2GDZA

Crystal structure of 15-hydroxyprostaglandin dehydrogenase type1, complexed with nad+
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
266
structure length
266
Chain Sequence
b'AHMVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALHEQFEPQKTLFIQCDVADQQQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHIKDMIKYYGILDPPLIANGLITLIEDDALNGAIMKITTSKGIHFQDYGSKENLYFQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD+-dependent 15-hydroxyprostaglandin dehydrogenase
publication title High-Affinity Inhibitors of Human NAD-Dependent 15-Hydroxyprostaglandin Dehydrogenase: Mechanisms of Inhibition and Structure-Activity Relationships.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 104
structure length 266
sequence length 266
ec nomenclature ec 1.1.1.141: 15-hydroxyprostaglandin dehydrogenase (NAD(+)).
pdb deposition date 2006-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2gdzA00
3GA0A 4WOJA 3K2EA 4PLPA 2J6IA 4Z0PA 4FFLA 2FPGA 1HKUA 2Q50A 2Y66A 3NX4A 1ZUD1 1FMCA 4HWKA 2A94A 4HX5A 5JC1A 5BSEA 2RH8A 1A4IA 4MKXA 2GLXA 3PIDA 3SJUA 1QXSA 2WMDA 1NNUA 1PR3A 3PJGA 4HBGA 3RI3A 3LF2A 4UUNA 2C20A 1NFFA 3L4SO 3PP8A 2IEDA 5JDCA 4U7WA 5T8KA 5G2OA 4EUFA 1B0AA 1UZMA 2OMEA 1DC4A 3S2EA 4DBVO 1ZJZA 5KJ6A 1PTJA 1IOLA 4F45A 4N7RA 1PJ2A 1UP6A 1LSJA 3PTZA 4R1TA 5LDHA 2Z5LA 5CDTA 2C29D 3O38A 4R68A 1CYDA 1GYPA 1LTHR 2AG8A 3WICA 1B15A 3HG7A 4BNLA 2QZZA 3WIDA 3ABIA 1K6XA 1JA9A 2DC1A 2Q99A 2PH3A 4FDAA 4J4BA 1ML3A 1QYCA 1SBYA 1LDGA 1V6AA 2C5AA 2ZYGA 4ILKA 1R0SA 4R16A 1Z75A 1DIHA 1PQUA 3BTSA 5CG2A 4HP8A 3LLVA 3PHIA 3VTZA 5JLAA 4GSKA 4PN3A 5KVCA 1IL0A 1VI2A 5HA5A 1C0KA 2B83A 1HETA 1ZEJA 1U2DA 4XIJA 1P1RA 1QV6A 2FRDA 4FCCA 3WGQA 1QP8A 4YYZA 2NU7A 2GD1O 4CPDA 1U5AA 3AM4A 4W6ZA 2EKPA 3WLFA 3JQEA 1RM5A 2NSDA 4DREA 3DZJA 2EV9A 3WWYA 5IZCA 4FSHA 3W4IA 4K6FA 5FI5A 2ZK7A 4E0BA 5K9ZA 5DN9A 4NU5A 1LNQA 4GLLA 4ZQHA 5I9LA 1GQQA 2CUKA 4HXYA 3VZRA 5G4LA 4ROSA 3QSGA 4YVFA 3OETA 1ZFNA 2NADA 1GV1A 1EVZA 4LVCA 2QW8A 1F8FA 4OMUA 4CMEA 4DIFA 4P8RA 3WMWA 4LSWA 4CM4B 3W8DA 3C3XA 4JBIA 5IG2A 1F06A 2EW2A 2WYWA 2AG5A 5L7YA 3GVIA 1YOVB 1XSEA 1M66A 3WG9A 1JTVA 3KTDA 2ZTVA 3OM9A 2BFPA 2OFPA 4YT5A 1FDSA 5H81A 2TMDA 4CODB 2Q2WA 4WLFA 3UGKA 4NBWA 3CE6A 3DBLB 2JHGA 3FWNA 4J49A 4K6CA 2AEMA 2DUUA 2C82A 1VC2A 1YQGA 2I99A 3GVXA 2GZ1A 2ZATA 1WZIA 3PWSA 4DTIA 1B2LA 1XU7A 3I83A 4TKLA 2WE7A 4IDAA 4HFNA 4RVHA 5KVSA 3WQRA 3NRCA 4KUHA 3DBVO 4UEOA 1FDUA 4BMVA 1QLJA 5MDHA 4D0SA 5BQFA 2QG4A 2E82A 3E48A 3MJCA 1T26A 2CF5A 4J16A 5DT9A 3AUSA 4I5GA 2YQ4A 5GMOA 4DPKA 4BO8A 1ISMA 1NPYA 3ICCA 1R4MA 1I2CA 2Q4BA 1EBFA 5TIIA 5TS3A 1B3BA 1IZ0A 3MJ4A 1WMBA 3DEYX 4ZU3A 4Q3AA 3QW2A 4ND4A 3ETGA 1VJ1A 4J7CA 3U09A 1H0KA 1SMKA 1XHLA 3DAGA 3GMDA 3IDSA 1GAEO 5EMHA 3ROMA 3H4VA 4U6QA 5A05A 4D79A 2Y1GA 1EUCA 4YWJA 5THQA 4BO7A 3LT1A 2X23A 2EJWA 3SLKA 4MVJI 2AMFA 4Z3KA 2HCTA 2O3QA 2FZWA 4N5NA 2ILTA 4KWIA 5TLSA 2Q1SA 5CDUA 4FD3A 5EQFA 4CMHA 1JN0A 1ZK0A 3BIOA 2CZCA 3S55A 2I76A 1X13A 5ER9A 4YA6A 1MC5A 2CDAA 2Q2QA 2ZCUA 2PKRA 3TFQA 4E30A 4MVJM 3UN1A 1K5HA 3VZQA 4DPLA 1X7HA 3WJ7A 2YFQA 4J0EA 4BO2A 2HSDA 4LRTB 3VDQA 3K96A 3PI7A 4D3DA 3RBVA 3ASVA 3Q11A 2BFMA 1LRKA 2HK7A 2X1HA 3DBHB 5ICMA 4H15A 4JX8A 4KZPA 3VH1A 3O03A 1K6IA 4L9RA 5L95A 3HFSA 3HDJA 1E3JA 4IIVA 3W6UA 3QVXA 1DEHA 4YJFB 2VWGA 2J3JA 1ZXLA 3JD4A 1M6HA 1BWSA 4WK6A 1BTOA 1YS4A 5TF4A 2W4QA 3HQ4O 3KBOA 1NWCA 3EAGA 2VTDA 1K89A 4LMPA 4EJ6A 1JW9B 1D3AA 1Q1NA 1YBMA 5ADHA 3JYPA 5GZ1A 3HADA 2CF6A 4R01A 4H3VA 3CMCO 4C7KA 4AFNA 3V1YA 1K6JA 4IY1A 2AEJA 2O3TA 3ZCXA 1UZLA 3ICPA 4JJGA 2OGUA 1C0IA 4A73A 3MJVA 3E82A 4D3FA 1ISFA 2BKAA 5I7SA 1KVTA 4GX5A 2ZJ1A 1DRWA 4AICA 1DJNA 4LN1A 3ZWAA 3WGGA 3JQ8A 3WB9A 5ENVA 1GYRA 1M76A 3ADPA 2PH5A 2V6FA 2ZB3A 4P22A 4OJNA 3JQ7A 3V1UA 1P31A 4U5QA 3ULKA 3F46A 4DUPA 4QO7A 5IDWA 2X0RA 4FC6A 7MDHA 5JO0A 3H9JA 3KV3O 3C1OA 1R0KA 4E31A 3C7DB 4GKBA 3CEAA 4F6CA 3DONA 1ARZA 5KCZA 1EMDA 1YJQA 2E48A 3KEQA 1I5RA 2R00C 3G0OA 3JYOA 3PRJA 4J2HA 4UULA 3DOCA 4DA9A 5K6AC 1YB1A 2Y0CA 2BI8A 3TZCA 1I32A 4RZHA 2TMGA 4I9NA 1ONNA 4XZ3A 1QLHA 3JD0A 1TT7A 4BB5A 5G4KA 3I23A 1RM3A 1IHYA 3H9GA 5JAMA 1PJQA 4BO6A 3TJRA 1N1GA 1JKIA 4A03A 1XQ1A 4BO9A 3I6QA 4NR0A 4PRLA 4ND3A 3SEFA 5ILOA 5B4UA 2V6GA 3VTFA 1FDTA 3RFXA 3EZLA 2WE8A 4EZBA 4Q3DA 4IJWA 3AOEC 1EE2A 1IB6A 1Y6JA 3ANNA 4GWGA 4NMHA 1HLDA 3DO5A 1E3EA 4FJ0A 4D3SA 1XKQA 5F5NA 3T4XA 1MFZA 4BGIA 5CEJA 3ZNOA 3JQAA 1P1IA 2BRUA 4YCAA 3MWDB 2H6EA 1LRLA 3O26A 5B4VA 2BI7A 3GAFA 1OZAA 2POQX 2X5OA 4CM9A 4IQ0A 3MTJA 1PL7A 1E7WA 3RC2A 3KHUA 4CMGA 2CVOA 4L74A 3HDHA 1CIVA 2FPPA 2HO5A 5JPIA 4BS9A 2Y0DA 3X2EA 4YR9A 2PNFA 2IXBA 4I08A 3F4BA 3RU9A 5I8ZA 3IUSA 4L4RA 3F5SA 4B3JA 3GZNA 5JBIA 2JFGA 2AXQA 5TC4A 5THKA 3TDKA 4Z6KA 4J1TA 3LYLA 4HNGA 3KM0A 2Y0EA 3PJEA 1OBFO 2B5WA 4BNNA 1QG6A 4RVUA 3JQFA 1ZK2A 4CLRA 3EYWA 4J91A 5U9CA 1TT5B 2AQ8A 1X7DA 4NFSA 1EVJA 1IY8A 4BO0A 1LBEA 2VOJA 3GEDA 3GFGA 1I0ZA 3GY0A 2X9NA 1MGOA 3UUWA 3ZGYA 1DSSG 1PSDA 2HMTA 5IZCC 2E6UX 2VWQA 3D5TA 3ZWBA 1DHTA 4TRRA 1O8CA 1LSOA 4DC0A 3A9WA 1VL0A 4W9NA 3INRA 1MXFA 1FJHA 3OQ6A 4GLOA 4ZQEA 3JQBC 1RWBA 4CMEC 4JJIA 1HDXA 5IZ4A 1SEPA 4CLOA 1P0FA 1LDBA 3EC7A 3FN4A 1E3SA 1ULUA 2DUWA 4CMAA 5I7FA 4YAIA 1ZW1A 3FNHA 2VNSA 3DZIA 5TT1A 1PS8A 1XIVA 1NHGA 4JK3A 1YH3A 2LDXA 3QWAA 1E3WA 1B14A 2H1SA 4E6PA 5H82A 4B3IA 3TOXA 2FZEA 2C7VA 3FTNA 4PG8A 2C07A 1NYTA 4TMFA 2O50A 2X6TA 5KTKA 3HDYA 3DBRA 3I4FA 1NPDA 3I9MA 3D3EA 3RKRA 3VKVA 1H93A 1C14A 1AN9A 4XCVA 3NT4A 5C3MA 5JO9A 4XGNA 5L51A 2HK9A 3V2HA 2QRJA 4XDZA 1P1HA 1Y8QA 4GGOA 3H5AA 3JD2A 2FR1A 2PFGA 1Q2XA 5EERA 1SOWA 2BFOA 4DLBA 1QMGA 4L76A 2EWMA 3KEOA 4IUYA 3L4BA 5DBFA 1R6DA 4EUHA 1LLDA 2W2LA 1DC6A 1I3MA 4A27A 1LX6A 4CV0A 3CUKA 4BKUA 1BW9B 3MTGA 4OH1A 2OUIA 4UAGA 4A5OA 3HSKA 4URFA 1E7QA 3BAZA 4DLAA 2A92A 2NQ8A 2G17A 1KERA 4P4GA 3ZU5A 2PKQO 5IXYA 1PJLA 3HJAA 3UCEA 4XQCA 1XCBA 2YV1A 1D1SA 1W73A 3C24A 4IS2A 4R9SA 3WYBA 2DBRA 3QP9A 5AXDA 2OXIA 5L4LA 4GL4A 1S7CA 2NU6A 1I2ZA 5L4SA 2RAFA 2EP7A 1KC3A 2JJYA 4ZVVA 5TQVA 4FBGA 3P2OA 1PS0A 2AQKA 4J1QA 2NVUA 2VZ9A 4WASA 3QE3A 5G0UA 5A9SB 4J9VA 4QECA 4RVFA 3K8ZA 2DAPA 2NVWA 3RUHA 3GFBA 3LLSA 1LEHA 3JQDA 2BELA 3ORFA 3UFXA 3ZWPA 3BMQA 1R0LA 2WD7A 4DPMA 4CJXA 4CM8B 3ANMA 1I2BA 3EVTA 3KSZO 4I8XA 4Y6SA 1I30A 2YDXA 3A14A 2O3SA 4KTVE 4L4SA 4EDFA 1EBUA 2FWMX 1DIGA 5G0SA 4JROA 2PZLA 4XWYA 1HE5A 1MLDA 3JQ9C 5EPOA 5TNXA 4UVHA 4XYBA 2XF8A 5ILGA 5AYVA 3L9WA 2B4QA 4DIBA 3DTTA 4YTEA 5I7VA 1E1NA 1ADGA 3M6IA 4CR6A 1Q7BA 4BO1A 5TJ9A 4NBRA 1CERA 3WYEA 1V3VA 1PJSA 1KBZA 1LA2A 4LMRA 4UREA 2PZMA 1DPGA 2D4AA 2BD0A 2HLPA 2I5PO 4BL5A 1I8TA 1XA0A 5IXSA 2VHZA 2EF1A 2O3RA 5HS6A 1DHRA 2Q1UA 1BXZA 2R6JA 4RLHA 1GEGA 1LLQA 3CSDA 2GUGA 3WNVA 1PZFA 4XYEA 2E4AA 3PFWO 1YXMA 3O9ZA 1DOHA 3GG9A 4TVBA 1H2HA 4NK4A 5DCWA 3I9NA 4FOSA 1W0CA 1Z6ZA 4NHEA 1O94A 1YKFA 1SCUA 3KRTA 3Q9UA 4RL6A 3RJ5A 3WWZA 4YRAA 4FFNA 3PHGA 2JKVA 3A1NA 3OJOA 3ZV3A 3WIEA 4GX0A 4E5NA 1ZEMA 1F14A 4MIYA 2Y05A 3RIHA 4UUMA 3LC2O 4BGUA 3FWZA 3WLEA 5JXWA 8ADHA 1G0NA 4ZICA 1LSUA 1HDGO 3GRKA 1UXJA 4YRDA 5KJEA 3ZU2A 1HRDA 2X7HA 3AJRA 2NTVA 3GDOA 4TROA 3SVTA 4RCVA 2DBVO 4W99A 1U28A 4OQZA 3INTA 3GEGA 1IPEA 2YHIB 3OEYA 4TRMA 4R9RA 3F47A 4KDEA 1U8XX 5A4DA 2NWQA 3QY9A 4FFPA 5B12A 3OP4A 2HU2A 3GPIA 4GBJA 1G6KA 2OBYA 1NQAO 1DBVO 1CDOA 4O1MA 4XA8A 4ALLA 3QHAA 1T1SA 4NJOA 1E6WA 4WCDA 4JCOA 3G3EA 1V0JA 3RC7A 3WNQA 4C7JA 3EDMA 2E37A 4PRKA 3KYBA 1VLLA 2X0NA 1N9GB 2QQ5A 1YL7A 5IN5A 3KYCA 1EQUA 4NDNE 1SB9A 1IE3A 1Y5RA 4YXFA 2Z1MA 4IINA 3WS7A 3GHHA 5EJ2A 1NAIA 3OBBA 2OZPA 1Y1PA 3IC5A 3IL2A 1TB4A 3DDNA 4B79A 2VTEA 3O8QA 3N7UA 4O63O 4YJGA 1F17A 2NACA 1QRRA 3NTOA 3PHLA 4UEJA 5IJZA 1MB4A 1BDMA 3MEQA 4PVDA 4N5LA 1YB4A 1O95A 4NFHA 4Z0TA 2HRZA 4LSMA 3DMTC 9LDTA 4J4TA 5B1YA 2EW8A 4WEQA 4L4XA 3PHHA 4UUPA 1O6ZA 3QWFA 4N5MA 4BKOA 4CMIA 3QV1A 1ENYA 1E6EA 1E7RA 1PZEA 3OECA 2EJVA 3DQPA 4R69A 1AHIA 5U4QA 2JAPA 1P1JA 3IKVA 1O89A 1GY8A 3SC4A 2UDPA 3F1LA 3H9UA 3MWEB 1C1DB 5A3JA 1DLIA 2CMDA 3ONEA 3TOZA 4QEDA 1ONPA 2Y68A 1PIWA 2FMUA 2I67A 4PZDA 4BHTA 2AQIA 3TPCA 4BNVA 4L73A 3AY3A 1SAYA 2BLLA 4XKJA 2EIHA 5ITVA 2WD8A 2PGDA 1UXIA 4J3FA 2DTXA 2NUAA 1E77A 3D3WB 1N92A 7ADHA 1BHSA 2I3AA 4BV8A 3VVBA 2VN8A 1OC2A 3V5NA 2VQ3A 2WSBA 1DRUA 1GPDG 1NX6A 4ZJUA 2EEZA 3NAQA 1Y9AA 1ZXBA 4PG6A 2O3UA 3TF5A 3D64A 4BNHA 4M49A 1U7HA 3QRWA 4YACA 1MC4A 4ALJA 4F6LA 1J5PA 4CUZA 1RM0A 5JYDA 1IYZA 3QWBA 3OQ1A 2OP0A 1H5QA 3TSCA 3WGZA 1YQXA 5LDGA 2O4UX 3CZRA 3TFOA 1ZBQA 5C5IA 4FJ1A 2FR8A 4EITA 2VYVD 3ROKA 2J3KA 1XU9A 4AJNA 1HLPA 3ZWYA 1F0YA 1Y9EA 2B4TO 1R15A 4YQYA 4BNJA 2UUOA 4KOAA 5AXBA 2J3HA 4RF2A 3L6EA 2Q1WA 1I24A 3Q2IA 3C1AA 2BFAA 4I5FA 5GZ6A 4R41A 1IULA 4BIIA 4QXMA 3ZW8A 5CEFA 1X0VA 5AQ1A 1ONOA 3PQDA 1GV0A 1EUDA 1JDJA 4CQMD 4E5KA 3ZWXA 5AXAA 4XEHA 3ZWMA 1K2WA 1NM5A 2Y67A 4OYRA 4J43A 3VPGA 4NJMA 3FPLA 1J49A 4Y9DA 5GZ3A 3ZV5A 3UW3A 1WWKA 1UUFA 5C37A 4ZQFA 2XXJA 2VZ8A 5TX7A 2D0IA 1XELA 2D5CA 4IJKA 3JD1A 3QWHA 2BH9A 5L53A 2IRWA 4IM7A 1HDOA 2IODA 4B7UA 3JYNA 2X86A 2O48X 1H9AA 3M2TA 4JN6B 1ISIA 1JVBA 1LRJA 3KVOA 1T2EA 3D4NA 2CVZA 1M75A 3WGIA 2GN4A 1LQUA 3P19A 1U8FO 2DBQA 4RPJA 5T6BA 4CLEA 4EEXA 1BXGB 1PL6A 2LDBA 4AJIA 5IDQA 4BNYA 3I52A 3JQAD 4BNIA 3PVZA 4H7PA 4GH5A 2HAEA 2EGHA 2YJZA 2VHVA 2XAAA 3I9OA 2I9PA 3H6KA 1JAXA 5ITWA 3CXRA 1QSGA 4CM9D 4ONEA 3TZKA 3AK4A 2YYYA 1ENPA 1JLLA 1UP4A 1FXSA 4IGEA 3DWFA 4CLHA 2PZJA 3L6OO 2RHCA 3GAZA 4GMFA 4JLWA 3R1IA 5KOIA 1PJ3A 4U0KA 4J9UE 1A9YA 4IQGA 2NTNA 3GEMA 1ZK3A 3PWZA 4P4NA 3W4JA 3JQ8B 1P1KA 4D41A 3KUXA 1AGNA 3QLJA 3OFSA 1A72A 4PLYA 1V3TA 2RBEA 4Z9XA 1EQ2A 5JFOA 3RROA 3GN2A 5T67A 4WCFC 1JKJA 2CDBA 2OBNA 4MVJD 2O7SA 1GUFA 2ZJ0A 3NV9A 1Y81A 4CQMB 3VHRA 2WEKA 3DOJA 1PQWA 2B36A 2B69A 1BDBA 4XGIA 5DP1A 4Z9YA 2HQ1A 3F4LA 1PGOA 3RAJA 3IP1A 2YHUA 4BO5A 4WLVA 5DZSA 5DOVA 4AJ4A 4B8ZA 4KMSA 2VCYA 4EBFA 1A71A 1PR9A 3HDQA 1CETA 5COBA 4GWKA 4IDDA 3UOGA 3AU9A 3FR8A 5JCJA 1HDRA 3U9LA 4Q3CA 1TI7A 4GX1A 4KUEA 3H2SA 3K73O 1WDMA 2HJRA 1VJ0A 1KVUA 1HYEA 1NTOA 3AFMA 3ITKA 3FR7A 4OXYA 4P38A 4E33A 5CFZA 1JU9A 1PJBA 4O6VA 1JWAB 3I9LA 4E21A 2CNBA 3TRIA 4R1NA 4S1VA 4FB5A 4CUKA 4XB1A 4OGWA 2NVBA 4CMCA 3N74A 3A06A 4CM4A 2JHFA 1UDBA 3KXDA 4BQPA 1ZIDA 2CVQA 3EHEA 4RVGA 3UF0A 3ZNPA 3NYWA 1YOVA 4UVGA 2DPHA 5J23A 2QRLA 3AFNA 5DBGA 1PZHA 4GSLA 2I65A 1SNYA 4XIYA 1MXHA 3C85A 3IMFA 4DGSA 4A10A 2EHDA 5JMWA 4NBVA 1BG6A 1DXYA 2QYSA 2HMWA 3DBLA 3NJ4A 3H5NA 1W6UA 3WGYA 2Q3EA 1OFGA 4UEKA 1KOLA 2W90A 1NAHA 4DQVA 4LCEA 1ZKMA 4QFCA 1NQ5A 4BNTA 5L7WA 2O3JA 2DBZA 1Y5MA 1N8KA 2GRAA 2BF7A 1NQTA 4YDRA 1HE3A 4NBUA 1MG5A 3GGGA 1QORA 2Y99A 2Q1TA 1H94A 2SCUA 5TSDA 3H3JA 4CMJA 1SPXA 4L8VA 4CLRB 3PK0A 4K1LA 4XQEA 3C7AA 5IF3A 3QVTA 5KNLA 3BMOB 4PLCA 3PZBA 4PIVA 3T7CA 1E1MA 4FGSA 1R4NB 3AI2A 3S1LA 1H2BA 4D0RA 4MKZA 3AUUA 4R1UA 4XD2A 6ADHA 3K92A 3WTBA 1UZNA 3TZQA 2B37A 1PX0A 4MIEA 4ZQGA 4W4TA 1M6WA 1GFSA 1KEUA 2JFFA 1HYGA 4I5DA 1XDWA 2P4HX 1GYQA 1UAYA 3EW7A 1T25A 3D1LA 2HUNA 5JAQA 1P44A 4CV1A 2C0CA 2PD6A 2FSVA 3Q1LA 3DC2A 4MP3A 3RBXA 1HL3A 5A02A 1D4FA 1KIFA 3DXFA 1P33A 2P5YA 1YBAA 2D1YA 2G5CA 1JQBA 2HMUA 3PGJA 1U3WA 4HFJA 3B1FA 5TGDA 1A7KA 5IN4A 2YDYA 1UXGA 5KKCA 3H7AA 1QR6A 2YFHA 1YONA 5G0TA 1RJWA 1Y7TA 3WQSB 3C7CB 2GR9A 2X4GA 3EUWA 4TWRA 3MZ0A 1RKXA 1MG0A 4INAA 3C1TA 2DTEA 4J7UA 4IZIA 2DLDA 3VPFA 4IJVA 2UYYA 4RPGA 1N7HA 2NLOA 4E5PA 1OOEA 1X7GA 5JS6A 1O0SA 1M2WA 2HJSA 5BSGA 5JDCC 3KYDB 3LT2A 1XQ6A 2I66A 2GZ3A 5T8KC 4UUOA 1UH5A 1RPNA 3ZZNA 2GO1A 4RDIA 5JSFA 3QVSA 3NDRA 1IPFA 3M1AA 2GF2A 3NUGA 1BRMA 4ZN6A 3CINA 3DBHA 2IZ0A 1N2SA 3IUPA 4RF5A 3RUEA 4K26A 3BHIA 3JQGA 3E6AA 4IIUA 1SEVA 1DFHA 5FYDA 2UAGA 4WLEA 4YJFA 4CLDA 1DIRA 1V8BA 5F1PA 3VVCA 1ZJYA 2F1KA 5I9NA 4M86A 1Y8RB 2VOEA 1JVSA 5KKAA 1CJCA 1VKOA 4GKVA 5LCXA 1KY4A 2FSSA 2C54A 2GERA 3CZMA 3EMKA 1UJMA 1C1XB 1QKIA 3GT0A 4GI2A 3U5TA 3WGTA 3L9XA 3KOUA 1E5QA 5EL0A 1J0XO 3M2PA 3U0BA 4J4HA 1RYEA 3G49A 2D8AA 4G81A 3JSAA 1DC5A 5BR7A 3PLRA 3EY4A 2WJPA 3AUAA 3AU8A 3GN1A 4PZCA 2W2KB 2VHXA 3GOHA 3LC1O 3PJFA 3CH6A 4MDHA 5F3RA 5HWSA 2CD9A 1U2GA 1U7TA 3OQBA 4MJLA 1XGKA 5TJHA 1YRLA 3BXXA 4WCFB 4KP7A 4AJKA 2WWRA 4HFMA 4W82A 4BKQA 4IDGA 3WQQA 2P4QA 4X54A 2PGJA 1BSVA 5KIAA 1KYQA 3E9QA 1ZO8A 3FNFA 3MOGA 2C5EA 2AE1A 3V2GA 1Q7GA 1M67A 2V6BA 4WUVA 4PG7A 3BMCB 2IYOA 4WECA 3KB6A 1W8DA 3E03A 1N5DA 8LDHA 3VPHA 1H6BA 3HB5X 1E0DA 2JCVA 1C3VA 3V1TC 4FPXA 4DL9A 2YV2A 4XYGA 2XPCA 1YE3A 1LU9A 4CQLB 1A7AA 2FY8A 3QWIA 4OXNA 3C8MA 4AJPA 3ITDA 4EGFA 1N1EA 4MO2A 3ETEA 4P4LA 1IZ9A 1MA0A 2WTBA 2AA3A 2ZCVA 1HDYA 2GYYA 2NNLD 4OAQA 5L40A 3S8MA 3TZ6A 4BKPA 3PPIA 3OF2A 2RH4A 4RV9A 5COAA 4KQXA 1DRVA 1LSSA 1OC4A 3W8FA 3EZYA 3PLNA 3TZHA 2C59A 4BNUA 5G0WA 1NASA 2ZYAA 3G79A 4PLWA 4EI2A 2IE0A 5IFLA 1YO6A 2Y1FA 1SB8A 1JWBB 3LT0A 4AVYA 4E2WA 1EVYA 4MVJH 1D7OA 3NJ8A 1GTMA 3RUAA 1DIAA 1UDCA 1DLJA 1A9ZA 2E49A 2DM6A 4BNXA 1U4OA 2X5KO 5BT9A 1LC3A 1NFQA 2H5LA 3KLMX 4TRJA 1R66A 4II3A 2JFHA 4UVDA 1VRWA 2X5JO 2X9VA 2VUSA 3LC7O 5T64A 1LQTA 4RDHA 1P74A 1EDOA 2RCYA 2PK3A 2DTDA 4FC7A 3OICA 3AI3A 4IXTA 4O0LA 5DCUA 4KUGA 5GY7A 4QFDA 3ZU4A 5C7LO 4HADA 2GZ2A 4YJHB 4BMSA 3ZNQA 4GGPA 1OI7A 2IZZA 3GNTA 4Y6PA 4YEDA 5A5FA 4FFMA 2EGGA 1LI4A 4WLUA 1TT5A 2H63A 3VZPA 3B1JA 3OJFA 5CDYA 1NPTO 3OMLA 4JP2A 3OH8A 3GDGA 4FGWA 1UR5A 5A3VA 2Z1NA 3DOOA 2D3TA 3PYLA 3Q2KA 1GZ6A 1XG5A 1XLTA 3FBGA 1AXEA 3KYCB 1VKNA 3ON5A 4M8SA 4Z3DA 3G1TA 4WLOA 4AJOA 4B4UA 4IS3A 1D1TA 3GNSA 3CIFA 3GUYA 5A06A 2D59A 4B4VA 1HSOA 4EW6A 1FK8A 4U8GA 3WJAA 4M55A 3RASA 3T4EA 1P45A 2P5UA 3QJ5A 3Q0EA 3LVFO 5F1OA 3LSYA 3E8XA 1GQYA 3KSUA 1CEQA 3AY6A 5BNIA 1LLCA 2IDZA 2NQTA 3E9MA 3EGOA 3V8BA 1YL6A 4DQXA 5A5EA 1GUZA 1Z7EA 4CMIB 1FDVA 3PDUA 3O4RA 4AL4A 1C0PA 1NR1A 3I3OA 3R3SA 4YT2A 3BMNA 2OP1A 1UAGA 4UVEA 1XWFA 1AHHA 4RPHA 1E1LA 4QTZA 3D4PA 1KEWA 4YT8A 1ADFA 2NM0A 1I01A 4AJHA 3PWKA 2B5VA 2UVDA 2QYTA 4NU6A 3VDRA 4DBZA 1E7YA 3RWBA 3ADOA 3AWDA 3WGOA 5DP2A 3HUDA 4DIOA 3WSVA 3L77A 4RO0A 1GCUA 1YQDA 3ZV4A 3WTCA 2VYNA 4ITUA 3RU7A 1PZGA 3LQFA 3TQHA 1E7SA 3EVNA 4IXWA 3VH2A 4HUJA 5L9AA 3KO8A 3RFVA 4XQGA 3W8EA 3GG2A 1PS9A 1SOVA 4XR4A 3K5PA 1EZ4A 1HZJA 1I3LA 2H9IA 5ENDA 4BGEA 1HXHA 2QHXA 1E92A 3K31A 3GNQA 2WDZA 1GZ4A 2HKIA 3F6YA 4J1SA 2B4RO 4R54A 4WNIA 4EJMA 3VPSA 2OO5A 4R5HA 5F1KA 1R12A 2DT5A 1PGNA 3F1KA 4HKTA 4A7PA 4DXHA 3L07A 4DWVA 4NBTA 2JCYA 5JAIA 1UXKA 1PQPA 2X22A 4U6SA 1PU2A 1U3TA 4S3MA 3ZW9A 4J7XA 4ZA2A 3M1LA 1U1IA 2PKQP 2YZ7A 4OIMA 3ZDFA 4GVLA 5A9SA 2VRCA 1AXGA 1B26A 1HYHA 3ZI0A 4W7HA 4YQZA 1U3VA 1ZK4A 2Y1EA 2PGLA 4IPTA 4D43A 4BO3A 1ZMOA 4J6FA 4YAKA 1E1KA 1A4UA 1L7DA 4CM8A 1XYGA 3OIDA 4BB6A 4ALIA 5AOVA 4NJMB 1ZSNA 3E5MA 1EVIA 4YT4A 1N7GA 4B3HA 2B0JA 4ZGWA 1NWHA 3GLQA 4FIZA 5CG1A 1HZZA 1A5ZA 3NGLA 3L0DA 1PGQA 4MP8A 2R00A 1DFGA 5K6AA 1EK6A 1JAYA 1H9BA 1VE9A 3I6IA 3ROPA 2EERA 1DAOA 3DHEA 1Z73A 4II2A 1NQOA 1B8PA 4N18A 4IDFA 4U0JA 2C2YA 1EK5A 2B35A 2DFDA 3DHNA 4BO4A 3MJSA 3WYCA 1TEHA 3GPDG 1DFIA 5B4TA 4CM7A 3RUDA 3MOIA 1DJQA 5AVOA 4K9DA 3H9EO 5KVVA 3WBBA 3RSHA 1WXDA 2DKNA 2HK8A 3JQFC 4ND5A 1YDEA 4R5MA 3RBZA 1DO8A 1HWYA 2CFCA 4TZKA 4AG3A 3I4CA 4MOWA 4G65A 1EE9A 5ICSA 1U3UA 3GF4A 2VRBA 1RM4A 2RIRA 3AOEA 3ZU3A 3DL2A 1R4MB 1X14A 1ZSVA 1E3LA 1T2DA 1GDHA 3RCBA 1S6YA 4BUCA 3VC7A 3PEFA 4RQTA 2CY0A 2AHRA 2ZTUA 2EP5A 5HS4A 2Y1DA 4W9NC 3WBFA 3HE3A 4ID9A 2O2YA 4Y8VA 3W1VA 3OIFA 3LT4A 2GN8A 4CM6A 4RVDA 2I6TA 2UUPA 3F9IA 3AW9A 1B16A 5FFFA 3WOHA 1CQJA 3KZVA 3AM3A 1XEAA 2JD0A 1KVQA 2YHIA 1B8VA 4Q3EA 1KVSA 2C7GA 2WM3A 5EQDA 4BNGA 1PWXA 4PLFA 3TWOA 2DQ4A 4NFYA 5A1TA 1NHWA 4LK3A 2QRKA 4OL9A 4CL8A 5KJ1A 2YV3A 4BMNA 4JGBA 4M54A 3PQFA 3CTMA 4MKRA 2PLAA 4E4YA 4OOEA 3BA1A 1WMAA 2YQ5A 2EKLA 3HB4X 2O23A 2OL4A 3OHSX 3JTMA 4HY3A 2D5AA 1DB3A 3I9JA 4XR9A 1LUAA 4DMLA 1ENOA 4GAEA 4PLTA 5FF9A 3K9QO 1QYDA 4E3ZA 1YGYA 1N9GA 1K3TA 4MP6A 4WNCA 4F3YA 1YJ8A 2AQHA 4M89A 5FWNA 1WW8A 3TN7A 1ISGA 1X1EA 1RYDA 2AEFA 2EXXA 2I3GA 4LW8A 4IDBA 4E12A 4R51A 1QYXA 4LVUA 3H9QA 3JQBA 3U4IA 4BOYA 4ZHSA 3NT2A 3QA9A 4BKRA 4H16A 1E3IA 3L4BC 4BV9A 5JNLA 5IDYA 2BGKA 3H65A 3HFGA 4WOKA 4OOFA 1B8UA 1SO8A 4RZIA 2PA3A 5F21A 4XJTA 5JCXA 3A28A 1K0UA 1KEVA 5IDXA 4M1QA 3ZWVA 1GD1O 4PLVA 1F12A 3RVDA 3FHLA 3AOGA 4R3WA 4YJDA 5DOZA 2C2XA 4R3NA 4DC1A 3IP3A 4QO8A 4XYLA 1EFLA 1I3KA 1SC6A 4GQAA 2JD1A 1EUZA 1V3UA 4XRRA 5BNFA 1C1DA 1HDCA 3HZZA 3WR5A 1CRWG 2CDCA 2GN9A 2GCGA 5I9MA 1GEEA 2AW5A 2VUUA 3GUCA 5BSHA 1JKFA 4PVCA 3MJTA 1WNTA 3NDJA 3DZBA 3PHJA 4CM3A 1Z45A 5DF1A 5L7TA 3I9KA 3KLPX 1E7MA 4NG5A 5CDSA 1TA4A 2VWHA 4QUKA 1T4DA 2DU8A 1NR7A 3D3WA 1KETA 2WYVA 2VT2A 1P1FA 3GQVA 2O7QA 4R4JA 3ZHBA 3ZN2A 2VUTA 3JQ7B 4NPCA 3VAZA 3X2FA 3OJEA 4E2ZA 1PJ4A 4Z0HO 3SXPA 4YAGA 2VZ0A 3I5MA 3RJ9A 4OO3A 3U4DA 1MX3A 5B37A 3RC9A 2ZTMA 3R3JA 5EINA 3ZHZA 4LGVA 4YAEA 2OORA 2VHWA 4NZ9A 3K6JA 3DFUA 3LF1A 1KS9A 3LDHA 3JCZA 4MVJG 4Q9NA 3Q9NA 1R16A 3VH3A 2GSDA 2R2GA 1I36A 3QIVA 4B8WA 3B20A 1MFPA 3FBTA 3D4OA 3ZWNA 5G4KB 3RD5A 1GADO 3K2BA 3ZV6A 1VL6A 4D46A 1VM6A 1H6CA 1VSVA 5EIOA 2EG9A 3JD3A 4E2YA 5KJCA 1OMOA 3DTYA 3G1UA 4TZTA 3GVPA 5DULA 2VWPA 3V2UA 3UH1A 4BNWA 4IQ8A 1NVGA 2DFVA 3PXXA 4M87A 3DZGA 2IXAA 2HMVA 2V7PA 3FF4A 4IJUA 1KEPA 1YB5A 4FFRA 1A27A 2GN6A 4DYDA 3S2GA 2PD4A 2ZIZA 4I9UA 1PEDA 2QZ9A 3WSWA 4MVJP 3B6ZA 4A0SA 4LRSB 4XRGA 3JQAB 4ESOA 1ADBA 5BNTA 4B7CA 3LZ6A 5CP8A 4ND2A 5JMPA 5MGBA 3GDFA 1WDLA 1U9JA 5I8WA 4EEZA 3NKLA 4MINA 1CF2O 4TRNA 1WVGA 4HFRA 4IMRA 5BSFA 3JQ9A 4JBGA 4E5MA 1J4AA 4RPLA 3DAFA 2A4KA 3UKOA 3WFIA 1DIBA 1BVUA 1ID1A 4OKNA 3A4VA 1X15A 3JQGB 2XXBA 5DNAA 5T57A 3WXBA 2ZQYA 4CV2A 3STHA 3GZNB 3GK3A 3AI1A 5FI3A 4DQUA 1VSUA 3SJ7A 1PL8A 1OAAA 4TKMA 3PGXA 3PFFA 3GR6A 2VHYA 3WX0A 1GCOA 2W2LD 3RUIA 3OEWA 1BXGA 4IBOA 4WKGA 1O9BA 4L75A 2Q45A 2GDZA 2GNAA 5DDIP 3SLGA 4MVJF 4QSMA 3GH3A 1LDMA 2PR2A 1FDWA 1EFKA 1W4ZA 3RQSA 4NIMA 2V6MA 3R0IA 3BTVA 5JW6A 2VYVA 2PWZA 3IAHA 4O5OA 4ALMA 9LDBA 3BTUA 1ZNQO 3DAPA 3JQCA 4DYVA 4PG4A 3ONFA 4I5EA 2PZKA 3JV7A 1CWUA 4IDEA 4GVXA 4BQRA 3ZWCA 4YAJA 2ZKLA 5A03A 1HDZA 4LCJA 2HMSA 1PGPA 4CLOB 2ZB8A 1T24A 3DZFA 2JD2A 4I9HA 2IZ1A 1O5IA 1PJCA 1GZ3A 4TVOA 3IJPA 2Q46A 3OA0A 4OXKA 4CQMA 1F8GA 4RORA 5C7IO 1Q0HA 3TNLA 2Q2VA 4JP3A 3H2ZA 4NK5A 4AJ1A 1E3WB 2G76A 3WGHA 3IS3A 2FPIA 4WLNA 3ENNA 2PV7A 3S2FA 4R1SA 5L45A 3GMSA 3GVCA 1BXKA 3DBRB 3DR3A 1H6DA 2AE2A 5JDIA 5C7OO 1YVEI 2X9GA 2J8ZA 2RHRA 3FD8A 1KVRA 1EEHA 4G5HA 5U1PA 3HNPA 1T1RA 5HBRA 4OSOA 2J5QA 5F5LA 3MJEA 1SZJG 1GL3A 4N54A 2Y93A 4YPOA 1Y8QB 2ZB4A 4FN4A 3FCOA 3I1JA 2A35A 3ST7A 1VJTA 3UCXA 3UICA 1IUKA 5EN4A 4ND1A 3H3FA 3PJDA 3HHPA 2OHXA 4NH4A 1X1TA 1AE1A 4BVAA 1X0XA 4YBZA 1ZMTA 1HSZA 2W98A 1P9LA 2BMAA 1HTBA 5EESA 4EYEA 1PGJA 3ZHXA 3GRPA 4AJ2A 3DMTA 3D5QA 4XYMA 5L3ZA 3ZWOA 3NGXA 2HDHA 1GU7A 3IJRA 4BNZA 2G1UA 5G0VA 5CAEA 1U4SA 3MCVA 1PWZA 3OJLA 1Z74A 2FN7A 3T7EA 4EUEA 4ZD6A 4XX0A 1VPDA 3E5RA 1DC3A 1UXHA 4PLZA 1GUYA 1IHXA 4RF4A 5KWEA 3P2YA 1PJTA 4FOOA 5KJFA 5TT0A 4JIGA 4WGGA 1WZEA 3LU1A 4LISA 4OHUA 2NVUB 3ROQA 2VYND 4GX2A 1ZZEA 4MVJA 4OM8A 3PDJA 5JYEA 4QT0A 4KQWA 1FF9A 4PZEA 3GC6A 1H6AA 3NEPX 3BTOA 3IKTA 1J6UA 1LJ8A 2P91A 4KWHA 3BMOA 5JY1A 1I33A 3BMQB 3ZHYA 2WD7B 4WE3A 3JQ6A 4AJEA 3AUTA 5JC8A 2GPTA 1R4NA 4EJ0A 3VOSA 5HTOA 4RPKA 5A04A 4PCVA 4JNKA 4Z9FA 1ADCA 3P5SA 5KVQA 4XJSA 2GGSA 2ZTLA 4E32A 1HT0A 3GHYA 3TL3A 1I3NA 2VNAA 3K30A 2J5KA 4IGFA 5CEEA 4Q3BA 3INGA 3PIIA 2IYPA 2P9GA 2UV8A 1LDYA 4E2XA 1T2CA 3E9NA 2IEBA 3FTPA 5CDGA 3ZH2A 3U49A 5FEUA 3IIEA 2O2SA 3UAGA 4XGKA 3IOYA 2VRCD 3HN7A 2YY7A 1G1AA 1WAMA 4Y6RA 1DAPA 1UP7A 4MVJE 4TSKA 4IZHA 4WPGA 4KDFA 3W4KA 4CR7A 3LK7A 1G0OA 3NT5A 5JAZA 5COQA 2BGLA 1GPJA 1MV8A 1LXCA 3QVOA 2CSUA 3HN2A 4RVSA 3BMNB 4B4WA 1Q7CA 2ET6A 3GGOA 1LDEA 2NTJA 1WLYA 2G82A 4C4OA 3BHMA 3GVHA 4D7AA 4FR5A 1L1FA 1U5CA 4AJJA 3UXYA 4D44A 3KYDA 1YBVA 5CPFA 2DVMA 4RJTA 1KC1A 1T2AA 3D0OA 2ZQZA 4D42A 5L4NA 2X8LA 4RQUA 1NFRA 3KSDO 4Y67A 5K0ZA 2JAHA 4CMBA 3ONDA 4FS3A 1Q0LA 4F46A 3ZNNA 5LC1A 4A26A 4GPD1 2NU8A 2VT3A 1DDOA 3ASUA 1TXGA 1E5LA 3SX2A 3TL2A 4CLXA 3EK2A 4FQ8A 5A9TA 4E5YA 5DCYA 1HF3A 4BNMA 3CKYA 1LDNA 3UHAA 3DB2A 4B7XA 2W8ZA 1YL5A 5HM8A 1Y8RA 4YRBA 3P7MA 4BNFA 2PY6A 4JJFA 1MUUA 1WP4A 2GASA 2PTGA 4G2NA 2FHSA 1C1XA 3DMYA 1KY5A 1GR0A 1NVMB 3UVEA 3FPCA 3FI9A 4ALKA 4DVJA 3R6DA 1E6UA 1WDKA 3FNGA 4DLLA 3GGPA 3U4HA 2FP4A 1ENZA 2D2IA 1HEUA 4Q3NA 3OJ0A 2YUTA 4OQYA 5T5QA 2W2KA 3BYZA 2QX7A 1NVTA 4BGVA 4PFJA 4PG5A 1P0CA 3E1KA 1ZVMA 3SBOA 3O8QB 3HWRA 4YJGB 3AY7A 4PLGA 3PYXA 2OOSA 3DZKA 4WCFA 2NV6A 1P77A 1V35A 4XQ9A 3WDSA 4B4OA 4PLHA 3NTRA 4I1IA 1R37A 1P3DA 4CR8A 3S2IA 4CV3A 1BVRA 2P68A 4JQCA 5H83A 3BMCA 1ULSA 1L7EA 1YWGO 2P2SA 2DPGA 2Q4EA 4FJ2A 4JBHA 1ORRA 3GZ4A 1CQIA 3L6DA 3RUCA 4J0FA 4DRYA 5A9RA 2A9FA 3QQPA 3RC1A 1QYVA 2FR0A 2PD3A 3WMXA 3JYLA 2Q49A 3H8VA 1LLUA 4WJZA 2O4CA 4GMGA 3JYQA 1D8AA 4MIOA 4CQLA 3UCFA 3ANLA 3B1KA 3ENKA 3PYMA 4BNKA 1T2FA 3VH4A 3W6ZA 4PGFA 4DMMA 2P9CA 4Q39A 2BHLA 1AUPA 4CUJA 5CPBA 1I10A 1WPQA 1Z7BA 4O59O 2YW9A 2XOXA 4HV4A 4NNJA 3VZSA 5TRTA 3BHJA 1V9LA 3B70A 4QX6A 2EKQA 2Y1CA 5ER6A 3FSRA 1BW9A 3FNEA 1HE2A 2NU9A 4HNHA 3BZUA 3Q6IA 1TLTA 1Q0QA 4FFOA 4IDCA 5I7EA 1XR3A 2X0IA 2ZYDA 2P9EA 4CL3A 4L0QA 4W7IA 4Y98A 2FOIA 3CMMA 1EDZA 3IQDB 4QQRA 4J1NA 1UDAA 4OKIA 3DHYA 1TVEA 2J5RA 5JE8A 1LC0A 2G0TA 3OSUA 1NBOA 1MP0A 3G17A 2F00A 1ZSYA 4IMPA 1NXQA 4J2OA 4MPDA 3FRJA 5AXCA 5CHEA 4RLSA 3F5QA 3OA2A 1ISHA 4YJHA 2WYUA 3COSA 3PZRA 2QIOA 4CM1A 5ES3A 4ZQBA 3NDIA 3RFTA 5IAAA 2X0JA 4UVIA 1C0LA 3DZHA 4AJLA 1ZK1A 3H5RA 1ISJA 4E13A 4ZRMA 3N58A 4WEOA 4JXKA 3RUFA 3SC6A 3QVWA 1GQ2A 3KETA 4XB2A 5JDIC 3DFZA 3ETDA 4RF3A 1HE4A 2X58A 2HRBA 2Y1OA 1VL8A 3WFJA 1YDWA 3ZWWA 4YB8A 2J3IA 3F3SA 2V65A 3OIGA 2JCXA 4J90A 4XDYA 2Z95A 4D45A 1ZCJA 5JY6A 2JL1A 4ZRNA 1ZH8A 3AM5A 3D7LA 4TQGA 6LDHA 1B7GO 1NP3A 2BGMA 3PQEA 1BMDA 3U3XA 4NQZA 1QYWA 4A2CA 3CPSA 3NTQA 1QV7A 4K28A 5JCJD 1B3RA 3RKUA 3VPXA 4ALNA 4CMKA 1Z82A 4NI5A 5DBIA 1T4BA 2ZB7A 4KTTE 3U4CA 3Q3CA 3VKUA 4CM5A 5HRUA 1BGVA 4OSPA 3U62A 4RGBA 3E18A 4FW8A
chains in the Genus database with same CATH superfamily
4V2UA 1MAUA 3ZQUA 1V1RB 3GA0A 5JAPA 2WKPA 4B2PA 3C48A 1HEYA 1R4ZA 1IZZA 3I01A 3R3VA 3WRXC 2HOQA 3MUOA 2XIQA 1Q1BA 1ZUD1 4AX4A 4HX5A 5FULA 2OVBA 1SC1A 3HM9A 3W3AD 1L3CA 2JIDA 3PNMA 3K1TA 4NVRA 3N2EA 1UM9A 1YNSA 1M10A 1QXSA 1PR3A 1RQXA 4HDCA 3ZGLA 1C5KA 2HQRA 4HBGA 4EG7A 2R7AA 4UHDA 2OMKA 4B45A 3WYDA 3RIEA 1JLLB 2P1RA 5KWSA 1QM5A 3ER9A 4L95C 2X1LA 4Z99A 5FR2A 3UMSA 1QP4A 4A36A 4FE7A 4UHKA 4U7WA 5T8KA 1B0AA 1N0HA 1QPBA 1UZMA 2QD3A 2J0EA 3L82B 2A0WA 1ZJZA 3B82A 4LA4A 4DBVO 2VPPA 3GELA 1FRFS 3FYHA 4LYHA 3NPAA 3QNWA 1W34A 4N7RA 4GBMA 5A7GA 1N2BA 2AW3A 2FUNB 4IOMA 4MHSA 5CDTA 4MGZR 3O38A 1CYDA 4REQA 2B7LA 5F51A 2AG8A 4PHGA 1H69A 2A5YB 4BNLA 1T6ZA 2FDCA 2CBXA 4PS1A 2PT9A 2WPNA 1JA9A 1J2YA 2Z04A 2C7PA 3ZXIA 2IVZA 3FDJA 1SBYA 1U80A 3H5IA 3BXEA 3PU6A 3QJGA 4RAQA 4M7WA 3DMGA 3TLJA 2ZYGA 4HHEA 4WA8A 3H86A 3QVMA 3CC8A 4G5GA 1FRVA 2QUZA 4ILKA 1QWSA 5K8IA 4Q7MB 5CH3A 3LUKA 4LWOA 1ZM4A 1SR8A 4R8LA 2ODBA 3O73A 5CG2A 2QRUA 1RPZA 1M0SA 5KVCA 2BF4A 2REXB 3VSEA 1U5BB 1IL0A 2A30A 3PX2A 4JBNA 1NA5A 1V16A 2B83A 4ZT6A 4B87A 3U7FB 2JFYA 2Q5OA 4QU5A 1UOQA 3D6NB 1EQAA 5EE5B 5G1NA 1TM1E 1E4OA 4FCCA 3WGQA 4A8JA 1SK8A 3AJAA 3HCRA 5FBKA 3QENA 3AM4A 1BN6A 4W6ZA 5D7NA 1QAMA 2GKGA 2GFQA 3WLFA 3OTOB 3UENA 3HFRA 4OAPA 1CZRA 1FUEA 3DZJA 5EJIA 3RVSA 4DREA 4YREA 5J2UA 4TT8A 4RTMA 4FX2A 1MDFA 3G2MA 3SHVA 3FF1A 2FWIA 5DN9A 2ZSBA 1UBSB 4GLLA 4ZQHA 5ERGB 1GQQA 5IT4A 5AI5A 3VOTA 1I4LD 7GPBA 4ROSA 1H1TA 3UMGA 1RWKA 7ABPA 3D81A 2OZLB 4KN6A 4LVCA 4A0GA 4OMUA 4P8RA 4MV9A 4QUHA 4LSWA 4OYYA 4O4JF 2XDYA 3DMDA 3ROZA 1I4EB 4YDHB 2AG5A 1T6BY 2A1TS 2ZIXB 5L7YA 3GVIA 3VU8A 3GAMA 5IDVA 1GCAA 1A8UA 1JAZA 4LRUA 5EWMB 3THXA 3A6PC 4JYAB 3KTDA 5CB8A 3R6LA 2ZTVA 4RZQA 4P2BA 1ZRNA 1UWLA 4QU9A 4ZO6A 5E4FA 1NJ6A 4AS3A 1J00A 2C9ZA 2Q2WA 4WLFA 1CV2A 3DCNA 4NBWA 1HLGA 2J0VA 2A1IA 3CE6A 3R6GA 4QUGA 4QXPA 4K6CA 4O29A 3RM3A 2DJIA 5J59A 1WZCA 3PPYA 1Y7PA 2H7XA 2DR3A 2XMBA 4JB8A 2Q3JA 5CXSA 3U37A 2JGRA 3TZBA 4BC0A 4YJ2A 4B83A 2N47A 3PWSA 3K09A 4RA9A 1MIOA 2QMOA 4DTIA 4CF5A 3DEFA 1PG0A 3PQ4A 2WE7A 4YP6A 4HFNA 4RVHA 4DLNA 3WQRA 3NRCA 1D07A 1FB5A 3E0QA 3FFWA 4BMVA 3VNRA 2WIKA 3QI7A 2SCUB 4XFDA 5AHRA 2EBHX 1LPOA 1RP7A 1VPEA 1FMJA 4EMUA 1Q11A 1QOPB 1SXJB 2CF5A 2WJZB 4IJ5A 3V32A 1GVNB 3AUSA 5GMOA 4H7EA 3WL6A 3AKZA 3UV7A 1N3YA 4OFBA 1NPYA 1F1BA 4W5HA 3AVQA 1R4MA 1I2CA 4ENTA 1WW3A 2Q62A 1EBFA 4PAQA 1L5LA 3IVXA 2C2WA 2EJCA 1WIWA 1XB2A 4FKZA 3AEUB 2INGX 2F90A 4I2VA 3MJ4A 1N6HA 3URKA 3QPVA 2YX1A 4TS3A 4M8LA 3EXG1 1E58A 1CLUA 5HCUA 1TJNA 4WFIA 2YNMC 1VJ1A 4J7CA 3ZE9A 1H0KA 4KFSA 1Z4NA 1NVXQ 3EYAA 1XHLA 3ROMA 4DDHA 2ZM5A 1L4UA 1MX9A 5DN6D 4MQFB 4TUYF 1ECLA 2H8GA 1G7SA 4K9KA 4D79A 2YBDA 4NE2A 3QPBA 1BCRA 4LZJA 4ATNA 3F90A 4QUBA 3LT1A 4QBIA 2X23A 4HNTA 2GM9A 3SLKA 2XJ4A 5JSQA 5EUMA 4DNQA 4Q0MA 2WF5A 2FZWA 2QUHA 5AJZA 3FOCA 5FL7A 4GFDA 1R7RA 2YZGA 3M6VA 3I39X 3C6XA 1NTRA 4DCTA 2J6BA 3FGNA 1RHMA 3WL3A 1WCIA 2YUIA 4H0NA 4B46A 3KQLA 2KWIA 1A8PA 3BIOA 3T0FA 3CYFA 2CK3A 4I6JA 3WIUA 4N3GA 1GQOA 5ER9A 4L8YA 3DVAB 1RYMA 5JARA 1P6QA 3G9TA 3BL5A 3HKCB 1MC5A 2OLJA 1EKXA 2GUWA 2R68A 3K9NA 4IVPA 4YA6A 4DIEA 2KB0A 3TVTA 2PKRA 4W5NA 2RMKA 1T4GA 3SKVA 1RTKA 1YZUA 1ZD3A 4JLAA 2ZYIA 5P21A 4CDMA 1CY0A 1LS6A 4EA8A 5INTA 2QY9A 3HKBB 4NZZA 2NZ2A 4CEIB 5CA1F 3EXEB 2C77A 2YFQA 4J0EA 4Q4AB 3KLNA 1QF7A 2UZ1B 4BXOA 5FOQA 3VDQA 3W9BA 5C8ZA 1NMSA 4KITB 5HGXA 3OU6A 1BE1A 3QEAZ 5JROA 2HRCA 3RBVA 3D8RA 2BFEA 2YWBA 4BMOB 3T1TA 2BFMA 4XOUA 3I5YA 3ZK9A 3NHUA 3ZKWA 3DBHB 2PTHA 1M1NA 1XJCA 2QAJA 5DWQA 1JHMA 3PE4A 1K6IA 1P5JA 4NCKA 3Q9LA 1WPGA 4R83A 4X84A 5L95A 3VTAA 2COKA 3W6UA 5DHQA 2G1KA 3L6BA 3A1EA 1ZNZA 1LLFA 2FSHA 3AEXA 3PEWA 2F2TA 2ZW9A 3I0ZA 3IPCA 4FQ5A 4WADA 4QATA 1JEYA 1TMKA 4HXGA 3GYGA 2E18A 5KX5B 2P6OA 1T4CA 1YS4A 1KFCB 2NTEA 2W4QA 3KBOA 5H80A 3EAGA 1G2IA 2ECPA 4ESVA 1U8YA 1XZGA 4BV2A 1VYUA 4EJ6A 3R0XA 4EY4A 3SBEA 3WK8A 1JW9B 2C04A 3STXA 1D3AA 3ZLVA 1YBMA 3IB6A 4RCYA 5FR1A 2CF6A 2ONYA 3H11A 1ZNYA 3FIJA 4H3VA 1CY2A 3OFVA 1CEYA 2I8AA 4GO1A 4I3GA 2P2ZA 2YWHA 4LBWA 1D4OA 4W1PA 4FFBA 5BPFA 2O3TA 4IH4A 2WNSA 2WTAA 3ICPA 1L9KA 1ZM2A 4TN5A 2OGUA 4U2CA 3N2KB 1KQNA 2PKEA 4LDAA 3HYNA 1SOMA 2A1UA 2IEZA 2KLBA 3E82A 4B43A 3UK6A 4D3FA 1BU5A 2BKAA 4LF4B 1XZAA 3A2MA 2W6ZA 2Z43A 1AKNA 5DTQA 1IWOA 1YUBA 3JS5A 3ERCA 1HMPA 1WMSA 2MWMA 1JLKA 3MTIA 4HPWA 4QU8A 1K75A 5ENVA 1TW2A 4OYLA 4MWEA 4ZAXA 2PBZA 2Q5FA 2FXVA 1SC9A 2PH5A 2VTVA 2J9YB 2V6FA 2X41A 3V1UA 2H1HA 4OJNA 5LYJB 3F46A 2DLNA 4I50F 4QO7A 4V3CA 2VJOA 3OX2A 5CX4A 1G5HA 5KQRA 5JO0A 4FUQA 2R0QC 2WIJA 1O87A 1Y5IA 3WI7A 2WVHA 3JQQA 2OQVA 3AVYA 1R27A 1A9XB 1V8PA 4H7IA 5ALZA 5D5QA 2IWHA 4DLZA 2XGMA 5FFNA 2ZYVX 2KM1A 3WNBA 1NL3A 1G7CA 1DCMA 1I32A 1B74A 3ZBUA 1B00A 2TMGA 1ONNA 3G0GA 4JLMA 4LDNA 4CDNA 1QLHA 3JD0A 3VNUA 1TT7A 5AW2A 1SXHA 1FFSA 1I7QB 3I23A 1RE0A 2YNMD 5JAMA 1NVUQ 4L0MA 4D56A 3QPDA 4PQGA 5KYNA 1N3BA 4MPPA 4QPJC 4WX2B 4BPBA 2Z6QA 3LTNC 3GJTA 3ZQJA 2NSHA 2GEKA 1UPBA 1JDNA 2B30A 4NR0A 4PRLA 3RNOA 4KRGA 3F0TA 4HH0A 5EIAA 4CDGA 3VMMA 4EPVA 1FDTA 3KJEA 1GKYA 2ZRJA 4HH1A 3RFXA 3S2ZA 2RG1A 3ZD8A 3RSOA 2DCMA 3EZLA 4ENWA 4HI0E 4UUBA 4Q3DA 2FUEA 4YXWA 5A4KA 2XQVA 5ALNA 5AESA 4TYWA 3ANNA 1N8TA 3KQPA 1BE6A 1HLDA 4RW0A 3HCDA 4DIDA 2WKSA 1GSHA 1MFZA 1CU1A 3A9CA 3EASA 4BGIA 5GADl 4GLFA 1WNFA 1P1IA 1XQWA 4FMDF 2UVPA 3MWDB 1UDWA 4RZ3A 4MYSA 2ORVA 1MRNA 1II0A 2V7VA 4FTWA 4Q7KA 3HB9A 3NAZA 5DRTA 1CS4C 1OZAA 4AD8A 3C7KA 4BQOA 4HN9A 1XDSA 1ODJA 1PL7A 5JXIA 5EJEA 3I0MA 5ALYA 2R97A 3I04M 1E1CB 3M0EA 4O4HB 5K8LA 1ECBA 5IBQA 1XDDA 3ZX4A 1WBDA 2HO5A 1OREA 1ZN8A 4UBJA 5JPIA 3FUTA 1DIOB 3Q15C 2G36A 2JGFA 2Y92A 1ZC3A 1VPLA 5AI0A 1U7XA 4BLPA 3R0VA 1CR0A 1D6JA 3RU9A 3ZXXA 3OQIA 3ZVRA 1CRPA 3IUSA 1PAUA 3Q3HA 4L4RA 1TYZA 2CC2A 4F84A 2NYAA 2AXQA 1Q1ZA 3ACCA 3B9QA 3TDKA 4Z6KA 1SKBA 3KM0A 3AEKB 5IJWA 5MF6A 5TPZA 3PJEA 2DG2A 1SULA 1UK9A 3TQFA 3H4IA 5TQ0A 1GTZA 3EYWA 3WHIA 1TCUA 2GRUA 2FFRA 4ZOLF 4ER7A 1X7DA 1KMHB 4E3WA 3UKJA 4ZO9A 4GM1A 7REQA 4Y2YA 3GEIA 1EJ6A 1MGPA 1THGA 2KSQA 3GFGA 4YMSA 5JJIA 2Z98A 5KMGA 3GWGA 1Z33A 1YF3A 4OQFA 1F3OA 4OQLA 1PSDA 4OHBA 4NOKA 1L8AA 1IOZA 3WB1A 4NS4A 4U7TB 1PK7A 1AZTA 2C00A 2YXNA 2ZAOA 4M4SA 4DC0A 1G9TA 5T3YA 1A0OA 4UHFA 5HQTA 4XW2A 1NJFA 2YJTD 4F7WA 1NF3A 3HYSA 3QX8A 4GLOA 2C92A 1SKUA 3VR4A 1E98A 3EZ2A 3JQBC 4M0PA 3E8SA 1RWBA 5AW6A 4MRNA 2AFIA 5CIQA 3HI6A 2O8VA 2XGOA 4QDJA 4CLOA 1FX0A 1Q3TA 5IZ4A 1QE3A 1P0FA 1LDBA 3FN4A 3LK6A 1E3SA 1ULUA 2L0XA 2YL2A 3QXCA 5I7FA 3F9RA 1HFWA 3E23A 4CI9A 4F9EA 1YFJA 1GA1A 2QZ4A 1WF6A 2HCFA 2WG1A 3G23A 3PEVA 4KN9S 3DZIA 1P9RA 3PC3A 4M7OA 1G5FA 3KDSE 3PQCA 3K70D 4U3JB 2ZIVB 1PS8A 1W47A 1LPAB 1YGPA 4JVMA 1NHGA 4CFSA 2PKYX 3OMXA 4W8GA 2ZXUA 3SYKA 3QWAA 2CDNA 2PXXA 1B14A 4W5JA 3T3MB 4CKEB 3TOXA 5EE9A 2TSYB 1DMRA 1Q92A 3KAQA 3KX2A 4GDMA 2Q5LA 2H1IA 3EPRA 3X1YA 4C3ZA 2X6TA 5KTKA 1OD6A 5MN6A 3LNTA 2NUPA 4RQAA 3VKVA 2EU8A 3N8HA 4E08A 1H93A 4FXPA 4WVLA 4D5GA 1GGEA 1RXYA 4KGVA 2QK4A 4LI0A 3F73A 1BCSB 2XTJA 4L3OA 5AVJA 1C8KA 4J3JA 1U0LA 2J41A 1YB6A 1P0QA 1MENA 3MF4A 4DGQA 4RIIA 3JD2A 1N8SA 1Q2XA 5AIBA 3G5MA 2D2FA 4EVIA 1JXAA 2R7NA 1OX4B 4PAGA 3WBKA 5BN4B 4TKVA 5KTRA 1HOXA 2Q6TA 4RWZA 4QULA 1BAPA 4B8YA 4IUYA 3B85A 3FB4A 4DV0B 1M5RA 3FMGA 1DC6A 3GRRA 4NCJA 4UPDA 4LHVA 1G42A 1GARA 1U0SY 1X19A 1Z4JA 4V0QA 4BKUA 3R44A 4M1KA 3G85A 5E6UB 5AOBA 3RKSA 4DLAA 1DOZA 1QJCA 1WVMA 2NQ8A 3BL8A 4MYHA 1W35A 4RZ2A 4TL7A 2Q3MA 4P4GA 5ICGA 3A27A 5JNSA 1OT5A 2W6MA 4CG1A 4M88A 2NQ2C 4MR9B 4D81A 3GRUA 3N39C 5IXYA 3MINA 4JS0A 1YZHA 5AW7A 1TU0A 4IS2A 1QTIA 4AIIA 4P4TA 4IO0A 1WBJB 3WB2A 4AY4A 1Z4LA 2OXIA 1YFKA 2OD7A 3TM4A 2OBMA 4HCJA 1OBVA 1I2ZA 3F67A 3MG9A 4NMLA 4NX2A 1KC3A 1FRZA 4QYIA 5CH5A 4ZVVA 1O08A 4FBGA 3P2OA 2NV2B 2BZGA 3Q87B 3M82A 2AC7A 2Q28A 2BGUA 2FG7C 2Q9AA 2QI9C 3CRNA 4J1QA 4WASA 2C5BA 5K01A 3E3MA 3JATA 4OUKX 3TIVA 2C83A 4NULA 3C6YA 3D31A 4B2LA 4DB2A 4EZIA 4XLZA 4JC4A 3F7OA 5E6SB 3UFXA 2CMFA 4NWIA 4MA0A 5DXAA 5KBYA 1BDHA 3BMQA 1K6MA 2UUAB 4DPMA 2AK3A 3MAAC 1G9XA 3W5VA 5IVKA 1M2EA 5L3VA 1K08A 5IKPA 1X86B 4Y6SA 1BU8A 1KYIA 4LHZA 1I30A 2ZS8A 2A1TR 5HF9A 2EX4A 4RUKA 1GAJA 2FWMX 1JR6A 2BJHA 1Y63A 1N3IA 1YJAA 2ST1A 4QOGA 3DPIA 3FFBA 3SQOA 1VSTA 3JQ9C 1KDRA 2VPZA 4L02A 4U02A 2X0EA 1Q17A 3ZX5A 1TVMA 2HSEA 3AESB 3C3BA 4IEEA 1TTPB 2HWKA 1VIVA 3DTTA 4X8LA 4UXHA 1WB6A 7MHTA 4U63A 3PNOA 2P78A 4CR6A 5CK4A 3WDMA 1TMGE 3UV6A 4RY8A 2VQSA 4NBRA 5TJ9A 4BO1A 3C8ZA 1IDOA 1KBZA 3L3BA 1HNZB 4FE4A 4RA6A 1DPGA 3W5UA 4BL5A 4LXTA 1A9QA 3W5SA 5C35A 1D5WA 3W5IA 4A0FA 2JLYA 2W8BB 3NO4A 2OCGA 1BX3A 3QKRB 2R85A 3EBOA 4GMHA 2VA8A 4OLHA 1OYWA 4JOSA 3EGDB 1MQAA 2G5GX 4RLHA 1GEGA 3G2JA 2GUGA 2BMFA 4XYEA 4I4NA 5BYAA 2I4NA 1EUYA 4LHWA 1SIBE 3IO5A 3PLAE 2WF9A 5HKAA 1Q7RA 4FOSA 4I19A 1W0CA 5DCWA 5JNRA 4Q37A 1O94A 3RT7A 4QHSA 1SCUA 2YYZA 4QTTB 3RJ5A 4NU8X 4OXXA 4YRAA 3PHGA 1YDFA 1Z56C 1ULZA 2V9ZA 4E5NA 1ZEMA 1I7PA 4MIYA 4PU0A 4GU5A 4YROA 4MYUA 1GNPA 2JAQA 3W2GA 3EGIA 3AFGA 3H42B 3LC2O 1NV9A 4OF4A 5F35A 4ZZIA 1X2BA 3GLIA 2GDJA 4OHVA 1YR1A 4YMWA 4E09A 5K3CA 2I2DA 1DAFA 1HL7A 3GRKA 4XWTA 1HRDA 2X7HA 3AJRA 3BAFA 1SJ9A 2IHKA 5JFTA 5CJ2A 4W99A 1U28A 2WJJA 4RFSA 5D8DA 1CQJB 1UEJA 4UU8A 1IPEA 4X00A 5E9QA 3W2TA 1CNFA 4R9RA 3F47A 4KDEA 1U8XX 5I9TA 2NWQA 3VC2A 3QY9A 3O91A 2XLCA 4FFPA 5C8YA 4OUDB 3WHKA 1EVEA 1TVCA 4AUKA 2PZBA 2JFWA 3QUSA 4GBJA 4MTCA 2JLZA 4HF7A 1CNMA 1VI6A 2OBYA 3MLAA 1TLFA 4H0CA 5F77A 4F2GA 2XUAA 3GEBA 3TTXA 3QHAA 1T1SA 4NJOA 4Y1GA 1RXUA 1OI3A 1QE5A 2BSQA 1FXUA 3VOBA 2D8MA 1GL6A 1R0YA 4I4TF 2Y76A 5I45A 5FL3A 4ZHQF 4ND6A 2OZEA 2XCRB 1M34B 2FOLA 1MD9A 5LD2C 3ZBQA 1BHO1 3LW8A 5KWJA 3OT1A 3Q7TA 3B5JA 2X0NA 3GGJA 5IN5A 1QRUA 3SIWA 1S96A 1EQUA 1M8GA 1Y98A 4AY5A 2H4JA 3L0IB 3UK7A 1OLSB 1OWPA 4D57A 2YYAA 5BN3B 4Q4DA 1N32B 2PMBA 4QHYA 3U56A 4LF5B 4EX7A 3H75A 5EJ2A 3TLGB 1Y3FE 1QG2A 1Y1PA 2I7TA 5EUQB 1PNRA 4U4AA 2XNCA 4JI4B 4B79A 2VTEA 3OPQA 1QV9A 2BEJA 4YJGA 2X2OA 3NTOA 1S2NA 2JFZA 3PHLA 4TQAA 3R6WA 3I0NA 1MB4A 1T8SA 3DDCA 2ZIEA 5DK4A 4Z0TA 2P8SA 4WK0B 5AI4A 2XKKA 2HRZA 4LSMA 1REQA 1J33A 2R8EA 3PUKA 2EW8A 4LZPA 4MA4A 5IAOA 1ZD1A 4UUPA 1AS3A 1O6ZA 3QWFA 2DGDA 1FYWA 2OHOA 3KTAA 2AF3C 3ZE2B 1EXMA 4ZI3A 3DQPA 5C4IA 2WJYA 1JV2B 1G8HA 5U4QA 5EYPA 2XMDA 2WWFA 2MR6A 4UU7A 1GY8A 1ZKDA 4RMGA 2UDPA 1FRQA 3SC4A 3H9UA 3JWGA 1LJLA 5A3JA 1LD3A 4IG4A 5C4MA 2HBYA 1RI3A 2BISA 3GW8A 1FNDA 1UMDB 3L7OA 1JMYA 3K4HA 5AJXA 2Y68A 4UUQA 5CYPA 2I67A 4KCGA 3ZDXB 2I9KA 3C3EA 3OTGA 4WZBE 2AQIA 4GSYA 5SV2A 2C8VA 2ADMA 1KHTA 1SAYA 3QPCA 1D9XA 3ZYZA 4MUNA 1K97A 1N5KA 2VSOA 3DTVD 4C78A 4WTOA 1F8UA 2WD8A 4HUQB 1E77A 3D3WB 2XEDA 3G0DA 3HCWA 2WB2A 2W6IA 4BV8A 3VVBA 1S8NA 2P1ZA 2XMSA 2AFHA 3C2QA 1GJRA 1QQ7A 3A25A 1XE3A 2R84A 3EW9A 1D2RA 2O3UA 3KFXA 3ICOA 4H4EA 3ZK7A 2G8LA 4MS1B 2AJTA 3R5FA 4M49A 4YACA 1G2PA 1K3FA 4BNHA 1RZ3A 2CNOA 2P9FA 4F8YA 1IYZA 4HATA 2PXCA 4M6WB 3OQ1A 4JASB 4KX5A 3IEVA 1AQUA 4JMLA 2XNHA 2O4UX 3E3NA 2HJGA 1KK3A 2P6NA 3CY6A 4AO7A 4FJ1A 4RBNA 1X7ZA 3UJPA 3TW6A 2PZFA 2I2CA 1C9KA 1VHLA 4AJNA 4E1VA 2E4VA 3AUYA 3FPSA 5CNKA 5IVIA 4YCCA 2A0UA 1F0YA 4QDZA 3QLUC 1X80A 1R15A 2PT7A 1ABEA 5CVCA 1EINA 3ORRA 4R8SA 3KLOA 4RTPA 1SKQA 1US8A 1ZH2A 2QN9A 4RS3A 1KDYA 4RF2A 3L6EA 4TVSA 5SZIA 3ZWDA 2JLXA 1U9YA 2PZGA 4MWZA 4BVKA 3S29A 4BIIA 4CKBA 3ZW8A 1F1JA 5CEFA 4K6KA 2HWWA 5AQ1A 1PNOA 4X24A 1YE8A 4PN7A 1GV0A 2G9NA 4PEVA 2FEOA 2FX5A 1NQXA 4GOXA 4LQCA 5EG5A 4MAAA 2J59A 4AXXA 4Q6BA 4C0QC 4BMYA 1L5RA 4BFSA 1OYOA 5LBIA 621PA 2IXFA 1NT4A 3FPLA 4MCAA 1T91A 3LQRA 5T4HA 2F1RA 3ZV5A 2FG5A 4QASA 4TV9F 3OPNA 4G1CA 4P3NA 1LBQA 2IEYA 4M8IA 1VB3A 4ZVRA 3K05A 4B6FA 2D0IA 1S2LA 1BOOA 2IGBA 4IJKA 3T52A 1GRRA 2VHJA 3LQYA 2BH9A 3QWHA 4NMXB 1AV6A 3V7FA 2WUGA 2IRWA 4RCZA 1GOTA 1GGJA 3GARA 5HKKD 3UB3A 4AN1A 4E5DA 1W5EA 2O48X 1H9AA 1V1RA 3V8NA 2AGVA 3IHLA 1MF7A 3K1AB 3KVOA 3D4NA 3EN0A 2A3RA 2VDMB 2HWXA 1M75A 4U7DA 1CQWA 2GN4A 1KJJA 3W5BA 4P7JA 3KQQA 3MC1A 2D7DA 2DB3A 4CLEA 1JIXA 1L6IA 1QIHA 4KJXA 4W5OA 5IAKA 4D9GA 2QL9A 4V0NA 3I52A 4FMCF 3PVZA 3CVOA 2ERCA 4H7PA 2G67A 4TX1A 3UMCA 3QQ5A 1M34E 2B3TA 2YJZA 3O83A 3NGMA 5F2OA 5JCOA 3LBIA 2ZR9A 1CG6A 4KIGA 4CM9D 4N47A 3AR7A 3FGOA 1JLLA 1NYQA 1LK7A 3NEYA 3M49A 1DBRA 5F73A 3A6HA 2P27A 2HM7A 3VDNB 1R8QA 3O9VA 1GPNA 4QU0A 3L6OO 4GMFA 2P6RA 4JLWA 4WY8A 4KI0A 4U0KA 3FXAA 5M7EA 2EKDA 1PJZA 3QUAA 3CVVA 4P4NA 1Y4DE 1Q1QA 3W4JA 1CKEA 1SUCA 4OGKA 3OQJA 2FJUA 1M5TA 5IM4F 1Y8ZA 1AGNA 5K3SA 3ADCA 1A72A 3DDOA 3C3JA 1V3TA 2RBEA 4ZTBA 3ADBA 4MDFA 4W63A 1RMYA 1W4CA 2XB4A 1E60A 5FLYA 1WB5A 4RIEA 3VNAA 1W0JD 3NHMA 1GT6A 4N7BA 3IRUA 2VDKB 4NYJR 2RGGA 4B3DA 5KSZA 3L46A 2LD4A 2IYTA 1DPFA 3HRHA 1PQWA 3VHRA 4XQ0A 4P08A 4XGIA 3AR6A 3QIAA 4ZI5A 4RM3A 2DPMA 4GRDA 1LFDB 4Z9YA 1QQ6A 3LA8A 1TKCA 1G7TA 4XPZA 2HGSA 3HPRA 5BRNA 3ND5A 4R2WA 1U5BA 2AZDA 1CIJA 2D1RA 2I6GA 3EQZA 5DZSA 3CS3A 5TQ2B 3V3TA 5DOVA 2H07A 3DEAA 3F7TA 1ZI8A 5AKGA 3M4JA 2CEKA 2L2QA 1DKLA 4AMBA 3AU9A 3GJ8A 5KU1A 2CLCX 3U9LA 1IU9A 4UE6A 3A04A 2BUBA 4E51A 5AVVA 4Q3CA 5TVKA 3RTDA 3SHOA 4N03A 1NR5A 1M6EX 1RKBA 4HAXA 3LOUA 3OAAD 1NTOA 2ATCA 3AFMA 3L1UA 3P27A 4P38A 4O6VA 4RLQA 2CNBA 7AT1A 2IE8A 2QN3A 2H08A 5EGSA 5T3UA 2EFDB 3KNZA 2QT9A 1MOPA 4M98A 4MR8A 4S1VA 5K8CA 4YAFA 4BMCA 3MMNA 3FCUB 1KIMA 4MUYA 1DKUA 2NVBA 2EZ8A 4CMCA 4OI1A 3A06A 3A6FA 4OVKA 2W6JA 4KBYA 1VLMA 2CVQA 3PCXA 2CLSA 4WGFA 1KZGB 1NVKA 3GB9A 4I46A 3KWFA 3FVQA 3MGGA 1LW6E 4GKJB 3SCZA 5EWMA 4GSLA 2I65A 1RW4A 1KYXA 1SNYA 1YK0A 4M22A 3TSOA 4DGSA 3RS8A 4PTLA 3B2QA 3L49A 5JMWA 3AF5A 4E1BA 2XRFA 3DUFB 3NJ4A 1KK2A 5JD6A 2LXNA 3SMVA 1II8B 5KYGA 3KB1A 4UEKA 2WUFA 4LZZA 5HFNA 4HGOA 3LCCA 3B3FA 2J6HA 1EHIA 4LCEA 1EZZA 4G25A 2M2IA 4XLTA 1U11A 4INOA 5DMHA 3H18A 3V80A 2AXEA 3GRYA 2DBZA 1QHEA 3HKEA 1Y5MA 1N8KA 2JH3A 3QHPA 4H6WA 4JZYA 5H3LA 5HK9A 1HE3A 3HB0A 1I6LA 3GGGA 2XZTA 2QM0A 1H94A 2AH5A 2SCUA 3ACBA 1C3JA 3LXXA 3M5WA 1XAJA 3ZH9B 4DEXA 1TJ5A 1XD2B 4IKEA 4L8VA 4DCNA 5JNVA 4RANA 5FOVA 1Q50A 5LJLA 1SXJA 5JH7B 3BBPA 4RULA 3U4QA 2V98A 3OWXA 4FZ5A 3PD1A 2FSUA 1MAAA 2Y77A 1L4HA 4TLEA 3SE7A 1E1MA 3OCVA 2Q07A 2Q6IA 1R4NB 4FGSA 4P33A 4EHIA 4ETIA 1TA9A 5ERYA 2VSQA 4MWOA 2B82A 2V54A 1T8UA 1X3SA 4KH1A 4R1UA 4XD2A 1KSHA 1UZNA 3AEUA 3CEHA 3O3CA 1GPH1 3S28A 5KS2A 3EA0A 1KQGA 3D8NA 3DHWC 4ZQGA 5CA0B 3CURA 3G13A 4I5DA 5JAQA 3CX8A 4LBVA 1P60A 1P44A 4CV1A 2X8WA 1N33B 5TARA 4ID3A 4HB0A 8MHTA 1ODKA 1KI8A 1T5TA 2P8JA 2OM6A 2ZWAA 5JJCA 1P17A 1H0RA 2AVNA 3P94A 2JHAA 3DXFA 1JTEA 3B1VA 3E35A 4PR3A 3FJYA 1RI1A 3B6EA 1P33A 1YBAA 2IZ7A 1PO7A 3RSGA 3NHSA 5BV2P 3GD5A 3B1FA 5ALKA 5ESRA 3R3XA 3MUNA 4A8PA 2HZ7A 2EZUA 3O3MB 5DB4A 4EPTA 3GLRA 1GDDA 3TIIA 2BCJQ 3QV2A 2YFHA 4JBWA 4RTSA 3WQSB 1XALA 2OFXA 2R1UA 3DVAA 1MPXA 2CXSA 2XT6A 5IPFA 4PS0A 4XASA 1OILA 3EUWA 1YACA 1R4AA 1RKXA 3HKCA 3MZ0A 5HVNA 2Q4TA 3SSAA 2D6FA 4M76B 1FJXA 5K2OA 5FJIA 2DLDA 4PC6A 3TQOA 3O31A 4IJVA 1CUJA 1Q77A 2HFKA 2NLOA 4X6LA 5EKXA 1OLXB 2HEGA 1OOEA 2BM0A 3ED5A 1X7GA 3HKBA 1O0SA 1P39A 4CEIA 3EXEA 4HQ0A 5ALTA 5DSTA 2G08A 4Q4AA 3RFCA 4DEVA 2UZ1A 3LT2A 4ZZ0A 2OYSA 5T8KC 1V11B 3GZJA 1GSAA 3N8IA 4UM9D 4EMTA 4GPZA 3IEKA 3DYVA 2D7JA 3M1AA 3CU5A 1CJTC 1YMUA 2CD7A 3ZIAA 4AY2A 4ZN6A 1UFRA 2WA2A 1VG0B 1DTEA 2FPMA 3IQEA 3DBHA 3OLWA 4NAHA 2QVXX 5LYYA 3IUPA 4RF5A 3AW8A 4DAOA 4K26A 5LR6A 3OU2A 1SQ6A 4XCQA 4HDRA 3WQHA 3JQGA 2G06A 3E6AA 4TLAA 3KR2A 3FPAA 3ANXA 1QBKC 5FYDA 3PXEA 3AHGA 4U2DA 2E2WA 4X93A 4YN3A 4DMKA 5EWJB 4EJ2A 4TTIA 1RR6A 2JARA 1MA3A 1VSQA 4G5FA 5JS2A 3UG7A 2PSJA 4B6GA 1C3LA 1DX6A 1A9TA 4V24A 4X45A 3U0VA 4FHZA 4F2PA 2HT1A 2MSKA 3BJIC 1NLMA 1VKOA 3AHEA 3DKKA 5LCXA 4AZWA 3QMPA 2IZ5A 1IC6A 1Z8FA 2Z9BA 1Y3AA 4EG6A 1VOTA 4PZUA 3L9XA 2AKAB 4G8CA 1E5QA 5EL0A 1QHIA 3FVVA 4A8JC 2H85A 1XU4A 1J1UA 1RYEA 3G49A 2D1QA 3PNVA 4TMTA 4BATA 2ZBUA 2VP9A 4PNPA 2HU5A 2D8AA 2WJAA 5MGNA 4QUJA 3N2KA 2FP4B 3CNLA 1ABFA 4GZMA 3HDVA 1VKZA 4BTVA 2B8NA 2D0OB 1F2UB 3EY4A 3AUAA 5D1HA 4PZCA 3K0KA 4I4LA 2ERXA 3UA4A 2QJTA 2RARA 3LC1O 5GAJA 3CH6A 1W88B 4U9UA 4RC9A 4BN5A 1WU8A 2Q3DA 3Q0IA 3R0ZA 4FYVA 3OQBA 1C7JA 4MJLA 1I6WA 2C4MA 1U7OA 3HP1A 3G8BA 2OPHA 5LYJA 3KZKA 4C2TA 1F8XA 1NLFA 2QRNA 4KP7A 4AJKA 3SOZA 1QGYA 2AT1A 3BN3A 4R2XA 5FLKA 4IDGA 2FW7A 2P4QA 4DKJA 1VBFA 4L6CA 1MBZA 5A1JA 3HJCA 3EIWA 1CF9A 5CXQA 4KPEC 3FNFA 4DJ5X 2WOJA 4URVR 1W8IA 4OKSA 1CUCA 2JDID 5TXGA 2FLKA 2C5EA 1A9XA 2AE1A 3GLSA 1WS6A 4P2GA 2BGRA 2Z0MA 1YS2X 1IHUA 2BWJA 3L93A 4WECA 4ZOQI 1W8DA 2X2EA 3G0HA 3ISJA 3E03A 1GFWA 2O6HA 5IX8A 2IOQA 1E63A 1TQ6A 4PQRA 2I1VB 2ZE7A 1H6BA 2OK7A 1YHYA 4GL2A 2H59A 2VQ6A 3HB5X 4AMYA 2ZWVA 3D7KA 4K0RA 3V6MA 1MC8A 2AIRA 2JCVA 3K09C 1O6BA 2NXNA 3V1TC 4FPXA 1RJEA 2UZ3A 4GNKA 4M38A 4CQLB 2VP3A 2P40A 4EY5A 1BYUA 4AX8A 1ULTA 3OOEA 4AJPA 2QM7A 1QYIA 4A5SA 3ETEA 3P71T 2CLEB 4ETWA 1IZ9A 1SKMA 3PFIA 5EJAA 2WTBA 2AA3A 3ZJYA 4JKYA 1K7YA 5GONF 2GYYA 2NNLD 4FR2A 4UOEA 1L5QA 2JPDA 5H02A 4RK5A 5AK4A 4BKPA 1VRVA 2J3EA 3PPIA 4ZCTA 4KR3A 3RYFB 2G9VA 4CTJA 1XVLA 3L7YA 5COAA 4RSMA 4B3BA 1LSSA 3IP9A 3W8FA 3EZYA 1BFUA 1OXKB 4KWEA 4V0OA 3O93A 3TIGA 2ZWOA 3IR7A 3T5CA 1OTHA 1QOQB 3G79A 1RFGE 2FETA 2IPAB 4BIMA 2ZRQA 3MWDA 1OTYA 3LYHA 2Y1FA 1IY1A 4BTLA 1NUQA 4JLKA 1XTJA 3BXPA 2WHQA 4DSZA 3K32A 3KVNA 1A9ZA 2PU5A 2DM6A 3MRXA 1QZUA 4Q93A 2IDMA 4A8HA 1E1CA 1X38A 1X39A 2NXWA 3KLMX 1QIFA 3OEHA 1LB1B 2JFHA 3QU2A 4O4HA 4OMDA 2X9VA 4IXMA 1LQTA 3ABRB 1DC7A 2OHFA 3ABQB 3E70C 3WGMA 2O0JA 2QVZX 4FC7A 4N7MA 1WZNA 3AF3A 3O2JA 3AI3A 3OICA 3Q7RA 4IXTA 4RK0A 4CCSA 3H83A 5CT9A 3RRFA 4BE7B 3E7XA 5DCUA 5CFNA 2JG3A 3NM5A 3VNVA 3GI1A 3MGCA 3PNPA 3PVCA 4GHWA 3ZU4A 1TRKA 1KSFX 2JK0A 4X1OA 4L8FA 4QYMA 3WYFA 3ESQA 4DWJA 1CVRA 1RAIA 2PO5A 2V5VA 3U5ZB 2IZZA 5A5FA 1Y8CA 4HYTA 5JASA 2NAPA 3NH6A 4C76A 1U3CA 3VI3B 3LCJA 1D2EA 1Z5NA 3R24A 1Z6AA 1VLVA 3CH7A 1QIGA 4TLMB 5P8WA 3VZPA 1O0CA 2JS7A 4ERNA 5CDYA 1SUEA 4MW0A 2PBLA 1IJFA 1Z37A 2O9JA 4O2AB 4WVFA 5KNBH 1CX9B 4F21A 1T0HB 1V5FA 5A3VA 5AVRA 2Z1NA 2YKGA 1GTJ1 1B43A 3UAWA 3AKYA 3O4VA 3T9DA 1VKNA 4OD0A 3FY4A 1UBRS 4M8SA 5ELLA 5DLYA 1JKXA 1XZHA 2XGSA 4M1SA 4WLOA 4AJOA 3DMRA 4G23A 3TO5A 4CF7A 2X8JB 3B6IA 1V2GA 4PRYA 1C4WA 1ZQ9A 2D59A 3H4TA 4B73A 5A06A 1HSOA 5JISA 2N1BA 3HN6A 4JENA 3R3WA 1K2VN 1U2RA 1XRLA 4U8GA 1TM7E 4M55A 3RASA 3T4EA 3K0FA 2ZGVA 4RKEA 4B47A 4G1MB 3MBKA 3LSYA 2FLVA 4CL0A 3E8XA 4PIMA 1AQIA 1CFZA 4M9RA 5AJTA 3V3KA 4BJ1A 4DV3B 5J2TB 3EGOA 2AZMA 4TWBA 2NZXA 2IP4A 1YL6A 1K7CA 1DAHA 2QVLA 5K0FA 3CJQA 4QAJA 4U3JA 2FPGB 1Z5OA 2O0HA 1FDVA 2ZTHA 3ZHQA 3LTEA 5BOSB 4JYBA 5K3EA 3DE2X 4MQMA 1C0PA 1G2OA 3BMNA 1PLJA 1P3JA 1XWFA 4Q3LA 4RPHA 4QTZA 1KEWA 1N0WA 1HX7A 4KWCA 2NO7A 1T3GA 1XCMA 3ZU6A 4AJHA 9ATCA 3IVRA 3SQMA 3UJ3X 4B1FA 4TM8A 4YGYA 1ZU4A 4ARZB 5KZMB 3VDRA 3VR5D 4DBZA 1BCSA 3PTLA 3RWBA 3ETLA 3JQRA 1I5EA 3NLLA 4A2WA 3UYKA 5FKJA 4Z4HA 2C5HA 2NP7A 1SOUA 3BXZA 3L77A 3L79A 4HVCA 1EAYA 1KR5A 1OX4A 1W2GA 4QNMA 1OVMA 3F3YA 2NUAB 2ODPA 3CBQA 5BN4A 1OH7A 2VYNA 4JP8A 3IVGA 2FWNA 5HRAA 4AF8A 3RU7A 1PZGA 3SDZA 1V8FA 1ZP6A 3I6BA 1U04A 3NIWA 2L18A 5GP1A 3VO9A 4A2PA 4YX9A 5E0OA 2XOKD 4P3YA 1L0BA 4HGNA 1Q6YA 4UMFA 4IZ6A 4P3PA 4XQGA 2W22A 5E6UA 4C7BA 2I78A 3RSCA 3VM6A 3UJBA 1KQOA 1VGVA 1F51E 5JVDA 3WJ1A 1HZJA 2GD2A 3FROA 1IBMB 5ENDA 1UBOS 2QHXA 1WSAA 1E92A 5LOVA 2O8DA 2QR5A 2GZHA 3GNQA 3NWPA 4MR9A 4KR6A 4CIYA 2J4DA 3F6YA 2NMVA 4WNIA 4DNFA 4D80A 3V8MA 5BSKA 5EIBC 1VJRA 4MV5A 4R5HA 3VUFA 2UU9B 1I4OA 1P0PA 4NESA 1XEWX 2FMXA 1PGNA 2JH9A 2NU7B 1XYYA 3HJTA 3P20A 5BSGA 2PUFA 3KJHA