5CTAA

G158e/k44e/r57e/y49e bacillus subtilis lipase a with 10% [bmim][cl]
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
179
structure length
179
Chain Sequence
b'HNPVVMVHGIGGASFNFAGIKSYLVSQGWSRDKLYAVDFWDETGTNENNGPVLSEFVQKVLDETGAKKVDIVAHSMGGANTLYYIKNLDGGNKVANVVTLGGANRLTTGKALPGTDPNQKILYTSIYSSADMIVMNYLSRLDGARNVQIHGVGHIELLYSSQVNSLIKEGLNGGGQNTN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Esterase
publication title Crystallographic Investigation of Imidazolium Ionic Liquid Effects on Enzyme Structure.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 68
structure length 179
sequence length 179
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 2015-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01674 Lipase_2 Lipase (class 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5ctaA00
2XUQA 3QM1A 3G9UA 3HACA 4E14A 3OOSA 1P0PA 4DMHA 2VEOA 3I6MA 2OCKA 3GELA 4BTVA 4F0JA 1UKBA 4IO0A 1DINA 4G4GA 1LPAB 3DYIA 2GZSA 5IH7A 1XZHA 1I6WA 3W05A 4ZGBA 4OB6A 4H7EA 1FFAA 4NS4A 5DTJA 3H2GA 3I1IA 3WZMA 2WFLA 1FFDA 1JJIA 3C5WP 4BZZA 1ACLA 3WJ1A 4L3WA 5SYMA 1XZLA 3M3DA 1MJ5A 1YSCA 1EDBA 5LKAA 3QZUA 4FLEA 4UHBA 1HDEA 3E0XA 3D5EA 3WA6A 2XDWA 5ALXA 2WHRA 4X3CA 3BDVA 3VDXA 1YB7A 1UKAA 2Y2UA 4MYDA 2QS9A 4MEBA 2ECFA 4G5XA 1VKHA 3C87A 4HAIA 1JFRA 3KDAA 4OB8A 5EI5A 4BZWA 4BYMA 2PM8A 2VJBA 4ZXFA 2C4HA 2QUBA 2OLEA 1GKLA 1CUJA 4AO8A 2RGUA 2J3DA 1LZLA 1QIIA 5ALZA 4E15A 1WB6A 5LLSA 2DHEA 4Y2UA 3R3ZA 4ETWA 4B6GA 4HRXA 1OCEA 5HFAA 5ALSA 4CCYA 3DCNA 3DKKA 2FJ0A 5KWIA 4X00A 5ALMA 1GQRA 1QJ4A 2DFPA 4ITVA 1JMKC 1R9NA 5FPPA 1UK7A 1MN6A 1VXRA 4FFWA 3NUZA 2I78A 4UFNA 5ALRA 1XQXA 4OSEA 1Y37A 5ALHA 2H7CA 4H0CA 5AKHA 4UBMA 4F5ZA 1KU0A 4JEIA 2WHPA 2WQZA 3RKSA 3LLCA 4GW3A 1VE7A 3ESDA 5LP1A 4Y2RA 3BF8A 3BJRA 3HEAA 5EIAA 4AXBA 2QZPA 1CUBA 4ZV9A 4LYDA 5JAPA 5HKAA 1N5MA 2XUOA 2QJRA 1O6FA 3I1YA 4Y7DA 1DU4A 2J4FA 1EDDA 4X93A 2YYSA 3ZPXA 1B41A 4EY4A 3JW8A 2R8BA 1XRMA 2QR5A 2PPLA 4ZI5A 1XRPA 2NW6A 3D0KA 4KJXA 4HZGA 1R4ZA 5EHXA 2Z8XA 4H7FA 2YH2A 3WQHA 4KE7A 2G4LA 4BAGA 2OGSA 4H18A 4G4IA 1YCDA 3A2MA 4Y2QA 2CKMA 3WZLA 3AIOA 3PUIA 2WIDA 1ETHA 2QXUA 5LIPA 2GZRA 2GYUA 4DGQA 3C45A 4L72A 3PI6A 4X6UA 3EBLA 4RPCA 5JZBA 2XQKA 4EA6A 4BDTA 5AKGA 1ZD2P 4UHDA 1WOMA 4AZ3A 4BE9A 2ACKA 2YASA 2WG1A 4UUQA 3IIIA 3WWOA 1UXOA 1WB5A 1K63A 4B83A 1W52X 3T4UA 3L1IA 4G8CA 4BBZA 3SX4A 5JD4A 2W6CX 2C7BA 3LS2A 1CPYA 5AM3A 1ORVA 1YB6A 3K9BA 3N0TA 5A71A 3AIKA 4DNOA 1CUUA 2C0QA 1CUVA 4U2BA 4P08A 3BF7A 1C7JA 4DNPA 5ALKA 1E8MA 1N1MA 5K5EA 3A2LA 1E5TA 5AKKA 2O2GA 4CI9A 4LKOA 4DMFA 1ZIXA 3G0GA 1UT6A 5AI6A 5YASA 1LNSA 5CH8A 1H2YA 1BRTA 5ALOA 3O4IA 2CZQA 3TRDA 4D9JA 1QO9A 1CUIA 4U2FA 3ESCA 4U2DA 1QGED 5HF6A 1MNAA 5FOQA 4JYMA 3ZLTA 5JALA 3OM8A 3G0IA 3C70A 5D7BA 5CT5A 4W9RA 3IUQA 1CIJA 2RONA 2WG0A 3AILA 3R40A 4X95A 3I2KA 2JF0A 2VSQA 3D4LA 1XZBA 5K3FA 1XKLA 3P2MA 1LGYA 3QMMA 4Y2PA 3M83A 3GBSA 1CVLA 3W2TA 4PSDA 1F0NA 4M0MA 5BOVA 1BN6A 2OXEA 1DTEA 5DWDA 2XUHA 2QXTA 3MVEA 2ZSHA 2WUDA 4E46A 3UMJA 1P0QA 5AI5A 1IMJA 3FYUC 3CCBA 4U2GA 1ODSA 1CV2A 3UUFA 3R3XA 3HZOA 5I9IA 1LPBB 5CRIA 5ALDA 1XROA 4B85A 3ESAA 1GPNA 2JGJA 4A23A 5D6OA 2WIJA 2ZYHA 3WJ2A 2B9VA 5ESRA 4A5SA 2Y1KA 2WJ3A 1GPLA 2DHCA 3C6XA 5IVHA 4QDXA 5DLPA 3WKDA 4FFVA 1MX1A 5EIEA 2PX6A 2WFZA 4FBMA 2P8SA 2AJ8A 4QNNA 3PFCA 2OG1A 2VQ6A 5JZSA 4IH4A 3H2JA 1RYYA 1O6GA 5KREA 4C88A 3WK4A 1YAHA 4Q82A 2BUAA 2WFLB 2XMCA 3AFIA 2OAEA 4Y2VA 2EEPA 4LHEA 2Y6VA 2HA6A 4RNCA 1EA5A 4PNZA 1DWOA 1QIJA 4BDSA 4CFSA 2XMQA 4Y2YA 5ALGA 2OAGA 4M0EA 5DYYA 3WK8A 3CXUA 2BFNA 3WL7A 4UPDA 3PICA 4FLMA 5AK5A 2RI6A 1XLVA 4BP8A 4WCVA 1XLWA 2GBGA 5CTAA 3AZOA 2DQZA 1WPXA 3VKFA 3FCYA 4BRZA 1TCAA 4WY5A 2K2QB 4B9EA 3Q0TA 1KEZA 3FYUB 5K3AA 5LZ9A 2VF2A 3DYVA 4DLNA 1GKKA 1C7IA 4AMZA 1E8DA 3R3VA 4NZZA 4CCYB 1XFDA 5ALEA 4CG3A 3X3HA 3QMWA 3IUNA 4EUSA 4JNCA 1ZD4A 2XUKA 1EVEA 7YASA 3RLIA 4PW0A 3WK5A 4B0PA 1MU0A 4DNFA 2C58A 5AIAA 5JZ9A 4JH0A 3FSGA 1YS2X 3IB3A 4QDTA 1LBSA 4GLBA 4X6YA 1UOOA 4AB1A 1CUXA 3V1LA 4O08A 2G5PA 3HC7A 3C6BA 4RE5A 2O2IA 1MX5A 2WHPB 1G4HA 5JD6A 4Z49A 2QTBA 5AM5A 3BIWA 2FJPA 4WDQA 2C5GA 3NGMA 4X91A 3C6ZA 3O4GA 5JAOA 3LIPA 2PUHA 1UK9A 5AKEA 3I28A 5CT6A 4B84A 1VA5A 3WK9A 5CT4A 1ORWA 2XQIA 1MPXA 1DT3A 3B3QA 2H1IA 1J07A 4BCCA 4J0GA 1WHSA 1MO2A 1XLUA 1ODTC 3ANTA 4BCDA 3STWA 3D2AA 1XQWA 5IVDA 1SCQA 3K6KA 5JASA 4MQLA 2QVBA 2VT6A 4UHEA 5AI8A 5EFZA 1LLFA 5HF9A 3D59A 4KACA 3AZPA 3DKRA 3WKAA 3TJMA 2AJCA 2BUBA 4Q3OA 5EHQA 3QYJA 4FHZA 4IHAA 1L7AA 2EDCA 4ARBA 4FKBA 3H2KA 4PF1A 3AJAA 3WA7A 3W04A 4U2EA 1U2EA 2XUIA 4DM7A 4G9GA 1QIDA 2WU4A 3R41A 1QIMA 4LXIA 2HFKA 3WL5A 5EIHA 4HTAA 4GDMA 2ZYIA 4QE3A 3O9VA 2Z3ZA 1UK8A 1VLQA 1DQYA 2PL5A 3TEJA 3W06A 4H7KA 4GEGA 5DYWA 1R50A 4OCZA 3WKEA 3D2CA 1BCRA 3ICVA 4UBNA 4J0JA 1UOPA 2WILA 5A7FA 1Y7HA 2X8BA 2VJCA 4J3JA 4K2AA 4Y2TA 4YK7A 1R1DA 2HM7A 3KWFA 3AZQA 1QFMA 3QPAA 3C8DA 5AP9A 1LBTA 5I8PA 3H2HA 5CT9A 1UFOA 3WWEA 3QPDA 5ALTA 2WTNA 1E89A 3D7RA 4E11A 4MWTA 4XWGA 3KD2A 2G63A 2PSDA 4N8SA 1BROA 5HK9A 5A6VA 1XKTA 1QIFA 3JYHA 3K2IA 1NU8A 3R3UA 4QLOA 5D3KA 1CUEA 5HF5A 2DR0A 3STVA 1BEZA 3QBJA 5C8VA 2RHWA 3WWCA 4G8BA 5J3JA 1NX9A 1F8UA 4OB7A 5ALYA 1XZCA 3AIMA 5DNWA 5LYYA 4B7ZA 3U1TA 2GBIA 2ZVDA 2H7XA 1IUNA 3I2FA 5ALPA 1QFSA 2VTVA 4X71A 1XZAA 4BVKA 3SC2A 3PFBA 4J7AA 3GROA 3WKCA 4Q3LA 4UFPA 1XZMA 5C8ZA 3H19A 2CMFA 4P92A 1P0IA 1GT6A 3CN7A 5AOCA 5AOBA 2WIGA 5DJ5A 5HQ3A 2XQFA 1HL7A 3DEAA 4HVTA 1W1IA 5H3HA 3BE8A 3EF3A 2ZJFA 3FSGD 1ZI6A 1CUFA 1MAAA 1XZIA 3WI7A 5EHNA 1J06A 3MUNA 1IZ8A 3W9BA 3Q8WA 4XVCA 3DDUA 3FLAA 5HK8A 5FUMA 1ISPA 1MX9A 3FVRA 4DMCA 4N5HX 1CEXA 1THGA 5JARA 1FFEA 1EVQA 1CUCA 2IITA 2WUFA 1XQVA 5FRDA 4H7DA 3AUKA 1OXMA 2HDWA 3IULA 3NOXA 5E4TA 1DX4A 1CUAA 3WL6A 2VT7A 1OILA 3HRHA 1UWCA 5LZ4A 1H2XA 4UFOA 2JGLA 2QUAA 4WDRA 4IH1A 4KAAA 2XUDA 3T52A 5K3BA 1IUOA 5AKIA 3CN9A 3WYDA 1BCSA 4CG2A 4DTCA 2HIHA 4B0OA 4ZREA 5AI9A 2B4KA 2JGKA 4L9AA 1N8SA 4W63A 4LYEA 2HA4A 4Y2XA 3WMRA 3LCRA 4OYLA 4KE6A 4WFJA 1YS1X 4RGYA 3FNBA 1T2NA 3O4JA 3DLTA 1J1IA 4HRYA 2HA3A 5CBKA 5CH3A 4X6XA 2HU8A 5HF8A 4B81A 5LZ8A 1HLGA 5AM1A 1EINA 4M0FA 1DQZA 2HRQA 3STUA 1XZKA 1QZ3A 3ED1A 4KYVA 4AZ0A 2PSJA 4PO3X 4Y2JA 1TQHA 4XX1A 1CR6A 3GFFA 5DNVA 4CIAA 2IX9A 1ODCA 2BGRA 5JANA 2UZ0A 2CUTA 1VXOA 2C5FA 1IVYA 5K3EA 4J0HA 5AKZA 1DWQA 1XRQA 1TCBA 3U0VA 3TGLA 4QEKA 3OG9A 4KRYA 5FDFA 1YASA 2WHQA 1G5FA 1MAHA 4HXFB 4BC1A 4FTWA 5T4BA 4LIPD 3YASA 3F97A 3F96A 2XUFA 1WB4A 4KR0A 1PFQA 2OCGA 1VOTA 1ZGBA 2XMGA 3R3WA 3QPCA 2BUCA 2HFJA 5A7HA 5JATA 3H17A 1IZ7A 2HU5A 2VATA 4AO7A 4HXGA 2V96A 3QITA 1A8UA 4ROTA 2XI4A 4BTLA 5AM2A 3G02A 3D3NA 3BL8A 2J3QA 3GZJA 3RARA 2G5TA 3HI4A 4EY8A 1F6WA 2V98A 5T4EA 4BCBA 4F21A 4QLAA 4JUIA 1A8SA 3C43A 5JD5A 1E8NA 3WYNA 4MQMA 4Y2SA 3HXKA 4INZA 3IUJA 4IQ4A 4C89A 1XZFA 4BAUA 1LPOA 4Y9SA 1L7QA 4YX9A 4HXEB 2ACEA 2JGMA 4QDUA 5HCUA 4UBKA 1USWA 1TCCA 1W4LA 3EQ7A 3HABA 4WFIA 4QA9A 4EZIA 3VJLA 3IDAA 3OC0A 2BAGA 3QVMA 3ZV7A 2WSLA 4KE8A 2XMZA 3N2ZB 3VXKA 2Z5GA 4X97A 3STXA 3WK7A 1QO7A 4FLFA 5AIBA 4QWMA 4OD0A 1LZKA 1K6EA 2PSFA 1JJFA 4K6KA 2DQYA 3E3AA 4J0DA 4BRSA 4I4CA 5LZ2A 2LIPA 3WK6A 4C4YA 3G9ZA 3FLBA 1E66A 4TVKA 2EDAA 4AMYA 4BATA 1CUWA 4MEAA 1M33A 2GBFA 3B12A 2WIKA 3V48A 1HQDA 4XJVA 1EB9A 1QIHA 4TPKA 2ZJ6A 1X70A 2OCLA 4GBGA 4FOLA 5DYTA 5DNUA 4PSCA 5BWCA 2O7VA 3BJMA 2XLCA 5AICA 2BGNA 3SK0A 1K4YA 5AJHA 1TK3A 1AKNA 2PU7A 1QIGA 4ZWNA 2JGEA 3A6ZA 5CW2A 3I6YA 4QDZA 4K6GA 5AK4A 4LXGA 2AJLI 4OU4A 1VE6A 4DIUA 2I3DA 1S8OA 1ZD5A 3OPMA 2H9YA 2D5LA 3DL4A 3G0DA 3BXPA 5ALNA 3FOBA 1N5RA 5AHXA 4AQDA 4DSZA 2PSEA 1XZEA 2PSHA 1EK2A 4KAFA 3HSSA 1EI9A 2WKWA 1PJAA 4EY6A 1Q83A 1XRRA 2JIDA 2HA7A 1K8QA 5I7UA 4BC0A 2ONCA 4HS9A 2GBCA 3V9AA 4FDMA 2HADA 1UZAA 4UBOA 2XQGA 2OCIA 1QIKA 2Z8ZA 4OU5A 1JT2A 2QOEA 2PUJA 1BU8A 3I2IA 3ZWQA 1LPNA 2CJPA 1EHYA 4H35A 2OPHA 1VA4A 2AJDA 2XMSA 1HKHA 2BKLA 3ZLUA 3S8YA 2E3JA 1FFCA 3O4HA 4JYPA 4Q1VA 4G1FA 4MYSA 1MT3A 1EH5A 5EHZA 3UUEA 2Z3WA 1A8QA 2AXEA 4DSAA 4B82A 2XUJA 1K5PA 1AZWA 3W9UA 5AM0A 3PE6A 5BV7A 1A88A 2I03A 4AX4A 1AMNA 1JMYA 5AKXA 5A7GA 4AO6A 4P93A 2DSNA 1BN7A 2ZJ7A 3E1GA 4BVLA 3STYA 3VVLA 2ZSIA 5K3CA 1E3QA 1YR2A 3FAKA 1Y7IA 1D07A 1X2EA 4BAZA 5HKBA 1F0PA 5ISMA 2VJDA 1W75A 4BE4A 1JKMA 3H2IA 2XUAA 4Q34A 1Z68A 1CRLA 5ALIA 4KAJA 2I3ZA 1W76A 4N8EA 3H0CA 3V1NA 4QZVA 4DYHA 3VISA 2ORYA 4C6HA 2Y6UA 1QIEA 4CIBA 3DQZA 2BJHA 2V97A 3VVMA 1H22A 4Q05A 5FV4A 2CBGA 4F60A 3OTQA 1TKRA 4NVRA 1ZGCA 3G0CA 1HPLA 1SCKA 2W22A 4K6HA 1QE3A 2JGFA 4P9NA 4MJ3A 1VJ5A 4MXDA 3BDIA 3O9MA 3FYUA 5BWBA 1CQWA 3R0VA 3DL7A 3HYSA 4YPVA 4BB0A 5FKJA 2WFMA 3FBWA 2O2HA 2ZYSA 2XLBA 4BP9A 1BEEA 2FUKA 3LIIA 4J0CA 2RAUA 5AKLA 3ICWA 2JEZA 3G8YA 4X92A 1TIBA 2HRRA 3F8SA 1H2WA 2FX5A 1BS9A 1QONA 5JIBA 2ROQA 3G9TA 4UHFA 5K3FB 1VZ2A 3WIOA 1Q0ZA 4I19A 5ALQA 1B6GA 3F9CA 2GYWA 4QWWA 4IH9A 2OQVA 3E4DA 3MGAA 1EB8A 4W1PA 1IUPA 2XUGA 3B5EA 3DOHA 4RE6A 1QLWA 1NU6A 4X90A 1WCYA 4S0XA 1AURA 1GQSA 3KWJA 3H1BA 3F98A 4MWSA 3GA7A 2CEKA 5ALJA 3R3YA 4CG1A 2XE4A 3G9XA 4B80A 2WUEA 3S2ZA 5SYNA 3DS8A 2ZYRA 4H77A 5CMLA 5CURA 2WTMA 5KBYA 1AX9A 1CUYA 2PU5A 5C8XA 4OYYA 1R3DA 3GUUA 1CLEA 2RIPA 4H7HA 3WLAA 2OQIA 4J03A 2HA5A 3EQ8A 5AI4A 4GXNA 5AK6A 2X76A 2XT0A 1PV1A 4Q3KA 3FYTA 5K3DA 5C81A 1L7RA 5AK3A 4N8DA 3BWXA 4C4ZA 1JU4A 3DNMA 5E4YA 1MNQA 3RM3A 5AKJA 1LPSA 2YXPX 1ZJ4A 4EHBA 1DT5A 1WHTA 5AKYA 3O95A 3FVTA 4W1QA 4BVJA 3ESBA 1X2BA 4N5IX 4EBBA 1XRNA 1H23A 2WUGA 3PUHA 4UBLA 4UBJA 3C8HA 2PBLA 4WFKA 1TRHA 4J0KA 3QH4A 3O0DA 1AGYA 5CXXA 4X85A 1CUHA 1Q0RA 4J0IA 1ACJA 4ZV7A 3D2BA 3ZLVA 3V1MA 2JGIA 1WPRA 3G0BA 2WJ6A 2HA2A 2B20A 6YASA 4ARAA 4DMKA 5EGNA 2QT9A 4FNGA 2VA9A 3VJMA 4PQEA 5CT8A 1CUDA 1QTIA 3KXPA 5AH0A 1LPPA 2JEYA 2WG2A 2HA0A 2VJAA 4KRXA 4XIIA 5ALLA 2WIFA 3H1AA 1GZ7A 4UHHA 4OUKX 4EB0A 4X94A 2OGZA 5F4ZA 5ALFA 5A62A 1CUZA 4H7IA 1J2EA 3IURA 3C5VA 4GECA 1GGVA 5C7YA 1G42A 4WJLA 1DWPA 5IKXA 2C0PA 1G66A 3H18A 3STTA 5AM4A 2Q0XA 1AC5A 1CQZA 2B61A 1QTRA 3FWHA 5ALWA 1QOZA 5A2GA 3HJUA 1THTA 5LZ7A 5CXUA 5JYCA 1XZGA 1U8EA 1JI3A 4FMPA 5KWJA 1Q84A 2QM0A 3A70A 1GPKA 3RK4A 2H7YA 2WLSA 1VZ3A 5LKRA 3ILSA 4PV7A 4UBIA 4KEAA 3CCCA 2AJBA 3WWPA 2V9ZA 1GXSA 4K5QA 1UOQA 1DX6A 1ZOIA 3MUOA 1FFBA 4C87A 1WM1A 1H2ZA 4FWBA 1AUOA 4B9AA 2OGTA 4WY8A 3WKBA 5HFNA 2QJWA 2QRUA 3I2GA 4G9EA 4X7BA 3M81A 3OURA 1JU3A 1EDEA 1CUSA 5FLKA 2O7RA 1KU6A 3VJKA 1FJ2A 1TAHA 2GYVA 2XQJA 1RP1A 3C6YA 1ZI8A 2R11A 3FLEA 5FP0A 4OPMA 1ZI9A 3G7NA 3I6ZA 5AO9A 4H7JA 5JAUA 2JBWA 2DHDA 5AOAA 1XZJA 4GWLA 2Y2VA 4UHCA 3WIBA 4NMWA 3WL8A 5FXMA 3FCXA 1HBJA 3I2HA 2X5XA 4A16A 4YASA 1SC9A 5LZ5A 4C4XA 3SWWA 5ALVA 1R88A 4CCWA 2PVSA 2PKYX 1T4MA 1ZD3A 5ALUA 3ANSA 2QKYA 1FSSA 3PF8A 5AI0A 3BIXA 4GHWA 3M82A 1ZJ5A 2XMRA 5T4FA 4G4JA 1ZICA 1U4NA 1YA4A 2HU7A 1LPMA 3QMVA 3NWOA 3EIOA 2XMDA 5JAHA 3DD5A 2J4CA 2D0DA 4FBLA 2HL6A 1C4XA 2WJ4A 4PSUA 4I3FA 4W1RA 1BE0A 5HZGA 1XQYA 5IVIA 1YA8A 2VAVA 4TGLA 4FNMA 4DNQA 1CUGA 1RWQA 5D3ZA 3V1KA 1U65A 4EY7A 2ES4A 4LXHA 1P0MA 2CB9A 1XZDA 3IBTA 3I2JA 3HLKA 3JWEA 3DJYA 3LP5A 1UKCA 1EX9A 2XB6A 2HHAA 5JADA 1YAJA 3PDCA 2RHTA 3ZI7A 3L1HA 1UK6A 4AN1A 4KE9A 1JJBA 4G8DA 3IUMA 3WWDA 3F67A 4EY5A 3KOOA 2BCEA 2IIVA 1XRLA 1R9MA 2XUPA 3H04A 2XMBA 2QMQA 5CH5A 1SFRA 2DCMA 2VAXA 5FPQA 1SCIA 1EXWA 3AINA 5HQ3B 1AQLA 5DTIA 3EQ9A 1W6RA 2WM2A 5IVKA 1SOMA 5E2IA 4GI1A 1MTZA 4ZRDA 4AN0A 3KSRA 1CFJA 1EK1A 3IVMA 4U2CA 3DOIA 1ZIYA 4C01A 4QDOA 1A7UA 5E4JA 5T4HA 3PF9A 3A2NA 3IA2A 4V2IA 2WU3A 4L0CA 4W1SA 3L1JA
chains in the Genus database with same CATH superfamily
1RM0A 1J6UA 1F48A 1V35A 1PGJA 3O1JC 2EFEB 3EIXA 1G41A 3ODPA 4I1SA 1TGYA 1K7EB 1WKVA 1Z5ZA 3IOBA 2VK1A 1FNBA 3MWGA 4P7FA 3HACA 3E7XA 1Y9EA 2I22A 4E14A 5F77A 5C7IO 3P97A 3KDSE 2R66A 2W98A 3QBTA 1W5BA 4PZ0A 3RFCA 3HRKA 4HUQB 5TDHA 4DMHA 2VEOA 1MH9A 3MBIA 4BTVA 5KJ1A 3UPTA 4NHOA 2JG3A 3OE1A 1JG2A 1R4NA 1HG0A 2HWUA 2XVAA 1Q1EA 1EVZA 2C54A 4GPIB 4DG8A 3AY7A 4YR7A 5TLSA 1DINA 2JJQA 5HBGA 2E4YA 2R6HA 3K6SB 4G4GA 3RRZA 2ORIA 2YS7A 5E8RA 3V8MA 1ZN7A 2JLXA 1RRMA 3ORHA 3LOUA 13PKA 2A8YA 2QTRA 2AI2A 4W9NC 1OXUA 4OB6A 3LFTA 5JZVA 3CVJA 1FFAA 1GQ2A 4NS4A 1MG5A 4IMPA 4MWDA 1VE3A 1R74A 3F6SA 3R5JA 4FQ7A 1HTBA 2J9XB 3JTEA 3I3OA 4R05A 4V24A 5KHAA 3VR4D 3ZJVA 3IQGX 1P17A 3JAMA 2BJWA 3UUGA 2FZWA 3ROEA 2XWSA 3GWZA 4Q6BA 1RC8A 2NVOA 5BN5A 1R0LA 1WE2A 5JNWA 5B2FA 2D2IA 3T0FA 1QRUA 2CD9A 1CE8B 1TMYA 4PS1A 5K8VA 5LKAA 4A2QA 4FYPA 1DTWA 1Q44A 4DR7B 1J24A 2WJWA 3QZUA 2WV9A 4RLFA 2JC3A 3JS5A 4FC6A 1HDEA 4FLEA 2IYZA 2F3PA 2WU0A 3E3NA 3L43A 3L46A 3Q7IA 3WA6A 4EP1A 4D96A 4O4IB 5JRJA 2QM7A 2WHRA 4OKSA 2AXQA 1J8MF 2R1TA 3PRHA 4PPNA 5KTPA 2D0OB 3UMBA 2BBSA 3VPSA 4E09A 1XHLA 4I46A 4P31A 4P1ZA 3TIIA 2Y2UA 2CMDA 1W2HA 2C9DA 1YONA 3AUXA 1WTCA 2LIVA 2IZZA 3D4NA 3LYUA 3HJNA 1SXGA 1VYTA 2ECFA 2QR2A 1GN9A 2H51A 4XWKA 2L82A 3KJNA 2FRDC 2JJ1D 4I36A 2C1ZA 2P4EA 4HAIA 1VSQA 1C30A 1ODIA 3UK1A 4OB8A 1SHLA 2DX7A 4CQNA 5DWVA 1EFAA 1PFGA 2FETA 2DYKA 3SYNA 3IRVA 2IUSA 3MTGA 2PZBA 3W3ZB 4EA7A 1J1UA 2KB0A 1Z6XA 1OZGA 2C4HA 3REQA 1QP0A 2ZIFA 4TMYA 2QUBA 3NRCA 2CXXA 1GKLA 4DQ0A 3D3EA 3T5PA 2RGUA 2ZSUA 2GHRA 8ATCA 4GLOA 3DZ8A 1HT2E 3FWNA 1QIIA 1W85B 3HCRA 3OJCA 5DXAA 4E15A 1XNHA 2C4NA 3JWIA 3R3ZA 1YWGO 1PZNA 3H4TA 4TV9B 3HKBB 4HRXA 4FCTA 1ZHOA 2QZ4A 3EMVA 5F7ZA 3DKKA 2FJ0A 2XA1A 2R6FA 5DB4A 1ULHA 3SHOA 2QLBA 1VP9A 2AUTA 2WMDA 1R6XA 5ALMA 2SKCA 1N2EA 3MD0A 3HJHA 4LJKA 2WKPA 4C4OA 1X1AA 3DPUA 3UAGA 3I2YX 2VRCD 1JMKC 2R97A 2EARA 2PAFA 1RCFA 2XBUA 2YJ6A 3FNQA 5LU8A 1X87A 1UK7A 2JGRA 1G2PA 3S2IA 1MN6A 2DKOA 2ZU6A 3L9XA 1KO5A 4FYWA 4KUGA 4E88A 3VA7A 4RF5A 5BPFA 3L0CA 3Q15C 4Q7MB 2F8MA 1MF7A 2P2LA 2VKTA 3F3MA 1ZNXA 3OJWA 4INPA 2I4OA 3BRQA 1RI4A 3V8QA 4LMRA 1NMSA 5LQNA 3C7CB 2EFYA 2EU8A 5ALRA 4N49A 2INGX 1GNTA 2XODA 5H16A 4OSEA 3BBPA 1FQWA 4I0WB 3PX2A 5EJMA 1IK6A 4QUAA 3KVNA 1OASA 2WD7A 4H0CA 5SZHB 4CL3A 4LF9B 5AKHA 3OPYA 4F5ZA 1PQ4A 5DHTA 2FX2A 1C5KA 2WQZA 1T9ZA 1N8TA 1P6QA 3DLCA 3LLCA 1BZYA 1Y5NA 3DEHA 3ESDA 2MWMA 4MPPA 4GX2A 3IAFA 5DCYA 3O2JA 1JSLA 1L4LA 4RF3A 3A25A 3FHOA 3H1FA 3HEAA 4AXBA 1SUEA 3HY3A 5GZ6A 1AHPA 4RTKA 4RTSA 5JO9A 3RSCA 3F47A 4NE7A 2IH2A 2I7CA 3OZ7A 1TMGE 5HKAA 1A4UA 2VK2A 5KYUA 5TX7A 1QZXA 2XE6A 1KYTA 3I8SA 3OFKA 4YP9A 1PJLA 1DZ3A 1X7ZB 4LUCA 1XALA 2XUOA 5EPEA 2AEJA 4BEWA 2W6JA 1G1MA 3RRFA 1IAVA 3E7DA 3HKCA 4GWKA 4MS1B 1MIOB 1US8B 3QKTA 2F3RA 4HDNA 4QOGA 1DAGA 5EJFA 3L05A 4JJ4A 2Q62A 2HMSA 2QE7A 1E94E 5B7PA 1HR0B 1S4MA 4FZ3A 1UKZA 2R8BA 4ID3A 1L6RA 4UUBA 3T35A 2OBMA 4EYQA 1QZTA 1LBQA 4MNTA 4RDHA 2XA9A 1N2SA 4JUBA 4O0MA 1ISFA 1XRPA 1F3OA 2VPPA 2XCOA 2P4HX 1L4YA 5TQJA 4HNHA 1PKEA 2R44A 4DREA 1E2KA 4HZGA 5JVDF 1OGJA 4OX9Y 4BX8A 4IGEA 4BLRA 1HNNA 2EKDA 2YH2A 2QN1A 3LFHA 3LMKA 4H7FA 5G1NA 3WQHA 4KNYA 3HJBA 4FW8A 4PZPA 3E61A 4HG2A 4ZANA 5BO5A 4BMDA 4UNRA 3OUUA 1RQPA 4TWRA 4KSBA 2WJIA 4B7CA 4CLDA 4M21A 1IMOA 1JQDA 2XYHA 1N6NA 2Q29A 3A2MA 4I9GA 4Y2QA 1Z2AA 3HA7A 3ZVLA 1MX3A 1KY3A 2Q1WA 4GC5A 1A9RA 2ESRA 1G2QA 5JTUA 2IEBA 2ZXEA 1RIIA 2CDCA 3PUIA 1QE5A 2PX5A 2Q2WA 1RZUA 1K0FA 2GNOA 3EEBA 4GBED 5EIFA 1MVNA 1ARZA 2QXUA 3HCEA 2GZRA 4QJBA 3RB8A 5LIPA 5EOVA 3RRNA 1ZISA 2HREA 3OF2A 1FNDA 3UAVA 1QZZA 1O87A 3GC6A 3I9OA 2QQEA 3MG9A 4H1TA 4IJMA 4K9OA 3T38A 2O2SA 4PLTA 4YJ2A 1KOFA 2VSNA 4YVFA 5I3ZA 4OXIA 2AL7A 1GKIA 3C45A 1H6BA 2FZ4A 4L72A 2ZSJA 2PLAA 2ZI4A 3ANYB 3EMKA 2WPDD 5GGYA 2IT1A 3EBLA 4DPLA 1FFWA 2A88A 3DAYA 1H2FA 4WX2B 1E0KA 4BDTA 4DR2B 2YC4C 1RCTE 2PRZA 3K05A 4H27A 3V4FA 4IRXA 3X0DA 1ZOLA 1ZD2P 2PXHA 2QRLA 3E7WA 4AICA 4UHDA 1GUZA 4XJSA 4C04A 1ZBQA 2A5GA 1DPFA 4JXKA 4TXLA 3V3TA 4B4DA 2VP5A 2ACKA 5BN3A 1K8RA 4BNXA 2Q0QA 3AL2A 5HUQA 3MWLA 5F2OA 3TRHA 5EJAA 1N2JA 1QK5A 2N9UA 2O14A 3IUSA 4WK0B 1CIPA 2AVDA 1KZ6A 1WR8A 4UUQA 3GPBA 1PQWA 3OLQA 1NRJB 3FA2A 4E51A 3OSUA 1UXOA 3T7SA 3UAWA 1K63A 1GCGA 4B83A 4ND1A 3T1YB 1G5IA 3RC1A 1W52X 1WZUA 3TRKA 2Q1UA 2XTZA 3CJTA 4FIZA 2PKQO 2WYIA 3H5VA 3K4PA 1AUPA 3KFXA 2OWEA 3OLWA 2UVPB 4G8CA 4MR9A 5JXIA 3QUBA 4K6MA 1KMMA 4PYOA 1XXHE 5BW5A 1D0IA 3LS2A 5K0NA 2QK4A 3W78A 1Y48E 3V2UA 3NHUA 5AM3A 1IY8A 4MWGA 4XWAA 1CQJA 1R6DA 3K9BA 4P0TA 3N0TA 4CBVA 1IJBA 3AIKA 3ZE1B 2W4QA 4DCGA 1E61A 1CUUA 2C0QA 3HKDA 2BH2A 3SNKA 4L8LA 2DT5A 3FROA 1VIAA 3FH0A 4G1CA 1CFZA 5CVCA 4KGZA 4D3ZA 3HU2A 1U0EA 3V46A 2RMKA 4MKIA 5F7JA 4N7BA 1QLJA 1E6MA 1X77A 4ZEOA 2R8RA 1YDMA 3W5BA 2VIIA 3FRHA 2ZE8A 3A37A 4GS5A 4TMXA 5BW6B 2XEDA 4B34A 3M4YA 1UDWA 1I30A 3ILVA 4MUNA 1NSTA 1ISHA 3A2LA 4DBVO 1II8A 2QI9F 3QY9A 3GOHA 3KUKA 2UUAB 5UKDA 4RPLA 1KZYC 5JC8A 3LBNA 2BLLA 1D2GA 4LKOA 2OFWA 2YV3A 3T1QA 1YIOA 3O9ZA 2QIPA 2IDMA 4IZHA 1NQXA 4N5LA 3V6MA 3WDMA 3HBNA 2R8YA 2IPAB 3CMCO 2XE8A 4NH4A 3RUIA 4WZAB 4CR7A 4ZVNA 2KBFA 1UBNA 3KQUA 2IU6A 5ARBA 3LCUA 1R0SA 5DX8A 1H94A 1N0WA 1QQ7A 5FD8A 4BV3A 5AUOB 5YASA 1LNSA 5B1YA 1SG0A 4S1WA 5CH8A 4QDXA 5FA6A 3RHSA 3NBYC 3C3MA 3IE1A 1B26A 3O4IA 1NNUA 7REQB 1WZIA 3UJ7A 4ZDKA 2Z98A 3D7KA 4NLLA 2F1HA 3VDQA 4LFCB 4PTYA 1CUIA 1DAEA 4U2FA 1GLVA 4FGWA 2CJYA 1J2YA 4Y98A 4AJ9A 5ADVA 4C5CA 5IZ4A 4ZOCA 1SEPA 3CF2A 4C7JA 1B8PA 1QGED 1GGFA 2E1RA 4EFDA 1TZCA 5LDHA 3FB4A 3VZCA 1P9WA 1OX6A 1PWYE 2Q5QA 3CWZA 3JASA 4G84A 1RZ3A 4HMQA 2QX4A 5A5GA 1M5TA 3ZDYB 2DUMA 4EUNA 4Q02A 3RTCA 1JFFB 4O4HB 4KSYA 1P7YA 2BMFA 3IBGA 5CLQA 1E4EB 3OVMA 4KQIA 4BFZA 5JALA 3ONWA 4IMIB 1X1QA 1Y82A 3GN1A 4OAOA 3BCUA 3R76A 3C70A 3FUUA 3T5BA 3D0QA 5CT5A 3KSAC 2ZE5A 4JBLA 4W9RA 2GAIA 3QTLA 3MT8A 4GSKA 1I4WA 4XARA 2XF8A 1Y1PA 3LZCA 2PLRA 5F21A 3IHKA 3CUEF 2RH5A 1FU8A 4JQCA 3Q3EA 4PYIA 3ZCTA 4W5OA 2EQAA 4DANA 1WD7A 3ABRB 3A6LA 3NU1A 4B73A 3EDOA 1ZZEA 2BE7A 3OZTA 1XKXA 5LXTA 4X95A 2JF0A 1XWWA 2EZUA 1TUIA 2IYFA 4CMCA 1MDBA 1OLOA 4RTQA 3P2MA 4L95C 3JAWA 4G0WA 1M2WA 2RGBA 5IPFA 2PT6A 4JI0B 3D9QX 3N87A 2GEVA 4P7GA 3T3EA 4B3GA 1E60A 1GCUA 2IBMA 5IFLA 1XGKA 1T36A 3HLYA 4K7JA 2FEKA 2J7PD 3L01A 4TSKA 3TDNA 1ZR4A 3M83A 4BFTA 1Q0PA 3IV7A 1G6KA 2ACVA 3KV3O 4RXTA 3QUCA 4AJEA 2VG8A 1JALA 1XXHA 1W581 4O6VA 2GSDA 2KPOA 3ML1A 4IF6A 3QE2A 1Q11A 1YL7A 4D1YA 1Y6ZA 3Q8MA 4LOIA 2L0XA 5BOVA 2P65A 4DYVA 1KEKA 3EPLA 3CH5A 4HTFB 2DPHA 2J1LA 3WL3A 1GO2A 2BTQA 2C3UA 3ADPA 3K1YA 2Y99A 1QTQA 1M2JA 2ZW9A 4LJSA 2EJCA 8ADHA 1OYWA 4IJUA 2X3YA 3H5OA 2B2NA 1HYEA 1OJLA 4FE4A 2YZ2A 1ST2A 1IG3A 3HA5A 3ZXUB 4ZI7A 3SR4A 4NV3A 3GP5A 1UJCA 2P2YA 4HXGA 2XQVA 1EFRD 5M2QA 5AUQA 2H2DA 1YFZA 2EFJA 3UT0A 4Q4AA 4AYWA 2ATCA 2NXNA 2OPBA 5EC8A 2GDZA 4RORA 1MKYA 1LPBB 1XDDA 2NWQA 2NVUA 2PMKA 3L4EA 4H6VA 4N6OA 2NXCA 4AJ2A 1BMDA 3A1CA 3MWKA 3ECSA 1NIPA 1Q0SA 4Q15A 1BS2A 5CRIA 1K8ZB 5KPDA 1TF7A 5A3QA 3VSBA 3MK31 4C4TA 4PRZA 3GMDA 3LX6A 5BR8B 3OPNA 2R62A 4R83A 1EESA 3N7UA 1J8DA 1LJ8A 4F4IA 2J85A 5B1DA 1NBWB 3IT2A 4KLRA 4PYLA 2FEXA 3IDZA 4B4VA 1MRZA 1OXTA 5DLEA 3OPYI 4IWNA 4L4YA 1I5OA 4EHKA 3QE3A 4A5SA 1G5HA 3MUEA 3OQ1A 1NTOA 5EE3A 4MUKA 3TLAA 5K0GA 2PZKA 3EIUA 4XIJA 1NULA 4MPDA 1MC8A 2C42A 1TYAE 1QMPA 1UPBA 2WZQA 1NOJA 3MCAA 1MLDA 3LK7A 4FFVA 4IVPA 1GY8A 4P80A 5K2MA 3WKDA 1HO3A 1MX1A 2C3OA 5DXFA 5ICFA 4HDMB 3WYAA 5EIEA 4LRTB 1ZONA 1NJ8A 1JAZA 2YWEA 5JH7A 5KHOC 5CG1A 1BEUB 1TZKA 3C74A 4PC7A 4R1TA 2AJ8A 3TAHA 4O2AB 5JS7A 4N3BA 4F2PA 2ZUUA 5FUXA 1K8XB 3GQVA 3ZBPA 2QQ5A 3B9RA 1QCZA 3EHEA 3FHJA 4M4SA 4UEKA 1GSHA 1KY2A 2DKFA 3E7FA 3ZKWB 3I05A 4C88A 8LDHA 5KKNB 2HNBA 4JLAA 1T5BA 4EOGA 4BO6A 2Z6QA 2WFLB 3TMYA 1JHZA 1E2GA 4G41A 3AFIA 4TSFA 2BM0A 3MWEA 2PO5A 221PA 1D2AA 1VKNA 1OKKA 2EEPA 2ET6A 1UBFA 4IHJF 4KQGA 3GFQA 3GT0A 2PMDA 1QDEA 2A1UB 3PRYA 5FOUA 4LDNA 3FUCA 3DV0B 5CJPA 2FWIA 1XQ1A 3G5AA 5GPBA 1L4HA 2Z9DA 2EV9A 3ZXYA 1EA5A 1BW9B 1T6XA 2XWQA 3K5IA 4AKTA 2VYVA 2O19A 2NTYC 1UP4A 4WZBE 5FHRA 3ZTYA 3TW0A 3QTBA 5EWJA 5B58T 2BFNA 4FYIA 2Y92A 4IM7A 3WOVA 1Z26A 3MZ0A 3EOZA 2IF0A 3DZGA 4DUGA 3DOOA 4B4UA 5IN4A 4UUAA 4IDPA 2XZOA 2GUWA 1R27A 1FEZA 1F5NA 3SC4A 2GBGA 5CTAA 3BL6A 3S0JA 2VPWA 3RC9A 1SQSA 5KC9A 1KEEA 1SZDA 4NENB 3AM4A 1ONSA 3MFQA 5E3JA 5FWXA 3T4EA 4LZJA 2DQZA 3WGUA 3AIIA 4G0PA 1PT5A 2QVGA 3SHVA 3TXYA 2EXXA 2HSJA 2YBDA 3KZMA 2X0DA 3WLEA 2QPAA 2FDXA 3SXUA 1GJRA 1LFDB 3UGJA 2JLVA 1KY4A 2JJYA 3SIWA 4WY5A 2H4XA 3ZCXA 4YAGA 3THRA 2E9SA 3LZ6A 1ZWLA 4B9EA 4DLXA 2A9FA 4UM7A 3S40A 1U0BB 4AYXA 1DAIA 4OJKA 5KSZA 2I6GA 3B9QA 1ODFA 2CW5A 1YMUA 3NBZC 3H4IA 1II0A 1YD7A 1UFRA 3U13A 1GKKA 3DBOB 2O8EB 1OQAA 1C7IA 2FWNA 1E2MA 2J87A 3JQAD 1E8DA 1NMXA 1YRBA 4Q00A 5E6UA 4A0HA 4AP6A 5INTA 2FWMX 1T8PA 1S3SA 1YZNA 2IXDA 4Y1RB 3RJ5A 4C4SA 2FQQA 4EUSA 4JA2A 4TWJA 2JLAA 2JDIA 4AJLA 3QVOA 5SICE 1WJGA 2BGJA 2O7QA 2Y0PA 5HA5A 3SKYA 3KDPA 2VPYA 1G4AE 2GZHA 2A2ZA 2EZTA 1NJFA 2PKQP 2Z4TA 4ALMA 5DM60 4ACBA 2IOFA 4PW0A 3WK5A 4EGCB 1NDQA 1A04A 4XWOA 4GPD1 1GZSA 4ATNA 1YZUA 1GA6A 2C2GA 2WINI 3PD7A 1QO0A 3DMHA 2B8TA 4ER6A 3ELWA 5HOQA 2F17A 3WMXA 5EXEA 1WSDA 4BECA 3ZC3A 2J3LA 4NE2A 2YC2C 3DBIA 1CUXA 4GP9A 1OPRA 1G8MA 1RDFA 1TADA 1Y7LA 2DECA 3A8TA 3BGOS 1O03A 2X1LA 3HWSA 3P5BA 4MVJF 1DADA 1ZMOA 4EDHA 5K8CA 2G5PA 4TYPA 5CU7A 2V4ZA 3H9BA 4X8LA 3EVEA 4Q48A 1Z6GA 1IB0A 4RVHA 3ZV5A 1DZIA 1NR1A 2JD2A 4Q47A 1BDJA 2D1YA 4MI3A 3TTUA 3HY6A 1G4HA 4OH7A 3VUEA 1WDMA 4BGEA 5JD6A 2J08A 3W3AH 5DX0A 2A9JA 3I5YA 1WXQA 3PJRA 5IKMA 1SU8A 3VR6A 4HK4A 2VWPA 3VYTB 2I99A 4NK5A 4EF5A 3TLXA 1S2DA 1M1YE 2UZ4A 1M6VA 5E6RA 1KE1A 5MF6A 3HNPA 3SJAA 1EBFA 2PKXA 4HO1X 3SZRA 5CBPA 4F12A 3M5PA 3DAOA 2QI9C 1S9HA 3C6ZA 3EODA 4JDPA 2EX4A 3GPCA 4PYQA 1DPGA 4WNAA 2C2BA 5F52A 5KQSA 2UYCA 2DEUA 2C8LA 3KEFA 3I23A 5DCUA 3ORSA 4NCKA 3WDSA 4QXMA 3R0QA 4X8HA 1UEXC 1TYEB 3AV3A 3FWZA 4CODB 1VA5A 2A5DA 4QBKA 3H5NA 1LDGA 4YP5A 2BSQA 1NLFA 3P5SA 5CT4A 4XM2A 5F1KA 3UKJA 4D82A 2XQIA 5BWNA 1MPXA 1LFAA 2PL1A 2XNDA 1A5SB 2I8CA 2ADOA 3CPHA 2VTKA 3GLUA 4KWTA 2QLFA 5F76A 3GPLA 3ZWAA 4S1OA 4TN1A 4DRXA 1REQA 5I7WA 2PEZA 4G1VA 1L9KA 1XLUA 3EXIB 2QXYA 3RCBA 1O4VA 3LLMA 1YKSA 1JQLB 2FEPA 1QS0B 3GAFA 3TH5A 3JPWA 4LA4A 1L4NA 4RA6A 2Y1XA 5J9FA 1KEUA 4AJOA 1TYCA 3C3YA 2C7OA 4NQRA 3FW1A 2VJKA 4PY2A 2B8EA 1XQWA 4LDJA 1EE9A 1T0JB 5AUNB 2WJYA 3D6VA 1SCQA 4KPYA 2DLDA 3EPRA 4Z6KA 4MQLA 4R7ZA 3GRAA 1ZW6A 2VT6A 2YZNA 1TYDE 3UH0A 5ARDA 1E1CB 1YI1A 2YMMA 4KPFC 3GJTA 4TYMA 5IDYA 1C3VA 1AZSC 3Q6IA 3SC6A 1YL6A 2H17A 1F51E 2HPAA 2QZSA 4FS3A 3UMGA 5L3SB 1XDGA 5KEIA 1T6BY 1VCOA 5DTQA 4DDUA 3B9PA 3D59A 3PUVA 2FZLA 2LGJA 1GV0A 1L1QA 3AZPA 3DKRA 4L27A 1L7OA 3M4JA 3PITA 4IJWA 3OQMA 4G85A 5CVDA 1PZFA 4PS0A 3DO8A 2HXSA 1PUIA 2ZU0C 3HBLA 2Q1XA 2Q6IA 3TQTA 3K2QA 1X7GA 5I4BA 3TIVA 3HCBA 4K1XA 1JHXA 4KAXA 4KQ9A 5HCIA 4FHZA 5LB4A 1JG7A 3ETNA 3RVRA 3ST7A 2JH3A 2C1EA 1FUUA 2W48A 1L7AA 1U28A 3EOAI 3W5DA 4CEHA 4DYDA 4X7RA 1KK0A 4C6TB 3B8EA 1YC2A 2ODEA 4FKBA 5ANRB 1N7HA 3E9QA 3DDZX 1QB7A 3M9WA 5DRTA 2P2DA 1DRJA 1R64A 1V9CA 2BCJQ 3KTAB 1NZDA 1T6NA 2QD1A 4IEFB 4QUGA 4QUJA 4DLSA 4CTNA 1LWNA 3UICA 1C1DA 3DAFA 1BXRB 1QV9A 5PGMA 4TL9A 4ZHQF 5JR3A 4GBMA 3NBMA 1K98A 4MIKA 1VLMA 2PLWA 5ER9A 3RS4A 3F7NA 2FZCA 2BSAA 4II7A 3FDXA 2HNKA 3OEED 3GEMA 5A5FA 4HFRA 2HFKA 3PGA1 2DF8A 4QE3A 4S24A 2Z3ZA 8OHMA 1IVNA 2EJVA 2XYRA 4ETMA 2VNJA 4S12A 3B20A 2P62A 1ZJZA 1UK8A 2OV8A 2O59A 5DN6A 3VYSB 5K8IA 1C7QA 5JQGA 2G36A 2GRUA 3W06A 3PFNA 1M1YA 4H7KA 4X1YA 5DYWA 1PLJA 3I8XA 3V2IA 1R50A 1H2HA 1UEIA 3EG9B 4IXMA 4MRRA 1P31A 1L8LA 3VOBA 3MINA 3LLSA 4AF6A 1BCRA 1M34E 3KQQA 2CHVA 3CX4A 2FFJA 2ZSBA 3NNDA 3U7QA 1WU7A 1QYDA 4EAAA 3E2MA 4J0JA 3BA1A 1UOPA 3PNMA 5TR9A 4KYUA 5A7FA 2ACWA 2D1RA 3T1NA 4BEBA 2NO1A 1GGMA 3RVNA 1GL3A 2IVZA 4DIMA 2ATVA 1MEJA 5F23A 8MHTA 4U7HA 1MV5A 3LWDA 3LT5A 1R8JA 1BRMA 1N9ZA 5EZ6B 3C3BA 1IEVA 1WXEA 1E1LA 2NG1A 3RE1A 2NT3A 2GVNA 4YJ3F 2XD9A 2J9RA 2LCFA 2BN4A 2JJ2D 2ZUBA 3U17A 3CLUD 4E70A 1NASA 3KWFA 4W82A 4MX8A 2B30A 1D03A 1QFMA 3QPAA 4WBSA 1ESEA 3S4YA 3LUJA 1KPHA 1LBTA 4J90A 3KC2A 1JR2A 3X44A 5CT9A 3CINA 1FUIA 5ALTA 5CA0F 2N42A 1R9JA 3W79A 3W5VA 5TJ9A 1GNQA 1FU7A 3QMPA 1VIDA 2EWWA 4YO8A 5ESXA 5KSYA 2FOLA 1ONOA 2F67A 4NJEB 2FPRA 4ON9A 4ZVUA 4LYHA 1TZBA 4JI5B 1HKUA 5KIAA 2F3TA 2I5PO 1DKLA 1XI2A 1J0XO 5CR9A 1UJBA 2YIVX 1YJQA 4XGIA 5NULA 4P54A 3PE4A 5HK9A 5A6VA 2A7XA 2NTVA 3NYQA 4XLTA 3KPJA 3T7RA 1WV0A 3A6KA 1C7EA 1QIFA 4EBFA 3C1TA 1P7PA 3NVAA 4LE2A 4LZAA 3DTVA 2ZVPX 3R3UA 4EHFA 4QLOA 2NU9B 1CUEA 4N6NA 1QQBA 2EW8A 2DR0A 1HFKA 3STVA 4ER5A 4TTAA 5F2NA 3P0JA 2V7XA 2CC2A 1T34A 1O2DA 1XVUA 3EDMA 4YQYA 1Z4NA 4DC1A 3AGPA 3I83A 4XXHA 2JFVA 1GQFA 5H81A 1BHQ1 1QDLB 3SX0A 3T1OA 4DIEA 2R4TA 1HE4A 3GMSA 4G8BA 5G41A 1RLTA 3UQYS 1DJLA 2SHKA 3KZCA 3DKVA 4KR9A 4DDMA 3SBXA 3D4OA 1XZCA 1DIAA 3AIMA 4A0RA 2Y9PB 3FNIA 3ER9A 1QU2A 5ADHA 1QHEA 4U7JA 3HB7A 1YV9A 3GUCA 2C4KA 3TOZA 5ENZA 1F2UA 3F5SA 1FXUA 3AK4A 2M98A 3IXMA 1RXCA 1Q92A 2H7XA 4JT9A 3TQSA 4CV0A 3BFJA 3I2FA 1HNZB 4KXXA 1A96A 1FP2A 3QE4A 1QFSA 3Q4GA 4MJLA 4O4LF 2O8NA 4X71A 1UZUA 1KZ7B 4LCJA 2OXFA 3HB9A 3PFBA 2AMJA 3IEXA 4J7AA 2IHKA 4IINA 3WBBA 7ADHA 3COWA 1U8YA 5AFSA 3SDSA 1DO2A 3G13A 3BSSA 1I7PA 1MMFB 4O4JF 3X2SA 4MGHA 2M2IA 1P39A 5KOHA 3HCPA 1FUEA 5HG0A 3ODGA 4EKIA 3D6UA 3OX3A 2UAGA 2JI8A 3EGDB 2Z30A 4KX5A 2EWMA 2HT1A 1G2IA 3FMVA 2HGZA 3ZI0A 2AQKA 1NXXA 4A27A 4ILKA 3BIOA 4L78A 1O97D 5D3QA 5JJKA 2YWCA 3BJIC 4TV8F 2H9IA 4CLOA 1EJ6A 2WIGA 4MS3B 1NMZA 5HQ3A 1HL7A 3L6UA 4AY5A 1UH5A 3TZBA 3EF3A 3L7JA 4D0LB 5AVOA 4KDFA 5GM1A 3FZGA 4DLWA 2X5KO 3S55A 4YJGB 4NV1A 1U5BB 5J4KA 2JARA 5FO0A 2FHSA 2JGAA 3JQEA 3K1ZA 3ZHXA 1IQUA 4DDWA 1UC5B 2F43B 2FN9A 3MUNA 2HK6A 4XDYA 4C2TA 2ZTSA 4MVXA 3GGJA 4H3SA 5JWOA 4BYGA 1X1RA 2VOEA 4TKUA 3X1ZA 1XR3A 1VG9B 2QTVA 3INTA 3I4FA 2XNSA 2Z83A 1ESZA 1Y8QB 3DLPX 3ZK9A 4XA8A 3BK2A 4MQ4A 2E6KA 4TTVA 1VDZA 1R4AA 5HK8A 3EDCA 2ZS7A 3DEFA 4EVRA 2WJVA 4REMA 4DMCA 4JB3A 4QHTA 3C98A 4N5HX 3PTZA 4CXMA 1THGA 3QVSA 1E4YA 1FFEA 1J23A 4RFLA 5P21A 3GXBA 5JARA 4KGVA 3WDLA 3P4XA 1RP7A 4CL0A 1RE1A 1SJ9A 2NO9A 2WUFA 2ZBGA 1OROA 2J9ZB 1EQAA 3FXAA 4PZLA 4QFBA 5DHAA 1XQVA 4H7DA 2JCGA 4PFQA 3TS1A 2HDWA 3IULA 1TF2A 4YRLA 5LA6A 1U2DA 3WL6A 2VT7A 3IBFA 3HRHA 3EXEA 4F93B 1P77A 1PE0A 4OHVA 5KYGA 5LZ4A 3DDCA 2YWBA 3O3OB 3O8DA 4UFOA 4Y6SA 5ERYA 2QUAA 1SQFA 1NIJA 4MQEA 2HNAA 4KVAA 3SEQA 2E5FA 4AUNA 1H3EA 2FV8A 3S2YA 4MJ7A 3T52A 3U3DA 1F14A 2DWUA 3W7AA 3CE9A 1UDAA 4PZYA 1XNRB 2W90A 3EQ2A 1IUOA 2R9VA 1X14A 1GAEO 3ASYA 3OWHA 3D4BA 2C8JA 4L4RA 2DTXA 4WH0A 3FTFA 1RZRA 2E4ZA 3Q7EA 4YRKA 3AKCA 5BUCA 4B0OA 1JA0A 1MBZA 3LH5A 2VTBA 2Q41A 1YDEA 1E79A 2GASA 4JC0A 1ZN8A 2AEFA 2C2WA 3OOEA 4NFHA 4I4TB 1EHCA 4XOIA 4BLWA 2DMRA 3E5HA 4FEAA 3G82C 5IJ9A 4Y2XA 3P9KA 4G0ZA 2HU2A 3HDVA 2R84A 4HVCA 2WSBA 5E6SB 3NJ4A 4UAGA 2AMFA 1P1IA 2GFQA 3CNEA 3FNBA 1T2NA 1KPGA 3K1AA 2J3IA 1V7PC 1FPMA 3DLTA 2QNRA 3G2JA 3P2KA 4I5DA 4U8HA 4ZAVA 3GQBA 1DC4A 3MMSA 5KNLA 3B7GA 4NCHA 1J2RA 2JFHA 1JQBA 3NQ41 4O2BF 1XXLA 2IYOA 3P9CA 1M2OB 1DI0A 1O54A 2CB0A 2W2LA 3I9JA 1MB2A 2JFFA 1T8YA 4ARCA 4EPXA 2RGNC 3JRXA 3EBPA 4Q24A 2X4GA 5AM1A 5A3SA 4EEXA 1UBUS 1D6NA 1XJWA 2AZTA 2Y76A 1PK7A 1G9XA 1SVNA 1QYRA 2Q4EA 2J59A 2OHHA 4HDOB 5IW8A 4M0FA 2I2XB 1DQZA 1S01A 2FVYA 1SVOA 4GOKA 3WLOA 1QZ3A 3RT9A 4Q1AA 1EUCA 5TEWA 3NWPA 3LRPA 2CLSA 4TYWA 3DT9A 3TZQA 1NF8A 1WKCA 4RQTA 1YS4A 3EZ9A 3SS7X 1Y3CE 4LWPA 2WLTA 2HF7A 3PU6A 3MJSA 2BGRA 3EZXA 1W4BA 1I2BA 3LCJA 2DUWA 3HB1A 5DGHA 1GL9B 4KO3S 4ZYZA 5JANA 4Q1FA 2QYHA 1VKOA 2UZ0A 1UT5A 1O6ZA 1VXOA 5BYAA 3ORRA 5K7SA 2YOGA 2PGDA 3ABOB 1CQIB 4FKMA 1NW7A 1QF9A 1IVYA 4J0HA 4RIIA 2N47A 5IT0A 4PLYA 2CZCA 2F1IA 4NECA 4UJ3A 1JHOA 3U7EB 4YMGA 1SM4A 3HI6A 1B42A 3ER6A 3M6XA 3OQHA 1TD1A 3EPHA 2PA0A 6ADHA 4QEKA 3HR4A 5E1BA 4EPVA 4KRYA 3UM9A 1PUXA 5A02A 1L5HB 3Q8XB 2P69A 3LA6A 1T1RA 3OZIA 1Y3FE 3FBTA 4JMLA 1HTWA 3LPMA 4WCDA 2B5VA 5SY6A 2ZUTA 3LDUA 2HQRA 3STHA 3UJHA 1H66A 4Z7QB 5ITVA 4BNNA 1XRJA 3HJTA 3OX4A 1W25A 4J7XA 4TT8A 4LIPD 2GRJA 4WZZA 3D31A 5ECWA 3F97A 5DXJA 2VWHA 3FI0A 4NICA 1BDIA 2BF7A 1WB4A 4GX0A 4ZCIA 5FORA 4YQEA 1VSTA 4IIDA 2EZ8A 2EBWA 1SXPA 3DH0A 4RULA 3S99A 5B12A 3ORQA 1YBMA 2RKBA 3BGWA 2QDKA 4BV8A 3KLBA 4NL4H 3WIDA 2M6RA 1SA0B 1AQYA 1GILA 1SHKA 2UZIR 4V1CA 1NC1A 2IHVA 3AMVA 2R25B 3JQ7B 3QITA 1EM8A 4ROTA 3SLKA 1O94D 1P60A 4RD1A 4Z86A 3OSZA 1DXYA 1VJ1A 4P4LA 1W94A 2GLUA 5ELMA 5D6NA 1K97A 2B5OA 3RBVA 2GM9A 1B14A 4BTLA 4EVQA 3TG8A 3AF3A 4WCFB 3U4QA 2VS1A 1VI5A 3K0CC 4FGSA 3LXMA 3ZWWA 2B2CA 2Z6UA 2ASEA 2G1JA 1QRDA 1TM7E 3TCXB 5J5AA 3FCUB 2O3JA 1Z9BA 3LWBA 3OFNA 3UVEA 1B43A 4LX0A 4JB0A 1NNLA 4GWGA 2YYZA 3EFEA 2QLTA 4Q16A 5EMMA 4A8JB 5CLGA 1F6WA 4DNXA 2G7MC 4RK4A 4EJSC 2C3PA 4MS4A 3PIDA 4I50A 3DFUA 1MXFA 3U80A 3Q7QA 3QP9A 1RPJA 4IR7A 2ZLBA 4JUIA 4I8XA 4P3KA 2V9PA 4DQKA 1HC7A 1T91A 3SM3A 4TS3A 3RC7A 4O0LA 4NEGA 3Q1KA 4B3XA 2I65A 1E8NA 4MH0R 4OL0A 1CRQA 2JLSA 4MQMA 3DV2A 4K9QA 4BGVA 3GLGE 1LS6A 1OXXK 2OZKA 1WHSB 2OWDA 5HVNA 4INZA 3KUXA 4C89A 3HUTA 1U3CA 3NBKA 4ENWA 4DCJA 4NNPA 4MVJM 1PT6A 2G1UA 5DEOA 2ORWA 2W4MA 2Q6VA 3TQRA 4XUEA 3U0BA 5CAEA 1DKQA 1P73A 4NOJA 2O8CA 1BQEA 3ZGZA 1YB1A 2B8JA 1RHKA 2EIHA 5E1OA 1LPOA 5IAKA 4DILA 5IJZA 2W6NA 2OV2A 3QBDA 4EKNB 1L7QA 2XKAA 5REQA 2ACEA 1VMDA 1UKYA 1ND6A 1PO7A 2QF7A 1JNYA 4KYTA 3UMVA 2I4MA 3H7AA 2YW9A 1JZTA 4MK4A 1UMCB 3SYRA 1IVSA 1GPDG 2VXOA 4KXWA 2IYPA 4KQMA 4WFIA 1GUDA 4F72A 1R4NB 5LLTA 2P3QA 1TB4A 2VSXA 4EZIA 4ZC1A 1QHYA 3B2QA 1MO4A 2PRKA 3CNQS 4GD3Q 1FB5A 2WSLA 3ELUA 3UQZA 2R1VA 1KL7A 4EKGA 4ZVQA 4IFIA 2XMZA 2WVHA 4J3FA 4M46A 4WOKA 2B4YA 2EVWX 3VXKA 2PKWA 1LU9A 1ZM7A 2RH4A 3QKSA 1BVHA 1ECCA 3WK7A 1QO7A 2CXSA 1GPH1 4LJ9A 5B6IA 3GL9A 2BRUA 4F7WA 3HP7A 4HRVA 4M7RA 1NBMD 1NQUA 2WYUA 4J16C 4JT4A 4OD0A 4RLQA 1DUVG 2WRZA 3PWSA 5G02A 3TRIA 3VNBA 2X19A 4P83A 4HDCA 3U1VA 2QTZA 5CLHA 3VU9A 4ECAA 4J0DA 4BRSA 1NWHA 1NXPA 2G0TA 5BN5B 1QVRA 3IMCA 3QFHA 4IIYA 4RCYA 4W99A 5LZ2A 4ZPJA 3PV0A 3UF0A 1B8NA 3V5NA 1T3GA 1DTWB 3C6KA 1ENPA 1F8GA 3DMTC 4LQDA 2HMVA 3H2ZA 4MJXA 3RUAA 4C4YA 3LSTA 1UMDA 1E66A 2O4UX 4CIAA 5HKKA 4TVKA 2EDAA 2JIBA 5CVJA 3W6NA 4PAOA 4U8GA 4RGVA 1XZQA 1FP7A 2OENG 1CUWA 1RWNA 2FLWA 3ITDA 1BE8A 2ID4A 2R1TB 4FOTA 4NFYA 1K08A 4J29A 4LV8B 3CGGA 1O7JA 2GBFA 1IJEA 1FU4A 2NOAA 2RIRA 2C9OA 4ZO8A 4C3VA 4OP1A 1KRWA 2HZ7A 2W71A 4RXMA 4DARA 2Q2QA 4XJVA 1QIHA 3L49A 3A28A 1G4UR 3M3PA 5DYTA 4FOLA 4UM9B 1NVEA 2NZVG 1C30B 4UZEA 1NXQA 3DE7X 4DLBA 2O2CA 2XLCA 1I2AA 4HC4A 4TMVA 1SHTX 5SZJA 3UMCA 3ZX5A 4AJJA 4F1KA 4Z0HO 3SK0A 4XGRA 1RWPA 2ZDHA 5AJHA 5IC6A 3REQB 3Q7RA 3RVPA 3WXBA 2KBEA 3K9LA 4GR9A 3WLTA 3OO1A 5EL0A 2YCLA 4ED9A 3HVHA 1W2GA 3LCMA 2VDMB 4M1MA 1R4MA 4KHZA 2ZS9A 3HA2A 5CW2A 5I6DA 1XMVA 4YT5A 4FYMA 1SCUA 7MDHA 4QDZA 4L3OA 4V2UA 2JVJA 3K9NA 3O8QB 4M9UA 4OLFA 2YVQA 5LC1A 4HQRA 4JUAA 1VIVA 2B6NA 4G67A 5C5IA 1RMYA 1NN5A 2I3DA 2FPPA 5LYJA 1XPRA 1S8OA 2OUIA 1M8KA 4ZQGA 2X6RA 3M33A 4KXNA 1YT5A 2QD2A 1QHGA 2ZIVB 1PR3A 1QHHA 2P1RA 1PYGA 4BFYA 3W5SA 2WWGA 1MVLA 1IXSB 5KDDA 4ZC8A 3VV2A 2D54A 3MM4A 3AVXA 3WRXC 1ADGA 3BXPA 2ZYTX 4JYZA 4WERA 1WZ2A 3WLFA 3EEIA 1HI9A 5AHXA 3TZLA 1G8YA 1L5MA 3HWWA 2PD3A 4RCZA 4AQDA 3SX2A 2I67A 5KDLA 2O3RA 1U3FA 4DSZA 3PXDA 1EK2A 1WCV1 1RYNA 2HWKA 3A05A 4MEJA 1QVAA 4QASA 3ZY4A 1XNJA 1UFKA 5BUQA 1S4QA 2YL2A 1OD6A 1YDWA 5GVRA 1I7QB 1GA1A 2ECOA 2NYAA 1PJAA 3PI7A 4KDCA 3VTKA 3WDKA 1NR5A 1T8TA 1A76A 1Z6QA 2B98A 2JIDA 3OPYB 1FBNA 4MGIR 4LRXA 3SPXA 1G8SA 1ATZA 3I0ZA 3I9MA 2Z08A 2HA7A 4PTZA 1K8QA 2VYCA 5I7UA 3A26A 1JKJA 2W2KA 3B36A 2CVPA 2ONCA 4HZIA 4UUPA 1GLGA 4BC0A 5AYVA 4HS9A 3V9AA 3DYBA 5KYVA 4FDMA 2HADA 2AEEA 4IWYA 4BMVA 3HUDA 2LDBA 2W8BA 4IO1A 4IXDA 4JCCA 3KEMA 16PKA 4L4SA 4RIEA 4UBOA 4WKNA 4KHPB 3IEIA 1H8HA 4JIGA 4WEQA 5H4GA 5KYUB 5JI3E 1JQ3A 1SG9A 1O58A 1O1YA 1KGDA 2CL6X 1IXZA 1XMXA 3BCHA 1JT2A 2I7DA 4JLJA 4Z4CA 5C8YF 3DMFA 5I7VA 4R0VA 1J09A 1KO7A 2VJMB 2BP7B 5ITZA 1T0BA 4G5SA 1XMIA 3AR2A 4U00A 4AWXA 4HDNB 3PXAA 2JA1A 4HLUA 2JVKA 3L92A 3AC0A 3F71A 5DM1A 3GP8A 4ND8A 3GH1A 3G49A 2RBGA 2O5EA 1FNNA 3F7TA 5CFLA 4DG9A 3CLTD 3V7UA 4F06A 2XB2A 1U9IC 2UVQA 1FVOA 2XMSA 3QVUA 2BKLA 3OQJA 1B15A 4G5GA 3HMKA 5C35A 3L5KA 2QORA 1JFLA 4JYPA 2BFWA 4AK9A 4YCDA 4D46A 4PLVA 2VKQA 3K09C 4M36A 5GINE 2AFIE 3ROMA 1NSFA 4OXKA 4PHTA 1R0XA 1RRVA 4G1FA 1JU9A 4KSCA 1RBYA 1V7CA 2VJYA 1OU4A 1XMSA 3MTBA 2OCXA 2FVXA 3PUZA 4M87A 5DRYA 5CB6A 3EEQA 3QEBZ 4JHLA 3VHQA 3QPVA 5C1BA 3RUFA 2ZXFA 1ZM3A 2P3SA 1Z7WA 3FIUA 2IXBA 3QUAA 4UXIA 4AKSA 4BMYA 1ZD9A 2HF8A 1HEYA 1NF2A 1XT6A 1P75A 1VYUA 3H05A 2ZDGA 3KELA 3OJXA 4DSAA 1G3IA 3GLHA 5ES4B 4GSYA 4XDHA 5H83A 3AESB 5HZKA 2CUNA 5EEGA 1UAAA 1XYVA 3RC3A 1JR6A 4O2RA 1AZWA 4MMXB 2VYND 2PYIA 2QUHA 5IMBA 4OXYA 3TL3A 3GLKA 3PENA 3GAMA 1V1RA 1KZ9A 1A88A 3PT9A 4K6CA 1AMNA 4YJ2B 4R1PA 2LP4Y 4HF7A 5DTMA 3HYNA 3R24A 4JSRA 1MHTA 1JMYA 2HCRA 1KZGB 4CM9A 3CZMA 2WB4A 5JY1A 2AOWA 1KIFA 4FT2A 2ZJ7A 3ZVRA 4D7AA 4BVLA 2OXIA 1TT5A 2OCAA 1ESCA 2UYQA 4KIGA 3STYA 3VVLA 1EJBA 4FUTA 4Q3AA 1YB5A 1WG8A 4W5RA 4P3NA 3S6JA 3OCWA 3P7MA 1QXSA 1YR2A 4CCSA 4E07A 2WOJA 3FAKA 4AFNA 2WB2A 1N6LA 1SUIA 3IIEA 1H4SA 4LN1A 2FSPA 4HEJA 5E3HA 4K86A 3VKHA 5BN3B 2HHHB 3PRJA 3NRBA 1X2EA 3L4JA 1NW5A 1ZK3A 4HWOA 2ZR0A 5CD9A 4R1MA 1NI5A 4G56A 3FDIA 1GUFA 4X45A 1GL6A 3LQYA 2YFHA 4IP0A 4UULA 3ZDQA 3SQWA 1MW9X 1Y63A 1JAYA 2PKCA 1JKMA 2QMYA 3A3PA 4PNEA 4JZKA 3HK2A 3K30A 1Z56C 4CTKA 4JLMA 4MR9B 3MS7A 1DBVO 4Q34A 1Z68A 1M1XB 4CQLA 2H16A 3KAKA 3EX7C 2P3LA 2JGDA 4DA6A 4BFSA 1RAGA 3L5OA 4Y6QA 1OYYA 4JC4A 1CQJB 4RHEA 1BVUA 1R0CA 2P77A 3QX7A 4KAJA 1I9CA 2I3ZA 2NU8A 3HKDB 4N8EA 1USVA 1WXFA 1FMJA 3DC2A 4D0GA 2CXTA 2FSHA 1JIVA 1NA5A 4UDNA 4EK9A 4DKXA 3IAUA 1U0HC 3WLMA 2WSMA 4NEQA 1VG0B 1D6MA 1XAJA 2XSZD 3WTCA 1SBIA 3RVOA 1PJ8A 2EATA 4MQBA 4L5YA 3T3GA 1PLLA 2EAUA 3IE0A 3RIGA 9LDBA 4N5NA 4TT3D 2GN2A 2VHCA 1X7YA 4HZUA 5FUWA 3DQZA 4RD4A 4DWWA 1IN8A 4LF4B 4ALLA 3LUFA 5BNWA 1U2PA 3FPSA 3Q9NA 3LNTA 3UJ6A 5CLJA 3R6LA 4LF6B 4UD2A 1KMCA 3KHSA 4HNGA 2EP7A 5IZCC 1QDUA 2FPMA 3QU5A 2GAJA 2V5UA 2LZ0A 2BFDA 1SXJA 4Z99A 1PW5A 1RYHA 3LDAA 4UARA 1ZGCA 4L4UA 4JU9A 1QNLA 1ECJA 2BM8A 3AF0A 1JP7A 4D92A 3TSAA 1RMQA 1K4MA 2Y1FA 4K6HA 4Q4JA 1DIRA 1QGZA 3FYUA 4Y6GB 3DTNA 2R60A 5ULLA 3SBOA 2XXAA 1L7XA 2ZBUA 5JFOA 1VMIA 3CLUC 3DEZA 3DOUA 4X1OA 5FOVA 3NX4A 3C85A 1G98A 4E4RA 1W47A 1JA1A 1SK9A 1Y1TA 3T8YA 2GPNA 3HFSA 2HF2A 1PKXA 3IAEA 3QV2A 2QVCA 4NOMA 4TWZA 1OH8A 1FMTA 4EHDA 2WFMA 2O2HA 2ZYSA 5I3CA 3JASB 4WE3A 3RASA 4FXOA 4EO4A 3WFJA 5KOYA 1NV9A 1RT9A 1KO8A 1L8XA 2AX4A 4EW3A 4PG4A 3HXMA 3KEQA 3NTQA 1MG0A 3HH8A 1R10A 1V39A 1E3DA 1P1FA 2NZ8A 2HYDA 4DN6A 4BNDA 1G2OA 4PZAA 2VYFA 5AKLA 2R6CA 2V1XA 4ZYUA 5I7RA 1BMQA 2Q5CA 1M75A 2OKGA 3A6FA 3MMPA 3ZOZA 1H42A 5B3KA 5F1YA 4YT8A 5EE9A 4E5VA 1C1XB 2HIMA 3AKZA 4DCPA 1TIBA 4Z4FA 3TVTA 5F64A 4YMWA 1MP0A 2HRRA 2OV3A 3W8NA 4NDZA 3F8SA 1U8CB 3I09A 1TKCA 2I34A 1DTSA 2JAHA 4NG5A 3WMEA 3X1KA 1M7GA 1BS9A 4WKPA 2VF7A 4F4HA 5JHGB 5LXTB 2Y93A 4BRUA 2IODA 3P2EA 3R7NA 4BFCA 3TTSA 5JIBA 1VZ2A 5EZYF 5ITWA 3JAWB 5CK4A 2DR3A 4YPOA 1YJAA 1MUUA 1RR6A 4TRRA 4E31A 3EVFA 2J09A 1B6GA 1BYIA 3R7FA 2GYWA 1T36B 3COZA 1O6CA 4IH9A 4QWWA 5G40A 4E21A 1BXGB 1MB4A 1T2UA 2CVOA 3D8RA 4H0NA 4MYCA 4PLFA 4URYR 4WOPA 4Z8YA 2OQVA 2HK9A 4BPRA 3GGPA 4BFWA 3BT7A 1MW8X 3ORFA 1QFZA 1V3VA 1YVRA 3O3NB 4EZBA 1NR7A 2HRZA 2O0KA 1PHPA 2XGMA 4POOA 3U3ZA 1CEEA 2H2IA 3RAGA 5KYWB 1PL7A 3QFSA 3B5EA 2BTQB 2XV1A 3N6RA 4ASUA 3WNBA 3C5EA 1NW6A 4X90A 4R0MA 4DLYA 1J9GA 1M2NA 1R0KA 1VHJA 1AURA 1P9NA 1PWXA 2QP4A 3PQ8A 3TECE 4HWPA 4ZI7B 2JFQA 4DQLA 3PFGA 1G3QA 4BQQA 4ZCRA 4YMLA 2F90A 1ZN2A 2HBYA 1R12A 3BXZA 4P34A 4CMEA 3O21A 3W6OA 3ZHQA 4O33A 2FW9A 3R3YA 1IN1A 1GPUA 1NMQA 2ZI6A 3HXQA 1ML4A 4Q4AB 3NHSA 2EJBA 4E1VA 1TIPA 1AGNA 2BMVA 3B1JA 2QUJA 3HO8A 3IQIX 5E9AA 3J81k 4FYHA 1YFLA 1EFHA 2D7CA 1U4SA 3DS8A 3PNVA 4GXTA 1R0BA 2O6LA 3MMNA 5HJEA 6CHYA 2WTMA 1M2GA 4BQRA 3PEFA 1O97C 2X7HA 3QF4A 3P0IA 4I1PA 2QDXA 1BO6A 1U0SY 2CJXA 2NQ2C 2XD4A 2JKVA 4NFLA 5EQTA 4UQLA 2DB3A 1X7HA 2GEBA 5C8XA 1K3UB 4OYYA 5AVRA 3GUUA 2XWBF 4EJ0A 3S2SA 4PXAA 4B09A 5KWEA 2PUAA 2CE2X 1GZDA 5KCZA 1UBEA 2O48X 1TX4B 4GXNA 1NE7A 1RQGA 2XT0A 4Q3KA 1QCDA 3ESYA 3LQRA 1H0RA 1TZMA 2VPIA 4GOMD 3NDPA 3TBFA 1L7RA 3F5DA 1WBJB 2C7VA 2C03A 4JMPA 1JDZA 521PA 2VHUA 2OILA 3QELA 3RFTA 5DGTA 2AT1A 1C1HA 3WAGA 1CZUA 4CJXA 3RD5A 4YDSA 3OT5A 2GERA 2GMWA 4RYDA 1MNQA 3H0KA 5IARA 3SEZA 3RM3A 5EWMA 3LUPA 5JSFA 1X6VA 3A6EA 1DT5A 1WHTA 2ZIUB 3ILXA 4FDAA 1YC5A 4YXFA 4OQ4A 1E1RA 1ADFA 2BV3A 1X1TA 4PHCA 3L4SO 3NG1A 4Q21A 3H5IA 1T9CA 3HSKA 5CCXA 3FVTA 3K7EA 2VXYA 4K88A 5AVQA 3RUCA 1YQGA 2Q5EA 2O3UA 3JQAA 5BR7A 3VU8A 4JWTA 4OH1A 4ZEWA 2NO7A 3HN7A 3IMGA 4UBJA 1U11A 4Y3UA 4EQZA 1O5TA 2PVCA 1GRQA 1RVV1 4AT1A 5A9SA 1AN0A 1VQ1A 1TVKA 3VR2D 5EWJB 3OETA 4QODA 2PBLA 3WS7A 1A98A 1I4LD 3G7UA 4CR8A 3G8BA 3AETA 1Z07A 3A3NA 3O0DA 3J7TA 3OE5A 1AGYA 3P4YA 2CXHA 3EJ6A 4M8NE 1FW8A 4M83A 1SKMA 5DCLA 1OA1A 1KEEB 4DMUB 1Q0RA 2ERCA 3PNKA 2OTCA 5FR1A 4UMFA 2PO7A 4KZKA 4CLRB 4O4IF 5FWXB 1A4XA 1KY5A 1NN1A 2P79A 2DVMA 3DVQX 1SQGA 2EGHA 3P2IA 4CU5A 5KINB 3GEHA 1LRJA 2IYXA 2ZTMA 2QD3A 3BXEA 3I01M 4ZV7A 3TNLA 1U0TA 2CUZA 2OUKA 2YNMA 4FGKA 4WZ6A 2GK4A 2NZJA 3A7DA 2I0FA 2ZR7A 1XJQA 3ZGYA 4YACA 3NWEA 2GSWA 5B2EA 3E6AA 3OPVA 2WJ6A 4B3JA 1ZMBA 2B20A 3MGKA 1A7KA 4V39A 3EA0A 4Q1DA 4ARAA 5AJVB 3D3WA 3KKOA 4E5KA 3QYFA 5CT8A 3MQFA 5DGXA 4X3OA 1OC4A 1IL0A 3A3KA 3H83A 5CPFA 1CUDA 4R3NA 5E6UB 4BNYA 5HJ5A 3SZMA 1M2KA 1KJ9A 4RDXA 1CR0A 1RQRA 4D3FA 3KXPA 3L7KA 3A1EA 4DMGA 2VPXA 4OJQA 1XE3A 2QBYA 5EHIA 3UK2A 2VA8A 1LVGA 3CXRA 1KR2A 1Z2CA 1OAKA 3GO4A 2WJZB 3M2PA 3AR4A 3PZRA 4IWXA 3L1UA 4QBIA 3RI3A 2Z8YA 5DX1A 4RKYA 4WGFA 1JMVA 2HSWA 5FFNA 4EUHA 4TV9F 4CN8A 3H1AA 1GSOA 1XO1A 2GBPA 3LWNA 3USCS 1DG1G 1WA5A 3BWMA 3AVPA 1E2PA 1CJCA 3CZAA 3UMSA 5F1OA 4C7VA 4UHHA 4EGSA 5BWMA 2UYHA 4AS3A 2CY0A 3WGTA 4FP9A 4N01A 1IHXA 2G0NA 1A72A 1P2BA 2QR3A 2KI5A 3UUFA 3PYMA 1ZEMA 2ZS8A 1W93A 4DIDA 2CXQA 3WGVA 3AHCA 2QU8A 4HGPA 1KRXA 1G42A 1RPAA 3ICPA 4W6ZA 3OU2A 4MP6A 4AXXA 3ND7A 1C9MA 4WJLA 1KFBB 2ODAA 1VMEA 1DWPA 3QVVA 4PIPA 3HVUA 2ZRMA 5BVGA 2JLCA 2OHFA 1E2IA 2PD4A 1RWKA 2IF2A 2QYOA 2ZYAA 3ZE0B 3ZY6A 4EZEA 2H48A 3LP8A 3SYTA 5I9NA 3PJGA 2MYNA 3W8RA 2ATEA 1AF4A 2CLIB 2IGBA 4QUBA 1P1KA 4ZU6X 5AM4A 4HLCA 4QOJA 1RLOA 2J6IA 5FQOA 2RG7A 4PPFA 1CQZA 3GY0A 1J4AA 4Z3OA 4HH4A 3ISJA 3FWHA 3CJRA 4U7PB 5ALWA 3I6QA 4FB4A 1YE5A 1M6VB 2MSEB 3O8BA 4R2KA 5E6RB 1KSJA 2OHXA 1YR8A 4OGFA 4YRCA 3FM9A 5D1HA 1IPFA 2BI4A 1A9YA 4GPEA 4XEHA 3IP1A 3DBVO 3HJUA 2J7KA 4O3FA 4C03A 4L4XA 1E6WA 3T7TA 4ZDJA 4LBZA 4H6XA 2OCYC 1UKEA 3T34A 1PGNA 1Z4IA 4OP2A 5CX4A 5FLYA 3AB8A 5FBWB 2FQWA 2IBTA 2IXTA 4L9SA 1ECLA 1F8FA 1L4EA 1P4JA 1RZVA 2F00A 2QM0A 1IM2A 2YJ3A 3CWQA 2R7AA 2X1VA 3OQPA 2IIQA 1UJNA 4LYAA 4MQ6A 1LXCA 4HN2A 1O94C 4MUBA 4YRSA 3CRVA 3RK4A 5J4YA 2FSGA 1S2IA 3NDRA 4D99A 3SM9A 5JQWA 5BSKA 4FMDB 1U0OC 2NXEA 2WLSA 5FF9A 4L3VA 4KNVA 3SVZA 3VNUA 1REQB 4B31A 2O0LA 4MW4A 5KTNA 3I5XA 3RWOA 2HDOA 4RA6B 3Q6NA 4LOKA 2G9NA 2BBOA 1VCHA 3SZ3A 3WWPA 2L17A 1QV6A 4K5QA 4CV3A 1PZGA 1UOQA 2HWYA 4UDYX 3MIZA 4KIWA 1FFBA 4KQHA 3KETA 3JWHA 2QN2A 2B0CA 2VHJA 5JCJD 1HT0A 1ID8A 3ZHSA 4FWBA 1AUOA 1NXSA 1JHUA 2FHPA 3KX2A 1E7QA 4KKXB 4LSGA 4CF6A 3LWZA 2VLIA 4WY8A 3UAXA 4YO7A 1OXSC 3PC4A 2IWHA 3WGIA 3O7MA 2GCOA 4I5IA 3I2GA 5KMGB 1L4KA 4Q1EA 3OURA 1JU3A 1I33A 4OAPA 4URFA 5CFMA 4PONA 3RKRA 4E33A 4RTNA 5FLKA 2O7RA 1L1RA 5HXAA 1KU6A 4OG2A 1W0JA 1E69A 2AYXA 2KMLA 2XXJA 4O29A 2EFDB 3HVIA 2CXPA 3ENZA 4GVLA 2CVFA 5E1DA 3LX5A 1VPWA 3O8LA 3C6YA 4BO4A 1ZI8A 3FLEA 5TQ2A 1UWVA 1FFGA 4QGSA 4UDXX 4CEHB 3OC6A 4RMNA 1T35A 4G24A 1HTTA 5H3LA 2MSLA 1OIWA 1I10A 4U6QA 3AP3A 3DMDA 4DLLA 1DWUA 3OE7D 2GJSA 1VI2A 3PSAA 5IS2A 2C5BA 1BE6A 1MZPA 2QMZA 1NBIA 4Y30A 4AU1A 1C1DB 3WHKA 1IBMB 1UC4B 1XZJA 4GWLA 1S3GA 1ZRHA 4NXMB 4C3UA 5KJ6A 2NZXA 3RWMB 2O8VA 4NMWA 5IT9A 3PNSA 5FXMA 4JOQA 4NTZA 1HBJA 1HDXA 5JAQA 1G18A 2G70A 3KPWA 3UJNA 1SBHA 4KIUA 5GY7A 4ZZ2A 1R5NA 3HN2A 3VR5H 1K7SN 2PH7A 4GNKA 2PUFA 1GNPA 1MTOA 2WMYA 3K2EA 1KAOA 3ONDA 1YKGA 4UC0A 4C0SA 1UINA 3KALA 2PG3A 3W6PA 5HNKA 1ABBA 2V7PA 3Q3CA 4QBTA 3REFA 2V0NA 4C4XA 2OBXA 2HK7A 4NI5A 3SWWA 5ALVA 5JQGB 1R88A 1OWLA 1CJMA 1GQOA 1GZ6A 2PVSA 3M6IA 4N9QA 1WXIA 4X1YB 1D2HA 4FCWA 1DQSA 4N39A 3FNGA 3BXXA 1XG5A 4JNKA 2CCJA 1GSIA 1BCRB 3ZJTA 4LXYA 1V5IA 4RPIA 4Q3DA 2QL6A 2VNAA 4S2UA 5AXDA 3ZKAA 2IH4A 2AYYA 4QM6A 2W2XA 1N2CA 3EVZA 5TPZA 2E4UA 4HDRA 3CKLA 4XYBA 1JDBC 5EYPA 4EQ6A 5HKOA 1FSSA 1Y7PA 4MW6A 4OF4A 3UBTA 1HQYE 1ZGHA 4K03A 3P2JA 4ALKA 3L93A 3LE8A 3GRZA 3HUUA 2NUAA 3U9SA 3LUKA 1JUDA 1B8VA 2HQOA 3FNFA 1UBOS 1KHTA 5U1PA 3DDSA 1D0VA 3D1LA 2GCGA 3VPDA 1KWGA 3KWMA 3AHFA 3R5FA 1YA4A 3IPLA 3KL2A 4NYMQ 3CG4A 1X80B 2WZDA 1LPMA 3Q8LA 1N9GA 2UXBB 1P3Y1 1FS5A 5K45A 5EJIA 2IC5A 4LY9A 2V6BA 4U5XA 4K6FA 4AMVA 4M76B 1E7SA 4YDHB 1SB8A 3LXUX 5IC4A 1PBTA 2IZOA 3HL4A 2AH5A 2IPLA 2QG4A 2QTGA 4MCHA 1C4XA 1QGYA 2V4MA 3KQWA 4PSUA 4YRZA 2NZUG 4RQBA 2BD0A 2FN8A 4TWAA 4UXHA 4CKWA 5HS4A 3DEJA 2NSDA 3BRWA 3S81A 5C4MA 3VZQA 2ZDQA 1NUSA 1U5CA 2WAOA 4OHZA 3RV4A 4B71A 1XPUA 2RI0A 4P4SA 3MPUA 4PAWA 2VAVA 4C4PA 4TGLA 4FNMA 1AUVA 3LPNA 3VH1A 3EGOA 2JZOA 2KSQA 3DTVB 1Z7GA 5BMOA 1C9NA 5D3ZA 2FEMA 5CCEA 3CO0S 4DMMA 4W5JA 2HO4A 3HZZA 4RH1A 1BFKA 4F38A 3SR0A 4L74A 2I6FA 3E3OA 4I8IA 3DE1X 1I80A 2Q3HA 3GD7A 4LXHA 2CB9A 2B35A 2WWFA 4OKNA 5FL7D 4GGPA 2ZG6A 1LBHA 3FIJA 3I2JA 1I36A 1K9VF 2VNIA 5K4GA 5BQOA 1UBGA 3CH4B 3SJZA 4D4LA 4RHCA 5LOVB 2D7DA 3ANMA 1UKCA 3N28A 2QTCA 1B0PA 1G17A 2FRVA 1PZHA 2SBTA 1JDUA 5JADA 1B0UA 3WGQA 4OA8A 2C82A 2HY7A 1WXDA 4UNIA 2EKLA 4P3YA 5FPYA 3RRJA 1PBNA 3U39A 2IPXA 3ZGNA 5AD1A 1JWLA 2Y05A 1CS0A 2GLTA 5CDGA 1F2UB 1XVTA 4E3WA 1JJBA 3EAGA