2P5TB

Molecular and structural characterization of the pezat chromosomal toxin-antitoxin system of the human pathogen streptococcus pneumoniae
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
251
structure length
244
Chain Sequence
IQDYTDSEFKHALARNLRSLTRGKKSSKQPIAILLGGQSGAGKTTIHRIKQKEFQGNIVIIDGDSFRSQHPHYLELQQEYGKDSVEYTKDFAGKMVESLVTKLSSLGYNLLIEGTLRTVDVPKKTAQLLKNKGYEVQLALIATKPELSYLSTLIRYEELYIINPNQHHDFIVNHLVDNTRKLEELAIFERIQIYQRDRSCVYDSKENTTSAADVLQELFFGEWSQVEKEMLQVGEKRLNELLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular and Structural Characterization of the PezAT Chromosomal Toxin-Antitoxin System of the Human Pathogen Streptococcus pneumoniae.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Transcription regulator
molecule keywords fragment of PezA helix-turn-helix motif
total genus 86
structure length 244
sequence length 251
chains with identical sequence D, F, H
ec nomenclature ec 2.7.1.176: UDP-N-acetylglucosamine kinase.
pdb deposition date 2007-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06414 Zeta_toxin Zeta toxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2p5tB00
3QF4A 4C3ZA 2P6NA 3L8YA 4QM7A 2QORA 4ZIRB 1N5JA 4AKHA 4M1MA 1VYTA 4KSCA 1EX6A 2ZEJA 5FOWA 4C0JA 5JJKA 4LBYA 1P9WA 1OXXK 3GEHA 1A4RA 1E99A 1FQJA 5IRCD 2CDNA 4ZDIA 4HZIA 4DLSA 3NEYA 3OHMA 1E2FA 4Q4JA 4JL8A 1ZM2A 1ONBA 1T6NA 2BMFA 3NXSA 3GLHA 1N6HA 3GJXC 3PV0A 1PLJA 1JR6A 4V02A 3LXXA 1GKUB 2J5XA 3ZD6A 1KSFX 4EFMA 1Z0FA 4PSVA 2Q0HA 3A1UA 4G01B 3RS0A 4BECA 1KY3A 3QOFA 1G5RA 4WXRA 4EJSB 5LDDC 4MGKR 1UEIA 2O0JA 4MYCA 1UEJA 2OAQ1 1P61B 2F9LA 1YR7A 2GJAA 4NH0A 1G20E 1COWD 2BBWA 1T5LA 2QY9A 3N70A 3FDIA 4MKIA 5CIWA 2O8DA 3WNCA 1NKTA 1KO8A 2FA9A 2VP6A 2J9RA 4DEXA 1XWIA 1HV8A 3NH6A 2F1JA 3MD0A 4C0HA 4EPYA 1U2RA 2PLFA 3P20A 4C0SA 2ZRNA 3U7FB 3Q5DA 2DB3A 4LC1A 5B2ZA 4C0KA 3TK1A 3RS5A 1T3SA 1MRNA 1DAIA 3I32A 2VSOA 3EPJA 3GPLA 2R44A 2WSSA 2B21A 2XNDD 3THXB 4U00A 1GL6A 4IEEA 5SZKB 3ZIAA 2N42A 3DDCA 1ESNA 2BM0A 3OIUA 8OHMA 4HZUA 6Q21A 3S1AB 3B82A 4TZ6A 2G0NA 5TXGA 4YLGA 5SZJA 3T06B 2HCJB 2P5SA 3UIEA 3JZAA 3NVAA 3OFND 4B3CA 4DIDA 3K9GA 1E2DA 4EQ6A 2NMVA 4PAMA 3SZRA 1XCPA 4FCVA 2WJVA 3U3RA 4G5RA 3N2EA 4M8NE 3B60A 5KSYA 3VR5A 1FOEB 2W6ID 1SULA 1XRJA 2V1XA 4UKDA 3HWSA 3WP1B 2J0SA 3FMPB 4IXNA 2W2TA 2OSBA 4C2UA 2QAGC 4M9SA 1RRGA 3RNLA 4OQFA 2GA8A 1E69A 1U8AA 4M1YA 2FGKA 4B2LA 3X1YA 2A2ZA 1IY2A 3KFVA 3NBYC 2FX3A 1S9HA 5BW8A 2AHOA 5EJEA 4AY2A 3KXLA 2JLUA 4LYAA 4HB0A 4WXPA 4DBLC 4JLJA 4FD2A 2O8BA 3BERA 4P4SB 1IY1A 2ZR9A 3LLUA 2FV8A 5IDVA 2H8KA 1A2KC 1KSJA 2YWFA 2OG2A 4KJZA 2R9VA 4JLDA 4P31A 5CM9C 4DC9A 1TTTA 2GNOA 3G0HA 1AM4D 2GAAA 4TTRA 1LW7A 5HKKA 2KWIA 4FIDA 3B1YA 4I1VA 5C46F 2PX3A 2IUSA 2O8FA 1Z22A 3OIWA 3IEVA 1GTVA 4Q1AA 2C5LA 2W00A 4US0R 4QNMA 3GLIB 2F55A 4D80A 3QXHA 4KITB 1P4SA 2YYZA 4DT1A 5EE1A 1LS6A 2P67A 2ZAOA 221PA 2IK8A 1EFHA 4HB3A 3U4QA 2W2XA 1DARA 2YHSA 4W9MC 1XPUA 4OKSA 1XEXA 4PPGA 3BC1A 3NEJA 2IF0A 4MYUA 5J4YA 1WMSA 2QP9X 4B2IA 3X2SA 3BH6A 5HKKD 2XOKD 3AV0B 5G41A 1U8YA 2QGNA 1KO7A 4DIEA 1U98A 2XJ9A 2QT1A 3GLGB 3K70B 3GP8A 4DRZA 2LWIA 4Q1CA 3VU9A 2ATXA 2C99A 3I3SR 1MT0A 4ASUD 1M34E 2QT0A 4C7OA 2D3WA 4YQFA 1BMFA 2RHMA 4LC0A 2RGEA 3CRVA 1QHHB 1W36C 3LXRA 4XJXA 3LO5A 3K9LA 4EPVA 4IJMA 3RWMB 5CITA 2KBFA 3K8YA 4D4JA 3IGFA 3K0SA 5FOSA 5KO2A 5BN3A 4LJYA 2DBYA 2ZITA 4LX0A 4V0OA 3CX6A 4F92B 2OCBA 1T0HB 4GPTA 1XP8A 4NYMR 2VEDA 3QQ5A 3HYRA 2GCNA 4PPFA 3T12A 2QBYA 4J0QA 3RSOA 3RLFA 1UBGA 3I92A 1Z3IX 3SHFA 4B32A 1D9ZA 4XIGS 4A0GA 1YE8A 2NO0A 3SQXA 2XITA 5A4JA 3VHXA 2QENA 4F4IA 2R62A 3JVUA 1FNMA 4M1WA 1Q12A 1W4BA 4QNRA 3KQNA 5KNCA 1BO6A 5LB4A 3KX2A 2BJWA 3WBKA 1OB5A 2RCNA 2IT1A 1XNJA 5AJVB 1CR4A 5SZHB 1W36B 4D2IA 1RW4A 4GRAA 1KAGA 4K81B 1JR3D 1ZUHA 3EAQA 3LRPA 4MRSA 3W5JA 1E2PA 4L16A 5KYKA 4QBHA 4Q1EA 2HYDA 4HAUA 1XXHA 3WMFA 1N25A 4PSAA 1Z29A 3I62A 1UDXA 2X2FA 2D2FA 4NCNA 5H1YA 1GITA 1CP2A 1G7SA 3AKEA 2F3TA 3GJ6A 4A2WA 4DLYA 3BIFA 1R0YA 1Z8FA 3IKJA 3VHLB 4ZI2A 2D2EA 2RGNA 3DL0A 4QJ3A 3TGPA 4EAQA 1DS6A 1XCMA 2Q3HA 1IQPA 2ZRKA 4GP6A 1VCIA 4V0ME 2JLQA 4NL4H 3U3JA 3WYAA 1YZGA 3C41J 3UMRA 4ITRC 1G3MA 4PC7A 2AX4A 4YC7A 4ASUA 1CR1A 2W6IA 1P7CA 4FWTA 3TJZA 4QRHA 3AVYA 3C7KA 2GESA 2ZRDA 3GLFB 3B1ZA 2XSZD 2NOAA 1LB1B 2YVUA 1VECA 4HLUA 1VG0B 4HSEA 4TMVA 1Z0KA 2W6JA 3ZGXA 2ZI3A 3PEUA 4G0NA 4ILEA 2BMEA 2V7QA 5JJIA 4JL5A 2NG1A 1HQYE 1NI3A 4P32A 2UZ3A 3A4MA 3NIBA 4LBZA 4Q4AB 5AJWA 4NKRA 3FHCB 3MJRA 1L4YA 3WNBA 1H8HA 2FFQA 5B58C 4A0FA 3PUWA 3B78A 4Q21A 1UAAA 4PHFA 5GVRA 4AYXA 2OHFA 2QNRA 1J70A 2BBOA 3I5YA 4HAYA 4DEYA 5DN6A 1XTQA 2FEOA 4URYR 3I1FA 1KZGB 2UKDA 1KDPA 3HPRA 3SFVA 5F9FA 1HA3A 4UXJA 3K9HA 4RFVA 3NH9A 4Q9JA 2LCFA 2P3SA 4EDHA 4TZ0A 4MKFA 3VR4A 1KDRA 4P4TA 1TEVA 4QFMA 3U2QA 3RABA 3R7WB 2G77B 3SQWA 1F2TA 1E2LA 2FG5A 1G5TA 4HUQB 1CU1A 1ZM7A 2A30A 2GCOB 2IWRA 4LV5B 4TT3A 1W4CA 1UKVY 1NL3A 3GJ3A 4HAWA 4I1UA 5AUQA 1YRBA 2GXUA 2ZJ8A 4CEIB 3VR1A 4DLUA 4LYJA 1NRJB 1XTSA 3ZZUA 3ZVNA 1EESA 5FR2A 2IXGA 4XTRA 4DB2A 1F60A 3OAAA 3QG1A 4CT4B 5JECA 3B8HA 2VHJA 2ODWA 5F3WB 5BYKA 1IXRC 4JVMA 1DAMA 2ZUDA 2RGBA 4B47A 2GEVA 4MGZR 1I2MA 1ZM4A 3QPVA 4D4KA 1QRAA 3IO5A 3VQTA 3T1OA 1S1CA 1YQTA 3QXSA 2J7PD 1US8A 1XD9A 3ZLJA 5FUXA 1E2GA 1NBME 2AN9A 4XD7D 5KNDA 2O0KA 4EIWA 2Z6VA 1ZRHA 3VKHA 2V9PA 3SYLA 3FWYA 1G6OA 1DG3A 5A0FA 3O47A 4NCHA 3ETLA 4PPNA 4EPWA 2NIPA 3PVSA 3ZQJA 4DSUA 4XSHA 2MMCA 4QC2A 1RYFA 2XZOA 2QRNA 3S1AA 1OH8A 1NVVQ 4AK9A 4GL2A 1CKEA 3FYHA 4ESHA 3CRQA 3AF4A 3GEIA 3TLXA 4ABYA 2CCKA 3W8NA 2I4IA 3CR7A 3QVVA 1P2SA 1Q21A 1YJ5A 2ZR0A 2JATA 5KUTA 4FMCF 1L8QA 2HUPA 4URVR 4PC3A 1AN0A 3LX8A 4GP7A 3VX4A 2ZRBA 1E0AA 1CJMA 1XX6A 2Q9BA 4EPRA 3NHBA 4WBSA 3R9IA 3UG6A 3B2EA 3CPEA 4XTCS 2FGJA 2VRWA 1E2HA 4LPKA 2V8OA 4XOIA 2ZYWX 3W6PA 2VTKA 1QG2A 1MOZA 2GRJA 5GJVC 2JLWA 2IYQA 4D81A 2VQSA 4GDFA 4R2HA 4UJ5A 2WPDD 2WWXA 2HLDA 1NIPA 4JVNA 4BLSA 5IT5A 5JRZA 3RC3A 1ZD9A 1QHHA 2EVWX 2WWYA 1HUQA 2C2HA 3ZD7A 1RE0A 3CR8A 2IC5A 5L3QB 4OYHA 1AS0A 1G7TA 4IW3B 3PUVA 1D8TA 4QJ4A 1HYQA 5B57C 3RS3A 5EXTA 1NN1A 2PZGA 1GAJA 1W1WA 4B3FX 2JGNA 5EXPA 4ZDKA 2J7KA 4P4UA 5K8IA 4Q1DA 4TSFD 2GJ8A 1N5LA 5DYGA 4H9GA 3RANA 2ODEA 1Z0DA 1GILA 4K8OA 1KY2A 4Q7LA 4CYMA 5FI1B 4TLAA 1VTKA 3KKQA 2BKUA 5JCZA 2E87A 2ATVA 4L5BA 3UANA 5LD2B 3GFTA 2YNMA 3W5IA 4BE7B 2ZXUA 1FUKA 3JVVA 5KU1A 1GNQA 3TUZC 5LD2C 3W9YA 2CXXA 2G1KA 2EYUA 2Z0MA 4JLOA 3W6OA 2WV9A 1G18A 5JWHA 3DPUA 4RD0A 3RDPA 2ZYTX 2RH5A 3KQKA 1ZMXA 2IW3A 2ZRJA 3AGQA 4TSFA 5FPTA 3WHLA 4KHZA 2I1QA 4BWYA 1OH5A 5KSZA 3PJRA 2GBLC 2REOA 3EARA 4M1OA 1EG7A 1GL9B 2OESA 2OM2A 3W34A 1HEIA 5IK2A 3AVWA 4HI0E 4O25A 2B8WA 4OJQA 5FOVA 2I1VB 2YINC 1G3RA 3AUXA 3K9NA 4M0LA 4DUGA 1VG8A 1R2QA 3MJHA 3NDBB 5FOXA 2VP0A 2OBMA 1I4TD 2WAXA 5F9HA 4UNSA 1NLZA 1D6JA 4QGFA 1KNQA 1O3YA 2FPLA 3LW8A 2O8EB 1LS1A 1Y63A 2OXRA 2KE5A 1E9SA 4JBYA 1OIVA 1NLYA 2P6UA 4Q7MB 1BKDR 5CJPA 3GFOA 3W6NA 1KK0A 4NCKA 2O5VA 4MYHA 2RHDA 2GXQA 3IBYA 5FUVA 1DAGA 1T8TA 2WJGA 3ECCA 3HR8A 5JHGB 4M1TA 4TTQA 5BYJA 1PUJA 2VPPA 4DCNA 1MV5A 4JYCA 4LPSA 2DWQA 1OHHD 1KJZA 1P9RA 4QXAA 4IDNA 4YDSA 4AKIA 3GCGA 3R7WA 4BLQA 3ZIAD 3MWLA 2GF9A 1II8A 3QVUA 3CO5A 2VP5A 5EQTA 3KQUA 5JFGA 4PC6A 4JLPA 4F7WA 2JLRA 2XJ4A 3W90A 2QG6A 3T34A 1E2JA 4BRUA 1YR9A 3TSWA 1GP2A 4DLVA 2G83A 2PLRA 4P0TA 3RRNA 3QF4B 2J87A 2JIZD 4MDEA 3MWKA 2XTZA 2ZRAA 4CGZA 2BMJA 2CLSA 4HYYA 1Z0IA 2WJHA 2OCYC 1DO2A 5CJ2A 1ZNWA 1ZCAA 3KKOA 4KU4A 1JAIA 4BPBA 1XBTA 2AWOA 4YMSA 4OK3A 3AQ4A 4HAVA 4HDQB 1X1SA 3SNHA 4F93B 1Z06A 2YWEA 3L0SA 1CEEA 4TQ9A 5J4HA 4N0EA 1W4RA 4LJ7A 1N0WA 1Q1ZA 3AUYA 2J41A 2JEOA 1BIFA 3SU8A 3K1JA 1Z0AA 4IDPA 2FEMA 4QBFA 4CEIA 621PA 2QP3A 2QQEA 1ZNYA 2J3EA 2ZRLA 3QPUA 3P32A 3LLMA 4PAOA 4GOJA 5CYOA 3FTQA 3BD9A 3LX5A 1ZC3A 2V7QD 1T8UA 2WWHA 3GJ4A 4BFSA 4GZLA 4JSTA 2MSDB 2VA8A 2EFDB 4TYQA 3K70C 3AKDA 3TSOA 3VR2A 5C2JB 5K8UA 3TVTA 2GILA 4LDJA 3ZVLA 1E32A 3QNUA 4URZR 3U6KA 1P60A 5J4VA 1E1QA 3MFYA 5TY0A 1N6NA 1XCGB 3MUFA 4B34A 4IVRA 1TQ4A 3AVOA 1YRAA 1KNXA 2A5DA 4FCWA 1FMJA 4JKIA 2F3RA 2OZEA 1JEEA 1FQKA 3WRYC 2NO9A 3ZJYA 1IN4A 2F9MA 1K6MA 2HF9A 2ZETA 2RGDA 2CMKA 2QM8A 3EIQA 1XEFA 3LH5A 5EZ5A 3F3YA 1GKYA 1RC8A 2GXSA 2GZHA 2QTFA 2W2VA 3ZZ0A 3BFXA 2DCUA 821PA 3P26A 4NCJA 5FPYA 1XF9A 1RPZA 3PEYA 4PZZA 1OXTA 3OFNA 1OYYA 3A6PC 4D6PA 1KMHA 4LJ4A 5GJWC 4M1SA 5AUNB 4Z8YA 3EC2A 3V4FA 2VBCA 4NYMQ 2J0QA 3GLGE 2QROA 4Z1MD 5FL7A 1G9XA 4M1KA 3A58B 2FWRA 3BRWD 4KODA 4DHEA 2WICA 4TT3D 3B85A 4B6FA 3A1SA 4DKXA 4DUGD 1R5NA 1M1YE 4XD7A 4PFSA 1TUEA 5HE9A 4BUJA 4V0KA 4LJ9A 2F43B 2C9OA 4ERNA 5AJXA 3I61A 3K0CA 2O8FB 1OB2A 1L2TA 2VP4A 2ODBA 2QL6A 5JI3E 2BEKA 3RYTC 2VH5R 2J0UA 2ZRGA 3EASA 1OT3A 2VIIA 3SJCA 2D74A 1G6HA 1T91A 3EZ7A 2ZRCA 3CONA 4ZV4A 1LV7A 1HTWA 2HF8A 4N3NA 4OI4A 2XB2A 2WIAA 5FL7D 4Q1FA 2XNSA 1JR3A 5P21A 4PX9A 2FSHA 2X2EA 3Q3JB 3QI2A 4I99A 2WJYA 2GKSA 1FTNA 3EWAA 1ZU4A 4OI2A 5HR5A 3N5CA 5AWFC 1P9NA 3CNLA 4OQNA 3F0TA 1N6IA 2ZJOA 2ZE8A 4R2IA 3OE7A 2AR7A 4L9SA 4TLCA 5CYPA 3W8RA 1QHGA 2AFHE 1VG9B 4PPQA 2NO6A 3K0EA 1PUIA 1ETUA 1FX0B 1R8QA 2CNWD 4KCGA 3UWKA 2X77A 2P2LA 2YC4C 4A8JB 2FSGA 3CNOA 1KI6A 2C78A 2MSEB 1MH1A 2EYQA 4D0NA 3QY0A 4HB4A 4YMTA 1KSGA 4D4LA 1TUIA 2FNAA 2JCSA 4B2PA 1ZP6A 2DYKA 4HDOB 2GJ9A 3LFUA 1AGRA 1RZ3A 2AKAB 2QMUA 1LF5A 4M9QA 2UVQA 1N6LA 4C7OB 1IOZA 1Z2CA 1LY1A 3GFPA 4ON9A 4TN1A 3K0FB 4PHGA 4JJZA 1M7HA 1AGPA 4CDGA 2VHTA 4GI7A 1OFHA 1SVMA 1X6VA 2EW1A 3C16C 1DO0A 1S3GA 4PC2A 2E1RA 4Q9KA 5IF9A 5HZKA 4JBWA 2WIBA 3OESA 1VG1A 2GK6A 1OKKD 2XZLA 1E79D 4EUNA 2HJGA 4HLUC 1IN8A 2Q3MA 4LBVA 4G5QA 3PQCA 3PITA 4LHVA 3FGNA 4JLVA 4X8MA 1S9DA 1Z63A 4IOLA 5EP2A 3FHOA 3KL4A 4E07A 3L0OA 1FX0A 2CHQA 3IHLA 1NG1A 1GNRA 4DCUA 3DHWC 1RJ9B 3AVVA 1EXMA 1XMVA 1XMJA 3H0KA 3W3ZB 4BASA 4RD2A 5G53C 4DLWA 2PMDA 4LOAA 2C95A 2RMKA 4ZCMA 1EFUA 2VHQA 4IDQA 4XVQA 3LNCA 3H84A 4BFZA 3EPKA 1UBFA 1KOFA 4Q66C 3HPQA 4TTPA 3MAAC 2ZJZA 4YMWA 5FUYA 2Z83A 2C9CA 2IF2A 3VR6A 4DB4A 3CPJB 4QM6A 1E3MA 2CLCX 1SXJA 1CLUA 2GXAA 2QM7A 2HJVA 3E2IA 3MCAA 1CR2A 1RRFA 2EFHB 4CIDA 2PCLA 2FE4A 4M22A 1IAQA 2J46A 3G82C 5BWMA 1NJFA 1Z6AA 4JLMA 4B33A 1AKYA 4HLQB 3GLIE 2RGCA 3L8ZA 2ZJ5A 3IEUA 3SJZA 1ZNXA 4RKEA 1BMFD 2DPXA 2QE7D 1XMIA 3C5CA 3T1VA 2O52A 4NBSA 4POAA 1WRBA 1W0JD 2ZTSA 2QAGB 1XJCA 1X8KA 2OXCA 2FOLA 4X8HA 4ZKDA 1ANKA 3QIAA 4Q4JB 2AD1A 3Q7QA 1S8FA 1W2HA 4HUQA 4TMXA 1VHTA 2JJ2A 1J2JA 5FL3A 1GKIA 1M7BA 3ADDA 2ZS9A 1KI9A 3FFAA 4KLNA 1KHTA 2FF7A 1JI0A 4MRRA 1XEWY 3OE7D 5JI2E 4MKGA 4V0MA 1G4AE 2IEYA 4FN5A 4UNPA 1NVVR 1QF9A 4O3MA 1MO6A 1XTRA 2A5YB 3AP2A 2WBLC 3KQHA 1NMYA 3T1TA 3IQXA 2GTPA 1PLKA 4QHTA 3BE4A 1RVDA 5LB2A 1SKQA 1EWRA 2RKOA 1NJGA 4HATA 5CK5A 3RWOA 3VTKA 1KMHB 1K5GA 1P73A 3CNNA 3K0AB 4TL9A 3C4JA 2QBYB 2ZRFA 3OIVA 2ORVA 4PQYA 1NSTA 3TUJC 3EIEA 1GUAA 2PBRA 4CEHA 1AZSC 2WSMA 3CRRA 2QRZA 3E70C 1E1QD 4IRUB 3TH5A 2DFKB 5KDDA 3NC1C 3PFIA 4GMDA 4NYIR 2ZU6A 3I8XA 4GOKA 2IS2A 2IYZA 3MLEA 3GEEA 1KK3A 1QHSA 3KXKA 3RVBA 4E03A 2FH5B 1U0LA 1EFRD 1K5DA 3JZMA 1SXJC 3QBVA 4KO8A 5E3HA 4FWIB 3X1DA 5J5CA 3K09C 3ND8A 4WZBE 4L9WA 1NN5A 4A6XA 2JJ1D 3B5JA 2HYIC 2B7CA 5FFMA 5JMTA 1EFTA 1F5NA 3A1WA 1FP7A 1YZQA 1NVXQ 2Z4SA 3L82B 1DAKA 4Q19A 4Z54A 1G3IA 1V5WA 4AYWA 4EJSC 4HAXA 3GLHE 3I73A 3PEWA 1W46A 3DO6A 3GLFA 4BFVA 3QEJA 4LJ6A 3B9QA 1EX7A 1JXMA 4BLOA 4RKFA 2ERYA 1E98A 3PUXA 2REXB 1OPXA 1FZQA 3EA0A 3EA5A 2PT5A 1II9A 2YV5A 4RD4A 3BH0A 3HU2A 4PO1A 1R10A 4UXHA 1G3QA 2OFOA 3I8SA 1IJEA 2ZVPX 4R7ZA 2BJVA 3THWA 2IYXA 2N46A 2QP4A 4FINA 2VP9A 1M2OB 2ZE7A 1IJFA 3B7GA 3VAAA 2V6JA 3TE6A 2ZSFA 2V3CC 2BM1A 5J47A 3DVLA 1MRSA 2FDCA 1GWNA 3V9PA 4V03A 3C15C 4TQUS 1SVOA 1FP6A 3AVXA 4DSOA 4AYTA 2OUKA 5BN4A 1E9CA 2VF7A 3MWYW 4JLKA 4F4CA 4BFUA 2Y8EA 1H8HD 3REFA 5L3SA 4LBWA 1ELOA 4M9XA 3V00A 5G3ZA 1WBDA 5DI3A 3LVQE 1G21E 1FW6A 1OE0A 5DHAA 1KAOA 1KI3A 4Q1BA 4FMDB 1XTIA 4JL6A 3A4NA 3AVUA 1LFDB 3LQQA 2NPIA 1TQ6A 4Q4LA 1HT2E 2PZFA 2GCOA 2QSZA 1PLLA 1O87A 4NMMA 5FPSA 5C18A 4BZQA 1TAGA 3QKSA 5KTYA 4WA7A 4N0DA 1JEDA 4IOMA 4TYYA 2VF8A 3VX3A 1X3SA 3KUCA 521PA 1C9KA 4ESVA 2XAUA 1DAHA 2BCGY 4Q00A 4NU0A 1GL7A 1G5PA 1G8FA 3IPYA 1RKBA 2RB4A 3U3KA 4BLRA 3ZZTA 3O8CA 3K70D 2DY1A 4Q9HA 4AURA 1MABA 3ASZA 4LHXA 5H70A 2A5GA 3DOEA 1SGWA 3KQLA 2ONKA 4PZLA 3CF0A 1GOTA 3GLHB 1RYHA 2FPMA 4LJ8A 3OEHA 1HE8B 3ZQ6A 2R6FA 4OHXA 2SHKA 2A3RA 3U5ZB 1DADA 2JJ8A 3A37A 4URUR 3MG9A 4RVCA 2VHUA 4B3GA 4TYWA 1JQJC 4PO9A 3ICQB 1ZM9A 1HE1C 1W2GA 1T5IA 3W3AA 1G41A 2G88A 3SEAA 3A8TA 2OT3B 2KI5A 3PCRB 4OI1A 4XWOA 1PVOA 2VO1A 1PV4A 3Q5EA 4IFEA 4R71A 3WHKA 1NNEA 2AXPA 2Q21A 2BHRA 2OEPA 4YXWA 4PHTA 4W5JA 5C1BA 4H1VA 5DHFA 1DG1G 1J7KA 3VMFA 2FFAA 4QHYA 4AWXA 3IDQA 2O0HA 3SBDA 3WBJA 1CRPA 4WOPA 1QHNA 1VCOA 4JKYA 5D3MB 1KSHA 1KTVA 4Y0VA 1F3OA 4G5GA 4B76A 2CJWB 2GWHA 2VYFA 1SZPA 1IBRA 2LKDA 4Q4HA 121PA 3KJEA 2ZVQX 5EUQB 5FTNA 3KKNA 1DELA 3AEZA 4RFSA 1G8YA 3Q85A 2PJZA 1Z0JA 2IYWA 4W7SA 1GZSA 4NONA 3R8CA 1S0UA 4DDVA 2FPKA 1ZINA 2QPTA 3TQFA 3GJ5A 1K8RA 1GM5A 4PC1A 3Q9LA 1EGAA 4FI3C 1ZM3A 1XMSA 5ANRB 2R65A 1JBKA 1W36D 4RCYA 1JALA 4TYNA 1IM2A 3FKSD 2JAQA 4RZ3A 2IYTA 3QJYA 5EE9A 1NY5A 3SFZA 4LSGA 1W0KD 1EWQA 2CNWA 1HH4A 1JR3E 2WOJA 1X8LA 5GJCA 2ZUCA 3DMDA 5BN5A 1AKEA 1V43A 1P72A 1R7RA 2CVFA 2OILA 2ZI6A 3CBQA 3LWNA 4TLBA 5FR1A 2X19A 2JLYA 2OFWA 2C03A 2FSFA 2AXNA 1US8B 4HLCA 2CJWA 4UXIA 5TDHA 5CDFA 1KGDA 3THOA 4G5OA 2RAPA 2J0VA 3U3MA 1U94A 1VMAA 1L7VC 1TF5A 1Z6TA 4Q02A 2O8BB 2YWHA 5K8TA 5FH9A 3OEEA 1D2MA 5CB8A 4K46A 2H57A 3L0PA 2K5UA 1YHNA 1TL7C 2FFHA 3KUDA 4B43A 2QZ4A 3O8BA 2B6HA 2ODNA 3K0AA 3RRMA 5HTKA 1H65A 4JMPA 4OBEA 3FB4A 1C1YA 2F1HA 4CEJB 3NBFA 4BFTA 4JT2A 1D2NA 4V0NA 3HU3A 2D7CA 3ASYA 4CT5A 3AVQA 2JIZA 1KDTA 4RD3A 4Z8XA 3CB4A 4NCIA 1CJVC 2R8RA 1T0JB 1CULC 4I1SA 4IHQA 1Y3AA 4JZKA 4IXMA 4YMVA 2WSSD 1IY0A 3SI7A 1E2IA 4Z1MA 5EXSA 1CXZA 4UQOA 5EE5B 2GHIA 1P6XA 1KIMA 1R6BX 1U8ZA 2X1VA 5TARA 4OI0A 3X1ZA 1WF3A 1PZNA 4LI0A 1Q57A 4HUTA 3U44B 1N0UA 1CIPA 3IUYA 5DH9A 5DGXA 2EFCB 4OK6A 1W5SA 2V54A 1QVRA 3IILA 3QG5A 1NVUQ 2JJ1A 2OCAA 4A6PA 4CW7A 1A7JA 3ND9A 2QPOA 2IYRA 2ZYUX 3D7MA 2WKQA 2J0UB 4TYPA 1UFQA 2ASEA 3CX7A 1P3JA 4OHYA 1KMQA 3BB3A 3BFKA 3CRMA 3IIJA 3K53A 5FBQB 3T5GA 2WJIA 3EC1A 1ZD1A 2NO7A 3KJHA 4D82A 3THWB 1DOAA 1Z6XA 3IIKA 1D5CA 4M21A 1CRQA 4KFRA 1SXJB 3KB2A 4FMDF 1RFLA 2WJJA 2QQ0A 4PR0A 2CL0X 4BLTA 1CJUC 2FU5C 2FZ4A 3VNUA 3SS8A 3L43A 2F43A 1TEXA 3LBHA 1GRQA 2ECKA 4NPHA 3VR3A 4KSBA 2IA5A 3NTUA 4LUCA 1G16A 1S1MA 1YKSA 1ZVQA 2G6BA 2HEIA 3P4XA 3CF6R 2ZI7A 3EXAA 2R6DA 4F38A 1XD2A 2CBZA 4C4PA 3LQRA 2XTMA 5DI3B 3EX7C 1X8JA 1G7RA 4GSYA 5L3RA 3NC0C 1NSFA 2JLSA 5FI0B 4PQFA 3D6TB 1NMZA 1WE2A 1FNNA 1HY3A 2H18A 3VKGA 4RZ2A 2JA1A 4TL7A 1GIAA 4Y0AA 2ONJA 4ACBA 5JRJA 5C4GB 1NN0A 1Q20A 2OCPA 3IHWA 4GMXA 2QMOA 4QG7A 3OIYA 1NBMA 1R4AA 2H16A 1NBMD 4JLAA 4OQMA 1KO4A 3Q7PA 4AG6A 3THYB 4WZAE 1MKYA 5FOUA 1CJKC 2A5JA 1E9BA 421PA 2F1RA 2KBEA 4Q48A 4KI0A 1ZUNB 3RSLA 2VHCA 3A36A 2A5FA 5JSZA 1M8PA 3C5HA 1IXSB 2PEYA 1CR0A 2IWHA 5JHHB 3LD9A 3I4LA 3GQBA 3PG5A 3HDTA 5JWRA 4IDHA 1NIJA 5DN6D 1E9FA 3AF0A 4EFNA 3N2IA 5FPKA 3BS4A 1G4UR 2F6RA 2RGAA 1XTJA 4BFWA 3MSXA 5JZVA 3I5XA 1TNDA 3AKYA 4RCZA 2A7QA 2W0MA 3D8BA 2ZM5A 1OFTA 3QKTA 1OXSC 4FW9A 4II7A 4C30A 5EUMA 3ZVMA 2JLVA 2QMHA 4Q5IA 1YU9A 2IS1A 1ESMA 2GBLA 1KYIA 3DZDA 5DO9A 1SXJD 1TU3A 4L4UA 4Q4AA 3LA6A 1UKEA 4DDUA 2NO1A 3FHTA 1A2BA 3DM9B 3K0FA 2W58A 1E4VA 3QEOA 2A78A 2O8CA 3ZDQA 2XZPA 2GDJA 2WVJA 1U0HC 1D9XA 3HU1A 3ICEA 4EPXA 4LV8B 4B75A 3UK6A 1U90A 4A0HA 4JVSB 1F6BA 2H5EA 4LHZA 3M4YA 3VNVA 3E5HA 2WWWA 2QE7A 1TU4A 1VYVA 4LYHA 1OH6A 4HB2A 1ZW6A 2ZSAA 5D3QA 2WHXA 1NG9A 1FFHA 1QHYA 4D25A 1RIFA 1F2UA 3SN6A 2CK3D 1J8YF 3F5FA 2DFLA 5J4KA 3VFDA 4UNQA 2DHRA 3FPAA 2VP2A 5CDFE 2KB0A 3FMOB 1T3LA 4O2RA 4URWR 5IK2D 5DLQC 2Q3FA 1E1RA 4OHWA 2GETA 2N1BA 2CHVA 3BAFA 3PENA 3TW8B 4ZO4A 3NHAA 2P65A 2YJTD 1WDTA 3CZQA 1S4QA 4Q7JB 1ZC4A 4R98A 1AJEA 5EP3A 1II8B 3CM0A 1QHIA 5JBQA 5DSZA 1CTQA 1DTSA 2QU8A 3TBKA 4QL3A 1VDZA 1JJVA 4M4SA 2CCJA 3HYTA 1YZUA 2ZI9A 4Q47A 4BFYA 2VLIA 1W44A 5FTKA 3WXMA 1G64A 4MKHA 1DAEA 1S96A 2GAOA 4ZDJA 1TX4B 3U7HB 1G291 1Q44A 4BZXA 3R8FA 5B30A 1H8ED 4D26A 4QBIA 1G8HA 3BH7A 3QXJA 3BFVA 1NKSA 1TQDA 2IYSA 1EFRA 2ZAMA 2EQBA 4U02A 4F4JA 1OKKA 3LV8A 3TKLA 4G1UC 1UADA 5F2EA 2P6RA 1EFCA 2NPFA 3UG7A 1F48A 1XJ0A 3FKSA 2OFXA 1MO3A 1VCNA 4ARZA 1DPFA 4OHZA 1QHXA 1Q3HA 1P2TA 1S2MA 3CUEF 3T35A 2BOVA 3TRFA 1X86B 2IYYA 1P5ZB 3EZ2A 1JJ7A 2CE7A 4B44A 5KHOC 4XWKA 1XFAA 2HT1A 2WPDA 2HXYA 2P0EA 4DJTA 3AH8A 3CX8A 1M7GA 5BQ5A 5KDOA 2QPAA 4MUAA 2Z5FA 4RY2A 2QSYA 1KI6B 4X8LA 5CLQA 5CK4A 1LNZA 2H7VA 2HCBA 3RS4A 2QEQA 3P1JA 3U44A 5EXXA 5DNYB 1XZQA 2EU8A 1Z6YA 2ZSBA 4JSYA 3SHWA 5HZHA 4XH9B 3UATA 2WKPA 3U4QB 4YMUA 1P62B 3ADKA 2EWVA 2JJ2D 4BGDA 5GJBA 2ZRMA 3BORA 3ZYCA 3BK7A 1CBUA 4Q9IA 5E7IA 4B3BA 1UBEA 4AIIA 5HCNA 1KI4A 3THXA 2G1JA 1JXOA 3BB4A 4DLRA 2J45A 2AWNA 3A1VA 4US1R 1XXHE 3SJBA 1BOFA 2UZIR 1P75A 3KTAB 2GJKA 3K0CC 1E9AA 3QBTA 1OIWA 2ORWA 3B9PA 1U9IA 3A1TA 4EQ6B 3PXGA 1YR6A 2JASA 4GBMA 2CEAA 1N6PA 3B6EA 3AF3A 4LY6A 4LWZA 4MYTA 3H2YA 3U61B 1E79A 2ZRPA 721PA 2AKYA 1Q22A 2V55B 4B3XA 5HE8A 5DI9A 2WTUA 5SZIA 2EFEB 3H4MA 2L0XA 3NWJA 3X1WA 4ACAA 4AG5A 1W7AA 4MRNA 1NMXA 2C8VA 1I4DD 2ZREA 3MRSA 5JSZB 2DWOA 5DE3A 5L8VA 5IHPA 1KO1A 4MA4A 2PH1A 4WZ6A 3C8UA 3T5DA 3B1VA 3QKRB 4RFSB 5L3SB 5BXQC 4Q01A 2DR3A 1E9EA 2BEJA 3OEED 3DMNA 4B71A 4KVAA 2BVNA 2V4ZA 1UPTA 5FOTA 1E0SA 1GNPA 4DLTA 2ZU0C 2FSIA 4BLPA 4UNRA 2ZJ2A 1SVIA 1R0XA 1TF7A 4OK5A 5AJYA 5GADl 5H8WA 3QPWA 3BBPA 3T1QA 4BRWA 5EP4A 4G5SA 4TMZA 3WMGA 1B23P 3T61A 1OFUX 2E9SA 4KVGA 2ANBA 4LHYA 3WNDA 4DSNA 1R0ZA 1VIYA 3LW7A 1GRRA 5EE0A 4E09A 3CH5A 2NZJA 1WQ1R 1HT1E 3WYGA 2NZ8A 2WWFA 2VSFA 2H1LA 2JDIA 4UJ3A 4RZXA 2ANCA 4A15A 3GLFE 4G3XA 2WAYA 5KPJA 3KJIA 4KLZA 3EWSA 1MABB 1ODFA 2ZJBA 2IYUA 4KAXA 2CL6X 3M1IA 4LZZA 1GG2A 1OXVA 3DOFA 5FPHA 1D2EA 1Z83A 5JS8A 2BKEA 1Z6GA 4RSGA 3D3QA 1IN7A 5JCPA 4XVUA 3DZ8A 4ZPXA 3P27A 3SYNA 3TQCA 5CIQA 5E95A 4LGMA 3GLGA 1UJ2A 2XEXA 1FTSA 5CLLA 5E7MA 1N6RA 5AK0A 4IOJA 4NHOA 4PSKA 1E2MA 4IKEA 3AF1A 3WMEA 2W6JD 1IN5A 2BMDA 1OIXA 1JAHA 2QAJA 4NTZA 3UMFA 3FKQA 3QF7A 2R2AA 3SOPA 5FTLA 2YKGA 2J1LA 2OO7A 3U7GA 4MITA 4U7DA 3KKMA 1FL9A 2XNDA 1SHKA 1TQ2A 1ZIPA 3FMFA 4UNNA 5AR1A 5AUPB 3AKCA 4A8JA 2FN4A 4DWJA 3CPHA 5E7JA 5KOYA 2J59A 5B64A 4OJKA 4IVQA 3GJ0A 4M53A 5CB6A 3IO3A 3QXXA 1ZBDA 1U9IC 2QA5A 2DFTA 3BOSA 3LDAA 4MQBA 4LJAA 4P4SA 2IS6A 4TQAA 3L2OB 4JYBA 1Q0UA 3CWQA 4PTLA 5FBWB 2BV3A 1ZUIA 2W0SA 1CS4C 1GVNB 2AFIE 3GMTA 2OBLA 2ZJAA 5JWOA 2ZRIA 4IEIA 2Z4RA 2HXSA 3EIHA 1AA9A 1R5OA 1VCMA 2IUTA 3BXZA 2JLXA 1A1VA 1W48A 1SQ5A 4DDTA 3CH4B 4X8OA 1L4UA 2BDTA 1MO4A 2CVHA 2YWGA 5KSOA 2O8DB 2C77A 5DISB 2PJRA 1OLOA 2IHBA 2Z43A 4DCTA 4DT1B 2JDID 4OQLA 3UPUA 1RRPA 2GVDC 3FE2A 3NG1A 4TWZA 4MDFA 2JLZA 4ZI3A 2W83A 1W47A 2G9NA 3SDZA 1YZTA 3TMKA 1N2CE 4AKGA 4A2PA 3R9WA 4WIAA 3TIFA 3L0IB 4A2QA 2XSZA 1J8MF 1W0JA 2H17A 3KB1A 4Q4HB 4OQXA 1Q1BA 4HAZA 5C4MA 2EFGA 2QN6A 3KDSE 2C9YA 1WBBA 1I2DA 3DKVA 5KDLA 2BBTA 3ADCA 4M9ZA 1TF2A 4FXPA 1XPRA 4ZDWA 3TR5A 3EPLA 4MH0R 4NE2A 2WZQA 2C04A 5KSPA 4NYJQ 3RC8A 1KI1A 1GFIA 1VHLA 2GEDA 1B0UA 2YC2C 4OHVA 3IPXA 3TSZA 1VPLA 2KSQA 3FOZA 3B1XA 3V4RA 3CIOA 4I81A 4C0LA 1Z2AA 2OLKA 4Q9LA 4MGYR 4ZCIA 1JB1A 2QUZA 2ZS7A 4KBGA 4B74A 3J81k 2OE2A 2WWIA 4GFDA 2Q9CA 4Z51A 4JT4A 1SKYB 4V0LA 3AF2A 1KO5A 3LBIA 1VYUA 2B7BA 1KKMA 1KJWA 1DVRA 2CL7X 2MMGA 2CCGA 3EG5A 4PO8A 2LKCA 1JECA 2PT7A 4B73A 5K8LA 1M6NA 2QGZA 1U99A 4DZZA 1ZD8A 5LPNA 4TLDA 2XGJA 2X8AA 4KFTA 2G3YA 2QI9C 3AP3A 1TPZA 1H8EA 2QAGA 4HLDA 3RRZA 4DSTA 4IVPA 2R6GA 4W5WA 3A4LA 3AP1A 1KI2A 1G8PA 1W5TA 2Q6TA 3AGPA 4CF7A 5UKDA 1DE0A 2TMKA 3TVDA 2OAP1 4LHWA 4KFUA 2YZ2A 5JS7A 1OJLA 4JIMA 2AK2A 1W0KA 2PEZA 3K09A 4YDHB 5KPDA 5JEDA 3HP1A 3FMIA 4WVFA 3UXMA 1EK0A 3LVRE 3SE0A 1XJQA 1CJTC 1FUUA 4C9BA 1IONA 1ZYUA 2C98A 2FFBA 3CLVA 1T9HA 1XB2A 4CVNA 1AS3A 4B35A 2NGRA 3E1SA 3GD7A 2CK3A 2WKRA 4IOKA 4CEHB 4PZYA 4NYJR 3RHFA 3TR0A 1ZCBA 1NVWQ 3U3OA 3QKRA 5HPYB 1XTKA 4GNKA 4F91B 3AB3A 2EWWA 3P4YA 5J40A 2GCPA 3Q8XB 1JNYA 1X1RA 4LRWA 4KBFA 2IX3A 1SVKA 2AK3A 4PHHA 3KXIA 4IDOA 2HT6A 2REBA 3IQWA 4JVLA 3KKPA 3ZS9A 4GT1A 4URXR 3BJIC 3KFXA 3G5UA 1OXUA 2ZIAA 1G3UA 3OEHD 2QTHA 4BQSA 1LVGA 1ZU5A 1RRCA 2YOHA 2G0TA 2D06A 3QKUA 1MO5A 2ZS8A 5AJZA 2ZSDA 2BC9A 2XTNA 3GJ7A 3UWOA 2ORIA 3O8DA 3VU9B 2P5TB 1QZXA 4TL8A 4Q7KA 1DAFA 1ZNZA 1QG4A 2ZUBA 3X1XA 3U6BA 3AVTA 1UBCA 2NQ2C 3O8RA 3OZXA 2D62A 2H92A 4FCTA 1N5KA 2GZAA 3NBXX 4CEJA 3CF2A 4BEBA 2VSXA 4QGHA 1SVSA 4XVRA 2B92A 4Q18A 1P2VA 2CLDX 2DFNA 3ZS8A 5D3MA 1JPJA 3BB1A 3H86A 1E96A 2WMOB 1QDEA 3U7EB 4BFXA 4A8JC 2WOOA 4E22A 4EFLA 1G8GA 1RJ9A 4EKDA 4I4LA 3EPHA 1KI8A 2BWJA 4AC9A 3EW9A 4WW0A 1OF1A 3M0EA 4R9UC 3QUSA 4DCSA 3RS7A 2ERXA 4ARZB 2GF0A 4MGIR 4HZUB 1PJRA 4XSGA 4H1UA 4DVGA 2V1UA 1E94E 1NY6A 3REGA 1J99A 2BCJQ 2IXFA 2F7SA 1Z5ZA 3QXCA 3RS2A 5A5GA 1OSNA 3CW2A 4KYUA 2GK7A 3WRXC 5TV2A 2BBSA 3QE0A 4FMCB 2ZI5A 3UMSA 1UDWA 4NZYA 1KI7A 1AQYA 4QKQA 2RGNC 4TL6A 3EZ6A 5FUWA 1N3BA 3BWDD 1R5BA 1IXZA 3C14C 1LTQA 3DEFA 4HEJA 1C4OA 2IL1A 2MSCB 3FVQA 1KK2A 3D31A 4QHSA 1SKYE 2IYVA 1ZJ6A 3ONWA 1IHUA 4DLXA 3Q72A 5DIFA 2CHGA 3CRW1 1COWA 2A9KA 3EZ9A 2O8CB 1TMKA 1E2QA 5JJLA 4RD1A 5KNBA 1VIAA 3BGWA 5TMPA 1SVWA 1KKLA 4D4MA 3PUZA 4M2LA 2ZROA 4KXFB 1II0A 1WCV1 3MGCA 2PX0A 3TAUA 1T4GA 3IBGA 3H1TA 1A5TA 4OL0A 2IYLD 5EP1A 4C2TA 2IXEA 5EZ6B 3PR1A 4RJLA 5EE3A 3U60B 4A92A 2ZANA 4O0MA 3I72A 2BIFA 1U81A 4MUBA 1G1MA 2YOGA 4L15A 4MRPA 1AQUA 4TMTA 3TW4A 1Z08A 1GSIA 4RZUA 3TAHA 1BH2A 3LY5A 2AL7A 1Q1EA 3IIMA 4HDCA 4B3DA 4GZMA 3KZ1E 2F1IA 4JLNA 4ZIRA 2HDNB 4A0RA 1XEWX 3F8TA 1SXJE 1DEKA 2FZLA 2QTVB 3R20A 4P3YA 5M04A 4NDZA 1VKJA 4JBXA 3WY9A 1UKYA 1N6KA 5FTMA 4RD6A 1E2NA 2PMKA 2R6CA 1J90A 1IN6A 1F2UB 4PQRA 4DDWA 4US2R 4L8GA 5FBRB 2R6AA 3QSYA 1YZKA 3PEVA 2J7PA 5HCIA 1W49A 3WYFA 4XWAA 4W5HA 3AM1A 4D0GA 1UF9A 2XOKA 3ADBA 3FFBA 2WWGA 1E1RD 1BYIA 5AUOB 4Q03A 4P33A 1KK1A 4C0QC 1GRNA 2ZI4A 4U5XA 4C0AC 2OBNA 1Z28A 1KDOA 1TADA 3DM5A 2GEUA 1M74A 1E2EA 4PXAA 4DCVA 5TB5A 4PANA 3MWJA 5FTJA 4A36A 2AD5A 3KTAA 5DYIA 3UKDA 4MRVA 2ZJYA 1I4LD 1A82A 1XDBA 3HR7A 1YZNA 4CZ2A 2KJQA 2RGXA 4A1FA 1N6OA 1WXQA 1JPNA 3AVPA 1YZLA 2IHYA 3RRYA 1OHHA 4ZKEA 4AKEA 2PL3A 5CM8B 4AI6A 2YOFA 4N1AA 3T15A 3B1WA 4B6EA 4DXAA 1UM8A 1MR3F 1XEXB 1SVLA 2ZQ5A 4TMKA 4BZPA 3R9XA 4A4DA 1XD2B 2IUUA 4QOSA 1S3SA 1E2KA 3ZVRA 3B13B 4JLBA 2HLDD 2HV8A 3MMPA 2FMXA 1XD8A 4NYIQ 1GDDA 2CE2X 3NBZC 3NKVA 2C96A 5G3YA 3SJAA 4A9AA 1QBKC 1N5IA 3NDPA 1XU4A 4FMBB 1WB9A 1OH7A 2XXAA 1E6CA 4S2EA 1AIPA 3LAWA 3THYA 4YONB 1BYUA 1XZPA 1NLFA 4PAQA 3TNFA 1AK2A 1T3HA 1U0JA 4LYFA 2ZSEA 2V6IA 1WP9A 2OLJA 3SC3A 2PCJA 5H68A 1LF0A 4WAUA 5E4FA 1FMLA 1UKZA 3PIRA 4TMWA 1ZIOA 4KV9A 3WP0A 2WM9B 1DBSA 3QENA 5JLJA 1G7CA 2XX3A 3RAPR 3M6AA 2NTYC 4QBGB 2GVZC 2IS4A 5TVKA 1ZAKA 3EZFA 2GJSA 1AS2A 2OV2A 4JS0A 4LK2A 5L3VA 2ZRHA 1E9RA 3KJGA 1Q1QA 4GOXA 1HQCA 1QVAA 1FPMA 1Q3TA 3OF5A 1OYWA 2IEZA 1N0VC 4DLZA 4QGGA 2B8TA 5GVSA 4QGAA 2DWPA 5ELXA 1NP6A 1XPOA 1Z47A 1WA5A 4BEJA 1HURA 2XXAB 4IFBA 4JJKA 2D4HA 1XXHB 1YVDA 3SBEA 1SHZA 5L3QA 1E0JA 2PZEA 1E9DA 3GLIA 3ZH9B 4C0BA 1G17A 1NN3A 1G19A 1YR8A 4CRWB 3SYKA 5G40A 5FBVB 4NP6A 2RGGA 3HJNA 3VKWA 3SR0A 4A82A 3GJ8A 1E4YA 2FJUA 2Q9AA 2QMEA 3LBNA 1JQLB 4LCBA 5JEEA 4O2LA 1F2TB 4LJ5A 3DKPA 3CZPA 3OAAD 1KZ7B 2ZR7A 4TLEA 3TUIC 2XB4A 3PUYA 5LBIA 5J4LA 4KFSA 3CKLA 2ZE6A 4LV6A 2ZE5A 5F98A 1E0KA 1NF3A 4I1OA 1R0WA 2ZPTX 4E5UA 4EJSA 1OV4A 4EPTA 2D7DA 4KYIB 2ZYVX 1OFIA 4QJ5A 1P2UA 4D0LB 2GZDA 2I3BA 1W4AA 3CWZA 2O8EA 1CF4A 4ZCLA 5FBLB 4B48A 2VL7A 4YXWD 4S35A 1OW3B 1Z07A 2IBMA 1BS1A 1AZTA 1KJYA 1R8SA 2WMNB 3QKSB 4AD8A
chains in the Genus database with same CATH superfamily
4C3ZA 4P4LA 2DPMA 2FWIA 4QYMA 4PNZA 4GQIA 1MRZA 4M1MA 1VYTA 3ELBA 4UQPA 3KT8A 4EY3A 2FK7A 2RGUA 2VDVE 4DC0A 3BWYA 7REQA 3QJGA 5FOWA 4JP2A 2VTEA 1Q15A 5JJKA 5DHUA 2FR8C 1YB2A 3NW9A 1XL1A 4DM3A 1A4RA 3F2IA 3IT2A 4DREA 1PGNA 3RQIA 3QBEA 3OY2A 4ZDIA 3R4CA 5L45A 1E2FA 1TJ5A 2NN3C 5A0VA 1ZM2A 3LNTA 3HCBA 4HEA6 2BMFA 2FEWB 2HCTA 4OXRA 4E88A 4X92A 1KZ9A 1Y7LA 4YPOA 3FBGA 1XZNA 2DJIA 3MJFA 4UVEA 3R40A 2H51A 4RTLA 5LOVA 2OLEA 5C7IO 4ER3A 1JDJA 2CZQA 3H5TA 4OREX 1W34A 1G5RA 2JFVA 2WB4A 4L6CA 2O0JA 2Y67A 4HQKA 1P61B 1QHFA 3DQQA 4NH0A 4G81A 3O3CA 3UCXA 5IVIA 1T6ZA 3S8YA 2BUCA 3FPBA 4GI2A 2H1WA 4YJKA 4NY1A 1T5LA 2GPTA 5CFNA 3B6MA 3VOSA 2O59A 2O8DA 3GJZA 1PT5A 3WNCA 4YCJA 1FYVA 3ENVA 3G2NA 3GHHA 4U2FA 4Z3DA 2IV7A 3W4KA 4QVIA 4JELA 4DEXA 1HV8A 4IX9A 1KA9H 3MD0A 1M1UA 1ZLXA 2PLFA 5LXTA 1TVCA 1B1CA 2B9EA 1C8VB 1NOJA 2ZRNA 3IQEA 3N8GA 3U7FB 4QPJC 4OHPA 1AURA 4Q7EA 1EWTA 3HFJA 1FU4A 4LC1A 4UZSA 5LWQA 2ZUSA 3CX3A 3O4FA 4HDSA 2G6TA 4FBMA 4LF4B 2P40A 3PX2A 3RS5A 2DWCA 1NNUA 1HM5A 1MRNA 4ZAVA 3TD2A 3KAPA 2VDNB 3NANA 2WU1A 2AKEA 3TDMA 2Q2NA 1UBTS 2R44A 4N8EA 5KVQA 3ROQA 3GPLA 3THXB 1GL6A 2IIPA 2I03A 3CURA 3LHKA 3ROEA 2UVDA 4HZUA 6Q21A 4NCAA 5CX1B 2F8SA 5DV9A 2EG9A 2PD4A 2JFPA 2VQ6A 2D1TA 1U0GA 2G0NA 3DYVA 3U1BA 5SZJA 1DWOA 5KVCA 4OXXA 2HCJB 3RSGA 4CU2A 4P6VF 1M2GA 2RHHA 3E1KA 4DCJA 1E2DA 3HKCB 2Q41A 4PAMA 3SZRA 3EXFA 3A6JA 4OG2A 1XCPA 4PLGA 2EZ9A 2ZBDA 3CYFA 3ZV3A 3COSA 1XZAA 1NUQA 4LNAA 2PJUA 3ERCA 1ZH8A 3C3CA 3CGWA 1WHSB 2Q46A 5JXHA 2W2TA 4C2UA 1K4KA 2QAGC 2VDOB 1RRGA 2TMYA 4FR5A 3QEKA 1E69A 2FPGB 1B7GO 4M1YA 4NAVA 4EG7A 1Q74A 4O1MA 2XQVA 4B2LA 4F9EA 5JSHA 4PIMA 3E84A 2A2ZA 2SBTA 2IYNA 3FRHA 3AFHA 3HKEB 3EYWA 2P8JA 3NBYC 4RCVA 4EARA 2E89A 2WU8A 2E4WA 1XC7A 2EV9A 3D6AA 4KBYA 2AHOA 4AUMA 1WCIA 4C89A 5I9LA 2C2KA 3KXLA 4DDKA 1VPEA 4AY2A 1S6YA 1T2AA 1UAYA 2HO5A 1V5FA 3HL0A 4WXPA 3UAVA 3V7UA 3TLGA 2O8BA 3BERA 5ESDA 2ZUTA 1W5BA 3IVGA 5AOBA 3TPFA 4XEHA 2PBZA 1XRRA 5IDVA 1H4SA 4WY8A 4KJZA 1B3RA 4KDRA 4EG8A 5HIMA 1NVGA 4TTRA 2JIDA 4NU8X 1ZPDA 2GTHA 3KJZA 3HGMA 5HKKA 2RH4A 3A2LA 2B8EA 4I1VA 4J7UA 1B1AA 2PX3A 3DT6A 4EDFA 3TLBA 2Y6VA 2O8FA 5BOSA 2HADA 1Z22A 3ZX5A 2WAAA 4BLUA 1EZZA 1GTVA 4MX8A 4X00A 4E5YA 3PFBA 3PFKA 1KYQA 3UXEA 3CEJA 3QXHA 4D80A 1HNWB 1IK4A 1P4SA 4YRTA 4C4ZA 1DWPA 3L8EA 4OAQA 4XQ9A 1IVYA 1P4RA 4FKBA 2WSYB 1OTHA 1YCHA 3GPIA 221PA 1YBAA 2PMCA 4RNDB 2ZJ1A 5AVKA 4WBNB 3U4QA 3BWVA 3GXBA 5TS3A 1KEWA 3SC4A 3NJRA 3BX1A 3W3AD 2WYVA 3CLRC 3AHGA 3OCVA 4P7JA 3ZDCA 2Z8ZA 1CIVA 2BFWA 2J9XB 4B4DA 5ULLA 5G41A 4KPEC 4J1TC 4DIEA 2XJ9A 3GLGB 1YGPA 3GP8A 3LCVB 4UHDA 3MCTA 2GO1A 3ITDA 4ZV9A 3KHUA 3NCTA 4HG2A 3GMSA 2QHXA 2XVMA 5DZSA 4AMYA 2QT0A 3LY9A 2UUBB 2P9QA 2ZZKA 5EJAA 5A9SB 4C7OA 3PEEA 4GKBA 5K01A 1WZNA 2YW2A 1BVHA 2RGEA 3CRVA 1AO0A 3UT0A 1QHHB 2W5UA 1X7YA 3ZIDA 1YS7A 2VXYA 2A1TS 3LXRA 1M1XB 4MHOA 4XJXA 3FOEC 1CVRA 5FBKA 2JJMA 3RWMB 2RIPA 2VT2A 4D4JA 2DLNA 3AB7A 5K4AA 3R9KA 3DWGA 1R37A 4F92B 2BF7A 5AM4A 2GM3A 2BSAA 2BGLA 2FN9A 3M33A 1N9KA 5DMHA 2E3JA 1T8SA 4G0PA 1QB7A 2IU0A 1ZSVA 5EWLB 4AXBA 3I92A 3FW1A 4MQ4A 1P1KA 1WD7A 5CVJA 3HRIA 4XIGS 2CDRA 2WG0A 4BX8A 2RGWA 4R6WA 3T3MB 1RD4A 4RHTA 4ECAA 5LN1A 3VHXA 2QENA 4B4VA 4F4IA 1MZPA 2R62A 5JD5A 4P98A 3DHNA 4CM9A 3G1WA 4BKMA 1W4BA 1Z56C 2FJ0A 2NXNA 4QNRA 5CLJA 1UXGA 2QTGA 1CB0A 4MI3A 1O08A 5LB4A 1PQ4A 1VKNA 2A9JA 3KX2A 3MJDA 3TPZA 1CDEA 2RCNA 5M34A 4NBRA 5AJVB 5SZHB 1C3LA 2VHWA 4LMBA 3VH1A 4D2IA 5MFPA 3O7WA 4CLOA 1PGJA 2CT8A 3RQSA 4K81B 2P62A 5BNFA 5JFTA 1LI7A 3COYA 4X6YA 1X9IA 2X41A 2I3ZA 4MRSA 4XGKA 5JD6A 2Q99A 2PBLA 4OAPA 1DX6A 3NBQA 1N25A 2EATA 1JDZA 3DBHB 1MIOB 4LRYA 3DGEC 1PJLA 1UDXA 2X2FA 2R97A 2XNJA 2R00C 3ZNPA 1TYAE 1QLHA 2IU6A 5HIIA 3MQ2A 4A2WA 5JQWA 4MPJA 1N2HA 3J81A 1ISPA 1R0YA 1RAFA 1XLUA 2PUJA 1AUXA 3BTVA 3DXFA 2RGNA 4UCFA 5A5DA 4KWIA 4ETWA 3GBVA 4ZJPA 1L5HB 4UEOA 1CZLA 1KAHA 4L3OA 3N2NA 3PXEA 1IQPA 4GP6A 1M3SA 4V0ME 2JLQA 4OQZA 2ZB4A 3U3JA 5DWDA 3C41J 3UMRA 1OZGA 1PSZA 4LMPA 4PC7A 3VH2A 1MX1A 2FUKA 3NRJA 3PRYA 1QMGA 4QO7A 2G25A 4XLZA 4EMBA 2FRDA 4EUFA 2AX4A 1X19A 4LOHA 4ASUA 4CKXA 4E46A 3DZFA 2AG1A 4NBWA 1UWLA 3DAHA 1H69A 5H82A 1J2RA 1U04A 4HGQA 2GESA 4QRHA 4WMLA 3GLFB 2NYAA 2XSZD 3B1ZA 4HLUA 4UXHA 1OLUA 1VECA 1VG0B 1ZN8A 3F46A 3P0JA 4HSEA 2NO5A 1FUIA 4Q37A 5TGDA 4CQLA 1C9EA 2ZIVB 1YB6A 3I2IA 4YUYA 1U0BB 1NFFA 5ELMA 4WCFB 1JIQA 4GM0A 3GQVA 1PD0A 1LEHA 2GYWA 3GRRA 1ZH0A 4XIJA 3CPSA 4BFCA 2UZ3A 2H9IA 4G09A 4LBZA 2PFSA 4Q4AB 2PMFA 3RIGA 1Y8RB 3UJHA 3OZWA 3DL2A 4YVFA 2WUDA 5ALVA 2AOTB 2IITA 1PK7A 2JFNA 4GDMA 1KP2A 4UM5A 1L5KA 5B58C 4XB6B 1NRWA 2AVNA 1JQEA 1NQ5A 3HV2A 5KREA 4HMOA 4C22A 2PTGA 4HAYA 4BB9A 2XXJA 5DN6A 1XTQA 4URYR 1M8KA 3VVMA 3OTQA 2R00A 2OGSA 4EABA 3C3EA 1WHTB 3QFFA 1HKUA 2HSGA 2B8NA 4PF1A 4Q9JA 3OKPA 1E63A 3JYNA 3UA3A 2C9BA 2I33A 3BMNB 4MKFA 5F21A 3LHDA 2NUPA 4P4TA 4BX9A 4KK4A 3RABA 3H1PA 4H1TA 3WIDA 1FNSA 3ZWDA 4UVHA 3O0DA 2XUQA 2J5RA 2RSLA 2AFIB 5A6SB 1ZM7A 4BP3A 5ALRA 1QGOA 3OPYI 4D3FA 4YCMA 2FR1A 1T6BY 3GJ3A 3GWZA 1O94D 1IUKA 2P27A 4I1UA 2GXUA 3U0VA 2DECA 5GMOA 2VJBA 3G5AA 3K16A 1YQEA 4BBJA 2WQ7A 4DLUA 2I4NA 1SB9A 1L4GA 1NRJB 4K9KA 4IIYA 4LYJA 5I7EA 3A3PA 1H2AS 3H16A 3RJ5A 4ZGWA 1DMSA 2VDMB 3BE5A 3V2GA 4D9KA 2Q0SA 2VPQA 2F17A 2PZ8A 2IRWA 3QG1A 1T2NA 4NFLA 2Z2IA 3MZ0A 1Z35A 1GZ4A 1UAGA 1U1DA 1W25A 3D1VA 1KFKB 1NKVA 4DGQA 2O9JA 3FN4A 3U4HA 1IXRC 2DC1A 1E3DA 2P3LA 4JVMA 3W5UA 2ZUDA 1L5SA 2JGIA 3QFSA 4M87A 5ENDA 3X3HA 4BKQA 4DGSA 4ZOEA 1QP0A 3OZ7A 4A8HA 4MGZR 1A2QA 1I2MA 5EMHA 2XH8A 5DTJA 1V9CA 3IO5A 1KFBB 3T1OA 3VQTA 2OWEA 4OMDA 3G5TA 3M6VA 3QWHA 2QTLA 1H94A 2GZ2A 3BDAA 3CMMA 4HK4A 4J1QA 5CPBA 3IEMA 5FUXA 1E2GA 2X0DA 1QQAA 2JD0A 4XD7D 1R6AA 1RM3A 4S1NA 5BYBA 4AM8A 5KNDA 1OBHA 4WZAA 1ZRHA 3ZH2A 4EJFA 3SYLA 3FWYA 3G2QA 1G6OA 3JQGB 1DG3A 2NAPA 1X7XA 4JOQA 3M34A 4XIIA 2Z1DA 4NCHA 3PNYA 4JFAA 1IWPB 4PPNA 3VXKA 3FCXA 3ZQJA 4WEQA 1L5LA 4XSHA 4DUYB 4KNWA 4D1YA 4GKVA 1KU6A 4YJFA 1D07A 4LDAA 1D7OA 4YP7A 2E85A 1VJCA 4K05A 1CKEA 2FPRA 3A28A 3CRQA 4FCCA 4ABYA 2CCKA 4KUGA 3W8NA 2G1PA 4F7DA 1RWQA 4LMAA 1I7QB 1I1OA 4E5NA 1JHUA 2RARA 3KZXA 4FKZA 5BW5A 2WJAA 2VJQA 1Z5UA 4FWBA 4F3KA 3L0CA 1AN0A 3ESCA 3PVCA 3ZHOA 1GU1A 1FFYA 3WGMA 1E0AA 4J3JA 3SPXA 4CCYA 2Q9BA 4EPRA 3UG6A 4GECA 4MVJI 4GP9A 1GQ2A 5KWSA 3HBMA 1NTRA 1G6Q1 4XTCS 2FGJA 5IJ0B 2VRWA 3D43A 1E2HA 4AZTA 1M0EA 4LPKA 4R51A 1V8DA 1ZITA 2AMYA 4DQXA 1KPIA 2ZBGA 2V98A 3W6PA 4B6QA 3F71A 3D0KA 4RX1A 4EJ2A 4EF6A 3DLCA 4B8WA 3Q8MA 3EZXA 4IIHA 5GJVC 1WSDA 2IYQA 1XRPA 2JLWA 4HMQA 1Y1SA 5KNBD 3QVGA 4JASB 2B1GA 2WPDD 2WWXA 4JR0A 3MFQA 2CUKA 4JVNA 1GZ7A 3UMVA 3Q2KA 4S0XA 3RC3A 4PONA 2V6GA 1ISRA 1F2VA 3EEYA 2E4UA 4DR7B 3N53A 4J3FA 2C92A 1RE0A 1IE3A 4GD3Q 3OLQA 1D8TA 3FYUA 4DIKA 1WXDA 2Z8XA 4YNBA 3INNA 3RS3A 4XDYA 5EHQA 1KF0A 2PZGA 5EIBC 4E4TA 2A1IA 2K87A 1T0IA 2JGNA 3MWEA 3OCCA 4OIMA 3DXYA 4M6WA 3PQ3A 5EXPA 3RFTA 4Q1DA 3VRHA 5K8IA 4TSFD 4CLRB 2G9RA 3MLAA 3GLTA 4HQ0A 2GEKA 3EDCA 4K8OA 1MVNA 1KY2A 2HRBA 3WGJA 4CYMA 3H2IA 5FI1B 5LJIA 3R6DA 1Z4OA 2KPOA 4GR5A 3ZTTA 3KKQA 1X74A 2BKUA 2XMSA 3N8DA 3CNBA 4L5BA 4MROA 3UANA 3EXEB 4H0CA 1V96A 1U0SY 4P0QB 3V8PA 1EP2B 5EYPB 1H2WA 4BO9A 3R0VA 3JVVA 4GMHA 5M7EA 1M54A 3TUZC 4ME6A 1G0OA 3OFVA 3DR3A 4FIZA 2OB2A 1CC1S 1UWVA 4Q12A 4WN9A 3UH0A 4UQLA 2EYUA 5JCXA 2F1OA 1NJ8A 1G18A 1BJTA 2WV9A 1QPGA 3A04A 4FILA 3IKLA 4UUBA 4HWPA 1A8IA 2ZYTX 2RH5A 2JS7A 3C3DA 1UANA 2ZRJA 4WSOA 1O9BA 2G36A 3O4JA 3PJRA 4BWYA 1ZICA 4KE6A 3G13A 3EARA 4M1OA 2GBCA 2OESA 4QQKA 2JZCA 4ZARA 1HEIA 1PZGA 5IK2A 3ECAA 5LNK1 1Z37A 1YFJA 1I2ZA 3D2BA 1FXSA 3DV9A 2C4WA 3GT0A 3DMTA 3HA3A 3PA6A 5ESWA 2OFFA 3TRHA 1QX3A 4BZWA 3L5OA 2G09A 1T4MA 2I1VB 2YINC 3PDCA 4KOAA 4O0LA 4WLUA 3OIDA 3HN6A 5LDHA 3G2IA 3K9NA 4DUGA 4Y1RB 4MUFA 5MGBA 1YAJA 4GLLA 3BIOA 1TZKA 1QAQA 3IRUA 3L8GA 3S8MA 3NDBB 5FOXA 5KJFA 1XZGA 2OBMA 3B5IA 4WN3A 2FZGA 4UNSA 3PFNA 4B7AA 2C3YA 4A7PA 2B94A 2Y76A 4PRKA 4TXNA 1R74A 2FTKE 2FP4B 3LW8A 2GAIA 3KSAC 1E9SA 2R1TA 1OIVA 2ZB3A 3SBOA 1ML4A 4JI1B 2P6UA 4Q7MB 1LPSA 2ZTMA 1R50A 3Q4GA 2YXEA 1TRHA 2Z08A 3AY6A 3I9V1 1DMRA 1GR0A 2V45A 3QNMA 4R1LA 5DLDA 3JQDA 3HR8A 3QFRA 4RK4A 3F78A 3Q0IA 4M1TA 5BYJA 1ST3A 3S2IA 3ELYA 1PQPA 4PYJA 4X1OA 3HZHA 2XA1A 1M1ZA 4DW8A 3IT3A 5K0GA 4QXAA 2OVFA 3H5LA 2Z1NA 4NF2A 4R2JA 4YDSA 3GCGA 4YRFA 3R7WA 4AKIA 1SWWA 5FNVF 2OM6A 3PIDA 4X71A 4Z86A 3ZEIA 3ZIAD 1T1GA 3F67A 4B31A 3CLTD 5EQTA 1PHRA 2Z3WA 2PLNA 3AEUA 2VR1A 3G2KA 1RI2A 1Y1RA 4L8LA 4R8SA 4AMZA 4JA2A 2XMRA 3ZYZA 3QKWA 4B9EA 2FYTA 4Q3DA 3U9SA 1CY8A 5F51A 4G5FA 2BE7A 1KVTA 1VLMA 1JPUA 2PT6A 3WSTA 1A50B 2J87A 3E2PA 3FDJA 4I3FA 1KJNA 1M2JA 3I2FA 3MWKA 5EHGA 5GIPE 2PKCA 3DTTA 4HYYA 5CVCA 1E6EA 1SPBS 3K72B 1DO2A 3VNRA 1ZCAA 1L4MA 1U3GA 1YVUA 2JH8A 3I1JA 3ME5A 4R8LA 3GAMA 3C5VA 4HDQB 5KU7A 1X1SA 1CEEA 4F93B 3V9AA 2QRLA 1XP5A 1FSFA 4PG6A 3JZIA 2H1OA 5BWLA 1RWXA 3IOYA 5DWVA 4YY3B 1Q1ZA 4F5WA 5FA6A 2J41A 2JEOA 3G0IA 3P9XA 2CXSA 3ER6A 4FOSA 3SU8A 3FMVA 4A6EA 3U49A 5AW6A 3U4DA 1JP7A 4LTNA 4CEIA 5AYVA 2Q0QA 3R7FA 4NRDA 3AK4A 3T0FA 2OOSA 4JYZA 1D09A 3QPUA 4GOJA 1D1SA 2NV6A 5DXFA 3EXFB 2MT9A 1EPUA 4HSGA 1ZC3A 2RHBA 1T8UA 2WWHA 4YMIA 5F5XA 4GZLA 1NW4A 4JSTA 4YRGA 1YRQA 1UM9B 2Q0XA 3K70C 3Q2IA 2HV9A 1S3FA 3KT6A 5AKXA 4B4UA 4EKYA 1JMKC 5K8UA 3SXUB 4Y1EA 5TC4A 3TVTA 2GILA 5BSTA 7ABPA 2DBQA 3EGVA 1CFZA 3BSFA 4ATNA 4Z6KA 1L8AA 3F8SA 4ZOLF 4B6GA 2ZDHA 2BFAA 3QTLA 1POXA 3D7KA 3K5PA 3KAJA 2IODA 4RANA 2EFYA 3MUFA 4B34A 4E2XA 4IVRA 1TQ4A 4DPLA 1YRAA 4YUZA 5J1SB 1P31A 2UDPA 4FCWA 1CWUA 5FFNA 2IOHA 3O8NA 1JEEA 1YVEI 1ZUD1 2NO9A 1P5JA 2VPTA 2F9MA 3HP4A 2QUIA 1GRCA 1K6IA 2OV6A 2ZETA 3FA2A 3CH6A 5CB4B 4X6UA 1XEFA 2GPBA 4R6XA 4X1IB 3WGUA 3JQ9A 3A1NA 2RJOA 3IHKA 1JA1A 5IKOA 5SICE 4ER7A 5KOJB 4FQ8A 1A0OA 1WCYA 3VZRA 3A3KA 3D81A 3O3OB 5LKRA 4MR7B 1GG9A 3O6VA 5K1ZA 4GX5A 1N92A 3LTEA 4W6ZA 4XPZA 4NCJA 5ALKA 3PEYA 1OY1A 4LZNA 3UJ9A 1HYHA 1N1EA 1OYYA 2NVUA 3KR2A 4BKOA 2SICE 4QULA 5KWJA 1A04A 4ZO8A 2VUIB 2VKTA 4LJ4A 5EMLA 3QU9A 5IAJA 3INRA 5GJWC 5LQAA 3L8MA 2OA0A 4C3OB 1G60A 4NYMQ 4TX1A 1K7YA 2QVBA 2BLLA 3ZDFA 1NF2A 4NQZA 5EWMB 4RKQA 4UHHA 5EIAA 2QROA 4PCLA 1V4NA 4Z1MD 2FPUA 3HB9A 2X22A 2QTAA 5B6IA 5TMBA 5HQ3B 1G9XA 3A58B 3K5HA 1P39A 3MMSA 1Z5OA 1VKHA 3MUOA 2Z8YA 2DFVA 4UAGA 3ZWWA 1YZYA 1M2NA 4XD7A 4PFSA 1X15A 1Z36A 4R1OA 1K97A 4WUTA 5AKKA 5HE9A 4BUJA 4V0KA 4DR6B 1NOKA 1HGXA 1I6KA 5JZBA 2C9OA 4PNEA 5JO0A 1VCHA 3CKKA 2O8FB 3L02A 2I99A 4M8KA 3VDRA 5H02A 4QAQA 2GO7A 1USUA 1WL8A 5TT0A 1E2UA 5FUQA 4JX9A 1YRWA 1F8GA 1NASA 4ZJZA 2FPPB 1P74A 5BMVA 4GRDA 4D8UA 2OORA 1IUPA 5C3MA 2FRVA 1J7JA 2GMWA 2NU7B 3MS7A 4HQRA 1RE1A 3M6XA 1IVSA 4M8SA 4B5KA 5D6OA 4I9UA 2FSUA 3HJHA 2PPLA 4C2BA 4OP2A 3KKKA 3F9CA 1FTNA 4OI2A 5B5SA 5HR5A 1NWHA 2HQSA 4EG3A 2VATA 1KORA 1SCNE 3N5CA 4N7MA 2XCQA 1JAXA 1VP3A 4G63A 2ZJOA 1WEKA 1HF3A 3HNPA 3I1IA 3OT1A 3W8RA 1H2RS 1Z4IA 2AFHE 4CF3A 5JCJA 4PPQA 1NQAO 5TNXA 2C57A 2AN3A 1DX9A 1PUIA 2ZIXB 1R8QA 3K0EA 4A8JB 5K6RA 1ACLA 2C1XA 3BAZA 3EMVA 3F5MA 3JQFA 4XVCA 1MH1A 2EYQA 3BMNA 4YMTA 4D4LA 1GPH1 1Y8QA 2FNAA 2JCSA 4B2PA 5H9VA 4Q0MA 4JI8B 2P75A 3NHUA 1YR1A 4HDOB 3M6IA 3DE2X 1JE0A 2XODA 2VPWA 1RZ3A 4F5DA 2AKAB 1LLFA 2V96A 4JC5A 2QN8A 3ZTWA 4YROA 5DK4A 3SICE 1OILA 1Z2CA 4FU0A 1L7QA 3GC6A 1HTBA 4BNDB 1G9SA 1NMQA 4F45A 4CKZA 4TKVA 4WLEA 1OXBB 1AUPA 1M7HA 1GCAA 1M8JA 2WE8A 3FPEA 3L46A 4G24A 2VHTA 1O6CA 3N9IA 4XPIA 2EW1A 1GQOA 2GYUA 5EIFA 1OT5A 2NT3A 1I3OA 2PSFA 4Q9KA 3REQB 3MB8A 5IF9A 4EX7A 1VG1A 1Z5WA 2F3SA 2XZLA 2CN1A 4OFXA 4DCGA 3ONNA 4PGMA 2HJGA 1IN8A 2C61A 3T4PA 3HXOA 1FNDA 3EGIA 3O31A 3N59A 3NPAA 3HUTA 4KL8S 4LHVA 5AI0A 1N5RA 1Z63A 1HBJA 1X7HA 3KL4A 1BX0A 2HB6A 2V3WA 2YMQA 3GK3A 3QYFA 4K7JA 4N03A 3FD8A 4E07A 5C51B 1Y48E 1SRQA 1SIUA 1Z7GA 1ZLYA 1DKLA 1L5QA 3IHLA 1GNRA 4L7VA 4XARA 4BNWA 2OZLB 3PDJA 1RJ9B 1I0ZA 1A27A 3VPAA 5JH7A 3T5BA 1XMJA 4TV8B 1YCFA 4M89A 3TZLA 1N8KA 3EG9A 4DLWA 4YRKA 2BHNA 2PUBA 1ZA2A 3NHSA 4N5MA 3Q2OA 2OQIA 3PNPA 1X2BA 3WQSB 2VHQA 4A91A 4XVQA 3JATA 5ILOA 4BFZA 4NOKA 4YCNA 1UBFA 4DQLA 3FOBA 3HPQA 1GZ6A 4BN5A 1JX6A 1CVLA 3BTOA 4X1YA 2R60A 5K7SA 1QP7A 3VR6A 1Y5IA 4DJ5X 4G1MB 3Q0EA 1SXJA 3R7DA 3ZD8A 4ZCTA 2GXAA 3E2IA 1JDVA 3LL7A 2AOUA 2AN5A 4FC6A 1DBQA 4CG1A 2UYHA 1OBOA 4MDYA 1F7VA 4CIDA 3G8YA 5LVAA 4CMIB 1Y6GA 3WJAA 5A4KA 5BWMA 1EVJA 2EKZA 2IOFA 1NJFA 3GZNB 1Z6AA 5JY6A 1XYGA 2YDXA 3BHMA 1AKYA 3NPMA 4LE0A 4HLQB 2HOQA 3LKZA 1PZEA 1A97A 1E1KA 2RGCA 4YRBA 5JR3A 2IV2X 3SJZA 5IKMA 3AR8A 1RWVA 2HF2A 4Q15A 5GV8A 3LE8A 2O2YA 4FFBB 1BMFD 2QE7D 2G82A 1XMIA 2ETVA 3C5CA 3UCEA 3FLBA 4UBJA 1FDWA 1WRBA 5B1DA 4XUEA 2QAGB 4F9FA 2AG5A 2Q3BA 3BMCA 3IJEB 2JLAA 1ANKA 2JFOA 3QIAA 4RIGA 4X95A 3Q7QA 1XZKA 4HUQA 4TMXA 4HP8A 1KZ4A 5T6BA 3VR5D 3WRXA 1IBSA 4HDAA 1GKIA 1M7BA 4HGNA 5T4FA 2MHCA 3QV1A 5D3ZA 4PE5B 4KEAA 3V8QA 2DCMA 1A9RA 4NJMA 1JLKA 1SD1A 4FR2A 2I7TA 4MKGA 4V0MA 2F59A 3AHIA 4FN5A 1YA4A 3JWIA 1NVVR 3HO6A 1XTRA 4N8SA 2A5YB 4OH1A 1AA6A 3EWIA 4QUGA 3WGIA 10MHA 2Q2VA 1DBRA 2J0EA 3AEUB 3IQXA 4QU0A 2QYSA 1H6BA 4QHTA 2B1QA 4HPWA 4L5JA 2B4KA 4JU9A 4EW6A 2H8GA 5KWEA 1EJ2A 4D7AA 2P4EA 4LG1A 3GCWA 3ONDA 3GLQA 2GD0A 2QZPA 3PQ2A 4WV3A 2F62A 2QBYB 1Z4PX 2ZRFA 1BHO1 5DBGA 1TJYA 2M6SA 1NSTA 3EIEA 4CEHA 3CRRA 2QRZA 1WXGA 4O2BB 3EXIB 4WACA 4YRMA 5CFZA 2YXNA 4K40A 2DFKB 3PFIA 4NYIR 1Z8NA 3I8XA 5TMEA 2IYZA 2X14A 5DKFA 3GEEA 4P0PB 4HAZA 1GPJA 1KK3A 1U1EA 1YAHA 2G28A 3QUCA 1QHSA 5JNTA 3KXKA 3MTGA 1KH1A 5FWXA 1DC4A 1XSEA 1GVHA 2B20A 2FH5B 2PL5A 3MCZA 1EFRD 2X42A 3HA7A 4RPKA 4CKEA 2RJ3A 3A06A 3DFUA 4FN4A 3QSGA 4RMNA 4MW9A 1V5IA 1OU0A 3I30X 2ZOSA 3HKEA 2JJ1D 1EJBA 2Y68A 3TRKA 2B7CA 1LRJA 4IL5A 4JD5A 1EFTA 5D5PA 1F5NA 4ALIA 4Q19A 1KDYA 4DNXA 1D6MA 3OVMA 3MRVA 1AXEA 1G3IA 4AYWA 4HAXA 2IPNA 2WIDA 4C6SA 5AVXA 1W46A 2IUFA 1PZMA 3DO6A 4QDZA 4BLOA 3ZIUA 4WI1A 2NZXA 1B43A 1H6AA 3AI7A 4LZAA 4RKFA 4CCYB 3OTWA 4RD4A 3EA5A 3R74A 4PY2A 5AHOA 2BPOA 1ETHA 5TPWB 1ISSA 3BQNB 4G65A 1RDFA 2AMJA 4L07A 1ZK2A 1QGYA 4R7ZA 2L17A 5E6RB 1WXWA 4HVLA 3WICA 4FINA 3SYTA 3CVWA 4L8WB 3QE2A 5CAEB 1P3DA 1Q83A 3ETHA 5EGNA 4F4DA 5SV2A 1MRSA 2BY4A 1LPOA 5AESA 4ZOQI 1YE3A 1ZXLA 2J3DA 1VL2A 5B4UA 4JJGA 4ZRNA 3V9PA 4MVJD 2LXNA 3C15C 1U7XA 2NXJA 4KDFA 2C4TA 2ZXFA 2ATCA 3HB7A 1RHUA 2OUKA 1E6UA 3TEMA 3M3HA 4AYTA 3MWYW 4I1PA 2BH9A 4F4CA 4IIJB 4NABA 3CE9A 1J5EB 1L9XA 3CZ5A 1DB3A 1FP4A 1J09A 1C3OA 4M9XA 5G3ZA 3THSA 3LVQE 1G21E 3Q6NA 4KH1A 1OE0A 3AC0A 5DHAA 4CCSA 1BXKA 1KAOA 4Q1BA 2GUGA 3IERA 4JL6A 1YR3A 3OJCA 3AVUA 1LFDB 1T2DA 3RUEA 3LQQA 2NPIA 1TQ6A 2CUNA 5FQOA 3STTA 1HT2E 3I01A 2H4WA 4IM7A 1JJIA 2GCOA 4OSOA 1E8NA 3VPXA 2WTXA 4MPRA 4YR9A 1Y1TA 1OC4A 1YVRA 2EIXA 2JI4A 5DYTA 3EFEA 4XSVA 2JAXA 1ID1A 1V8PA 3BEDA 3JRNA 2CJPA 3NHZA 4IGFA 3RVNA 3AF5A 1K75A 1XA3A 2FN8A 4K3VA 5IBRA 3GOQA 2VF8A 1LI5A 3T41A 4EI9A 4PQEA 3V4PB 4G2NA 4IBOA 3KUCA 3L6CA 3JY6A 2XAUA 1LGYA 3A32A 4Z3OA 3ZE6A 1GL7A 3IPYA 2RB4A 4BLRA 3FYDA 1CQJA 4Q9HA 2AT1A 3ASZA 4LHXA 2YVAA 1KJIA 3KQLA 3LC2O 2ATIA 1GA6A 3OSUA 5E9QA 4LJ8A 1YIAA 2X2OA 1DLIA 1HE8B 2SHKA 4YK7A 3LK7A 3NNSA 3JQCA 4JYMA 4WADA 5CGZA 1IDN1 5HKOA 4LI3X 1P1IA 5ECWA 5IHXA 2FVXA 4B3GA 3N2GA 2VUHB 4TYWA 4MLDA 4BV2A 3UJNA 4RZSA 1W2GA 1K98A 4L28A 1YBFA 3U7RA 3A8TA 2KI5A 3TTTA 5ITSA 3W6ZA 3NDIA 2VO1A 3HVHA 3Q5EA 4R71A 4U7TB 4EFKA 1JYSA 4D9MA 5JVDB 4QG3A 2Q21A 4GXTA 1TIBA 1ZJYA 2OEPA 3WA6A 4D4IA 5FNZA 3VSEA 5FKJA 2H1RA 2VT3A 3HFSA 3I05A 3L0DA 2RAFA 1QIMA 4W5JA 3WOVA 2BRUA 5IAAA 1P8AA 2C7GA 2HJWA 3ABIA 1J7KA 3G2OA 1OJ7A 3H5WA 1TKAA 1QK3A 4JT8A 2PUVA 4AWXA 2QM0A 5LNK6 1Z33A 1JDBC 2NSYA 3MCWA 2H4HA 2QVZX 3NGLA 2I80A 1V25A 4G25A 1C4KA 3D54D 3F6RA 4V2IA 4B3RB 3H8VA 2VYFA 2LKDA 1OD6A 3AJAA 4Q4HA 3BL5A 2W8ZA 5EUQB 2R2GA 2AZXA 4WE3A 3LP6A 1LSOA 3KKNA 4RVHA 1PDOA 3DFIA 3AEZA 5E1OA 1T1SA 2FXVA 5CH3A 2PJZA 1H9BA 2IYWA 2GK3A 1YKGA 1K86A 2CMHA 3IS3A 5COQA 2HA6A 5B1IA 1Z17A 4NONA 1N9GA 3R8CA 4X64B 1U0NA 2BUBA 4C88A 5KJ1A 4NMHA 2QPTA 3W0LB 4ESEA 1PNTA 2PAAA 2XKAA 4NI5A 3Q9LA 5BUQA 1W2WB 5EJ5A 5GY7A 4RF4A 5DYNA 1GCUA 1M2VA 1W36D 2AA3A 4FZJA 1V7ZA 1M0SA 3RVRA 3FKSD 3CCCA 1RMQA 5DHPA 4TM7A 3BCHA 4C3UA 3W1EA 3IULA 4ZYZA 3AL3A 3VGJA 3WLQA 1W0KD 1Q0ZA 3QXGA 2CNWA 4L4XA 1AKRA 3H1AA 5GJCA 3OU2A 1X8LA 4IDDA 1BHJA 1N57A 1PT7A 3DMDA 3IDFA 5CFMA 1PNOA 3V1UA 6ABPA 3TOXA 1R7RA 2OILA 3CBQA 5K3AA 3W7BA 1YO6A 2X19A 1HDCA 2O2JA 4TXJA 2LVBA 3L4JA 2CJWA 2XUGA 3ABOB 1JG4A 1MGPA 1UP4A 2G17A 4I5DA 2RAPA 2J0VA 5F52A 1C9YA 5JAQA 3OKCA 3AOEC 3NALA 4Q02A 4CLXA 4BNXA 2AMLA 4UBNA 1X39A 3OEEA 2YW9A 2V9CA 1D2MA 5HG0A 4MQLA 2H57A 5CB8A 1R8JA 3QGMA 5CR9A 4ZT3A 1TL7C 2XUOA 2FFHA 2HU7A 3FETA 1FFSA 1B76A 3I53A 4B43A 2QZ4A 3N2KB 5G4KA 5BR4A 3K0AA 3DBVO 2X7XA 3H5AA 4OBEA 2JLBA 5AKEA 3TM5A 4RADA 3E27A 1ZMOA 3KQVA 3PPYA 2ACKA 5E2BA 3PKJA 4I36A 1UOEA 1A4UA 2AN1A 2XY4A 3AVQA 3RASA 4GI3A 1BFDA 1S2IA 1UDCA 2PGNA 3ZZ1A 5KTSA 2O5CA 1LC3A 4UNIA 4UFPA 2BEWA 1JIXA 1Y3AA 2QZZA 5FJJA 4JYPA 4IXMA 2BHTA 2LCIA 2D8MA 2I54A 4F6CA 5KOHA 3OZVA 5EXSA 4EI8A 1CXZA 7ADHA 5CB4A 1P6XA 4OJNA 4JJ4A 3KR0A 3NVMB 5A3QA 1J8FA 4O8ZA 4Q7QA 2K4MA 3LWZA 3QVKA 4UEKA 3X1ZA 2OR3A 4C7KA 1KPHA 1XG5A 5FULA 1KWKA 4IZHA 3O38A 1GSOA 4EMUA 3RTCA 2JZNA 5TT1A 5CCXA 1FRZA 2J07A 1QVRA 2EEPA 4U7JA 1A7JA 5HUHA 1MPXA 2D00A 4K88A 4YCSA 3GNLA 1JUDA 3MVEA 4GOMD 5CT4A 1UFQA 3RC7A 1CE8B 1E77A 3LUHA 4RVGA 1NT4A 2I2FA 3BFKA 3IIJA 3M4ZA 4MLCA 3T5GA 1B6SA 1GCGA 2WJIA 1DIHA 3L7NA 3T7TA 4BATA 2NO7A 2PKWA 4D82A 1FMCA 1KR2A 1NOIA 4V24A 2A86A 4Z7OB 3THWB 1D0IA 1D5CA 4G23A 1CRQA 1EUDA 3S55A 1SXJB 4WKOA 3H6HA 2VC2B 5C34B 2CJYA 3U5TA 1BVYF 5EJ4A 1V8ZA 4FMPA 3I28A 1SG0A 1Z26A 2VBFA 3TW6A 2OO5A 2X4IA 4E4YA 1T8PA 1E59A 3UJCA 2FZ4A 1ZD2P 3WB1A 1H4TA 1Y9JA 1A8HA 2V7TA 4BLTA 3G2PA 4ZYVA 3L43A 1P18A 2F43A 4RFLA 2EHJA 2QRPA 3UWSA 4S2UA 1GRQA 2BTQA 4F5EA 4N3AA 5ED0A 3EG9B 4AJ9A 2CXRA 1G16A 1YKSA 2P1DA 3P4XA 3V6LA 1EUCA 2A9OA 3IDAA 4ZHQA 2ZI7A 1DBVO 2DQYA 2R6DA 5BY2A 2CBZA 1BSVA 5DI3B 1U6IA 1XVTA