5CTAA

G158e/k44e/r57e/y49e bacillus subtilis lipase a with 10% [bmim][cl]
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
179
structure length
179
Chain Sequence
HNPVVMVHGIGGASFNFAGIKSYLVSQGWSRDKLYAVDFWDETGTNENNGPVLSEFVQKVLDETGAKKVDIVAHSMGGANTLYYIKNLDGGNKVANVVTLGGANRLTTGKALPGTDPNQKILYTSIYSSADMIVMNYLSRLDGARNVQIHGVGHIELLYSSQVNSLIKEGLNGGGQNTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Esterase
publication title Crystallographic Investigation of Imidazolium Ionic Liquid Effects on Enzyme Structure.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 68
structure length 179
sequence length 179
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 2015-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01674 Lipase_2 Lipase (class 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5ctaA00
3D4LA 4JEIA 3VJMA 3HACA 3UUFA 4BTVA 4X7BA 3STTA 3Q8WA 1CRLA 4DMCA 2BAGA 2XUAA 1BEZA 1G4HA 3H17A 4PSUA 5CH3A 4X6YA 4GWLA 5AI4A 3C70A 4MEBA 1WM1A 2ZYSA 4B0OA 3STXA 2WU4A 3CN9A 3FYUA 3IULA 4UHHA 1ODTC 2VTVA 2RI6A 1A88A 3A2MA 4OPMA 2HA4A 2BFNA 4L3WA 5AI6A 5CT4A 4UHDA 2IX9A 3M83A 1FSSA 4IQ4A 5CTAA 1D07A 3ESAA 1EXWA 3RLIA 2PX6A 3WL7A 4ZREA 3WL6A 5K3FA 2JGJA 3HSSA 4U2GA 5HFNA 2G63A 4DMHA 3AJAA 4UHBA 4J0IA 2Q0XA 3AILA 1M33A 1XZEA 1BRTA 2WIFA 5AOCA 3HRHA 4GXNA 5CT5A 3MUNA 4CG3A 5JIBA 1GGVA 3I6ZA 1MNAA 2DHCA 3H2GA 4J0HA 1W4LA 4H7HA 3ZPXA 2RHWA 5ALXA 2XUFA 3ESBA 4FTWA 4AO8A 1QO7A 1E8MA 4Y9SA 3CCCA 3UUEA 2WJ4A 3DS8A 4AX4A 1U65A 3F98A 1WPRA 4G9EA 4KE9A 5CT8A 2ES4A 3K9BA 1WB4A 3EIOA 5ALKA 3E3AA 2DSNA 1CUGA 2XMZA 1ORWA 4H0CA 1LGYA 2OCGA 4XJVA 5DTIA 3G0BA 1F6WA 3LIPA 5EHZA 2OPHA 5JD5A 1W52X 3WIBA 1R50A 5EIAA 1CFJA 1B41A 2HRRA 4ETWA 4Q1VA 4P9NA 2QUAA 1CQZA 5ALYA 1TIBA 4U2DA 4C01A 1DQZA 1R9MA 1YA4A 2HM7A 4DTCA 3OM8A 1DWPA 1XRRA 1IZ7A 5A7GA 4DSAA 2OXEA 3PDCA 2XUIA 5ALJA 1GPLA 3P2MA 1XQYA 3G0GA 4BBZA 4AXBA 1WCYA 3H2KA 5EI5A 2G5PA 1BS9A 2JBWA 1FFAA 3WL5A 3O9VA 2ECFA 1F8UA 4Y2XA 5ALGA 3C6ZA 1MJ5A 2J4CA 2PSEA 4HXGA 4YPVA 1QIKA 5IH7A 4OUKX 3IUQA 2ZJ6A 2P8SA 3ICWA 3WYNA 4G4GA 4AMYA 1KU0A 1OCEA 1FFCA 3C6YA 4KACA 3WQHA 1A8SA 3DQZA 4XIIA 4YX9A 3S8YA 2CBGA 2WUEA 4FFVA 1EB8A 3G02A 3QMWA 4BVLA 5IKXA 3SK0A 2QT9A 3R3UA 3DOHA 1ETHA 1CUVA 2QS9A 1X70A 1LPMA 4UUQA 1CUBA 3IB3A 3MGAA 3I6YA 4ZGBA 3RK4A 2C58A 1GPNA 5ALHA 2YASA 5ALMA 1L7RA 4B83A 4CCYB 5HF9A 3FVTA 2VAXA 3SWWA 2AJCA 4X90A 2ZJFA 4K6HA 4HAIA 1GT6A 3VVLA 3FNBA 1XKTA 2XUKA 4RE6A 5AK5A 2ACKA 4X6XA 5AK6A 1U4NA 4BP9A 4UFPA 1MN6A 4MYSA 5CRIA 1UT6A 4W1RA 3L1HA 5AI8A 4QDXA 5K3EA 4B6GA 4AMZA 1U8EA 3O4GA 3EQ8A 5AI5A 2HRQA 3BJMA 2WHRA 2WQZA 4F5ZA 1XZIA 4EY8A 1JJIA 1C7JA 1MX1A 5HKAA 5FKJA 3FYTA 5D3ZA 2PU7A 3BDVA 3E4DA 1FFEA 2VF2A 1CUYA 1YB7A 4I19A 5ALPA 3U1TA 4LIPD 1UWCA 1XFDA 2WHQA 2JEYA 3N2ZB 4QZVA 1AZWA 4F60A 1CUJA 3WZLA 5F4ZA 2WUFA 5SYNA 4K6GA 4PV7A 5ESRA 1RWQA 3F9CA 3W05A 1QIIA 1QOZA 4AZ3A 2W6CX 2CZQA 4BRZA 5ALIA 3AZPA 4LHEA 4WFIA 1UOQA 1E8NA 2BJHA 4QWWA 4ARBA 2VATA 2OCIA 4Y2YA 3KXPA 3FCXA 2HDWA 1ZJ4A 1YSCA 4QWMA 4UBJA 1EDEA 2X8BA 2ZYIA 4ZWNA 4I4CA 2HIHA 5JYCA 3WA6A 1LLFA 1BCRA 1BCSA 5ALUA 4BYMA 5AKGA 3QYJA 4CFSA 3A2LA 2H9YA 4CCYA 1YS2X 2GYVA 3WJ2A 3STWA 3C43A 5AIAA 2VEOA 5EFZA 2XQFA 5C8VA 1G42A 3G0IA 4FLEA 4GW3A 1UKCA 4Y2UA 3H04A 2O2HA 4UBNA 3W9UA 1BEEA 3I2KA 2FUKA 1WB5A 1T4MA 4E46A 5CXUA 4MYDA 4ROTA 1CUWA 1OILA 3O0DA 2Y2UA 4G4IA 1UK9A 2OQVA 2ACEA 1Q0RA 3KWFA 2XUJA 3QPCA 2WSLA 2WJ3A 1B6GA 4KRYA 1ZOIA 3C45A 3D0KA 1HBJA 2WG0A 2WTMA 4DYHA 1LNSA 4JYMA 3TGLA 2BUBA 4KEAA 3CN7A 1H2WA 1QFSA 1ORVA 4B82A 2DHDA 2ZVDA 4AQDA 2Y6VA 2BGRA 1H2XA 4KE7A 3TJMA 5I7UA 3V1MA 2VA9A 4FBMA 2OLEA 3I2GA 3D2BA 4FDMA 4A5SA 5CT9A 5EHQA 3M82A 3G9TA 3X3HA 1CUZA 1THTA 4Y2QA 4GHWA 4UFOA 2H7XA 1SCIA 3FLBA 4MQLA 5FDFA 4CG1A 1XZAA 4I3FA 5HZGA 1CEXA 1XQXA 5JAOA 4B0PA 3E1GA 1DU4A 1H2YA 5K3FB 2RHTA 3BIWA 4H77A 3AINA 3V48A 3OURA 3W04A 2QUBA 3GBSA 2C5GA 2XUGA 2O2IA 3HZOA 3I28A 4BCCA 5HCUA 1MU0A 3O4IA 4UHEA 1Z68A 1GQRA 2HA0A 1DQYA 2OGSA 5CH8A 1ZD3A 1XZLA 3H2IA 4GDMA 3PFBA 4V2IA 4BCBA 3OOSA 5DNVA 4QE3A 2PBLA 3KDAA 1TAHA 1X2BA 3A2NA 5AKEA 2XMDA 5T4EA 5JARA 5FLKA 1N5RA 2V97A 4MWSA 5K3CA 2O2GA 1I6WA 2X5XA 2XLBA 2XUQA 3WKCA 5JZ9A 5K3BA 5AO9A 1Q0ZA 4WFKA 1ZIYA 4EY7A 2EEPA 3FYUC 5DNWA 3WK8A 2WIGA 4FNGA 4X93A 4RE5A 5LZ2A 2QMQA 2V98A 3RKSA 2B20A 4EY6A 1OXMA 2QJWA 4PSDA 2XUPA 4CIBA 3BE8A 5FP0A 2XMBA 4AO6A 4PSCA 3JYHA 3AIMA 3DLTA 1XKLA 2VT6A 5D3KA 2JGIA 4TVKA 1QE3A 4GECA 5K3AA 1QIFA 3ZV7A 1A7UA 4W1QA 2PL5A 5JD6A 3PUHA 4DNQA 1EH5A 4AN1A 4EY4A 5AM2A 2OG1A 4OU5A 1EB9A 4F21A 1JU3A 4Q3OA 3QMVA 4X00A 2WIDA 4MEAA 1UZAA 1ZJ5A 1TCCA 1EX9A 3NWOA 2I03A 4TGLA 1H2ZA 4OSEA 1XZBA 5HF8A 4CI9A 2CB9A 3HEAA 4KJXA 1T2NA 2B4KA 3PFCA 4LYEA 4X94A 1JJBA 4QLAA 2RONA 4JYPA 3KOOA 3E0XA 1CUXA 1GQSA 2G5TA 4X85A 3F96A 5AK3A 4IO0A 3DEAA 1K5PA 3H1AA 3OPMA 5ALSA 3G0DA 1DT5A 2PUHA 4P93A 2XT0A 5CBKA 5LP1A 3QM1A 4UBMA 3R3YA 3L1IA 4HRYA 3I2IA 1YR2A 5I8PA 3AIKA 3VKFA 3RM3A 1K6EA 1O6GA 3SX4A 4BC0A 2HADA 1UK7A 1XRMA 2H7YA 2PPLA 3I2JA 2PSDA 1SFRA 4J0DA 1GKKA 4IHAA 5E2IA 1IUPA 4QA9A 5LIPA 1CUUA 3WKBA 1JMYA 4HS9A 3IDAA 1LPPA 1ZIXA 2GYUA 2V9ZA 4BATA 4Z49A 3YASA 5HK9A 1XRPA 4AB1A 4ZXFA 3WA7A 5CURA 5EGNA 2YXPX 2J3DA 1NX9A 3C6XA 5DTJA 2GZSA 3H2HA 1ZI8A 1MT3A 2OCKA 4K5QA 2J3QA 1A8UA 3V1LA 3IURA 1JMKC 1P0IA 3DKRA 2WTNA 1QFMA 2WILA 1ACLA 3QITA 4MXDA 2CMFA 4G5XA 1ODSA 4BE4A 4C89A 3HABA 2HFKA 1QJ4A 1AQLA 3STVA 2XUOA 5JASA 2NW6A 2WFMA 4W1SA 5ALLA 2XMRA 3ZWQA 2R11A 3VISA 2BUCA 3O95A 3WI7A 1VXRA 4ZI5A 5EIHA 3R41A 3I2FA 3F8SA 2ORYA 4JUIA 3HI4A 1J07A 2WJ6A 2VAVA 4X92A 2VJAA 1DT3A 5LZ8A 4ZRDA 1THGA 4Y2JA 3B12A 3F97A 4K2AA 3O4HA 1XZCA 2HU8A 4G9GA 4N8SA 3D2AA 3M81A 3N0TA 3WWDA 4B9EA 4DMKA 1R4ZA 4OB8A 4EHBA 4Q82A 4S0XA 5IVDA 4Y2PA 4HRXA 4G4JA 2PKYX 4A23A 5CT6A 2XQGA 2BKLA 1CV2A 7YASA 2O7VA 4AN0A 1XRLA 3EQ9A 3W9BA 3R0VA 5JANA 3G0CA 1YA8A 2DR0A 3LCRA 3LLCA 4X91A 3BWXA 3H19A 4B7ZA 1EI9A 1CVLA 2QTBA 4PF1A 5AKXA 5DJ5A 1K4YA 3NOXA 2QKYA 5DYWA 1XRNA 5ALFA 4OD0A 1SCQA 2QJRA 2GBIA 5CW2A 5LKAA 1EVQA 3IA2A 1UK6A 2JGLA 2C4HA 4H35A 1L7QA 1N1MA 3A70A 3GROA 4C4YA 5BWCA 3WWEA 5KWJA 2DHEA 2XLCA 3FLEA 1UXOA 2ZYHA 2PSHA 1Y37A 3WWOA 2JIDA 3BXPA 2DFPA 1Y7IA 3G9XA 1L7AA 2QM0A 4WDRA 1YAHA 1LZLA 5ALZA 4HTAA 5AI0A 4BCDA 4J0CA 3R40A 3B5EA 1GZ7A 3WLAA 5KBYA 4F0JA 3HJUA 1JI3A 1O6FA 2Z8ZA 2B61A 5C7YA 1HQDA 5FRDA 4FKBA 3QVMA 4PW0A 4EB0A 4KAJA 1JU4A 4Y2SA 1PJAA 3Q0TA 5A7FA 1BE0A 2HA3A 5ALOA 3VJLA 3ZLUA 3MUOA 3QPDA 1CUHA 4H7IA 1XLWA 1QTRA 3ESDA 2I78A 4X95A 3WKEA 2JGMA 4L9AA 1JFRA 1VXOA 4QDTA 2O7RA 4UBLA 5H3HA 2OGTA 1AX9A 1HLGA 1P0MA 4WCVA 5I9IA 5JATA 4DIUA 1JT2A 3FSGA 1MNQA 4O08A 1CUEA 2JGEA 2OGZA 4KR0A 1EK1A 1VA4A 2V96A 1AUOA 3HYSA 3V1NA 3LP5A 3FBWA 4HVTA 2BUAA 4JH0A 2OAGA 3S2ZA 1BU8A 1UOOA 4LXIA 3TRDA 3PICA 3BDIA 3WYDA 2D0DA 3FOBA 4DM7A 3FLAA 1WHTA 1JKMA 3O9MA 3IVMA 5EHXA 4BE9A 5IVHA 3HC7A 5AOAA 4W63A 3D2CA 3H1BA 2PM8A 2VJCA 1EHYA 2ZSHA 4BVKA 1U2EA 3KD2A 4EZIA 1J1IA 1LPOA 4ZV9A 5ALTA 2WIJA 4B85A 1J06A 1IMJA 1BROA 1N8SA 1XZFA 2I3ZA 4Y2RA 3WK7A 2HU5A 1HPLA 1ZI6A 5AK4A 4OB7A 5DLPA 1VE7A 2GYWA 5AM1A 4Q34A 3DL7A 4UBOA 4K6KA 4GEGA 5AKZA 3PE6A 4Q3KA 1BN6A 4E11A 4PO3X 1FJ2A 1QIJA 1BN7A 3CXUA 2Z5GA 2XQKA 3GZJA 5HKBA 4Q3LA 3STYA 1VOTA 2BGNA 4JNCA 4ITVA 1J2EA 5FPPA 5BWBA 4H7FA 2C5FA 1DINA 5ALQA 2HFJA 2WKWA 4IH4A 4YASA 2VJDA 4FFWA 2Y6UA 5JD4A 5AKIA 3VVMA 5AKLA 1XRQA 3H2JA 5LKRA 4FWBA 4RNCA 4X6UA 5CXXA 5YASA 2GBCA 2PSJA 3VXKA 4RPCA 1KU6A 3G9UA 5LZ9A 1A8QA 5ALRA 3WWCA 4QLOA 2VJBA 1XZJA 1K8QA 1G5FA 4EY5A 4DNPA 1HKHA 1LBSA 4KE6A 2IIVA 2PU5A 1C4XA 2OCLA 1FFDA 3I6MA 3I1YA 1HDEA 4NZZA 2RGUA 1MO2A 2DQZA 2CEKA 4BAUA 5ALNA 4W1PA 3GUUA 1E3QA 2QOEA 3F67A 2QZPA 1YS1X 3KWJA 1DWOA 4AZ0A 1YASA 1P0PA 1E89A 2C0PA 1GKLA 2OAEA 5FUMA 4P92A 5JAHA 1VZ2A 2HA5A 3QH4A 1EK2A 2QXTA 2PUJA 4A16A 2ZSIA 2QXUA 1VA5A 5A2GA 4C4XA 5KWIA 1QZ3A 4M0EA 2WHPB 2PSFA 2BCEA 5AH0A 1EDDA 4BC1A 1P0QA 1QLWA 4C6HA 4DMFA 5LZ7A 1IZ8A 3DYVA 4QDOA 5DYTA 3WK4A 3HLKA 2XMQA 4NMWA 5LLSA 4FMPA 1XZGA 2VSQA 4KE8A 1TKRA 4FHZA 5D7BA 3DDUA 1VZ3A 4L0CA 3WK9A 2D5LA 2HA2A 1MX5A 3JW8A 4INZA 4P08A 3LS2A 3MVEA 1CR6A 4KYVA 2ZJ7A 4DSZA 3DKKA 1YCDA 2QR5A 4G1FA 3UMJA 2JGFA 4E14A 3IUJA 4ZV7A 5FV4A 3QPAA 3WK6A 3C8DA 1LZKA 2XMCA 1QGED 4D9JA 3DYIA 3AIOA 3WJ1A 4G8BA 5AKJA 4LXGA 3ICVA 3ESCA 4TPKA 2XI4A 4C4ZA 2XE4A 2XMGA 3WKDA 3H18A 5HQ3B 3TEJA 3R3VA 2GBGA 4FLFA 5E4YA 4L72A 4WDQA 1MAAA 2E3JA 4J03A 3QMMA 2XQIA 3D59A 3V1KA 1CQWA 2OQIA 2WM2A 1XZHA 2VT7A 1IUOA 3IUNA 1EVEA 2AXEA 5E4TA 3I2HA 2AJ8A 4U2CA 2WHPA 3LIIA 4BTLA 5BOVA 3IIIA 1S8OA 3QBJA 4FBLA 2WLSA 4MQMA 2Y2VA 5ALEA 4GBGA 1X2EA 4LKOA 1ZICA 4UBKA 3L1JA 4B84A 3R3WA 1ZD4A 4UHCA 1DX4A 1GXSA 2XDWA 5AICA 5JAPA 2QVBA 3EF3A 3C5WP 2UZ0A 4H7KA 4UHFA 4W9RA 6YASA 1PV1A 3C87A 1VE6A 1CUCA 1R9NA 5DNUA 4OU4A 5A62A 3D3NA 3FWHA 4CG2A 1FFBA 3ED1A 3SC2A 4UFNA 1W75A 4BAGA 5J3JA 5A6VA 1MAHA 1QO9A 3DNMA 3WKAA 1R3DA 3BIXA 3AFIA 1AKNA 2H1IA 2I3DA 3KSRA 5LZ5A 3ZLVA 3R3ZA 1AMNA 5T4BA 3EBLA 3C5VA 2JF0A 4CCWA 3G9ZA 4U2BA 5K3DA 3STUA 2XUHA 1GPKA 4BVJA 5A71A 1YAJA 4WFJA 1CUFA 5HQ3A 3C6BA 5AM4A 4OYYA 1ISPA 1EDBA 5E4JA 3PI6A 1VLQA 4KAAA 4N8EA 2WG2A 4QDUA 1H22A 2YH2A 4C88A 5JAUA 2X76A 1ACJA 1EA5A 1YB6A 3I1IA 1QIEA 3WL8A 2AJBA 3T52A 3BF7A 4FOLA 3AZQA 1Q83A 2YYSA 3O4JA 5HF6A 3WZMA 4BP8A 4J0JA 1LBTA 4Y2VA 3K2IA 2ROQA 4CIAA 1IVYA 5LZ4A 1XQWA 2WIKA 5AKHA 1UKBA 4E15A 4WY5A 3WMRA 1ODCA 2GZRA 2HL6A 4WY8A 1TRHA 3CCBA 1E8DA 4J3JA 4B80A 2C7BA 1NU8A 2HA7A 2RIPA 5AOBA 2FJPA 3PF8A 4XX1A 4PNZA 5T4FA 1CLEA 2CUTA 1TK3A 1WPXA 1LPBB 1LPNA 3OTQA 1XZDA 2IITA 4DNOA 3DOIA 3IUMA 1H23A 2GBFA 1W6RA 1G66A 5JALA 3BL8A 1WB6A 4DGQA 1IUNA 1R1DA 1EINA 1E66A 4J7AA 1AURA 1Q84A 1K63A 4DNFA 4DLNA 1VJ5A 4EBBA 2WUDA 1QIHA 1ZGBA 5CH5A 3DL4A 2AJDA 3WIOA 1XROA 5BV7A 3M3DA 4Y7DA 2EDAA 1QIDA 5AJHA 4M0FA 4QEKA 2HU7A 2G4LA 2XQJA 2XMSA 5AP9A 3DD5A 4BDSA 4Y2TA 1XQVA 4X97A 1QTIA 1F0NA 4UPDA 4HZGA 3AUKA 1UK8A 2XUDA 5EHNA 2K2QB 5C8ZA 5LYYA 1DX6A 2DCMA 1NU6A 5KREA 1QIGA 3G7NA 3AZOA 3QZUA 5JADA 1WHSA 1UKAA 5K5EA 3H0CA 4B81A 4IH9A 2JGKA 1RP1A 2Z8XA 5DWDA 3T4UA 2FJ0A 1SC9A 4OB6A 4UBIA 1F0PA 3GELA 4BZZA 1XLUA 1LPAB 2LIPA 1ZD2P 2C0QA 5D6OA 1MTZA 1XZMA 3FCYA 4YK7A 4OCZA 2WU3A 5AHXA 1W1IA 3PUIA 4H7EA 4GLBA 3OG9A 4H7DA 2WFLB 2FX5A 1LPSA 3OC0A 3EQ7A 3U0VA 1MPXA 4J0GA 2PVSA 1QIMA 1N5MA 4G8CA 4H18A 5AIBA 3ZI7A 2JEZA 3V9AA 2W22A 1XZKA 2WFZA 3DCNA 1ZI9A 4BZWA 2VQ6A 3GFFA 4XWGA 2HA6A 5FPQA 3VDXA 3BJRA 2ZYRA 4AO7A 1W76A 4BRSA 1USWA 3NGMA 2XB6A 1TCBA 2ONCA 2RAUA 1R88A 3FAKA 5AKKA 3R3XA 4QDZA 1QONA 5A7HA 5AM3A 5AI9A 3JWEA 5C8XA 4FNMA 1ZD5A 5IVIA 4X3CA 3G8YA 4BAZA 5DYYA 4IH1A 3ANTA 4PQEA 5EIEA 3C8HA 1CUIA 2HHAA 1PFQA 4KRXA 4J0KA 3VJKA 4QNNA 3GA7A 5SYMA 3PF9A 4OYLA 4WJLA 3BF8A 2WUGA 2B9VA 5JZBA 2CJPA 2EDCA 5ALVA 4BB0A 3K6KA 5FXMA 4Q05A 4EA6A 3ANSA 3FYUB 2Z3ZA 2J4FA 5T4HA 4HXFB 1CUAA 1ZGCA 4RGYA 1VKHA 1UFOA 4MJ3A 1KEZA 1SOMA 1DTEA 1UOPA 1SCKA 2H7CA 2QRUA 1AC5A 4GI1A 4KAFA 2Z3WA 3RARA 3ZLTA 3FVRA 5FOQA 1CIJA 4BDTA 1MX9A 4B9AA 2WFLA 3HXKA 4ARAA 1C7IA 4N5IX 5HF5A 5IVKA 3D5EA 1CUDA 4NS4A 1DWQA 1HL7A 1CPYA 3WK5A 1WOMA 5ISMA 1XLVA 4MWTA 1CUSA 4C87A 4N8DA 5JZSA 4FLMA 2AJLI 4HXEB 4NVRA 4EUSA 2DQYA 4N5HX 1RYYA 5AKYA 2CKMA 4LXHA 4H7JA 4U2EA 3W06A 4LYDA 4M0MA 5ALWA 4G8DA 3A6ZA 2R8BA 5HK8A 1Y7HA 4XVCA 1JJFA 5C81A 3IBTA 5CMLA 3FSGD 5ALDA 3ILSA 1TQHA 5HFAA 3W2TA 2WG1A 5AM0A 5AM5A 2Y1KA 1E5TA 3WWPA 3DJYA 1TCAA 3B3QA 4U2FA 3NUZA 4X71A 1AGYA 3D7RA
chains in the Genus database with same CATH superfamily
4G5FA 1IEXA 1DARA 1Z4NA 2JFPA 3H1EA 5D86A 5J63A 1V3TA 4HR7A 3VYWA 3RRYA 4JSYA 3STTA 2D8AA 5TJ9A 5B6IA 2MMCA 1KPIA 2P0AA 4RD2A 5CA0F 3NHRA 1IEVA 9LDTA 1ACMA 4WXMA 4DMMA 2A59A 3KZCA 4DCSA 4D80A 2QL9A 3SXPA 3COZA 4MMYB 2QRJA 2OPBA 3HY4A 4M9QA 1BHJA 1QB7A 1RM3A 4BGUA 4FMCB 3A32A 4DV4B 1W19A 2C3YA 3T3GA 1AXRA 1GZVA 2NTYC 5HCNA 1IRXA 3PWZA 5C31A 1ORTA 2ORVA 1KOFA 4E09A 1F8FA 1PJ3A 1ZC3A 2PMBA 2I4TA 5GONF 2WU4A 3L6DA 1GL6A 1TZKA 2QMHA 5M34A 2JFXA 4OV6B 2WYUA 4KI7A 4Y0AA 3NNDA 4P4SB 1A88A 3RVRA 3H11A 4JITA 4LVUA 1ZW6A 3D31A 3MTBA 3GJ3A 3OCUA 4F3RA 2BFNA 1UWLA 5AI6A 1Z47A 1MP0A 3AUFA 3W6OA 3EY4A 3GG2A 3OA0A 3FNEA 3PSAA 2J7PA 1H1TA 2VPTA 2G9VA 4IWXA 4OK6A 5CT4A 5EE0A 3M83A 2IUUA 1FSSA 2EHJA 4WKPA 4DQXA 4UTPA 4YRKA 5IKPA 1ZHHA 4PAWA 4C0XA 2N47A 2C83A 4ZAFA 3ESAA 1XNHA 5DHRA 3BK7A 1WSBA 3ZDDA 2QL7A 1NZJA 4NNPA 4U2GA 1M2WA 2XECA 1QBKC 4JI0B 2HD4A 3DUFA 1EVLA 1I13A 2ZB2A 1XDDA 1C3XA 3FNFA 4DMHA 4ALLA 1V45E 4CXMA 2F55A 1DJOA 1YBHA 3IOEA 1XVAA 4ZVPA 3AILA 3RS9A 5JROA 1E77A 1Z4PX 1M33A 4JYAB 4YJFB 3UKOA 3VC1A 4DA4A 1FP4A 4CG3A 2AFIB 1GGVA 2ZR0A 4CCAA 2Y1CA 2P41A 1BDIA 2YIJA 4UNPA 2B7CA 3X44A 4ZGWA 5BSEA 4H7HA 4MA5A 3GT7A 3NPAA 2RK6A 1OWMA 1VC2A 4CQMD 3R23A 1LS6A 3C24A 3CT6A 4FTWA 4UPVA 3AXTA 4CF5A 4YYEA 1QO7A 2FX2A 2GN0A 1XCLA 2XCOA 1E8MA 5FPYA 1EE9A 1Z16A 1E7RA 3WHLA 4B8YA 4A8JB 2Z9DA 2CWWA 5JWHA 3AFGA 3UJAA 3I2YX 1U65A 4AX4A 4R71A 2R6JA 1E7QA 1IJBA 1HZJA 1VPTA 3LQKA 1E96A 1SK9A 1R6UA 4HADA 1AS3A 4KE9A 3ZUGA 2OZLB 4IXWA 3ELBA 5DGIA 4LQCA 5CT8A 2CNKA 1CU1A 1PGPA 2AX3A 2CLEB 1TO6A 2ES4A 2Q3JA 5AOVA 2J45A 2Q3FA 4JIGA 5EXSA 3EIOA 1L2TA 3OAAD 3ONDA 3QXSA 3SXUB 3UMGA 3T12A 5BYKA 4IGIA 1YRBA 5FPSA 4HQ6A 3L92A 2CJWA 4B75A 2DSNA 5EL0A 4ZEXA 4ZN6A 1Z08A 4UKDA 2C4KA 4J94A 5I7WA 3OOJA 4XJVA 4G1VA 5LNK1 4PYOA 4KFCA 4KCGA 2VBIA 4LDJA 1CY8A 2X5KO 1YS4A 4YJHB 5EHZA 1R16A 1U0FA 3L8MA 4YLGA 1HA3A 5DK6A 3WIBA 5FWYB 3UMYA 1SD5A 5IM4A 1NLMA 1YI1A 1I0IA 2FWNA 3B13B 3QUTA 4G89A 4HZIA 1CZNA 1ZVQA 3OT4A 2ZRHA 4MS1A 5THQA 1Z0AA 2CJFA 2D00A 2GEKA 4C07A 3HNPA 4Q1VA 3ZD8A 3AVOA 4P9NA 3ZY5A 4WLVA 3UWPA 3ZJ4A 4X66B 4RTPA 4KSYA 5AVXA 1W9MA 3NTVA 3KYBA 4BJ5A 1ZIPA 2BGWA 4U2DA 5H7XA 1Y4SA 1XHEA 1P7PA 1V1RA 2GD0A 1XZQA 1OR8A 1R9MA 3SBDA 3MXOA 3SZMA 2HM7A 1OYOA 3W6NA 5D00A 2GRAA 5HIMA 3TTYA 1AUXA 1IZ7A 2HGZA 4PZ0A 2P75A 3EZ7A 2C29D 2BEVB 2VHQA 3CV3A 4URZR 4HV4A 3S70A 2AOTB 4MW7A 2XUIA 2AWNA 2Z2JA 4BXOB 1JJVA 1P9NA 2FZCA 4GC5A 4ICIA 4U39A 5ALJA 5KJEA 3L0CA 3U7RA 5I47A 3EDQA 2RCYA 4U7PB 1GPLA 4IZ6A 4AUMA 4BLTA 2HKIA 4N82A 1GADO 4E30A 3OLXA 4RTQA 1ZWLA 3IEMA 4AXBA 4NHOA 3GR6A 1RKBA 1NVBA 3IQFA 1SVWA 4O2RA 3H2KA 3UPUA 2EBFX 3JCZA 4JLUA 2JBWA 3UMCA 1YC2A 4YRCA 2RG7A 4EJ2A 2D7DA 1O94D 2OECA 3PNSA 4LS3A 5GTDA 2Z2XA 4KXMA 1Z4QA 2XE7A 3PR3A 5LLTA 1F7VA 3B5JA 3GAMA 3VPBA 3BGVA 1HDGO 5H16A 2HCJB 3PQ8A 2YJ6A 5ARCA 4CCSA 3ZWXA 3LHDA 1Z0IA 1DOHA 4UZEA 4TLDA 1MJ5A 1YQXA 4UARA 2A9PA 2VDVE 5BT9A 4RM3A 1W5EA 4JENA 1RWKA 5CB4F 4HDKB 4J8PA 4KO2S 1FDSA 4XZ3A 1QIKA 5BQXA 3DFUA 1L4YA 2JJ2D 4XWWA 2QTLA 1QUEA 4U5QA 1RABA 2H59A 4INAA 1H94A 4KQHA 3WL4A 3SG0A 3LUFA 2DKFA 2HCBA 3EMKA 5TRTA 3LQ1A 1OBOA 2FCAA 2FGJA 3KOXA 1AKVA 2P8SA 2QAJA 2R1TA 4DCMA 4ER6A 4F4JA 1P72A 4DCPA 3MPOA 3AEKB 2C7VA 4WV3A 4J7UA 2OXIA 5LQDA 4UAUA 4GYYA 3SHWA 1FMFA 4AIRA 1KU0A 3QY0A 2ZB4A 4AMYA 4ZHQF 2R65A 3ZLUA 2GAAA 3PIIA 1DBQA 3WQHA 1J8MF 3DQZA 2A9QA 3IBYA 4WXRA 5DV9A 4FHFA 3K0AB 4FFVA 3CNBA 4OOEA 4EFMA 1I5OA 3IMFA 4J90A 3CKLA 5IKXA 3SK0A 5A02A 2NTEA 3VKVA 4COKA 3R3UA 3WR5A 1ISGA 3FJOA 2GAJA 4Q39A 4EJSC 4PZPA 1DRKA 2G09A 2WV9A 3ADKA 5HRAA 1XJWA 1IZZA 2QS9A 5LR6A 3VR4A 2I33A 4ZI3A 3GLGB 2ZIGA 4M8SA 1AGNA 3ZD9A 4B6OA 3L7IA 3VR5A 3ZWCA 2H0QA 1CZLA 3HDGA 4FZJA 3PCXA 4OGLA 5KOIA 1OUMA 1E5LA 2CMDA 3VR6H 621PA 4DCCA 5J2UF 3I6YA 1NN3A 2ZCUA 2XNDA 3BGSA 4PRLA 5CVUA 3RK4A 4UM9D 1BCSB 1RMQA 2C58A 2D0OB 4MS3B 3DNPA 5FH9A 2CCGA 3LUDA 4OQDA 1NNSA 4D3YA 1GDDA 1Z22A 3IIKA 4JR0A 4K9PA 2DX7A 2YASA 1UKEA 3GFOA 3W5SA 5I48A 3W6PA 2WWYA 5FBHA 3NONA 3T0FA 1ESMA 1XTKA 5EIFA 3TTUA 3W8FA 1UXHA 5KNDA 3OE4A 1WXXA 1DB3A 1XTVA 3CF0A 3FDIA 3OFKA 4ZOBA 3I5XA 4KPUA 2YRWA 1DTWA 2W4QA 1LLDA 4OQPA 4K6HA 3TAUA 4HAIA 3IBCA 5LIRA 2Q2QA 4Q24A 1P44A 2V45A 4K6MA 2I55A 4DPLA 2ZRFA 1PLLA 2XEXA 4A0SA 4E4RA 1DC7A 2P7HA 3AVUA 5AW7A 4QC2A 5K09A 1ZNZA 4RE6A 3V8RA 1UC4B 5AK5A 2ACKA 4DG9A 4S05A 3QE9Y 3JZFA 2YW2A 1TYCA 1XC7A 3ZZ0A 4X6XA 5AK6A 1U4NA 4DC1A 2XY4A 3N2GA 3S29A 3ZD6A 1ZW1A 1JB1A 2L2QA 3L8FA 1O9GA 3ZC3A 1MN6A 4MYSA 1V11B 3E1KA 4W1RA 5CNIA 1KSJA 4ON9A 5AI8A 4HDRA 4ABYA 1G41A 5TY0A 2QM7A 2OBYA 4AKGA 3TSYA 2F62A 4MYRA 4H16A 4B6GA 4AMZA 2XSZD 3O4GA 2ZP1A 3EQ8A 4MV9A 4O4HF 3VU3A 4JP5A 5K4GA 2AR9A 4ENVA 2G4CA 3WBFA 4FINA 1JQKA 2ONYA 2ZJAA 4A6EA 4BFYA 5KYVA 2CYBA 2WQZA 4AJEA 5C0OE 1XZIA 1RLTA 2F48A 1L6RA 4PFKA 1MX1A 4H0NA 2AR7A 4L02A 3RD5A 3ZHTA 1XK6A 3BCUA 5ADVA 5HKAA 1U3GA 2P7IA 2Y0CA 4M88A 1A9PA 2RGGA 3RF6A 3QKIA 1D9XA 2YRXA 1OLUB 4GNRA 5G4KB 1UEIA 2P5TB 2QP9X 4CL8A 4YUAA 2JFZA 1C0EA 4QNRA 2M2IA 1O03A 5LDGA 1EWQA 2NXCA 4OQ4A 1YB7A 3V2HA 1Z6AA 1U80A 4J1TA 4QOIA 3U1TA 2DG2A 1NWHA 3AEYA 2WHQA 2JEYA 3ZBPA 1Y8ZA 2RAFA 4A27A 4JWTA 1D6MA 1NAIA 3MCAA 1CUJA 1P81A 2ABWA 2IUFA 3SYRA 3GJXC 2IOYA 4UVGA 5CPFA 2NQ2C 1JYEA 2DGDA 3W5IA 3DMPA 4LY6A 4BRUA 3Q15C 5HGXA 4NXNB 3MG9A 4Z8XA 2FQYA 3EFEA 3A06A 4QXAA 1QHXA 2QRGA 3UT5A 3L6OO 3AHHA 5KYNA 4EVSA 2CVQA 3EVCA 1A9TA 1JHVA 4MQ6A 5T8KC 3I8OA 1SHTX 4MQUA 4G2TA 1AQYA 1OWLA 1YQEA 1FTYA 3KB8A 3A6LA 1QIIA 1KH2A 3W7VA 4RABA 4YYZA 3THXB 1V8ZA 1ML3A 2BBWA 1OKKA 3BBLA 3I4LA 2AFVA 1L5LA 4L0MA 2QW0X 4QAJA 3L7CA 4RA6B 3HA3A 5DNCA 2PQ6A 1RMYA 4BB9A 2WTUA 1ZEMA 2FEXA 2Y0DA 4YUXA 5M04A 3GJZA 1VP9A 2YKGA 3ZQ6A 4Z4HA 2RD2A 3AZPA 1UXIA 4RHCA 5JD3A 2WVHA 4ZOLA 2MYUA 3HCDA 3IDSA 2Z1NA 4F71A 4HAWA 1DKPA 2BJHA 4RJTA 3BB3A 2VATA 4IP0A 3V3KA 2BH2A 2UZIR 3FCXA 2W4IA 3SU8A 2X0NA 1GCUA 1X77A 2JHGA 3RVSA 2ATCA 3JQBC 3EX7C 1YSCA 1U98A 3T0GA 3E7FA 2QSZA 4QWMA 4H6XA 4LJSA 4UBJA 1DJNA 4EI8A 1G9XA 5FHRA 5GAJA 2DWUA 2VF4X 2X8BA 2ZYIA 1S7CA 1CT9A 4DPMA 1DG1G 4G0NA 4I4CA 2JCGA 5F33A 1NMYA 2I8CA 1CZKA 4R1MA 5JYCA 3AQ4A 5ALUA 1K0UA 1TXGA 2ONZA 3ESYA 5KTTA 1IE3A 2EKQA 3QYJA 3PQ3A 4WA7A 5JMTA 4CFSA 3BE4A 3O8QA 4BFSA 1FBTA 1MA0A 1Z63A 1RSZA 2H9YA 1T8PA 3A31A 3MJVA 2J6CA 3T94A 1DXYA 3EQZA 4B3DA 1RBZA 2XHZA 5CGZA 2GYVA 1UODA 2PQMA 3OQIB 3WJ2A 4EA8A 1CIVA 1P3JA 2WTAA 4RLFA 4HDSB 4RQTA 3W5BA 2VEOA 2Z5FA 2LPMA 2B3DA 2WUWE 3AHJA 3B1XA 4KBFA 4RTKA 4LJ5A 3R0XA 2GD6A 2HLDD 4UNNA 6Q21A 3AHIA 1HYQA 3ETCA 2DULA 1HE1C 3LYLA 1E6EA 2XQFA 4L8YA 1SA0A 1JEJA 4P3OA 1BS1A 3C39A 3SEAA 3UW3A 4L85A 1OC4A 1U5AA 5J4KA 3EC7A 1LK5A 2FPRA 2GEBA 4PICA 2BL4A 1E6LA 1B6TA 2AA3A 2QG9A 3PQFA 1BEEA 3DW1X 2BT4A 1EX1A 1GZ6A 1Y8QA 3O3MB 3TRFA 3RUIA 1X7ZB 1JWAB 1UC5B 2FOLA 2X22A 3EGCA 4Q9DA 1DCTA 4R0MA 3VSEA 4D45A 4E1AA 1JDSA 1A2BA 1QS0A 2GETA 4I50F 1OILA 2CZCA 3I9NA 4ROTA 3QU9A 4X7MA 4G4IA 1W30A 3BFVA 1IOVA 5H8WA 4BFXA 1WEHA 2R6ZA 3L8HA 1YNOA 2ACEA 4KQWA 1JV2B 4P1ZA 5TEWA 1U7HA 2WF5A 4OJYA 4OH7A 4LYFA 2VCEA 5C80A 2X15A 1HT2E 2IE0A 5T7BA 3HXQA 3N8NA 4KRYA 4J07A 5LU8A 3G85A 3R6TA 3F6YA 2Q1TA 4HNSA 4I6EA 4DLBA 3C45A 2XF8A 1W5FA 1HBJA 3CINA 3KKNA 2JZOA 3QXCA 4RKWA 4AYTA 4BMNA 2MR5A 3ILXA 4RZHA 1D6SA 3LXXA 1N9ZA 1Y5NA 3CLUC 1Q14A 3GGSA 4IJQA 1JKXA 2FZLA 3H86A 3RAEC 1EE1A 3BK2A 3VHXA 3CN7A 3SM9A 3SXJA 4B2IA 1V3UA 3FPGA 2E5FA 1H2WA 4GR4A 3VO8A 3Q9SA 3LPMA 3NDRA 2C88A 4OAPA 5SICE 3R5TA 3E5MA 2Q6OA 1E3WA 3KKLA 4XCQA 2ZVDA 2X9NA 1USGA 4ZICA 5CX1B 3A3PA 3B85A 3HCCA 4W5JA 2NGRA 2V5VA 2EZTA 2N1BA 4R4JA 3TR0A 2CXOA 3EC2A 1FSGA 3QE4A 2X7JA 1P7CA 1TUIA 4ZOQI 1U28A 1YR3A 4YAWA 1E0SA 1U2ZA 2M1ZA 3IESA 2X9GA 3RR2A 4BQIA 2HREA 2G06A 3CKYA 3DMTC 4PWYA 4QOJA 2FRVA 4CU2A 4N39A 4EG4A 5KX5F 2IS6A 3HB5X 4URFA 3AWDA 3N7UA 4DA0A 2YY7A 3GD5A 5CT9A 2RIRA 5EHQA 3T5MA 4GZLA 3UZUA 5K1ZA 1GT91 2XRMA 2VSOA 4BWGA 1MHPA 1VHLA 1CUZA 1HOXA 2CNWD 1U1EA 2OZKA 4EMSA 4NHEA 4RWZA 5HJ7A 3GLIE 1G5PA 4HGOA 4UFOA 1U02A 1X8XA 3E3LA 4N0DA 2J3HA 3IQWA 1J2UA 1RPZA 2VQEB 2QB5A 4MQLA 4MV1A 4R9UC 3QOWA 3CZ9A 4FFDA 3KKPA 4FDUA 3MOGA 3J7TA 3Q6MA 3IV7A 1XZAA 1I3CA 1ZCZA 1OOEA 4I3FA 1V16B 3THOA 5HZGA 3I76A 3WLMA 2IE8A 2K6GA 5JAOA 3LUHA 3ZZNA 4YWHA 2Q2OA 1H2YA 5K3FB 1I51A 4B48A 4K05A 3OE7A 1MJHA 2XZPA 4DQLA 4EG7A 4JI8B 3V48A 2ILVA 3WB9A 3NS7A 3W04A 4CEIA 1W93A 1H93A 2HPHA 3LL7A 1VI5A 2ODEA 1AA6A 1YBAA 4MK4A 4DV2B 3RFFA 5LN1A 3BCHA 5F1YA 4H1UA 1UBMS 1F2TB 2A8YA 4G37A 2ERYA 1MA3A 4QUIA 5HCUA 3OIUA 1E60A 1ZOOA 4UHEA 4XARA 3LLMA 1N6OA 1XVTA 1Z68A 2FETA 3BXHA 3P9XA 4PR3A 4QNMA 4M1YA 1D2EA 1GQRA 3DEIA 4ZYUA 1NV9A 1NXWA 1YBFA 1JAHA 1Y98A 3D6JA 3KHTA 3MT8A 4ID3A 2FPPB 2IL1A 4X1IB 3CZQA 1UC9A 1XZLA 1VSBA 4P34A 5K2OA 4Q3BA 2PRSA 4KN8A 2I34A 2VXOA 3RS7A 1QHFA 4EYQA 2YVKA 4M1KA 3OOSA 4V2IA 4E5KA 3ZY3A 3ZHSA 2VOEA 4IJ6A 2FP3A 3JV7A 2R62A 3DBHA 3EEFA 3JQ9C 2V8OA 3AI2A 4RCZA 2BMFA 5AKEA 4Z9YA 4E07A 3L7KA 4JI3B 1Z13A 1XDGA 4ZP1A 5JARA 5FLKA 4DEVA 2Q4RA 5CFNA 3FYDA 3X2SA 2QV0A 3JAKB 5AW9A 3PNOA 1C9JA 1D1PA 1I6WA 2O2GA 4XQ9A 3U60B 2IF0A 2I4RA 2O3JA 3TZHA 5K3BA 2PFKA 4IXMA 1FXWA 4TS9A 1F2UA 3LHIA 1PJ4A 1LTKA 4WFKA 3RVBA 1PR0A 1ZIYA 2KJQA 4F1JA 4TL8A 3M34A 3VR3A 5B3AA 4WQMA 1N0UA 4EY7A 5DNWA 3WK8A 3BHIA 1Q95A 1CDDA 3GGJA 1CW2B 4XD2A 2KPOA 5KJ1A 3NOOA 1XALA 4IIBA 3VR2D 3WADA 1FBNA 2I4IA 1C3LA 2FB9A 4RE5A 1Q1AA 1ZBDA 2EU8A 3MNFA 3WO0A 2C8KA 2FU5C 2G76A 4CV2A 5JJKA 4J16A 1U5BA 4RJJA 5CA1A 1Z5PA 3FOCA 1Z8DA 3PE3A 1PNRA 2B20A 3H5NA 4PQGA 4RC9A 1KXJA 2ENUA 5ABPA 2JAWA 4EHDA 4IVQA 1OXMA 4NJMA 5JFGA 2HHHB 3KZVA 5EMHA 2E7ZA 2PLRA 4ETIA 5GPBA 1W2HA 1J24A 1IL0A 5JI3E 2VTBA 2Q07A 3BE8A 3OWOA 2G04A 2CVHA 4GPTA 4IQ8A 5IEJA 4AO6A 3KSAC 1NXVA 1J6UA 1XCPA 2QAGC 4EG5A 1UFKA 2NZUG 3GVCA 3RSCA 3TLBA 1N3LA 3JYHA 1YZLA 3EZXA 4FUQA 1SD2A 4IKPA 1YH3A 2VT6A 3TQHA 4B43A 3KD3A 3QOYA 3S2UA 2ATXA 5D3KA 1DMSA 4GLFA 2QXYA 1XNJA 3W5DA 1GD1O 4MKIA 3O2SB 4TVKA 5IJZA 5A1JA 4KK4A 2HWUA 4RTRA 1L5MA 1BH6A 1EFVB 1LFAA 1UL1X 5BR4A 4S04A 4DZRA 1BJKA 1G7CA 4X7PA 5F7ZA 4C2AA 2P27A 3EVNA 5FF9A 3T54A 3RYIA 4CIYA 1YOVB 2YN0A 3FHCB 5UKDA 3D4PA 3PUHA 1Q0LA 4EF4A 1NW8A 4DNQA 5K51A 3DLIA 1MVOA 4N6NA 4PPFA 3MD0A 1IVSA 2A7XA 4ZAGA 2HIMA 3DE5X 4FCTA 5B57C 4AN1A 2IZZA 4I4TA 5K0FA 2QNIA 2BELA 2XXAB 1UJMA 2OG1A 1P3Y1 4E88A 1TYAE 1LKZA 4D0GA 5CDFE 4F21A 3BHNA 3VC7A 4Q3OA 4WNCA 2YFKA 3ER9A 1B14A 1T15A 2Y77A 3AV3A 2C7QA 2DF8A 3QKSB 3OHSX 3T7AA 3SBOA 2G71A 4I7EA 4ZAXA 5K6RA 1T6ZA 1ZRHA 2WIDA 1FDWA 4YAGA 3TB4A 3VR0A 3DKIA 4YP0A 1URPA 2WWGA 1TQ2A 1ZJ5A 4MEAA 1TCCA 2OYRA 2QR2A 5BRJA 5TPZA 2XOEA 1JNXX 2B7BA 2ZRCA 4PRKA 2WMOB 2PZMA 4J75A 4TGLA 3SZUA 1ZHOA 1G1AA 1H2ZA 3HTXA 1QQ5A 1U3WA 1Q0PA 4RA9A 1XMOB 3BMOB 3HP7A 4TV9B 2E82A 2MSKA 3UY4A 5KTOA 3B1KA 2DUNA 3HEAA 1JLHA 1ZRNA 2YIMA 4KJXA 3FF1A 4PPNA 3WLHA 5I7VA 1T2NA 5IXYA 4Y9DA 2Y0EA 2ZRLA 3H75A 1HEYA 3DZ8A 2GKSA 3VMMA 3KYDB 4QLAA 4IUCS 1WXIA 2I2AA 1KDRA 4GG1A 3G1TA 1DO8A 4BEWA 1F8XA 4DJDC 3KOOA 5ADHA 3ETNA 5EKUA 1M2HA 2VLIA 4YAKA 4EI7A 2N0SA 5IDYA 1P0FA 1YJXA 3DZIA 4OYRA 1I3OA 3FAZA 1G38A 3SEZA 1HEIA 1PF7E 1TX4B 3G1UA 3EF0A 4S1NA 1G21A 1QJCA 3JU3A 4P8RA 2XKAA 2BEWB 2R7MA 4CMGA 4CF7A 1KJ8A 2BCJQ 2W6QA 1DL5A 1TI7A 3R8CA 2PUHA 2XCTB 1AT1A 4TZ0A 3TBKA 1ISIA 3MFYA 4TKUA 4MW0A 5B64A 2UUBB 2DVMA 3R3YA 3LGAA 1E64A 2GEDA 3A9VA 3OIGA 1NW7A 4HRYA 1WF6A 5LA6A 4WEQA 3I2IA 3ISTA 1M0WA 3K6SB 4P36A 1YR2A 2HJSA 3AXSA 1YZQA 2Q2NA 2X77A 4Z51A 1LRLA 3A37A 3LA6A 3SC3A 4JVLA 3RM3A 2R1UA 4LRWA 1Z0JA 1ZH4A 4JVSB 5B3JC 1O6GA 2BIFA 1Y80A 2W2QA 4WI1A 4EPXA 3N6XA 5D5QA 3V4VB 3HP4A 4XM2A 2Z57A 4JA0A 2JC3A 4MIOA 4CM8B 4KYTA 2BKXA 4Y9UA 3GPBA 1XRMA 4PRYA 3KJEA 1OT5A 2H7YA 4HDNA 1I6LA 4XAQA 4ZV4A 2AZTA 1UP4A 3I2JA 5L6MB 4AUKA 2XE6A 2J32A 1PT6A 3PX2A 5JZMA 3T9AA 5JMOA 2ZI7A 4R2MA 5BN5A 3I34X 5JMPA 2AG8A 2XNSA 4HMQA 4J2TA 5K0TA 3ZNPA 1PHRA 1JMYA 3A10A 1Q7CA 4LWPA 5H4HA 1WLSA 1LPPA 1PE0A 2I9PA 3CMCO 3DMDA 3IDAA 1SVUA 4WX2B 1COWD 3RVJA 5AJVB 1ZIXA 1YDWA 3NUQA 2XVZA 2C1ZA 1VSTA 5KI6A 1XPJA 1RXVA 3DMHA 1RFGE 4KNWA 5SZKB 2AN4A 4YT2A 2QG4A 2NUTA 5JS8A 1JHOA 2TS1A 3KVOA 3RHSA 2IYAA 3RS5A 4QIHA 2FI1A 4QRIA 5HK9A 4XVHA 3R24A 4Y9RA 1XRPA 3D9QX 3M5PA 3PNPA 4AB1A 4DCUA 5JC1A 4D0SA 3CB4A 3KK0A 2HXYA 2O6LA 3W3AA 5EGNA 3ZIAD 3MHPA 2GN2A 3C3CA 4LC9A 5LXTA 5KKAA 4XRGA 4TKVB 1JFFB 2X9VA 2YOFA 1I33A 5DHQA 4PG8A 2D0IA 3MWYW 3MTGA 4BX0A 3JQPA 1T3LA 4MQEB 3CW8X 3K5HA 3KE8A 1FU8A 3MB5A 2C9MA 1XWIA 3RUDA 4J6EA 2FPOA 1FYVA 4DN6A 3CZMA 3VR1A 3WHKA 1E62A 1GL3A 2DECA 3PHBE 2ZSFA 3RS4A 4AW9A 4CHGA 3B1FA 3A1FA 1Y5MA 4M87A 3V1LA 3MM4A 3W2HA 1S7GA 3JYQA 1IBRA 1JQDA 2PZLA 3QHPA 4O2AF 3Q41A 1D5CA 3IPLA 3UWOA 2IIPA 4GPBA 3VKUA 1ACLA 3HL0A 3PJDA 4MCJA 1USKA 5B6JA 4FHGA 3QITA 1BFDA 1J8QA 2CMFA 3K9LA 3NP9A 4FT4A 3UQYS 4HG2A 2DBVO 1ODSA 2CXUA 2FZ4A 2PZEA 1J22A 1FC0A 2ISSD 1FTQA 1BWPA 1QAOA 2GTIA 2Q6TA 2VYFA 2WBLC 1C50A 3G79A 4BTEA 1VPEA 2Z8YA 5DHUA 3HABA 4X8LA 4A2CA 3ZQ4A 4ZCRA 1NY5A 3LG2A 4AM8A 1KDYA 3K92A 2DBQA 4Y6LA 1L3CA 5JASA 2NW6A 1MQ8B 1GG9A 2WFMA 4YT8A 1S8FA 4US1R 1NFFA 2DFLA 3LQRA 4MWCA 3SZLA 4O63O 4W1SA 1AU9A 4IIGA 4R0NA 4DL9A 5FOTA 4WNYA 4FWTA 2WINI 1WE2A 2NTJA 5ALLA 4YWJA 2OA0A 1GSHA 5DLEA 4DDMA 1ZBQA 3B6ZA 3VISA 4OTZA 1WCV1 4M0CA 3RBVA 2I6SA 4PPYA 3L4EA 3V8QA 4GFDA 3I2FA 1FX1A 3F8SA 2ORYA 4TWRA 1RZ3A 4MVCA 4JUIA 3TQQA 4DREA 3VFDA 5LQMA 3NDIA 1TIPA 1NGSA 5KDLA 3WYCA 5KIAA 4TRMA 3A1EA 3F4KA 4ONEA 1GU1A 2CXPA 4L08A 2FQWA 3GYGA 1JVNA 2ZYWX 5DASA 3TDKA 1SU4A 1DT3A 2GNAA 2ILTA 3UK2A 4BKOA 4MIYA 4X60A 3JS5A 1BTOA 3UXMA 4IWYA 3LKDA 4P84A 4AD8A 1BE8A 1Q0UA 5IVPA 1Y5IA 1E2JA 1HTWA 1YDHA 2ZI5A 3F97A 4L5CA 3IPAA 2NSHA 4NBUA 3GGDA 5KYUB 1P29A 2D59A 2AT1A 2FW6A 2X8JA 1F51E 2QY9A 2YTZA 2ZI3A 2EYQA 3HBNA 4WRRA 5CYFA 5B7PA 4O4IA 2WE7A 3D5TA 3RGGA 2FEMA 4XB6B 1MBZA 3WLTA 1QE5A 5BO5A 3KPJA 4N8SA 2BC9A 3IVCA 3S7TA 4HWRA 3M81A 1T5SA 3H42B 3ONEA 1UBLS 1YBVA 4KH1A 4B9EA 3GMIA 4IVPA 5J23A 5TMPA 4S0XA 2HK8A 1EPUA 1KGDA 2L19A 3FPKA 3GXBA 5BR1A 4G4JA 3RH0A 1I3NA 1K8YB 3HS3A 1W1UA 4KDRA 2J6HA 5CT6A 3UFXA 4YCAA 4F86A 2O7VA 1VP3A 5TX7A 3OTIA 1AN9A 1MEOA 2SICE 5EWMA 4F3TA 3OQPA 4MV8A 4DQUA 2ZUEA 1FLVA 2NO4A 2RKBA 2C2WA 1RHQA 1YA8A 2J3JA 2REOA 1E4EA 3G0CA 4XWAA 3TB6A 2FR8C 1MAWA 2YFQA 3FCAA 3AKYA 4FC6A 5FWDA 5I7AA 1N7HA 3DVRX 3ZDFA 3H19A 5TQVA 2Z4SA 2QDXA 1OI4A 1J9EA 1EI9A 1CVLA 2OV2A 3DULA 1BSVA 2PS0A 2VHUA 3DE6X 3DXYA 1E4YA 4KFRA 4PF1A 5DJ5A 1C4WA 2ZM6B 3NASA 4Y2GA 2ZUUA 3NOXA 1QCCA 2B34A 3D54D 1SC6A 2QKYA 3NEJA 3R3HA 5DYWA 4F2GA 5JNSA 4RTNA 2ZM5A 4WZAB 4PNEA 4BY9E 1XMSA 2GBIA 1ISMA 3N6VA 2E4YA 4CV0A 4BJHB 3HU2A 1T5TA 3OKCA 5IP5A 4C4SA 2O8CA 1NBME 1O96B 4UNIA 1T1GA 2FMUA 2GNPA 4XLTA 2JGLA 3W78A 2NP6A 5TGZA 3FKSD 1L7QA 5AVYA 1V37A 2PHZA 2QJFA 2V4UA 3GROA 4C4YA 1R0YA 3H5OA 5KWJA 3RTCA 3FLEA 5FUVA 4NYJR 4ZFNA 1YVDA 2YC2C 1ECPA 3GJRA 1N8NA 1UBHS 1BRMA 1EFLA 1HFEL 4M1WA 3WWOA 2QI9C 3CZ4A 1FSFA 4ZI7A 4FGLA 4OMUA 3RU7A 2DFPA 2BR3A 1UAYA 3AUXA 2YWXA 3NVDA 3T3DA 4WBNA 1BMDA 1POXA 1KEVA 4O5OA 1J20A 3VUFA 3FTNA 1KZYC 1ZM2A 3ANXA 3PGKA 4HKTA 4IDOA 4LOHA 4Q3NA 1SIOA 3U13A 5ARBA 1WBDA 5DGXA 3H2BA 3RFXA 3DW3X 5HKKA 3EMDA 2XVAA 4L1KA 4KC0A 2PXXA 3EFOB 3GFBA 3L2OB 4G84A 4WDRA 1BW9B 1QP7A 1YAHA 2ZOSA 1KEPA 2YDXA 3PZBA 2O3TA 3CISA 1B0AA 1XF1A 3I9FA 2Q5EA 3AR5A 4G5SA 3N74A 4YJDA 5ALZA 1ULTA 5EUQB 1R2QA 1V6CA 5AI0A 2D0PB 5ILQA 3WYBA 3PXAA 2VP5A 2WJZB 3R40A 3ZE2B 2AMFA 3BWBA 3Q1LA 3HA5A 1AKUA 3DPSA 4HB4A 3K0FA 3LUGA 1UBKS 5TQ2A 3WGMA 3PL5A 1ITZA 1QDUA 3VKWA 2PG3A 3WLAA 1L7MA 3DZJA 3H13A 4GL4A 3T41A 5DP2A 4A36A 4F0JA 1X80A 1Y9JA 1C0KA 4TYQA 4EW3A 1UBFA 2QTGA 2Z8ZA 1LC3A 3MGKA 4TYWA 2NPIA 1FJXA 5C7YA 1HQDA 4AYXA 2JFGA 2TECE 4FKBA 4C4PA 3OY7A 1NVWQ 4E5MA 1CS0B 3LRTA 3QVMA 4I1YA 2PK3A 4EB0A 1JWBB 4NU6A 1Z56C 1NDUA 2O4UX 4NEGA 1J2YA 1OF1A 4P0PB 5CDTA 2P68A 4HGNA 4RD4A 2X86A 4TS4A 1HYEA 3GIWA 1ZCBA 1BE0A 4H1VA 1NLYA 1TZJA 3FY4A 3K4HA 4BNXA 3CTPA 4GP9A 4CI0B 4P4LA 1CUHA 1JDJA 3WFJA 5LM3A 4XH9B 1KMHB 1QTRA 1UDAA 2P6NA 5DN6A 3UT6A 2NO7A 3BICA 5BOSB 3GJSA 2J0SA 1DJLA 3UJ6A 4C2UA 1SBZA 1FP1D 4MLCA 1V6SA 1B15A 2GD1O 2JGMA 2O50A 4LGCA 4REQA 1JFRA 1KETA 5IUNC 2B98A 1PNTA 1W5TA 2P4UA 3ZV5A 2ZR7A 3DT6A 5JW6A 2O7RA 2D2FA 4CMHA 1NR1A 2DH6A 2R25B 4B3TB 1JHYA 1E3LA 3E7XA 3UV3A 13PKA 1P0MA 4WCVA 2YMQA 2Y76A 2ZIWB 1EJ0A 4IIDA 5I9IA 5JATA 2NU7B 4RHFA 5AVOA 4MICA 1DAPA 4DIUA 1DAIA 1T0PA 3AERB 3E2IA 3PYMA 1JDPA 1R74A 2JGEA 4XIJA 1M2KA 1SQGA 1T9ZA 2QTTA 2Q9AA 2YWEA 3NHSA 4NCJA 4ZAWA 3SFTA 1VA4A 5DDIP 4AZ0B 3WHPA 3EG5A 5BSGA 4UTNA 3HYSA 4Q6WA 3D1VA 4UJ3A 1AXGA 1GR1A 3VDNB 4Q21A 4DRXB 4EKDA 2ZB3A 5KWSA 1YBMA 4HMPA 1AKMA 1J1UA 1N2CE 2H5LA 3CR8A 2OAGA 4WNAA 2X6QA 1Q20A 4IIXA 3FW1A 3RC3A 3TRDA 1VHQA 2O8BA 2YC4C 3PICA 3KZMA 3PIDA 1U0EA 1NLZA 4LYGA 5CA0A 1X3SA 2QTVA 5HIIA 4DIOA 3V4PB 4F2HA 3KWMA 1KK1A 2PYZA 2QTZA 3PVCA 3FOBA 4V03A 4CF6A 4G1UC 4DM7A 4E2FA 1AA9A 4KVGA 4LWQA 4V0SA 1T3ZA 2BGUA 2ZYGA 4Q93A 3UATA 4CKXA 5E1OA 3O2QB 4TZKA 2JAOA 5E6RB 1Q91A 3UB2A 1IXRC 1ZCJA 1KMMA 8ABPA 2CV2A 3GBPA 3NBKA 3K70B 2EL9A 4NENB 1GNVA 1T1SA 1HDZA 4WVLA 4E94A 3H1BA 3M4ZA 3MGGA 4GRAA 2XCLA 1OE0A 2PM8A 1M3SA 1RWMA 1YUNA 2RGXA 3BTOA 2MSLA 3IKMB 3NHZA 2O8DB 2BKVA 4G23A 3NBMA 1T9BA 4LHZA 2LGJA 3ZCSA 5KQLA 2NVWA 4QGGA 2D8MA 4GKKB 3ENVA 5I4IA 1AK2A 1JVBA 4JL5A 1VFPA 3DKVA 4YAFA 3U9LA 3TQOA 2ZR9A 2EKZA 3EXG1 3NTLA 2A35A 5FBQB 2W6PA 4YP7A 4JBHA 4O0LA 2W2LD 2C5HA 1XAJA 5HIJA 4CRWB 1IMJA 1BROA 1KMQA 1UC8A 1JLRA 2AC7A 1FB5A 1N8SA 1S8NA 2NUPB 3CW2A 2I3ZA 4M99A 5CXQA 2HU5A 1Z73A 1ILEA 5AK4A 4U6QA 1MDBA 1AS2A 1ZMTA 2GLXA 1GPUA 1VE7A 2RK3A 3NWJA 3PRKE 5DLPA 4Q34A 4DJFC 1QSGA 5E2BA 1T25A 3ZDQA 3Q4GA 1JHAA 3KFLA 1JDNA 3P9KA 2HCRA 4B2PA 2IPMA 1M1YA 3I45A 3FNRA 1MRNA 4RGVA 3A05A 1O4WA 5DTMA 1V4NA 4OO3A 3UOWA 5JYEA 1BN7A 2RMKA 1N5DA 1YKGA 2Z5GA 2JAQA 5HKBA 3LC7O 1D2NA 3BXOA 4RDIA 3STYA 2IWHA 1NKTA 1J2JA 1DAKA 4WXPA 1XEAA 8LDHA 1XDUA 4RWEA 1Y34E 4FYIA 3C48A 2GN6A 2ZWPA 5FPPA 3GYBA 1PD0A 4EG3A 5BWBA 1M74A 2JIOA 2WM8A 3NFRA 3Q3IA 1UF9A 5C1DA 2ODNA 5ALQA 2MYTA 2INGX 3C3EA 2GDJA 3TSAA 3IT1A 4YJ3B 1J97A 3R2JA 4JHXA 4YASA 1JG3A 1SVNA 2FXVA 1W34A 4PIMA 2EV9A 5AKIA 4MDHA 2ZAOA 2VT3A 2OGWA 3NB0A 3O4RA 3QK7A 5DOVA 3VVMA 4KQEA 2ZIFA 1QZZA 4MQ4A 1VIAA 3R7FA 1X1RA 1SGWA 1XEWX 4LNAA 4FMBB 4QAQA 3COJA 4RNCA 4F4DA 4OJNA 1S1CA 3KYCA 2IDKA 3IXLA 1KSGA 2A2ZA 3W5VA 3UHAA 1W48A 4PQFA 5IANA 2PL3A 3QX8A 3B6KA 1FNDA 1QH8A 2TMGA 3OAAA 3I8XA 3PXCX 4V0LA 3TZBA 4ZDKA 5ALRA 4YV7A 3VZSA 1GKUB 4RIHA 2GARA 3TLAA 4NMXB 3OQHA 1T3TA 1KS9A 2DR3A 1Z2CA 4R8VA 3E9QA 1GPWB 1WZIA 4JD5A 3AH8A 4OF4A 4WOKA 4DNPA 1FOEB 1PG5A 1ECCA 4UDOA 2PU5A 2OCLA 5EUCA 2RI0A 4B3HA 1VBKA 4UAJA 1FFDA 1RRGA 4WKBA 4Z1OA 3C85A 5I7RA 3DMGA 1WVGA 2OO5C 1N4DA 2DQZA 5CVCA 4BAUA 2OE2A 5DNEA 5ALNA 1Q74A 1JSRA 3U39A 4AMVA 3KELA 4RVSA 5HKLA 2YS7A 4PZUA 4L51A 3IODA 3Q12A 5HWSA 3V9PA 1XRJA 1EUDA 2FSHA 3F67A 4OKSA 3QX3A 3RTDA 4FQ5A 1YS1X 4MVYA 1KP3A 1GRCA 1ORHA 3S55A 2V8BA 5BMVB 1ZDMA 5L4NA 2P8JA 3M6FA 1E89A 2JH8A 3KLMX 3FOWA 3MMXA 1Z6GA 5GJVC 4RKRA 2FDCA 1XDZA 1XVLA 2OAEA 5FUMA 2G25A 4RAQA 2X3UA 4AJIA 4RK5A 4B6PA 3B70A 1P60A 1YE3A 3NHLA 2P9FA 3E7WA 3L6BA 1ZRMA 1TK9A 2QLNA 2AK3A 4GGMX 4WZBE 5KZMB 2PA0A 1GGHA 4A16A 4YAEA 2IU3A 3GJ4A 1RHKA 5ITWA 2RHBA 4PAOA 1T8TA 1S4QA 2BR5A 3QWAA 1CZOA 1H0SA 1AK1A 1OAOC 2VHTA 4K9NA 1QZ3A 4M0EA 3DDHA 2WHPB 3VR5H 4BNJA 1J25A 1PCXA 4Q7EA 3ZZUA 4A82A 2Z6AA 4OOFA 3M6AA 2H1OA 3GMSA 2Q3BA 5IU6A 2ZDQA 3INNA 5DBOA 1A27A 1AN0A 1T6BY 1KNXA 2DT5A 2Q4DA 4HRVA 2JBHA 4R8KA 2HSGA 4I5EA 4KNVA 4IF4A 2Y8EA 1WMAA 4GMDA 4YRDA 3AEUA 4M7RA 1WKVA 4QEDA 2R1VA 3S68A 3HUUA 4BZQA 4AK9A 2WSSD 2LCFA 2V6FA 5CB4A 3ZCPA 3IAFA 5FEMA 4F9EA 4R9VA 4XASA 1XQ1A 1WW3A 3UCEA 3ETHA 1NVFA 4EY3A 1YFLA 1Y1RA 2XMQA 5FOXA 5F98A 4OHKA 5FQNA 4BFLA 3ACDA 4IX1A 2JJ2A 5LLSA 1KERA 4PAGA 4JEHA 4M1MA 1ZGGA 4CEJB 3JASA 1IXKA 1C2YA 3CE6A 2BHRA 1TKRA 4FX2A 4HI0E 4HAZA 4F04A 4L2IB 5CIWA 2IHYA 2RKOA 5HP4A 5LJIA 4QD3A 1A96A 2TSYB 2ZE5A 3EJ6A 3T95A 1CKEA 4B3BA 1NBIA 4L0CA 4M89A 2FW1A 4C5CA 2D5LA 3IJPA 4KREA 1BXRB 4O29A 4QBTA 4MKGA 2QI9F 3ASYA 3CLRC 3Q5GA 4FHEA 5CFZA 4BMPB 3CNHA 3CR7A 3PDIB 3QNUA 4G0ZA 4MCAA 4P08A 4XPIA 5GM2A 4DGSA 1L7VC 1CR6A 4QDJA 4I0WB 1YJBA 5J58A 4ZEWA 1T6NA 4JB0A 2J5BA 5DFAA 2RAPA 3W4KA 1NBAA 2CJYA 4I1SA 2A5DA 2GPYA 1GL7A 2DWPA 1QLJA 2EKLA 4DW8A 1AKRA 3BGDA 4EL5A 5A5VA 3ZGYA 1Z4JA 3PRYA 4N5NA 4PQYA 2GZ3A 1JZSA 3V8MA 4TWBA 2QTAA 1O54A 3CRNA 1C9YA 2O2CA 4BNIA 3UQZA 5J2UA 2GVZC 2QUHA 2GHQA 4GU5A 2GZDA 2JGNA 1DBVO 4MUMA 4ZV7A 3I01A 1JXAA 1FDUA 1NIPA 3GWGA 4BP1A 3V6MA 3WTCA 1YC5A 5CFLA 5FV4A 4C7MA 1RCTE 2ATEA 3LDGA 2WWVD 3OQMA 3WK6A 4DCJA 3C8DA 2PDAA 4LMRA 4UDYX 4DQDA 1SZDA 2I8AA 2G9NA 3EZ2A 4GQIA 4NDAA 5BW6B 1H4SA 4U5XA 1G7RA 1HQCA 2BMAA 3FFBA 4QECA 1ZJWA 5B3KA 3W90A 1YL6A 2ZPAA 4V0NA 1EQ2A 3WJ1A 2ZYTX 2FLWA 4TL6A 3EXFA 4FZRA 4M0UA 5DTQA 3JSXA 1GGEA 2A3RA 2YIVX 3KTAB 4CKCA 4L6IA 4JCOA 2E4WA 1T6YA 2XYHA 1H8HD 1D8TA 1RJGA 4MNTA 2XMGA 5E6UA 3NAGA 4C4ZA 2IS2A 4V39A 3U7HB 1VLVA 1J2TA 1JVSA 3RRBA 3A9TA 3B1YA 4HNAB 4EO4A 4CODB 1ZUNB 1ZJJA 3R3VA 2GBGA 1KO5A 4WK4B 5I01A 3PNQA 1S2NA 1BFKA 1XQ9A 3JZAA 4NABA 2FRDA 2WICA 1H2HA 1U2DC 1VRVA 1J33A 3A1NA 2XXBA 3D8TA 3GLVA 3L43A 4L72A 4RYLA 4WDQA 4RL6A 1IN8A 2D2IA 4R2HA 5EXXA 1Y1SA 2ZB7A 4XEUA 2A1UB 2R751 4G0OA 1MXHA 2HN9A 1GRNA 4O4HA 4P3XA 5DGCA 2IH4A 1ODKA 4MIKA 1MR3F 3GGOA 4S1VA 5F9FA 3TTWA 4PXYA 5IYZA 2XSZA 2RBKA 1P1HA 1A5ZA 3QKUA 1QG4A 4M9ZA 4DIMA 5J43A 2OQIA 3UFBA 3VTZA 4EMBA 1O57A 4IS3A 3RVNA 3N75A 1XZHA 3AJEA 2IQ5A 2BMEA 3M4NA 4FB5A 5ICMA 5ECWA 7GPBA 1A8PA 1M6VA 1ZUIA 2AXEA 4KBGA 4RFVA 3SAJA 3VPCA 3D6HA 1O6BA 2JJQA 5C51B 4CMCA 3ZVNA 5FFMA 2A0FA 2GERA 3I2HA 3BCRA 3G68A 2X2EA 4LPSA 4HQ0A 1HNXB 5M5BA 1FFWA 1KOJA 1M2OB 2XDQA 4DE5A 3I9V1 1EVKA 1R0SA 4BTLA 2CYCA 3DVLA 2EKDA 4N40A 3BH7A 1Z6QA 2YXNA 1C7ZA 4M98A 4CIXA 3NBFA 1UZUA 2QQ0A 4ZVKA 2CVPA 3CUWA 5BNZA 1NBEA 1THMA 3OQ6A 4C7BA 3BQ9A 3RAPR 3KQNA 3HP1A 4M7WA 4M8NE 4PO9A 5EMJA 2WLSA 4MQMA 1XV5A 2Y2VA 5KAMA 3I12A 5GIOE 1X2EA 3IJ5A 4GI2A 2RDMA 5FI1B 1IBLB 5JRDS 1T29A 2F9LA 1RI4A 4WTOA 5T6BA 3MGCA 3KPUA 3L0YA 4MW4A 4OXKA 4B84A 1ZFNA 4GT1A 1TW2A 1ZD4A 1H4VB 1MG5A 2O2XA 4LZNA 3OESA 3LGSA 1G291 1IG0A 4KQ1A 2JGRA 4IHJB 4WCFB 5CR9A 4DT1A 4Z0TA 4OMFG 2E2WA 4QXRA 5KJCA 4FWIB 3UCXA 5GMOA 2QVBA 4CUJA 2PRJA 2UZ0A 2VXBA 2VO1A 3C5WP 4JEMA 5AXBA 4AJ2A 3GRKA 4KK3A 3MCVA 3UK0A 4GVPA 3EVAA 1G8JA 4CQNA 5F5LA 1N2EA 2HHJA 2XXJA 4Q4DA 4TLCA 1R9NA 5GGXA 2C9BA 3VC2A 1KJYA 3LBAA 2EFYA 3NI2A 2D1RA 2PBZA 1D03A 1CF2O 2VJQA 3WB1A 4EAAA 4Q4AB 4CG2A 1LXCA 1OX4A 1TZCA 5ICGA 3FYSA 4BO5A 5CP8A 2OFOA 3TQTA 1N36B 4QBIA 4V0QA 4KQKA 3H9QA 2II6A 2ZUTA 2Q5CA 3I52A 4E6EA 1KBOA 2VHWA 3M1LA 1DEHA 3P19A 2L42A 2OV3A 3VNBA 4X20B 1DAOA 1PJZA 3DV9A 5A6VA 2C1XA 5AW0A 4YQZA 2IYNA 3AFNA 3FVQA 1MAHA 1KPGA 3U7QB 4EG0A 1TM2A 1EX6A 1GPH1 1O0BA 1PR2A 2OMKA 3NCHA 5LQJA 1ZMBA 1X9IA 2IYWA 4HFMA 5EVJA 3WKAA 3GQBB 2ISCA 3SYNA 2F1HA 4XYEA 1R3DA 4LQLA 1H1LA 3NKFA 4RKQA 2A5GA 2NVOA 1FRFS 1NI5A 5BQPA 5G0UA 1NPTO 3FCCA 3KEQA 1P5ZB 1OBCA 2CSUA 2HLNA 2WNHA 3A1CA 3O7WA 4LMBA 4P7BA 4R81A 4W99A 4COOA 3U5TA 3FHTA 1IY0A 2PXHA 3OT1B 1UJ5A 1ND6A 1YFZA 3R3ZA 4J76A 4YXFA 1AMNA 2HBQA 3DV0A 1KVSA 5T4BA 3TEFA 5AVTA 1YQQA 2ZRAA 4KXLA 4OHWA 4FEAA 1HDRA 3QOXA 3IXMA 1U11A 4GBJA 2ERXA 4DCTA 4US2R 2WOOA 2XCRB 3QU2A 3C5VA 4XX0B 3L46A 4CKWB 2IY8A 1DIGA 3U6KA 4WXHA 1P61B 3LH5A 1C8KA 1FUEA 1P2VA 4BQEA 4U7JA 3KJXA 1VL0A 1RXWA 1NF3A 1SBTA 1GPKA 1QG2A 2HLDA 1IH8A 2XUHA 4FSHA 5A71A 1PWEA 4BVJA 5KOYA 1KF0A 5BORA 6PFKA 2JAUA 5HQ3A 4RO0A 1G8YA 3GT3A 2AVNA 3QWHA 2FUG1 3FTCA 4JI1B 2I7XA 3H2ZA 1YQGA 3HCEA 1DBSA 2WT4A 3K0HA 4DJ5X 2O4CA 2FN8A 4B71A 4BGIA 1YJAA 4CQLA 3HCNA 2PGJA 4RACA 2BGIA 1M76A 4H6WA 3QX9A 3JALA 4I50A 2NV0A 5E4JA 5T3YA 3WO1A 16PKA 1GTJ1 1YR1A 2GSDA 2CHGA 2B83A 2RHRA 1VLQA 2WB4A 3N07A 4KO4S 2QN6A 1Q0HA 3C8UA 4LJKA 4NEQA 3RWBA 4D4IA 3U48A 2NMVA 4ARIA 1TLFA 3CRMA 1NXTA 5MGBA 1H22A 2P9JA 2YH2A 3V1UA 1M1YE 3FPFA 3TGPA 2AF4C 2HLPA 1PQWA 2PL9A 2H4ZA 1BQ3A 2QPOA 3DBVO 2X76A 4OG2A 3SQMA 3SZRA 1DBWA 3ZWNA 1RQNA 5EJ5A 1G20E 3IC5A 1YB6A 1UWVA 2ZUDA 4YI5A 4BKPA 2Y4NA 2AE1A 3GJTA 5U1PA 3WL8A 1H4QA 1BXZA 1P75A 1VKZA 2HGSA 5JQWA 1NIJA 3RTAA 1DDGA 4PPQA 5BXQC 5ITZB 1I0ZA 2AXPA 2RHHA 3P96A 4PPGA 1Q83A 3BG5A 4KN9S 2YYSA 4ZOEA 4POAA 2I2FA 1VJTA 5HF6A 1BXKA 4ZHSA 1BOOA 2FRXA 4RANA 1H05A 3X1ZA 4BNUA 4BP8A 1CY1A 1G8FA 1N7JA 3R9IA 3MXTA 1BOFA 2ZIXB 1SNYA 1YONA 2ROQA 2XGOA 3OJLA 3K5PA 4AKHA 1T0JB 1NBWB 4UM8B 5IZCC 3MMSA 2WIKA 4RZ2A 4L22A 2IXEA 2YYYA 3QPBA 3SJAA 3TLZA 3ZIUA 4KWCA 2QHXA 2J0VA 4QJIA 4X1YA 5KPDA 4IHKA 1AY0A 4J3JA 2B25A 5C4MA 5KX5A 2YXEA 4NQZA 3UVEA 2HAEA 5CIYA 1VYUA 5BV2P 4B80A 1F6BA 4N3BA 4X0EA 4HQKA 1KVUA 2VR1A 2RIPA 2W5UA 4R6XA 1ODLA 1NYRA 3L6CA 3SKXA 2XZLA 1IQRA 3MJDA 2FJPA 1Q50A 3F6CA 4YFYA 4NCBA 2ZBRA 3FVVA 3UA3A 3LXUX 5MGNA 4PANA 4IGKA 1X1BA 4GOND 5LWQA 3HEBA 5IX8A 2VQSA 3QA9A 4HVAA 2CNWA 2FMFA 1UFRA 1YKFA 4XYBA 1Z07A 1YTUA 2JIMA 3NPMA 1QVRA 2CHUA 4JLJA 3OOYA 5J2TB 1LPBB 2XYPA 5KTPA 3C6MA 3EG9B 4G1EB 2G77B 2HWWA 2NV2B 1JI0A 2RGRA 4HYYA 4WZ6A 2VHVA 2FGKA 4E5PA 3S6JA 1PL0A 4YJHA 1QG0A 2Q7XA 3DEJA 4PM4A 2VJPA 2CNBA 2YVLA 1E5QA 5JALA 1C0IA 1WB6A 2QRMA 1E1MA 1ZINA 1RXCA 1TJYA 3CLRD 4IIVA 4NWIA 4FNOA 4YONB 1F1BA 2NVUA 2FG5A 3GFRA 4YHHB 2NU9A 3VAYA 2QVCA 4CTOA 5B30A 3QWFA 2RHJA 3NCTA 1LUAA 3U4DA 1MGPA 3MB8A 5IDQA 3RYCB 3F78A 1CJBA 3P4YA 3AUTA 1O89A 3R5FA 2ZUCA 2QV7A 4KVAA 1B16A 1P1CA 3G2PA 3WC4A 4EPWA 2HX1A 1TT7A 1UDRA 2HRDA 1PWHA 3L4SO 1SBHA 4ZDJA 3PG5A 2YJTD 4O2LA 3DP7A 3K4QA 4NDZA 4QUJA 3WQRA 3NWBA 1N6NA 3GJ8A 1UMCA 3CEAA 3PP8A 2ZT5A 1PR1A 3M5CA 4UC0A 3OZIA 4EJSA 1V96A 2BEVA 2AKAB 4N5MA 2CE7A 3RQIA 3FG9A 2NUBA 3HUTA 1FNNA 4KTTE 3JQ6A 3MAGA 4C1BA 4ZQGA 1BX3A 3Q10A 3JQEA 4R1OA 2JPDA 1R4MB 4FXOA 4EF6A 1QR2A 2A33A 3A9SA 4ZOCA 4D44A 3I6QA 1JR3D 4G07A 5BV7A 4LKRA 1M83A 4KQXA 2HTEA 3DFFA 2Q9UA 3OFJA 4G5OA 5BR7A 5C3MA 1QIDA 2GZ2A 1WQ3A 4QEKA 3EXEB 4UNSA 5IDVA 3WGQA 2QTNA 4KQJA 5LOVB 1NY6A 2G4LA 2H9IA 4H3VA 3KDSE 1JIJA 1PTKA 2BM1A 3F3YA 1R5BA 1Z5ZA 4MAAA 1J42A 2G0AA 2YX1A 3ZDCA 1DLIA 4GR9A 5ESWA 1QHGA 2QD3A 3KKEA 4IMPA 4YECA 5EG5A 4HZGA 3AUKA 2KM1A 5FLEX 4BLRA 4EYSA 5FADA 5B7NA 3RQSA 5CLJA 4ERNA 4WK6A 5FLXA 2ORWA 2DCMA 2Q45A 1BG6A 4U7FA 4HDKA 1C80A 1CWUA 3IEIA 5IXSA 4N0QA 4N7RA 1P7VA 2AOXA 1DFIA 1MTOA 4BFWA 4DRZA 5JCJD 1VLJA 3THSA 3OEHD 4D56A 3VR2A 2CUNA 4FN4A 2QD4A 2AOUA 1G64A 1M0SA 1UXJA 2DFTA 2PCLA 4DYVA 5JADA 4HPJB 4HWOA 5K5EA 4G0PA 4RMNA 4J43A 1JGTA 5EESA 4IH9A 4MUEA 3FCUB 4LJ7A 4PZDA 2GK4A 4DDKA 4BIMA 1H3NA 1VJGA 3NEAA 2Z8XA 1BX1A 5DWDA 5AT1A 4EHKA 1IG3A 5J59A 3MFQA 2FJ0A 3F7NA 3ZU5A 3GEIA 4IXNA 1MZPA 3UWKA 4X44A 4BX2A 2FMXA 5L3QA 4BZZA 1Z4KA 4EARA 3A6EA 1C1YA 2I7DA 1P7YA 3KPVA 2Q5HA 1SU7A 2CUKA 1PT7A 3K0AA 2QBYB 1XZMA 1I9CA 1B8PA 3IP3A 1ZZEA 3U81A 3TJRA 2XGSA 4G5QA 1RWBA 3AI7A 4K2HA 5FTJA 1YZNA 1CX9B 3GLSA 3NC0C 4MH0R 5AVUA 1MC1A 1P5FA 3AUJB 2QG6A 3HJAA 3ULKA 4OCZA 3N0WA 1X7YA 3UIEA 2JH3A 3MWDA 4LWZA 4CKBB 3UH0A 1SXQA 5AHXA 3TK1A 1WPQA 4QVKA 3PUIA 5L7WA 2VDOB 4H7EA 2IX3A 4WLEA 3K1AB 1GL9B 1JEDA 1EBFA 1Q5PA 3IAS6 4LOAA 1T8UA 5B1DA 5JE8A 8OHMA 4UE2A 3ZLBA 2PL1A 1JLSA 3L04A 1TVCA 3G59A 2HBYA 3QI2A 2XCIA 4FR2A 1GUFA 3QLJA 4NFYA 4UNQA 4C5AA 4CDRA 1SCUA 2GKGA 3EQ7A 2K7ZA 1J49A 5JLAA 5KOJB 3AFOA 1AV6A 2CSXA 1EXVA 1TLLA 4DARA 4RVUA 5IT9A 5BWLA 1NMSA 3ZZMA 2OHFA 3G5AA 3HWRA 1CY2A 5A7GA 3VO1A 3FKJA 4H18A 2EJUA 4II3A 1OLXA 1RJWA 2IRWA 1Q3HA 4RY0A 1T6XA 2W22A 2VNAA 2H51A 2WFZA 3BB1A 3ZDXB 4FEGA 2VQ6A 3FRIA 5T8KA 5TMBA 3DHWC 3HI6A 1LSOA 5T41A 3LKZA 5KVQA 2BHTA 2H5IA 1M2NA 2CBZA 3EFBA 2FEOA 3GAAA 3VDXA 4J6FA 1JG7A 1BC5A 2YRFA 1U5CA 5IWAB 2GHTA 4RK7A 2ZYRA 3W3AH 2H5JA 2VAMA 3EGXB 1W36C 3EXAA 4HBZA 1YVRA 3GLRA 3GQVA 1W96A 2GCOA 4L28A 5FCDA 2Q2WA 3HA2A 4TYYA 1CRPA 1GV1A 1XD2A 5K7SA 1WZUA 1S02A 5AKKA 5T5QA 5HUHA 1II8B 5A4FS 5KSYA 5HIAA 2B1RA 4B5KA 1JZQA 2EXXA 3EGVA 4QDZA 2GDZA 3D8SA 5A04A 1J0DA 3AR4A 3HYLA 5MFZA 1BD4A 1UANA 2QZSA 5KSWB 5IARA 3E9YA 3JQBA 2NU6A 4BGDA 2BDUA 2HLHA 3H83A 1E1CA 1EWRA 4MV3A 3SC6A 1N25A 4X3CA 4MDFA 4C7KA 3KQVA 2QORA 4P7KA 2ID7A 2QRLA 1UMDB 1VL5A 3HH8A 3LF2A 5LMNB 4AS1A 4IH1A 1IZYA 1NYQA 4KMRA 2G08A 5AVQA 4GKJB 1N8KA 1T2EA 2H2AA 4JIMA 1DELA 5EFOA 4BQRA 4G1BA 2H06A 1CUIA 5A3QA 5E95A 1XSEA 2J9FA 5BW5A 3EZFA 1TEXA 3HGQA 4QQRA 1I7LA 2GRUA 3CLHA 3LUAA 1DWUA 1JA9A 1R6DA 3VJKA 4QNNA 2PQ2A 2X23A 1GN8A 3GA7A 4JU8A 3V42A 3EIFA 1REQB 5SYMA 2HBZA 3HQ4O 1KWKA 2DWOA 3HCRA 1EMDA 3N2LA 3WIDA 4MVJA 1P3DA 2EQ5A 2QL6A 1I9GA 1ICEA 3BF8A 1CQJA 1JDUA 1I6MA 1RKUA 2HSZA 3AP3A 3EZNA 3Q5EA 4JZKA 2CJPA 2EDCA 2FXIA 1SQSA 5D1NA 3LECA 4RPKA 3PR1A 4LZLA 4A6PA 1COWA 4R3WA 4G0QA 3U56A 1W4ZA 4PS1A 3RYHA 1T4CA 4KL8S 3CIFA 3K2BA 3RBAA 3V8PA 5ESXA 2J7KA 2TMYA 4DM3A 1PZXA 1E61A 2NADA 3P5SA 3VZQA 4G0YA 4JB8A 1VHDA 3TUZC 4E1BA 3EUAA 2ET6A 1O58A 5CDHA 5BSRA 4DA9A 3I5YA 5BQ5A 2SBTA 2G17A 3ZIAA 3FBGA 2IEDA 4EYOA 4DB4A 4LHVA 3E0QA 2C3PA 3H11B 2PUAA 1A4IA 5MFPA 3WL3A 4IFIA 2D1FA 5DMHA 3PU6A 2JVIA 2WA1A 1Y6JA 3IIMA 4Q1BA 3UJBA 4DQ0A 3HE3A 3P9CA 5EKDA 2NOAA 4DSNA 2IPXA 2ZDGA 4L4YA 3T0IA 4JXXA 1HL3A 1PFUA 3N8KA 4MKXA 3T4XA 4BO8A 4H3HB 4O2AA 1BMQA 1NASA 3OETA 4FGZA 1IY9A 1VG1A 2JANA 4M86A 3KB1A 1DQRA 4WN3A 3G3EA 1R66A 4UOQA 4QYWA 2P9QA 2AFHA 4LXXA 1ZL2A 5TXGA 2JHFA 4DR6B 2BGMA 2JVKA 3EUWA 2QRUA 2A92A 3DUFB 3UUGA 3W3ZB 1LBEA 4GI1A 2PNJA 2F43A 2FFAA 3K9QO 4E4TA 1CNEA 3W1VA 5HTKA 4DQVA 1K5GA 4FYVA 1ADCA 2VDWA 2OD9A 7ADHA 3DT9A 4NU8X 4TOIA 4UDXX 1IIBA 1L7NA 4B6RA 4EYKA 1FP4B 1ECFA 3EQ6A 1P1KA 2PIAA 4ETNA 1GM5A 2WFLA 4ARAA 1APBA 3BA6A 2R9VA 2VH5R 5K2MA 2W37A 1ZMOA 4IJWA 4KXWA 5IVKA 4BIIA 4W5QA 3KLOA 1ABEA 4IDEA 2X4GA 1FFGA 4IJMA 5DOZA 4EPVA 3DMTA 3H3XA 1QYCA 1KRHA 3VTKA 4O3MA 4MYTA 5DM2A 4K9MA 1FSPA 2A4KA 1EWYA 1OSNA 1JIKA 1CUSA 3LBHA 2VRBA 2DCUA 3OQIA 4FDLA 4MWTA