1YR3A

Escherichia coli purine nucleoside phosphorylase ii, the product of the xapa gene
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
273
structure length
273
Chain Sequence
QFSHNPLFCIDIIKTYKPDFTPRVAFILGSGLGALADQIENAVAISYEKLPGFPVSTVHGHAGELVLGHLQGVPVVCMKGRGHFYEGRGMTIMTDAIRTFKLLGCELLFCTNAAGSLRPEVGAGSLVALKDHINTMPGTPMVGLNDDRFGERFFSLANAYDAEYRALLQKVAKEEGFPLTEGVFVSYPGPNFETAAEIRMMQIIGGDVVGMSVVPEVISARHCDLKVVAVSAITNMAEGLSDVKLSHAQTLAAAELSKQNFINLICGFLRKIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Escherichia coli purine nucleoside phosphorylase II, the product of the xapA gene
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords Xanthosine phosphorylase
total genus 78
structure length 273
sequence length 273
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2005-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1yr3A00
1RXUA 4MARA 2AI3A 4YJKA 3O6VA 1VFNA 3LBAA 4WKOA 1RCTE 4DA8A 1Y1SA 1T8SA 2P4SA 1A9QA 4OJTA 2IQ5A 5K1ZA 5CCEA 1PR2A 1ODLA 1Y1RA 3OZEA 1TGVA 5DK6A 3DF9A 1Z34A 2OC4A 4NSNA 5IFKA 1Y6RA 3OPVA 4DABA 3OOEA 2HN9A 5FAKA 4UC0A 5F7ZA 4GKAA 1PBNA 1YQUA 1PK7A 1ZOSA 3DJFA 1YR3A 1A69A 3INYA 4TYMA 5CYFA 1V41E 1PF7E 3OOHA 5KB3A 4G41A 5B7PA 3KUKA 1SQ6A 1JP7A 3OF3A 2OC9A 1QE5A 1VHWA 4TXJA 1JE1A 4OGLA 3EUEA 4NS1A 1Z5OA 4EB8A 3OCCA 2ON6A 1U1DA 3EUFA 1Z37A 4L6IA 4L0MA 3SCZA 1PR0A 5CYGA 4L5AA 1XE3A 4YO8A 1Z5PA 3FAZA 3EEIA 1ULBA 3UAYA 4GLFA 4JOSA 1JDVA 4FFSA 1Y6QA 3E9ZA 1A9PA 4BMXA 3D1VA 4QAQA 1CG6A 1K9SA 5JPCA 1T8RA 4QFBA 3FWPA 3NM4A 4MCIA 2I4TA 1TCVA 4WKNA 3PNPA 1TGYA 1RR6A 4DAOA 4JP5A 1Z33A 3FOWA 1OVGA 4YNBA 2OECA 2BSXA 5EFOA 3MB8A 4P54A 1U1CA 5F7OA 4TTAA 4DANA 1OU4A 1RT9A 5ETJA 1LVUA 3DP9A 1T8WA 4F3CA 4GLJA 2Q7OE 1B8OA 2QSUA 3KVYA 1PR4A 3UAXA 2QDKA 2HSWA 2PGAA 3P0FA 3FNQA 1ODKA 3E9RA 5F77A 1NC1A 4E1VA 1SD1A 3NBQA 3ONVA 5F76A 1V4NA 3K8OE 5EPUA 1SD2A 5F78A 5F7XA 1A9SA 1PR1A 3GB9A 2HRDA 4L5CA 4TXNA 3MMSA 4D8VA 4M3NA 1Z35A 4U2KA 1ZL2A 1Z38A 3KU4A 2OXFA 1PWYE 1V48A 1TCUA 1V2HE 4I2VA 4DAEA 1RXYA 4TXMA 4D9HA 3ENZA 1PK9A 1PKEA 1U1FA 1JYSA 3DDOA 3QPBA 4QASA 2RJ3A 1WTAA 2A8YA 1JPVA 4DA6A 1V3QE 4TTIA 5B7QA 1LX7A 1Z36A 4NY1A 1RXCA 3BGSA 1VHJA 1ECPA 4LKRA 1YQQA 3GGSA 3EMVA 2A0YA 1ODJA 4BN0A 1A9OA 1YBFA 4WKPA 3NM6B 3KVRA 4OY3A 1RSZA 5C80A 4TTJA 1T8YA 4D8XA 1U1EA 1OUMA 1Y1QA 4LNHA 3F8WA 3FUCA 3OZBA 2QPLA 5B7GA 4R2WA 4X24A 4EARA 4IP0A 2QTGA 4G89A 4F1WA 4M1EA 3E0QA 2AC7A 4TS3A 4DA7A 1Z5NA 4QATA 1V45E 2GUWA 2XRFA 3IEXA 4LDNA 4PNPA 1JE0A 1OTXA 2AI2A 1SJ9A 2A0XA 1ODIA 1M73E 4RJ2A 1JDTA 3BJEA 4WKCA 4L5YA 1A9TA 4QARA 4JWTA 5I3CA 2I8AA 5F7JA 3P0EA 4K6OA 4ECEA 3OZDA 5CXQA 5B7NA 3KHSA 5CXSA 3FB1A 3K8QA 1JDSA 3KVVA 4F3KA 4TXLA 1CB0A 3U40A 3UAZA 4BMYA 4YMLA 5EUBA 3OZCA 1NC3A 4DARA 1RYZA 1N3IA 4WKBA 1B8NA 4LNAA 4F2WA 1YRYE 1NW4A 4TXHA 3LGSA 5IU6A 4OF4A 1K3FA 3TL6A 4G8JA 3UAWA 3PHCA 1Z39A 4QEZA 4F2PA 1JDUA 3UAVA 3UT6A 1JDZA 3BSFA 4H1TA 1PR6A 4DA0A 3NM5A 1U1GA 3ODGA 4PR3A 2HWUA 1OV6A 1Y1TA 1ULAA 1PW7A 3IOMA 4R2XA 2QTTA 4MCHA 4GMHA 1PR5A 2AI1A 5CCDA 1C3XA 1K27A 3BL6A 2B94A 4D8YA 2H8GA 4LZWA 3DPSA 1Q1GA 3T94A 3PHBE 3C74A 2A0WA 1G2OA 4R31A 1RXSA 1OTYA 4M7WA 1FXUA 1VMKA 4TS9A 4KN5A 1I80A 3LA8A 4BMZA 1LV8A 1T0UA 1TD1A 1RFGE 5F73A 1A9RA 3PNSA 4OEHA 3O4VA 4D98A 2ISCA 4OGKA
chains in the Genus database with same CATH superfamily
3E8XA 2XIJA 3F6RA 2TYSB 4TS4A 3K9NA 1K7SN 3SHVA 1SC9A 5IBCA 3FIJA 2ZRNA 3ZHTA 1MENA 5JZBA 1X14A 3DWGA 3FNEA 3QSGA 2QN3A 4TWZA 1JH9A 1TKBA 3OLYA 1N2ZA 4RE6A 1QIHA 1KY4A 2JAUA 1NUQA 1NYTA 4HHEA 3CQ9A 5AVTA 3THSA 3UBTA 1HDYA 5DBFA 3MWEB 4AMZA 1LDEA 1HX7A 5CHYA 4KMOA 2J6CA 2OYCA 1P7PA 4JX8A 5CHEA 4C4XA 2I9KA 1CJCA 1KFEB 1QIEA 2L18A 2XDYA 3NXSA 4OMDA 1GTMA 1UKYA 3F49S 2NXCA 5DFAA 1KEZA 1HL3A 1QH9A 1L6RA 5JVDA 2RMKA 1Z07A 3OH8A 3Q10A 3TTSA 4QVIA 2YZGA 1COWD 3KT0A 3EH1A 1E2NA 4HS9A 3A1CA 1J1UA 1MG0A 1QFXA 2O0KA 2QNRA 3SHQA 1L7RA 1U6JA 1C9EA 1SZDA 1VSQA 3NBAA 3RSGA 4HVAA 4ZOLA 3L0IB 1M34A 3CEMA 4ZOCA 3JYHA 1RLUA 3A32A 4MQUA 3QXSA 5CCXA 2VK4A 3NYRA 4MINA 1BU5A 2KLBA 4PSDA 4DQKA 2RGXA 2COEA 4P36A 4PPGA 4J75A 4C78A 2VT7A 2BELA 4B40A 3MWJA 5PNTA 3G82C 2CJWB 2H1HA 4ALNA 1T4CB 3NHYA 3CV3A 4Y9TA 1DTWB 1CD5A 1COWA 2CJFA 1Y4ZA 4S1VA 4MICA 5CH5A 5E3IA 4AMYA 1DUVG 4C01A 4ND8A 1RDFA 2VP5A 2E4UA 1B8PA 4EHJA 1KY3A 3OJWA 3L3BA 1RI1A 3GELA 4NDAA 2XOEA 1H94A 2YWJA 4RH1A 1Y8ZA 5BXYA 2V7VA 2FWRA 5IMBA 3QRWA 1PL6A 5AW7A 3CN9A 2Q3FA 2ASVA 3FWZA 3L0BA 4NEGA 5IKPA 1RC8A 3KKMA 3K9FC 1E3LA 5T4EA 1FLNA 3CKYA 4KXYA 2WF7A 2HU5A 1NI4A 1C1YA 1KH3A 1SCKA 4LXUA 3UM9A 3A2NA 2I66A 1F5NA 2WVHA 3E5HA 3MA0A 4ZJZA 3HWSA 3I92A 4FMPA 5ENVA 2VCHA 3OE7A 4HCJA 5DOZA 1SKYE 4UPVA 3T8YA 1MGOA 3F74A 1FL9A 5E95A 3KXPA 3PGMA 3ILYA 3NKFA 3OEYA 4PS1A 4TM7A 3W9SA 4LRSB 3I32A 4KJXA 2VWGA 2RIRA 2XYHA 2ZE7A 4MA5A 1V3UA 4HEHA 5CLHA 5CRIA 1JWLA 1R6TA 1O7JA 1ONSA 2ZJ6A 4JITA 3V8MA 1YJBA 3WTCA 2QQGA 1K5HA 4ALIA 1OHHD 3MYYA 1KDZA 5A02A 5FL7A 5LU9A 4UUMA 2Q4BA 1BE1A 1E6KA 1NW8A 4Q3LA 3V42A 1JEYA 3OLZA 3OTIA 3KEMA 3AP2A 4HUQB 2XMZA 2YV3A 2ZULA 1MO2A 3TZBA 1AUQA 5ALXA 3L6DA 4CDMA 4EA8A 3AUKA 1EQ2A 1HQKA 2GASA 4R9VA 1XDGA 1KP9A 1ND6A 2FF7A 4IILA 3VU9A 3Q8KA 3PQ5A 1L4NA 3DS8A 3Q3GE 4ZVPA 1E69A 3DYIA 1I4WA 1Y6QA 3LT0A 2X8WA 1JKMA 1U4SA 3LDUA 4RX1A 4LA4A 4XVRA 5LZ7A 5IXJA 4NOLA 3E9ZA 1AY0A 1E94E 4GI1A 2P9YA 1P17A 1RD4A 1U9YA 4DMUB 3S2YA 1SXJD 3BH6A 3A28A 5KOHA 1IVYA 5JYBA 5EZ6B 2CUZA 3DB1A 3JZDA 4I4NA 2WTNA 4ZJUA 3ZKAA 3HXPA 4ZCSA 1N2HA 4HAOA 1NQVA 3QPWA 3ABZA 1OI7A 1JQ5A 5ITSA 3GZJA 1NI3A 5KEIA 1X80B 1MGPA 1YZQA 3UWPA 5HRUA 3IQWA 4OHUA 3BIFA 1Z33A 2DBYA 3H2ZA 4QRIA 1X1EA 4BASA 1N57A 1MO6A 2WUWE 3UH0A 3UMFA 1HTWA 4L5JA 3VR4H 4I1OA 1ZCFA 1QNFA 3V1LA 1Z4JA 1ZJYA 4JJ8A 4JXKA 5EJEA 1YXMA 1THTA 3IALA 4Y2SA 2XNJA 4MRMA 3RPEA 1KC3A 4YAWA 2WPNA 2VHVA 4R0NA 3BORA 5H68A 3ZWXA 3HCRA 2CVPA 1EEXB 4EUHA 2JCGA 5IDYA 1ORTA 1NWCA 1ZITA 2YHIA 3C85A 4UUBA 4YJGA 5AQEA 5CB8A 3HFJA 1D2GA 1F8FA 3HUFA 4TL7A 5DHAA 5GVSA 1GKLA 2CF6A 1RQRA 1RS0A 1TJNA 4O2BF 5E7IA 1AGYA 5DHFA 1PZFA 3TTXA 5D84A 2PE5A 4HT3B 4CUJA 1N6HA 1H1LA 2VRCD 1C9DB 1N1GA 1YASA 5AK0A 3GJTA 4DLSA 4I50B 2F9FA 1FS4A 2ATEA 2FPGA 2VH1A 3ZIUA 1AZWA 2UKDA 2QPOA 4I5EA 4RZHA 2QDKA 4A6XA 3GOQA 3RASA 3O8QB 3BE5A 4F5WA 3MUNA 3MJRA 1DKLA 1QG6A 1V26A 1XLTC 2LGJA 3STHA 5HBRA 3UATA 4OXQA 5J2TB 2ZBUA 2CHUA 5F77A 5FPPA 1DUSA 2WWTA 3QNUA 4Q3KA 1G19A 1LRKA 1SD1A 1ZOOA 2Q2NA 3OZAA 5FOWA 3RRJA 1NT4A 2GPJA 4NMWA 4PR0A 2OQRA 4GDFA 5EJ5A 2L42A 2PDAA 1GL3A 1KR2A 2VZLA 4Q4HA 1NBMA 1TQ2A 2FUKA 4RFSB 5F1OA 1JBQA 2JFPA 4I1IA 2GF0A 1EFRA 1QVVA 4PLVA 3F3YA 1N6KA 1RLOA 3CLSC 5AK5A 5DSTA 4GWGA 3ND6A 5IAEA 3EE6A 3E1GA 5TRTA 2BOVA 3WWZA 1I1OA 3MWDB 3ZHRA 1JPNA 4BNDA 3H84A 1A9YA 2CJYA 3FCOA 3LVQE 5T6BA 4DC1A 3H5OA 1U8EA 3WB1A 4M9SA 2ERXA 4DIDA 2DOKA 3ZX4A 3FY4A 2X13A 1G8FA 4RF2A 4ZEMA 2VP6A 4PTYA 3A36A 1AV7A 2NU7B 2QB5A 2CZCA 3WYEA 1RFLA 3BRWD 4KACA 1FQWA 2HF7A 3N2GB 3AILA 4XB1A 5LFAA 4KREA 2HEGA 3RSQA 1UODA 1G66A 4H0CA 3JARB 3QPCA 4PU0A 5JEDA 1U63A 2QY6A 4N39A 4UHCA 2HRQA 4YECA 3C5EA 1JMKC 1K6JA 2B37A 2TECE 2XEDA 4Y6SA 1P4HA 2Y4NA 1N9ZA 1XLWA 4U5XA 1U1FA 4QOEA 5JAQA 4F4UA 4YRSA 5LLTA 2VUSA 1QPBA 2HLHA 5TX7A 4IVPA 4FYYA 2XOKA 2BMAA 3R0XA 5DX8A 2F1OA 2WSIA 5JBQA 4FFBB 1I9GA 3JVIA 1UJ5A 1AV6A 3HU2A 1CYEA 4G09A 1WTAA 2J3HA 4U7HA 1GUFA 5KYUB 3C98A 5HKBA 1RAGA 2H1IA 3BXOA 4BJHB 3WLHA 1LC0A 1G6OA 4LEIA 1IOWA 5C3UA 1SUAA 4DR3B 2ROQA 1OI2A 1IMJA 4OYLA 2HHJA 1WVMA 3MWFA 1YJAA 1VCMA 3IAM6 3JWHA 3M5PA 4LZPA 4OU4A 3QK7A 3C15C 3NV7A 2CNWA 1RJDA 2PJDA 4DR2B 3QKSB 1YFLA 2W93A 1AGRA 2R6CA 4COKA 2AFRA 4EG1A 9GPBA 3TLAA 3IH5A 5E6RA 4YUAA 1QFMA 3U7FB 3DE1X 1EZ4A 1PQ4A 4ASUA 5FH9A 5ALNA 3GRYA 2WC1A 1G9TA 2EJTA 2BR4A 4KJZA 5EHGA 4B75A 5HVNA 4CT4B 2W9XA 3DZCA 4A0SA 4LXTA 4EUFA 5CVUA 4A8TA 3WO0A 1JSZA 5KOIA 3I61A 2VDWA 4CM8B 3MMZA 2I2WA 3BWBA 2EFYA 2RK4A 1XU4A 2P68A 1WKBA 2GCGA 2WTEA 4OIFA 2RGNA 1MPXA 1MEEA 1T36A 2Z57A 2ZBFA 1JTEA 2R6ZA 4J9VA 4ZAVA 5TSDA 4B3FX 1HDOA 2J31A 4KYTA 3HV2A 4WY5A 2ZWOA 5JFTA 2FLWA 4IIDA 3QVGB 1T1IA 4IDQA 2WUFA 4Q0MA 4OX9B 1P6XA 1XMSA 2X6RA 4P3KA 1SZPA 4EMSA 2QPLA 2FMUA 2ZXEA 3I9NA 2IY8A 3B3GA 4F86A 3B1JA 5AM5A 1BYIA 1N8KA 4EKYA 5BMVF 3LS2A 1JIVA 3PEFA 1Z13A 1IDOA 2VNKA 3LY8A 3BSWA 4G89A 4ZI2A 3T1HB 2B4AA 2C84A 1WG8A 3UK2A 5IJXA 3VHRA 5JDIA 3OOSA 3EVDA 3RS3A 1T34A 2GH1A 5IVDA 1DG1G 1D9ZA 4FOOA 1ZRHA 3LECA 1DJPA 5IM4F 1XHLA 2XRFA 3H9EO 3IDQA 3R5JA 4LDNA 3RJTA 4E09A 2PUCA 3EG9A 4XUEA 2HIAA 1ONBA 2O19A 1X1QA 1MH1A 5B64A 3L1IA 4DZRA 3UGJA 1QUFA 3CNQS 4DXAA 1E92A 4WD3A 2IUSA 2PQ2A 3AY3A 4WWHA 1CQZA 5B1DA 4PYMA 1MX1A 1QMGA 2FK7A 4Z0TA 4U39A 1SJ9A 5CFLA 5G4KA 5HQ3B 1OGIA 5CBPB 3NORA 3UICA 2X2PA 3OD5A 4D4IA 5A3RA 3AX6A 1SUFA 1IOZA 3GYBA 2RGWA 4MS4A 4UXIA 1FX0A 3DKKA 1SCBA 3BJEA 4MTCA 5DTRA 5ITWA 1F2UA 2IC5A 1KHHA 1GKYA 2YKGA 3ZDAA 2R1VA 2CLFB 2JF0A 4TV8A 4X3CA 5DCWA 4JDUA 1D2NA 2P5SA 4FN4A 1RM0A 4DUGA 2X8BA 4ZQCB 4BO1A 3BZWA 3MWLA 4GBJA 4CN9A 3C3MA 4L78A 4P4SA 5HIKA 2IHNA 3QA3E 3GL9A 3KSBC 1QP4A 2QE7D 3R6GA 1FFSA 2X1VA 4PFJA 1SCUB 3SZMA 4EGAA 2QM3A 1NX9A 3A25A 3PUIA 1TM5E 4O59O 5HS6A 2NU8B 2B69A 3K4QA 2GR9A 3TKAA 4CMHA 4CTJA 1OBVA 2CL7X 3Q0TA 2K6GA 2D5CA 2X15A 2C8KA 1R5BA 1SA0B 5IFLA 4OHYA 4GGMX 1OFIA 3BCUA 1ZK2A 2LNDA 3LXXA 2BGGA 3T4XA 4ALMA 2W8BA 3HQ4O 3JWJA 2VUUA 4C08A 3KKKA 3Q3EA 3LF2A 3TLEA 2PMWB 4BVKA 5DLQC 3EXFA 1H1DA 5E38A 5A4IS 3L4EA 1AM4D 1X92A 3P97A 1PS0A 2Q28A 3L7AA 3RC2A 3EVBA 1NP3A 1QQ5A 2NV6A 4EF4A 1P75A 5C81A 4RV5A 5K45A 4QPPA 3LBIA 4UHEA 1MA0A 3RUEA 4DSOA 3G02A 4LDPA 3UAWA 2JS7A 1Z5ZA 1W5TA 1KO1A 3CISA 4K7JA 5JCZA 9LDTA 3FSEA 3AP1A 1YFKA 1W5BA 3ZZUA 1J39A 5D5QA 4DV1B 3VJRA 1NBHA 1YO6A 3ZVKA 2MR5A 2IEZA 1QSGA 1K68A 1NPTO 1W4AA 4BVFA 5C8YF 1OPRA 1QIJA 2J07A 4BJ6A 3ZVLA 1IU9A 3FTDA 3F5SA 2F1JA 1K7YA 4I4TB 4O2AF 4WPGA 4ZDWA 4F9EA 1T3LA 1E9RA 1TUEA 3JZMA 4DJEC 3GP3A 1EFKA 2ERCA 1E32A 1F1JA 3NM5A 1MOSA 4URWR 1ODTC 1FYFA 4JUFA 4J3NA 3L6RA 1GCUA 1BXZA 1VSUA 4IMJB 4YRMA 5AD1A 9ABPA 1A1VA 3PJRA 1FQKA 2ENWA 3VH2A 4BLSA 1IXKA 1EUYA 3GBPA 4WFJA 3EXEA 2GCNA 1T1RA 4S1WA 4MCHA 5H9WA 1LBQA 4GMHA 1FNSA 2PKCA 2VNIA 2H4ZA 1X9IA 3EQ7A 5ERGB 3T1OA 5ICCA 4JR1A 5LNK6 1K27A 1M2NA 1TUBA 2WJ3A 5FCDA 4GQBA 3TLJA 4NE9A 4E2XA 1EDZA 2B2XA 4B4VA 1F2TB 2HXYA 4KLNA 1CDOA 3F1LA 5CW2A 1P9OA 3STYA 3ZZMA 2WFZA 4YRNA 1N2CB 3ZI7A 2ZBGA 3TAHA 3KKLA 2Z98A 4KAFA 5ERXA 3KZ1E 2NU7A 5JLJA 2P6OA 2UXDB 3BGVA 2R5WA 4IEEA 3I01A 2BLLA 5DHUA 1DSSG 4KN5A 4WAUA 2Z5FA 4EKGA 5A3VA 2QDXA 2Z04A 3V4OA 2X0EA 1WZCA 3I4LA 1SCNE 1U6IA 3QX9A 4ZC1A 1K8XB 1IK4A 2K7ZA 1T6BY 1F8GA 1R12A 2CXNA 3BHNA 3U9LA 4GX0A 1G291 4RHEA 2DLNA 5H9VA 1AMNA 1KDPA 3N58A 4ARBA 2J3IA 3GLIA 1P7ZA 4D98A 1LNZA 2B36A 1XTUA 4OJYA 2DFNA 3HBMA 4N5DA 1PGNA 5KU1A 5C7IO 4BTVA 1RLJA 4GU5A 2VDQB 3QLVC 5AKXA 2H51A 3GGCA 3KHKA 5HF5A 3NRBA 4DEVA 2IYWA 2JVKA 2ZRDA 3ETLA 3LHIA 4GZ5A 1LPNA 2G9NA 4US1R 2A9FA 3RS7A 5AVVA 1VE5A 3F1KA 5KKAA 1SHZA 5ARDA 2VBIA 1UK6A 1QYRA 3LUFA 5GINE 5SYNA 1GAXA 4WZZA 1T9DA 4J29A 2TMYA 2IZ6A 1KO4A 3GA7A 4HLUA 3DDSA 4MITA 4MR9B 5JJIA 5F2EA 3P4YA 1DHRA 7AT1A 4KSBA 5K1ZA 5AJVB 1S3GA 3OX2A 2VAMA 5KSYA 3V4PB 4PYJA 2E1PA 2ZT8A 3VO1A 1K7XB 4TN1A 4C0JA 4HNVA 4IXNA 2GVNA 1VIAA 3FX2A 1TAUA 3HNRA 2OG2A 1R16A 3C24A 1I1NA 1VSTA 3PRJA 2HK8A 3UHJA 2BFFB 3MT0A 1LDNA 1NL3A 3FLMA 1J9GA 4HQ6A 1GA4A 1T5OA 4FC7A 4RYLA 2YDYA 4ROSA 3Q0EA 3RVNA 3CF4G 1KYXA 1IEXA 2II6A 3QHAA 4G1FA 4TMYA 5KJCA 4O2BB 5FOSA 2G88A 4LYYA 2CB9A 5GONF 1ORHA 4L16A 1DWQA 5AHKA 5JJCA 1OT5A 1GY8A 3OOEA 5BWCA 4FOPA 1WUIS 2BWJA 2J4FA 4EB3A 4YUVA 2OCIA 4KMSA 3UQZA 3GR6A 5DTIA 5I7FA 5JC1A 4QOIA 1S9HA 3ZD7A 2CZGA 3GIDA 1LJ8A 4Z86A 5A1TA 1I6MA 4V0ME 4AQ7A 4DIOA 3DEHA 2I22A 5D87A 5TEVA 4PQFA 3WGMA 4NZOA 1WB9A 3VNSA 4AY3A 2XBMA 3EIOA 2FI1A 1CC1S 2WRZA 4QHYA 3UJ8A 3VYVA 3W7VA 2J5KA 4EQ6A 3BSYA 3OOHA 1YE5A 3VU8A 1SAYA 3AKEA 2GNAA 2VSOA 3HE3A 4HB2A 5BOSA 1JP7A 3RYIA 3HJBA 3K92A 3VPHA 2BR5A 4PBTA 2JASA 4W5QA 4EUKA 1JQEA 2QPAA 2WG0A 4YJFB 1LBSA 4YI3A 5IK2D 3K2IA 1SBCA 1W48A 2GLXA 3DZFA 2OYRA 3IKVA 1KMHA 4QJIA 3T7SA 3M1AA 2FG7C 4ZYVA 3D5EA 3IVCA 2X1LA 4J43A 4IOKA 3GEMA 3NASA 4P7JA 4R9SA 1NNEA 1ZHFA 3UWOA 3CF4A 1VDMA 3QJGA 1FZTA 5BSEA 1DC8A 5TGZA 1SG9A 1OZ0A 3QFRA 3D6JA 4YDHB 2F8TA 5FWYB 2ON6A 1VIMA 4LYDA 3L7NA 3DMFA 1UBNA 5KBYA 4EJFA 4WKGA 1YKGA 4CLRA 1WW8A 4MCJA 4E5SA 5I7WA 4WHMA 3BDIA 3D02A 3U3OA 4MW1A 1Y3HA 4JQYA 1Q20A 3H9JA 4X1IB 2ZITA 1KEKA 3ZCUA 1CY6A 1AKWA 4FDUA 3NO4A 5CITA 1NJ2A 2C77A 4YC7A 1A5BB 1USKA 4RTSA 1IAVA 4C1NA 3K70C 4QO7A 4EHLA 5KWVA 4MWGA 3L43A 3QUTA 4NFSA 4ZVRA 3ULKA 4AP9A 1Q21A 1KORA 5AO9A 3K72B 1GQRA 4WERA 2J41A 1XTPA 3MQ4A 3FTEA 1N25A 4Y2QA 2FOIA 3ZLUA 1ZU5A 3HGQA 4M8LA 4HQNA 2VTBB 3DLPX 1YE3A 3BQNB 3FDZB 3K15A 3EASA 4R81A 3STXA 3WWOA 2R6GA 3KTAB 4Y6QA 4FFSA 1Z82A 5AKYA 4BQFA 4RTNA 2CV2A 1PU2A 2P2NA 4QBFA 5J2UA 5BOVA 3KCNA 4RSMA 2I80A 1VJDA 1L1QA 1MXFA 2ZUUA 1MT3A 3JASA 2WFLA 1SOUA 4JNCA 3V1UA 4W5OA 2QSJA 4QXPA 3B2EA 1CLUA 1J1IA 2FPWA 2UYQA 2VYND 1CG6A 4Q82A 3MBIA 1YS1X 4KIGA 5I8ZA 1E3DA 3ELUA 5CA1B 4JI8B 2BDEA 3NM4A 1E9CA 3WQRA 3WL7A 3VI3B 1FP4A 3FPKA 5DP2A 1MQAA 4JGGA 2YQ5A 1A5ZA 1E18A 1SUIA 2D5LA 1S8OA 4ARCA 1KH2A 2QRLA 2X3YA 2QMEA 1R4AA 3RUHA 2W8ZA 3D3KA 2YUTA 2QV7A 3IBGA 4IPTA 4BQOA 1N4DA 1A4RA 4YP7A 1L5OA 1UJBA 1Q91A 2O0JA 2YQZA 3MD9A 2P9QA 4GPEA 2AC4A 2LP4Y 2NYRA 3RRBA 3S4YA 3ZE2B 1R27A 4TTAA 3GLHE 1YB2A 1WM1A 3I01M 4HV4A 5BNIA 1KQOA 4J1QA 2PH1A 1WD7A 3ZDFA 3N2LA 1LPBB 2X23A 1FFWA 3UAGA 1JG1A 2UUPA 4DRZA 1OLSB 3AUTA 4RHFA 4F06A 2WHPA 5GJWC 4N5MA 2WU0A 16PKA 4U00A 3FPHA 4F2GA 1QWOA 4OQ4A 4XKJA 5CK5A 4JGIA 1SFRA 1RHMA 4ZXFA 3OHMA 1DXOA 2ZBEA 4R3UC 3RS2A 4CKZA 1GILA 1I7PA 2W90A 3MTDA 3NCTA 4HSEA 4OLFA 2OENG 4YGYA 4CNQA 2P2YA 1WP4A 1WSBA 3DDWA 3ZCXA 1EYZA 4Z4HA 2X5JO 2PGAA 5AW1A 4DLKA 3CWZA 4C3ZA 3Q87B 4GP7A 4BO0A 2A5LA 3IERA 2FZLA 1Z9BA 4U6QA 2Z6AA 2CKDA 2V3VA 2X4IA 3EYWA 3MT8A 4NOKA 4D57A 2ZANA 3QYPA 2ZSDA 4ITRC 4IDBA 4QUIA 4G9GA 3NOVA 4UMDA 2GMWA 4XJXA 4EVSA 2C20A 2EBHX 3OY2A 4MV7A 3RC1A 3RU2A 1Z5GA 3VR4D 1XK6A 4I55B 2FMFA 3CW9A 2ICAA 2FJUA 1VFPA 2DMRA 2AK2A 2PMEA 2XMQA 4GPIB 4HRAA 3OMLA 4NYMR 5CNKA 4KRFA 1CRWG 1EXDA 2D54A 4CKWA 3UJNA 1NLMA 2O2SA 3QMMA 1QGUB 1SBZA 4KODA 1OXKB 4JASB 5B2FA 1IEQA 1J25A 4JJ7A 3B85A 1U2DC 2FG6C 2QQFA 2AMYA 1CZOA 1PQYA 5DYGA 5C8ZA 5EWJB 1I01A 4LRYA 3GXBA 4LW8A 4LYJA 2I3BA 5BXQC 4KVAA 4ZVTA 4R3WA 3OHSX 1Z38A 2R68A 3TD9A 5CAEB 3AB7A 2OXFA 3P9SA 5CR9A 3L6EA 4FGKA 1U4NA 1ZA1A 4YAGA 4MP6A 1P7CA 1CUYA 1YCDA 2ZPTX 5KOJB 2KYRA 3K30A 4UM7A 3W2HA 1WLYA 2YZ7A 4IOMA 4MUNA 2WYHA 2J3LA 3TMYA 1F9AA 1P7VA 1XZHA 1NLYA 3N86A 4CLRB 5BV7A 2P1DA 4OTZA 1NW6A 4HATA 2BFCA 3L79A 3GZNA 4GSLA 4F5YA 4CEJA 2ZVDA 1YTLA 3N0TA 4YPOA 1HE3A 4V0MA 5DLPA 1XSEA 2X41A 2EP8A 5EQDA 3VGJA 4CT0A 2C5BA 1NFQA 2N75A 2Z1MA 4XWKA 2JIMA 1FY2A 3HXTA 3NAGA 2QP3A 3SDBA 1OU0A 1Z36A 2JFFA 3IQHX 3RWBA 1HYQA 3ESBA 1J5PA 3FGOA 4JD5A 1NQWA 4FDMA 3V33A 4CODB 2Z4RA 3LX8A 5DBGA 3USCS 3QMPA 3GLFE 1ZYUA 3NC1C 5DN6A 5J3JA 1SOVA 3RBXA 1AS3A 2Q1XA 5T8KA 1EESA 1Q1ZA 3DD1A 4L4YA 5DLDA 3UOWA 2L19A 1VKNA 1Y81A 3IUMA 4PC2A 4WGFA 4YDSA 1ZVVA 1I24A 4DOMA 1PZXA 4J3JA 1E5DA 3F9IA 4O1HA 3W2FA 1E6EA 1X38A 4C30A 5EIWA 1G4UR 5CP8A 3H5WA 5DE3A 5DT2A 4RDCA 4W7IA 3ROGA 1DAEA 3TFWA 4B3JA 1P9RA 3W8RA 1VIDA 1SVMA 2O1XA 2O2CA 2VYNA 3D3JA 3QBVA 4UXHA 2EAUA 5JWHA 4DLPA 2VP0A 1UOEA 4TLMB 4R1PA 2HCTA 4YT8A 1QLHA 4OXYA 1DV2A 4Z1OA 5BSGA 1MT0A 2G77B 3ZY6A 5CA1F 1OSNA 1BWSA 1B41A 3H42B 1XCPA 1I13A 1NQAO 2Y0BA 3HBNA 3PRHA 9MHTA 2XUHA 3HPQA 1WXFA 1SIOA 3LV8A 4G01B 4DTIA 4FM9A 2LUOA 1XLVA 3G17A 5C34B 3LIPA 1HDZA 1ID1A 4PICA 4Q9AA 3UUWA 4X1YB 3ROKA 1JHRA 2BFFA 4GR9A 2AC7A 2RH8A 4IEIA 1NMSA 2NUTA 4D3SA 4UREA 2EYUA 4LQ4A 4D56A 4WZAB 1GTZA 4R16A 3BYZA 5LBIA 3IEXA 4QQRA 3OFJA 5EXTA 3WIUA 3GJYA 1PGOA 5GP1A 4QG3A 4ZT2A 3DEKA 4G36A 3EXHA 1ZOLA 2YWCA 2GBCA 1TA9A 3BD9A 3HLTA 1LPSA 2W6MA 2LCFA 3MTIA 4DADA 1ZHOA 5SY6A 4AMBA 2CDNA 1RLMA 2JEYA 3OIWA 4KPGA 2J5XA 3JWPA 4O6VA 4XWYA 3W1EA 1SGWA 1Z74A 3N8IA 3CKMA 1I5OA 1UBCA 3WLQA 3OJFA 4WKCA 2ZIFA 2K4MA 2NT4A 1KHTA 2WIBA 3EJWA 3I04A 2DT5A 2FPRA 1P80A 3KYBA 5I4IA 1U2PA 2H59A 2ZGVA 4HTAA 3N70A 2VQEB 2AQHA 2BMFA 4FKZA 3HB0A 1IZYA 4EEXA 4AKTA 3SZLA 2GK7A 2ISSD 4GEGA 1GNQA 2IY7A 2NZJA 1QRTA 4MWEA 4WLNA 2IPAB 4A82A 2FEKA 3NUZA 4WESA 1WXWA 3DL2A 3G8CA 4PZLA 4W5WA 3TQHA 4ZI7F 5GQSA 1W85B 1F7UA 1LXCA 1I3CA 2CT8A 1KP3A 1I4TD 3EF0A 1HDCA 5F1PA 5A4MS 3CZ4A 1G18A 1SWWA 1XRSB 1V8PA 1TDJA 3IB3A 5BW4A 2P79A 3X1YA 5J5VA 5FTMA 2WMDA 3RAJA 3P2IA 2V6MA 4BAGA 3QEKA 2YWEA 3NX4A 2X22A 4X85A 2OVFA 2V6IA 2YFQA 1Z4MA 1ZO8A 4GXNA 1BU8A 1T3ZA 1E5VA 1H6CA 1YAHA 1ZUD1 2HO5A 3B3JA 2PAAA 4MUMA 3A4LA 2XKKA 5P8WA 2PRYA 1Q74A 2BP7B 4X84A 2YNMC 3SJ7A 2XQFA 4H08A 1J4AA 4NYIQ 3TKLA 5CX1A 5L9AA 1DC7A 1MAUA 3FTQA 1RXWA 1PT9A 1TB4A 2NUPB 4OF4A 4EI7A 1ISMA 2VPIA 2DYKA 3CRW1 4IWNA 5BYJA 3SR3A 2DFLA 3ST7A 4DC0A 2GD1O 3I28A 3O8NA 4DMFA 4F5ZA 5IKXA 2OY0A 2ZWPA 3E18A 4OQFA 3TL6A 4D45A 4QGSA 5C53B 4MVYA 3MWKA 2AJ8A 4RCYA 4EG6A 2MYTA 3UFBA 4OQQA 4LCJA 4QEZA 4KLCA 4F2PA 2W2XA 2YMQA 1T2CA 4B76A 3H04A 1HEIA 5EUQB 3FVWA 4J7CA 3HJUA 5DLEA 4X64B 4D25A 4F0JA 3D5TA 4JB0A 1FRNA 2FR8A 3K6RA 1VGRA 1O54A 2P7IA 3C3DA 1NMYA 3BGIA 3I30X 1PUIA 1RKVA 5I7AA 4YXFA 2FPXA 4RY8A 3NI2A 4EZIA 3W90A 2X0FA 4V0LA 1UK8A 5DGHA 1OH7A 4G1VA 4R0MA 3GVHA 4UATA 1NVEA 3RF6A 3GQVA 4EPWA 5U9CA 3I1IA 2ABWA 3F0TA 4ISCA 4W1QA 2IYEA 2XQJA 5E9JA 3JQQA 1ACLA 1EWYA 1FNNA 3LC0A 3UWSA 1JF8A 2VJYA 5K8VA 3T0IA 2VS1A 3REFA 5FWDA 1G16A 2JIPA 4ND5A 4YP9A 4PZAA 4RJKA 3ZI4A 1NE2A 4GFDA 1L7MA 1L4BA 3BCRA 5FPYA 3WYAA 4UZEA 5DBEX 4HGOA 3IIKA 5DULA 1DAPA 2PNFA 4LC0A 2QWXA 3DKIA 2ZSJA 3DE6X 2XX3A 4B9AA 2JATA 2NW6A 4PQEA 1U8AA 5JZMA 3ZXXA 1CR1A 2VRCA 5JQGA 1BROA 1WZNA 2ONJA 1U8CB 1MRSA 1XF1A 2HLPA 1G2IA 4G4SO 3UT5B 2ZR7A 4UFPA 1WAMA 1WDLA 3ND5A 4TVBA 2ORIA 3OU6A 2YRWA 3TIFA 4Z2YA 1CERA 1AQYA 1FXUA 2ILTA 4K28A 4JVOA 1M1XB 5FPQA 2R96A 4KWHA 3GV0A 1UXHA 2YBEA 2R8XA 1AA6A 1V16A 3HY4A 3BQMB 3U9SA 2W70A 2H4XA 1BHSA 3G9ZA 1J0DA 2AZTA 5IBQA 1QDEA 4A0GA 4F92B 4TWAA 2F90A 1TYZA 3CF6R 1UBEA 2QN6A 2X1HA 4ENSA 5K05A 3UGQA 5JQWA 3F7MA 1LCIA 4JLAA 5AOVA 3ZDEA 4US2R 5JD4A 4NCAA 2VQ6A 5C8YA 2JEZA 2PZFA 4LHSA 1Y8CA 3DC7A 4LF4B 2Q0HA 2O3SA 3B3QA 1KOGA 2LBPA 5F3RA 4RA9B 4FGSA 2YIMA 2R00C 2J67A 3JALA 1ENZA 4F8YA 3QPAA 3S1SA 4YRRA 1U5CA 4OGKA 4CU5A 1KQGA 5TQJA 2W6ZA 2ZJAA 3TZEA 1RXUA 3E8MA 1HDRA 1IY0A 1EBBA 4B82A 2AI3A 1XKTA 4IAOA 4YJKA 1C1XA 3HHPA 1SN7A 4L7VA 1PHPA 1VSVA 3CWQA 1D03A 2A9RA 3SQLA 4BNMA 4WH0A 5JDCA 1YHNA 1FVFA 1UADA 3ZVNA 2C7QA 3ZVRA 4DIMA 1NFFA 2XTJA 4NX2A 2GHTA 1WXIA 3LY9A 1DKPA 4MPRA 5CBPA 1RAEA 4I99A 2GJAA 4EYGA 4Q4AB 4Z49A 3MT9A 4TZ6A 3PUXA 5BUZA 3FPCA 1UKAA 2XV1A 3H75A 3WMGA 1O97C 1NJ1A 2VPYA 2H52A 5LJLA 2XNHA 3JW8A 4BBPA 3NVDA 1DEHA 1FDRA 5JADA 2C5SA 4ZGBA 4QQFA 2P4HX 4XEHA 4HNAA 1SOMA 4IQ0A 4NG5A 1JXQA 3MTAA 3UQYS 3RIEA 3I8SA 4L3WA 2VBGA 1X7ZA 5EWMA 1O6GA 1XHFA 2PGIA 2WSSA 2O8VA 3AVPA 3OFNA 4KV9A 4P84A 1NPYA 5IAAA 1HXHA 3D7RA 3WYNA 3KEOA 3U19A 1EZZA 5DIZA 1OASA 4EI9A 3MUFA 1RC0A 4KPFC 4GYJA 2HMWA 3AETB 2HRZA 1RCFA 4FHZA 3T5GA 4EO4A 4S0ZA 5JR3A 3RK4A 2CNWD 3DE3X 5JMTA 2W98A 3QWHA 3I12A 3UOGA 4XCVA 1SXJB 2JLVA 3TSZA 1LSUA 3W9BA 4D0LB 5KNBH 1ICEA 2H31A 4PBSA 5AUOB 4LNUA 1FP1D 4J2TA 3ZE0B 2JFBA 1DWUA 3HCBA 5JNLA 1TKRA 1XFDA 2HX1A 3WRXA 4Q7LA 5B4TA 1QONA 3KRTA 5HF9A 5BN3B 2DERA 3AL0C 5HYVA 1HDIA 2Q8NA 4JT2A 4S35A 3KDAA 1NQUA 2Y0DA 1QLJA 2VF7A 5G4LA 5LQKA 1MDFA 2ZS7A 4A0QA 4W9MC 1AE1A 4ZVUA 4UHHA 5KTYA 4Q4LA 2V58A 3CX6A 1V7CA 3MB5A 4FMDF 4HAVA 3GEGA 3LRXA 4RMHA 2W2QA 4E46A 2QMQA 1TVKB 2FP4A 3VBCA 4FHEA 1ONPA 1WUHS 3EPJA 4GKJB 3U1VA 4GP6A 1Z45A 3RRMA 1Z47A 1UWCA 4Y2HA 4DUPA 1R4MA 1S02A 3VM6A 1AZLA 1G3QA 2GEVA 1LSJA 2I3AA 1CJVC 2GEBA 1UEXC 3OM8A 4QGGA 5DNAA 3WLJA 2SKCA 3C6ZA 4D92A 2HJ9A 3MWDA 3OKCA 1LNQA 4X5OA 3OAAA 1M2WA 2OQVA 3ETNA 1M0EA 4WFKA 1L1EA 3RFCA 2Z1NA 3IAUA 3GZNB 3E7DA 2IHJA 1A5TA 3G8YA 3RIHA 3TUIC 3ER8A 4RFSA 3PF8A 5F2NA 3PXGA 3MWYW 5EIFA 4TT3D 5CX4A 1J49A 3WKDA 1DRWA 3C7CB 2PGOA 3PP8A 5AI4A 3T5CA 4DZZA 1NMXA 1ZJ4A 2H17A 4WZAE 1YVPA 4CLDA 1JZQA 4WLUA 3HRIA 4ED9A 4WADA 3ANSA 1PR3A 2FHSA 2LPMA 5I9BA 3DMHA 1I0ZA 2XB8A 2O9JA 3ZGXA 2A58A 4INAA 2OK8A 1XPRA 2O2GA 5BR4A 1I1QB 4M1QA 2PWYA 5DISB 1Z5PA 2G71A 4KV7A 3KJIA 4XWWA 3DPUA 1G8KA 1TI7A 4CI9A 1UC4B 3E53A 2XZOA 3EUAA 2DUUA 3ANNA 5G2OA 4YRTA 4ZI5A 5BVHB 2RC5A 1NW7A 1Z7WA 4LF5B 4XB2A 1XZNA 1ACJA 2OO5A 3NP7A 1QH1A 5I9NA 2ZI3A 2GM3A 1EFVA 3A6FA 4YB8A 1DJOA 1I3MA 4YJGB 4G4GA 3FPJA 1E0JA 4BBZA 4R9NA 5ESRA 3LL4A 3QY9A 2FN7A 4PZYA 3BXPA 4TMFA 2Q6VA 3FKSA 3VYSB 1KZ1A 2IPMA 5IP5A 4K05A 3R24A 5THXA 2QL9A 5F2KA 5LP6A 2Q5EA 2ZRJA 2J9RA 3AK4A 5JSZB 3D8TA 3PNPA 2WKSA 4W1PA 2GBLA 1GHTA 1EVZA 4BFXA 1Q7RA 3MNFA 5HZGA 2Q49A 3FYTA 4C7OB 1HT0A 3B6KA 3H4VA 4IKPA 1R1DA 1Y3DE 1KI8A 3IP5A 4P33A 5JU6A 2Z2JA 5EFOA 1ULUA 3ZY4A 1K4MA 2ZIVB 1R8JA 2FPGB 2X5NA 4KN8A 4L50A 1FVHA 2FN9A 2H4YA 3UMCA 4DANA 3CONA 3DW1X 4RDXA 8AT1A 1T43A 1OU4A 1DKOA 2XGMA 1AB5A 5U4QA 2J32A 3ET4A 1W44A 3EBOA 3AUAA 3O8LA 4KH0A 5CVEA 5KOHB 4YWHA 1BWQA 2ZRLA 2TSYB 4JVLA 4KDEA 1Z6QA 3D3WA 2KLHA 1DAOA 2H9IA 2KX7A 3HI6A 1Y8AA 3A06A 3DFMA 2Z56A 5HKOA 1T9GR 1LTHR 2OXEA 2HWXA 4N65A 2Q7OE 1C1HA 3PTZA 3ZOZA 3ZJVA 1E7QA 3RVJA 3FCAA 3ZJ4A 1HZZA 5CT5A 4QDZA 3OBBA 3KQNA 3F73A 2QD5A 3DLHA 1OAAA 1CU1A 2EF1A 4MRMB 3CE9A 1YR9A 2F6RA 2ZI9A 1BH6A 2I87A 5B12A 2I4OA 4FMCF 4EFLA 4MJLA 1NF2A 1L7NA 3P9NA 3IO3A 1XAHA 3UAOA 3GMIA 4B7AA 5IEJA 4UBIA 4DY6A 4KGVA 2JAOA 4HD8A 3L7MA 2X0NA 2E4WA 5CCEA 1A0OA 2F43A 1LI7A 2R4TA 3VDRA 3MHTA 5EP1A 1O0CA 5L40A 2FZVA 1E9EA 3H2GA 2Z5GA 4GPZA 4IGFA 4WECA 1MAHA 5B58T 4B0OA 5FHQA 4O25A 3N59A 5KNCA 3OZGA 1NUTA 4MV6A 1BEUB 4KQMA 4BKPA 4ZFNA 4UNSA 1TMGE 1ZG3A 3LYUA 2D2VA 5LKRA 4O2RA 1DAGA 1RQ2A 4BVAA 4JI0B 2HRCA 3ADOA 2DT8A 4BAUA 3IA7A 3GP5A 1EHCA 1N0WA 4L5CA 4RAQA 3EXG2 3FI0A 1ECGA 1F51E 2AFIB 2O7SA 4D41A 2QP9X 1POXA 4WK6A 4D7AA 1VMAA 3DEZA 3M6FA 3C3XA 1V35A 2FAXA 5CAEA 3EPPA 4IO0A 1KU6A 2K2WA 3T0FA 1BN6A 1KL7A 4TRRA 1GPYA 1OFTA 1W49A 3NHBA 2JFQA 1IZ7A 1GNVA 2NX2A 2Q3CA 5JE8A 4LC1A 2AV6A 1PJZA 2EARA 3Q88A 4HAYA 3JQAA 2P6PA 4R2JA 4M1YA 5IAJA 3VSCA 5A04A 4OMFG 3GPLA 1EGMB 2KW5A 5HIMA 3PZBA 2C58A 4LMPA 3SX0A 3JV7A 3Q3IA 4JKOA 3FSGA 4YRKA 2CNBA 2JRLA 3H2YA 5B3JA 2P9BA 4F7WA 4RPGA 5BMVB 2W6PA 4XCXA 1GGVA 2VHTA 2WDZA 1J06A 3EQ6A 2XGOA 1NVBA 1UMCB 2QPTA 4AC9A 5DU2A 1C0EA 3H3JA 4GX5A 2PLAA 1JVBA 3RVQA 2X9QA 3KQMA 3BH7A 5A0FA 2NVOA 3IP3A 1YDFA 4ID9A 2VXOA 3FPLA 2R4QA 2VJKA 5ARCA 1ADJA 2A1IA 3MXOA 5EAIA 1W94A 1G41A 2XBLA 3CR7A 1JS1X 2ZKIA 3FAKA 3FDXA 3K53A 5B7QA 2WJGA 1LSOA 3TLZA 2ZIXB 2I55A 2AX3A 4G4IA 3T3OA 1VHJA 4FK8A 2QGNA 3ZY5A 2BT4A 3R3YA 4MIEA 4WX2B 5IT5A 5LP1A 5D7NA 2GFIA 2O8BA 3D0OA 2XUQA 2HADA 1W19A 4S1TA 1R9JA 3WLAA 2GPTA 4BN5A 1YNSA 3U39A 2WMOB 4YRPA 2J0EA 2A0YA 10MHA 4NCNA 2Z8XA 2UU9B 3KYDB 4KO3S 2YYAA 2YXLA 3AFOA 2JDID 1E1MA 4QFCA 1NY5A 4KXFB 1BCRA 1P1IA 2D59A 2DGDA 4KXMA 1EFPA 2PUVA 4FBMA 4I5GA 1E9SA 1PP4A 2JFOA 4TL6A 3ZXSA 3MRSA 3WNZA 1EJBA 3WICA 3QGMA 4BKOA 3U56A 1XPOA 2QRVB 2ZYVX 2CNKA 3MTEA 4FIDA 2WKRA 4FCWA 3WLRA 5JROA 4WCDA 5EJ4A 4DJDC 3HA2A 3HEAA 4ZVSA 5KYGA 5C2JB 2O8DA 4CQLA 3ESXA 4XE5A 2A4MA 1Q44A 2Y1EA 3OZBA 2I7CA 3PEYA 1ISGA 3PR2B 4XDZA 4MDHA 1YI1A 1D2MA 2VPWA 1LK0A 3P5SA 2DAPA 3TQRA 1NJFA 3ZLVA 4LJRA 1Q17A 1OB5A 1I3LA 4PQYA 4F4JA 1G20B 1NQOA 3LCMA 2C4VA 1OIWA 1DFGA 3MFQA 3VKUA 1QP0A 3IILA 2HY7A 1S0UA 1DO0A 3HP1A 3PEVA 2QTVA 5EYPA 2HBYA 4J2OA 1ZCAA 4KR6A 1M6NA 2J0QA 3WLTA 1CULC 1T0BA 3A2LA 5BVHA 2H1CA 5TJ9A 2PK3A 1IY1A 2RGUA 2NPFA 1T10A 1JJ7A 3BCSA 3PPYA 2YZNA 3BK1A 3IT1A 5ELMA 1NSTA 3BD8A 5EVJA 2F48A 5CFRA 4Z4FA 3ZUPA 3W5CA 1GNPA 5LU8A 2B9EA 3P32A 2RAUA 4GO1A 1V9CA 2XNDD 2YCBA 4L15A 4LVUA 2W42A 2ZU0C 4W4TA 4W8OA 3OZXA 1ZWKA 3U4MA 3KWJA 1F60A 2VC2B 3JY6A 3A6KA 3KQYA 5JSYA 5LZ2A 5FWAA 2AWOA 1HR0B 4JI7B 2YC4C 3PQ6A 4GZMA 2XOXA 2Q4RA 2WV7A 3QH4A 1RYEA 1E6MA 5JAIA 4V39A 1Q1BA 4R8LA 5FNVA 4D42A 3DYBA 4P3NA 3GLIB 2MMCA 4K6OA 3LUJA 1EUDA 1UPUA 4Z54A 1X7WA 1KVUA 3WK6A 2ZLBA 5I6DA 4C4RA 1WUKS 2EG9A 1ZRNA 3DDCA 3KHSA 3CLRD 3EGOA 3S70A 2DR2A 2ZB4A 1LV7A 1V11A 4KWTA 2PS9A 4GICA 3TLKA 2RGEA 3NVMB 3ZNQA 4BO6A 2NO1A 4LZZA 3L6UA 5FPHA 1JIIA 2QJRA 1NR7A 1ABBA 2CL5A 1I2CA 3L1JA 1VLZA 3DL7A 1GGFA 1QGAA 1BFKA 4BXOA 3U40A 3CLUD 1JSLA 4BEWA 4QOSA 2IOFA 1NVXQ 1SBYA 2QN7A 2PV0A 4HI0E 4ERXA 3AR6A 2E1RA 1JU4A 1FFXA 4WKBA 4Y1GA 3W3ZB 4F93B 4LNAA 1P1RA 2QORA 4G2NA 2AOXA 2J87A 3LGSA 4KBFA 1VLJA 4YFVA 4L1KA 4WNYA 1QLWA 1SWVA 3WTBA 4ZK6A 3G5LA 1M2FA 1K3FA 4AK9A 1CEEA 3E61A 3V46A 5CGQB 3VHXA 2R65A 4LK2A 4NMHA 2VTEA 1DCFA 2BTQA 3GOHA 3SC4A 1N0UA 5IJWA 3QKUA 1M10A 2YJ6A 3ORRA 1IXYA 4O63O 4BVBA 1WVIA 3T3IA 1LFDB 1MLDA 2PV7A 5K3FB 3HWRA 3VA7A 2CXTA 2FWPA 4FQ8A 1P2FA 3SX2A 4JIMA 4K6GA 5TQ0A 1L5YA 2BDTA 5H80A 3QWAA 4FE4A 3R3SA 3USES 3PHLA 4B33A 1EDEA 1JDZA 4I4TA 4W7SA 4JCOA 1O0SA 3DONA 2DPMA 1FRFS 5D1HA 4JXZA 2C3PA 2XY4A 2WWHA 2G76A 5C4IA 4DA0A 1EHYA 3RH0A 5HWSA 3ZDZB 3JQRA 2V4MA 2IWRA 1UPTA 3QE0A 3DZ8A 3W8EA 4F3RA 4LXHA 2YXDA 3DGFC 1DDIA 1PNRA 1BMFD 4LVNA 3W6ZA 3H65A 3THXB 4DXHA 1QV6A 4ALKA 1IE3A 1PW7A 3AJDA 4CKYA 4TGLA 1S3IA 4H3VA 2V7UA 1G5IA 4CR7A 2O8NA 2YYZA 1A9XA 4D79A 3TNYA 1C4OA 1C3XA 2FVXA 1QZTA 1Y89A 4HDMB 4MKZA 4Z3DA 4KXQA 4ENVA 2PS1A 3CRRA 3O4IA 4BVLA 4KGXA 1Q1GA 1O4WA 2G82A 2VSYA 3NKLA 1ZMTA 4ZDIA 2VQFB 2YX1A 2ILVA 2DECA 5K3EA 4HWTA 2A0WA 3NBFA 3X2SA 5K3OA 2G8LA 1JT9A 4R7ZA 1TVEA 2YHUA 2A0KA 2DPYA 3SXPA 5EWJA 3AONB 3TO5A 1F4VA 2JAPA 3VYUB 5AW0A 5DDIP 3R8FA 2HV9A 1ND5A 2W6JD 3RHZA 3WMEA 2I2CA 3V00A 1ZGHA 4EYSA 6LDHA 2E49A 1GA6A 1SVWA 4XIIA 1V2GA 2HJGA 4NJOA 3SFTA 3IBFA 3L93A 3VKVA 2BMDA 1P2VA 2X2OA 2XLCA 4NJEB 1X9GA 1WZEA 4H3HB 4KXVA 2AFHB 4O1IA 4XD7D 4DCMA 4FMDB 1KQPA 2LTAA 3HJFA 1HKUA 3N0WA 4QPDA 4HFMA 4JUCA 4TMKA 4D80A 5LPNA 1T5HX 4XJSA 5A3SA 4AMUA 1EWKA 1RYMA 1BA2A 3DOOA 1DBSA 2F43B 1KTVA 2FX2A 3VO8A 5E1OA 2Q1YA 5KTSA 4J1SA 3VFDA 1WY5A 1SZCA 2D4HA 1AVTA 8ATCA 5BQXA 1LJLA 3B6MA 1Z6XA 3HCNA 3ZU4A 3HCAA 2HA6A 4ENRA 1HNNA 3AEQA 1CR6A 3NWEA 4RETA 3RFTA 5DJ5A 4V03A 1CY0A 3MHPA 1NONA 5HPYB 2FPIB 4ZDJA 4MHTA 4ZYWA 1M2HA 5LA6F 2VXBA 3KSZO 4PO9A 2GKGA 2WYOA 5HHTA 4QNMA 2EKZA 1T8TA 2C4UA 3DCNA 1OX6A 4X00A 2O59A 4N0QA 1U31A 4X8OA 3AFGA 2DP4E 2B6NA 3T7CA 4H35A 1WUJS 2Q1UA 2ZCUA 5G41A 5H82A 3KHUA 1H2BA 3KYDA 3DF9A 1QB8A 3QU4A 1SXGA 4I7EA 4L3OA 1YRQA 3WLKX 2XA1A 1IG0A 4D8UA 2P2LA 1YK0A 4B80A 4YCMA 4W7HA 3LXMA 3NMUF 4J1NA 3R7LA 5KVQA 1W88A 4F6RB 4DDWA 2XMGA 4E5UA 1DIAA 3SQMA 2LIVA 4YV0A 1BOFA 1G6KA 1YCFA 2R7MA 5EA2A 5FP0A 1MTOA 3O8OB 4J0QA 3UMBA 2PT6A 1DMSA 1WNTA 1FIUA 1OI4A 2WFMA 3AESB 4TLCA 5KQGA 4JI2B 1XTZA 2LDBA 4R8MA 5FR1A 3KC2A 3TSAA 3TXAA 3O4FA 1CUZA 4XVQA 1DOHA 1YQUA 4GL2A 3QVXA 4JSTA 4KXWA 3Q6IA 3HZOA 5GV8A 2ZM5A 2HHAA 1C8KA 3IT0A 3AHJA 2R7KA 2WUGA 4O29A 4WTOA 3SLRA 3I04M 3UENA 4EHIA 2HT1A 1TTTA 2NXJA 4FJ0A 5FIUA 4HADA 4BYGA 4MWDA 3HG7A 2WFLB 4XOIA 4ZICA 5ITVA 1KWKA 1B6RA 5EXXA 1PV4A 2I33A 4NV0A 4S12A 1OD6A 4NAUA 2V6JA 4ZO6A 2HB6A 3R3XA 1QFYA 1JHQA 2J46A 3ELWA 3INRA 1NGSA 1AX9A 4PONA 1XTVA 3VDNB 3IIMA 1WR8A 4PGHA 3PFBA 4R41A 1BS9A 2W4IA 2XUZA 2QVGA 4XARA 5FWXA 5TB5A 1P5HA 5JNRA 1C1DB 2ZRKA 3QG5A 5CD9A 5JDIC 1E77A 3A11A 4TQ9A 3LOUA 3D4IA 3EUEA 3U4HA 1TEVA 1L5FA 2QE7A 2B1IA 1KJIA 3R6WA 2JJ2A 1DPGA 1NASA 1Q7TA 2B25A 3HBFA 4HWGA 5ESXA 4Z7OB 3QU5A 3NIDB 4CUZA 1ZY2A 1HT2E 1XD2A 2H1RA 3DAOA 3PFKA 4BLTA 4FB4A 4RTOA 2OT3B 4AZ0B 1M8GA 3UHAA 3BWEA 4F4DA 5KYKA 4KR2A 3KS9A 3R2JA 4IUYA 2R0QC 1H8EA 1QBKC 1FU7A 1T3HA 1XEXA 3B48A 3T1NA 4BMVA 2CVZA 3IUPA 3IO5A 5C7YA 5ADWA 1XXLA 4RC9A 2H2FA 3CLRC 3NGLA 1RZRD 2QBYA 1NUHA 1MV5A 2LWIA 2IDJA 3VMMA 1Z0ZA 3DA8A 1R6AA 4N7BA 3NONA 1XTJA 3OEHD 4HG2A 4ZVOA 4IHKA 5JXIA 3QNWA 1ES9A 4GXRA 5IVKA 1KMHB 2AJLI 1CUXA 1R9MA 2WZCA 2CMKA 4G5OA 4ND2A 5COAA 3HLKA 3G85A 4GG1A 1BQEA 4WXHA 2YJNA 1L5WA 1I6LA 2O4UX 3FF4A 1KAOA 3LVFO 3EDQA 2Q21A 1XR3A 3E9DA 2ZAYA 4RJIA 4A23A 3JQDA 4GW3A 1JR6A 4M1ZA 1RNLA 3QVUA 3SS7X 3WRXC 4XX0B 1S8AA 1NX6A 4HKTA 4WK2B 4GUDA 4IVNA 721PA 5KTTA 2AW5A 1DS6A 2HIGA 4Q3BA 5K01A 1UKVY 4UPDA 3WDLA 1GKIA 1CZNA 1W0KD 1NU8A 2BTOA 1NV8A 1T3TA 2BGIA 3HMQA 1YGYA 2XKAA 4IRXA 4JQZA 4Y2YA 4X92A 1HDEA 3U31A 3W1VA 5IJ0A 1EQAA 1KVTA 3W5IA 5GADl 3U2QA 5KJ6A 1PV2A 4X1KA 1DXHA 3QKRB 4Y9DA 3GWGA 4ZK2A 5HMLA 1ZK1A 3ESDA 3SYKA 2IU3A 3M2PA 4PXYA 4RZIA 3CT4A 3LCCA 2BEKA 3U3KA 3JATB 3LOQA 3NBKA 3WL4A 6Q21A 3LSTA 4PYKA 1HURA 1M2GA 1WZUA 3IPRA 4HOYA 1U3DA 2YRFA 4C7OA 2VRBA 2VJDA 2HBZA 4E70A 2WYIA 3Q5EA 1ZD8A 3JD4A 4HN4B 3A1TA 3JAKB 1KS2A 4OHBA 4N48A 3AF5A 2Q4EA 4Q6BA 2JFYA 5T3YA 3WQHA 3SVTA 2GN2A 4QZVA 2WYUA 2QK4A 2YVLA 3H5NA 2AR9A 4FZJA 3GGPA 1UT5A 3MVEA 2NXNA 2ZTUA 3DZDA 3ELDA 3N5CA 2ZCVA 5MFPA 2ETXA 4AN0A 5HBGA 3S2ZA 3UV3A 1AGNA 1U7TA 1ML4A 3CYFA 4MI1A 4TWRA 2W58A 4UDOA 1JDBB 1VPVA 3IAFA 3PC2A 1CNFA 4DBZA 1HOTA 4HDNA 8ABPA 1MQ8B 3SYRA 3ZY2A 3PKIA 1K0UA 3HS3A 4DQ0A 1G8YA 3M5WA 3DZIA 3FOEC 2WWIA 3D2LA 4YMWA 1A2QA 2PWPA 2V98A 4ZHQF 1VJTA 1BMDA 5CYOA 5KKNB 2OD7A 1CUJA 1Z6GA 4HH0A 1ODKA 2HQSA 4ZCIA 2YWGA 1J97A 2ZSIA 3I8XA 1PDVA 1MB2A 2OILA 1JBKA 1UDRA 3QVOA 4E1VA 1TJ5A 4ES6A 2IYTA 4ZQFA 2EL9A 3ZGYA 1T8UA 4F6LA 1P9LA 1VB5A 3FXAA 1LDBA 5EI5A 1SHUX 5AW4A 4I08A 1JLHA 1MOPA 2IIQA 3HACA 4N01A 1PGQA 1JEAA 2K87A 2GX6A 2SHKA 4RM2A 4EHHA 5A5VA 5HOQA 1XDSA 1NOJA 4M1TA 5CCBA 3PJDA 3FNHA 4OOFA 5FI0B 2SNIE 1BGVA 4L0CA 4ZEOA 2C4MA 2P9TA 4CMEC 3AEUA 1S5PA 2YS7A 1UXOA 2GCEA 3AI7A 1XMPA 3ORHA 3FJ1A 3FOBA 2VJNA 4JJ4A 4PXSA 4S3MA 1H3FA 3G5TA 3MJFA 2JA2A 4HAIA 5ALKA 2HWYA 3EVAA 5ADHA 3IDZA 2GZDA 3E9YA 2G7MC 2Z3WA 3CH6A 3K1AA 3FUUA 4MO9A 5KYNA 1E1KA 2XTZA 1D8TA 5CIWA 2PSSA 3RC7A 4J7XA 4CLOA 4Y6RA 2MTBA 3UT5A 4JSRA 3ZE6A 3U62A 2CFCA 5IBPA 5CA0B 1I4EB 4R5MA 2XE4A 4J6FA 3MOGA 3AF4A 3E82A 4DVJA 5IHXA 1ACMA 4DR7B 2QNBA 3ENZA 4PGFA 4MJ7A 1L7XA 1NVVR 4Q34A 2VYQA 1LVHA 2HJHA 5HSGA 3ZKWB 4C6RA 1YRWA 5CJJA 2RBGA 3KB2A 4TSFD 2CYAA 3LPCA 5IAKA 2DRIA 1L7VC 2PZGA 3Q9SA 1ESEA 2JFUA 2B4YA 2Q0XA 4K03A 3TLBA 5HP4A 4MQ6A 3S81A 3LP8A 2AT1A 4Q1DA 3DWIA 2V7QA 5JRZA 4DA6A 2YN4A 3OTGA 1ZGGA 4H16A 5AI5A 4DUGD 5DCYA 3GDWA 3DOFA 3AERB 5AHXA 3CZRA 4QPZA 5HIIA 3RYHA 1XV5A 4BB5A 1HEUA 3EZLA 1UC5B 2X58A 2V1UA 4NYJQ 3O1LA 1N78A 5THKA 1ZIDA 5IXYA 3AUFA 3S1AA 4BJ3A 1G21E 2NAPA 2QR5A 3EC1A 4TSFA 3RRNA 4C21A 5LBUA 4X7PA 4AO8A 3ITNA 4YAEA 4D81A 4OGWA 2CCKA 4F5EA 1JTVA 3KG2A 4CVNA 4J07A 1ZIPA 3H11B 5FORA 4F84A 2G9ZA 1O77A 1YQXA 3BFKA 5L53A 3ICWA 3LHKA 2W6QA 1U1EA 2GJ9A 2VXCA 1HEYA 2AN3A 1N75A 1LY1A 1OW3B 4HAWA 4M8SA 4MTLA 5I4BA 3AF6A 5JSKA 5IABA 2C9YA 3AEQB 2UYGA 3RSOA 3SFZA 2LKCA 4Q7EA 1H5UA 3OCYA 4UARA 4BKUA 4FDLA 5EJ8A 1UC8A 1Y7TA 3F98A 2HDOA 1PUXA 1YA8A 3SAJA 3JVUA 4D8TA 2CLKB 3H4TA 3Q2KA 1EVIA 4UNNA 1K89A 5KYXB 4RKWA 1U98A 1U2RA 4O3FA 3IP7A 2BKEA 1K6EA 5M7EA 2QLMA 3TBFA 2YJGA 4HNHA 4TLLB 3REGA 3RLFA 3VNVA 2WU1A 1T3GA 2YW2A 4IDOA 4QATA 4MEJA 1I0LA 1EG2A 3Q0IA 4AWAA 4PWZA 5JXWA 2AK3A 3LKVA 2Q5HA 2UZ1B 3GVCA 3Q2IA 2E5WA 4GR5A 4IVRA 4KVGA 4XIJA 2NU8A 4BBJA 3EGWA 1W85A 1DAFA 1J70A 1S1CA 1U9CA 1X9HA 3BB3A 1L3IA 3PNMA 3S40A 3U48A 3KT3A 4HYQA 4PG4A 4WXRA 3SMVA 1E98A 3X3HA 3TGLA 1C7RA 1J2UA 1ODIA 3ABQB 5KC9A 4P3XA 1JALA 3VU9B 5AFSA 5JRJA 4EHDA 2D0IA 4RJ2A 4F5DA 1H4SA 1J8DA 1Y3IA 5JW6A 4MVJI 4RKFA 3W1WA 3B6IA 2JZOA 3BXZA 4IJ6A 3WZLA 4EGQA 3DSRA 2QKYA 4D6PA 2VATA 4RTJA 4QXRA 1A9TA 1SHKA 2QVBA 1IVNA 1PFWA 2IW1A 3GUZA 2HF8A 3IJRA 4RD1A 3KKOA 2F1KA 3SQNA 1WDTA 3B9PA 2XWJI 4WBNB 3S99A 4L5BA 1FDVA 1UZNA 1RWVA 5JS7A 1IK6A 4HDMA 2GZAA 1P1CA 4LOAA 2LXNA 3RU7A 4B6RA 4GC9A 3WAGA 3AW9A 1N1DA 4O4IA 1UJMA 3WJ7A 2VSFA 1BRTA 1OFGA 5ALSA 3OZDA 1VHTA 1YD7A 1U8YA 1E6LA 2RCNA 4RHTA 1FMLA 4O2AA 1ML3A 3IHTA 4O33A 4CMGA 2LCQA 1NMQA 3ZJUA 1LUAA 3PFFA 1MVOA 2DQ4A 4ODIA 1D0IA 1TO6A 3LNTA 2IDKA 5DNWA 1KGSA 1X7XA 1JDSA 2ATCA 2YMMA 3P52A 4I14A 1II0A 2IL1A 5REQA 3EPKA 5LYYA 3UAZA 1E2BA 4GMDA 1PJ4A 4BZQA 4CLHA 3UF0A 3W5HA 4ARZA 2QUZA 3BWCA 4DARA 2ACVA 3UT0A 5B6PA 4Z8YA 1EM8B 3UA4A 3GLUA 2FZKA 4RWZA 2JC3A 2O3TA 4IL5A 3SP1A 1MDBA 4QOJA 4CQMD 2PSEA 2X6TA 3RU9A 1HDGO 1CJKC 5ECDA 2GUGA 1H93A 3KUCA 5K09A 1EJ0A 2V9PA 3IXLA 3WR5A 3X1WA 4Q4CA 5ALJA 4P32A 3G8DA 1GJRA 2EWMA 4WBSA 2PUDA 4EY8A 1L7DA 3QJYA 4ZZ3A 1NZFA 1H42A 1Y7LA 4IIJA 4UMFA 4V0KA 4NXNB 4K8RB 1FP6A 4E14A 1S1MA 4MZDA 2GSDA 2X9LA 3LKZA 4EHNA 1U8ZA 2WD7B 3AC0A 4RADA 5HE8A 5BP7A 2B3DA 3SR4A 1IATA 1A8SA 1X1SA 3EC7A 3WNBA 3JWIA 3WB0A 2BFOA 3JQBA 3LPDA 3R0IA 5ILQA 3GLRA 5CT4A 3KZVA 4ABYA 1HFWA 5ILGA 1ZPDA 1XQ9A 3QQPA 4WXYB 4NABA 5K8LA 4D96A 3A3YA 1B15A 1LKZA 3R41A 3W6OA 1V8DA 4AAYA 2PUJA 4QICA 4BEJA 4IXWA 1G0OA 4C6TA 2O8CB 4JT8A 2O05A 2G25A 1L4KA 3H6HA 2HMTA 3BMOA 5EUCA 5BQ5A 3OMWA 1VL8A 3MD0A 2C9OA 4HS4A 1K5PA 5LQCA 1PL0A 1OOEA 1E9DA 3MERA 3OKFA 3GLKA 2CMHA 1OX5A 2AJDA 3R23A 2WM9B 3DUFB 1ZR4A 2PGNA 4LI3X 5C35A 5AKIA 1DC4A 3MTBA 3RBZA 3TTVA 5JNVA 1QHYA 1WCIB 1TM7E 3GVIA 3K6JA 2Z9BA 3JARA 4BO7A 1RMYA 1XU9A 5HTKA 1G4HA 2WIJA 3PHBE 1BXGB 4OOEA 2P9ZA 2VDVE 3JYOA 3N5KA 3KQPA 3D4PA 4CL3A 2JG3A 2P9GA 2JPDA 5K0NA 3CLKA 1K7FB 1Y8QB 1QH8A 4I4LA 3PQFA 1GAEO 4UU0A 2HLDD 4ITUA 2AN9A 5CU7A 1E2FA 2ZRAA 5E6SB 1E3IA 3NYQA 2QU8A 3OPYA 2EBWA 2WAYA 1TJPB 1ZVKA 3CVOA 1W8IA 1WF3A 1ZM9A 7MHTA 1DARA 4A91A 5ANRB 4PYOA 5KWEA 3NIBA 4EG5A 4HRVA 4RKEA 2VDPB 3LP5A 4PYIA 1X7YB 3IBCA 4FWBA 4NBUA 3OZWA 3AEKB 3LAWA 5KJEA 4CCYB 4DG5A 5EMHA 2RH4A 4V3CA 3NYWA 1CCWA 4G1MB 3C87A 2HDNB 4O4IB 4UUAA 4WL0A 3A9CA 1LK7A 4OM8A 4NL4H 5EZYF 1G20A 4ISBA 2RSLA 4WZBE 3UJ7A 3W8DA 1QAMA 4RJTA 2PGJA 3RVLA 1FQOA 4U3JB 1U0LA 1CUWA 1YS7A 2YWXA 3Q9NA 3CNBA 3KJGA 2JHAA 3N8HA 4ZOAA 1KR5A 5KCMA 1E4EB 2V8BA 3O6VA 4P98A 5F12A 1DELA 4JI3B 2FWIA 4KQKA 1VFNA 5I7SA 3SQXA 1LBIA 2XCQA 2H2HA 1R0CA 1R0KA 1RJ9A 3ZGOA 1KEEA 2OG1A 4FNOA 1P31A 3VR1A 2VHUA 4YAUA 1LB1B 1QYXA 1Z0DA 2PXHA 3G89A 5KWJA 3HU5A 5BR8B 2V5AA 2C2ZA 1E6UA 1V9SA 3TXXA 4NG4A 4W8HA 4G5SA 4C4YA 2PO5A 2ZTHA 2I2BA 3LUGA 1ODLA 5KTMA 1LW6E 5CM2Z 1UL1X 5BQPA 4AJ2A 1VSBA 2UZ1A 1NN1A 2XAAA 4CKCA 4QYXA 4JJKA 1DADA 1TGVA 4DDKA 1EB9A 1PL7A 3WHKA 4TRJA 4C0SA 3PC6A 3UK1A 3DZJA 2MU1A 3BMQA 1M6VA 2IP1A 1XX6A 3A7EA 3NH6A 1COZA 2BMWA 4BZWA 1KPIA 3IIJA 3LDGA 5MN5A 2XUJA 1U9IC 2JLYA 4LBVA 4HNUA 4IXMA 4ZAGA 1JQ3A 4JHLA 1BS1A 1JAHA 4CMBA 4YAFA 1IQRA 2Z2XA 3GAZA 3OJOA 5BNFA 5KYWB 3T5AA 1TLTA 3PDJA 3AM1A 2VEDA 3JYNA 4C0QC 4HBGA 1ZM7A 3LSYA 4KX5A 2X4LA 1XMQB 4BE9A 1OXXK 2AMFA 5G0VA 2BGWA 3VC3A 4EOGA 3LUAA 5CA0F 2K2QB 4HC4A 3TDMA 4I4CA 1TK3A 4M6WB 1FFDA 3EDYA 4RY9A 1QGYA 5BORA 3P2EA 3ZWKA 3BK7A 4YCBA 2V7BA 1W96A 2B3TA 4LGYA 2WQ7A 1NTRA 2OL4A 4C2AA 1BCRB 1S8NA 4J49A 4GM4A 1XB2A 3HDTA 4AS2A 3R7NA 4IH9A 1Z18A 2PT5A 5FR2A 5HJ7A 2QVLA 4TKLA 2O3JA 4DV6B 3RVRA 4LXXA 4ESVA 1DBWA 1TUGA 2R8PA 5HK8A 5ICGA 3WL8A 4DV5B 2XXBA 2OBYA 2HAEA 4IUDS 4COOA 1FPMA 1RIIA 4UFNA 1NF8A 5JLAA 4AECA 1ZMXA 4HUQA 4IRUB 5ALFA 3WADA 2KMLA 4O3MA 2RHDA 3IP6A 5BSUA 3ZI0A 5BV0A 1DT5A 2OCDA 4WLOA 4EFDA 1KEPA 3DFIA 1FX1A 4RZ3A 2O5CA 1P0PA 2XD9A 1TFRA 1TIPA 1J2RA 5D7BA 4B47A 4HYEA 3GFTA 1Q14A 2FFRA 3WWPA 1EP2B 4DR6B 1JXAA 2I2DA 2GFQA 2KE5A 1E89A 2RGDA 3GRRA 4L6AA 3H17A 5GV7A 4BLRA 4LXQA 4F3YA 3HJAA 5FBQB 3NHRA 2IZ7A 1XG5A 3IKLA 1HDXA 3CG0A 4MUKA 4FHGA 2PQMA 1FUKA 1Q50A 3OICA 3Q7TA 3HL4A 2QD4A 2IE0A 3EVCA 5DNUA 1O94C 4F8JA 4UM9B 4PLHA 1YV9A 4C2BA 1W35A 1L4YA 2HD4A 2WJPA 1G5TA 2W22A 3D7LA 4CJXA 1DU4A 2YJTD 2CDAA 3NV9A 1MO3A 4RZ2A 4CLOB 1DAMA 4ZI7A 1UH5A 3EQ9A 3I83A 4D82A 3TM5A 3B60A 4C14A 3M0EA 4HPWA 2NACA 3B36A 3FAZA 1JG7A 1FSSA 1I6WA 4AURA 3W5BA 4DR4B 2PKQO 4WJKB 3VSAA 1A4XA 1EX1A 1Z2OX 6PFKA 3GUUA 5B3LA 1IHDA 4Q21A 1N32B 2V97A 3PPXA 4D3DA 1DWPA 3M4NA 3QV2A 1OLSA 4QG7A 3A58B 4MSUA 1OHHA 2ZVJA 5H70A 5FDFA 1C4XA 4P31A 3NRCA 1G0NA 4HZUB 4I8IA 3LX5A 1VJ0A 3KWFA 2CLLB 1T4GA 2HNKA 3DO8A 3J7TA 3WYCA 4KZPA 2QT1A 1TO1E 5ALYA 4RMGA 7ABPA 3IJPA 3HHEA 4AB1A 1JG6A 4CRWB 3ZCPA 1VL0A 4Q05A 3VDQA 2P78A 4HTFB 1ZQ9A 3HXLA 3HVRA 5AM0A 3QU9A 1OV4A 2WZBA 3M5DA 1QGED 4P80A 1XCLA 2WE8A 1Y5IA 2C2GA 3K0KA 1DBQA 1YR1A 2V0NA 3UJ6A 3KYCA 2GRUA 4L9SA 2GDJA 3MB8A 2R9VA 1V47A 3CR8A 1I3NA 1GAQA 1V7QA 1CZHA 2NN3C 3RGGA 1XJQA 4I3FA 4BFVA 4E6EA 2J6HA 1L5QA 4YJ3B 3TR0A 2I29A 1FNDA 1EQUA 4BU0A 3C3YA 4ZO9A 4F3CA 2A59A 1QQ6A 5J40A 1ZHHA 1U0OC 2BM9A 1JDBC 4MGYR 3X43A 4UNRA 4LF8B 3KFVA 4I1YA 3ZY3A 3ZWBA 1NBMD 4ARVA 2PT9A 1E2IA 5FKJA 5FOVA 3FDZA 1MMFB 1NXXA 4RPCA 4ATNA 2C7VA 1H4VB 3ZXIA 3KYIB 2DKNA 2BFNA 3A6EA 4LFBB 4ZEWA 1AKTA 1E61A 2H7YA 4FT4A 1RPAA 1PX0A 5KHAA 3TCNA 3WIBA 5JY1A 4BO3A 3IAS1 2RD2A 2FNAA 1YQWA 1FDWA 3FDFA 3FN4A 1SXQA 4W5NA 2RJOA 1G6Q1 2WIGA 2EATA 2OHGA 1H1TA 4FEEA 1QPZA 1B6TA 1W30A 4DLUA 2IPOA 3MGKA 1Y9JA 3RC8A 4Z4QA 2PFSA 3HB4X 4C6SA 1GQOA 3H3FA 2HPVA 4GZ6A 4QU5A 4LC9A 4QTZA 4EF5A 1DKNA 1SD2A 3P0HA 3QFCA 3QPVA 5HGXA 1FXWA 1USUA 2OAQ1 5I45A 3I53A 5JTTA 4C7KA 1Y33E 2QM7A 1HQCA 4V0OA 5FWYA 4TLBA 5DGIA 3T1YB 1FTSA 1J42A 1JKJA 3R3ZA 4LF9B 2ZUEA 2Y8EA 1GLGA 1KI2A 2ZK7A 2ZZKA 3DLAA 4M21A 4B3HA 3FNBA 3SXJA 3IP8A 1HRKA 2GN0A 2J30A 1Z35A 4EGFA 3O8DA 2QLBA 4KL8S 4M37A 1F2DA 3NTVA 1GTSA 1FJGB 3UTDA 4RQTA 5B37A 3NNDA 2H06A 3K8YA 3CJQA 1PBTA 3HU3A 1XCOA 2X19A 4UFOA 4N12A 5AJTA 3M6UA 3S7ZA 3RYIB 3F96A 1VI5A 4MV3A 1IHXA 3IIEA 2QTNA 3LGXA 1XTQA 4EW1A 2XQGA 4UOZA 3UUFA 1EUCA 5D00A 4O4JA 4FILA 1D1PA 4LQLA 1W87A 4JELA 3Q11A 2G72A 5DGDA 3RBVA 4AKSA 4KP7A 1TPZA 4MVJG 1KY2A 1NDQA 1KDRA 1MJGM 1ST3A 4C7VA 4ENQA 5CB4F 4S1PA 2V5UA 1AZTA 4E5KA 2V6FA 4M0KA 3AOGA 3HJGA 1L8QA 4Q4HB 4TKVB 1SCIA 2DFVA 2VWQA 2BEJA 4CPDA 3Q7QA 3JD3A 4MYSA 1TU4A 3ORFA 4N82A 2O5EA 4G26A 5T64A 1JA1A 1QTNA 3AJEA 1RWMA 3WJ1A 2BUAA 2PVCA 1B43A 1MJFA 1I5EA 1QZ3A 2EFCB 2IHYA 2ZCJA 2FZ5A 1GU7A 1WIWA 4ZQEA 4LJ5A 5K5EA 1IWBB 1RBMA 4L5IA 1U3UA 4BBAA 3C7TA 1V8FA 4PZ9A 1DIOB 1VZ3A 4RVOA 5CTAA 1XA3A 5L6LB 1IMOA 2RG7A 3HL0A 3OZIA 4K2AA 3DV0B 2J3QA 2ONZA 3PX3A 1XVAA 2IEGA 4MNTA 2NU9B 3WMRA 1AQUA 2HA4A 2O57A 3A6HA 5KS2A 1ZGBA 1GUYA 2ZI6A 4RL6A 5P21A 3ONNA 3PQ3A 2FW8A 3O92A 3VPAA 3WOVA 5C52B 5BQFA 5JCJD 4HH1A 3VDXA 1HYEA 5MGNA 3AI3A 4RW0A 4AWBA 1C9YA 1QNLA 1GTL1 5EESA 1QVAA 4DR5B 5J59A 2E6KA 2PSHA 2QR2A 4S0XA 3JAWA 1LJUA 3DXZA 4MVJA 4QKQA 2XTNA 3QVMA 4Q3AA 3LM8A 1US8B 4ICIA 3FUCA 5IVPA 2XCOA 4NFHA 1KQNA 1DIRA 2N9UA 3AR2A 5EGNA 3VO2A 3W2TA 1D07A 1JAXA 3O1IC 2PSFA 1YZNA 1G8HA 3EWNA 4YAOA 1ESZA 3BTOA 3DFZA 3M83A 1FU4A 3EZ6A 3JQPA 5FNZA 4IF6A 5ECYA 4RNDB 3TYXA 3OJEA 1IJEA 2WZQA 1W2HA 1O9GA 4IFBA 3B1WA 4KE7A 1DC5A 3E7XA 2DPLA 2MMGA 1GA1A 4LBWA 4Q4DA 1UP6A 4XB6B 4NECA 2GUWA 1P45A 2IDZA 1AXEA 3LO5A 3AB8A 3IR6A 4MVJD 3H19A 1B0PA 4UOQA 4RMJA 3S3TA 5AVWA 1XL1A 4WNAB 3SJCA 1GPUA 4IMPA 1EIWA 2O2JA 2VSXA 3BHMA 3NTQA 1JE0A 1GVNB 5ES4B 1PFKA 4FLEA 4R7GA 4WGGA 1W2GA 2KWIA 1KAQA 3I2JA 5BSRA 4H6PA 2ADFA 2AJTA 2DLDA 2OGWA 4XZ3A 2VCEA 5B1HA 4DNFA 3EZFA 3S29A 2X6QA 3HM9A 2YV5A 1HT1E 3EIWA 2C1XA 3G7UA 2Q5QA 1KI9A 1TW2A 1U2DA 1DBVO 3E2PA 4JB3A 5LQMA 2OORC 2ZJ7A 3GN2A 1IM2A 2KSQA 2A1UA 2ET6A 3QVTA 1A7UA 4OU5A 4E2ZA 4JLDA 4L76A 1EU1A 1F2TA 1JEQB 2P5UA 2XCLA 3FPBA 2YV4A 4H1HA 2M6KA 4ESOA 2RDMA 1C50A 2JLBA 2D8MA 4EATA 3F97A 2WHEA 1V96A 4K1XA 5THQA 1CUFA 5JXJA 4JBXA 2JI4A 2FSGA 5MHTA 3PJGA 3MYRA 2D0OB 4OYYA 4QGFA 5FAXA 1J2TA 2C5HA 3TUJC 1I33A 2PEYA 1XD2B 3C5VA 4R68A 3FD8A 1ENYA 1HZJA 2OFOA 2D3TA 3D5QA 3W6PA 3WA6A 5KYYA 2D2XA 3GRKA 5HW0A 5HFAA 4CCSA 4LYGA 1WDKA 3GFPA 3STTA 1CIVA 1ZN2A 1LGYA 1XO1A 3EZ9A 4ZAYA 4TXLA 4BO9A 3L04A 5BW5A 3A6GA 3DE2X 5FB3A 1SC3A 2YVKA 2FEPA 4HGRA 1NC3A 1EBFA 3EOAI 4UJ5A 4IGEA 2GVZC 4XGKA 4IJWA 3OZFA 3USZA 4H1WA 2OBLA 1NLUA 3I76A 2VOEA 1JLSA 2PUEA 1Z5UA 2ZT6A 5EIAA 3TOZA 1E4OA 2A9JA 2CK3D 4QYMA 5DBOA 3WWYA 5K0BA 2P4EA 2RB4A 5LB4A 3H1EA 3V4ZA 3L18A 5ALTA 4DQDA 5CJPA 3WMFA 2B2CA 4YDRA 1MFPA 5I9IA 4RIGA 2D1RA 1OB2A 3K5WA 3U7EB 4OI2A 2J7KA 4PSUA 1Y5MA 1LWNA 4YVFA 4X6XA 4G0MA 2FMHA 4P0PB 2Q5CA 4LHVA 3OETA 4N7JA 4QYSA 1ZBQA 5IARA 1LWOA 3D6NB 2V03A 4DS3A 3CIFA 2Y76A 1JRLA 2WAAA 2O5VA 4J16A 5KVAA 3E27A 2RBKA 4K88A 4JODA 1XC7A 1GZ5A 1TAHA 2PBLA 2Y1LA 3GW8A 4LGVA 4NQRA 4QX6A 2YXPX 1RLIA 1VLMA 3DV9A 1E1CB 3HGTA 3VHLB 3ECCA 2QS9A 2Q9BA 2Y1GA 3CGGA 4Z7QB 1M6HA 4V38A 1BDJA 2HF2A 1B3RA 1DIHA 3JZAA 4NH0A 4U63A 4YAIA 2VNSA 4TSRA 2GEDA 2ZJBA 4ZXPA 3SDZA 4Z9BA 2WY2D 3OQVA 4BS9A 5K3FA 5FI1B 4B3BA 2VHXA 2YC2C 3B20A 4CF4A 1ZISA 4MQEA 3U13A 1U0HC 1F4LA 2IXDA 3HM2A 3IOMA 4ZPXA 4XRGA 4DMCA 1FFYA 5L4NA 3WX0A 4YYEA 2XUGA 1WPQA 4OHWA 4X9XA 3KSMA 1YJQA 4X41A 3C45A 3GUVA 2WJIA 3KKQA 4G3XA 1N5DA 3DMGA 3LPAA 2IZ5A 3QUAA 1KEEB 4RD6A 3HRHA 1EFHA 4NICA 3BVPA 3AUYA 3LCRA 4RU1A 4EG4A 3T94A 4Z6KA 4HQOA 2W11A 3E58A 4JUAA 4Q19A 3RABA 4RAOA 2G0TA 2NZVG 3IUBA 1GZ6A 1HY3A 1XCMA 1V5EA 2O6LA 2VDNB 2ZOSA 3ACCA 4DYDA 4S04A 1D2CA 1I3KA 3FSJX 4US0R 1S01A 3MN1A 3CXRA 5ADVA 5E3JA 1UM8A 2FGJA 2FWAA 3OQIA 4R1SA 4BNFA 1B4DA 2GWHA 3MCVA 5HGJA 3F2VA 3ZD8A 4AG3A 2BBTA 1V11B 4BGDA 4DM7A 4B4KA 3HYLA 2B20A 4YT2A 1SUDA 1NXSA 2BH2A 4EUSA 4DVGA 1BWPA 3LQKA 4YXWA 1W25A 3EG9B 5J5AA 3OTQA 2W2KA 1Y9ZA 2WE7A 2XGSA 1MX5A 4FGWA 2B99A 3HNPA 4H60A 4RXTA 4TMVA 4XI9A 5AHRA 2CLMB 4A6DA 4CW7A 3T15A 5F9MA 1Y9DA 4CMIA 2VAPA 2YOHA 2R8RA 5JS6A 2PPLA 2QW1A 3AB3A 1II8B 1D4FA 2A7XA 4C0LA 3O21A 2P6UA 1PWZA 1XYGA 3LD9A 2AHOA 1XELA 1VIVA 2ZP1A 3EPRA 3LKBA 1F14A 4JIGA 4C3VA 5LWHA 3FCEA 4ETMA 5B4VA 2HXGA 4R2MA 2D5AA 3CSUA 1N5MA 1ISHA 2QE6A 1FYEA 3IMEA 3QLJA 4YXWD 2YICA 1KJ9A 3ZBUA 3EIXA 4YYZA 1M6YA 5B5SA