5CTAA

G158e/k44e/r57e/y49e bacillus subtilis lipase a with 10% [bmim][cl]
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
179
structure length
179
Chain Sequence
b'HNPVVMVHGIGGASFNFAGIKSYLVSQGWSRDKLYAVDFWDETGTNENNGPVLSEFVQKVLDETGAKKVDIVAHSMGGANTLYYIKNLDGGNKVANVVTLGGANRLTTGKALPGTDPNQKILYTSIYSSADMIVMNYLSRLDGARNVQIHGVGHIELLYSSQVNSLIKEGLNGGGQNTN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Esterase
molecule tags Hydrolase
source organism Bacillus subtilis
publication title Crystallographic Investigation of Imidazolium Ionic Liquid Effects on Enzyme Structure.
pubmed doi rcsb
total genus 68
structure length 179
sequence length 179
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 2015-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01674 Lipase_2 Lipase (class 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5ctaA00
4BZWA 5J3JA 3H04A 1ZICA 3GUUA 1CUFA 1TCCA 2PBLA 2VT7A 5BV7A 3DNMA 1QIIA 4QDXA 1UOQA 3WK9A 4AN0A 1QIKA 4C4ZA 3U0VA 2HA6A 2GYWA 5CMLA 3V1LA 4FNMA 1CLEA 2PKYX 3QBJA 5DYWA 5HFAA 1YR2A 1J2EA 1H22A 3O4GA 3C45A 3BL8A 1SOMA 5K3FA 1LZKA 5HK8A 1L7AA 1UT6A 4GDMA 3I2IA 1XRRA 3SWWA 4F5ZA 3EF3A 5HQ3A 5CTAA 4B7ZA 1WOMA 2I3DA 1ZD2P 2IITA 3WIOA 5T4FA 1JJBA 1SCIA 5A2GA 4KAAA 5FPQA 3FSGD 5IVKA 3DKRA 2YH2A 5AKYA 1T4MA 2C4HA 2PSJA 3PUHA 5CH3A 4EUSA 4X7BA 5C8XA 4Q05A 1ODTC 1G42A 4AZ0A 4OD0A 3W06A 3WQHA 2GYUA 2ACEA 4J0IA 3GZJA 1R50A 3I6ZA 5JZBA 5ALIA 2Z3WA 4MEAA 4PO3X 4J7AA 3M81A 1MAHA 4OCZA 3ILSA 5ALHA 1J1IA 3FWHA 4FFVA 2Y6UA 3DYIA 5CT9A 5DWDA 3WKEA 2H7YA 3D2AA 1DWOA 1LLFA 1MN6A 1CUSA 1C7IA 2O2IA 3FYTA 3ZI7A 1VKHA 3JYHA 4U2BA 5I9IA 3H0CA 2HA4A 3G7NA 1BEEA 4BRSA 2FJPA 5DNVA 1GZ7A 3STTA 1XZKA 2WJ3A 4X95A 3LS2A 1F6WA 2QJRA 2DCMA 1F0NA 3A6ZA 1LBTA 5AI5A 1QTRA 1H23A 3HZOA 2HA0A 1EB9A 4MYDA 4HZGA 3NUZA 4HTAA 4EZIA 3STWA 2XMSA 2DHCA 3ANTA 4QLAA 4LHEA 4FLFA 3QITA 2ZYSA 1QIHA 5DNWA 1Q84A 4AQDA 1VXOA 4B6GA 4DM7A 1EVQA 4OU4A 4MXDA 2ZYIA 2ZJ6A 4PNZA 4BTLA 2PSDA 2H7XA 4Y7DA 3MVEA 5DJ5A 2WFLB 2WQZA 1XRMA 4H7IA 4S0XA 4HS9A 2Z8ZA 1YS2X 3RARA 4CFSA 2WUGA 5DTIA 3I2FA 3BDIA 4X00A 4FBLA 2WHPB 3VISA 3C6ZA 4PF1A 4P93A 5JYCA 2JEZA 1LGYA 1CV2A 1QGED 2QJWA 3ZLVA 2RHTA 3AFIA 2H9YA 2QOEA 4AXBA 3WL8A 3C5WP 2HA5A 4F60A 1ZJ4A 5ALUA 2VTVA 4H7HA 3DD5A 5AOAA 4G9GA 1OCEA 3EQ8A 3PF8A 1VJ5A 4UBKA 3KXPA 3ESDA 4BVLA 4AN1A 1DTEA 1ISPA 4K6KA 2O2HA 4UHBA 3H17A 2VF2A 4DNFA 4GHWA 3FYUA 1XFDA 2XQKA 1JT2A 3HRHA 5LKAA 5ALYA 1XRNA 2AJLI 4X3CA 1NU8A 2BUAA 3GA7A 1J06A 1XKLA 1HDEA 2YASA 3N0TA 4MEBA 2BFNA 2H1IA 3RK4A 1E66A 1UFOA 3TGLA 5HKAA 4H7FA 2OGSA 2VJAA 4LXGA 4U2EA 1AKNA 3QPAA 1BN6A 5AKZA 3K9BA 3WLAA 4QDOA 4W1RA 1EDEA 1VA4A 4F21A 1U8EA 4JNCA 4RE5A 1H2ZA 5ALJA 3PE6A 3C87A 2R8BA 4L72A 1XZFA 2XQIA 5LLSA 4DSAA 3GFFA 4UHEA 1DWPA 4DLNA 4BC1A 2G4LA 1WB4A 1U65A 4L3WA 3VKFA 2BAGA 3HABA 4TVKA 3N2ZB 4H7EA 5A62A 5AM4A 2DQZA 1XZBA 1XZDA 2FX5A 3DJYA 1CUHA 5LYYA 3CN9A 3WK7A 5FV4A 1J07A 1XQWA 1XZMA 2XLCA 2HADA 4J0GA 1EX9A 1B6GA 1D07A 4Y2PA 1G4HA 1W75A 4B0OA 2ZJ7A 3DYVA 3L1HA 1E8DA 3IULA 3WKAA 2J3QA 5F4ZA 1UXOA 5ALTA 1K63A 4GEGA 4EY6A 5KWJA 3BJRA 3WZLA 1XZGA 1YS1X 4ZRDA 4B84A 2BGNA 2OGZA 5AP9A 2HU8A 4BTVA 5K3FB 3D4LA 3DOHA 1MTZA 3W05A 3LIIA 5AKXA 5T4HA 1VZ3A 4J0KA 4EY4A 2VQ6A 3L1JA 1RWQA 1BCSA 4B80A 5AM1A 5AI0A 4U2GA 3R0VA 4NMWA 4YASA 4FWBA 2Y1KA 3GELA 4N8EA 4D9JA 1DQZA 3AZOA 1H2XA 1DWQA 5IH7A 1W6RA 5JADA 1ZD5A 3IUMA 4BAGA 1FSSA 1YB6A 3JW8A 4IH4A 3BF7A 4N5HX 1T2NA 5EIEA 1CUYA 1GPNA 1THTA 4J0JA 4BBZA 4UBNA 4IO0A 5C8VA 4Y2XA 4DNPA 3IVMA 1BE0A 3BIXA 1SCKA 5A7GA 2NW6A 3W04A 2C58A 2WIKA 1EI9A 3QPCA 4RGYA 5IVIA 3R3XA 2QMQA 3AJAA 4G8DA 1EH5A 2WJ4A 2VAXA 4X97A 1CPYA 1WHSA 2D0DA 1IUOA 1CQWA 1UZAA 1RP1A 4C01A 4CG3A 1XRPA 3RLIA 1KU6A 3QH4A 4HXEB 2J3DA 3VVLA 3D7RA 3CCBA 3V9AA 3I6MA 4C4YA 3FLEA 2WTNA 4EY7A 2XQFA 1QOZA 3ZLTA 3UUEA 4DMKA 1QFMA 5AOCA 3WWEA 4C88A 4E46A 2JGJA 5AM3A 5A6VA 3F98A 3KWJA 2WUDA 5LZ7A 1CUDA 1QIDA 2WFZA 1CUJA 3BF8A 1YA4A 3R3YA 1CUEA 5CXUA 5LZ5A 4Y2RA 1ORVA 1HL7A 3IA2A 4G8CA 1K8QA 2RI6A 2OQVA 4BVJA 4X6YA 3FAKA 4E11A 4B83A 4AZ3A 2VSQA 1UWCA 2RONA 3FVTA 3HLKA 4XVCA 4QWMA 3HSSA 4CG2A 2HL6A 1TCBA 4ZREA 1GPKA 4A5SA 4ROTA 3O4HA 1HBJA 3VJKA 2PSFA 1TKRA 2OAGA 3DQZA 1W76A 1QIEA 1CRLA 1CUWA 1MPXA 3STXA 1THGA 1EDDA 2X8BA 2XUIA 3FYUC 5D3KA 1JI3A 5K3AA 2VATA 1FFCA 4DNOA 3G0IA 2JGMA 1CR6A 5ALRA 4CG1A 4LYEA 4ZI5A 4PW0A 5ALSA 1BU8A 1YAHA 2HFJA 3DL7A 4UUQA 4FDMA 5KREA 4X85A 2B4KA 4UFOA 5CH8A 1JMYA 1MO2A 2QUAA 4N5IX 1C4XA 4JH0A 2FJ0A 3KSRA 2WFMA 4XJVA 5A7HA 4ZXFA 2JGFA 1E3QA 3O4IA 4GW3A 1XZIA 2VJCA 4B0PA 4AX4A 2PL5A 3D59A 2ZSHA 2OLEA 4MQMA 5CRIA 5ALMA 2X76A 1DT5A 3WYNA 1XQVA 5AIAA 4BB0A 3O4JA 2Y6VA 4W1QA 4J0HA 5FUMA 2WILA 4QDTA 2AJBA 4LXHA 1IUNA 3M82A 5ALOA 2PUJA 4AO7A 4BCBA 5JD5A 3T52A 2ES4A 1DX6A 1KU0A 1VE7A 1R3DA 4N8DA 2VJDA 3H2IA 3KOOA 1XLWA 3OG9A 1XRLA 5AKIA 4JUIA 1PJAA 4PV7A 3ZLUA 5JARA 2AXEA 1JU4A 2I03A 3I28A 5FRDA 4FHZA 1CUXA 5I8PA 5KWIA 3OPMA 2IIVA 2XMBA 3IIIA 1DU4A 1MAAA 4OUKX 2AJ8A 4NZZA 4TPKA 5AKJA 3W9UA 2XDWA 5ALEA 3G9TA 4MYSA 4W1PA 5ALNA 1U4NA 4INZA 1GQSA 2FUKA 2WU4A 5AO9A 5FOQA 5AI8A 5ALFA 4JYMA 1GKLA 4BE9A 3QMWA 1N5RA 2XQJA 4I3FA 4UHHA 3HEAA 1QO7A 3K2IA 3V1NA 3D0KA 2WJ6A 1QIMA 4V2IA 2WFLA 1TRHA 4BDTA 4KE6A 3HACA 2WIGA 1UK8A 5I7UA 3QYJA 1UK9A 1FFBA 3B3QA 5K5EA 1FFEA 4BE4A 4EA6A 1R4ZA 2WUFA 2CKMA 1UKAA 5JZSA 4RE6A 3MGAA 1B41A 4X92A 5HFNA 1QZ3A 2ZSIA 4IH1A 1LZLA 3IBTA 1NX9A 2Y2VA 4OB8A 3WL6A 3BWXA 1LPBB 5CT8A 1M33A 1ZI9A 2HRRA 1Y37A 5HF5A 5JIBA 4OYYA 4QZVA 3R40A 1SFRA 2HM7A 5EHQA 3WK8A 3RM3A 3B5EA 2CZQA 3WWDA 4U2CA 1FFDA 4Y2JA 1GKKA 1XZHA 5LZ4A 3PFBA 2QVBA 2W6CX 7YASA 2ACKA 2QRUA 2ROQA 2C0QA 4QWWA 2CEKA 2QXUA 2RGUA 4KRYA 1X70A 4CCYA 2WIFA 1UK7A 4H35A 4W9RA 1YASA 3A2LA 1BCRA 3IUNA 4CCYB 2OQIA 3ESAA 3K6KA 5ALQA 1IZ8A 3I1IA 1EK2A 1EB8A 1W4LA 2EDCA 5EHZA 5FKJA 3QM1A 2PSEA 4J03A 3ZV7A 5AI4A 5ALXA 2QT9A 2D5LA 2J4CA 2XUOA 3PI6A 1Y7HA 3OTQA 1QTIA 2OCIA 4MWSA 1EK1A 1WB6A 2QXTA 1ORWA 4Y2YA 1JJFA 4BP9A 2CBGA 5JD6A 3ICVA 2XMGA 3WKDA 3HI4A 3OURA 4KE7A 5ESRA 5KBYA 2XUDA 2W22A 3UUFA 4UFNA 3QPDA 5JAUA 4QNNA 3BE8A 3VJMA 2QKYA 1MT3A 4H7DA 4KE9A 1ZGCA 3G0BA 1ZI8A 2BUCA 2RHWA 1K4YA 5JZ9A 1MX1A 3C6YA 3R3UA 4J0CA 5DLPA 1H2WA 3OC0A 1CEXA 5E4YA 1VOTA 2GYVA 2O7RA 5K3EA 4FMPA 1RYYA 3WJ2A 5AK5A 4CCWA 1K6EA 2XUAA 5SYMA 1L7RA 4BATA 1EA5A 1ZIYA 2OAEA 1LPPA 5HZGA 3S8YA 1XROA 1MX5A 1IZ7A 1O6GA 1A8QA 2V97A 5C81A 5FLKA 4OU5A 5SYNA 1WCYA 3G9ZA 1QIFA 1SC9A 3ANSA 2JF0A 5D3ZA 3C43A 4WY8A 4HVTA 3GROA 1XKTA 5AM0A 5E4TA 4RPCA 2XMQA 4FFWA 4G4JA 4EBBA 1L7QA 4ARAA 1VE6A 5E4JA 3TRDA 2VT6A 2PU5A 1CFJA 1I6WA 1XZEA 4QLOA 5CT4A 2OCLA 1NU6A 1N5MA 2Z8XA 1P0IA 2WG2A 5AOBA 3DDUA 1O6FA 5ALZA 3WA6A 1XZJA 3WK4A 1AURA 1GT6A 1CVLA 1EXWA 1CUVA 4K6GA 2I3ZA 4YPVA 1DINA 2WUEA 3C6BA 4H0CA 2PM8A 3WJ1A 5IVHA 2Y2UA 3BDVA 4EY8A 5DYTA 3STUA 5FP0A 4M0FA 1X2EA 3G9XA 4K2AA 3W9BA 2ZVDA 4UBOA 4BZZA 1EDBA 4X6UA 4BVKA 4X93A 1U2EA 4KRXA 1YA8A 3JWEA 5D7BA 4WCVA 4YK7A 4JYPA 4IHAA 5HKBA 3FVRA 2WM2A 5K3BA 1CQZA 1TIBA 4B81A 2RIPA 4OSEA 3G8YA 3NGMA 3WA7A 1FJ2A 4OB7A 1YSCA 3D2CA 5CT6A 1BEZA 4QE3A 4OYLA 1E8NA 3IUQA 1UOPA 5IKXA 4O08A 4CIAA 4M0EA 1JKMA 5T4BA 4AB1A 1A88A 2O2GA 3DKKA 1R1DA 5CH5A 4W1SA 4DSZA 4WFKA 4I19A 1MU0A 2XT0A 5HF6A 1FFAA 5LKRA 3AUKA 4QDUA 3O9MA 4BC0A 2BUBA 5A7FA 2GZSA 3H2GA 1X2BA 1AMNA 5T4EA 5AKKA 1LPOA 4Q3OA 1G66A 2C7BA 2G5PA 2C0PA 2E3JA 4RNCA 3DS8A 4A16A 5ALDA 3B12A 4X71A 2AJCA 4B9AA 2HIHA 3G0DA 1E8MA 4AO6A 4X6XA 3PDCA 4ZV9A 4PSDA 3U1TA 1BN7A 3H19A 3G0GA 4BCDA 4Y2UA 5ALGA 1CUGA 2K2QB 5EIAA 2I78A 1W52X 1ZIXA 5AKEA 2ONCA 1QIGA 4DMFA 1UKCA 4L0CA 4FBMA 5ALWA 3VDXA 3QMMA 5ALVA 4Y9SA 1VZ2A 1P0QA 1UKBA 3H18A 1XRQA 3M3DA 2PUHA 4KYVA 4BP8A 3TJMA 2QM0A 4ITVA 3WK6A 2OCKA 3DEAA 4UBMA 4WY5A 3LIPA 1BROA 3WKBA 2WKWA 1A7UA 1W1IA 4UHFA 3C70A 3EBLA 3WK5A 1QIJA 5BOVA 5A71A 1Q83A 5EIHA 5AI6A 5LZ2A 1WPRA 2DHEA 2PPLA 3LCRA 1UK6A 3I6YA 4G1FA 4CI9A 1IMJA 3WKCA 4ETWA 2XUJA 5AH0A 3IDAA 5D6OA 4KAFA 1N1MA 1AC5A 1N8SA 5BWBA 4LIPD 1XZLA 2XQGA 1ZGBA 5AK3A 1R88A 4FTWA 3H2JA 2OPHA 4M0MA 1LPSA 5AM2A 4Q82A 1UOOA 4MJ3A 5FDFA 3C8HA 3NOXA 4U2DA 1LPMA 3BJMA 3D5EA 2VJBA 4E15A 2VAVA 1ZD4A 3FCXA 2XMRA 4UBIA 5AKLA 1QONA 4X94A 1VLQA 1E5TA 3STYA 1XLUA 2WHPA 3HYSA 1CUZA 2GZRA 1C7JA 2JGKA 4P92A 5CURA 4KEAA 1Q0ZA 4YX9A 4Y2VA 2XUKA 3A2NA 3T4UA 2XUHA 4FLEA 3UMJA 3AZQA 3QVMA 4U2FA 3FBWA 4WDRA 4KE8A 4TGLA 2DFPA 4Y2SA 4I4CA 3HC7A 3ZWQA 1YCDA 1PFQA 2XMDA 2C5FA 2CJPA 1AUOA 3ED1A 3AIKA 1DX4A 2V9ZA 4DMHA 1LPNA 2GBCA 3OOSA 1WB5A 1ACLA 3D2BA 2R11A 2Z3ZA 3DOIA 3RKSA 3KWFA 4K6HA 5DYYA 2H7CA 5CBKA 2BGRA 3E1GA 1A8UA 3D3NA 4XIIA 4C89A 3I2KA 2XLBA 3MUNA 4WFJA 3WYDA 4AO8A 2HU5A 3DCNA 1ZI6A 5K3CA 4G5XA 3PUIA 4DNQA 1GPLA 1QO9A 1OILA 5AHXA 3OM8A 2WU3A 1QLWA 5HF9A 4B85A 5EI5A 2JIDA 5K3DA 3V48A 3WWPA 5LZ8A 2CB9A 4DYHA 5ALKA 1MJ5A 4FOLA 5AIBA 3FLAA 1YAJA 4X91A 3FSGA 4QEKA 3WZMA 4EHBA 1KEZA 4UBLA 2OCGA 3F9CA 4HRYA 4AMZA 3R3VA 3WMRA 5FXMA 1MNAA 5C7YA 3C5VA 1EINA 1HLGA 4X90A 3QMVA 2P8SA 4FNGA 4UPDA 3CCCA 3EQ7A 1ODSA 3V1MA 3DL4A 3LLCA 3WL5A 2O7VA 3S2ZA 1TQHA 1CUAA 1S8OA 4QDZA 3ESBA 4ZV7A 1CIJA 2B61A 2HFKA 1GGVA 1XQXA 4GI1A 2JGEA 1WM1A 3R3ZA 1USWA 1HQDA 3WL7A 2YXPX 2B9VA 1DT3A 4ARBA 1CUBA 3I2GA 5AM5A 2PSHA 3ZPXA 1ACJA 1BS9A 1AX9A 3F8SA 2WHRA 4G8BA 3WI7A 4EB0A 1JJIA 3FYUB 2QUBA 4GXNA 4P08A 2BKLA 4FKBA 3FNBA 4ZWNA 1LNSA 1ZD3A 1R9MA 4GBGA 3E4DA 2XUFA 4Q3KA 3V1KA 5HCUA 5E2IA 2PVSA 4Z49A 1H2YA 2ZJFA 3DLTA 3YASA 3I2HA 1TK3A 1P0MA 1F8UA 4E14A 1E89A 4IQ4A 4K5QA 5JALA 2LIPA 4BAZA 2QR5A 1Q0RA 4J0DA 1R9NA 2XE4A 5LP1A 2WHQA 5CW2A 1CUUA 1CUCA 2ECFA 4OB6A 3VXKA 4WDQA 3ESCA 3SX4A 2BCEA 4UBJA 4DTCA 5AICA 3QZUA 4XWGA 1LPAB 5H3HA 4BCCA 2DHDA 1Y7IA 3AZPA 4Y2QA 5HF8A 5EFZA 1TAHA 2DR0A 1K5PA 1VA5A 3HJUA 3G0CA 1VXRA 4C6HA 4MWTA 3AINA 3E0XA 2WTMA 2WG1A 1AZWA 4P9NA 5JAOA 1ZOIA 2ZYRA 3H1BA 4N8SA 2VA9A 2VEOA 1HKHA 4GLBA 3E3AA 3PF9A 5AKGA 2OGTA 4UFPA 5EHXA 3R3WA 1IVYA 4GWLA 2QZPA 3WIBA 1PV1A 4PQEA 2EEPA 2JGLA 4WFIA 5EGNA 2Z5GA 2AJDA 3F97A 5LZ9A 4B9EA 4BYMA 3I2JA 2XMZA 4WJLA 2CUTA 4HAIA 4KAJA 3FLBA 3BIWA 1IUPA 1G5FA 3EQ9A 1TCAA 2HU7A 3HXKA 1ODCA 5AKHA 5JATA 4L9AA 5FPPA 3FOBA 4G4GA 4KJXA 2XB6A 3CXUA 3H2KA 2DSNA 4DIUA 2XUQA 1EHYA 4H77A 3ICWA 2JEYA 3SK0A 4IH9A 2HHAA 3O95A 5AK6A 1JMKC 3STVA 4Q34A 5DTJA 1MX9A 4HXFB 4C4XA 4HRXA 2XUPA 2QTBA 4BAUA 4QA9A 4FLMA 2XUGA 3AILA 4GECA 3C8DA 3P2MA 4UHDA 3R41A 1BRTA 2JGIA 5AI9A 1ETHA 2G5TA 1JFRA 4W63A 3TEJA 2V96A 4PSCA 3L1IA 2X5XA 4C87A 1EVEA 2ZYHA 3PFCA 4NS4A 3I1YA 4LKOA 2HA2A 4KACA 2PX6A 2PU7A 1XQYA 1WHTA 3C6XA 1P0PA 3M83A 1XZAA 3H1AA 1QE3A 2JBWA 4NVRA 2HA3A 3A70A 3MUOA 5HK9A 1HPLA 4DGQA 4OPMA 4Q3LA 1QFSA 1YB7A 2IX9A 1AQLA 1AGYA 4DMCA 2GBFA 4KR0A 4EY5A 5CT5A 1CUIA 2DQYA 5DNUA 1MNQA 2GBIA 3W2TA 4A23A 2HRQA 2ORYA 3A2MA 4XX1A 3VVMA 4JEIA 3FCYA 5JANA 2G63A 1GQRA 4LYDA 4G4IA 4ZGBA 2Q0XA 3WWOA 2WIJA 5LIPA 1ZJ5A 3H2HA 2GBGA 4MQLA 4H7JA 3G02A 5JAPA 3KDAA 1LBSA 5AJHA 3X3HA 1JU3A 5HQ3B 5C8ZA 2EDAA 2WSLA 2YYSA 5ISMA 6YASA 4Y2TA 3O9VA 3G9UA 1A8SA 4PSUA 3IB3A 4HXGA 5JAHA 1QJ4A 4H7KA 3Q0TA 2QS9A 4BDSA 2WLSA 5YASA 4LXIA 3AIOA 3F67A 5IVDA 2OXEA 1OXMA 3Q8WA 3CN7A 4J3JA 3IURA 2CMFA 5ALLA 5CXXA 2J4FA 1DQYA 2XI4A 3VJLA 3EIOA 2V98A 3AIMA 4H18A 2BJHA 2WIDA 2HDWA 5AK4A 4AMYA 4BRZA 2OG1A 1XLVA 3IUJA 2WG0A 3O0DA 3GBSA 5EHNA 3PICA 1WPXA 2UZ0A 1Z68A 4F0JA 5JASA 1SCQA 3KD2A 3WWCA 5JD4A 4UHCA 1F0PA 1XZCA 2B20A 4G9EA 3BXPA 1GXSA 4B82A 3SC2A 3LP5A 5BWCA 2C5GA 4Q1VA 2XMCA 2RAUA 3F96A 3NWOA 5ALPA 2HA7A 4CIBA
chains in the Genus database with same CATH superfamily
1Z17A 3MF4A 1RKUA 5H80A 5JH7F 3GD7A 2WC1A 3KJFA 3SS7X 3KYDB 4CLOA 1G63A 2VG8A 3D6TB 1P8AA 2UUPA 3GAAA 3H04A 2PBZA 4XIGS 4HNVA 3DFFA 2ZJBA 2IDJA 5DE3A 1RCUA 3O8DA 4WINA 4HDSB 2ZVPX 4DJEC 2JAPA 5IANA 2A0FA 3DAOA 4FBGA 3U1BA 1DP4A 3EZ9A 1A2OA 1TTQB 1V7PC 2EGUA 2PBLA 3KK0A 3KYCA 2VHXA 3PYMA 5DXJA 5KC9A 1QIIA 2L19A 1RJ9A 1UOQA 3GJ7A 4G89A 4QDXA 4X41A 1QVRA 2YWXA 4X1YB 5K8TA 2JD2A 4O4HB 2WK1A 3WL4A 3OT1A 4C4ZA 3T9FA 4O3FA 2IS1A 4UE3S 1X9IA 4W5QA 5DLQC 2EGGA 1AZSC 1GAWA 1CF4A 3AM4A 4CKWA 2XB9A 2B8EA 1IOZA 4FINA 4PSKA 2ZTVA 5I3CA 3L4JA 1A9ZA 1EDOA 4TWZA 2G9ZA 1U3UA 3AR3A 2I6UA 4EG1A 2GXQA 2F43B 4NJOA 4DR4B 1L5QA 5AT1A 3PC2A 1C7FA 1AGNA 1H5NA 1ZWKA 1S5PA 1SIBE 1G8JA 3BRWA 1AUVA 3LYHA 4GZ3A 4Z1MA 3SDSA 3SHQA 4H1TA 2DTXA 3ECCA 4UNPA 3TTWA 3CO0S 4QASA 1EUZA 3UW1A 2WQ7A 5AJXA 5AVZA 4BNKA 1YR2A 4XUEA 5LM3A 4TT8A 5BPFA 2FSVC 1IPFA 4MVJF 3ZJ5A 5CHEA 5TPWA 5TY0A 3A32A 3H83A 1IN7A 4H3HB 4PICA 5BQFA 1E0SA 2ZQ5A 2BRUC 4P80A 5A5GA 3K9HA 3BL8A 3Q7PA 5FUWA 4XX0A 4ND3A 1Y3AA 1X8XA 3AQ4A 4QUIA 5TB5A 3T38A 3I2IA 1XRRA 4Q37A 4DYVA 3SWWA 1VMDA 1VYHA 3JQAB 5E6SB 3L1KA 3NHRA 4O0LA 4YJDA 4C76A 4NCXA 3WGMA 3EB9A 4A0QA 2WSSA 4IHKA 5CVTA 4IDHA 4DT1B 4GP9A 4XVUA 4B7ZA 3T5DA 4ENRA 3T3OA 1QE0A 2IE8A 1ZLXA 2Q5FA 1K6IA 3WLMA 5FB3A 5ARBA 3E9RA 1N8NA 2Y93A 3AHGA 2OXRA 4MUGA 4AJ4A 4QGSA 4YUXA 4V1CB 4S2UA 1IQPA 1I8TA 1S1MA 4ZT2A 2E6KA 3P26A 3P4YA 3P0HA 3R5XA 2WJHA 4HUTA 3LYAA 2XZDA 4GYJA 3PV0A 2WJZB 1H2RS 3EFHA 3GH3A 1F2VA 3UAXA 4PX5A 4DLRA 5TRTA 3DDWA 1XPRA 3O4FA 2JIPA 4CM6A 2QX4A 5A2GA 3MERA 4TUYB 2O0JA 1UM9A 4XDHA 4I5FA 5F77A 3TLZA 5CITA 5IVKA 3GA0A 3G2OA 4F04A 1G7TA 3GEBA 3X1YA 3GFVA 2Q4DA 1XJWA 1S9DA 1PGJA 1W9MA 2CLDX 4FW9A 5EIBC 4P7KA 3ZKAA 5HKOA 2UVQA 3RRBA 1FQOA 4NARA 4H08A 5C37A 5KMGA 1UDWA 1KIFA 2EQ5A 4N48A 4KWIA 1C3LA 1HI9A 1N2CE 4MPPA 3IBCA 4X7BA 4D74A 3PU6A 2P0EA 4Q05A 1H1LB 2CHUA 2H18A 2WHXA 1G42A 3IPRA 1WABA 1LTQA 4OD0A 3JCZA 4M98A 1DPGA 4ZGWA 4K9KA 1X80B 2ACEA 1EVJA 2GYUA 3K9WA 2FN7A 1BKDR 4J0IA 2HYDA 3NHJA 1R50A 1UBFA 1JQKA 2GOYA 3I6ZA 5ECGC 3UYLA 4KXVA 2Z3WA 3TRJA 1ESMA 4MEAA 3QV2A 1HG0A 4BX3A 3K0FA 1ICEA 1UXJA 4UE2A 5JYBA 4MYRA 2CJWA 1I3CA 2W2VA 2LZ0A 3GJXC 4EPVA 4XUGB 5A4FS 2XAAA 1RT9A 1NY6A 3OKFA 1ODLA 4FKZA 4HS4A 4M9ZA 3D8BA 5EMHA 3RVDA 1X7XA 3LC0A 5AK0A 1UBKS 5T8KC 4DEVA 1SIOA 3VC7A 3D7LA 1NNUA 2A1IA 4UC0A 3K6SB 3OOEA 3T1YB 1NAHA 2R8PA 2ZJ8A 1QRDA 2ZCUA 4FFVA 1UBHS 4BGIA 5I48A 3P19A 1E9SA 1YRHA 3INYA 2TS1A 3U17A 1A4UA 5DWDA 1RJDA 2TECE 2RK3A 3WKEA 5ITWA 2P78A 1Y4DE 3C3AA 5JSHA 3HI6A 4R5MA 1TJ3A 3D2AA 3VC1A 1JZTA 3DBVO 3GLTA 3LE8A 1BXGA 2Z1DA 3IIKA 1C7IA 2R5NA 1W93A 1RP7A 3QJGA 1Q77A 3DDNA 1G8GA 4O4JB 3MJRA 1O87A 1OB2A 3PEEA 1G16A 2OXIA 2ZVQX 1XYVA 4IXDA 3G7NA 1WAMA 3OBBA 3OLCX 2Q2NA 3F3SA 2C7OA 2RI1A 4YJ2B 1AF4A 2X3FA 3E7WA 3STTA 1S6YA 1PG2A 3Q7SA 2REQA 1T3LA 3RASA 5BP7A 5HUHA 3HKCA 4P3OA 1CIVA 2HWWA 1EFUA 1G2IA 2PR7A 1NVFA 3E22A 3TLAA 3C3PA 3ZXSA 2J5QA 4FFNA 4KSYA 4MV7A 4Q93A 3SR4A 3RVPA 2HAEA 1QTRA 2C2KA 1N6PA 2WWRA 1YR7A 3HZOA 3JQDA 2CJYA 2HSWA 2HA0A 3VC2A 1EP9A 2GCOB 3NTLA 3O8QB 3PQDA 3ADDA 1Z26A 2B1RA 4DC1A 4LOKA 2EKZA 1TQ2A 3OJWA 4BNXA 1OMOA 4MYDA 4CHTA 2ZETA 1Y5NA 3QPBA 4R6XA 1TJ5A 4V0KA 2RGDA 3ZE8A 2R86A 3KVVA 3LUJA 821PA 1DTSA 4BASA 3STWA 4EZIA 2ZT8A 2P9ZA 3ABRB 3PTAA 1E1RA 4O5AA 4DQUA 4Z54A 2XMSA 4I1VA 3SN6A 5GAJA 4ANFA 5L53A 1SD1A 1PBNA 4V0OA 2B99A 5CCEA 3OLYA 2QMUA 5KKAA 1UBNA 1NXPA 1H2HA 3VYVA 4Z7JA 4HV4A 2CD9A 1D09A 2HLPA 4LHEA 4FLFA 4UM8B 5G0UA 1JFVA 3I30X 1T91A 4JNKA 3I61A 1QIHA 2ZJ5A 5E6RA 3ZI0A 2ZR7A 4CKYA 1H0KA 1KI1A 1LQUA 2RGWA 2BI7A 3G9QA 5I51A 4HJXA 3INTA 4JXKA 3MUFA 4DM7A 1QM5A 4MXDA 2ZYIA 2GLTA 3KDSE 3KPYA 4HXYA 4M0DA 1XZPA 4BTLA 4D45A 1MIOB 3EVCA 2H7XA 3IQFA 3OIGA 3QLEA 4L57A 1DAOA 1UJCA 4CIDA 3MVEA 1BMFA 2JVIA 2WFLB 1U7UA 3BWBA 4CLEA 4S0XA 2UYQA 1KEUA 3V7FA 1YS2X 3GCZA 1GCOA 1W5EA 1X1AA 3ETEA 4RJ2A 3GDWA 4ZYTA 2F17A 3AB8A 4P7JA 4KV9A 3G0HA 2O8FA 1YZHA 2ZUBA 3UICA 2IWHA 2FUG6 1WZ2A 2VXOA 3OCZA 1PWHA 4LEIA 3DHWC 4C2AA 5DTIA 4F3TA 3MELA 2ZYVX 3KLBA 5K6AA 4DJTA 1MZPA 2C7VA 4LY6A 1EX7A 3DTVA 3SNHA 5LQJA 1RSZA 2CNOA 1GTJ1 2VXBA 3CVYA 2I2WA 4RXUA 4IMPA 5EE5B 2C7GA 4PF1A 3W1EA 5F4BA 1PEYA 4RZ3A 5LDGA 2JEZA 2VYQA 1YJAA 1WHTB 3CEAA 2VIIA 2AEFA 1ML4A 3AVXA 1RQLA 3WGNA 5GGXA 4CKEB 4FYHA 2QGZA 1HUQA 3AFIA 3C48A 3C85A 4OY3A 1U2SA 4JCOA 5FUQA 3RGWS 3TJZA 2UDPA 4BWFB 3I6QA 4QOSA 1JU9A 4YJ3B 3DQQA 3AY7A 1SGWA 3O8LA 5ERXA 1Q1GA 4AS3A 3C5WP 1YZFA 5CNJA 3D4NA 3DT9A 3MOSA 1Q0UA 3S1AB 1N8TA 3ZE9A 1J8DA 3D7MA 5ALUA 5DGDA 1EM8B 4GOXA 2QT0A 4KIFA 1DBWA 3VBEA 2XZTA 3PKZA 5EG5A 4HVCA 5HRCA 2FQQA 1P60A 1SA0A 2A92A 2VTVA 4PRYA 4Z0NA 3DD5A 2QV7A 2R8RA 5KTYA 2HQ1A 1SKYB 3ELBA 4CQNA 1A9QA 1VJ5A 4S1PA 4X5OA 2AE2A 3Q10A 3ZQKA 4CKCA 3AF2A 4AJ2A 2GWHA 2PIAA 1Y8RB 3EAFA 4FYIA 3B5IA 3CNQS 3PD7A 4HAZA 2NZ2A 3KTAA 1N32B 4AN1A 3EXHA 1ULAA 1PX0A 1RWVA 1AKMA 4G1MB 1V25A 3N8NA 1ISPA 3RREA 3MT9A 3O1LA 3ACCA 1K6XA 2EYUA 4MKGA 2EERA 3H8VA 4O2LA 4YO8A 4ZCQA 3COSA 3V9PA 2BZ1A 3GGDA 4FJ1A 4URXR 5FF9A 1XF9A 4GHWA 4RKFA 1PT8A 3FYUA 1I01A 3VTAA 1A71A 1DBSA 3ZWOA 1FNMA 1P5RA 4FJ2A 1GRCA 4JQCA 1A5ZA 4X3CA 4B8YA 2AGVA 5HIKA 1YUMA 1BO6A 1IU9A 1TYDE 2JJ2D 5D1NA 1VKRA 3DJFA 4G85A 2XYGA 3D6NB 1NULA 1D7OA 2GZDA 3DOFA 4KVFA 4MMYB 5AQ1A 5KS2A 5DHRA 4RMHA 5CTJA 4YJKA 1HDEA 1KPIA 2B94A 2P40A 5ITZB 4DVGA 1SXGA 2PFSA 2J9RA 4A6PA 3KVNA 1RAEA 3IA7A 2BFNA 3BH0A 2H1IA 4AJJA 1A97A 5JS1A 1KPHA 2PV0A 2YJ6A 2A0UA 3EY4A 3ESZA 4KYIB 3RK4A 2V58A 3BB1A 3TGLA 4QYIA 4LRTB 3CFYA 3VU9A 4RTSA 5CEFA 2OGSA 2MWMA 2DBYA 4HUJA 4BLUA 1IJEA 1BCSB 3AFMA 3PE4A 5K4HA 1RIIA 2SKEA 3B9RA 4WJKB 3ZNOA 4CFYA 5BSWA 2YKGA 2H17A 3GLQA 3Q1KA 1GM5A 5D87A 1K6MA 2E7ZA 3BL5A 2FSUA 2DCUA 3DUWA 4IYJA 4WN9A 4BGUA 4FE3A 1EFDN 1TFUA 2AMVA 2P4SA 2BR3A 1VLMA 4E5SA 4G86A 4YRZA 3BIFA 2SKCA 1U8EA 1GTRA 1LW7A 4GMXA 1U98A 2ATCA 1N0HA 3R0QA 3VHLB 5CFNA 1YK0A 2BP7A 2Q2VA 3PE6A 4FZ5A 5AW1A 2RGCA 3E6AA 3TX2A 1Q0SA 4DMRA 5H59A 3GJ5A 1SPBS 1VECA 3HZZA 3L82B 1UFVA 4RLSA 2RH5A 4DLNA 4BOYA 3NDIA 7REQB 3EGEA 3EVNA 1PNQA 4UMFA 4WCFB 3JQAA 4OQPA 4E94A 3B9QA 3EOBI 3WV4A 4YV0A 3UWKA 1NRXA 2DETA 1OTYA 2X14A 2ZIWB 4W9NC 1KAMA 2WUWE 3Q6MA 3M1YA 3FGZA 4TVKA 1WVGA 2QMEA 3K0AA 2GEVA 1E2FA 5LYJF 2N0SA 4Z7NB 4DQ0A 3L0CA 3ZK9A 1C1HA 1TO1E 3VR6D 4GPD1 3WFZA 3ROEA 1GKYA 1YIOA 3FIUA 3HZRA 2EKDA 4BB6A 5LYYA 3UWOA 2WWWA 1OR8A 4P81A 3QFCA 2CVHA 3BGDA 4TL7A 1SG0A 4I8DA 4EO7A 1XQWA 1XZMA 2XLCA 2FMTA 1T2FA 2HADA 3QFFA 3PEFA 1RZVA 2CCGA 3VO2A 8GPBA 1GEEA 1QF7A 2RDMA 1XXHA 2VJNA 2PL1A 1PQUA 2EP5A 2I2BA 3AEKB 3IAS1 4Q9NA 1RJFA 4IM7A 3QX7A 3AHCA 4CTJA 1UKZA 3H5WA 4JBGA 3BAFA 3K4HA 5BUZA 4DNXA 2ODWA 3IULA 3WLRA 4HNAB 1M6VB 3UJHA 2FWPA 4F2DA 2O2EA 2ZDGA 4X61A 1I3KA 3LQFA 1SN7A 4HDOB 5JT1A 5JPCA 3VTZA 3OU2A 1KDRA 2QSYA 5ALTA 3S44A 3E9QA 2DT8A 3ISTA 3NOOA 3CZAA 3D4PA 5JC8A 1PQWA 2CK3D 2HRDA 3WLEA 4MRNA 4CMAA 3IXQA 5KSWB 1X80A 4DREA 3OEED 4FJ0A 4HT3B 1NUAA 3SQOA 5ADVA 2OCYC 4OAOA 4DLYA 2D7CA 1Z6QA 2ZB4A 3QU5A 1I0LA 1YS1X 5T3YA 3W4KA 4ZRDA 4JLNA 4BHTA 1UC4B 2P2NA 4TV8A 2IYUA 5E9QA 4Q03A 5GOTA 4MRAA 3PJRA 3UT5A 2Z9CA 5JSQA 4K0KB 1V0JA 1GO2A 2E6UX 2X23A 3GEHA 3TZ6A 3W4JA 4L73A 3DOHA 1KY4A 2QAGB 3PNMA 4IGKA 3O8RA 1MTZA 1OI4A 2WYOA 3ELDA 3K30A 2HMSA 5E1MA 4F4UA 3W05A 5MN5A 5TJ9A 3LIIA 5JR3A 4KI7A 3KR0A 4AMVA 4CM9A 1C14A 1E64A 2WNHA 3DWFA 4FZRA 2XWJI 3CUYA 4J0KA 5CYGA 3L1JA 5DIZA 4MJLA 1RWQA 4XH9B 1BCSA 1C41A 3RSQA 2V55B 4B80A 5AM1A 4EKGA 5J4VA 1LCIA 3ZCRA 2R1VA 4NF2A 4U2GA 2A9PA 3ZKWA 1CB0A 2CKDA 1AKEA 5CFRA 1MC4A 1VBMA 1C30A 2D1TA 3EGXB 4GGPA 4B40A 4TTSA 5THQA 3ZV6A 3OZXA 4PSVA 1YRQA 2IWRA 1J49A 1NA5A 1IN6A 1P19A 1K3TA 4ZVPA 1P73A 1YB5A 4ZAWA 3VDMA 3FYCA 1PJQA 4OQMA 4RM3A 1R8QA 3EZXA 4LJ5A 3ZVNA 1SELA 4JHLA 3S5UA 2CMGA 4RABA 4ZKDA 3NS7A 4RKEA 1RWNA 3V3TA 2JHFA 4OJTA 3UJ6A 3GWZA 5H70A 1AKYA 4AZ3B 2VYFA 1ZONA 3AM3A 3EYAA 3TIGA 1IXZA 1GAQA 1QB7A 3BULA 1R5JA 1R0YA 1KYQA 2ZS7A 1QDLB 3BF7A 1KAQA 1OYYA 1X3SA 1R4MB 4QFDA 5JI2E 2CLOB 5CVUA 1KSFX 4PINA 1HFKA 1ENOA 4XSGA 3C3XA 5CGQB 5EIEA 1TTTA 3A14A 2W98A 3GY0A 1GPNA 4BNJA 1NVEA 3IOMA 4BLQA 4YMUA 1IN8A 1JHDA 3GDOA 4B3DA 4BBZA 2AUTA 2EL7A 5BRJA 1U0GA 1WD5A 4PYRA 5MF6A 4IO0A 1H8HD 1PSDA 3K2BA 2A33A 4PLCA 5EJFA 1U2GA 2JBAA 3GHYA 4QHSA 4B79A 2NQ8A 4BNTA 1BXRB 5IK2A 3H1GA 1H94A 1M6NA 3BIXA 4PPNA 5BSTA 3OE4A 2NSHA 4Y0VA 5EWMA 5TSDA 3RODA 1ZD8A 1T5LA 2IYVA 4M86A 4KFUA 2JCYA 3PUYA 3C2QA 4RA9A 3W04A 4TXNA 2WIKA 3DW1X 3QPCA 3RHFA 1S96A 3Q12A 2QMQA 1NUPA 1EH5A 4CDNA 4XLZA 3REFA 4PLTA 3SYRA 3OOHA 1PGNA 2R4QA 3HU2A 3HJHA 1QQ6A 2G3YA 3MB5A 3QVLA 4G63A 4O4IB 4CMIA 3AVUA 2ZSEA 4GKJB 3IDQA 1UJMA 2DWUA 4ZPJA 5CBPA 2D0DA 4PEVA 4LE2A 4NFLA 2VJMB 3CLHA 4IVNA 1MO5A 1IEVA 9ATCA 1UZAA 1RP1A 4L6AA 1A1VA 3NAMA 2PKWA 1XRPA 3RLIA 1G5PA 4XWTA 3R44A 2NT3A 3SVLA 1B76A 3D54D 3LV8A 3IP3A 4Q21A 3L0OA 1Z25A 3EXAA 2YZNA 5FR2A 3DE2X 4HEQA 1UANA 4I3HA 3D7RA 3MT7A 3I6MA 1H9AA 1R4AA 3PLNA 3NR2A 3PNBA 2FPXA 1IG3A 1YKGA 4PAMA 3KLNA 4KV7A 2W2LD 4LWZA 4JGIA 1W19A 4M37A 4P38A 3SC2B 4EY7A 5U4QA 4IUDS 4CKZA 5JO0A 4LF7B 3DULA 3ORSA 5FR1A 1D2NA 1Y6RA 4DMKA 1ZCJA 2CWWA 5MDHA 4OGKA 1KXZA 1NQOA 4R0MA 1Q3HA 2NP7A 5KDOA 3A6LA 3R0IA 4JSRA 3ZU4A 3QIAA 4Z0PA 4S04A 2ZCJA 4Q7EA 2KBFA 4LDPA 3KWJA 1FMJA 1J2JA 1J8MF 1KI3A 1RZ3A 3ISVA 1CUDA 5IN5A 4Y1RB 2QMOA 2P67A 4LYGA 4KOEC 4MCJA 1L5KA 2GF9A 4MCAA 2CE2X 1Q7BA 4GR9A 1FMCA 3ROKA 3CZPA 3WNZA 3KEOA 4CWAA 4EGAA 4W5NA 1JHMA 1VPLA 4YY3B 1RE1A 2D1YA 3O4VA 2Y1XA 3Q2OA 3QKRB 3U4MA 3PFKA 5IXYA 2Y1WA 2BM9A 3WFJA 4JJ7A 1XJ0A 4JJ6A 3L43A 2YVQA 4AKHA 3L0ZA 4NXNB 4NQZA 2JNWA 4FCVA 4G8CA 3RKRA 3RYHA 3B1VA 3H6KA 4P2BA 3WMWA 4JT9A 2F9MA 3K0BA 5CA0F 3AHJA 2Z9DA 3DOEA 2R7KA 5FQNA 3D8SA 4OI0A 1O9GA 3CUSA 3AL3A 4AZ3A 4L4SA 2C03A 1E99A 2I66A 3F73A 4HMPA 4Q7JB 5D6NA 2HHJA 2J5KA 2OTCA 2X0JA 1KOGA 1UMBA 4XFKA 2V7TA 2UVDA 2Y4NA 1GPKA 3B2EA 1NE2A 4QD3A 4ROTA 4UU0A 1R12A 2XWPA 1PR4A 4CI0B 1RNLA 4IKEA 4RY8A 2H4HA 3IX7A 1TKRA 2ZBDA 1C3JA 2WMOB 2EJWA 5KJEA 4V3BA 1W76A 2AQ8A 4ZVVA 4EGJA 4A2QA 4ZJPA 3W5JA 1HA3A 1NWCA 5IDXA 1NSTA 1LU9A 1GQ2A 4L16A 1A0OA 4UZEA 1MPXA 3BVPA 3OOYA 3OHMA 3EBOA 1EDDA 2XT6A 3B7GA 2RMKA 4HEJA 3NHMA 2P65A 1KJJA 1MGPA 2WJYA 3RIXA 3IE1A 3FYUC 2RD2A 4QQFA 4YDQA 1JI3A 1W4CA 3GH1A 4JI1B 4C7OB 3BA1A 3GJ3A 4NNJA 5CFQA 4XD7A 4U7FA 2ZEJA 4MP8A 1RI1A 1K4KA 4J0FA 4MI6A 2ISCA 3L79A 4EK9A 3O84A 3CBGA 1FFHA 1E9EA 1CT9A 1QWOA 1X7WA 2D4AA 1IXRC 3SE0A 1GG5A 5LIRA 1A5TA 1BS2A 2O8DB 4TWRA 3AVTA 3ZCSA 4KPFC 4QEDA 2O5VA 3ZD6A 4HGPA 5ALSA 3NYRA 2QXYA 3UY4A 1H05A 5I7WA 4I4TB 3VAAA 4UEKA 3DL7A 2PXAA 3BQ9A 2Q3BA 3ORYA 4FDMA 4R9RA 5G02A 4X85A 3SD7A 2C57A 4Q9KA 3NRBA 3F5QA 3DAPA 3MSXA 2V8OA 5D01A 1XMJA 3LPAA 1QQBA 2BTQA 4UMVA 2O4CA 2QUAA 3R7WB 4KDCA 1J7KA 4MRMA 1FQKA 2CK3A 1RZUA 3KSRA 3OJXA 4GO1A 1DCFA 3CUTA 3TYXA 3CTMA 4YRMA 1SQ6A 3I0MA 5GADl 3V7UA 2W9XA 1C0PA 1RYBA 1X1TA 3LBYA 3ODPA 4K1LA 4DA0A 1BOFA 2HJSA 2FMHA 1NLUA 4IRUB 3GGOA 4OFXA 1WU7A 2QTTA 1T9GS 5E38A 3UAOA 4DCOA 2B37A 2HV8A 5JNVA 2IBTA 2CNWA 4AX4A 4NE9A 3MLEA 4HLUC 2I8AA 1UEJA 4LJ6A 1TA0A 4KQIA 1Z0AA 1GN8A 4E4YA 3QE4A 3RWOA 5JJCA 4ONEA 3Q5GA 1GGNA 4QRHA 1QRAA 3SQWA 5E8RA 2YZ2A 3EXIA 5ESDA 5ALMA 4NCBA 1MOZA 3KHKA 4F97A 1LNQA 5JVDA 3G2HA 1TF2A 4PBTA 2MYUA 4KQXA 3WYNA 3N3AC 3F2IA 5JZMA 3CR7A 3T41A 3HP7A 2Y4OA 4FFOA 4XLTA 1YWGO 3O4JA 3R3SA 1SU7A 1U3CA 3LT4A 3F7NA 3UMBA 2WDPA 5CLLA 4BFYA 2VNKA 3NWPA 1QWSA 4L15A 2PBRA 5KQSA 2FEWB 4MTLA 4CMGA 3ZHRA 4DIDA 2G06A 3QFHA 4J0HA 3ANNA 2IK8A 1U3FA 1EESA 2BFMA 2JIRA 5I7SA 1YZQA 2QUKA 5AVOA 2FPGA 2XRZA 3IAEA 2I71A 4QDTA 5LFAA 1F8YA 4OXYA 2AJBA 1HY3A 3L6CA 4LXHA 4FDUA 5KQPA 5IT9A 4NC9A 3PQCA 4RSHA 3JATB 4HI0E 5C2JB 5HWSA 4XSHA 3M82A 4DWVA 1IULA 1OX5A 4J49A 3L6RA 1AE1A 3NGLA 1ZMTA 2W48A 3PENA 4H0FA 1P33A 2PUJA 3A05A 3GFSA 4PFQA 4AO7A 1AHNA 4D2IA 2GVDC 4KGVA 4TV9A 3DLPX 4E5VA 5GTDA 3UAWA 3KJNA 1A7AA 4UDYX 3CX4A 3V2IA 1OTHA 5FO1A 1M0TA 1IQUA 5HZMA 1XLWA 1W4RA 2IJGX 2L0XA 3CE6A 3WYBA 1V9LA 1N7JA 2XKAA 3DWIA 3DZFA 2IV7A 5AKIA 3C3YA 3TQSA 3ZN2A 3BOSA 2ERCA 2JCSA 1Y4SA 5JARA 1GPYA 1WCIB 2PTGA 3X0DA 4MK4A 3CH7A 3DBLB 4L4ZA 5CG2A 5FRDA 2LVBA 3LDFA 4LOLA 3JQ8B 1Y82A 2OGUA 4NYMR 1USVA 2FR8C 3EASA 5EE1A 4HGRA 1JQ5A 3IMKA 5C1PA 5KWIA 5HKKA 1JHZA 3I83A 1JFTA 2H2FA 2INGX 1DXOA 3DPUA 3OPMA 2Y1LA 2WMYA 3JAWA 3NBZC 3QA3E 4OUKX 1CJCA 4W5RA 3HO8A 4ZOEA 4AWAA 4YMHA 5BV8A 1U1DA 1A82A 1Z06A 5AKJA 1N4AA 2XDWA 4NESA 1JA0A 2J3JA 2P2YA 3G9TA 3O3NB 4NZNA 2FZLA 2X9QA 3FN4A 4OHRA 3Q8MA 4W1PA 2BFPA 3UG7A 4OI1A 2HKIA 1NBMA 2Y1EA 5JY1A 5CM8B 1Y8CA 2FUKA 3TSCA 5AO9A 3Q3CA 3WHLA 5FOQA 3SKXA 5EOVA 1YGPA 5KTNA 2D06A 2DERA 4FWIB 2XY4A 2I1VB 4JYMA 1PZNA 2F8MA 1MRNA 1UJ4A 1CQJA 2JFYA 2QVXX 1FX0A 4IDGA 3N74A 1XYYA 4AT1A 4JY7A 4BNDA 5TE9A 3H8SA 4RJTA 1AK1A 1U9CA 4KN5A 4U7JA 3SIPA 1EFPB 1DX9A 3VSAA 4Y98A 5K0SA 1QO7A 3K2IA 4MJ7A 4RFVA 1KNQA 1PLLA 3D0KA 4Q1DA 4MQBA 3NHSA 3VSBA 4MRPA 5T6MA 2HIMA 2W2LA 1WMFA 4REOA 4BDTA 1AUXA 3LKDA 5F2EA 3P9KA 3D4BA 2ZTLA 1VLJA 2P79A 4IEFB 5DI3A 1B42A 4WKGA 4BNIA 1I4EB 5DRYA 2DFVA 1JW9B 2JASA 4V03A 3RNLA 5BMVA 5JBIA 1QHIA 4ZAGA 1IN1A 4PANA 2O8EB 5F7XA 5D3MB 2UZAA 1T24A 2GO7A 3G2PA 3ONEA 4D4LA 5K5EA 1TYAE 2C9ZA 2KBEA 3H11B 5LVAA 3L92A 1R4ZA 2HLNA 4MV8A 4EA6A 2WUFA 1V16B 4NP6A 4QQKA 4YAFA 3VSDA 3TMKA 1C50A 2EG9A 3KJIA 4EFMA 3ZV4A 1HLDA 1WUYA 3P8ZA 3LWBA 2XD4A 4FN5A 2ZSIA 4GOMD 4IH1A 1ID8A 4HB2A 2Y2VA 3SSAA 2PVCA 1BDMA 4K6MA 1RBZA 1WCIA 3FI0A 3VR5H 2QR3A 1NQWA 4FX2A 3U2QA 3WL6A 3ZCQA 2G8LA 1ZI9A 3C3KA 4O1MA 1W46A 4FOOA 3STHA 4MCIA 4BUCA 5JIBA 2P9YA 2ZRAA 3R40A 4XB2A 3IRUA 4Y6OA 5I7RA 1FPQA 3ULKA 2QX7A 1I7NA 2D2XA 2A14A 2ZT7A 1B0ZA 1U7ZA 5EHGA 4BMPB 2IV3A 1SY7A 4CBVA 1HLPA 4R1PA 1SFRA 4XWAA 2HM7A 5I9MA 4JX8A 4CT0A 4EWLA 1WP9A 5EWJA 2ID9A 5B55A 2X8JB 3IOYA 2GPJA 5BN3B 1VMKA 3H2SA 4JOSA 3LZDA 4TOIA 2QQEA 4JMPA 1DGQA 1CG6A 3B5EA 2CZQA 4GOND 5DLYA 2CE7A 4U2CA 2HUPA 1PFYA 1QS0A 1WP4A 2AZ4A 2GCOA 3C8UA 3QVWA 1M2OA 3KALA 3BWCA 3TSOA 3AB3A 3Q8LA 1G8AA 3DXXA 5EAIA 3Q40A 4UMDA 1S8AA 1WX1A 3OEYA 4KLNA 1C81A 4UD2A 4R5HA 1I3NA 4X63A 4XAQA 1VRWA 5TPZD 7YASA 1A04A 1H0HA 4RSRA 2ACKA 5FWAA 2QRUA 3P9QA 2PUBA 2WWXA 4I6GA 4QAJA 4CL0A 4WHMA 2P3SA 3TRFA 1XG5A 1XX6A 2R6DA 4BO3A 2B1JA 1D9ZA 1MAWA 2IIPA 4MKZA 4X1IA 5AWFC 2FP4A 1G7CA 2DMRA 2Q3DA 4R2HA 1TD9A 2WIFA 2B3DA 4FUTA 3EN0A 4YMWA 3UC9A 3ZHBA 5AW6A 1VCIA 4YRFA 1C3XA 3IUNA 3WLIA 1WBJB 3U5TA 1K6JA 1VYUA 2RH8A 1NASA 3R20A 4N39A 1YI8A 3INRA 1EJ6A 3VZDA 3SQMA 3IUEA 5B1YA 4QOEA 3HA3A 4HFNA 1O8BA 3I1IA 1KGSA 621PA 4PZYA 1ZHFA 4NBKA 4F92B 2QRNA 2EDCA 4BEWA 3KUKA 3RANA 3AW9A 5JLJA 4BQEA 3OEHA 1XL1A 4TXHA 5FKJA 4HEHA 4HVLA 4OLFA 4RHUA 2E55A 2I6QA 3ZV7A 2K5UA 7ADHA 4JBXA 2I99A 1V2HE 1YR9A 1IDN1 4R2KA 2FN8A 1WQ3A 3TL2A 2J4CA 3ZE0B 1R8YA 5EWLB 3BTOA 3G5UA 3H05A 4BMOB 4YT4A 4O25A 1Y6JA 1Y7HA 4GMHA 1BGWA 2CHQA 3SF8A 3OCUA 3VBCA 3OTQA 3EAQA 4W4TA 3IEKA 1QTIA 2A78A 1S3IA 2PKEA 5BRAA 1PS9A 2NQ2C 1JG7A 2X7XA 4FGUA 1YFJA 3RVJA 3ZNNA 4LQ4A 4RANA 3MWEB 1E3SA 3UEOA 2ASEA 1ORWA 1JA9A 1Q91A 1WXGA 1XQ9A 2PCLA 2VYNA 4Y2YA 2ZRNA 4BBPA 4F84A 3TBFA 2D54A 1ES9A 4BP9A 2E87A 3PQ3A 4DLKA 1NKVA 2SCUB 5EKDA 3ICVA 1CDZA 2C95A 1F2TA 4HADA 5ETJA 1LWOA 2WZDA 1E0AA 2PTHA 1NN0A 2XUDA 4KQCA 4L9WA 2W22A 3B85A 4M46A 5FTJA 4CT5A 4IR7A 4UFNA 2A6PA 4ZCIA 4UCQA 2RGNA 1I80A 2F62A 2ZITA 4PCAA 3GZTB 2IT1A 4KI0A 5LL6P 1JDSA 4NFSA 5CD9A 1MT3A 2IXBA 2VWQA 2JAOA 5BXQC 1UZMA 2R6AA 2AK2A 3EYWA 3KKEA 5A9RA 2IUTA 1ZI8A 1KVRA 2BUCA 2G1UA 2LKDA 3FFWA 2B5OA 3FRIA 3IAM1 2PZLA 1A3CA 2AHRA 2TMGA 1ZHHA 3TCKA 2Q0HA 5HUQA 2G76A 3F2VA 3PHHA 2Z30A 1JHQA 4PC1A 2PXHA 4D9IA 3GT4A 5TS3A 3C6YA 2PFGA 2B2XA 3DUFB 1VB3A 3NX4A 3P27A 4RQTA 1UMCB 5E6UA 5CDYA 5B58C 1MJFA 1HRKA 5A06A 3WOHA 3CF6R 4C0BA 4DMLA 5F9HA 1KJZA 5KNDA 2QJFA 1KEPA 2YN0A 5E4YA 2NU8A 1VOTA 4GXRA 4MLPA 3SR3A 5J4YA 1DKLA 1DBVO 4IQGA 4FMDF 1NVMB 2O7RA 3TDMA 3LX4A 1CZHA 4PS1A 2I54A 3G0OA 1NYTA 1RYYA 4LNHA 5AK5A 1P4RA 1IB6A 3AFNA 2JI6A 2XBUA 3CV3A 1WD7A 2C2WA 1L7RA 2IZ1A 2Q9UA 2Z08A 3PEYA 2J5XA 3TTVA 1XCBA 2HSEA 1EA5A 1OV6A 4L0QA 1ZIYA 1V7CA 2Q0QA 4R71A 4PXSA 4U9UA 4F4CA 1BQ3A 3ETCA 2II6A 4N3AA 4ER7A 2YVUA 1ZQ9A 1XROA 4M0CA 4COKA 1MX5A 4JP8A 2WTBA 1O6GA 1A8QA 1YQUA 1YZKA 2MSCB 2M2IA 3P9YA 3F8WA 1U1GA 4OHWA 4F4HA 2EXXA 5FLXA 3NYWA 4FT2A 1P6XA 1CP2A 4ZVLA 1M6EX 1L5RA 4ND2A 1JJAA 3S7ZA 3N2IA 4N6NA 1Y9EA 4F5DA 3F90A 2KWIA 4LQLA 1QCZA 2X1MA 1CP3A 1U7DA 2P9QA 5CDHA 1VPEA 4YONB 5D3ZA 3MUEA 1RMYA 1MQSA 1C0KA 4XEUA 1X14A 1J9ZA 1T36A 2WKPA 2NZXA 2TYSB 3C43A 2EF0A 1XKTA 3R7DA 1WZIA 5AM0A 5E4TA 2AG6A 4RPCA 3COVA 1VG1A 4FFWA 3VGJA 121PA 1GAJA 1OROA 5JSKA 4MW7A 4MUNA 3OLQA 3QW4B 5EZ6B 2IOQA 1FDWA 4C3UA 1R0LA 1X7GA 1X0XA 2FV8A 1NW6A 3BQNB 2GN1A 3EEOA 1X1BA 1F14A 2AUMA 3JVDA 1CFJA 3TLEA 2IBSA 3DEHA 4ER3A 3DO5A 3MLAA 5CT4A 3JZDA 1DTWB 1KS2A 1V1MB 1QFYA 1TUEA 5BV1A 4B3SB 4CEJB 4MKRA 1RHJA 2VC2B 1P0IA 4EP1A 3HB0A 4C0AC 3DDUA 3T5TA 3WA6A 3W5IA 2JFHA 4KUEA 3EDQA 3V2HA 3H1EA 1AURA 3ECSA 1W5AA 2BW0A 2W6JD 3KKQA 4LJRA 1GT6A 4URHA 2MSEB 3PSAA 1EXWA 3QXCA 1CUVA 2CDRA 2PRIA 4P4SA 2WOJA 4ILEA 3ZX4A 1BCRB 1U81A 4K6GA 2ZANA 2I3ZA 4IQFA 1DINA 1ZM9A 2XB2A 3WGQA 1XMQB 2WUEA 4XYLA 1T5HX 4WKPA 1P7CA 2VI5A 5BW4A 4XD2A 4DA7A 4R40A 4A2PA 1HNZB 4EY3A 1FP1D 2XNJA 4Y8VA 2M6RA 4YMVA 1DXHA 2HMUA 2Y2UA 1AQ6A 1N9GB 4OHVA 1FJHA 3NBFA 2OUIA 3HWSA 2Q8QA 4ACBA 1XF1A 3GHHA 3B1JA 5KVQA 1G9SA 3E05A 2BZGA 4NU8X 3PXBA 1PD1A 3G2KA 1X2EA 1LSUA 2XYRA 5CUQA 3A26A 3AU9A 3H13A 5DP2A 1TJPB 4KNWA 3FUWA 3G88A 2V1XA 4HGYA 4EQZA 3B8HA 2G1AA 1U0RA 5ESXA 2KMLA 2VPPA 3P9SA 1EDBA 4BO5A 1AKVA 1E3IA 1CR0A 2LD4A 3QEMA 2P3OA 3DMHA 1FDTA 4M9CA 2FFAA 3JASA 4KRXA 5HQJA 3JWEA 1R6XA 4P5DA 1FC0A 5D7BA 4MYHA 4WCVA 4YK7A 2C94A 3ROPA 1KS9A 2NUAA 1KEVA 3K1YA 4TKUA 1B6SA 3ZGVA 3AUSA 4ZEXA 3F9IA 1YU6A 1CZKA 3JASB 5LP6C 4B32A 2JFQA 2VCYA 3K09A 4ZO9A 3JQBC 3TTXA 4A92A 1DOZA 2QF7A 1C1XA 2WM2A 3UFXB 4OM8A 4YFYA 2DKOA 1Z4MA 1CQZA 2WJPA 4QUHA 4KO1S 3NGMA 4XASA 3L6BA 3OSUA 3O2QB 1R9GA 1HO3A 3AR9A 4GS5A 4EPWA 1IBKB 4G1BA 2IZ5A 5FUYA 4XVRA 1V2GA 4U0JA 3GFRA 5DPMA 4DVJA 5KYTA 4JWTA 1C2YA 1WZNA 3OU7A 4HQ0A 3VUFA 2FZGA 4HLDA 2O07A 4CKEA 3SX2A 4XEHA 1BEZA 2OVBA 1QTQA 3OTOB 4CM4A 3TK1A 3C8ZA 3IUQA 1DARA 5CJJA 3SLGA 5LSAA 1O4WA 5HTKA 1QGDA 3QVXA 1WBDA 1F2UB 4M0EA 3I5YA 1FP4B 3RUFA 4AB1A 1A88A 1J4AA 2BGKA 1U0HC 2X4DA 4HF7A 4MW5A 3LGAA 4OK3A 3S8EA 1R1DA 1A50B 3NXKA 5CH5A 3VAZA 1XRSB 1CY1A 1DLJA 1PJ8A 2AZTA 4GMDA 2AXQA 5AUPB 1QGZA 2OSBA 2ZWMA 4ZOQI 3K6SA 4HZUA 2RH4A 4YP7A 4IIGA 1CHDA 3LVQE 2WJAA 1I7SB 4ZJUA 3I9NA 1KI2A 5HJEA 2CUZA 5CB0A 1GZ3A 2V5UA 3AY6A 3IDZA 4IIJF 4KWCA 4WL0A 2GZSA 2QY9A 3RKUA 3E7PA 1D2GA 5THKA 4C4RA 4F9GA 5GQSA 1YZYA 3LQQA 4WXRA 3IAAA 3ANXA 3DBRA 4FFPA 4I9HA 2Q4RA 4JLOA 1S7CA 2A9KA 3P5BA 1AMNA 3QWHA 2ZJ4A 1M8KA 3S2YA 1V1RA 1F8XA 1ULSA 5D85A 1TLTA 2CCKA 1U3VA 1EE2A 1ZVQA 2G5PA 2P62A 4WECA 4B4WA 2XXJA 4RNCA 4PHTA 2EF1A 3SYMA 2AJCA 2UU9B 5FV7A 3G0DA 4HN2A 1E8MA 3DMNA 3IT2A 4GXQA 3IOCA 4ZANA 1TMGE 4X6XA 2COKA 3BMNB 3RT7A 1YJQA 1YQDA 3IALA 3ESXA 3U1TA 1DAIA 1BN7A 3H19A 4LZJA 1XAJA 1Z82A 3QVJA 1P4GA 4IGIA 4MWBA 5KTSA 1AMOA 4G0WA 1N92A 2AR0A 1MOQA 3ZGYA 1YD7A 1YR8A 5DHAA 3G0GA 4X45A 1XCPA 3UBMA 3T4PA 5LYJB 2MYPA 3L4SO 3P2KA 4N5LA 1DRVA 2W43A 3OWXA 3W7BA 2GVNA 5KYUA 2JG3A 3QUBA 3MOIA 3CKKA 4ZRMA 2B1QA 2JS7A 5EMMA 1SCAA 4A91A 1W87A 1PF7E 2LCIA 4TL8A 5AKEA 2GZ2A 1QBKC 4JI7B 1M8GA 3PVSA 4JCCA 1VG8A 2V4UA 5FTLA 3VYSB 4KQ2A 3V46A 2Z6UA 3JALA 2QLLA 4DMFA 5IZCA 3P2OA 4ZVSA 3W1VA 5ALWA 4I99A 1VSQA 4IDNA 4IJMA 1RAAA 4JJAA 5ALVA 3AK4A 1Q2XA 5LMNB 4YLGA 1T5BA 1KI6B 1GUYA 2GBPA 3F7OA 4PHGA 4WLVA 5JJ5A 4AKIA 3H18A 4JJKA 1XRQA 3W1WA 2AN3A 4MMZB 4DWOA 5EJ8A 2Q4BA 3IBYA 4MH0R 3KKNA 3M3DA 1P7YA 3TLKA 3UWSA 3JQ9A 5A4IS 1Z12A 1AJEA 3UXEA 5JAIA 4KYVA 1G8SA 3RUPA 5K8VA 3CNBA 4BP8A 1XPUA 2QM0A 2AVDA 1DEHA 2BTOA 2F1JA 3HP1A 1KC1A 4C5CA 1T2UA 1CJUC 3J7TA 1HE5A 2UAGA 4KQGA 4PE5B 3T3EA 2AOWA 2GX6A 3CUKA 1ZGJA 3GP5A 3N7TA 4MPTA 4IF4A 4KPGA 4OHKA 1NFFA 4HAYA 5T64A 4GWKA 2J6CA 1W1IA 3NATA 3OPVA 5F51A 4UHFA 1WETA 3UIEA 2H0RA 1L5VA 3HVKA 4ZPXA 1JPUA 5CG1A 5EXDA 1QIJA 4HN4B 5BOVA 2PRZA 2YC2C 4OA8A 5A71A 1X1SA 3WNCA 3NTRA 3SR0A 4YP5A 1U0FA 2Q1YA 2NYVA 2Z6QA 1TDJA 2ZRCA 2FF5A 2QQ0A 1WPRA 2AFIE 3CX6A 2DHEA 4Q4JA 4F7DA 2PPLA 1B1AA 4RV5A 3O1IC 1JQ3A 4C9BA 1VL2A 1ILEA 1C7RA 3ZCVA 2A0KA 2ID4A 2BI4A 1E4YA 1SUDA 3JRNA 3LECA 2FXIA 1P3JA 1KZ6A 2ZP1A 1IMJA 1ISHA 3HZHA 3RFTA 1AG9A 3K4PA 3LXRA 4I8XA 5DW3A 5C18A 2CC2A 4RYDA 2WIBA 1YUNA 4Q9JA 2PZAA 5BYAA 2BFFB 1OFHA 1UKVY 2LTAA 4IXNA 1RI4A 3T3GA 1GZSA 1AC5A 1D8AA 1N8SA 2VP9A 5HBGA 4C30A 1YVEI 2D59A 2BGJA 3EPRA 1VPDA 4WE3A 3T1VA 1W36B 3TFWA 3NCHA 5GIPE 3ABQB 3CVUA 2SICE 3H3FA 4ZOCA 4CF6A 3FOZA 3AHDA 5HG0A 1C9KA 3LHSA 1F7VA 4WESB 2HH9A 4XQ0A 1NMZA 1IY8A 3I04M 5TQ2A 2OVFA 1L2TA 3TO5A 3H2JA 4EAAA 2G82A 2C04A 1NW8A 1GTZA 4MR7B 3EBPA 4MV4A 1O9BA 2CXPA 2VZEA 3IP6A 2P35A 2JDIA 3K72B 4EPTA 5AVRA 5FPKA 4QVIA 4RMNA 1TYCA 2N3ZA 2J3LA 4DRXA 4CIWA 3F4BA 3KYJB 2QG9A 5KNBH 4E12A 4LHXA 4LGVA 5T57A 3HYLA 3JSAA 2ZIFA 2PY6A 1Q0LA 5EIBD 5A4JA 1NP7A 3AUXA 2BI8A 4B7CA 1MIHA 1N0UA 3NOXA 4Z7QB 1BHO1 3GEEA 2PRKA 3LMKA 4YRQA 2EP8A 2GEDA 4ZQFA 1LPMA 3EPKA 4K9DA 4BYGA 2XEXA 2VDUE 5KPJA 2JIQA 4RWZA 2V45A 4OQFA 5TMDA 5DSZA 3A6EA 4Q4AA 4MQUA 2C82A 4YHBA 5AKLA 4D8XA 1FFYA 2G8NA 1QDEA 2YFKA 3LDGA 4R1NA 3TW8A 3ETGA 5HQTA 1VI5A 1E5TA 4Q6BA 1NW7A 3BICA 3STYA 2YMPA 4F6RB 3TTUA 3NHAA 2ZROA 1PI3A 1ABEA 4ARZB 1QVZA 1UP7A 4KHZA 3QMPA 2MJLA 3RUDA 1UR5A 2W93A 2R00A 3ZDCA 4H6XA 3HADA 4GMKA 4IZ6A 4KZKA 1VJ1A 4KLAA 2SKDA 2WSMA 4BJ6A 1L4LA 4PFSA 5JCOC 1ZBDA 1Z4PX 4GAEA 3FPCA 4IVRA 5KC8A 2JGNA 1ND5A 1FMFA 3RUHA 4Y2VA 2X5KO 4ZXPA 4M9XA 4RULA 1XLTC 2DHQA 2XUKA 4DV2B 1X13A 5CD1A 4IMRA 4P83A 1E94E 2GEKA 4HATA 2P2GA 4AC9A 4DJFC 2Q4OA 4RPJA 5EJ4A 1QHNA 4QYWA 2XUHA 3T4UA 2R85A 2VKTA 4QNMA 3RFFA 4MV1A 3KJEA 4OMCA 2F3TA 1AT1A 3QVMA 4PX9A 1T6NA 3NT2A 5I9NA 4JVNA 3H5TA 2QPLA 3T3HA 4CM5A 5BQ3A 4UAUA 1QPZA 4E03A 1VHWA 4OA5A 4POAA 5ER6A 1I7LA 3FPGA 3COZA 3WB9A 3TSWA 1C0IA 5B6PA 2DFPA 4OQLA 4BNZA 1Z45A 5BYKA 1JE0A 4HWOA 1LQTA 4FUQA 2I7CA 1ZUIA 1YIDA 2DQKA 3HC7A 4QT4A 1UAAA 4GWGA 1P2DA 1D2EA 3Q2IA 4E3WA 10MHA 3NKVA 2GSDA 2C61A 1PZMA 3D1JA 3OE1A 1OBHA 2XB4A 5FPYA 3LC2O 421PA 2CGEA 2CJPA 2VZ8A 1J56A 3M7IA 2ZU6A 4PRLA 1JEDA 3PDHA 1AUOA 5CX1A 5L7YA 3CWCA 1B2LA 3K05A 4D0GA 3BK1A 2Z56A 1A96A 5IM4F 2GBCA 1RMTA 1WPGA 1T1RA 3PNQA 1D4ZA 1YS4A 1WB5A 4YRPA 1UP6A 5EL0A 5AXDA 4LJ9A 5IASA 1LVGA 4HB3A 3CUVA 1MORA 3KWFA 4TVSA 1RTKA 1KZ1A 3MYYA 5BYBA 1T9ZA 5TQJA 1NW5A 2H7CA 2YOHA 3SOZA 1ECBA 5CBKA 2BGRA 2HWYA 2XJ9A 1AXEA 3OWHA 4C08A 1M2VB 2ZSJA 1XJCA 2F1RA 3HUUA 1UBUS 3VR0A 5DFAA 2FVYA 1KY5A 3L0IB 1JZQA 2ZSUA 4KFRA 1L7EA 5KSOA 1XALA 3K70B 3O73A 1L9KA 1S2LA 4L95C 2GTPA 1U8AA 1RWWA 5ENDA 2V0NA 2H2AA 2JD1A 4GRIA 3DCNA 2IEAA 2QT1A 3E9CA 2Q3LA 1E58A 1M6YA 4DLVA 4A1FA 4PO9A 4ARSA 3G5TA 3LLSA 3T8YA 1OW3B 1J90A 4JB0A 1ONBA 3QX8A 1QO9A 4AECA 5COAA 2R6R1 2AYYA 4TMZA 3K0KA 3CR8A 2M6SA 3ZW7A 4D79A 5CLGA 1NKSA 3OM8A 2JA1A 3L8DA 3R1IA 1KBOA 2RJNA 3GRCA 1IZZA 2Q99A 2X9GA 3WGJA 1I3MA 1IBLB 1KH1A 2CL6X 1J39A 2G04A 1LVUA 4B85A 2XITA 1Y34E 3H1TA 1Z0ZA 5IAGA 4YUVA 2C42A 1YB4A 2DBZA 2NSDA 3RO7A 5K3DA 3V48A 4BLVA 3WWPA 1CETA 1SVLA 4KO8A 2ZWVA 4GRAA 3RU2A 2IQ5A 4QU5A 3KR9A 4FOLA 1K86A 4TWJA 3FM9A 4TN1A 2P0AA 4MYCA 2AEEA 4FNOA 3N86A 1RC1A 4IEEA 1BJKA 3PPIA 4X91A 1B4DA 1JXMA 4QXMA 4EMUA 3Q0IA 3T5BA 1E1DA 2R6JA 5K0GA 3C3BA 1OWPA 4EHBA 3EFBA 4TV9B 1YO6A 4IVPA 1CC1S 2PLRA 1DEOA 1E1CA 3D6HA 1JEQB 1TTHA 4IWNA 2Y8EA 4TV8F 1YVRA 4WOJA 3RC3A 4F5WA 1N7GA 1BOOA 2GESA 5FXMA 3MT8A 5BT9A 3C5VA 5K9ZA 2UYCA 4NCIA 2X15A 5U4XA 3HL4A 3NBMA 2Q5OA 1QGYA 2C4UA 2GJ4A 2P8SA 3JQEA 3RD5A 1CSEE 3IKVA 2EKPA 1YQTA 3CCCA 4L5CA 4IIJB 1DBQA 3QBTA 1IPHA 4IXMA 5J40A 3V1MA 3U3JA 3LQ4A 4EB8A 2JHCA 4QXQA 4U7HA 4DSNA 3I45A 1PWYE 1C0LA 4CEJA 4C03A 3KQOA 1T1SA 1FUKA 1PGQA 5KNCH 1QYDA 4BMNA 1SBQA 4H4CA 1QZUA 4CNQA 1S8OA 1XKQA 4QDZA 1R5NA 3EY9A 4YRBA 1X92A 4Q4AB 3T4EA 4E7PA 2VP3A 2FZWA 2I7VA 2WP0A 1YC2A 2BE7A 1Y5LA 3CC8A 1JHRA 1RU3A 1KOJA 2B61A 4G26A 1GILA 1ZISA 3SQLA 4MW9A 2GAIA 4H2DA 1E69A 4LY3A 4XD7D 2ZT6A 4DKXA 2OBNA 9ABPA 3EPJA 2QGFA 4BEBA 4GI1A 4QXPA 1SC4A 2E4WA 5H02A 1K9SA 2KW5A 4KQFA 2TMDA 1HYGA 3QEBZ 2QMHA 1TMKA 1WM1A 1HK7A 2RHJA 2FJUA 3QF7A 3ONNA 4QKQA 1G98A 3OFJA 2HLDA 1USWA 1T3TA 3TBKA 3FOAA 1FVHA 3H6GA 3HPQA 4CKWB 2B9VA 3T94A 4AURA 3JU3A 5E95A 4DV7B 2WLTA 2OXCA 4XQGA 2PSHA 1ACJA 4C20A 4BQIA 2RHRA 2WHRA 4G8BA 3U7JA 3IDFA 1MVNA 1Q1AA 1S3GA 4H59A 2B30A 5IP5A 1RAHA 4I9GA 4DMGA 4V3CA 3PC6A 3QTLA 4M9QA 4YJ2A 4P08A 3CLUC 3OQBA 2BL4A 4WVFA 4FKBA 4X3PA 4XM1A 4OSPA 3WMFA 1FL9A 2JI8A 3AQIA 2NZ8A 2HPZA 1J8YF 4FGKA 2FZ5A 2BFDB 4GE3A 1ZD3A 5F1PA 1JUDA 3ZQ4A 3ABIA 4E5MA 2DWQA 3JQGB 3K16A 4GBGA 2P2SA 3KQKA 2BP7B 2XUFA 1OZAA 1L5NA 1XHLA 2RGXA 3Q9NA 1P2TA 4Q3KA 5E9AA 3V1KA 4EVQA 5L3RA 5HCUA 2Q3EA 3NNNA 16PKA 2PVSA 1Z0JA 2UXCB 4Z49A 3AUYA 1G1AA 3ZY4A 4YUAA 4TSKA 4DW8A 4QYXA 1R64A 1KBQA 4M38A 3ZIAD 3AETB 5BW6B 2YY6A 1WL8A 2NU9B 4E14A 1THZA 4LGYA 1Q0TA 2ZKIA 3F4KA 5AD1A 1E3WA 1G8MA 3ZTTA 4F2WA 5JALA 4Q7KA 1W85B 3U13A 2LIPA 3MFQA 2Q3HA 1QANA 3G13A 3M5WA 3WY9A 1Q0RA 5IKOA 2CXQA 2ACWA 3AIIA 1OGYA 4AUMA 4I1YA 1RQNA 3UB4A 3AJDA 1AU9A 1M2HA 4G0QA 2Q07A 3MXTA 1BNCA 2MMCA 4I1OA 3OM0A 1CUCA 5KYWB 3M1IA 3W5HA 5A0TA 2O2YA 5F7OA 4GLFA 3DA8A 3I5MA 4TLCA 5AXBA 2XZLA 3FG9A 1WDTA 1PK9A 2I80A 4RD1A 4TL6A 5P21A 5A6SA 1NBHA 1Z0DA 5MFZA 1WKVA 1SG6A 1STOA 5AICA 2OCBA 4XWGA 2GARA 3QG5A 3ASZA 3R6TA 4J2HA 4NBWA 2WT9A 5CDFA 4NULA 3U09A 4BFCA 3TG2A 1E9CA 4F56A 2FDXA 4OFBA 4TTJA 1OSNA 1WDMA 1K7EB 3NTQA 5E4FA 1IONA 1E4EA 4PR3A 1E20A 5LMZA 2BDUA 5IDVA 3OP4A 1WNFA 4CW7A 2WTAA 3VHXB 1KAOA 5CK5A 3VFDA 2O2JA 1NI5A 4BFWA 3BWYA 1DIRA 3SQXA 3BHMA 2DR0A 1K5PA 3EPPA 2GAOA 2PO7A 4MGKR 2PMEA 1URPA 2DPHA 4DJAA 1IIRA 1VXRA 4BMXA 3QPUA 3HCFA 4C29A 3PFWO 2WB4A 2O6HA 2WTMA 1PS8A 2G0TA 2WG1A 1YF3A 4V02A 5E6SA 3P0RA 3C8MA 4A73A 1ZOIA 2OZPA 5B4TA 3EDMA 3H1BA 4N8SA 4OHPA 4OJKA 2PWPA 1IOVA 2EL9A 2ALJA 5AW9A 4XYBA 3E3AA 5AKGA 4MKHA 2GD2A 1IBMB 1YL6A 3UUWA 1AHHA 2PEZA 4TLBA 1LDBA 1U6JA 3QEKA 3DBOB 3E61A 5EHXA 5F35A 1JSXA 3KSZO 5IBCA 4N0MA 4JL6A 1U3WA 2JLSA 2RB5A 2DHRA 4P2GA 3UT6A 4ESEA 3S27A 3AP3A 1MQ9A 1T4CB 4TMFA 4RADA 3OICA 5H16A 1ZU4A 4HDCA 2JGLA 1ZESA 2LXNA 2G83A 1OXVA 2VJQA 3CO5A 3F7TA 3RJ5A 4MV9A 2VCHA 4I36A 1DJNA 3NVDA 4Y6SA 4LTDA 5TQ2B 4WZAB 3QU9A 4IV0A 4BYMA 3HCEA 1LBHA 2XVZA 2ZJ0A 1L7PA 4DB2A 3PUJA 4N7BA 5A9TA 2GZAA 3E1SA 4NYJR 5LBTA 3OJOA 3TNJA 4WJLA 5HJ5A 1A72A 1VE1A 3K8QA 5EP3A 1TCVA 2X3UA 1K08A 4K88A 1YDFA 3BIWA 3ENZA 1O77A 1EQUA 1TCAA 2BZSA 4GLOA 4NMHA 3RQIA 4OJNA 5KVAA 2V5AA 4Z0TA 4ILKA 2QTHA 4L5JA 1RAFA 3K94A 5JATA 2CMHA 3HU5A 3PSHA 4KQKA 3WNVA 1Q7TA 3LUCA 1E7SA 5FPPA 2ENUA 4R98A 4QQ8A 1U02A 3CXUA 2IA5A 1RHRA 1YXMA 4AMBA 4J1TC 9GPBA 5JBNA 2BMVA 4CQMB 1SC6A 2I91A 1ULHA 1ZY2A 5K05A 3KV1A 4R41A 2ZAOA 2DJIA 3QEAZ 4GM1A 1QHYA 1QR6A 3A4VA 3GMIA 4U63A 4IH9A 3RK0A 5EZYB 1YDWA 5DHFA 2HHAA 5F3WB 4EA7A 4W6QA 5AK6A 1W29A 3TTYA 3DZIA 4TS4A 4UTXA 2WMDA 2QTZA 1BTOA 3F78A 1PFVA 1UBCA 1Y8AA 3UWDA 1YFKA 5CM9C 1BXZA 2XUPA 4XR9A 1V95A 4MV6A 3OH8A 1MA0A 1F4PA 4QA9A 2DBRA 2WEKA 1ML3A 1PTKA 2WKSA 3NUGA 2XUGA 1W4AA 3HDGA 4M0KA 3AILA 4WY2A 3P2MA 3JWIA 1Y5MA 4M0PA 1ZM7A 3CLSC 1QV9A 3T3PB 2X4GA 2ZE8A 3WADA 1RVDA 1E2GA 1JFRA 3WNBA 1I6MA 1T2CA 2AFHE 3ZCXA 4D4JA 2ZRQA 1C9NA 4KPEC 1IWOA 1U5BA 4ZOAA 2VL7A 4WXPA 4LG1A 2J5RA 4UQPA 1F8FA 3MILA 1WEKA 2E1PA 2JEOA 2NV0A 4TVBA 3GLGE 1Y1SA 2CXHA 3BXGA 5FBZA 4FS8A 3PXUA 4JC0A 3EGDB 1JKFA 2YYYA 3JYLA 3PFCA 5E2AA 1B8UA 2DZDA 2QRQA 3I1YA 4LKOA 4Q1FA 4JIGA 1V5WA 1VPVA 4H4EA 4DRXB 4YQFA 2PU7A 3FLMA 2G9NA 1N33B 1RQGA 1DIBA 2MYTA 3F6EX 4AJNA 3WP0A 2K2WA 3AETA 3PTLA 4CQJA 4PO1A 4N1AA 1FSGA 1WF3A 2A9QA 3DTNA 3PP8A 1RRVA 1LS1A 4K9MA 2MR5A 2TRSB 4CEIB 1FDVA 1W5FA 1AQIA 4CN9A 4DDMA 4C7KA 1QK4A 3QVGB 2W8ZA 1N2IA 2Q3FA 1DRJA 3H1AA 4MP6A 1NVKA 4NVRA 2XNHA 3FPEA 2ZBRA 2XGSA 3O82A 5EUBA 3HKDA 3AEXA 4AYXA 4C0JA 2ZBVA 4FFBA 4GNKA 4DFDA 5IAJA 2LV8A 4XIYA 2J7PA 4A7PA 2I76A 2JJYA 3PEVA 5FBHA 2ZOSA 4HYQA 2PE5A 4OPMA 3T9CA 1LF0A 3LI2A 4HTFB 3FYSA 1HL3A 4R8MA 1GGKA 2AOVA 3OMXA 4G8JA 3RFUA 4AU1A 1N1EA 5I7EA 5I7AA 2JBAB 2QN2A 4I5IA 2CYBA 4DMCA 2ZI5A 4CCSA 4HO1X 1LDEA 4GBMA 3GV0A 4LDQA 1D04A 5AJTA 4ZGGA 2BLNA 4OBBA 3UW3A 2G1KA 3HWRA 4HAOA 3W2TA 1U2RA 2OQRA 4JUDX 5M3BA 3EFOB 4WV3A 2V03A 2E4VA 4YCJA 2C9BA 2GZHA 5JNRA 4FFSA 1R3UA 1XTRA 1QH1B 4LK3A 4XX1A 4J6EA 3PX3A 4Y0AA 1M2EA 2EJBA 4CV3A 1T8YA 2QA5A 4JLPA 4B44A 4NTZA 4QLBA 3IDSA 5JANA 2BONA 2IHKA 4AJPA 2ZAMA 2PH3A 3IR6A 4NCJA 4REQB 1W94A 4R0NA 2MINA 5LOVA 2VK2A 5CXUA 4DM3A 1A4RA 1O5OA 5JSZA 1KZ7B 3QSGA 4WIAA 1Z8DA 4JB2A 4Q6WA 5PGMA 3HUEA 1HF3A 1K68A 4PRZA 3WWOA 4UJ5A 1N5IA 2K7FA 4ARCA 1N5DA 2WIJA 1FZTA 3TLBA 3QE0A 3IQIX 4CDRA 4YIHA 1NX6A 1I0ZA 1FJXA 5BVHB 2B1IA 1QJCA 4TLDA 5LNK6 3LFUA 1HDIA 3KPVA 1V16A 2BKEA 3MLBA 2O0MA 3E8XA 4KBFA 4ZO7A 2QB5A 3V8NA 3SICE 5AJHA 4YRIA 2G25A 1KTVA 4QG3A 2V4ZA 1JU3A 1TQ6A 2IXEA 2OLKA 4I5EA 1K5GA 1USKA 3I76A 3JVIA 4G5FA 5GJCA 2WVGA 1KJNA 3C3MA 4ZZ3A 3NONA 1DC6A 1CNMA 1II9A 4RTLA 5MHTA 1M2KA 1DEKA 1C9EA 3EVAA 4DC9A 3CZQA 3OUZA 6YASA 1GUAA 4U7TB 1W25A 5ISMA 2LBPA 3PLRA 4DLZA 3KQLA 3U3DA 4YROA 3WQQA 3I8OA 1IH8A 4BLWA 1OH6A 2G28A 3K35A 3NU1A 4FHCA 1PD0A 4UTNA 5FL7A 1H3EA 5TIIA 1DZIA 2O05A 1GTL1 3IPXA 2COEA 4OV6B 2QS9A 5K8CA 2BPOA 4RD0A 2Q5CA 4V0ME 1XD9A 3WRYC 3VOTA 4BDSA 1CQJB 5YASA 3F9RA 5LU8A 2X1HA 1XMSA 4P3PA 3GYGA 3P96A 3UMMA 3C7DB 3SOPA 2YJZA 2ECOA 5FOUA 2Y1FA 4MVXA 2GUWA 3U7EB 1OXMA 2WZBA 4A0FA 2QVGA 5ELMA 2HBYA 4J3JA 1ZITA 5KQRA 2OBBA 2BHRA 4TSFD 4DZTA 3A9CA 2TMYA 5DOZA 3R5HA 4MA4A 2GM5A 4PC6A 2J4FA 1U3GA 1L1RA 5CK4A 3WGTA 1SWWA 5JS6A 1P39A 1SEVA 4ZIRA 4E4TA 1Y7PA 2X0RA 3G7UA 2C4NA 4J8PA 1JEYA 3L5OA 2F59A 4OL0A 1G7SA 1DV2A 2GZ3A 4WK2B