0JA 1LB1B 1ZNZA 2ZRDA 2HV8A 1QHYA 1M7BA 1HA3A 1CRQA 2JJ2A 3GEHA 3TIFA 3ZGXA 2H1LA 4C0HA 2PMDA 1XU4A 4AYWA 3HJNA 2JGNA 2GZHA 3VU9A 5KPJA 3L0IB 4CYMA 1LS6A 1R6BX 4TTPA 2D62A 1YRBA 4MRRA 2XGJA 1OFHA 4C7OA 2P5SA 3ZQJA 2LKDA 2ZSAA 4A0FA 2BIFA 1SXJD 1N0UA 1CJUC 3FDIA 4HAUA 1RRPA 2QP3A 1RC8A 2HF9A 3QF7A 4RCZA 1DAEA 1E2PA 3BH7A 4LWZA 4YMUA 4FMCF 4YC7A 4A36A 3W5IA 3W6NA 2QEQA 4HLDA 2FSFA 4PXAA 2IYUA 2R65A 4MA4A 2F9MA 3BORA 3T35A 3FMPB 2W58A 1ZAKA 1PVOA 5IRCD 4LJYA 3KL4A 4JLJA 4Q1CA 3LY5A 2CL6X 4DSUA 2FSGA 1ONBA 1Z0JA 1GDDA 3EZFA 2ZYWX 2J0UA 4HB0A 1FP7A 4US0R 2YC2C 3P32A 4KXFB 4D82A 2V6JA 1RKBA 2XB4A 2G9NA 4Q1AA 2QROA 3B60A 1US8B 3QG5A 3GLGB 2CHQA 4JVNA 4MRVA 3AP1A 5C1BA 2IUSA 2PEYA 4MDEA 2ZRBA 2F7SA 1YR6A 2WJYA 3FMOB 4KVGA 5HPYB 2BMDA 5LB4A 2Q0HA 1E4YA 4Q9IA 2C03A 2CLSA 2IF2A 3RNLA 2DWPA 2FFAA 3CPHA 3CX7A 2BJVA 3EC2A 4Q1DA 3B78A 3U3RA 4QHSA 4JLAA 5CJ2A 3ZH9B 4NMMA 1WA5A 1N6PA 2NO9A 3LQRA 3U3OA 3IIKA 2DHRA 1W4AA 4G0NA 4PAMA 4C9BA 4ZV4A 3VHXA 4X8LA 1NBME 2R9VA 2IYTA 4IW3B 3GEIA 1EFRD 2I1VB 3NBFA 4I1VA 1Q3TA 1G3QA 2PZEA 5E95A 2ZUCA 5FUWA 4DUGD 4EFNA 3MGCA 4ZDIA 2HT6A 3ZDQA 3MCAA 3DO6A 1GITA 1Z29A 3K0AA 2A7QA 4BRUA 1OHHD 1JEEA 4JBXA 2QORA 3THYA 3KX2A 2JA1A 1HEIA 4RD0A 4KFSA 1HY3A 1E9RA 1OV4A 3C5HA 3EPHA 1HURA 3WHKA 5J4YA 3QEOA 5CJPA 1JJ7A 1VG8A 3RAPR 2IX3A 2X19A 3C4JA 1S0UA 1G16A 3P1JA 4URVR 1E99A 1TQ4A 1G8HA 4JT4A 1KI1A 1R5BA 1E2QA 2VEDA 1ZNXA 3CRMA 4R7ZA 4M9XA 1KY3A 2VO1A 5B30A 3SFZA 3REFA 1GILA 1W1WA 4ABYA 5JSZA 3F5FA 1P2SA 2NO1A 1UBGA 1G20E 4UNPA 1D2NA 2GVDC 4XVRA 3EIQA 5EP4A 2HLDD 4C3ZA 4B74A 5L3VA 5DISB 4AYXA 2BKEA 1CJTC 2Q21A 2BOVA 4Z8XA 1KK1A 3IO3A 5F2EA 1W48A 1Z2CA 3KQKA 2VH5R 1QG2A 5HTKA 4IHQA 3EIEA 4D26A 1O87A 3H2YA 5F3WB 4HI0E 2GXAA 3QE0A 3FHOA 1U0HC 1E94E 2GJAA 2RGDA 3WRYC 1II8A 3I62A 2PCLA 3OE7A
chains in the Genus database with same CATH superfamily
2A0XA 4UNRA 2V4UA 1KDTA 4D43A 3I09A 3Q3EA 4NHOA 3RUAA 4FILA 1OX5A 4BNJA 5I01A 2WV7A 1JEDA 4LF8B 5F98A 2RK3A 4G85A 3T3IA 1N2OA 1CQIB 1PD0A 3EOZA 5H70A 1O0CA 4EPVA 2P9CA 5TQ0B 2J45A 2AXPA 4RACA 2HLHA 2DVMA 3L4BA 1VLLA 1V1MB 2J0EA 3FROA 4A8JA 4WN3A 3O8QA 5EQJB 1NJ8A 3TQTA 4QUGA 3ENZA 5BN4B 2HEGA 3F6PA 4LPSA 1HM5A 4LF9B 4UBIA 3K9FC 4RZXA 3QX3A 5L3RA 2Q5FA 3OJWA 3Q9LA 3WGYA 2EFHB 2NMVA 2G4VA 4MQEA 4BJ5A 1P1IA 1JQJC 4EA6A 4BX9A 3ZWKA 2O54A 5ILGA 2Z1DA 2C0QA 1QUEA 2FWMX 1EXDA 4JUBA 1NLFA 4NOLA 3TE7A 3K0CC 4JI5B 1UPBA 4PIMA 2J33A 1OBCA 3RJMA 3ECAA 4TMKA 3PE6A 5CA0B 1D9ZA 3C0KA 3QMPA 1RQGA 2IU4A 1XEFA 4OHPA 1UPXA 3LCRA 4HDCA 4DUGA 3ZD9A 1FMJA 2QRQA 3A4MA 2H2HA 1SHZA 3O8CA 3ROQA 3EULA 1AN0A 3VMFA 2G0NA 1QH1A 4MLCA 3LIIA 4CM8B 2CLCX 4UTOA 3HWRA 1JTFA 4UE6A 4H6WA 4Z1MD 3ZDYB 5KYYB 2RK6A 3E0XA 4R7TA 4XYMA 3AUXA 3RJ5A 2V7WA 4KNYA 4JC5A 2XDWA 1Y89A 4MWGA 1JFSA 2AA3A 5JXIA 1EMDA 1ZK0A 1IN5A 1KFJB 3N2KB 1HOXA 4IHJA 4ZGGA 3PX7A 1BS9A 1Q0ZA 2LCIA 4UCFA 2W2OA 1QMGA 4AURA 1G8MA 1ISMA 1CIPA 2BDEA 2VDQB 1H2HA 1MX5A 4AG6A 9LDTA 4IZHA 4J3JA 1J0XO 4L16A 1LDBA 1E79D 2VF4X 4UZEA 1XQ9A 2J46A 1Q19A 3IAS1 4QBTA 1RXEA 1SUSA 1ZOSA 3FR7A 3IBFA 4CBVA 4Z2AA 2WVJA 1SIWA 2GHRA 3NR2A 3QJGA 4LDJA 2F3TA 3VH4A 1TNDA 3LNCA 3RYFA 4DQLA 4LOKA 1UAGA 3CE9A 4GPEA 2FG7C 2GTIA 3FZYA 5EMJA 4DBZA 4UQLA 3LUFA 3QLJA 1IJEA 4H7DA 3FCSB 3F2VA 5JADA 4AYTA 5DV9A 1DX6A 3KSDO 4I55B 4B46A 3ZV7A 4AAYA 1LVGA 2PPVA 4AY5A 3RS7A 4PIPA 4OL9A 4OI4A 1QZ3A 4P2BA 4PG6A 1DX9A 1JVNA 1U98A 4HV4A 2FWAA 5ADHA 2GAFA 4EHHA 1TE2A 4TSFD 1Z68A 4Y1GA 3RTCA 5BW4A 5I7EA 1WLSA 1EVYA 1FMTA 4TV9A 4N5DA 4CKXA 4YR7A 1E2KA 5B7PA 1PD1A 1S8OA 3CURA 1T9ZA 3FLEA 3ITKA 4UJ3A 5C4GB 4TUYF 4LYEA 1GVHA 3C6KA 4B7ZA 1JV2B 2R00A 4TMFA 2YWRA 1WCYA 1VL8A 1P7ZA 4M0UA 1O5OA 1XMPA 2VQ3A 5EIFA 5JAQA 5REQB 4AROA 1IXSB 2EX0A 2FNAA 3IBCA 4M37A 1A4IA 2BFDB 2D8AA 3R9XB 3HLTA 3WTBA 4FGZA 1E7MA 4ZT7A 5IX8A 1E8NA 1DEAA 1ORWA 2EFJA 2NU9B 2VPTA 2PT5A 3IPRA 1C0IA 1HZZA 3LF1A 2C00A 4EMSA 4MCHA 1MOSA 2QTRA 4V0KA 5EIWA 1SC3A 3TJMA 5JSKA 2PE5A 4Q00A 1LZLA 1J49A 2JGEA 1O03A 3FPHA 2HK7A 3CZ5A 3QEMB 3AUSA 5LQDA 2DFNA 1U1GA 1HGXA 2VQ6A 4RKEA 3C8HA 1MJFA 4XB6B 1QGUB 1NX6A 4REQA 4NQZA 3U7IA 3G88A 3VR1A 3KXIA 3QY0A 4B2LA 1QNFA 2NGRA 1FJ2A 4TKVA 1PX2A 4ETNA 3I9OA 1J9EA 1NJ6A 4DANA 1SB8A 5HOQA 1WD5A 2GK3A 3ONFA 4DR4B 4ZEWA 2ROQA 4X97A 3CTPA 3MWKA 2P5UA 1JZQA 3CKMA 5GV8A 1SH7A 1GXSA 1JHPA 4YALA 4EQZA 3UMJA 4RVGA 2W6QA 3U13A 3ZHCA 1OB5A 3E82A 4LYDA 2R00C 2PK3A 1E8MA 1KZ7B 5ALRA 3U17A 3NHFA 5BSEA 1Z12A 4EQ6B 5HQTA 4DM7A 1N1DA 4DJFC 1MX9A 2I8CA 4JP8A 1TM2A 2D7JA 3KB1A 4C0SA 5JZOA 2R68A 3IB6A 4CF6A 3PT9A 3DC7A 4ZJUA 3MHTA 5BO5A 3QXCA 3VKHA 4RMHA 1HQYE 1WAMA 1G3UA 3AUKA 3ORRA 3FVRA 1TA0A 1XRSB 4MV7A 4YCNA 4OXQA 1R8QA 5ALIA 1E6EA 3AJRA 3P9NA 5DCUA 1I4LD 3BCUA 4MQ6A 4QULA 5AKXA 1KY5A 5HKKD 4RTRA 3PQ5A 3KKOA 3PVZA 4M0KA 4XX0B 1XCPA 3G8DA 2W98A 1TMKA 2W6ID 5EPEA 4ZYXA 3RBVA 2QX6A 2P5YA 5UKDA 2I87A 4KVZA 1WXEA 1G0OA 2YJNA 3AP2A 2IHUA 2B37A 2GNAA 2WW8A 2P75A 2PS9A 3GBVA 4MQ4A 4L9AA 2FDCA 5E4YA 1EVEA 3NIDB 1DV1A 1GPWB 1B16A 5T3UA 1XTPA 4D80A 1CTQA 4U3JB 3B1FA 3KQWA 2ZT8A 4EO4A 3QTTA 1MIHA 3WLLA 3DE7X 4EY7A 4AL4A 4F2DA 3JAWA 4NE2A 2HJHA 3HL0A 4NECA 4UHKA 2C61A 1KHTA 3EG5A 3NRJA 1Y9EA 1RAEA 5BQ5A 3RS8A 3C2QA 2RHJA 1VKOA 2Y3IA 5E6UA 4QYMA 3RLIA 2Y99A 4LK2A 2LTAA 2GCGA 5DNCA 4HDMB 5K20A 3EZNA 1TTHA 1YDEA 1ZD3A 3K70B 4K9QA 1W36B 4UUPA 2ZR7A 1U3FA 1MV5A 1J5PA 2W6OA 4H2DA 2QX9A 5EJ8A 1TL7C 2OUIA 2X23A 3RU2A 1H3FA 1EEXB 1YULA 4ETIA 1JSZA 5DXAA 1NPTO 1M83A 1AQIA 1YJCA 2ZRCA 1G5TA 2HPZA 5HFJA 2CW5A 4FGSA 2WHXA 1G19A 2RHHA 3CJQA 4GUDA 5FFFA 4Z3OA 1GZ6A 3F6CA 3MRXA 3IS3A 4U6NA 3OEED 3WNBA 4F6RA 5C4IA 4CKZA 4NAUA 5SICE 1QNLA 1XTKA 2GAJA 1XEXA 1YS9A 2V3WA 1O5IA 1ZJZA 2O50A 5AWFC 1W30A 2I4MA 4UOZA 5LIRA 1RYNA 1J2UA 1KH1A 3A6ZA 1CQZA 4LOLA 2O19A 2EFEB 1YVEI 4M9QA 4Z4FA 2C9MA 3L7AA 3OSUA 3W5CA 5AYVA 4LYHA 4P34A 3OT5A 4PZAA 4TYQA 5TX7A 3AOEC 3N0WA 5J2TB 5T57A 4QU8A 1P3Y1 1TW2A 5JANA 1KSJA 1E89A 5AW7A 2IYNA 1XPOA 3LCUA 2UYQA 3LD9A 1MMFB 1K6JA 1DC4A 1XK6A 2AEMA 1YJ5A 2X6QA 3A31A 3OOJA 2FZLA 3PCRB 1VP3A 1EA5A 3QE4A 4HEJA 3UT5B 2OT3B 5E0OA 2IGTA 3L7OA 3T0FA 3GFOA 2XDQA 2C4WA 4JJ6A 1L9KA 4BN4A 1SUEA 1H0HA 2YIDA 3CLSC 2ALJA 3PUKA 2CDCA 1AKEA 2JEOA 1R8XA 2NUBA 3T12A 2R5FA 4O8CA 1QG0A 2EOAA 2R6FA 5TMPA 4QU5A 2Z2XA 2W2VA 1BWPA 3QJYA 4FGWA 3WIBA 5ALLA 4YBRA 3EGIA 3KHTA 3FYTA 4M87A 4NP6A 4M0LA 2CV1A 1L7OA 4NLLA 1WXDA 2YN2A 1B3RA 4GX5A 1Y5LA 1LVUA 4LEIA 5E9QA 1UXOA 2PA3A 4X94A 1ZUIA 2QLTA 2HFJA 3KUKA 4FGLA 4YRTA 5DASA 4I4NA 2W42A 1WPXA 3RS2A 3CEJA 3NM5A 2IEBA 3AB8A 2DRIA 4KGXA 1LTKA 3IDSA 4L4ZA 3QFTA 3PIDA 4FXPA 4YEDA 1EU1A 3JQ6A 5DN9A 4JBYA 4DOMA 1RBZA 1X70A 3X1KA 3UOWA 4ZAVA 1POWA 2WWIA 2XJ4A 4OQLA 1OR8A 4XR4A 5FTNA 1L5LA 3ZWCA 1M6YA 5AQ1A 5KTOA 4CQJA 3ZGYA 3ADKA 5BYBA 5FWXA 5JJ5A 1MABA 3WGQA 5TF4A 3FPJA 3UMYA 2XCSB 4AS3A 3E3NA 2EKDA 3JZFA 1YZNA 1DCMA 1RHQA 3ICPA 4QEKA 1USWA 1V16B 3BL8A 3EAQA 3AHHA 3IKJA 3KXPA 2DQKA 4AUMA 3E0QA 5CURA 4B81A 4RVOA 3EXFA 4MUEA 4LDRA 1JR3E 1KU0A 2Y71A 3P94A 4IRXA 3KBBA 3BKWA 4JLOA 4ERXA 2JLYA 5BYAA 4AZWA 2CV0A 4OXRA 1EDZA 4ZMBA 2ZKIA 3WMFA 1RMTA 3B12A 4HH3C 3WYGA 2HQSA 4GD3Q 3UCEA 1QV7A 221PA 4XFJA 3F71A 3RAEC 4KN9S 1UKBA 3NT5A 4I7EA 1A98A 1LI5A 3QVSA 4PFSA 3IEIA 1XJCA 3BJEA 1NQUA 2C5GA 3OZWA 3Q10A 1N6HA 2WJWA 3CEPB 4IOMA 4NV0A 1WCIA 3ZJVA 3EGXB 1QYWA 2JD0A 3HJCA 1NQTA 3WK8A 1IEWA 4I55F 2IK8A 4D5EA 3QVLA 1IHOA 4D6YA 1DQPA 4OHFA 4KIFA 1JA9A 1NAIA 3RI3A 1JPJA 4IRMA 1MJ5A 3VR6A 3WRYA 2IS1A 3C97A 4CN9A 3FJYA 4F4CA 4UM9B 4KIUA 3WK5A 4F4UA 1JFVA 4HDAA 4LHZA 2B6NA 1K8RA 2N1MA 1SELA 3D3JA 1PS8A 4BO2A 2YNMA 5D6NA 1A72A 4KJXA 1UKZA 3WB0A 4JJ7A 4L8LA 2JJQA 3DEFA 1I10A 2HIGA 4I50A 4BMYA 3SQWA 1HT1E 3SC6A 2WM8A 2PXXA 4N8EA 4IWXA 3PDWA 2NSHA 4PWYA 3UHOA 4H15A 1KJYA 5CCXA 4RY0A 3BTVA 1WDTA 1ACJA 2XZPA 4KDCA 1EP9A 1GG9A 4KSCA 3B9RA 4P3KA 1N4AA 4E08A 1AM4D 2R79A 4WN9B 3QU5A 3MCZA 2LIPA 4RCVA 1H1LB 4R16A 3VTFA 2HWUA 3QKSB 4XI9A 3QWIA 4U9UA 1Z36A 1U80A 2FMKA 3BRWA 4NULA 1J2JA 1SVNA 1OC4A 1OGJA 2UV8A 3C6MA 3E9RA 3Q3HA 3EXEA 4OIFA 3J80A 1O7JA 4PSUA 1BN7A 1RZUA 2MYTA 2QE7A 1KMHA 3C87A 3QUSA 5MF6A 4M49A 2PCJA 2NZUG 2OCPA 3RHTA 3HV0A 1NLMA 2VKTA 4NZYA 4NPAA 3QHAA 3N53A 4D4KA 3HCWA 4MRNA 4NCKA 2NXNA 3F3YA 5H59A 3GK3A 4O02B 3KCQA 1W6UA 4BZQA 1MTZA 2NQ2C 2QQGA 3KVRA 2J7KA 4FN4A 1TB4A 3NUQA 1IBKB 3G8AA 4RL4A 1IEXA 3F49S 4OFWA 1K4MA 2A0FA 2YV5A 3S68A 1QIIA 3H05A 3OKCA 1BMQA 1EUZA 1RE1A 1Y81A 3MSXA 5F12A 4ZAWA 4PO1A 3UAGA 3RBZA 4AKTA 1A7AA 2ATEA 2NO6A 4WACA 5F5NA 3PTAA 3S81A 1FVOA 3GG2A 1OIVA 2GHIA 1K6MA 4A5SA 4JLUA 4IIEA 2QBYA 3F6YA 3V4SA 2YHUA 3R0IA 4YWJA 3R5KA 5CFOA 1RWXA 2P2NA 2YJTD 4L7QA 2PSEA 5G0VA 3OTWA 1YQUA 4B4WA 4F2HA 2YWGA 4WJKB 4UU1A 2JBWA 5DP2A 2Q8NA 1LPNA 3H9CA 4XPZA 3SLGA 3SOPA 3KQLA 3QZUA 1Y1LA 4MLPA 1XO1A 2VC2B 5G40A 1KP3A 2GN4A 5JD5A 1TEHA 2XUZA 1XFDA 3ZWBA 2PT9A 1OC2A 1XLVA 2EJVA 5JEDA 4NZPA 3FTQA 3IV9A 2YDYA 1A9XB 1WUHS 3TLCA 3KKEA 1N2EA 3G0BA 4B79A 1C0PA 3DWIA 5JS7A 3FHJA 5IM4F 1IN1A 3S5UA 3LVQE 2ZE6A 3MBOA 4AJLA 1SVUA 4BJ3A 1ADBA 1N2XA 1KI7A 2C2BA 4KWCA 1GPDG 3GO4A 3GCXA 1Y42X 1F1BA 3M0EA 4YCDA 5KC9A 2QRHA 3WL4A 1JDVA 4HAWA 1KYZA 1SCQA 4K81B 5CVCA 3IERA 4DLKA 1R0ZA 4DKJA 1IDN1 3MWEB 4WZBE 3L7KA 5J4VA 2MYNA 5JJBA 4CM9D 1MB9A 1PZMA 5HKLA 4F97A 5BRJA 3GEPA 5JAOA 1WEHA 2ISSD 1YQ9A 4RL6A 4E5NA 5LYJA 3R74A 1FYVA 1YL7A 3PE4A 1Q50A 2O3JA 3LVRE 4HRVA 1GRRA 4DEXA 4EVSA 1GGJA 1T3SA 1RYHA 2PGJA 3WA6A 1EWVA 3CEAA 1CJCA 1UDRA 3FETA 1RCFA 1NNSA 3IPAA 4KSYA 2ONZA 4RJLA 2V6IA 4KQKA 4BE9A 5GVSA 1DE0A 2B4RO 2PZLA 4BO1A 4LZPA 4NBWA 1CY6A 3MJTA 2EWMA 3K96A 3RU7A 3CS3A 2QAGA 3EXIB 1Y5MA 2ZYVX 4X91A 1FFHA 4RM2A 2NYUA 4YJGA 3WHPA 4GPAA 3QQ5A 3ZEIA 1N3IA 3DYBA 4CMGA 5B4UA 4I1RA 4P3XA 3SHFA 3DUWA 1A95A 5AJXA 8ATCA 3VTKA 5JXGA 2VDPB 5FF9A 5CDYA 4N1AA 1GG2A 5KSPA 4JI0B 5KOHA 4EEKA 3WY9A 2NTYC 2ZFUA 1Z16A 3JRWA 3NHWA 2H5EA 3N87A 3JALB 2C29D 2R1TA 3UMGA 3IQHX 2NO4A 4FKMA 2GNPA 3W7AA 3KUCA 3O8BA 3NH9A 4LF6B 5AI6A 3T9BA 2WIFA 3X3HA 2CNLA 4Q0MA 1S6YA 2PX4A 2QTCA 5EJ4A 4QKQA 1U28C 2W4QA 2WUFA 5IBPA 3STXA 4BMZA 1KO1A 1Z2AA 2FRVA 3G7SA 4HAZA 1CB7A 3ONEA 5JSHA 3L8FA 1KJNA 1NMXA 4H1VA 4PNEA 3PEWA 1NYQA 4TZ0A 4FE4A 4GWLA 5C7OO 3L8YA 5CVJA 4ZU6X 4B2IA 1XZKA 4N7RA 2IZ1A 3W05A 4C4XA 5C1OA 4D0NA 3L6EA 4DDVA 1UKCA 5KKCA 3GYGA 4W5TA 1MBZA 3AUFA 2QUAA 1EXNA 3OLZA 4DDUA 3U3MA 2QZ4A 4R7GA 1ZH4A 5DOZA 3WO1A 2Y6UA 1IATA 4HF7A 5GONB 4YJHB 4OMDA 1T3LA 1U0EA 3RFFA 3GGPA 4C6SA 4RF4A 2RHBA 1XMJA 2PXAA 4XYGA 4C14A 1QFYA 3L1JA 4LJ6A 5FQNA 2X2FA 2XXAA 2GKSA 1JQKA 1UK7A 4Q19A 5A0FA 1BXRB 3DE5X 5LZ5A 2OVFA 5K51A 3W5BA 1NJFA 3QUQA 5DN6D 5JT1A 3BD9A 3EPRA 4P92A 5MN5A 1V8PA 4H4CA 4N8SA 1QUFA 2QQEA 3PSAA 3KU1A 1YJ8A 4YV1A 5BMVF 5IVKA 4EI7A 3WE7A 3QM1A 4FFSA 3GFRA 4W1QA 4TLCA 1D5CA 2Y9PB 2YJZA 3G0GA 5FBRB 2F90A 1Z13A 2RGNA 4KI0A 1C3XA 3ROKA 3VHXB 2YQ4A 4FE7A 1KRWA 1L5RA 1QS0B 1Y6FA 1LGYA 3JD3A 2IUFA 3ZHRA 3KUUA 1KBZA 1IY0A 3QVTA 4GWKA 5HCIA 5THXA 3RE1A 4NNJA 1Q16A 2M6SA 3WOVA 2WDZA 3P9KA 1HF3A 5EWJA 1B2LA 3JD1A 2A5JA 3MTDA 3HYSA 3KHKA 3IQEA 1DOAA 3JQAA 3IP9A 4NEHB 4OP1A 2IOYA 1X19A 2IW3A 5DSXA 5K2MA 4CG0A 4WDRA 1A9QA 1M6NA 4YLGA 4ZANA 5AIBA 3ZY5A 3THYB 1EGQA 2OQRA 3JQCA 2BV3A 4Q9DA 4XZ3A 1MDFA 2IH5A 2PA0A 1GCIA 1KFEB 1Z6GA 3AF1A 5KJCA 1Y8CA 2WTBA 4P22A 3MTAA 2F59A 5DE3A 3L3BA 2ZULA 1NXVA 3COVA 2VJYA 1I9GA 2QJTA 2GRAA 4DZTA 1O94C 2HZBA 2GN0A 5C34B 4DCGA 2ETVA 3E81A 3TL6A 4NWIA 1KAMA 3VDRA 2Q49A 2VATA 4I4LA 3NKLA 1VMKA 2CJPA 4RGVA 1L6RA 1D4OA 5CYGA 5BW5A 2ZXFA 2O8CB 4O33A 5HFNA 5LA6F 3AHFA 5K4GA 4MVJG 4X63A 4Q7LA 2VQEB 1YUBA 1LY1A 3FPCA 1Z6AA 3WIDA 2QYSA 1HFWA 1XZMA 2PO7A 2DJ5A 1ZO8A 3CXRA 1G6HA 3B1ZA 4RHCA 2Q7OE 1BMFD 2JAPA 2IWRA 1Q7TA 1Z45A 2I54A 1AGRA 1YB5A 1YQDA 4LTMA 5EIHA 4TYWA 4NZNA 3MXTA 3NIBA 4RV5A 3AR7A 2ZJ3A 3RUHA 3F67A 4MUGA 5JBNA 4QM7A 2ZATA 3D3NA 3RKRA 2AK2A 1SAYA 4EEXA 3QBTA 1QCZA 4RVSA 2VXBA 3SP1A 4DCVA 3JWJA 4D3YA 1NBMD 1WX1A 4CFYA 4PAOA 1WO8A 2HI0A 1KI4A 1LK0A 1B73A 1LLUA 1YI0A 2XW6A 4ETMA 1L5OA 4DMKA 1JJBA 2P8SA 4JU9A 2Q9BA 2RBEA 1V6CA 4F46A 4POAA 4HWPA 1YACA 1AGYA 1AS2A 3FCUB 4DC9A 4XUGB 2COUA 3WNDA 1P44A 4ND2A 2FMUA 1USIA 3JYHA 1FX0B 4OM7A 2X2PA 1Y9DA 3AG6A 5TVKA 3R7WB 5A62A 4KNVA 1RCTE 1L5MA 1PO7A 3AF4A 2DBZA 4Y6QA 3GPDG 2B4YA 3GJTA 4BBZA 3HEBA 1KI3A 3B3QA 2WPNA 2ZT6A 2JGLA 3T9AA 3WYCA 3Q3JB 3KKNA 1L8XA 2A5YB 3NATA 3ICOA 4ZU3A 2BH2A 1M6HA 2CYAA 4N12A 1TQDA 4Q12A 3M89A 4GSKA 4ENPA 2G7MC 1C1DA 1R8JA 2J48A 2GHTA 4HB2A 3F46A 3VR4A 5BR8B 2ZYSA 1P80A 2OA0A 1C7EA 3VSCA 2AZDA 2CHFA 4P7GA 2JD2A 2CMKA 2FTKE 1IXYA 5EA2A 3FTPA 4I0WB 4TWZA 3ZXXA 1W88B 4FOLA 5ELLA 1Q0PA 3ACCA 4Y6SA 4JA2A 2MDTA 1ENOA 2XWPA 4MQEB 2DPHA 1XL0A 4IOJA 1V1RB 3EQ2A 2QSZA 4DG9A 1ECPA 1TEVA 3ESCA 1NP6A 2YBEA 1QP0A 1QKKA 3HUDA 3H9EO 2JKZA 4LMAA 2CNKA 3NJ4A 3TW8B 2KBEA 3ADOA 4PZEA 5CB4A 4XDYA 4CMJA 2A35A 2QMYA 2QMQA 5TQ2B 3TD9A 3SDZA 1QZUA 4RKQA 1EXVA 2XHZA 2K2WA 1NN0A 4V1CB 5BVGB 1UBRS 1COWD 1GDHA 4N0QA 1JECA 3QFRA 1FEZA 3GFBA 1Z26A 3HFRA 3IODA 1QV6A 1JPUA 3O2JA 2VZ8A 4EFDA 5ALVA 5EI5A 1MH1A 4PHTA 4DLNA 3U39A 2NQTA 5EN4A 4JT9A 1JSRA 3F7OA 4NZ9A 3E7PA 2AQ8A 2OYRA 3ENVA 4OJMX 3TINA 3BDVA 4E2XA 3PXDA 4ER5A 5PGMA 3SE7A 1JJIA 2ZYUX 3ZXYA 1AE1A 2IZ7A 3PJEA 3PWSA 3NAMA 1Y3CE 3C41J 1CJMA 3LK6A 2Z30A 3ANNA 5A6SB 1N9KA 2CHEA 1FFGA 1BS2A 1KDVA 1OYOA 4BNKA 1UKYA 2VUUA 5E3HA 3ZV6A 2JFGA 2XUJA 2UXBB 5TT1A 1Y8RB 1M2VA 2QTVA 1CUVA 3PRHA 4I9UA 3ADBA 5F3DA 1Y37A 5KYKA 2EW8A 3DDCA 1TK2A 2I4RA 3FF4A 3GGOA 3GU3A 1HDRA 1TECE 3G9UA 5B4TA 1TU4A 4LWQA 2ATVA 2CCGA 2ONJA 1RDFA 3WBFA 3F6SA 1Q5PA 2MIIA 3HJFA 3JXEA 2A0UA 5JY1A 1EH5A 3NBUA 3GJ4A 3A1DA 1E1LA 2O1XA 2OGWA 1FRVA 3JATB 3LY8A 3FCEA 3AEUA 2CD7A 5KNDA 3FSGA 1RI1A 1WUTA 1GY8A 5ALQA 5IZCC 5BYKA 1Q21A 5CT8A 5KAMA 4KN8A 3PKIA 5FRDA 3VJLA 4C4ZA 3S2IA 3K0BA 1Z62A 3RGWS 1EZ1A 1U0SY 3BILA 4TLMB 2V8BA 2QUIA 3DCYA 3A3NA 2PANA 4OOEA 4WCFC 3T5GA 4TUYB 3EEOA 3I76A 1U0BB 4NMHA 1TIKA 2IXAA 3M81A 2EL9A 2KSQA 1BGXT 3H1AA 1H6CA 4EM6A 1PWXA 2A3RA 1XHEA 1XA3A 4IQFA 2E1PA 4AS2A 2GCOA 2R86A 2Q3FA 2Q3JA 5LKRA 3KM0A 2VP5A 1PWZA 3FWNA 3LO5A 3LOPA 3OJXA 2JGKA 1U8ZA 4UD2A 4F4IA 1OSNA 3JZDA 1XHFA 1ND5A 1H9AA 2FK7A 2QLFA 2IYFA 2X77A 3DKIA 3BTSA 3MHPA 4NSNA 4LXYA 3EZ2A 4C21A 5IYZB 1XZDA 3JQ9A 2I8LA 1V37A 5EE1A 3W8FA 1T0HB 3INTA 1N0VC 3BGOS 3QXXA 3CGWA 4ARAA 2VPYA 3GFSA 3ISJA 4D4HA 1J07A 3OQJA 4IXMA 5H80A 2ZCJA 3EY4A 4LKRA 2IHJA 2MSEB 3K9HA 3IXLA 4UBLA 4XWWA 3HKBB 1PEAA 2H1IA 2O1WA 1AXGA 3KQOA 3O92A 4X61A 3L93A 3PBKA 3IVAA 2JJ1D 5GJVC 3TUJC 1B8VA 4CL2A 4YGXB 4OLJA 5KYVA 3ZU5A 5EJ5A 3NC4A 3PUXA 2XXJA 3B3FA 1E2LA 1EVLA 4I14A 3DZKA 1ZNQO 3IKVA 3IQXA 3GARA 4MUJA 4CUZA 3R20A 4DSTA 4QXRA 2PZJA 5HIAA 2DCUA 3ZI7A 1HG0A 1XPRA 4TT3A 2BDTA 3E5NA 1PJQA 1OX4A 1QHSA 4INOA 4RDHA 3WISA 2BFCB 4FLEA 4RPJA 5HK9A 4IV5A 2BFEB 1FX1A 1WCIB 3PJGA 4ZPJA 5CB6A 4M0EA 4EQ6A 3HZZA 2Y1FA 4ROTA 3RAGA 4BU0A 3NYRA 4P0TA 1T36B 5KUTA 4EYGA 3IR5A 3A14A 4PPQA 1R2QA 3ZJTA 1Q7GA 1ZUNA 4F3TA 3I9LA 1Y3FE 2I91A 2AKEA 4K2AA 3L4KA 1GT6A 2VBGA 3IP1A 4J2TA 3WB2A 3Q15C 3BK1A 4IWNA 3RHZA 1MP0A 4AJNA 4AM8A 5CBKA 4PHCA 4BXOA 2YBDA 3WNZA 1VL1A 3FUXA 3NT4A 3QFHA 4LRSB 2IUUA 5ITSA 4BATA 4YO8A 3DWEX 2JA2A 4BMCA 4RHTA 4K6KA 1AURA 5THQA 2AGVA 3OUZA 2KHZA 4CW7A 3VGJA 1OLXB 4Y2UA 2ZR8A 1NURA 1G9SA 4ON9A 1UBHS 4BLRA 1MIOB 1BE0A 2O07A 4RMJA 4FT4A 3WL3A 3MM4A 4HGRA 3AVOA 3NTXA 3AU8A 4QTYA 1DBIA 1P19A 5CA0F 2FEWB 2VOEA 1R6AA 3F3KA 4EG7A 5DHRA 1VC2A 2VOJA 3NORA 1CD5A 1P72A 1RJ9A 1ZWLA 5DMHA 3URMA 5CB0A 1E2EA 5ABPA 5DN6A 4B87A 2OOKA 4ZMSA 1SULA 1Z37A 3O8DA 4EA7A 1EPUA 1NVWQ 2D5AA 3GJ3A 4QC2A 1PLJA 2NXJA 3ZHBA 1JAHA 3DBOB 2QJRA 4R8KA 4EJ0A 3WGUA 2FVYA 1JBQA 1QKJA 1MPXA 2CC2A 3R44A 4C2TA 1R4MB 1HDZA 3K53A 3BSSA 1XZNA 1PV1A 1YMUA 3KVNA 3Q1LA 1TYDE 3GLKA 4J75A 4HZGA 4UXIA 1L3BA 5CXUA 3IVCA 1YIDA 1GG8A 4LZWA 3E5HA 5EMKA 2IBTA 1X7YB 1ORRA 1XAGA 2PWYA 4EPXA 1FSZA 2PR7A 1P31A 1WVMA 2CDRA 3R3ZA 4Z0HO 4ER6A 1E6MA 1B14A 5FORA 1NVTA 1KNXA 3K9WA 4J43A 4YQEA 3OQBA 5J5AA 5TPZA 2N9UA 4R1QA 3ZE8A 2OD9A 4PZ0A 2XBLA 1H4TA 3UUFA 3RIMA 3U4MA 1LPAB 2QJOA 3A70A 4YHHB 3AVUA 3WAJA 3R0ZA 2B4AA 1SRQA 1ADYA 3MWLA 4J49A 3I8OA 3E22A 3WLQA 5GZ3A 1RFLA 3KEMA 3Q12A 2IYSA 4GQBA 1NF9A 1QVAA 2V55B 4GNKA 1QQAA 2NG1A 3B3GA 3ANSA 3HJTA 1C9KA 4J0HA 5IUKC 3VYUB 5JCZA 2ZJ2A 2Q9CA 2XKKA 4BMPB 2AOUB 4ZIRB 3D1VA 1WETA 1UCFA 2I62A 2IYEA 3KFVA 5JCPA 2J3DA 2E87A 1F8FA 5LP1A 3I9KA 2DB3A 2VHCA 1QYCA 5ES3A 2YFYA 1AXEA 2TS1A 4QBHA 4EBBA 3GEDA 4XLTA 4UNSA 4IUYA 4MQFB 2ZRHA 4TLAA 1TO2E 2AI1A 1ZK4A 1ZYUA 4HAIA 4OHCA 4D46A 4DT1A 2HU7A 2HF7A 4WFIA 4YXFA 3I2JA 1QONA 4D4MA 3ZWAA 5T67A 1WP4A 1YXMA 2W7TA 3CVWA 4AWBA 1HT3A 3MB5A 4QWMA 1E2BA 1I5OA 5EXXA 2YHIA 3CX6A 3T61A 1S7CA 1O97D 2CLEB 4MA5A 4CFZA 4ANFA 3Q87B 2LIVA 3H8VA 1BYUA 1M54A 2XSZA 3CLTD 3ONDA 4ACBA 4IDNA 1UDXA 2E6KA 2E0IA 2GYVA 4F60A 9ABPA 4UD6A 1CY8A 2TMGA 4KN6A 1ULSA 4HO1X 4BIIA 1BEEA 1DFGA 3TQOA 4MB6A 4ZXFA 1F9EA 4IJKA 1F2DA 1X9HA 2G5PA 2QD4A 2H9AA 2YUIA 1O6FA 1USVA 3AEZA 5CP8A 5E2BA 5EXSA 3I73A 5CYFA 1ZI8A 5B1HA 4DIMA 3MLBA 4HSEA 2WI8A 4JYAB 5TV2A 3KP1A 3D4PA 1IY9A 3KZMA 3TR6A 1A8QA 2XGMA 3CFYA 5HWSA 5KYWA 4JZKA 2L82A 4NAVA 4BQEA 3RDPA 1XPJA 4PLTA 1OI3A 2V7QA 4MW0A 4P8RA 1KS9A 5FOXA 4PV7A 3QE9Y 4KREA 4GBGA 4L51A 2IF0A 4KDRA 3ZW7A 4RTOA 2QSUA 3FSJX 4V39A 4GX2A 3H5TA 5LDGA 3TLJA 3AY7A 3B53X 3S44A 1WXQA 4BGEA 3A26A 3W2HA 3ZK9A 1N25A 4KPYA 4PVDA 4RFSA 4RK4A 4EUKA 2XNDA 4IFEA 8OHMA 2E7ZA 4YWHA 3DZJA 5DJ5A 4LISA 5KOHB 1I4DD 4C0XA 2NTEA 1I2DA 3ORYA 5K0LA 3X1ZA 1O9HA 2I6SA 3ZQ6A 5DOVA 5KNCH 2PFSA 4LZNA 5DXFA 3RGGA 3CINA 3ZX4A 4ZMRA 2DUUA 2RGYA 5IZ4A 2QRVB 4YAWA 1HRKA 1PKEA 1Z8DA 3JAMA 5E7IA 1WV0A 2FPGB 4EH1A 3PUJA 3NNNA 4UNPA 1V9SA 4LDNA 2B9VA 5FPSA 5GIOE 1SXJC 2WOJA 5EZYB 2Z1NA 3W77A 1AKRA 3IKLA 2DC1A 5FCDA 4PC3A 4AG3A 1S96A 3GY0A 3KV3O 4K2HA 1EFRA 3B85A 4ZO4A 3L43A 1JRLA 1T5HX 4YRJA 3U4QB 2AFHE 3KLMX 3O2SB 3P9ZA 4H3VA 2AFIB 4C1NA 4ZC1A 3WGHA 4Q7EA 2UZ3A 1QV9A 2PMBA 4FYVA 3PA6A 3ZU3A 2C9BA 2GD1O 3WMXA 2EBFX 4DBLC 2ABWA 3L04A 5DRYA 2CXHA 2VHTA 1AHIA 3U44B 2PUFA 3ER9A 1JG1A 2WHYA 1WKVA 2HCTA 2JIQA 3I23A 3NJ8A 1DIAA 1M2EA 3ZWPA 4A2CA 3KPVA 4CIAA 1RRCA 3OD5A 3QWFA 2OD7A 1CJSA 2B1IA 2DCMA 1Q0QA 4QECA 2QP4A 4HNAB 1MPTA 4X24A 1TZ2A 4PLWA 2A5GA 3E7DA 1KI8A 3QWHA 4YJ3B 1ULUA 3M6VA 1Q83A 2XQJA 2PSJA 2HDWA 3EXEB 4WZAA 4CIVA 4KXMA 4EJ2A 4GLBA 1JFTA 5T6MA 5KINB 1I14A 4E46A 4OIMA 1NWHA 5CLLA 2IELA 2WIGA 2Y0CA 2AG1A 3SX0A 1CW2B 2ZRGA 5KS2A 1KZGB 2H5JA 4WLOA 4AJKA 4LGCA 3FOEC 1W35A 3N58A 3DXXA 1AQJA 3CR3C 2BJWA 4X71A 1PLLA 10MHA 4G0OA 5IG2A 3FB1A 1XZFA 3WK9A 3U9LA 3UK7A 4H1HA 4UTPA 4YQFA 3JYPA 5FH9A 1JN0A 1V5GA 3SC2B 4HC4A 4ZVOA 4EA9A 2DKNA 2PV0A 1FYEA 5EY5B 5KQGA 5AVXA 1ND6A 3PC8C 4L78A 5HK8A 3LKBA 1FJXA 2QX8A 2H07A 2RHRA 4BNLA 2BC9A 5ICEA 1M2WA 1HQKA 3OUTA 1T5BA 4HOYA 3H1PA 4Z0PA 5FA5A 4F93B 1WU7A 1ESEA 2NP7A 2QR3A 3TFQA 3G0OA 3Q6NA 1Z7YA 3D2BA 3OIGA 1C3OA 3FDXA 4RPIA 3RSHA 2X2OA 2WJAA 5FBLB 1ZK1A 1GL6A 1P9LA 4JB2A 1TAQA 3F8SA 5BNTA 3CUVA 3DEIA 4OB7A 1V8FA 3AP3A 3BWXA 4P81A 4DT1B 4AXBA 2P4SA 5G0SA 4B2PA 4R8VA 2JJ8A 4QXOA 4CETA 3L07A 1RRKA 4QVKA 3RABA 2ZIWB 5TR9A 4B3DA 3OPQA 1JKMA 1N2CA 2O5VA 3MJHA 4PLPA 3REOA 3MT0A 2WJGA 4LHWA 3I5UA 1WMSA 3K8ZA 4I8DA 2B94A 4BIMA 1JH8A 2XMDA 4JLMA 4Z9AA 1XSEA 1EE2A 3ZW9A 4DYDA 4HXFB 1FA9A 4O2LA 1CRWG 4PNZA 4HXGA 3IVMA 3L79A 4ESEA 4KFCA 3C5WP 3N8DA 3FI0A 2L19A 2YN0A 4K6MA 4YN3A 1JIIA 3HM9A 4EKEA 1H69A 1JDUA 1L4FA 4ZK6A 3A6KA 3FMGA 1EDOA 3RYTC 4EHJA 4IP0A 5BR7A 1J0DA 3NDPA 3NWOA 4M0MA 3PGLA 1EESA 4OK3A 4I8IA 2HSJA 4MCAA 2XTNA 1PR3A 4K9SA 4P6VF 3ZHQA 1TXGA 1KEUA 1PL0A 3MD9A 4BC0A 4E7OA 5K8UA 1VIDA 4MYUA 2IEYA 5JD3A 3UMFA 2E49A 5B53A 2FPIA 3CLKA 2AOXA 3JD4A 1VE5A 3AR4A 4X54A 1XMXA 1GLGA 3ITEA 5FD8A 3OT1A 4E5VA 2D74A 1MXHA 2JBHA 2R2AA 4LOHA 1KDPA 4XJSA 1M34E 1C9NA 2QU8A 4UVGA 5HR5A 1NN1A