5CTAA

G158e/k44e/r57e/y49e bacillus subtilis lipase a with 10% [bmim][cl]
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
179
structure length
179
Chain Sequence
HNPVVMVHGIGGASFNFAGIKSYLVSQGWSRDKLYAVDFWDETGTNENNGPVLSEFVQKVLDETGAKKVDIVAHSMGGANTLYYIKNLDGGNKVANVVTLGGANRLTTGKALPGTDPNQKILYTSIYSSADMIVMNYLSRLDGARNVQIHGVGHIELLYSSQVNSLIKEGLNGGGQNTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Esterase
publication title Crystallographic Investigation of Imidazolium Ionic Liquid Effects on Enzyme Structure.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 68
structure length 179
sequence length 179
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 2015-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01674 Lipase_2 Lipase (class 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5ctaA00
1P0IA 3D7RA 5AM5A 4D9JA 4J3JA 4BP9A 2H7YA 3QZUA 1ZGBA 3ZPXA 3O9MA 1DWQA 2XUPA 4ZXFA 1ETHA 3UUFA 2WM2A 4HS9A 4ZV7A 5T4EA 5AKEA 2WKWA 3C6XA 4QLOA 4J0KA 3HXKA 1XRRA 3G0GA 4X6XA 5C8XA 2H7XA 5AO9A 5DNUA 3AIMA 1H22A 1CUDA 3LIPA 3GUUA 1ACLA 3WL8A 3WLAA 1Y7IA 4UBKA 2WG2A 3F98A 1MAHA 1C7IA 1ODTC 1CUGA 5IVIA 1LZLA 1A7UA 2UZ0A 1E3QA 4U2BA 1XZEA 2XUQA 1IUOA 5JYCA 3DL7A 2QOEA 4WJLA 4FNMA 2X76A 1VXRA 5D3KA 4H35A 4BCBA 5AI5A 3B3QA 2XQGA 2XQFA 3C70A 4K6GA 3STUA 5AM0A 3HZOA 3R3UA 4PV7A 5EHZA 4PSUA 4B6GA 2BFNA 2ONCA 4Y2YA 1BN6A 3R3ZA 3AZOA 4NS4A 5KWJA 1ZD3A 4EY4A 4GWLA 2VJDA 3BJRA 4QDOA 1YS2X 2XQJA 5CT6A 3STVA 2B61A 5AK4A 3R3WA 3PUIA 1CUUA 4UHCA 3QMVA 5HZGA 1QIDA 3WK4A 4EY8A 2ZJ7A 2WUEA 4U2DA 3IULA 4BZZA 4KRXA 5FPPA 1LZKA 4FNGA 3MUNA 2XMRA 1A8QA 2XUFA 5DLPA 2HM7A 3ZLUA 4XWGA 3M3DA 1JMYA 1MPXA 1BS9A 3PFBA 5HFNA 5EIEA 2J4FA 4CIBA 3WKAA 3QMMA 2BJHA 1XZHA 2CZQA 3WK9A 5LZ9A 2QJWA 2B9VA 4I19A 4B81A 3DOHA 4H7JA 2WIJA 1R88A 1VXOA 1H23A 2ZYSA 4C4XA 3O4GA 1WB6A 3OM8A 3EQ7A 2WHPB 1LPAB 5A7FA 2Z8ZA 2VJCA 4AB1A 1JMKC 5JANA 3FWHA 4DMHA 3EF3A 4J0CA 1VZ3A 3I6YA 2K2QB 4BVJA 4A23A 4P93A 5AH0A 4BBZA 2JGJA 4G9EA 3I2FA 4W1RA 3C6ZA 4MXDA 4AXBA 1DWOA 1L7RA 4J7AA 1XQVA 4IH9A 2PU5A 2CJPA 4AO7A 2B4KA 3GBSA 4E46A 1WPRA 1UK9A 3VJMA 3I2GA 2ROQA 4H7KA 4KAFA 2WU3A 5D7BA 3O0DA 3FOBA 2ECFA 5AM3A 1GGVA 2PSEA 5ALZA 1HDEA 1AC5A 3QH4A 5AKHA 1YR2A 5AK6A 2HFKA 3FAKA 1QOZA 1XRMA 4DNFA 2Y2UA 3H1BA 5CBKA 2LIPA 4H77A 4CCWA 4QZVA 4B9EA 4CG1A 3F97A 5ALSA 4KE8A 3VJLA 4CI9A 5CT8A 5LZ7A 4I4CA 2ACKA 3JW8A 1NU6A 5JD6A 5CMLA 1CUYA 2GYUA 2NW6A 5DNVA 5IH7A 1I6WA 1EH5A 5A7GA 5AKKA 1C7JA 3QVMA 4WFIA 5ALHA 1P0MA 3JWEA 1CUCA 3GFFA 1UK7A 4UHBA 4O08A 4QA9A 3GA7A 4C87A 4ZREA 1M33A 2HU8A 4UHDA 5EHXA 2DQYA 1UKCA 1R9MA 3NWOA 4Q05A 2EDCA 3LS2A 2PPLA 3SC2A 4BAGA 4P92A 5JIBA 4Q82A 3ESBA 3WKEA 5A62A 3F8SA 4Y2VA 1F0PA 5BWBA 1JJFA 5KREA 1MNAA 3I2KA 4TGLA 3HYSA 1MU0A 3QITA 4QDUA 2ZYIA 2V97A 5HF8A 3WK6A 4PO3X 5JZBA 5LLSA 4IH1A 4B0OA 2EEPA 3M81A 2YH2A 4MYSA 5ALLA 3V9AA 2FUKA 1TK3A 1Y7HA 1UFOA 2ZYRA 1DU4A 1W1IA 3WZMA 4C89A 1UZAA 3DYVA 4S0XA 3L1HA 3PFCA 1ZD5A 2PL5A 4EY7A 1HKHA 1QJ4A 1K8QA 4BP8A 4Q3KA 3D2CA 1N1MA 4UFOA 2C4HA 1C4XA 4V2IA 3V1LA 3RKSA 2W6CX 4U2CA 3H04A 2CMFA 4ZI5A 1DT3A 4MEAA 3AZQA 5T4FA 3OPMA 2AJLI 1QZ3A 4Y2XA 3FCYA 1XQYA 3HI4A 2Z3ZA 1R4ZA 1XRQA 4OCZA 1E8MA 2JGFA 4X91A 1AQLA 1UOPA 4OB6A 1H2XA 2R8BA 1TCCA 1R9NA 5FLKA 4C4YA 1GXSA 4LXHA 3PDCA 1THTA 4RE6A 4DMKA 3QMWA 1PJAA 4Y2QA 2HFJA 5LZ5A 3AILA 3WYDA 1CUJA 3D5EA 3WWOA 5AOAA 5D3ZA 1K4YA 5BWCA 4U2GA 3R3VA 4XVCA 3FVTA 1CV2A 1OCEA 3LCRA 4C4ZA 2PSHA 4HAIA 2I78A 3SX4A 5LZ4A 5CXUA 4E15A 3ZI7A 5AM2A 5CT9A 4X92A 4WDRA 2ZJ6A 1JU4A 3E3AA 2AJ8A 4QDZA 1T2NA 5HQ3A 2OCIA 4FDMA 2HA7A 4Q3OA 5AKXA 3L1JA 4OPMA 4DLNA 1UOOA 1QO9A 2XUKA 4GXNA 3WWDA 5ALDA 1DT5A 4G4GA 3TJMA 1EK2A 4B9AA 4RPCA 1SFRA 3W2TA 1XZDA 5LKRA 4ARBA 2QXUA 4G4IA 5H3HA 5A2GA 3WJ2A 2O2IA 2Y2VA 1QTIA 4CG3A 5IVDA 5CURA 1IUNA 5JD4A 3BF8A 3F9CA 3E0XA 4BVLA 2G5TA 3FCXA 4CFSA 2V98A 4G5XA 3U1TA 1XROA 1X2EA 3RK4A 4KAJA 1QFSA 5FUMA 1CRLA 3UUEA 4C01A 2PVSA 3ANTA 4PNZA 3AZPA 2WFLB 2Z5GA 1MO2A 4X71A 1Z68A 2RAUA 4B7ZA 5AKLA 1OILA 3ZWQA 1D07A 6YASA 1H2WA 1F8UA 1GQSA 2C5FA 3N2ZB 2ZSHA 1EXWA 2G63A 3OURA 2C7BA 4A16A 1NU8A 3EIOA 2P8SA 4B0PA 1L7QA 3BF7A 1W6RA 4EB0A 2PSFA 4QDTA 3QPDA 1JU3A 5ALFA 5ALUA 4L3WA 3ESAA 2XUGA 1CLEA 2HA5A 2QS9A 4FLMA 1ZD2P 4W9RA 2JBWA 3SWWA 3IVMA 3RARA 4YX9A 3QBJA 2QR5A 4FBMA 2JGLA 3WZLA 1H2YA 2OAEA 1XKLA 5C81A 4J0GA 4EA6A 1FSSA 3TRDA 1QIIA 5KWIA 4BYMA 2I3ZA 3O4JA 5AI0A 3WL6A 4JUIA 5YASA 1R1DA 1MX5A 1TKRA 2AXEA 2JEYA 2OLEA 5ALOA 1B6GA 2CEKA 4EHBA 4X95A 3G02A 1UKAA 5JZSA 2XE4A 1WHSA 2RGUA 3DCNA 4N8SA 2HRQA 2HU7A 2HADA 1QIKA 3OTQA 3D59A 4NMWA 4BVKA 3DS8A 1BU8A 3QPAA 4WFKA 1XZKA 2HA3A 3I2IA 3F67A 2JGIA 3WK7A 2BUCA 3OC0A 2VQ6A 4G8BA 5K3DA 3WYNA 1IVYA 2VTVA 1LGYA 2WUDA 5FXMA 4F0JA 1SCQA 4UFNA 2FJPA 5A71A 2X5XA 5E4TA 1CUBA 2HU5A 4MJ3A 5AM4A 5AOCA 2HA2A 1MX1A 4AZ0A 1JKMA 5HK8A 1UOQA 2RONA 3O95A 4UBIA 1GKKA 3DJYA 2XDWA 4FOLA 5CTAA 4BE9A 2XT0A 2JF0A 1QFMA 1RYYA 1QIMA 2GYWA 5FV4A 4OYYA 4M0FA 3BL8A 1ZICA 3G9UA 1YAHA 4H0CA 3WA7A 1EVEA 1VE7A 3WKBA 1CUIA 2BAGA 1ORVA 1IZ8A 2C0QA 3I6MA 3QM1A 2ES4A 2BGRA 5LZ8A 4UBNA 4JYMA 4FWBA 1VE6A 3W9UA 5BOVA 1XRNA 1Q0ZA 1N5RA 4AQDA 3ICVA 1CUHA 5AKYA 5AI4A 3W05A 5JADA 4QDXA 5HKAA 3F96A 3IBTA 2WJ3A 3WWCA 3GELA 5JD5A 3DEAA 4DTCA 2WTNA 5DTJA 5FKJA 3O4IA 3G0BA 4J0JA 1PV1A 5ALRA 5CRIA 5FDFA 4Q1VA 3HRHA 3B5EA 1CPYA 4UHFA 1U4NA 5LP1A 3OG9A 2RI6A 3PI6A 3M82A 4NZZA 4M0EA 3H2KA 5E2IA 4KE9A 3X3HA 1DINA 3IUMA 4X97A 2Z8XA 4UBJA 4BAUA 4FHZA 3BWXA 1G42A 2Y6VA 3W04A 1XZMA 4BCDA 5HF5A 1UKBA 4BDSA 1VOTA 4QWMA 2PBLA 3G9ZA 4TPKA 1E5TA 5F4ZA 5AI8A 2DR0A 5K3EA 3PE6A 3A2NA 4DM7A 5DNWA 3IIIA 1ORWA 5ALQA 3HC7A 3CXUA 1TRHA 1CIJA 5ALMA 4X6UA 2C0PA 3BIXA 5HF6A 2FJ0A 1QIHA 2QM0A 4K6HA 2QZPA 2R11A 4PSCA 4B82A 4ZRDA 5IVKA 2WILA 5CH3A 4QLAA 4UBMA 2J4CA 4KE7A 5K3FB 1E8NA 1ZI6A 1MN6A 4MYDA 2GZRA 2WJ4A 4E11A 1ISPA 1U2EA 3CCBA 3NOXA 2H9YA 4BZWA 3A6ZA 2HA6A 2VT7A 1ZJ5A 5AI6A 5K5EA 4X93A 2QKYA 4H7HA 3UMJA 1Q84A 3C45A 4ZV9A 1DQZA 2HIHA 3BDVA 2AJCA 3D2BA 1LPSA 1UT6A 3V1NA 1OXMA 3ANSA 4MQLA 1BRTA 5I7UA 3KOOA 2QUAA 2BUAA 1ODCA 4BAZA 1BE0A 4IO0A 1WHTA 4WFJA 1E66A 2WHPA 1FFBA 2G5PA 4BCCA 4OYLA 3HJUA 4PSDA 2WSLA 2OXEA 4FFWA 5ALYA 1AZWA 1QONA 1USWA 1LBTA 4CCYA 2GZSA 2WIDA 5K3AA 1R50A 3FLAA 4LXIA 5ISMA 3FSGA 3I2JA 5HQ3B 3AINA 1R3DA 3IUQA 1VJ5A 1MT3A 1X70A 1SCKA 4XX1A 4GI1A 2DHEA 4KYVA 2YASA 1BROA 1J2EA 5CW2A 3JYHA 1TCBA 1IZ7A 1IUPA 3H2JA 2J3DA 5J3JA 2OAGA 3WQHA 2WIFA 1ZD4A 5AP9A 4AN0A 5AKIA 2DSNA 2O2GA 2HA0A 2VT6A 5HK9A 2HHAA 4ETWA 3N0TA 2VJBA 3DD5A 1EDDA 4UBOA 3ICWA 5SYMA 1CUWA 5JAOA 4P9NA 4I3FA 2ZJFA 1DX6A 5ALPA 3IUNA 1XZFA 4C6HA 4DNPA 3D2AA 5I9IA 2X8BA 2C58A 3AFIA 1TIBA 3KSRA 5D6OA 1LPNA 3FVRA 2W22A 1YASA 3YASA 2OPHA 4PF1A 4EZIA 2CKMA 4JNCA 4F21A 4XIIA 4KACA 4GDMA 2QMQA 4N5IX 5ALWA 4AX4A 3AUKA 2DHCA 3DNMA 5ALXA 4Y2PA 2GBFA 2PKYX 1VLQA 1QIJA 3IURA 3R0VA 4W63A 4BDTA 5EIAA 4X94A 1G66A 2PU7A 3D3NA 1QLWA 2XLCA 1ODSA 2DQZA 4QNNA 2ZYHA 4X6YA 3WWEA 1THGA 5KBYA 4Y2UA 1CQWA 3GROA 5K3CA 1BEEA 3AIKA 3VJKA 4EUSA 3WA6A 3C8HA 2VA9A 1ZI9A 2XMDA 3VKFA 1B41A 3E4DA 4KJXA 4CG2A 3LLCA 2QVBA 1GT6A 1QO7A 5ALIA 1XZGA 4FLEA 1EDBA 4H7FA 2HA4A 3I1IA 1J1IA 3STTA 1SCIA 3IA2A 5LYYA 2ZSIA 1G5FA 1XLWA 1XKTA 4Y2SA 4AO8A 1CUAA 1XQWA 4LXGA 4Q34A 4TVKA 4DMCA 1TQHA 1K6EA 1LPBB 1NX9A 2OGSA 5T4HA 4Y2JA 1QGED 1YB7A 3H2GA 3KWJA 1LPPA 4KR0A 4A5SA 4H7DA 4FMPA 2QTBA 1HPLA 1LBSA 4ARAA 3QPCA 5A6VA 3FYUA 1CEXA 3WMRA 1O6GA 3RM3A 4X85A 5C8ZA 2YXPX 5E4YA 4Y9SA 3VVLA 2XUIA 2C5GA 3ILSA 5IKXA 4N8DA 1LNSA 4ITVA 5EIHA 2XQIA 1QE3A 1XZCA 2QJRA 1WB5A 1XRPA 3G7NA 3R3XA 3IDAA 3AJAA 3KD2A 1HBJA 1YSCA 2PUHA 2QXTA 4L72A 4ZGBA 7YASA 4GLBA 1F0NA 2PSDA 2O7RA 4G1FA 2OG1A 4K6KA 1CUEA 1DQYA 1AGYA 2Y6UA 2J3QA 2WG1A 2HL6A 3WL5A 4YPVA 2ORYA 3HACA 5ALTA 5LKAA 3FLBA 4J03A 2XUOA 3A2LA 2DHDA 3WIBA 4BE4A 5EGNA 5ALVA 3I2HA 3MGAA 4GHWA 4Y2TA 5AIBA 1WPXA 1WOMA 1EB8A 2Y1KA 1GPLA 4G8DA 3WJ1A 3PF8A 4MWTA 1XRLA 4X3CA 1XQXA 3WK8A 5LIPA 4FTWA 5E4JA 1IMJA 3LIIA 1VZ2A 2RHWA 4WY5A 1DTEA 2HDWA 2WTMA 1EA5A 3FBWA 1ACJA 1ZIYA 4F60A 1TCAA 3ESDA 2OQVA 1VA5A 1H2ZA 3RLIA 3Q0TA 2BKLA 4UUQA 1RWQA 1KU0A 3P2MA 2WLSA 2VEOA 1L7AA 2BGNA 3MVEA 2XUJA 2WFLA 3G9XA 4N8EA 1MTZA 1EX9A 2OQIA 4BB0A 4YASA 3AIOA 3H0CA 1DWPA 1JJBA 2IX9A 2XUHA 3K2IA 1QTRA 5JAPA 3I28A 2D0DA 3H2HA 4UBLA 4RE5A 3GZJA 3HLKA 2OCKA 4UPDA 4H7IA 3BIWA 2RHTA 3HSSA 3H17A 1ZI8A 3WWPA 3H18A 2OCLA 2EDAA 4BTLA 3Q8WA 5ALNA 4BRZA 5EI5A 5JAHA 1CVLA 4INZA 3IUJA 4BATA 2ZVDA 1UK6A 5EFZA 5FOQA 4DSAA 3VISA 3STXA 2XB6A 1XZAA 4OB7A 5DTIA 5SYNA 4M0MA 4OU5A 2WHQA 5FRDA 4DNQA 1Q0RA 1MJ5A 4X90A 3G8YA 3BDIA 3D4LA 5AKGA 1VA4A 1QIGA 4RNCA 3KXPA 3O4HA 4GECA 3W9BA 4GBGA 3NUZA 5CT5A 5HFAA 5AOBA 3R3YA 1CQZA 4EY6A 3D0KA 4GW3A 3C43A 4HVTA 2GBCA 2O2HA 1YB6A 4OD0A 3WKCA 4LYDA 5ESRA 5AM1A 2H7CA 1YAJA 4MWSA 1GPKA 2JGKA 5CH5A 2Z3WA 4W1QA 4OUKX 4B80A 3BE8A 3CCCA 4JH0A 4BRSA 3I6ZA 2ACEA 3PICA 2B20A 3VVMA 2V96A 4HZGA 1ZOIA 3DDUA 1VKHA 4HTAA 4FFVA 2CB9A 3ZV7A 3C6YA 3WI7A 4BC1A 1T4MA 4Y7DA 1U8EA 4AN1A 3C5WP 2XUDA 1CUVA 1W4LA 2VATA 4ROTA 2XMZA 3MUOA 1LPOA 2VAXA 4CCYB 2GBGA 4FLFA 1GQRA 3G0IA 4LIPD 2WJ6A 4DSZA 3HABA 2PUJA 3E1GA 1BEZA 3PF9A 3DKKA 4OSEA 4AO6A 1UK8A 2OGTA 1EVQA 4F5ZA 3EQ9A 1N8SA 4OB8A 4PQEA 3DYIA 4WDQA 2AJBA 2JGMA 1XZJA 3NGMA 4UHHA 4DYHA 4OU4A 1E89A 1SC9A 4XJVA 2VF2A 3I1YA 5ALEA 5T4BA 2WIKA 2I3DA 1JJIA 4DGQA 3DOIA 5IVHA 1P0QA 3STYA 3L1IA 5AHXA 1CFJA 1FFAA 3WIOA 2GBIA 2IITA 4G8CA 4FBLA 3PUHA 2XMSA 1KU6A 2GYVA 1GPNA 3G9TA 5C8VA 4G9GA 1ZIXA 5AKZA 5ALJA 2QT9A 1MX9A 2DCMA 5AK5A 3U0VA 1YCDA 1FJ2A 2PX6A 3V48A 5DYYA 4W1SA 3S2ZA 1WB4A 3C8DA 5A7HA 4EBBA 4MQMA 5BV7A 3DL4A 4W1PA 4U2FA 5AICA 1QIFA 2XQKA 5AIAA 1KEZA 1YS1X 1PFQA 2JEZA 4G4JA 4AZ3A 4N5HX 2CBGA 3IB3A 4MEBA 1XLUA 5FPQA 3QYJA 3HEAA 3A2MA 5LZ2A 4B85A 4WCVA 2AJDA 5JAUA 1S8OA 5AJHA 4AMZA 5JZ9A 5AK3A 4JYPA 2WHRA 1CUFA 4IQ4A 4L0CA 2WFZA 1TAHA 3ZLTA 1EI9A 3FNBA 1A8SA 3H1AA 2WIGA 5JALA 3OOSA 4KAAA 3C6BA 1HLGA 4Z49A 5JATA 3T4UA 5AI9A 1WM1A 5DJ5A 4C88A 1HL7A 1EDEA 1J07A 4JEIA 1A8UA 1JI3A 1W52X 1LPMA 4NVRA 5HF9A 1K63A 4BTVA 3W06A 2JIDA 3CN9A 4DMFA 3G0CA 2E3JA 5K3FA 5I8PA 2PM8A 4X7BA 1AKNA 2XI4A 4CIAA 1BN7A 1X2BA 2BUBA 5ALKA 1G4HA 3STWA 2Q0XA 4H18A 4J0HA 3WL7A 1W76A 2I03A 3B12A 4B83A 1F6WA 1A88A 4DNOA 4HRYA 2RIPA 5CT4A 3FYUB 4H7EA 3EBLA 3WKDA 1SOMA 3BJMA 2WUGA 3FSGD 3R41A 1JFRA 1GZ7A 4J0DA 4K5QA 2WG0A 2H1IA 1EK1A 4BC0A 1P0PA 1XFDA 3A70A 3DLTA 3C87A 4UHEA 1YA4A 3KWFA 1RP1A 4IH4A 2OGZA 1BCRA 1AUOA 4KEAA 1CUXA 4LHEA 1HQDA 2HRRA 3WK5A 4YK7A 1AX9A 3VDXA 1XZIA 2WFMA 5DYTA 4B84A 1O6FA 1E8DA 3LP5A 4HXFB 3ZLVA 3TGLA 3H2IA 1AURA 3ESCA 1K5PA 4IHAA 1ZGCA 2XUAA 1EHYA 1FFCA 2YYSA 5HCUA 3O9VA 1CUZA 4U2EA 5CH8A 2VJAA 4FKBA 2JGEA 2XLBA 1XZLA 4Q3LA 2WUFA 3R40A 2DFPA 4WY8A 2CUTA 1AMNA 4Y2RA 2VSQA 2QRUA 1UWCA 1MNQA 5JARA 5C7YA 4EY5A 1XLVA 5CXXA 1WCYA 5FP0A 2XMBA 4QE3A 4E14A 2XMCA 2PSJA 4QWWA 4HXGA 3FYUC 4PW0A 2XMQA 3M83A 5DYWA 5HKBA 2O7VA 1ZJ4A 1W75A 4KE6A 3S8YA 3VXKA 1BCSA 4X00A 3FYTA 3FLEA 3G0DA 3H19A 3DQZA 4QEKA 5ALGA 5EHNA 2G4LA 3CN7A 4L9AA 1Q83A 1LLFA 1FFEA 1DX4A 3K9BA 4P08A 3TEJA 3EQ8A 4UFPA 4HXEB 1FFDA 2VAVA 1EB9A 2XMGA 1J06A 4J0IA 1QIEA 5AKJA 1GKLA 2WQZA 3K6KA 4GEGA 1CUSA 2WU4A 1MAAA 4KRYA 4DIUA 3V1MA 1N5MA 2D5LA 2IIVA 5K3BA 2BCEA 3V1KA 5DWDA 3DKRA 5JASA 3T52A 5EHQA 2OCGA 4RGYA 1UXOA 1JT2A 1EINA 1Y37A 3ED1A 2QUBA 3C5VA 3BXPA 3KDAA 1CR6A 3SK0A 1XZBA 4K2AA 1YA8A 4LYEA 4LKOA 4ZWNA 4AMYA 2V9ZA 4HRXA 1U65A 2FX5A
chains in the Genus database with same CATH superfamily
1P0IA 5JJ5A 3E05A 3P7MA 2KBFA 1IN5A 1VFPA 5B6JA 3GB9A 4LW8A 4YP0A 5JT1A 4ND7A 2I2CA 3TLJA 4AY4A 4QG3A 4DVGA 4WOJA 1NI4B 4URVR 1ZH6A 4IMJB 4CF3A 4H2DA 2DYKA 1JR3E 3O9MA 3TNJA 3U7EB 3U9TA 1DWQA 5KSOA 4R2XA 3PHCA 5A1JA 1JAYA 1M6YA 1TU0A 2KLBA 4EJMA 3UUFA 2YXLA 1V6AA 2J3JA 4HMQA 1LQ2A 3FNQA 2MSEB 2ONYA 2XCLA 3W6ZA 3C6XA 3PD1A 4QU5A 2GD0A 2BRUC 4WLFA 5EA2A 3G0GA 3RANA 2GQ0A 4KLCA 2CE2X 5C8XA 4E31A 1M5TA 2GFQA 2H7XA 2ZRCA 4IV8A 4RD1A 5H83A 2I3GA 1H22A 3KQSA 5H80A 5EE1A 2H2IA 1O77A 3ETJA 2IUSA 1HC7A 1R66A 7REQA 3WLAA 1C9MA 3PQ7A 4X64B 1SQ0A 3MS4A 4RIFA 1TVKB 1HFEL 3AETB 3FKSA 2VTKA 1NNI1 5FBLB 4KP7A 1FNNA 1CR4A 3JARB 4LY3A 1OXTA 3B5JA 3JAKB 3QPWA 4AY2A 1PT5A 1CUGA 4C05A 3L7YA 2H1FA 2L82A 1PUJA 3NM6B 1LC0A 4FCWA 5AD1A 3T1TA 3N8HA 5AHWA 3RT9A 4NULA 4AI6A 3IEVA 1BXGA 5GY7A 1OI7A 1U04A 2RDMA 1SBTA 4OK5A 2C2WA 1IUOA 2OHXA 8AT1A 4WJLA 1DFHA 3G82C 3KUCA 2Q49A 2WI8A 4KITB 5D3KA 1FFYA 4IIJA 5IULC 4M9CA 1ULAA 4ZDKA 1ZZGA 2ZJBA 3NAMA 4A0HA 1UM9B 2DPMA 3LBHA 4I4TB 4TQ9A 5CLHA 5AI5A 1E2BA 3EC1A 4P35A 3QIVA 1L1EA 4Q4JB 5FTWA 5EXXA 4Q4HA 1R0RE 3GT0A 4EHIA 5E1OA 1DARA 3AKEA 2VDUE 5HSGA 4RFSB 2JNWA 2Q6IA 2CD9A 4PICA 5J5VA 2FPSA 1M8KA 3TRIA 1DQPA 3MUFA 1ML3A 3ZHXA 3CLSC 1P17A 3TUJC 1P33A 3I6IA 4F45A 2YVKA 3L6UA 4G1UC 4JDUA 4K6GA 1EVJA 3WS7A 3COVA 3RRYA 3QGMA 1NL3A 2NSJA 4BJ5A 2O3UA 1R4MB 3FMPB 3OQMA 5JS1A 3I5YA 4I4TF 3IAS1 3RI3A 1JL3A 1G3IA 1NYQA 1X74A 2ATEA 2V7PA 3KSZO 2X0EA 4ZCMA 4G4SP 3R3ZA 1W34A 2DMRA 3T4PA 1MB3A 1NMZA 2XUZA 2XRYA 5KTSA 4QPZA 2B2XA 2PZEA 3TGWA 1TMKA 1D4ZA 4CMIB 2J3HA 2AHRA 821PA 4ZI7B 1UJ6A 3H11B 5CFNA 1XKXA 3A1SA 1L5MA 4PYRA 4QQ8A 5BN4A 3BJRA 1NVKA 4D1YA 2P9HA 1L4UA 1Y1RA 1YS2X 3IJPA 4JBXA 4RD3A 3RSCA 4WKGA 2WAXA 3T7EA 2PZLA 1D2MA 1YMUA 3K30A 3K94A 5F7ZA 3GMSA 1CUUA 3KXIA 2QT0A 3LY7A 5JJKA 1SVWA 4YP6A 5JVDA 1HK7A 2JLSA 2R7LA 3A37A 2XV1A 4ABYA 4CIVA 5LQUA 5I5GA 1Y5MA 5TIIA 3Q12A 4BP1A 3G8DA 3EG9B 3D6FA 3K0HA 2X7JA 4QHYA 4NNPA 4ZI7F 1NASA 5F77A 2R4UA 3DEJA 4CLRB 1P7WA 2J3EA 2OZKA 4KRXA 5EMJA 3TPZA 1LZKA 2PGDA 3PHBE 1E0KA 4X9XA 3MUNA 4D4JA 1E18A 2HYDA 1MJNA 3MJHA 4HQNA 4JWTA 2XUFA 1HYQA 5DLPA 1KQPA 2P62A 3L5KA 4MW1A 3ZLUA 1VLZA 2HT6A 4BYGA 1AUPA 4QATA 5L4NA 2Z30A 3A9TA 3TPFA 4DSTA 2WMDA 1F1JA 1JMYA 1MPXA 1GNTA 2QLLA 3B1ZA 4H1WA 3E81A 3TZCA 3W3AA 5KOHA 1XJ5A 2Y1OA 5EAIA 3LY5A 4JB0A 5EIEA 4A1OA 1N5IA 4RK7A 1T35A 2I7CA 2XA2A 4FGLA 3WKAA 2JLXA 3ZY3A 3KJNA 4GD3Q 1EUYA 3UG7A 2G1AA 1D2HA 2VTEA 5TF4A 4B81A 4LGMA 4XCQA 1D4AA 3QKWA 5JYBA 1ZJ6A 5KQGA 2WIJA 3FJOA 1VXOA 2PDAA 3HNPA 1H23A 1VYVA 1ZVVA 2WYVA 3VKWA 3ZHUA 3O9ZA 4R7ZA 2DEUA 2FZCA 3NHWA 3L6EA 1D4OA 1EFPA 3R6LA 2WHPB 5JHGB 4RHTA 1H9CA 4J4TA 2ZATA 2Z8ZA 4FX5A 3AERA 4Q47A 3GBVA 1Y8QB 1FF9A 3HYRA 4AB1A 4MUIA 4DY4A 3KAKA 5H82A 3GLGE 4JEHA 2G77B 2ZVQX 3LECA 1AZLA 4UM7A 4OJYA 2WB4A 2AZTA 4PFSA 4D9IA 4WBNF 5JTUA 4TSRA 4FFNA 4M0CA 4Y7CA 4ZQCB 4D3ZA 1ZGHA 1UP7A 4Q03A 1CTQA 5L3RA 5BUSA 3I8OA 4MO2A 2ZR7A 4KL8S 4JOBA 2WJZB 5JXIA 1HF3A 2JGJA 4EECA 4DZTA 4W1RA 5L95A 1JJ7A 1TMGE 3RREA 1F38A 1DWOA 4J7AA 1XQVA 1HT0A 4RDIA 3OTIA 4IH9A 3GU3A 2H0AA 4DWWA 3GJ5A 2QTCA 4KXYA 1KRHA 2JAQA 1J5EB 2RARA 4RKFA 1KI7A 3HCNA 3HR4A 3A1EA 3W34A 4E2XA 2Z5FA 4KPEC 3GLFE 3KVRA 3PRHA 1GP2A 1YR8A 2HMVA 4MIKA 3GBSA 3QYFA 5JS7A 1OH8A 4M1ZA 3BWDD 2XXBA 1K5DA 2ZRBA 3L07A 3PPWA 4FYMA 4JD5A 1WPRA 4X8OA 5CLQA 4XOUA 3ZZ0A 5EJMA 3FJYA 2R68A 3HKEB 1QGUA 5SZIA 3ME5A 3N2KB 1OH6A 4G09A 4WZBE 2CL5A 1U1IA 8ABPA 1U8TA 1Y4DE 3CPEA 5JWRA 1R3UA 5FL7D 1K7EB 1ZWKA 1L9KA 3MGBA 5FYDA 1OLUB 4F2DA 5MN5A 3VZPA 4BUZA 3NC4A 4TS3A 1N2CB 2F1JA 5CIWA 3IT3A 1H0HA 3KSUA 2AG1A 2OVFA 3CLUD 1M5UA 1XQ9A 3MCTA 1P62B 2HFKA 3MK31 4JOQA 5AK6A 4ZOAA 3GLHA 1RHRA 1QOZA 3COYA 3F4KA 3OQNA 3HWRA 4NYJR 1A9SA 2GCPA 4IF4A 4PLHA 1XRMA 2RSLA 1AF7A 3IDOA 5DGHA 2C9MA 1ZINA 3H1BA 4KLNA 3F6RA 4UTOA 3PHHA 2E87A 3M2PA 1N34B 2BH2A 1KR5A 1G19A 6PFKA 4K9OA 4L50A 4K81B 2VQFB 3K0KA 4DAOA 3OZRA 1M76A 3OF3A 2H65A 3ESXA 4RS3A 3EXAA 1O94C 3L9XA 1QBKC 4HDOB 1ZH4A 4MICA 4CM1A 2V8OA 1P7YA 2IEDA 5HILA 4CR8A 4QZVA 4MWCA 3CZCA 2DH6A 3LHFA 1YACA 2OC4A 5ALSA 4B9EA 1IN6A 2O3QA 3KJGA 3ZXSA 4DCTA 1AQNA 4J0QA 4YMLA 1YKFA 1ZFNA 4GLLA 1O95D 4LFCB 3ZDCA 4O6VA 5IT4A 2WWWA 3UWOA 5FWDA 3NVKI 2QNIA 1OXSC 3A9CA 4PQRA 4XASA 3SFTA 3QVOA 3DCJA 4ZHQF 1N3BA 3TYXA 1US8A 3LRPA 1JEEA 3DLIA 5CMLA 4E08A 3AKDA 2NW6A 2R85A 2WE7A 3GLQA 5F1PA 5IH7A 2IEBA 1I6WA 2AD1A 4A8JC 3N8IA 1VE5A 3D6TB 3OJ0A 5A7GA 1XZNA 4LF8B 3CNHA 1I3KA 1WCIB 4PX9A 4BKRA 4N40A 3FPEA 3F4BA 4G89A 1DHRA 1U7WA 2AQ8A 4B8WA 2HBYA 3GFBA 1BA3A 4QUDA 1Q3KA 2ZPTX 4ZVSA 4R69A 4BVHA 5KYVA 1R8QA 5F12A 4XZ3A 1UKYA 3JWEA 4B6QA 2JCVA 5JJBA 4GOJA 2Z4RA 4PIPA 1Q0PA 1U9JA 2B8WA 1WXDA 2OCAA 5DLQC 1YB5A 3PNYA 1JLSA 3HU5A 2FEKA 1JQAA 3L0IB 4LE2A 4O08A 4RMHA 3RG8A 3ZTWA 4C87A 4QYXA 1YB2A 2I6FA 2YWFA 2I7DA 3TLEA 1G6Q1 4JYZA 1M33A 2C9DA 1NMXA 5TGZA 3IYLW 2H29A 2J6CA 4XQCA 5BN3B 5EHXA 4NBSA 2H5EA 2ZT7A 4PLFA 3AI1A 4I5EA 2CV2A 5FUVA 1MEEA 5EWMB 1KJ8A 3L8EA 1GFZA 1LRJA 4IJ5A 2J9FB 3ZY5A 4D56A 5DN6D 4JEMA 3G59A 3K8ZA 5F7JA 3KB8A 3SXUA 3QPUA 5BSFA 3PD7A 5JY6A 5AVRA 1OYYA 2DFNA 5AFSA 5IHPA 1MVOA 2AT1A 4YRDA 2O8DA 2HF7A 4BAGA 2OKCA 1SWWA 3E61A 1UCFA 4BOYA 1H3FA 1PK7A 3WKEA 5B5SA 5IFKA 2HQRA 2JGAA 3DMYA 3F8SA 3HA3A 1HRKA 4Y2VA 2BFFA 4BU1A 1AKRA 4FEEA 5FQNA 5JZVA 3UFXA 1XJQA 3JQ8A 2QLFA 3L0YA 3A0RB 1F0KA 4LMRA 4M8KA 4OP3A 3W5IA 1EBBA 3WLEA 1BCRB 2FFRA 3L8GA 3SN6A 4FDUA 5IT9A 2CNBA 1YUMA 1MNAA 4ZU3A 3H8VA 3TNLA 3TRKA 5LQRA 5CK4A 4DWJA 3H5IA 5T8KC 1REQB 4M88A 3VNSA 2DUWA 1V39A 1F4PA 3FHOA 1DOHA 4BNJA 3MTJA 5EE9A 1MU0A 3KL4A 2JH8A 1QV7A 1AA9A 5EZ5A 3ADCA 3LPNA 3E18A 3O90A 3V8NA 2LTAA 1QH9A 1NFFA 1RWWA 2JHAA 1T3GA 2DHRA 3MWDA 1B00A 2GN9A 3QE0A 4U7TB 3SD7A 4ZOLB 3GRRA 5JZBA 2VWPA 4IH1A 4B0OA 4XYLA 5L3QA 4I8XA 1SY7A 1HORA 2GYYA 2YH2A 4NG4A 5JISA 2FUKA 5L3VA 3DAHA 3R44A 4IS2A 1Y7HA 1Y1TA 1R10A 2BZ0A 2ET6A 3HA2A 3N2LA 5FPYA 4CF7A 1Q2UA 4GM1A 1UFOA 2ZYRA 1EFAA 3RR2A 4WTOA 4X5OA 2JPDA 1JWLA 1JW9B 3WZMA 1T9HA 1UZAA 1SUEA 1J42A 1BVHA 4P82A 3EVAA 1EXMA 1ZD5A 3PFCA 4NJOA 5JPCA 1E79A 1HKHA 2CLSA 2C83A 2QN2A 3MIZA 4IO1A 4Q39A 4WN3A 5DV9A 1FPQA 3LQ4A 2FFHA 4A15A 3TIVA 1N1MA 4UFOA 2QVYX 2HSEA 5BW5A 1JQDA 3ED5A 5JPDA 2R1TA 1X1RA 2O2ZA 3O4FA 3NBMA 2JW5A 4M49A 3U61B 4HRVA 3DMPA 1DT3A 2G67A 2OHOA 3UWKA 2E0IA 1M54A 2CMGA 3ER6A 4MEAA 2PJDA 3X0DA 4ARCA 4OVKA 3OPMA 4RWEA 4WXPA 3HCOA 1KBQA 3FETA 2CW5A 1LTHR 5HKKD 4RX1A 4YCMA 5JCZA 1IWOA 3N6VA 4JP2A 1LDGA 4NXNB 2PGIA 3C24A 4Y2XA 2ZIFA 3NXSA 3BRWD 2GHQA 1U0SY 2Q8QA 5T3YA 3KJFA 5K6TA 3J81k 2QMEA 3OZCA 3HVHA 3TI9A 4UOQA 5KAPA 3TWOA 4BMVA 4DG9A 1E5VA 3W4JA 1R4ZA 2E4ZA 5F7OA 4HMOA 1XRQA 4HDQB 3I53A 1XPJA 2FPUA 1DEAA 1OWLA 5JDIC 3A7EA 4L76A 1BQ4A 3L6DA 4Z86A 1HKUA 2Q3MA 4OHZA 3EPKA 3FJ1A 1CDZA 4NLLA 4JUFA 5JCPA 5I4BA 1ID8A 2HRZA 5IBCA 2CKDA 2KBEA 4FOOA 1L8AA 2WA2A 3DAPA 5E6UA 1AKQA 1PLJA 2IEIA 3GVHA 3K3PA 1R9NA 5FLKA 1X1DA 3FNHA 3PDCA 5FBQB 3U44B 4OI0A 5A9TA 1GG5A 1E1QA 1THTA 3QLTA 2RBEA 1JYSA 4DMKA 1WX1A 1G0OA 1S0UA 3RS2A 5JQGA 5EJGA 3DZDA 3NM4A 1PJAA 2COKA 3R4VA 1BQ3A 2HFJA 3D5QA 3UUGA 5JRZA 3NHZA 3SPXA 1SBHA 3RG2A 4X24A 1O5IA 4BMYA 3A04A 1U9ZA 3LXUX 3TOCA 2YC2C 4GGOA 4ZGWA 3O3NB 1Q7TA 2JIBA 2Q5CA 2QTFA 4KOAA 1U7DA 3PDWA 4H9GA 4XH9B 1K4YA 1HTTA 5D3ZA 3F6SA 4BQRA 3REQA 1PZGA 2F8LA 4N12A 1BKDR 1R6UA 4AP9A 4ROSA 4YRFA 2QRZA 1V9CA 2HJRA 2WA1A 1E1CB 3RTEA 4XVCA 2CE7A 1CV2A 3FTQA 1JPVA 3KFXA 4LNAA 3ZYZA 3ETDA 1QHIA 1Z47A 3LCRA 4C4ZA 5K6RA 2PSHA 1YFLA 2I78A 4PG4A 4D3XA 3ORSA 1YQEA 4C5AA 3SP1A 3T3MB 1CEEA 4TX1A 4BJ1A 5E9WA 5JECA 5CXUA 5TQJA 5KZMB 1YQQA 2WM8A 3GHYA 3TB6A 2AZMA 5L51A 1P1FA 1JKXA 3K20A 5CT9A 1OYVA 2HMYB 3HYNA 1VIVA 4B74A 3UXEA 3UPUA 1JU4A 5CNKA 4DIMA 4I8IA 4MPJA 4QDZA 3AB8A 4RGVA 1YIDA 3CX7A 5CNJA 3WLNA 2X3YA 3ND7A 4AJ4A 1UFRA 1LKZA 4J2OA 2MJLA 2BM8A 2JC3A 2PH1A 3MW8A 3OZGA 4JL6A 1JQEA 4K88A 4R2LA 4D99A 3FDZA 2WJPA 4OPMA 4TMYA 4DLNA 2NTVA 5E3IA 3ML1A 6ABPA 3LVRE 2B1GA 1IJEA 4HQ0A 5IDXA 3UWSA 3R7SA 5ALDA 2VCHA 4KQKA 5EQFA 4GSKA 1T6XA 4CHGA 1XYVA 2Q8PA 3CM0A 3IV9A 5GIOE 3SFVA 1JSRA 3DHVA 1H42A 2EGHA 3LW8A 3NHUA 2BOVA 1YS7A 3EGXB 1Q16A 4Q9AA 1CX9B 1ZOLA 2YZ7A 4DLVA 4O1HA 2JG3A 1FP4A 4GS5A 2QX6A 4PWYA 3NWBA 3ADKA 3RB8A 4YO8A 2O6HA 1MZVA 2G9UA 2JRCA 3B3JA 2WJGA 2CHVA 1T4CA 3OIUA 4U7PB 3SE0A 2EWVA 3KLPX 4UNPA 4MYRA 4J3NA 5KHLB 2BL4A 2ZBFA 3UC5A 1RMYA 3DF7A 4CVNA 3AF1A 1RTKA 4Q3EA 3O31A 3Q3HA 3TFQA 1JDTA 5JTTA 4DXDA 1MOPA 4J7CA 4HSGA 1NA5A 4M7OA 1LV7A 4Y6QA 5E6RB 2CNWD 4LVOA 3HNRA 5L4LA 4N48A 2X0DA 5GOTA 5E38A 4D9BA 1RABA 4GX0A 2EW2A 3O2QB 1RBQA 1DUSA 1KZ1A 2AI2A 4Q6BA 3L3BA 2B4RO 4QAJA 4AKIA 1SQ5A 2V6GA 2VJNA 3BF8A 1O1YA 1OIVA 4BEWA 3CUUA 3E0XA 4KXWA 1DQRA 4IGAA 3GZNB 3QMPA 3P2EA 2V98A 4YREA 1SVLA 3C7TA 4FKZA 3OWHA 1QFSA 5CYOA 2GAFA 3RS8A 5JZOA 5LXTA 1CRLA 2Q2QA 3UUEA 4XI9A 3THXB 4RKYA 4IZ6A 3UK0A 2RKWA 4GX2A 3OBIA 3EZXA 3ZTYA 4TOIA 2I0FA 1R4NB 2AOUB 5DW3A 5CFRA 5A4MS 3HM9A 3ANTA 4IOJA 4KQ9A 1WUJS 4PNZA 3RBZA 1B0ZA 1OMOA 4J2TA 5KYYA 4GICA 1IXSB 1OAAA 1FPMA 4JJGA 4PN7A 9MHTA 1C81A 3QUCA 1QRRA 2IH5A 2B7LA 1VLJA 3K9WA 4YJ3A 1QO0A 5JY1A 4RZXA 1Z68A 2ARKA 2XECA 4U4AA 1L5YA 4YRLA 4DW8A 2V7UA 1XLTA 1GRQA 2Q5IA 2RC5A 1BD4A 1XHLA 1VPVA 2QRQA 2XTAA 1D2GA 3L40A 3PGA1 1RHQA 1U3DA 1OILA 2Z9CA 1D07A 1KKLA 3M6AA 1H2WA 4XQEA 3JAWB 5EJFA 1OKKA 5JPIA 3U0BA 3WGZA 1QHFA 3ZQ4A 5BP7A 1GQSA 2C5FA 4GVXA 5FUXA 3BZBA 2JDIA 2HKIA 4B3IA 3QWIA 1C41A 1Z4LA 5LU8A 2VBFA 1LDMA 3FKJA 3MD9A 3DBRA 3VPHA 3AO0B 1OBCA 3F0TA 1GY8A 2VHJA 1M2KA 3QHQA 2A9VA 1YE8A 3OVMA 3OURA 2XHEA 2RG1A 1ECBA 4TM7A 5IDWA 1OIXA 2HQBA 2P4UA 4LDPA 5DP2A 1C7ZA 1FTWA 4BO2A 3EIOA 4Z3KA 3I9FA 2P8SA 3T1NA 1YTLA 4B0PA 1KYYA 4AW9A 3IL2A 2P6UA 4DR2B 2WUVA 1V43A 2XJ9A 4NCAA 3P9CA 2AOVA 2JFWA 4ZEOA 4NFHA 4M4SA 1U90A 1X19A 4K0KB 4DC1A 3ADPA 3QPDA 5DTQA 5JWHA 2NUPB 3VVBA 5F5LA 1NJ5A 4U3JB 4MW7A 4YFYA 2XUGA 1B23P 5D1HA 1YJ5A 4KUGA 1MQ8B 1T0IA 4K9NA 4OBBA 3NHPA 2XZOA 2QAJA 3MTGA 3AMVA 3K5HA 5TMDA 1AZSC 2RJ3A 3VR3A 5GZ6A 4F4FA 2JBWA 3O8DA 1MW8X 4FT4A 4YHHB 1H5QA 4BGUA 4YX9A 1T3LA 1RPAA 3QXGA 3QBJA 4IJ6A 4ND5A 3CW2A 4V2UA 3PUYA 5AYVA 4P5PA 1BD3A 2ZULA 3RRJA 4AMVA 4B6EA 3L46A 2JGLA 3A3NA 3A6KA 3L4BC 3LYLA 5GONF 3TM5A 4C9BA 4CM8A 4RMNA 1YRLA 2ZRFA 3HNOA 1VG8A 4HTFA 4C06A 4PYLA 3WSTA 4AYTA 1AHHA 5C81A 1KFBB 3FIUA 4XR9A 3Q5GA 5L7TA 2GAAA 1JLMA 4L3VA 3RS4A 3PX3A 1ZLXA 1LWOA 4FYWA 5H1YA 1JG2A 1V37A 4TT8A 3TRDA 5EJ5A 1NT4A 1QIIA 1WSWA 1Z4PX 3FBGA 3FNFA 4EYQA 1E5XA 1ECCA 5KWIA 4ZT6A 4MGHA 4CHTA 2JGDA 3ELWA 1IY2A 4BNTA 4BYMA 5IJWA 1XDSA 2I3ZA 3EQ2A 2P9QA 3VUFA 3H9JA 4V02A 4C0KA 4UDOA 3QY9A 1B2RA 5C37A 1YHZA 5AI0A 4DV3B 4Y2HA 4DEXA 2JBHA 2SNIE 4O1MA 3RWOA 3MJEA 1NPTO 4JXJA 2I7TA 2BLNA 2CNDA 1M1XB 1MX5A 2OBFA 2R60A 3H3JA 3ZUGA 5LBIA 3ZWDA 2I99A 3BGIA 3BSSA 3T5PA 4KR2A 5E3HA 3LY9A 1Q11A 2PH3A 4DKJA 1Y8CA 1W87A 1G98A 4QXOA 1YDFA 4G65A 4PSVA 1QU2A 1UMBA 3OEEA 4YBRA 5IUNC 1SBZA 1WF6A 3OC6A 4CMEA 1J21A 1HYBA 3G02A 3OFNA 4YJHA 1GL9B 1JKFA 1Y8RA 5J2TA 3KHSA 1V11A 3G5UA 3QV2A 4YLEA 1H8ED 2X6TA 3CUYA 1SB8A 4HLDA 1P0FA 4RF4A 4V0LA 3R0ZA 1M2OA 3ROEA 2II6A 3ZV5A 5JNRA 3T41A 3ZJ5A 1FP1D 3LDAA 3DCNA 1ZYUA 3QVGB 4O5OA 4TTIA 4U8GA 3JQAA 2IYAA 2W4QA 4KRGA 4PAWA 4UCWA 1LU9A 3II6X 1XDDA 3K6JA 3OTQA 1ADJA 4KFTA 3UT0A 4PZEA 4MQ4A 5LP6F 4M3NA 4ZT7A 2BONA 1DKPA 4BVKA 1J8QA 1XHFA 2I1WA 1GGKA 4QBTA 3VSEA 1SKYE 1T1SA 3RTAA 1EZ4A 3I2IA 2QROA 4ANFA 3SCZA 3ZCQA 2PTGA 4I1YA 4NJEB 3CRNA 1Q7RA 1HTWA 1VKRA 3V3KA 4N47A 1GZ6A 3ER9A 1R15A 1T2UA 3O3CA 2AW5A 4P1ZA 4RSGA 4WXMA 5K3DA 3WYNA 4AQ7A 3CF2A 4R9RA 1O9HA 1IVYA 2VTVA 4CKYA 5FXMA 1QMGA 1JHZA 5DHUA 3RUFA 3VR4A 1NIJA 1Z6GA 2FJPA 3ZS8A 1HEIA 1NVDA 3Q15C 2W4IA 4HPXB 4D3DA 1KZ6A 3C16C 4G1MB 5E4TA 3T7KA 3GYBA 4CKBA 1WTAA 1C0PA 4IKPA 1TUEA 1NUHA 1J7KA 1X7WB 5AOCA 3D8BA 1I01A 5IANA 1MX1A 4DJ5X 4MAMA 4MGZR 5K7SA 4AIRA 3RYHA 4BS9A 2O2SA 4ZRMA 1FXWA 1XU4A 3G8CA 5B30A 1IDOA 4BLSA 3WG9A 1CR0A 1YI8A 4DLLA 3C1UA 5B3KA 3BWYA 2XDWA 3MEQA 5BURA 5DBEX 5CTAA 4BE9A 1U3UA 3JRWA 4EMUA 1IWBB 1QFMA 5AW5A 3ZU5A 4GUAA 4CLEA 4YCSA 1V47A 1D8TA 3PIDA 3ABIA 2HK7A 3OFKA 2IUEA 3LDUA 3KKNA 1RXSA 4MUNA 5DHFA 3Q8KA 1J00A 2E4XA 4PGAA 2FX2A 3HJGA 4GMFA 3MGKA 3DDZX 5IBQA 3T06B 2WSIA 5A4IS 4O0MA 4RHXA 1KFCB 1GZ5A 4TXHA 4HV4A 4LZOA 4I7EA 4NFYA 2EKLA 1OOEA 3RAJA 2IGBA 3FCSB 2B1RA 3U4QB 2JD1A 3I6MA 2ES4A 1CNEA 2BGRA 3D81A 3EWAA 4XUCA 4BFZA 3AEUA 1OW3B 1MA0A 3PEWA 1CIVA 3P96A 1XMVA 3W9YA 5BUZA 5JWOA 1JDUA 3EXEA 4M83A 5LP6C 1ZIPA 2A6PA 4INOA 4TMWA 3UMVA 2PS9A 3FN4A 4CQMA 3X1ZA 1Y4AE 4AQDA 5ARDA 4BC0A 2WM3A 3ROXA 5AI4A 4MUHA 3URKA 2CJFA 2JGNA 3W4IA 1XNQB 3Q2OA 4W8HA 4HNAB 1I3CA 4PCAA 4ZTBA 2A4MA 4GYJA 2I33A 2P7IA 3C7DB 2G9ZA 4R8KA 2PFKA 1ADGA 3QBVA 5DYNA 4ER7A 1ZK1A 3QFSA 4BRWA 4DDMA 3CE9A 1ISIA 2FZ5A 4ZO7A 4MB2A 3IBTA 2WJ3A 3FUVA 1B42A 2LDXA 3WWCA 4AWBA 3JQ7A 1IEWA 4ND3A 2IYSA 4BQIA 1Y34E 1F14A 3OEWA 2ENWA 4KWEA 4DTCA 3TG8A 5JJIA 2KLHA 1C4OA 4CDNA 2FUNB 2VP5A 2POCA 1Q6ZA 2XMPA 3JSAA 4J0JA 4K6FA 5ALRA 4GXTA 5IAEA 4TKUB 1RRPA 4JK3A 4PZYA 2GLXA 4NK4A 4YQFA 5CRIA 1GDDA 2IPXA 4FHGA 3KNZA 3ND6A 4E5DA 2BZSA 3WISA 4BY9E 4OQQA 3ANXA 4ZVOA 2G80A 1IOVA 3SQLA 1C7FA 1SUAA 4MULA 3BMCA 3F1KA 1BHO1 4DM4A 2B3TA 3DAFA 2FWAA 1UJ2A 5LP1A 5A04A 4CXMA 2ZT6A 1TYDE 3PI6A 4EW1A 4KN6A 5KYWB 5DEIA 1D7AA 4AZ3B 2WKSA 4F1KA 1L5SA 1LC3A 1TVKA 5E2IA 3KR1A 1TMOA 3AETA 4PRYA 5T67A 1J8FA 2PKQO 3VHLB 3JARA 4MV7A 3WGMA 1TO2E 2H1HA 1D5WA 3JAKA 3ORQA 4MDYA 3X3HA 2GT1A 3DHWC 1IOWA 5JQWA 3Q87B 3CQ9A 2FAXA 3ETHA 4JLMA 1YZYA 1CVIA 2CXQA 4RKEA 4TRJA 4WINA 2IW3A 4ERNA 3UWPA 1K97A 5F4BA 1YZVA 3SSAA 2IKSA 2VRCD 1W6UA 1ST3A 5G40A 3V4SA 4Z4HA 3AIIA 3HA7A 4PYJA 4F96A 3GCXA 3KR9A 4DM3A 3U37A 1YVDA 2XZDA 4IMPA 3WTBA 3B8EA 3GH3A 3VPSA 4EW3A 2Y6VA 1VB5A 2L18A 3DOOA 3H87A 1JIUA 2GPSA 2RGEA 1EJ0A 1UM9A 4U7JA 3R5KA 4IDQA 3IO3A 1V45E 4F5EA 4CKZA 3RBAA 4L0QA 4QWMA 1JBQA 1I5OA 3EVNA 4Q4JA 2PBLA 3T5AA 2XWSA 3G9ZA 4ML3A 1NVFA 3E9CA 3EASA 3K8YA 2J9ZB 1W85B 4LVNA 4RFSA 2YYAA 2Y93A 1YJAA 4OA5A 4TPKA 1ZUD1 3LHDA 4JI4B 4CV3A 1VPWA 2G9RA 1MLDA 3RFVA 1XP5A 2I22A 1YOBA 4EFNA 2DR0A 2EKBA 3BCUA 1ZM2A 3K05A 3LT1A 2ZUTA 4B4WA 6GPBA 2AMVA 2WBLC 4NCXA 2K6GA 1GPBA 1FDWA 3UAGA 1YBVA 5ALQA 2V9PA 2WPNA 1GA6A 3BD9A 1UDXA 4K40A 1TLFA 3QX8A 1N5OX 1Z28A 1WLSA 4GBJA 1K68A 4ETMA 1ZM7A 1TRHA 3UJDA 2BFBB 5CDFA 1VBMA 2F9FA 4JUAA 2EG5A 3LA8A 3HCAA 3ISTA 3UV7A 3CZ4A 4KGDA 2H17A 2PS1A 2HHCA 4ON9A 1ZN7A 5MN4A 3DZBA 4R3WA 1M6NA 1IHXA 1TPZA 1UWLA 3CXRA 3PHLA 2HHLA 4E5SA 1F06A 3IEKA 3V7NA 3U1BA 4UEKA 4LA4A 3ZWVA 3AU9A 3NOQA 2R66A 1ZGAA 3GNQA 2I6SA 2A7QA 3GLIB 4DSUA 3ZIAA 4IIFA 2A14A 1I2BA 5CH3A 4JDPA 4HAVA 2FCRA 2OORC 4UAGA 1XE3A 3T61A 3EE6A 4CMBA 1G5IA 4X41A 2WAYA 3KKLA 2ZKIA 4KE7A 2QG9A 1E8NA 1XCPA 4LQ4A 3STHA 4A03A 3ZX4A 5KJ1A 4NZMA 1LEHA 1MN6A 5CXSA 1HG0A 2C5EA 2C1ZA 4CFZA 3GNTA 4R8MA 2R5WA 2G7MC 3EG9A 2QQFA 1RBYA 2ACWA 5EUCA 5DWVA 3QXHA 1MJGM 2WJ4A 5IJ9B 4P4NA 5ENZA 5HCNA 1Z88A 1I32A 4PYIA 3X1YA 1AO3A 2XF8A 3BWEA 3NOXA 2QG4A 4YJ2B 1Q0HA 4BZWA 3A6ZA 2J5QA 4KWCA 4XUGB 4ARUA 5AI6A 4Z1OA 2O20A 3VHQA 3M3PA 4TKVB 1L5LA 4X93A 1ND5A 3REFA 3SYKA 1Q84A 4MHTA 3EDQA 1SZCA 4ZV9A 4X8MA 1OI3A 3NWJA 3DEFA 4JJIA 2HIHA 2AJCA 5FOWA 3NZEA 3A6EA 3LBIA 1UT6A 8ATCA 5CEEA 1UOEA 1QG2A 3OPNA 2YHUA 4BLTA 1JLKA 4PG6A 1MA3A 4GRAA 3KTDA 3BZWA 1A9XB 3H1PA 3DO6A 2HR1A 1SK8A 3GT4A 3GBPA 5ICGA 2XT9A 3F5QA 1R6BX 2FRDC 2XZPA 3K35A 5EXPA 1H3NA 2R6AA 1EJBA 4HFJA 5JLJA 3BXFA 4P3KA 1RJ9A 4CDRA 4G0UA 2BFOA 4DNXA 4PX3A 3LQRA 4GYWA 1JHPA 2VHTA 4FYVA 1TI7A 1FQOA 2WHPA 2IXDA 1FFBA 2G5PA 3CWQA 4HJRA 1GL6A 4V0RA 4YAFA 4OYLA 4PSDA 1GDHA 3U4AA 1Y8QA 2GX6A 3I23A 3FOEC 3HKCB 3COPA 4W6ZA 4MW2A 4QT4A 1M34E 1WCV1 4AKHA 2QYOA 4YRJA 2FW9A 3ESRA 1OBHA 2YN4A 4EG4A 1M67A 3VR2D 1T15A 1NVGA 1J0AA 1NZJA 2VDNB 1XNRB 4CKCA 1S02A 3PZBA 3NUGA 4QOGA 1TT5A 3GUHA 3PTAA 3EWNA 2W42A 3ABOB 1EVLA 2WIDA 2LPMA 4CQNA 4YQYA 3LHSA 2G88A 1RQGA 2FE1A 3MCZA 1E63A 1ZN9A 2C57A 2JVIA 3B6EA 5FNVB 1E0JA 1XDUA 5K3AA 4ER6A 1F8FA 1R50A 1VJRA 5B7GA 5G1OA 3UWDA 5F73A 2O7NA 3D02A 2FX3A 2DFKB 1RI2A 4ISCA 4N3GA 4RDXA 3R4CA 3AINA 3LWDA 2P9TA 3PIIA 1VJ5A 3EOAI 3P9XA 5LB4A 1SCKA 3SIRA 1H1DA 1RRFA 2Z1MA 2Z2ZA 1PFUA 3B2QA 3QTTA 4GI1A 4OLAA 3HKEA 1P2UA 3N2KA 4XVRA 3T1VA 1RAEA 1BROA 5JAQA 4BQEA 1J2EA 1I0LA 5FTJA 2O2XA 5FNVF 3LBFA 1NM5A 1WA5A 3R8CA 1QF6A 3H2JA 3KQTA 1N2CA 2VYQA 2J3DA 1ONPA 2XQVA 3P20A 3GO4A 3RF6A 4YUZA 3FOCA 5J3JA 3PUKA 2VNJA 1OI4A 2R1ZA 2WIFA 4DA8A 1BDMA 4OI2A 5K0TA 4GM0A 4NF2A 2UKDA 2QE6A 3IMCA 1MDBA 1RE1A 5H3LA 4MEJA 1NQTA 5DYIA 4AN0A 5DCWA 2R6GA 2AXQA 4D02A 3PFWO 5L7YA 1PT6A 2OOSA 3A10A 4IZOA 5DHSA 2VPYA 4H6WA 2XB9A 2QP4A 1G5QA 1XMPA 2O2GA 3JQPA 5KNDA 2C4UA 4N3AA 2IX3A 1BXZA 1SBIA 1G20E 3FGOA 4LV6A 5IT0A 2HIAA 3AF4A 2OCPA 1RLIA 1QCYA 2M32A 5AR1A 2Y77A 4H1HA 4QO7A 3K8OE 3ISVA 3LBNA 4IOKA 4OLJA 3CG4A 5AHKA 1P3DA 1U11A 3CF0A 3JR3A 2NO9A 5EXTA 5KSPA 3QG1A 1Q74A 1DV2A 3QIAA 4UBOA 5EZYA 3GNLA 4B79A 5L53A 5EOVA 4JN6B 1ECFA 2YWRA 2H4WA 4RLSA 2ZSDA 2XVYA 3LL4A 2QD1A 3PNKA 3GUCA 3UWMA 4DDTA 5JSFA 4JLVA 3V55A 1TJ4A 1U2RA 4WNAB 4D4HA 1XJCA 2R86A 2X8BA 3O03A 4L9SA 1I2AA 5H4GA 1U63A 1GAJA 2ZQ5A 5M04A 1KFJB 4G5HA 5A0FA 2FFAA 4G37A 1PR1A 2V7VA 4Z1MD 1NBIA 4YRKA 1Q21A 3NDRA 3EXFB 4UMFA 5D6OA 2EOAA 4KMMA 1LF0A 1YONA 4UCQA 3OX4A 4R1MA 5DHAA 4KLAA 1M66A 1R0ZA 3B6IA 2FPPA 4PF1A 3PWTA 5TS2A 4EUHA 4MCAA 1GSAA 2HV9A 3SEAA 1M72A 2D74A 4F21A 4OQMA 4XIIA 1IIBA 4BX8A 2Y4OA 4KVZA 2RB4A 4GDMA 3CR7A 1U2GC 2QMQA 1GFIA 3K72B 3UJAA 3GP3A 3IKMB 4DLPA 4Q19A 2Y68A 1JLLB 1W19A 2GZAA 4KODA 5BN3A 1NNUA 3N87A 3PWKA 4QLBA 5BQ5A 5ICMA 3NYIA 2JIRA 4H17A 1NLMA 3P0FA 5LBUA 5A5EA 4WD3A 3LO8A 3D31A 3OMWA 3VC7A 1XVVA 2JANA 2VXYA 3CIFA 4J1TC 5CLGA 4HYYA 2XT6A 1ZRSA 3U60B 3H1TA 3OF2A 5JO9A 4G8JA 4TLEA 1XTSA 2O4CA 4FSDA 2R8EA 3WRYC 3NBFA 1P77A 1E9CA 2NM0A 2OHJA 2PU7A 3LLSA 4I8DA 5C34B 5I9NA 3KOYA 2PYDA 3FWKA 2DQZA 1FVXA 1N8TA 2IPOA 3G1UA 5JMPA 2GPWA 1YQWA 3WDSA 4LHZA 3JQCA 4X6YA 3ZHYA 3WWEA 1FNBA 4JVSB 5TGTA 4EKIA 1PYOA 2EBUA 3KPUA 1REQA 2QZSA 3IEPA 5DE3A 4AXXA 3L8CA 3C3WA 3S5JA 5K3CA 4BMPB 3SGLA 3BJZA 1HL3A 1TZKA 1UDCA 2YS7A 1SVKA 3C8HA 4KXNA 5EQJB 3TO5A 4G0OA 4ZOLA 2QR2A 3HVIA 3M70A 1GRRA 5IXSA 1P9WA 3L0DA 3AF0A 1A9YA 2BGLA 1XMSA 5JCOA 5KWSA 4HADA 4J3FA 4N5NA 2P3OA 3IOEA 2AEMA 1GOTA 2ZYWX 2E89A 2VHXA 2B2NA 4ALKA 5HS6A 2OL4A 3GMDA 1B7GO 2MYPA 2V5AA 2J07A 1QK5A 3QWAA 4PBRA 2NSHA 5CU7A 3ZQKA 3PNPA 3QLVA 4PEVA 2PL3A 3OCJA 4DUYB 1I4DD 4EPTA 5A5FA 2BFDB 3PDUA 2BCGY 3MF4A 3RAEC 3JQ9C 4JVMA 4UHJA 3TQCA 1P5FA 4GPIB 3NKFA 2FWNA 1AB6A 2HTEA 3MRVA 1RYHA 4NFSA 3VPAA 4XIYA 1RRKA 3GPCA 3H6KA 4G25A 4N3CA 3W8EA 2BD0A 2NV0A 3QXSA 3OO0A 1NPDA 1VPTA 2IYPA 2X5NA 5EXDA 4P3YA 2YWDA 3FNIA 4R1LA 3L6RA 1G5FA 1XLWA 2WAMA 1XKTA 3G0OA 3PC6A 4E4TA 4RTMA 3A31A 2C4TA 1YVRA 2M6RA 3AVPA 4AO8A 4BMOB 4XWTA 3ROMA 4E7PA 4ERXA 4BASA 3X1XA 1VLVA 1SCJA 4KFUA 3LUJA 1MVLA 4Q34A 5E1MA 5LN1A 4N82A 2OV4A 4ID3A 1O4VA 1XIVA 1NRJB 2IVFA 1E1YA 1YUBA 1A77A 3FSEA 1K6EA 1LPBB 4P4TA 4CIXA 2NYRA 3W8FA 1IE3A 3TCXB 3MSCA 3DZHA 4L08A 4QL3A 4Y2JA 3TECE 1IY9A 2FSFA 4X62B 1BX0A 2NU6B 4XSHA 1SCDA 4CLHA 4K8OA 4QC2A 3QBEA 3FYSA 1V5GA 5C9ZA 4M54A 2Q4BA 1XAIA 2GM3A 5CX4A 2Q45A 1ML4A 1YZTA 4ZO9A 3ZGNA 3SR0A 2Q5QA 5JCJA 4A5SA 4US2R 4HLCA 5IM4A 2VQ3A 1HSOA 1ADFA 3PCXA 2A0KA 3MJVA 1Z7GA 4TZKA 4RC9A 3WYEA 4NCIA 1V25A 5DX8A 1HPLA 3EVGA 4C3OB 4RIGA 1VKOA 3OX2A 1FFXB 3FPLA 2FOLA 5AUPB 1CEXA 2Q6LA 3WMRA 4UXIA 1O6GA 3TTTA 4O2AF 2LNDA 4RLFA 5CIYA 1E3WB 3RM3A 3U44A 3H8SA 4O0LA 3ZDAA 1HYHA 2X58A 1ZHFA 1QQ7A 3Q6NA 4DBLE 5C8ZA 5J58A 2HSDA 3ZKWB 5CX1B 5E4YA 3UM9A 3ZY2A 4FGWA 4JX9A 1EX6A 1S2DA 3ABZA 3D9QX 2QL6A 3GUYA 3H9GA 4KXLA 3TOZA 4TTAA 1LBHA 3VVLA 1T8SA 3KEQA 2FPLA 2GHRA 2BSXA 4XCVA 3ILSA 4D4LA 4QUHA 1KP3A 4JYAB 4TM8A 4XUDA 3LQ1A 2FMUA 3OKPA 3Q3EA 1JHVA 4FIDA 5EIHA 3SLKA 2X2PA 1P6XA 2AFIA 1AKWA 2XCOA 4YJFB 3V4LA 1EK5A 3DOEA 1W47A 4NX2A 1WB5A 1AN0A 1NYTA 1JA0A 2HCBA 3ICPA 1H65A 3AKYA 3EDYA 4CLDA 1QRSA 1Y6ZA 3R74A 3PITA 1GTVA 2V0NA 3SM9A 1EWQA 2WUWE 3C3KA 9ATCA 4XB1A 2WT8A 3OZSA 3ZHZA 3HCBA 2TMKA 1EFTA 5ELXA 2QX9A 3UJBA 4HB2A 1FS6A 3K4PA 2VJKA 1XC7A 1XU7A 4JLNA 7YASA 3IODA 3P9QA 3AJDA 1IXYA 1N8NA 4JR0A 1GAQA 4EF5A 4YUVA 4IGFA 1ZXLA 2WSSD 4FKMA 2VUHB 1YUNA 2R4QA 1YR9A 4K28A 2O7RA 2QNBA 5T6BA 3UH1A 3ENWA 3W5VA 5ITWA 2O0LA 4QARA 2RGCA 3NVDA 4G67A 5EKXA 1RKQA 2O8VA 3OU6A 1AN9A 1EFRD 1K66A 2YN2A 4KO3S 4X60A 3WL5A 4ENWA 1UJ4A 3MJSA 1WW3A 2ORYA 1BXKA 1IEVA 3HACA 1VIAA 2A0WA 2NNWB 5BQPA 3ZNQA 4ZHSA 1C1DA 1GR0A 1UBCA 1GQOA 1UP4A 2B34A 2H0QA 3K73O 2Z43A 3NBKA 5ENDA 4QKQA 1FBNA 1L4BA 3I5XA 3FTEA 2IOYA 5HNKA 5EGNA 2YBEA 2P9ZA 4HLUA 3F3KA 4INPA 4OI4A 4F4CA 4IDHA 2C4MA 4UXJA 1G60A 2ATCA 4RF2A 4C7MA 3EEBA 3A14A 3NH9A 1Y9EA 3HMQA 4N9QA 2A9PA 3AR5A 2N42A 3KJHA 4LSGA 5JXHA 2RAFA 2ZTMA 2PWBA 3VGJA 4AKTA 1EB8A 1WXHA 4RH1A 2UUOA 2REXB 3PHIA 2Y1KA 1GPLA 1P60A 3BICA 3UHFA 5IKOA 3T0FA 3UV3A 1YVPA 3OOYA 4R68A 1AOXA 1EBFA 4GFDA 3KALA 4BUJA 5BSHA 3F73A 2I6XA 2QG6A 3QE2A 4ALMA 4J0FA 1YFZA 3GLTA 2QX4A 1SVIA 3JWPA 4BXOA 1AQ6A 4X3CA 2IDZA 5CD9A 4QUJA 1I9GA 1KF0A 1CERA 4XFDA 1G7TA 3V97A 2NZYA 1MDFA 1RHJA 1IMJA 2P4QA 1UR5A 4F2GA 1I51A 4WY5A 1TJNA 5TMEA 4TRRA 3G2HA 1NLYA 3PYMA 3QLUA 3CSDA 3ZCRA 3LX4A 2UUPA 3PU6A 2ODQA 4YQZA 3E4CA 1EA5A 5DKFA 2IF0A 3E7WA 1ACJA 2PMBA 5TQVA 1T4BA 3KCNA 3ESDA 1NBHA 2DCUA 4JUBA 2XYVA 3V8QA 2OQVA 2ASVA 5ERGB 2OWEA 1CJTC 3JD0A 2ZT8A 3DEHA 2CXXA 1DMSA 2O9JA 3QYPA 2AOUA 3ZZUA 4XWOA 5JSQA 3I64A 3PFGA 4V3BA 1TEVA 1TM5E 2JEOA 4AKEA 2HZBA 1L7AA 2PWAA 3OLZA 4DLSA 2BGNA 3ZD6A 3KV1A 4I50B 1V5WA 3U49A 4J29A 4HLNA 1J70A 4X1YA 3IBCA 1L7BA 2OQIA 4NMHA 4YJKA 3AIOA 4YASA 1U0LA 2OZVA 1DWPA 1YC2A 2NACA 1AKUA 1ULUA 3Q7QA 5KKAA 1SQFA 4BHTA 4BJHB 2XUHA 5JAPA 1QTRA 3AW8A 4MA0A 2I87A 1CK4A 3I28A 2O5CA 2GERA 1R18A 1KH1A 3N7TA 4R31A 4F5DA 1EFHA 1W94A 2HY7A 4XWKA 4NL4H 1S9DA 1DRVA 4OGWA 4KBFA 4PVDA 3D54D 3HLKA 4QPPA 3ZE6A 4KNYA 1WXQA 2OCKA 4UPDA 5BRAA 3AWDA 3G2IA 3EZ6A 3FPCA 3OM1A 1T0PA 1XEFA 5KYUA 3B3GA 2QLTA 4ZQBA 4C4TA 2IBTA 4ZQIA 1X9HA 1PNOA 5EMHA 1E1DA 3PCRB 1YWGO 4CT0A 4G5QA 2MMCA 1Z5OA 3U48A 3COJA 1ZO8A 1PK9A 2OCLA 3KTAB 2EDAA 4LXTA 4GBED 1FK8A 1TCUA 1U0RA 3EUEA 5ALNA 1XCBA 4BRZA 5KINB 4QFCA 4NRDA 3KPVA 1ZD1A 2EKZA 2OAQ1 3KBOA 3SY8A 3UJ6A 5HJEA 1YOVB 4D4GA 4V0MA 4IFTA 3SHWA 3PRYA 1O96B 2NUPA 3SC4A 5JAHA 2OUKA 5T57A 2QL7A 4U3JA 5FULA 1B3BA 2BFPA 4FILA 2I6TA 2SCUB 1J25A 5K3SA 2Z5LA 3IIEA 5M5BA 5LA6F 1W0CA 1UK6A 1QDLB 3OESA 4NOLA 1WBDA 1LK5A 1NF2A 3ITKA 4HVCA 3L4JA 3RK0A 4DIBA 1Y4UA 1KVTA 5CA0F 1XVTA 1VB3A 3PV0A 4MW4A 5DTIA 4PHFA 4ZVRA 3BDAA 2ZRKA 3LI2A 5CTJA 3OETA 2BTEA 1C7QA 3ZNOA 3UBTA 4DNQA 2FSIA 1Q0RA 3VFDA 3WBFA 3DT9A 4C4OA 2G4CA 4X90A 3KXDA 4EY3A 4BNFA 3BDIA 4KFSA 3TQQA 4EBFA 4WCFB 1SIWA 3BORA 4DV4B 2REQA 4W9NA 3KXPA 1MABB 2CT8A 3WLRA 4YV0A 2VDRB 2YX1A 1YZNA 4OGKA 5TPWB 3DA8A 5JRJA 3KVNA 1T8UA 3NUZA 4OP2A 5HFAA 3T3IA 2X77A 3NHMA 4RDHA 3QJYA 4GPBA 3GJQA 4F2PA 1GGJA 3BGOS 2LDBA 3R3YA 2IXGA 4DE5A 2BEUA 2HIGA 2PKQP 2RBKA 2VSOA 3KQVA 5H9VA 3EGEA 1CQZA 4O2BB 3D0KA 1SURA 3E8XA 2JK1A 2JLQA 1PJCA 2B3DA 3FR7A 1JHRA 4Z7OB 3C3JA 5FADA 4DSOA 1AF4A 2O2HA 5DBFA 3T95A 1YB6A 6LDHA 1VSTA 5CDGA 4MGEA 3TRHA 4CGYA 2Z6UA 4OD0A 3K7EA 1XF1A 1W581 2CHUA 3OU2A 2OXRA 3VNUA 2R1VB 3LOUA 1WULS 1MGPA 4MWSA 2VHZA 4JCCA 4BFXA 3I5UA 4J4HA 2R751 2EX4A 2JGKA 2WD8A 2D0PB 4RGQA 4PINA 4QGHA 5CH5A 1EGAA 3MBKA 4EHNA 4M37A 4R6XA 2X9QA 1CBUA 3TVTA 1PHRA 1LDBA 1SZPA 4LWOA 1O95A 3CCCA 3OM0A 1VLMA 4Q1CA 1P19A 4ZU6X 4DMLA 3H2YA 3NH6A 1RRVA 4KB5A 2V59A 5IUKC 4RHCA 4BRSA 3QFTA 2IHYA 2B20A 2ZR8A 1A82A 1TM4E 2V96A 5FTLA 3E7DA 1JHQA 2HC9A 2QQGA 1E4OA 4FE7A 4J94A 4A92A 5A4FS 2J9GA 4HTAA 3ZWMA 3U13A 1LS6A 1DKMA 1ZC4A 5BRJA 2PX3A 1T1JA 1A04A 1JIVA 2VUUA 4L8FA 3OE1A 3WI7A 1XG5A 3HUUA 3OZBA 4OKIA 1P4AA 4Y7DA 5EP1A 4A6DA 5HEKA 4QU0A 1NATA 1U8EA 2NWQA 4FZ5A 2XUDA 4LG1A 2VATA 4HUQA 5CA1B 5HUJA 1AUVA 4J07A 2OB1A 2VAXA 2W6JD 5CGZA 4CF6A 5BMVB 1A7JA 4FFDA 1UM8A 2PL1A 2PT9A 2VIIA 3E82A 1GQRA 2P9FA 4FLFA 3IILA 4EL0A 2EIXA 1NW9B 4IZHA 4KLZA 5A4JA 5LMUB 1GTL1 1SQ6A 3P2IA 2BFWA 1JHDA 1H2EA 1NW5A 2XNJA 3W8NA 3GR6A 4CR7A 4QT0A 4KYUA 5GM2A 5TSDA 1PT8A 1XMOB 4KN8A 1FUUA 5HJ2A 1MAUA 4FFMA 3DULA 3EJWA 3T1QA 3CNEA 2HPVA 2LKDA 2Y0BA 2Z4SA 5DN6A 1USUA 2LVBA 3OZEA 4ER3A 4CIYA 2HU2A 2F90A 1E2HA 2IHZA 1MPTA 2VNIA 2VYFA 3CNLA 3GG9A 4ZCRA 2GKOA 3SQWA 5BMVF 4I9NA 4DDHA 3D6UA 2UZIR 3EQ9A 2VAPA 1IEXA 3HYTA 4WXEA 1G291 3UK6A 2P77A 4XXHA 5B1HA 3T7RA 3T3HA 2UZAA 1IN1A 1OGIA 2VFAA 2PUCA 5EIOA 3LNTA 2R7AA 3LCVB 1HXHA 1Z29A 3E9NA 2AV6A 5IARA 4CYMA 3HVRA 2CV1A 1IQRA 3A11A 2A1TS 1E1MA 4Y67A 1MBZA 4MUFA 4UHHA 1WBJB 5HW0A 2ZAOA 4EHJA 3INRA 1L9XA 2BELA 2G7ZA 4QXAA 2CL6X 1HG1A 4JI3B 1RTTA 1SC6A 1GAEO 2BFEB 2JJ1D 2VF2A 3I1YA 3RE1A 2VLBA 1WB9A 5ALEA 5DM0A 5G1PA 1EWRA 1Z36A 2WIKA 3HCEA 3BVPA 1J2YA 4QHSA 4CT5A 3AG6A 1L7MA 2IE0A 1I24A 2QORA 2VXBA 4EM6A 3P9YA 2C7QA 1JFTA 1PJLA 4DGQA 1IPEA 1U2QA 2C31A 4FCCA 3IIKA 2FPRA 1WMDA 4YFVA 1P0QA 3WHLA 5C1BA 3L1IA 3OJFA 4HWSA 5AHXA 3HEMA 3LW7A 1MUUA 4FW8A 1NLUA 2IITA 2HSGA 3M33A 4FBLA 2H6EA 3QU4A 4OSPA 3PUHA 5HKLA 1NJ8A 1ZITA 2D7CA 2GYVA 1IVSA 1JU9A 1ZIXA 1AB5A 1ODIA 1JG6A 4PYOA 4R2IA 3KEOA 1R8XA 3GDGA 1G16A 4J1NA 4GKJB 2PKEA 1MX9A 2IOFA 4BQQA 1U8CB 5AK5A 4JJFA 4YMVA 5DYYA 3DR5A 3FMFA 5TPZA 3TKYA 5A7HA 3ZWXA 5CAEA 1NRWA 2FH5B 3KYBA 3IIMA 4MQMA 2FLKA 3DFIA 3M6IA 3GLHE 1U28C 3NASA 5K0JA 3GGPA 3J81A 1TQ8A 4GL4A 1P9NA 2C92A 1QIFA 3HVKA 3OOJA 1GG9A 5BUQA 5HKKA 1ACMA 2DUUA 3CZQA 3SSMA 4ALIA 5LVAA 2FPMA 2ZTUA 3FXAA 4P81A 3S2EA 3SX0A 4JS0A 3GUVA 1KS9A 4M7WA 4WN9B 1EE2A 3TLXA 1M2VB 3B3AA 1KSJA 4Q18A 5KYWA 2PD3A 4NYMR 4AZ3A 1KEEB 1HQYE 1JNXX 2FGKA 3MTQA 4NU0A 3L84A 4N5HX 1Z63A 1GFWA 2UUAB 2GARA 1B6RA 4MV9A 3WYFA 2CVPA 3C3MA 5D84A 2V58A 1DLIA 2YDXA 3AR7A 3DZ8A 3EDOA 3W6PA 5B6IA 3HEAA 4NNOA 3W7AA 4F5YA 2F1OA 1T6ZA 3ENNA 5GWXA 3B38A 4Q5IA 5K4AA 3U5TA 5J23A 1WD5A 4OHUA 4LMBA 3GVCA 3AEXA 3NBYC 4U9HS 4BO0A 4DLBA 3I45A 1V7QA 3U3ZA 1N36B 2BM1A 1V8FA 3SC3A 2FSHA 3GA5A 4JU9A 4EG0A 2QA5A 2AJDA 3IJ5A 3OZAA 1VE1A 4FFPA 4AMZA 5JZ9A 2A59A 1D2RA 2IA5A 5CXQA 1XDWA 4JYPA 3SJAA 2C20A 2EFCB 2WHRA 3AEKB 3B36A 3QUBA 3D4NA 4L0CA 4N0EA 3RBVA 4FDTA 5A5GA 5FA8A 4AMUA 1O58A 3EFOB 1NVAA 1P1IA 2R00C 3CUEF 2WJVA 1DFIA 1V71A 1QP8A 1W85A 3FNBA 4R8RA 3H1AA 1QXSA 2PLFA 3CZ5A 1C80A 4HNQA 3OCUA 5D3QA 2OYCA 1CEYA 2JASA 4C04A 3E0QA 2DQ4A 3H13A 4DXAA 4IHKA 4FB4A 5KYTA 1S89A 1GTMA 2WIGA 3D4OA 4FYJA 5I9TA 1MX3A 5A2QA 2YW9A 4RPJA 2M1ZA 2HNBA 3JRXA 1ZWLA 2ZBVA 1QZUA 2WP8J 2XDQB 4HN9A 1EGHA 1JA1A 1GKUB 1E2FA 1Y48E 2C8VA 4QU8A 3TKLA 2BJVA 3H6HA 3L49A 1EUZA 4CJXA 2DGDA 2Y1CA 2ZJOA 3CRZA 1E2QA 3AR2A 3C6BA 4U6SA 3VOSA 2I4MA 1QF9A 1GZ4A 4OQFA 4Z49A 4IVNA 1TQ4A 4RZUA 5EJIA 2J0QA 2GOYA 3CINA 4KYTA 5C4MA 4IOLA 2BFBA 1W88A 3T4UA 2F59A 5E9JA 5MHTA 1X1TA 4PBSA 2EFJA 2IK8A 3OHPA 3S8MA 1JHUA 4YCDA 2Z8YM 4GMHA 1HL7A 2YINC 2ZE8A 3DNFA 4R7TA 5JOQA 2DBZA 4D4IA 4DR1B 1JI3A 3Q2IA 2RAPA 2HIMA 2IXFA 2WMYA 1NX6A 1SU6A 2E21A 3C6MA 3OIFA 4NVRA 4RLHA 4Y0VA 3VGPA 5B4UA 3WL4A 1N1EA 4BTVA 4U2KA 3W06A 3FGPA 1NUPA 3DO8A 4CI0B 3GLIA 2VDKB 1A69A 4ZD6A 3F7TA 4RXMA 1NJSA 2GAIA 5H81A 1R0BA 1Q7CA 3EZLA 3G9QA 5EIBC 5HZMA 4KVGA 3S27A 4DLZA 3PQ8A 2CBZA 1DDOA 4JLUA 2YC4C 4F9EA 3ZVMA 3SEQA 3GLKA 1FNMA 2PM8A 4LHWA 1SEPA 4IJQA 4V3CA 2DQKA 1O89A 1AKNA 1K7CA 2O50A 2YMLA 2FN4A 3EDCA 4CIAA 1BN7A 1ST2A 1X2BA 3KQHA 2AN4A 1SIOA 4OHXA 2CMHA 2QMOA 4H18A 5AJWA 3NDJA 3NW9A 3RSSA 3WL7A 5IJ9A 3DG9A 5DXJA 2X8AA 1UMCB 3TW4A 1G5TA 2FWMX 2VHEA 3COSA 3ZUPA 4YJ2A 1O5OA 1BH6A 3ICOA 5AMXA 3C1TA 2CC2A 4WZZA 1XXHB 2DG2A 4TKVA 3TLYA 3DWGA 1OV6A 2RIPA 4YVFA 2XYHA 4LUCA 4B17A 1IH8A 4BFCA 3REGA 4RTSA 3RWBA 1SXJD 3PFNA 2FR0A 2C8LA 1H94A 2X2FA 2FFQA 3FMIA 1L5OA 3AC0A 3NHSA 5BMOA 1N57A 3DW3X 3LDHA 2CZCA 2WUGA 1ZK3A 4XM1A 4QFMA 2V3CC 5CB6A 2MYUA 2PGJA 4IIXA 3DEKA 5CYGA 5U4XA 4URYR 4J0DA 4OXIA 2I4OA 1EG2A 1A97A 1J49A 1EK1A 1XFDA 4MVJD 1WAMA 4RHUA 5COQA 3F7MA 4RMJA 3D7NA 1FU7A 5SY6A 3I9V6 1BXRB 1V1RB 3TQSA 4Z4IA 1IJBA 3GGGA 3I39X 4V0QA 1A9QA 3P9RA 5FTKA 5IKPA 2A1UB 2ZB3A 2GGSA 3K0AB 5F64A 5ITZB 3CVUA 2OCXA 2C4NA 2NZJA 3KX2A 1TOAA 1IN8A 5DN9A 3TIXB 2EYUA 2G9NA 1Z4OA 2W37A 4GMDA 4AURA 4B4KA 1HZZC 4ZO6A 5IWAB 5G4KA 4IYRA 3OZXA 4TUYF 5HRUA 2WTUA 2DB3A 2N46A 2FSVA 1GVHA 1LSUA 1NN0A 3U7RA 2AC7A 1AX9A 1VSQA 2CXRA 5LL6P 4FYXA 1W36D 5LMNB 1ANKA 4EJSB 2ZREA 2XKAA 3ASUA 5CVDA 3EWIA 1BKSB 3KUUA 4LMAA 5J1TB 3CLTD 1FA9A 2C88A 5C46F 4JJAA 3H2IA 3M4NA 5LLTA 2O07A 2IKQA 1QVZA 4JSYA 2Q5HA 1IHYA 4KDEA 3BT7A 1VJTA 1IHUA 1W4BA 3KB6A 3TM4A 4L9RA 2ACVA 1SKYB 1JWAB 1Q22A 1FJHA 1XL1A 2VNKA 2GHTA 3G2JA 4I6EA 1LWNA 5DHTA 5DVZA 5JO0A 2D06A 1Y6FA 4ZAVA 3FTCA 3GV0A 1H4QA 2W71A 1KL7A 4GR9A 3TSCA 1KI8A 5P21A 3FOZA 1XZPA 2X4IA 4ACBA 1DXHA 1U99A 3AY0A 4HGYA 5LC1A 3SJZA 2A5DA 1CZLA 1M75A 3EGOA 4RZSA 1ULTA 1YRWA 2Y4NA 1F3OA 1HDZA 4N39A 4BVAA 3NVAA 1AMNA 1I94B 2GK6A 4Y2RA 2IZ6A 4Z99A 1SC4A 1ORRA 2QZ9A 4JHLA 2BMJA 4FR5A 1BJKA 1UWCA 1X42A 1E5DA 1G8JA 3BHIA 3NR2A 3BMNB 4V0SA 5IC6A 4L5BA 5JLAA 5JARA 1V41E 5IMBA 4BPRA 2B82A 2Z6QA 3AWIA 3LH5A 1II0A 3LCUA 5KS2A 1VFNA 2I5PO 4N54A 1GQQA 2VP9A 1VECA 1DTWA 2UAGA 1FLAA 3HFSA 4EY5A 3DBHB 5A0TA 4H3VA 3VDMA 3KO8A 4YIKA 2ZXEA 1GLVA 1EVYA 2X40A 2NVWA 1QB8A 2BH9A 3GC6A 4JGGA 4MKIA 4QYIB 4ZKDA 5JYDA 1N7HA 2BE7A 5BVHA 2A0YA 4Q00A 3RGWS 3QUQA 2YW2A 3GN1A 2PSJA 1L1QA 4YHBA 1WHSB 2AX3A 3WYAA 1L5KA 1QCDA 1SR8A 1RBMA 3K0EA 1MFZA 2MSLA 1QHHA 1M2WA 2YBDA 3CGGA 3DH0A 3KQWA 2ZVJA 3RFTA 5DYWA 4PCUA 4LOLA 2NQTA 3NV9A 4K46A 1X1SA 1E4EB 1Z18A 2R47A 1QX4A 1RAIA 4JBGA 2VPQA 5CP8A 1E62A 3OE5A 1O03A 1CY6A 5B7PA 5F3RA 3FYTA 2ZUCA 5TT0A 1G7RA 2H3HA 2NU9B 3KLMX 2EF0A 3QG5A 5M7EA 3IBYA 1P44A 2ZRGA 3GFSA 4MNTA 2XBUA 4EO9A 3MJRA 4WNAA 4P0QB 1KK3A 2J5BA 1BE1A 3DV0A 3W2HA 3AM1A 3DQZA 1N2GA 4Y1EA 4JJ8A 3FCUB 2DBYA 3GH1A 5EHNA 3P4YA 1UMKA 3WGJA 3ZX