2GDZA

Crystal structure of 15-hydroxyprostaglandin dehydrogenase type1, complexed with nad+
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
266
structure length
266
Chain Sequence
AHMVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALHEQFEPQKTLFIQCDVADQQQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHIKDMIKYYGILDPPLIANGLITLIEDDALNGAIMKITTSKGIHFQDYGSKENLYFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD+-dependent 15-hydroxyprostaglandin dehydrogenase
publication title High-Affinity Inhibitors of Human NAD-Dependent 15-Hydroxyprostaglandin Dehydrogenase: Mechanisms of Inhibition and Structure-Activity Relationships.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 104
structure length 266
sequence length 266
ec nomenclature ec 1.1.1.141: 15-hydroxyprostaglandin dehydrogenase (NAD(+)).
pdb deposition date 2006-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2gdzA00
4YAGA 4BKPA 4MOWA 3LQFA 4TKLA 3X2EA 2ZB8A 4DQXA 5HTOA 4IDEA 5JCJA 3BTUA 2PR2A 2ZJ0A 4PCVA 1YJ8A 4F46A 4NJMA 4E5PA 1HKUA 3VPSA 1XU7A 1DSSG 4CLOB 4I9HA 3VDQA 1N7HA 4JQCA 3WXBA 3GNQA 1AGNA 3VH1A 5T8KC 5JAMA 1V35A 1DRUA 1WAMA 2IZ1A 2Q4BA 1GCOA 1J49A 1R4MB 1VJ0A 4OQZA 5KVQA 1SZJG 4YT8A 3KYDA 2X9GA 2DAPA 4ZRNA 5TS3A 2XXJA 3GVPA 1DPGA 4M89A 1PZEA 1A4IA 2GYYA 3C3XA 1YDWA 2HK9A 4RQUA 4XGIA 2B5VA 1M66A 1ENOA 4E30A 3NDRA 4FW8A 4O0LA 3MJ4A 5L9AA 2O7QA 2C7GA 1J4AA 3BA1A 1YWGO 4IBOA 5EL0A 4U6SA 1ZNQO 3A14A 2Q4EA 4MVJP 2EKLA 4N54A 2P5UA 4MO2A 1T2DA 2W2KB 4J3FA 4TRMA 4LVCA 1GY8A 2QX7A 3GFGA 4BMNA 1PWZA 1GZ6A 3U3XA 1JA9A 1OOEA 1LXCA 2DTEA 3FPLA 5A3VA 5A4DA 5I8ZA 1TEHA 1K6JA 3HDQA 3L4BC 1T1SA 3RROA 1ZUD1 4RQTA 3DBHA 3PFWO 1XDWA 1MC4A 3D4OA 2Y99A 3INTA 1H6AA 2PFGA 3NTQA 1R4NA 2X7HA 1YOVA 2C54A 5TT0A 1U3WA 4R5HA 1PEDA 5THKA 4CV3A 1UDCA 3W8DA 2CSUA 1UZLA 2B4TO 4FBGA 3F3SA 3PI7A 1EFLA 3VTZA 2NTNA 1I36A 3QWIA 1MP0A 3DQPA 1QYCA 3AW9A 3G1UA 4AJEA 3PJGA 3DAGA 3PIDA 1DC6A 4EGFA 1F17A 1KEPA 1F0YA 2DU8A 1U8FO 2HAEA 4LN1A 1V3TA 2DUUA 5B4VA 3I6QA 1I3KA 3OJLA 9LDBA 4DTIA 4YT4A 2ZQYA 2JD1A 3PYMA 2D1YA 4CMCA 2FP4A 1SAYA 4BOYA 3AJRA 4XRRA 2P4QA 4PLGA 2JFHA 1VL6A 4I5EA 4DIFA 3WB9A 5A5EA 4P4NA 1FDSA 3UN1A 1X15A 1DC4A 4QTZA 3W8EA 3CZMA 3OHSX 5K9ZA 4B3JA 2B4RO 4CM5A 3JQGA 5G2OA 3NUGA 1Z75A 1D1SA 3KHUA 4BIIA 1PQWA 3DZJA 4N7RA 5L51A 4I9NA 4FOSA 3ST7A 3UKOA 3MCVA 5L45A 4ESOA 4CLXA 4YDRA 1K89A 2OZPA 3JD4A 1X1TA 4Y6PA 4NBTA 3AI2A 1E6EA 2IYPA 3PZRA 3EZLA 4HKTA 8LDHA 4RDHA 4XDZA 1P74A 1PGOA 5HBRA 1NVGA 4CM4A 3WNQA 3PDUA 1U28A 4JNKA 5JO9A 1XG5A 2C82A 4OKIA 3TDKA 5L4LA 3GH3A 1PJSA 1ENYA 1ORRA 3LK7A 3N58A 5IDWA 2I65A 1ZEMA 4HUJA 4EUFA 4NI5A 1BVRA 4D79A 1X13A 3QWBA 5IZCA 3WJ7A 2X86A 2PKRA 1NFRA 4FS3A 4BGVA 3VHRA 4XDYA 1FDVA 4WUVA 1Z6ZA 4B8WA 1EVZA 3DZHA 1Z74A 4KDFA 4DIOA 2X5JO 2J8ZA 1QLJA 1AXGA 2O2YA 4WCFA 5G0TA 1B2LA 4LCEA 4BNUA 4YJGB 1GPDG 1P9LA 3OH8A 3D64A 3F4BA 4ZN6A 4NPCA 4XIYA 1DLJA 3VTFA 2Q49A 1XHLA 4G65A 3AFNA 3BIOA 2B83A 3IDSA 1EVIA 3CE6A 1IULA 3K2EA 3NRCA 3OETA 4W7IA 3F46A 1UAYA 1GQ2A 5KJCA 2HK7A 5CDUA 4YWJA 2OBNA 3FF4A 3JSAA 5IDYA 4PZCA 3C8MA 5FEUA 2PZJA 1N1EA 1NHGA 4MINA 1YXMA 2X5OA 1P33A 2B35A 3WGOA 1P0FA 1R6DA 4MVJG 1TI7A 2XPCA 3BHIA 5FWNA 3AUAA 3UCFA 4II2A 5BNIA 5L40A 1PQUA 3WWZA 4Q3AA 4GL4A 2F1KA 4BNXA 2E82A 3FNHA 1WVGA 4IDAA 1CRWG 1B8VA 5A9SA 2PZKA 2UUOA 2CFCA 3F4LA 3QA9A 4UUNA 1U3VA 2D3TA 3KSDO 4TVBA 1HLPA 1NP3A 1K2WA 2NU9A 3V2GA 5IDXA 3VKVA 3O8QB 3WS7A 1I2ZA 4R51A 3C7AA 3CEAA 1MA0A 1WZIA 2IXBA 3O4RA 3RUHA 3HDJA 2PD3A 2Q46A 4Z0PA 2PGDA 3TZCA 2Y66A 4JCOA 3ZWAA 5EQFA 1V8BA 3NGLA 2RAFA 3OEYA 5DCWA 1GEEA 5L4NA 3L0DA 2JD0A 3GVHA 2B36A 4M8SA 2AEMA 2JAPA 5CG1A 3F5SA 4FJ0A 3AM5A 2FPIA 3WMXA 4HP8A 5KJ1A 2E37A 1Y8QB 2IEDA 4OH1A 2C2XA 3GNTA 5I7SA 4DXHA 3JQDA 3WGQA 4INAA 5EINA 5HA5A 4W9NA 4MPDA 5A5FA 4R1NA 1DIRA 2YFQA 3CPSA 3INRA 3ZU2A 2Y1OA 4CM8A 4PIVA 1G0NA 2V65A 3G17A 3BTSA 3NGXA 2V7PA 4OHUA 4TMFA 4M54A 4UVEA 5KKAA 2P91A 4LISA 3ZNOA 1UDBA 4JBHA 4URFA 3QY9A 4IZIA 4XQEA 5A05A 3GHYA 4IDDA 4IDCA 2QYTA 3QVXA 3JV7A 3LDHA 2ZATA 4LW8A 4CQLA 1T4DA 1B7GO 5JAIA 1HXHA 4I5DA 2NU6A 1BHSA 5C7OO 4IDFA 4GPD1 2CDCA 1JW9B 5IFLA 4JJIA 3ZCXA 3N7UA 1GV1A 3HG7A 3UH1A 3PGJA 2H63A 4FFLA 4BO1A 1UXGA 2C29D 4XYGA 3CKYA 4YJHA 4UEOA 3OQ1A 4CMIA 1DBVO 4D3SA 3TL3A 1YDEA 3MJTA 3QVOA 3R6DA 4NJMB 1DC5A 2PKQO 2YQ4A 4DUPA 5KNLA 4D0SA 2VHVA 3DBLA 3W8FA 5F5NA 3ABIA 5DDIP 5F3RA 1T25A 5I7VA 2X0JA 3SVTA 2VT3A 1ZSYA 2GF2A 3VZRA 4PG7A 2FOIA 4YAEA 5TQVA 5JYDA 5ENDA 2E49A 1ZFNA 2OHXA 2AHRA 2PY6A 1K3TA 3VH4A 1EBFA 3WLEA 1DXYA 4E5YA 1R0LA 5FFFA 1Y9EA 3LC1O 3U09A 4QQRA 3WGYA 4G2NA 2P9GA 2GLXA 4MVJF 3L4SO 4BO2A 2Y1FA 3GVCA 3WLFA 4CMKA 4D45A 1ISFA 4FB5A 3ETEA 2VOJA 5KVVA 2FPGA 4ZRMA 4I1IA 4H7PA 4M86A 1CQIA 5G0SA 3DHNA 3HFSA 1E1MA 3SJUA 8ADHA 2WSBA 4CM3A 2AW5A 4P4GA 4MDHA 3WYCA 2HUNA 2ZCUA 3DBHB 3VH3A 1QYXA 2P4HX 2NVUA 3HWRA 3WNVA 4EUHA 3U4HA 4CR7A 2IZ0A 2Q45A 2O3TA 1R4NB 3GA0A 1T24A 5TRTA 1N8KA 2YZ7A 1CYDA 3NTRA 3FSRA 5G4LA 4IIUA 1IY8A 4CM1A 1UP6A 4NJOA 4FR5A 4IXWA 3GAZA 1O9BA 1ONPA 1O8CA 1T2FA 2FR8A 3D5QA 4N5LA 4IJWA 5DP1A 4E32A 3QE3A 1HT0A 3KETA 2BFOA 3BMQA 3F1LA 3AY7A 3OA0A 3PDJA 3ROMA 4BNVA 4DA9A 2G17A 2XOXA 1MV8A 2GNAA 3HZZA 4NIMA 4JROA 2PTGA 2VRBA 5KVCA 3VVCA 1NAHA 3RFVA 3B1FA 1JWBB 2W2LD 3A4VA 2GR9A 1D1TA 3L6OO 2RHRA 1ZSVA 1DJQA 1AHHA 1OZAA 2QW8A 3JYNA 4B7XA 4BNHA 5ITVA 1NASA 3H2SA 3VDRA 4H3VA 5KJEA 4GKBA 5ILOA 4AJIA 2WM3A 1SMKA 4P38A 3BXXA 4HV4A 3JQGB 2Y93A 1UZNA 4RF5A 3ONDA 4H16A 2EXXA 1VJ1A 4JIGA 2WTBA 5LCXA 3UGKA 1HDRA 3WIDA 2R00A 4J90A 3PGXA 1HE2A 4K9DA 2VRCD 2XAAA 3E6AA 3QJ5A 4D46A 4PG5A 3IJRA 5FI3A 1LRKA 1IUKA 4CM4B 1QXSA 1LLUA 4M1QA 4YCAA 4CM6A 5IDQA 5L53A 4KOAA 3GPIA 3ADOA 3A28A 1ZKMA 3DHEA 1ADFA 2BF7A 5DP2A 3VH2A 1Z82A 2O3SA 4Z0HO 2H5LA 2BGMA 1HEUA 2X9VA 1F8FA 4IQ8A 5JO0A 1Q1NA 1GQYA 1ISMA 4K26A 4XB1A 3LC7O 4EUEA 4R1SA 5TSDA 5F1OA 2IODA 1Q7GA 2O48X 1I3NA 4CR6A 3KXDA 1HDZA 4YT5A 1B8PA 4QT0A 5FYDA 5DT9A 5B4UA 2VN8A 2RH8A 1A4UA 1LLDA 2DT5A 4J1SA 4WCFB 5TX7A 3VPXA 4GSKA 2C5AA 2VZ8A 2JD2A 3Q9UA 3PQDA 1ZCJA 1HE3A 5ADHA 4GX1A 2GASA 4PLYA 4I5FA 1IPEA 2VWQA 3FCOA 3SLGA 2PD6A 4BNLA 3VPFA 1E92A 4UUMA 1PJ3A 5AXDA 4O5OA 5BQFA 3BMCA 4DREA 4YR9A 4MJLA 4FFRA 5BT9A 2EV9A 3ANLA 1EFKA 3SC4A 3V8BA 3FNGA 2Q99A 2BD0A 4OQYA 1DIGA 1U9JA 1EQ2A 1M76A 3C1AA 4U0KA 3QWFA 1AHIA 4XYMA 2AQKA 3ROQA 1E0DA 2EJVA 2ZTLA 2DTDA 2NADA 1NYTA 1Q0HA 5EJ2A 2VNAA 1A9ZA 2HO5A 2UV8A 2DBZA 4TSKA 5TT1A 2BMAA 2ZKLA 1QR6A 4YBZA 2C5EA 4D41A 1YONA 2RBEA 3JYOA 4GQAA 4NU6A 3EY4A 3RUFA 1HL3A 1ZMOA 5IZCC 4YAJA 4GAEA 3TQHA 3HE3A 1B26A 4YJGA 5KWEA 2O50A 1QYWA 3RJ9A 1GYQA 2HRZA 1BRMA 3JQCA 4KZPA 4PGFA 3M2PA 4YQYA 4GGPA 1ID1A 1MFPA 1ULUA 4E13A 7MDHA 3TOZA 3ZWYA 4WCFC 4Y6SA 5KTKA 5DBIA 1ADGA 1DB3A 1H6CA 4B79A 4AJ1A 1Z45A 3F47A 3HDHA 3KEOA 4MVJI 4BGEA 1BXZA 1N9GA 4UVHA 1KVTA 3V1TC 3DZBA 2UYYA 2YHUA 1PWXA 1XEAA 4WOKA 3BTOA 3ZI0A 5EESA 4IDGA 1P45A 3DOCA 2EGGA 3RUAA 1KEUA 1RYEA 3UFXA 1I5RA 3HSKA 4RLHA 5BSFA 4BO6A 4BNJA 2D2IA 2WE8A 4ZJUA 3TSCA 1Q0LA 2LDBA 1EEHA 1HDGO 1SCUA 4IIVA 4JGBA 1JLLA 4CM8B 5C7IO 2D5CA 3GZ4A 4RDIA 2Y1DA 3DFZA 2V6GA 1EVJA 5DOVA 4LRTB 1MXHA 4A7PA 1DFHA 3QW2A 3LF1A 5TIIA 3GMDA 3QV1A 4RPGA 2ZK7A 4B4UA 3P2OA 4PVDA 1JN0A 3OJEA 2VTDA 3DOJA 4MP3A 1LSOA 1DIAA 2GDZA 1QYDA 4CMAA 1DOHA 1OC2A 1EK6A 2YJZA 3V1YA 1UXJA 3MEQA 3LYLA 4XD2A 5G0UA 4GVLA 2O3QA 4RZIA 1E3LA 2GN9A 3NX4A 4TZTA 2EHDA 4KDEA 4WE3A 3G1TA 4CMIB 2OO5A 1HRDA 1YBAA 2YHIB 4MP8A 4KQWA 3GY0A 1GPJA 1NBOA 1PJTA 4FFPA 4WLUA 1E1KA 1Z7EA 1LRJA 1H93A 4FGWA 5HM8A 3DBVO 5I8WA 4L4XA 4FIZA 4RCVA 1WWKA 5TGDA 4RPKA 3PLNA 4IMPA 3B20A 4CV1A 4DYDA 4P8RA 5KOIA 3DL2A 2A35A 1LLCA 1HSOA 1T1RA 4BV8A 4ZICA 3NT2A 1LQUA 2QQ5A 3OMLA 4L75A 1DO8A 3RU7A 2DC1A 4W9NC 2E6UX 5JLAA 3EVTA 5BSGA 3R0IA 3RC2A 3UCXA 1DIHA 4J1TA 4J6FA 4YEDA 1E7WA 1BVUA 5AXCA 4IS2A 1OC4A 5IN4A 3S1LA 2C7VA 2Q2VA 4E5MA 2WJPA 1CQJA 3FHLA 1N1GA 1C0LA 2I76A 1XIVA 2OL4A 5DN9A 1MXFA 2FHSA 1H9AA 1T2AA 2FRDA 4N18A 4EYEA 1IB6A 1WXDA 1HSZA 4NU5A 5EQDA 1ISGA 4W4TA 1AE1A 2ZTVA 4KUHA 1E1LA 1GU7A 1HTBA 1PZHA 2AMFA 3L6DA 4R3NA 5ES3A 3DR3A 4OSPA 2NVUB 3VPHA 5GZ3A 4BB5A 4BMSA 4E5KA 4BNZA 1YBVA 3PWZA 1WW8A 4JN6B 3RC7A 4TQGA 1NVTA 1L7DA 3C7DB 2DFDA 5JE8A 4W6ZA 1BMDA 3H9QA 1UDAA 1A5ZA 3JD3A 3IUSA 4BNIA 2QZZA 4JX8A 2C2YA 4Q3EA 3BMQB 3RUEA 1T4BA 1NXQA 4OO3A 1C0KA 3UAGA 4B4VA 2HJSA 2NACA 3R3SA 4KTVE 3WR5A 4ZQEA 1E7YA 2CDAA 1ULSA 2AXQA 2X6TA 1P1JA 3D3EA 3DDNA 3KV3O 5G0VA 1X7DA 3WQSB 3COSA 1O95A 2HMUA 2GN4A 1X0VA 4NNJA 3ZNNA 1L7EA 4YPOA 3E82A 2JCVA 3GHHA 1YO6A 1HDOA 1ADBA 4Y8VA 1OAAA 3ENKA 1B15A 1SOWA 3PYLA 4OKNA 3JQEA 1E3EA 3TNLA 3TRIA 1PL7A 4AICA 2VUUA 4P4LA 4EJ0A 1EUDA 2J3HA 3ITKA 1C1DA 4IUYA 3ZWXA 4AJ4A 3GDOA 1QSGA 3A06A 3QIVA 1PS9A 5AXAA 1H0KA 6LDHA 4GH5A 4C7JA 1QP8A 3K31A 3PWKA 3JQAA 1NR1A 1KOLA 4E5NA 4U8GA 3OIFA 4R1UA 1XSEA 4BMVA 4JBGA 2UUPA 3GGOA 4AJNA 3GEGA 2I5PO 3SXPA 1D7OA 1LC3A 1I30A 4DLAA 2OUIA 3GR6A 3MTJA 1MUUA 1Y8RB 2FSVA 3H6KA 2O23A 5T67A 2CY0A 3KVOA 4IMRA 4J4TA 1BXKA 3PYXA 2OP0A 1VLLA 2YDYA 3K2BA 4PG6A 2A92A 4LSMA 1Y6JA 3NV9A 1H6BA 4Z9FA 3LT4A 2H9IA 4GMGA 1TT5A 5JXWA 3ADPA 1SOVA 3LT0A 4R41A 2J5KA 3AU9A 3H65A 3ROKA 4YRAA 1DDOA 5I9LA 1QMGA 3IQDB 2YUTA 3KTDA 5EPOA 4PG4A 4UULA 5CFZA 4KUGA 5BSHA 4KQXA 4RVDA 3ZWPA 1R0KA 4XA8A 1SNYA 5JY6A 4CPDA 3PHIA 3ENNA 3GGPA 4DVJA 5COQA 5JAZA 1UP4A 3GF4A 1HYGA 2X4GA 5KVSA 3IIEA 4BVAA 3BMCB 5T6BA 1YQXA 2HU2A 3MZ0A 5DF1A 3DZKA 4K6FA 1U3UA 2R00C 4FN4A 4IGFA 3VZQA 3AUUA 1JAYA 1LSJA 2B37A 1V0JA 3PK0A 4CQMB 4M87A 4CV0A 3K96A 5BNTA 1YB5A 1XCBA 2WDZA 1LA2A 2BRUA 2CDBA 3TZHA 4WLEA 3FRJA 3ZWWA 1WP4A 1E5QA 3DOOA 1YVEI 3WWYA 1TVEA 1KY5A 2HSDA 3PVZA 4LMRA 1MFZA 3JD2A 1P0CA 1XWFA 5HRUA 2JL1A 2HQ1A 2AQHA 2WYVA 5I9MA 1P1KA 1ONOA 3S2EA 1SEVA 1VI2A 3RWBA 4J91A 3FNEA 4F6CA 3ZHZA 1LNQA 1BDMA 1B3BA 4MKZA 1W6UA 3DTTA 4CM9A 1N9GB 3H2ZA 5A9TA 4LK3A 3G49A 1JKJA 4R9SA 4XYEA 3JQFA 1PGNA 4R9RA 4A0SA 2NNLD 5JFOA 9LDTA 2J5RA 3I9OA 2GUGA 5TNXA 4JBIA 2VYVA 3IUPA 4FCCA 3FR7A 3LU1A 2QYSA 3IAHA 2EKPA 1R16A 4GWGA 4YACA 4ZQGA 1JKFA 3F1KA 4QECA 4BGIA 5LC1A 2NVBA 1ZSNA 5GZ1A 3V2UA 2X58A 4KWHA 3ONEA 4GX2A 4H15A 3ZWBA 3D0OA 3FN4A 1F06A 4GKVA 3BTVA 2ZIZA 5CEEA 3M1AA 4WEQA 3JTMA 4CJXA 2BELA 3JYLA 3ROPA 4BKQA 4R5MA 2IZZA 3CIFA 4Y9DA 4ZQHA 2FMUA 2W90A 4I8XA 4PLZA 5GY7A 1ONNA 4NBRA 2C0CA 4R01A 3H3JA 2EF1A 4JP2A 3G79A 4I08A 3U0BA 3RIHA 1QORA 2DUWA 2PK3A 1GUYA 2HKIA 3JQ9A 3D4NA 3AI1A 3CH6A 3TZKA 3GG2A 1A71A 2VWPA 2RH4A 1QLHA 4WOJA 1E3JA 5JYEA 4FC6A 4NFSA 3K6JA 4LGVA 5AXBA 1IOLA 4ALNA 1U8XX 3AU8A 4OIMA 3T7CA 4CUZA 1WLYA 1LBEA 3ETGA 4U0JA 1I33A 2VYND 2VWHA 4BNTA 4E2WA 4BO0A 4DBVO 5IJZA 4OAQA 5LDGA 3DEYX 3ANMA 4XQGA 3UCEA 4UVGA 2DBRA 1M2WA 4D3DA 5B12A 1A7AA 1YL7A 1PGQA 4TRNA 1W0CA 1CETA 3WFJA 1BXGB 4LSWA 2WD7A 4P22A 4AJHA 4AJOA 3IC5A 4PFJA 4DC1A 3AOGA 1EDZA 3RBVA 1GYRA 4WGGA 4ZVVA 2Y0EA 3FPCA 4DPKA 1N92A 3GGGA 1PL8A 4Z3DA 5ILGA 2V6FA 4AFNA 2OFPA 3WIEA 4AVYA 3C1OA 5JMWA 1VKNA 4PLHA 4U5QA 4A10A 1MGOA 3D3WA 4AG3A 4CM7A 1J6UA 5J23A 2VTEA 2EERA 3F6YA 1TXGA 4KP7A 3FWZA 2YHIA 1CDOA 3NTOA 4NMHA 1AN9A 5CPFA 4RZHA 2Q1TA 2BFMA 1KVSA 1M67A 2VOEA 5F1PA 4M49A 3SBOA 3K92A 2FY8A 4WPGA 1LDGA 4PLCA 3EW7A 4FJ2A 4HNHA 4WK6A 1KEVA 4EW6A 2YV2A 3RASA 4MP6A 3GPDG 4TWRA 2WE7A 4WLNA 1FMCA 2QRLA 4B7CA 1JKIA 4XKJA 4ND3A 5COBA 4AJKA 4D44A 1ZK2A 2D0IA 3Q1LA 4WEOA 2QIOA 2NM0A 3IS3A 3RAJA 2ZYAA 4G5HA 2X0NA 4M55A 2NU7A 1ISHA 3EUWA 4FFNA 4RJTA 3EGOA 4CV2A 1PS8A 4DQVA 1PJ2A 3JQ6A 5GZ6A 4ALKA 4CMEA 4XWYA 4HFNA 3TZQA 1Y7TA 2HDHA 3PP8A 2ZB7A 4MVJH 4I5GA 1GD1O 3PZBA 4EITA 2EWMA 1TLTA 1HZJA 4YYZA 3K9QO 3HHPA 1KETA 4LCJA 2EW8A 1NR7A 4GGOA 4MVJA 5AYVA 1YBMA 1F8GA 2VUSA 3UXYA 4BNKA 3OM9A 3TOXA 1ZVMA 1RM4A 4GBJA 3E5RA 4KUEA 3WYEA 4AJLA 1P44A 3QQPA 1VSUA 4B7UA 5L7TA 4DBZA 1C1DB 3CTMA 1X1EA 2SCUA 3LLVA 3PLRA 3L77A 1JAXA 4NK5A 3I9NA 3G3EA 5ICMA 3JQ7B 1NQ5A 3CUKA 4OXKA 5THQA 1I2CA 4BQPA 4DYVA 4YJDA 2Q3EA 3GOHA 3KBOA 3JQAB 1RM5A 1UJMA 1Y81A 3ZHBA 3GK3A 4CMGA 1SB8A 5CG2A 4DPLA 1RKXA 3P7MA 4X54A 1BDBA 3WTCA 3WQQA 3F5QA 1QRRA 3BMNA 4NBVA 4PLPA 3RQSA 3DHYA 4CUKA 4WLOA 5T64A 3MJEA 4RF3A 1Z73A 4TRRA 1NX6A 4RORA 3B6ZA 5MDHA 1NPDA 4BNWA 4AJJA 1M75A 3PEFA 3JQ8A 5COAA 4E2XA 2YDXA 1KC3A 3INGA 3T4EA 1IHXA 4XX0A 1P31A 1TT5B 2HJRA 2X23A 2OOSA 3FI9A 4YQZA 3H8VA 2RHCA 4J9VA 3U62A 4A03A 4OL9A 4RLSA 1ZW1A 1ZIDA 1SB9A 1I3MA 4D3FA 1IZ0A 1PJBA 2Q2WA 5I7EA 2GERA 1GADO 3GG9A 5KJFA 3ZWOA 5TLSA 2VUTA 1WNTA 2G0TA 4OOEA 3E18A 2NTVA 5A9RA 1UH5A 2I3GA 1V3VA 4HY3A 3WGZA 2BFAA 2NU8A 4MKXA 3RU9A 1ZXBA 4J4BA 1NPTO 5F5LA 2C07A 1FF9A 2FR1A 3GVXA 2EW2A 2A4KA 4OMUA 2NV6A 3EZYA 3AI3A 4K28A 4DPMA 1CERA 1Y8RA 1QV6A 4XJTA 5L3ZA 1VL8A 3ZZNA 4C4OA 2B4QA 4PLWA 5B37A 2EJWA 2XF8A 3I1JA 4ZA2A 3TZ6A 2AG8A 3C85A 4RL6A 5A03A 1KIFA 3AY3A 1NNUA 4UUOA 3MTGA 4WNIA 4MVJM 4WNCA 1DHRA 1QYVA 2X8LA 2PH3A 1DHTA 2BH9A 4R69A 4NK4A 4BL5A 3FNFA 5JCJD 3TFQA 5ER6A 2JFFA 1PR3A 1T2EA 4DRYA 4YJFB 2FZEA 2Q1UA 1PL6A 4Z9XA 1ZJZA 2CUKA 4RGBA 2ILTA 1G0OA 3I23A 3ZV4A 3EDMA 2BFPA 2HCTA 3OQBA 1KC1A 1YRLA 2V6MA 5B4TA 2ET6A 2XXBA 3HDYA 5U9CA 4RVHA 1UXIA 4CQMA 4BO7A 2NVWA 5JNLA 1LSSA 2P2SA 1I10A 5T5QA 4S1VA 3RBZA 4J2HA 4UVDA 3OIGA 1HE4A 1OMOA 1PJCA 6ADHA 1RM0A 3B70A 4BNNA 1LSUA 3N74A 2PD4A 3NAQA 2IEBA 1P1FA 1PQPA 1V9LA 4A2CA 4J7CA 2OORA 4L4SA 3KO8A 5IN5A 2CNBA 5JCXA 4NBWA 3FBTA 1M6HA 2OBYA 2PGJA 3RC1A 3W4KA 3SJ7A 2G82A 1CIVA 4CL8A 1LDNA 4O6VA 3H9EO 4PLTA 5HWSA 2CVQA 4BV9A 4LMPA 2FR0A 5CEJA 4B3IA 5JPIA 1HF3A 1DIBA 1KERA 4CL3A 2X0IA 3B1KA 3M6IA 1U2DA 2PH5A 1CWUA 4GVXA 1WPQA 2O4UX 3ZU4A 1CF2O 3Q2IA 3ASVA 2G5CA 2CVOA 3NT5A 3JQAD 4WKGA 4IY1A 5DCYA 4YVFA 5AVOA 4BO5A 4AJ2A 4PG8A 4BKOA 4TRJA 2DFVA 2DVMA 1RJWA 2NWQA 1WMAA 4G81A 5G4KA 5JSFA 1MB4A 3KSZO 4TVOA 1KY4A 3PJDA 3RSHA 2IRWA 4RVSA 5AQ1A 3U49A 4RVGA 1I3LA 3BMOA 2BI7A 4A26A 4RPHA 4OM8A 5G0WA 3IL2A 1LUAA 1SPXA 3PFFA 1EQUA 1ISIA 2EG9A 4FD3A 3WGTA 5CDTA 1QG6A 4IJVA 2YQ5A 2P9EA 1YKFA 2WD7B 1E6UA 3SC6A 4IS3A 1GUZA 1HZZA 3KLMX 5CDSA 5KCZA 1E3SA 3HQ4O 4IJKA 5JAQA 5JC1A 1R37A 1LDMA 1RYDA 4QFCA 2GZ2A 3K73O 1E7QA 4J2OA 3OICA 3OJ0A 4XCVA 1NFFA 3WOHA 3I6IA 2BGKA 3CMCO 3RCBA 3D3WB 3JYPA 4RPJA 2DBVO 3ZHXA 1Y5MA 3UICA 2D4AA 2IE0A 1H5QA 4YA6A 4N5NA 5IXSA 2PV7A 3A1NA 1EVYA 3PIIA 3OQ6A 2GZ3A 1FJHA 1ZXLA 3G0OA 4PVCA 1H6DA 4XJSA 5HS6A 4B8ZA 3GQVA 1NM5A 4YTEA 1X7HA 3BHMA 2W2LA 4UUPA 3S2FA 1HWYA 3WQRA 5IZ4A 4W7HA 4E2ZA 4KWIA 3P2YA 4IQGA 4ZU3A 3ZU3A 5EERA 1O6ZA 4DGSA 2EEZA 1GQQA 3A9WA 2AEJA 1GEGA 4YAIA 1BXGA 4CLRA 1U7HA 1TB4A 2NQ8A 3GEMA 2EIHA 2VZ0A 4KTTE 3RUCA 1PJLA 3LVFO 2HLPA 4XB2A 3RBXA 2DQ4A 4ID9A 2R2GA 4TKMA 1LC0A 3DXFA 3WFIA 1SO8A 1PU2A 2EP7A 3OBBA 4FGSA 2JAHA 4QO7A 3FD8A 5BSEA 1WMBA 3KB6A 3AUSA 4ALMA 1O5IA 1B3RA 1JDJA 3I52A 4IJUA 1OI7A 2P9CA 4AJPA 3ZH2A 2CMDA 1A7KA 2HMWA 1T26A 1O94A 3GDFA 5JMPA 5MGBA 1PIWA 3I4CA 2PZMA 1GAEO 3M2TA 3LF2A 3UW3A 3JD0A 3EYWA 1X14A 1I32A 5T57A 4DIBA 1NQOA 3KOUA 3STHA 2VYVD 3MJSA 2Z5LA 1IL0A 2FZWA 2YY7A 3IOYA 4NDNE 3C24A 4ALJA 3L9XA 3NEPX 3WGHA 2ZB3A 2FPPA 3Q3CA 4OJNA 3EC7A 3LT1A 4HBGA 4EI2A 1NPYA 2LDXA 4B4WA 1ZK3A 5CAEA 1NWCA 3BMNB 1S6YA 3Q0EA 1M6WA 3HADA 1AUPA 5CDGA 5L4SA 2Y1GA 4PZEA 1HYHA 1GTMA 3GZNA 3ZV6A 3GUYA 2QHXA 1XQ1A 4XEHA 4PLVA 4BB6A 3JQBA 1KVQA 3IMFA 3MJCA 1Y5RA 2JHGA 1NFQA 4HADA 3Q2KA 3DBRA 3NYWA 3JQ8B 3FR8A 3ZWMA 2J3KA 2GZ1A 3JD1A 2P68A 1K6IA 4UAGA 4R3WA 2D5AA 3HN2A 3LLSA 4CMEC 1BW9A 5LDHA 3BZUA 3LZ6A 3E48A 4L73A 4FPXA 4CODB 5JDIA 2PNFA 4Z9YA 4AL4A 3AOEA 4Q3CA 5DOZA 4XGKA 4GLLA 3D5TA 4E4YA 5C3MA 4U6QA 1S7CA 1GDHA 1W8DA 2NUAA 1BTOA 3FTPA 3QVSA 4NHEA 4OGWA 1Z7BA 3JQ7A 1L1FA 3E9QA 3OIDA 4DWVA 2OGUA 1ZMTA 1E7RA 4MKRA 3E1KA 4GSLA 5K6AA 3DZIA 3OP4A 1NTOA 1SC6A 1KS9A 1PTJA 3EK2A 1FDTA 5TJHA 4DMLA 2DKNA 3ICPA 5HS4A 4GLOA 1H9BA 3UUWA 4BKUA 3P19A 1D3AA 1D8AA 4D43A 3IP3A 2DLDA 4J9UE 3K30A 2V6BA 2JHFA 2Y67A 2FSSA 3PPIA 4PRKA 3WTBA 2WYWA 4O1MA 4JP3A 2B69A 1I2BA 2HK8A 2X5KO 1PZGA 1XR3A 3GFBA 4FOOA 5ER9A 3WICA 4DLBA 4E2YA 1GL3A 3U4DA 1B8UA 2QRKA 5ICSA 4PZDA 4QFDA 1LI4A 1IE3A 1T2CA 3GNSA 1ARZA 1ZJYA 3ULKA 2Z95A 4IM7A 2VHWA 1GYPA 1EUCA 1E1NA 3AY6A 5DBGA 4KMSA 4HWKA 1PR9A 1P1HA 3MOIA 1TA4A 1J0XO 5K0ZA 1EZ4A 1LDEA 2X0RA 1Q2XA 4JJFA 2JKVA 4BUCA 5A04A 1U5AA 4UEKA 5CDYA 2AG5A 4L9RA 4CLDA 4ZGWA 5DZSA 3QHAA 2AA3A 4ILKA 1H2BA 2C59A 2PZLA 2WEKA 1E7MA 2Q2QA 4QEDA 2NTJA 1Q0QA 3E5MA 2O2SA 3HNPA 1J5PA 3O26A 1I01A 1MG5A 2D8AA 3BYZA 4XR9A 4L8VA 4J49A 3TN7A 3PTZA 1UR5A 4YRBA 2H6EA 4MIEA 3PHHA 1ENZA 2PA3A 2W8ZA 4ALLA 3OJFA 3CXRA 1C0PA 1PGJA 4ITUA 4J1QA 3VKUA 3H7AA 4MVJD 3BHJA 2C20A 1DFGA 3S8MA 4YAKA 3IKTA 2VT2A 3GDGA 4ND2A 3DMTA 4YJFA 3H5NA 1IYZA 5DBFA 1YB4A 3WGGA 4XYLA 5CHEA 1X7GA 4U7WA 1NHWA 3JYQA 4RVFA 2D59A 1ZEJA 2DM6A 4Y67A 1DRVA 1NQTA 1LRLA 1KYQA 4XYBA 4NZ9A 1QV7A 2B0JA 3X2FA 3ZWCA 1FK8A 3RVDA 3RUIA 4HXYA 1K5HA 2W4QA 3HB5X 3CINA 1YL5A 4J16A 2PKQP 1ADCA 1GR0A 3PJFA 3ZNPA 3GUCA 3K8ZA 4ZQBA 5F21A 3S2IA 4YB8A 1LJ8A 1HDXA 3MJVA 1PZFA 1GCUA 2DTXA 3GT0A 1LDYA 5G4KB 3VC7A 1YE3A 1KBZA 3DC2A 5CPBA 5F1KA 1YB1A 3VZPA 3E8XA 4QXMA 1PGPA 1VL0A 4XIJA 1FDWA 3DWFA 4A5OA 4F6LA 2B5WA 5BR7A 4WLVA 3BMOB 1LLQA 3DZGA 3S2GA 2AEFA 3ETDA 3W1VA 4W99A 3D4PA 1V6AA 3L07A 4XQ9A 1VJTA 4DL9A 3TWOA 1UXKA 3DAPA 5AOVA 3GRPA 1DRWA 1JWAB 1PJQA 5JDCA 1P3DA 1KEWA 4NFHA 2BHLA 2GO1A 4L4RA 4O63O 1YGYA 4YT2A 3JCZA 1U1IA 4QUKA 1R12A 3ZDFA 4HX5A 4E31A 3I4FA 4D7AA 3KLPX 3KUXA 3QWHA 1IPFA 1U7TA 5DNAA 2FWMX 4WECA 1VKOA 2E4AA 3WBFA 4OSOA 1DAOA 2O7SA 1YJQA 1ML3A 3IJPA 5FF9A 3KM0A 3OF2A 5IG2A 4FJ1A 4TZKA 1HDCA 3Q9NA 2Y05A 2O3UA 3DAFA 4Q3DA 4XGNA 1W73A 4DMMA 3ZWNA 2HMSA 1XKQA 3EMKA 3FBGA 3M1LA 3ZWVA 1KVUA 4ZQFA 4BNGA 1HLDA 5C7LO 4N5MA 1VM6A 3RC9A 1UZMA 3QWAA 1LTHR 3B1JA 3PHLA 2VZ9A 5L7WA 1E7SA 3ITDA 4NFYA 3BAZA 2E48A 3T7EA 4BO3A 3HN7A 4EEZA 3U4CA 3H3FA 1LEHA 3H4VA 2NSDA 5H81A 4CLRB 4DC0A 1E77A 4EEXA 1YQGA 3I9MA 2CF5A 2J5QA 1DC3A 1BSVA 5EMHA 3ZW9A 5A02A 1E6WA 1Q7BA 3WSVA 3GMSA 3EVNA 5KKCA 1C1XA 5TC4A 1JU9A 1CJCA 1ZK4A 2O4CA 1VRWA 1FXSA 2POQX 2VHZA 2Y1EA 2YW9A 4ND4A 4R16A 4YRDA 4CLEA 4OOFA 2UAGA 3AK4A 2Y0DA 1EUZA 4EZBA 1U2GA 2AQIA 4Y98A 4Z6KA 5A06A 3WJAA 2OP1A 3HB4X 3CZRA 4IGEA 3NDIA 3ZGYA 1WZEA 1VE9A 1EK5A 1GV0A 5ITWA 2TMGA 3QRWA 2AE2A 1C14A 4Z3KA 4CQMD 4PN3A 3TFOA 1LX6A 3H9UA 4CMHA 3OA2A 2RIRA 4F3YA 5IAAA 3GLQA 4A73A 1RM3A 2Y0CA 3U5TA 4FC7A 2YYYA 3OSUA 1ZZEA 2EP5A 4NH4A 4XZ3A 2Q50A 4IDBA 2TMDA 1D4FA 1PJ4A 3AWDA 1NVMB 4WCDA 5T8KA 5JW6A 3NDJA 1LDBA 1X0XA 1Q7CA 2BLLA 4K6CA 2DBQA 4WLFA 3ZHYA 3ZW8A 4XQCA 4BKRA 4JLWA 4BHTA 1PS0A 3MWEB 3KYCA 3GZNB 4GMFA 4J7UA 1WDKA 2J3IA 4J1NA 1VPDA 3DO5A 3FWNA 1UAGA 1WDMA 4JXKA 4BGUA 5TF4A 3DBRB 2ZCVA 2FN7A 2HMTA 3TL2A 4B3HA 7ADHA 5H83A 3RJ5A 4R68A 3Q6IA 3QSGA 3KYDB 3P5SA 4ND1A 3NJ4A 3U4IA 2OMEA 4UVIA 3EAGA 4RV9A 1BW9B 4II3A 1O0SA 5U4QA 3RFTA 5L7YA 1HE5A 4FSHA 4OYRA 5L95A 2A9FA 3KSUA 3L9WA 2CVZA 2QZ9A 4YXFA 2WYUA 4GWKA 4J0EA 2VHYA 4WJZA 2VWGA 4PRLA 3L4BA 1SBYA 3WX0A 4BO8A 1E3WA 1GUFA 3ANNA 1XLTA 3PQFA 4HFMA 1NQAO 2ZYGA 3WMWA 2GSDA 3GAFA 1E3IA 4DQUA 4LVUA 1ISJA 4J7XA 3VZSA 3MWDB 3WBBA 2I67A 4Q3NA 4NG5A 3AUTA 4CLOA 3GN1A 3W4JA 3DZFA 5A1TA 2Y1CA 4NQZA 1YS4A 1MX3A 1K6XA 1YOVB 2IDZA 2WWRA 3L6EA 2AQ8A 4ND5A 1A27A 1XGKA 2O3JA 2Q1SA 1HETA 1R4MA 2BGLA 2H1SA 5DULA 1G1AA 4BO4A 1B0AA 3WGIA 3JQBC 3VVBA 3WDSA 1MG0A 1ZK0A 3ASUA 3SX2A 1I0ZA 2A94A 1N2SA 2VNSA 3NT4A 3O38A 5GMOA 3H5AA 2GN8A 4MIOA 3OEWA 3NJ8A 3PWSA 2X1HA 1GZ3A 2GGSA 3HUDA 1R15A 3OECA 4BNFA 3SEFA 2GRAA 4IQ0A 1NAIA 2YV3A 3S55A 1OBFO 2W2KA 3H5RA 4E12A 2F00A 5JDIC 3RI3A 1K0UA 5FI5A 1N5DA 3AOEC 2Q1WA 3CSDA 1JQBA 1HYEA 3D1LA 5EN4A 1HDYA 1ZO8A 3TJRA 4A27A 3KEQA 4BQRA 1DJNA 3I9KA 4FDAA 3I83A 3CMMA 3RD5A 4GX5A 4MIYA 1U3TA 4MVJE 4DLLA 3EHEA 4UREA 1EMDA 1W4ZA 5K6AC 3ZV3A 1CEQA 1RWBA 1JTVA 1Y1PA 1XELA 4W82A 5C5IA 4OXNA 1ENPA 4C7KA 5TJ9A 1C3VA 2DPHA 1G6KA 5U1PA 2I6TA 4RVUA 4QO8A 2X22A 1ZBQA 3C1TA 3RKRA 1YQDA 1JVBA 1PX0A 1IZ9A 3PJEA 5I9NA 4QSMA 3QVWA 3MOGA 3WG9A 4NBUA 2DPGA 2HRBA 3OJOA 3ZU5A 2PLAA 2VYNA 3GEDA 2QG4A 2RCYA 2WD8A 2P5YA 4EBFA 2ZJ1A 2ZTUA 4NR0A 3Q11A 1YL6A 2VHXA 4ZHSA 2JFGA 4BNMA 2IYOA 2NQTA 3H9JA 3VOSA 5JY1A 4E0BA 4CLHA 3WSWA 3E03A 3E9NA 1QKIA 1R0SA 2JCXA 3DFUA 4L74A 4TROA 1IHYA 4L76A 4Y6RA 1JVSA 1WDLA 4ALIA 3ZN2A 3D7LA 4HFJA 1F12A 1A9YA 4XR4A 1DFIA 5H82A 3W4IA 2PWZA 3QP9A 3I9JA 4GI2A 3T4XA 1AXEA 1EBUA 1XYGA 3PXXA 5JS6A 4EJ6A 1EE2A 3V5NA 3F9IA 4D0RA 4EJMA 1E5LA 3QVTA 4RPLA 4EDFA 1A72A 1H94A 3OFSA 4L0QA 2CD9A 3V2HA 2J3JA 4PLFA 3AM3A 4E33A 3I3OA 1O89A 4J0FA 4E21A 5I7FA 3KZVA 3GRKA 2JCYA 3E9MA 1P1IA 5EIOA 1H2HA 3QLJA 3DTYA 4FFOA 3UVEA 2NLOA 3PHJA 2ZB4A 3WYBA 3ZV5A 3K5PA 1B16A 1UP7A 4ONEA 5DCUA 4B4OA 5C37A 4UEJA 2GD1O 3O03A 2ZTMA 2YFHA 3HJAA 3ONFA 5A9SB 3DMTC 1U4SA 2X9NA 5B1YA 1LQTA 2ZQZA 4RF4A 1SEPA 4CR8A 3RUDA 2EKQA 1I8TA 4Q3BA 1EDOA 4RO0A 1RPNA 3JQFC 3GN2A 5A3JA 3PQEA 4R54A 5IXYA 3DONA 2OXIA 3ZNQA 2Z1NA 3AM4A 4IPTA 4D42A 1Y9AA 3I9LA 4CMJA 3GC6A 1DEHA 5JBIA 4BNYA 3V1UA 3NKLA 4J43A 1GFSA 4Z0TA 1GZ4A 1U4OA 2QRJA 1MC5A 4ZD6A 5BNFA 1ZK1A 2VCYA 3SLKA 3RKUA 2GPTA 4IINA 2EGHA 2JJYA 2J6IA 2PGLA 3KYBA 3ORFA 5JDCC 4ROSA 1C1XB 5IF3A 3PRJA 2Y68A 1PSDA 2R6JA 2WMDA 3HFGA 4K1LA 3LSYA 1P77A 2W98A 1MLDA 2AE1A 4BS9A 1BGVA 4GX0A 3UHAA 2BI8A 3O8QA 2BKAA 2IXAA 3VAZA 2UDPA 4HFRA 1B14A 2I66A 3AFMA 3DMYA 2O3RA 2HMVA 3JQ9C 3UF0A 1I24A 4FFMA 4HNGA 4RF2A 1C0IA 1P1RA 2UVDA 1XU9A 1EE9A 3ICCA 4CQLB 4XRGA 1F14A 1UUFA 3R3JA 4WASA 3U9LA 1V3UA 3RFXA 3PHGA 4IXTA 4LRSB 1BWSA 2GCGA 1FDUA 4QX6A 1TT7A 3IP1A 4CMBA 4R1TA 4JJGA 4E3ZA 5KJ6A 4Q9NA 3LT2A 4F45A 4S3MA 4YJHB 4BO9A 1KVRA 3FTNA 2GN6A 1Y8QA 3I5MA 4J4HA 3KYCB 4E6PA 1N7GA 3DBLB 3IKVA 2VRCA 1UXHA 3O9ZA 4O59O 1R66A 2Z1MA 3R1IA 2I3AA 5CP8A 3W6ZA 2G1UA 1ZH8A 3DB2A 1VC2A 3TPCA 3C7CB 4Q39A 1VSVA 4JK3A 3VPGA 2I9PA 3GVIA 5JC8A 4R4JA 4CM9D 5KIAA 1XQ6A 2YV1A 3ON5A 3W6UA 1DAPA 1YH3A 5CEFA 5ENVA 3TF5A 2ZYDA 2G76A 2CZCA 1BG6A 3KRTA 4IZHA 3UOGA 3H9GA 2VQ3A 1U5CA 1NWHA 1OFGA 4I9UA 1XA0A 1E3WB 4CUJA 1DLIA 4FQ8A 1LU9A 2CF6A 3LC2O 2I99A 4OXYA
chains in the Genus database with same CATH superfamily
1Q1EA 1TYBE 1QNFA 2IWHA 4MOWA 3X2EA 4DQXA 2ZB8A 5JVDB 4IDEA 3X1WA 5FTWA 2CUTA 2F3SA 2UU9B 2PR2A 4HX9A 1C3JA 2ZEJA 4BVGA 4Z7NB 1ODCA 1GGJA 1YJ8A 621PA 4F46A 4MH0R 3Q9LA 5KHLB 2ZSUA 3NWPA 3PVSA 5LA6A 4MULA 1A3CA 1FP1D 4E5PA 4OI0A 1Y0BA 4JQCA 3WXBA 3ACBA 2Q29A 2XMDA 1ODFA 2SHKA 1CRQA 1Y37A 2UVQA 1GCOA 3PSHA 3FFTA 4O3MA 4CDMA 1VJ0A 3O7MA 3FYUB 5EYPB 5A71A 2C78A 3LYAA 3UYKA 3GVPA 1V7QA 3GEEA 1PZEA 1X8LA 2XODA 2GYYA 2ZE8A 2HK9A 2GTHA 4F0JA 2IYXA 4GOOD 4X7BA 4ZCMA 4MTLA 4JI0B 4QC2A 2XE4A 3SQXA 3BXOA 4DCNA 4REMA 2D1FA 4PRYA 4F11A 3LRPA 4QUGA 2ATCA 4QASA 4QJ5A 4JZYA 4AB1A 3ZLTA 1NSTA 3G82C 4WRRA 2Q4EA 2EKLA 1RJ9A 2I1VB 2P5UA 4H7DA 4JD5A 1T2DA 2W2KB 3U16A 1BGWA 5CFLA 1OU4A 1ZJ5A 2JFNA 4J3FA 4TRMA 1PG0A 2LW7A 3K35A 3LPDA 2FSFA 3GFGA 3VAYA 1PWZA 3G13A 3HC7A 3CS3A 1JYSA 4A0GA 3H8JA 3WMGA 1FSPA 1FRFS 2VP6A 3RF6A 1DAGA 3BRSA 5I8ZA 5K8UA 4GBED 3GX1A 3O90A 5FWYA 1B8NA 3M3HA 1Z35A 4RQTA 2BC9A 3PFWO 2G5PA 1BGXT 2J5XA 1RQRA 2ZBUA 1MC4A 3D4OA 2REOA 1X8KA 5AJWA 5EP3A 5EMNA 1BDIA 2QBYB 4JQZA 5J4VA 1GFZA 1NVVQ 2OHOA 3AETB 2AG6A 3Q8KA 1YOVA 2C54A 4BZZA 1U3WA 5AJZA 4R5HA 1FNSA 3AX6A 3EVDA 5THKA 4CV3A 4NCJA 1V8ZA 1C8BA 2VJAA 4G6ZA 5KQGA 4RFLA 1I2AA 2B2XA 2ZI3A 2I7CA 4D9CA 2H11A 4AJEA 1MP0A 4GNKA 3AW9A 2ZREA 4BWVA 3UMCA 3OZTA 5CJJA 1T43A 1ZN2A 1HLGA 3DAGA 4M37A 4NECA 4UXIA 3SXUA 4DILA 2XB6A 1U6IA 2DQYA 1KEPA 2DU8A 4HZUB 1L5GB 1RLUA 3TYXA 2A9QA 4EW1A 5B4VA 3U60B 2ZIAA 3ABQB 3I6QA 4ENPA 1Y4UA 2DLNA 2QRVB 3L0IB 4K9QA 3OJLA 3L93A 4XI9A 5JT1A 4MKGA 3SZMA 3K9CA 4GPTA 3IEPA 2D1YA 4R98A 1V4BA 5F73A 3RFFA 4ZDJA 2FP4A 1SAYA 3R7SA 4N7BA 4DEVA 2GK4A 2IY9A 3W6OA 2FMTA 1MHTA 4IH1A 1DG1G 1VL6A 1Z7YA 3CLKA 3G9XA 4I5EA 2LCIA 4HYEA 2WJ4A 5CIWA 2G71A 4QATA 4XWAA 4ZAZA 5IW8A 4BAZA 1DC4A 1BCSA 4KLCA 3W8EA 3HM2A 2WZBA 4XM0A 2QQEA 2A84A 4B3JA 2B4RO 1SKBA 4NPHA 3U3KA 1R0CA 1B00A 5FULA 3KHUA 4N3GA 4BIIA 1WZUA 5BXYA 1Z4NA 1KS2A 4I9NA 2QP4A 4O1HA 5JI3E 3ST7A 1TQ8A 1M74A 4NJEA 4UHKA 5CJPA 1Z0UA 3ME5A 2ZRMA 4ESOA 3UAYA 4YDRA 2JGNA 2VP2A 3BGIA 3K3PA 4F60A 4HKTA 5EIEA 3IB6A 2ST1A 5LQJA 3H1TA 3KB8A 1W49A 1PGOA 3H86A 4ETWA 5EJAA 1U28A 4FSDA 1TGYA 2C82A 1Q3HA 2HNKA 2TSYB 2XDAA 1RQ2A 3GH3A 3GRAA 4JJ7A 3TH5A 1XRJA 3K71B 3J7AC 5CXUA 1JEEA 2PLNA 1WB5A 1CLEA 2H1HA 3IV9A 1CUZA 1CT9A 1OFIA 2RGNC 3P0FA 4G37A 2AZMA 3WJ7A 3ZCTA 4ER0A 4NH0A 3UJCA 2PKRA 2GLUA 4BGVA 3O4GA 4RUKA 2FHPA 4PZ0A 4UEWA 2P4UA 3I28A 2HQSA 3VHRA 4WUVA 5D86A 1OH8A 1E9FA 2QMQA 2OQIA 5AHOA 4HG2A 1QX3A 3PQ7A 3B38A 1P7ZA 1Z74A 4IZOA 4X7PA 4DANA 4Q00A 4DIOA 5IT4A 2W6JD 1QLJA 4JS0A 2BM9A 2GF0A 3RHTA 3IUBA 4N0MA 4PYMA 4HDCA 3ILHA 3QFRA 5EMMA 3OH8A 1NW8A 4PHGA 2K87A 2YXDA 1ZONA 1Q7TA 1NBMA 1SHJA 4IJQA 3FHTA 4JLNA 1XCMA 1ZR4A 4QGAA 1W9MA 2GHTA 4BLWA 4LXTA 1KI8A 3AIIA 1MDFA 3A37A 4NC9A 2XD9A 3OLXA 2R7NA 2IJGX 1WPRA 2AIRA 4HWTA 3WI7A 2OB1A 3HEBA 5CLQA 1C41A 3HCPA 1H1TA 5CDUA 1I5EA 4YWJA 3FF4A 1T1GA 1DP4A 4R0NA 3FB4A 2PZJA 3FIJA 3EVAA 1N1EA 4ERXA 2XUHA 4IUDS 3ESQA 1YXMA 3LXXA 1E60A 1RYFA 3LQYA 4MVWA 1J8QA 3QTLA 5TY0A 1R6DA 1YULA 3DD1A 1CUCA 5FB3A 1ODIA 1OZ0A 3GJQA 1R10A 1TI7A 3SBDA 4M76B 4E5VA 4H0NA 4XVQA 2AJLI 3AUAA 2W6QA 4I81A 3HBNA 3HFJA 4II2A 2R0QC 1GGKA 1Z6QA 1TKRA 2VHJA 3EXHB 4DJ5X 3FB1A 2DB3A 4Q3AA 2E82A 4JL8A 4MVXA 4Q0MA 3EDRA 1ECGA 4L2IA 2WKQA 3V4VB 2PZKA 4LC1A 3P27A 3QA9A 1ND6A 1FPQA 3H5IA 2XWJI 1KP3A 3KSDO 4LDAA 1PK8A 2AWOA 3TR0A 5JATA 4NRDA 2NU9A 5IDXA 4FWIB 3O8QB 1T3HA 2N9UA 2XCOA 3F9RA 4O33A 1U9IA 3TLGA 3VHXB 5B3KA 8AT1A 1T0BA 1Q1GA 1TQDA 1OLUB 4QYSA 4R51A 4H1HA 2Q3HA 5JD3A 1AA6A 4QFMA 2N1BA 4WT7A 1G8FA 4RTJA 3O4RA 3BXZA 4E4RA 3I9V6 2H06A 2CXTA 2PGDA 2Y66A 5HZMA 3ZWAA 4LE2A 3TKYA 2IHYA 3EEQA 2GD2A 1V8BA 1XD9A 2RAFA 1HYBA 2YYAA 3PFKA 1OUMA 4WKBA 3UTCA 2AEMA 5B57C 2R1VB 2R6ZA 3F5SA 1RMYA 1E9DA 5GONA 1HK7A 2P3QA 2G6BA 3AM5A 4DA4A 1JSZA 2FPIA 3BC1A 4HP8A 3PENA 4HRVA 3H0CA 3KVNA 2QJTA 2X2PA 2OUKA 3FRHA 3L0SA 4CEIB 1LX7A 2WAOA 2IS4A 4YCCA 1T1IA 2GN1A 1HQKA 3ND6A 5EINA 3TQOA 5IVPA 3QUTA 1F5NA 4EVRA 3NHYA 2QN8A 1DWPA 2Q3JA 5H59A 2OOKA 3THWA 2ZG6A 1WD7A 5CFQA 4JEIA 4YLEA 4PIVA 1RLOA 1Q83A 4EHDA 4YRGA 1G0NA 2BGRA 2V65A 3BTSA 3G17A 3TRJA 5CFOA 4YAUA 2HNAA 5BR1A 3K5HA 5FOUA 1P7YA 4JBHA 1SC9A 1DBIA 1ZCFA 2AHOA 3IVAA 5A05A 1G8MA 3PGMA 4IDDA 3IDQA 3IQEA 1FQOA 3TO5A 4LW8A 4CQLA 4RGVA 1B7GO 5JAIA 3EXIA 4H4EA 4HRAA 5ABPA 1CUIA 1BHSA 3Q7QA 3AKDA 4LE0A 3NYRA 4LCBA 3TJMA 4KNWA 2CDCA 5IFLA 3PXBA 2AD5A 1KSHA 2PX4A 4JJIA 3N7UA 3HG7A 1ZRSA 3CZAA 3PEEA 3V48A 1RC8A 2F17A 2P1DA 3HJHA 1OE0A 2VQ6A 3BZBA 1Z0JA 1ETHA 4XYGA 3CKYA 4NLLA 5CUQA 2JLXA 4GMHA 1CDZA 4UEOA 4D3SA 3WK7A 4NBLA 3QF4A 2N42A 1WQ4A 1D0VA 2XGMA 1DC5A 2PKQO 2XRYA 2YQ4A 2B30A 3BL5A 4IO0A 4YXWA 2VHVA 2GAIA 2VPPA 3DBLA 3NWEA 1NVWQ 3QU9A 2XNJA 3ABIA 1V41E 2Z3ZA 1QUEA 4QM7A 3FNRA 4XFDA 5FWDA 3LTEA 1YZFA 1OX4A 2X0JA 2R8OA 2VT3A 4A3SA 5I7VA 5HFNA 4A92A 4S1WA 4PG7A 3AFIA 5TQVA 1TM7E 2NT3A 5ENDA 1GITA 2GEBA 4IKEA 4M9QA 4LOJA 4MWTA 1SG6A 4QAQA 1G16A 3RG2A 4CKXA 4DCVA 5BSRA 3VH4A 2Q5CA 4HZIA 1GTL1 3BEOA 1EBFA 3N75A 2AUTA 1H1LB 5A4IS 1UKCA 1OZGA 1C9KA 2QD4A 3KJNA 5FFFA 4UE6A 2MR6A 2R1ZA 3JPWA 1R6UA 4HWPA 5B7GA 3AO0B 1K3UB 4I1PA 3L4SO 1WP9A 4MWZA 2O5RA 1RQNA 2EJBA 3DVRX 4D45A 4OXQA 3HNOA 2FUEA 1H2RS 2JBWA 3F6EX 5B55A 4H7PA 1MABB 2AOUB 3LKBA 2DGDA 2VVTA 8GPBA 1W47A 4X3OA 1AQLA 1DCTA 4RKFA 4WZBE 3SOZA 4RZXA 1G21B 2I6QA 3RVQA 3BJEA 1AKVA 3SZLA 8ADHA 5AO9A 2WSBA 4GOND 2JGMA 2R8ZA 3CLSC 4G1BA 4KVZA 1ZRNA 4JT9A 4MDHA 1D5CA 1LBHA 3O1HB 4L8GA 2ZCUA 4NAVA 4CF7A 3DBHB 1QYXA 1NXTA 1QLWA 2ORED 1KGDA 5B7QA 3FY4A 1GA6A 4BX8A 1TIKA 1T24A 5TRTA 3F90A 1I4OA 2OGSA 3L4KA 3SJAA 3KYIB 2VPIA 3CZ4A 1G291 3FSRA 3CX6A 4JLOA 4MR7B 4FHFA 3IXMA 4F4CA 4W5QA 4QTUB 2VDRB 5TMDA 4BFTA 5A4FS 5C7YA 4M38A 2ARKA 2HT1A 4E32A 1O8CA 5AESA 3D5QA 3NHMA 5DP1A 5LIRA 1YZLA 2HU5A 5HF9A 1IN5A 1LZKA 2Q5OA 4CDGA 1SQFA 2WINI 1EX6A 2CFRA 3AY7A 3OA0A 3H18A 5LBTA 2HWKA 4DA9A 3KIPA 3KR2A 4DDTA 5GJVC 2GNAA 4OLHA 2HA6A 1YZYA 1JBEA 3WHIA 5BN4A 5KVCA 3MSCA 4RX1A 1YMUA 3C7KA 5REQB 1QTQA 1K6MA 1NAHA 3RFVA 1WSDA 1S4MA 4B3MB 3V7WA 3B1FA 2W2LD 3L6OO 2GR9A 3OQIA 2XNDA 2AWNA 3FETA 1W9HA 3CUEF 1AHHA 3JYNA 3R6GA 4D6PA 4JLMA 3VDRA 3IUNA 4H3VA 1M8PA 3GPLA 3GUZA 1JIJA 1N6KA 4OGKA 1W48A 2YWGA 5ILOA 1W5BA 2WM3A 3KL2A 1X1SA 2AOXA 5B30A 3JQGB 2QPAA 1E20A 4KXXA 2GNOA 4RF5A 4E5MA 3ONDA 2PFSA 1T36A 3WLHA 4D9HA 5J9FA 4O2BA 3T41A 3EH1A 4J0JA 4Q9HA 4U5XA 3EC2A 4QNNA 1EP1B 1G42A 4MHOA 3LIPA 1SR8A 3HXTA 4BVBA 5KNBD 3AVOA 3E6AA 3ZY4A 2AFHA 2XB8A 4KBGA 2XUAA 3RWOA 4IW3B 1LRKA 4Q9JA 4BP9A 2QTLA 2OGZA 1OZHA 3PQ6A 1FVOA 3ADOA 3RS2A 3L18A 4LZZA 1ZU5A 1C2YA 2L0XA 3OPQA 3I5UA 3FW1A 4Y9UA 5AK5A 4Q03A 5IAJA 3W04A 2W6PA 4TS9A 2QRVA 2QL6A 1RHJA 2H5LA 4M2LA 1HEUA 2CHEA 3DMPA 2BEUA 1XMSA 1Y3HA 5IT0A 1ISMA 1UDRA 3FLEA 4JVLA 3L0BA 5CLJA 6GPBA 4M21A 5KWJA 2IODA 5KTMA 2O48X 4HXEB 3KUUA 4D92A 1ZQ9A 3CLSD 5D01A 5HSGA 1NBAA 4UE2A 4IAOA 3LBYA 3UK0A 4A36A 1KFEB 2QS9A 4LF7B 1KIMA 3CB4A 3PPVA 4DZRA 5DIZA 5JNUA 1EFPB 4IH4A 2C5AA 3DE7X 4RAQA 3ZLVA 2PX8A 3Q9UA 4KN6A 1H05A 2POCA 3DLHA 4AX4A 1WPGA 2PUWA 4U7JA 1HE3A 2AMJA 3GJSA 3ZXXA 1IPEA 1XLVA 1I80A 2GEKA 4GYKA 3JQQA 3WKAA 1GPKA 5C8YF 4YMHA 2VATA 4L8FA 2EG5A 4REOA 4RHXA 5AUNB 3DT9A 1T9HA 5CB4F 1JJAA 4O5OA 4KREA 1UBSB 3BMCA 1G8AA 3BGOS 3SQWA 2OCYC 4MJLA 3KKKA 2I34A 1AXRA 1U81A 5MN4A 1EFKA 4RTLA 3P9YA 5C5CA 4QDOA 2AF4C 4P53A 2YL2A 4MWDA 1D6SA 3M5DA 4OQYA 3U7JA 3VR6H 1OWOA 4CQJA 2OZVA 5EZYA 4UBKA 3ZHRA 4U0KA 3C1AA 1XB2A 1GP2A 4BLOA 1KYIA 2Q8QA 4DR5B 1A2OA 3HYCA 3EQ6A 5FBLB 5AW1A 2WFLA 3MRSA 3TB6A 3WLMA 1SU8A 1LF5A 3I2FA 4QOEA 4RMNA 1PJRA 3PXAA 3MUOA 2O1XA 3DOHA 3CW8X 3OE7D 5TT1A 2EWVA 2ZKLA 1QR6A 3R9KA 2RBEA 3G59A 4AMGA 1NNLA 4TVSA 1HL3A 1TVKB 2QG9A 3I01M 1U0FA 2X1MA 3BVPA 4BN5A 4GAEA 1YB2A 3QTBA 2ZR7A 3TQHA 1U98A 5IK2A 5KWEA 2AH5A 2O50A 2YICA 3DGEC 3FHCB 2XWBF 3HNRA 4LRWA 4C0QC 3AFOA 2HRZA 2ZT8A 3I8SA 2YWBA 3JQCA 3M2PA 3EPHA 1MFPA 2ZRFA 1RAAA 1FP4A 5KAPA 3ZWYA 4HPJB 5KTKA 1EVKA 2ZJ6A 3AP2A 4UXHA 4OP3A 1Z45A 1BWQA 1VBKA 2VFAA 1S8NA 4TMWA 5CX1B 1PV2A 2C9YA 2YWXA 1E1CB 4J76A 1YJXA 4YUYA 3MBKA 4KXQA 2P2ZA 3V1TC 1M2EA 1XEAA 3OFNA 2FPMA 3BTOA 3AEQA 1THGA 3ORSA 5HF6A 1I1QB 2MYNA 2VHEA 5SZJA 3WIVA 3ZI0A 3A0UA 3DOCA 2NZJA 3C98A 1QJCA 3RUAA 2YV4A 1QIHA 1L5NA 2RHHA 2FPOA 1CBUA 2P5SA 3WLPA 1SJ9A 2N0SA 5FLYA 3WP1B 3WA7A 4BNJA 5A1JA 5H68A 1BX3A 3TSCA 2WHPA 3TLJA 4KE7A 2W70A 1JYEA 3QBDA 2C9ZA 1EEHA 4IIVA 1R7RA 3D8UA 2WSMA 3BIJA 3E58A 2ZYWX 4CM8B 2D5CA 2QUAA 5BW8A 3GZ4A 4DCCA 2ZJ7A 3ZDYB 2IGTA 4TM8A 1VCHA 1C1HA 3OZGA 4A7PA 1F8UA 2IDKA 3LF1A 3L1JA 5TIIA 4I2VA 1ONSA 2NO6A 1C4OA 4U02A 3TTSA 3T95A 3VYRB 2ZK7A 3P2OA 4YROA 1L7VC 3BRWA 3PC8A 4WXMA 2C2GA 4MP3A 1LVHA 3UOAB 1U8YA 2J07A 3LNTA 1BE0A 1DOHA 1IZ7A 1V71A 3H13A 4Q21A 5BP7A 3ICEA 4AW9A 2XX3A 1QMPA 1U9IC 3M6FA 2V59A 1V7CA 2PGIA 4MUFA 2YJ3A 4GVLA 3BOSA 4XD2A 4G0PA 3WK9A 1E3LA 4RE5A 2BEWA 3FVQA 3E9ZA 1XWIA 3NTXA 4KDEA 5DLQC 5HHTA 4I66A 4CMIB 1HRDA 4DY6A 3LQ1A 3HV0A 2JASA 2YHIB 4CIYA 1D6MA 1MJHA 1GPJA 4H6VA 4E1AA 4RKEA 4ZYLA 3GEHA 2VPTA 4WLUA 1E5VA 1C9YA 1E1KA 1Z7EA 4HBZA 3AY0A 3VSAA 1KFCB 3GDWA 1VIAA 2ZULA 5KNDA 2VF2A 2W8BB 5HM8A 2D1QA 1I4LD 1KYXA 3QJYA 3OOEA 1S2OA 2O54A 4L4XA 4UUBA 4FKZA 5TGDA 2J1LA 2QROA 1G8HA 3AGQA 4JBXA 3C4JA 1XJWA 1EQAA 3DL2A 4QWWA 4ZICA 1K4KA 4K6GA 2RKOA 3QKSB 4L75A 1DO8A 1WCV1 3BN3A 3TDNA 1PT9A 1KY3A 3HLTA 2HDWA 4LYEA 3K32A 4NYIR 3D8NA 4UPDA 5CBPA 1Q1AA 5JLAA 3EVTA 3SWWA 5JIBA 1X9IA 4X84A 3ZE6A 1CSEE 1Z29A 3OZ7A 4J1TA 5AHKA 4ZZ3A 3WFZA 3EB9A 1NBMD 4CCWA 1TL7C 1BVUA 4LVOA 2P67A 3IRUA 2MU1A 5AXCA 3PUVA 6AT1A 1BS2A 4HWRA 1XK7A 2J4FA 4OHCA 5IN4A 4I46A 1D6JA 4JYAB 1VRCA 1YNSA 2C7VA 2FPGB 2IPNA 3QBJA 3OM8A 2ESRA 2L82A 1OLSB 1TEZA 1N6LA 1VP9A 2XYGA 3BH7A 1XIVA 2OL4A 5DIFA 1Q92A 4MZDA 3W9BA 4NE7A 1BNCA 4NMXB 2FHSA 1Q2UA 5ERGB 2WF9A 2O7RA 4NU5A 3WP0A 2FZGA 2EVWX 1ISGA 1MVOA 1XNRB 1YV9A 4GICA 2A78A 2E9SA 4W4TA 4ZQGA 5KU7A 1E1LA 1GU7A 1PZHA 2AMFA 2VPZA 3B78A 4TLAA 1JHZA 5ES3A 2EWWA 2UKDA 4XQ0A 4G4SO 4RTMA 1H5NA 1HI9A 1O4WA 1VXOA 4BNZA 3NIFB 1YBVA 1YS9A 3GL9A 1WW8A 2G9VA 4ZOBA 5DX8A 2WTAA 3G8DA 1KEKA 3F2VA 3R3WA 4PO8A 1E2HA 4FKMA 1L7DA 1PR6A 4WCVA 2DFDA 3HXPA 4YP1A 5JE8A 4AU1A 4HQNA 4QEZA 5ED0A 2FQXA 4B2IA 3QYPA 2IU3A 1CVIA 3A4IA 3BUSA 4MW0A 2M1ZA 5DHUA 1SHKA 4N5HX 2WWTA 2QZZA 5JSYA 1E1QA 2FZKA 1K5PA 4P4SA 1MF7A 4FMCF 3RUEA 3BMXA 3K5IA 1NXQA 4OO3A 1C0KA 1LPAB 3UAGA 3U7IA 1UMDB 3R3SA 5HUJA 3WR5A 2UZ0A 4K6HA 1XRLA 2CDAA 2F9MA 3PQ4A 4Y1RA 3EFOB 2PSDA 1I4EB 1P1JA 3DDNA 3HKEB 1WNFA 3C97A 1YDFA 3KV3O 2OM6A 5DT2A 3TPZA 4HQOA 5C1OA 3ZLUA 2AOUA 2ZIXB 4EG1A 5KMGB 1FFYA 3UWOA 4W9MC 5IJXA 4PZUA 1ADBA 1JJBA 2ONYA 2FFJA 4RZ3A 4OKNA 4ENTA 2F3RA 3TNLA 1RJEA 2J59A 3ERCA 2GAAA 3A6LA 1E4OA 2X15A 4P4TA 1EUDA 5D1HA 3ITKA 5JJ5A 1N0WA 1VJDA 2J3LA 3ZWXA 3ES9A 3EW9A 3GDOA 1LQ2A 4G8CA 3OC0A 2R85A 5AXAA 5H3LA 3IBCA 4N39A 1PHPA 1H0KA 4YONB 4S0ZA 5G3YA 1ZHHA 1FNDA 1DBSA 5FOXA 2JGAA 2G7ZA 1IM2A 3VZDA 4K2HA 1SQSA 3RJMA 4BNDB 3JQAA 3MW8A 5IWCA 3KJXA 4PGHA 4E5NA 1JR3A 4R1UA 4X0EA 3T54A 5GJCA 1DIOB 4IV5A 1JAZA 3DR5A 3SJBA 2BTQB 3GEGA 4KXUA 4OEHA 3GFQA 2YHBA 3RTDA 2PBZA 4HXGA 4LJ8A 3TQFA 1VLQA 4QYWA 1Z2PX 4Z99A 5HMLA 3C6BA 3FYUC 3QV2A 2ZJFA 3GR6A 4FDLA 4TN1A 4YN3A 2FSVA 3PWTA 4BE7B 1NNEA 3HMKA 4G0VA 5HZHA 2GEVA 1VMEA 1M5UA 1ORDA 2BGIA 1KFBB 3IUJA 2WKWA 1HYQA 4J4TA 5KEIA 2V7QD 4MWGA 2P6MA 3TTYA 4ZV4A 2Q3MA 3NHZA 4XPIA 2B1GA 5EQJB 3ZJYA 2DEUA 1H6BA 1L7BA 1T8SA 4Z9FA 3RK0A 5DTIA 4JQOA 4H4CA 4PAGA 1TT5A 3RRFA 1SOVA 2ZI5A 3ESZA 2ZYRA 3VO1A 2J5KA 1TO1E 1TW2A 3ROKA 1DDOA 1DJLA 1N0HA 2WLTA 2G09A 3CV3A 3IQDB 2YUTA 1BN7A 2IA5A 5TGTA 5LP6B 1FJXA 1OX6A 1EFUA 2FOLA 1V1JA 4RVDA 3THXB 1JIQA 3EULA 3CRQA 1OTHA 5AK0A 4LYFA 3CVVA 4BUJA 1AB6A 2PS3A 4YXWD 2HMAA 3S68A 1T4MA 2H07A 1QC5B 4Q4JA 5ALRA 1ZDMA 4MEAA 2OV2A 2LRHA 4F4IA 1HYGA 4RXTA 3S6JA 4P7GA 4KIUA 5AKKA 5EQTA 3BIWA 3CWZA 3MZ0A 3O3NB 4ZAFA 1NY5A 1J56A 2CJFA 3FPHA 4IGFA 1VYTA 3VZQA 2FMKA 3RV3A 1IBSA 4KGVA 1OA0A 5BURA 1G21E 3NOOA 4IZ6A 3J81A 4WWHA 2I1QA 1EVEA 4L9SA 2H4HA 4HO1X 2GCPA 2LWIA 2YBDA 4HAIA 5FOVA 4BRSA 2H54A 3G2PA 2RG1A 5C8YB 1FNBA 5J4YA 2BE7A 4WINA 5H16A 5CB4B 4G0XA 2VNIA 4XVRA 1ZITA 4KWCA 2WDZA 2ANBA 4WLEA 3OWOA 2IUUA 4CETA 3HSSA 3Q72A 3ROGA 2R8BA 1OASA 2FUG1 1J8MF 1E2MA 1T9GR 2WTXA 4O1IA 5AI5A 4YUZA 5FUVA 3FUXA 2CXXA 1VHTA 3CPJB 3FVWA 1IK4A 3ETJA 3G68A 4YP7A 4TYYA 5EMJA 2CFTA 5DGHA 5FTKA 3WDSA 1YVEI 5JXJA 1AQUA 1TVEA 2J6BA 3AEYA 3MINB 1KY5A 4JL6A 4R0VA 5EIWA 2ZJ3A 2MINA 4YH1A 1YBHA 1M8JA 1BYUA 2ZITA 1ZMRA 1XWFA 3R3ZA 4ZWNA 4AP5A 5FQOA 2PANA 1PKXA 3AB3A 5DHPA 2GHRA 2AQHA 2WYVA 3KXLA 5I9MA 5J1SB 1ONOA 1YR7A 1SEVA 2C1XA 4QOIA 1FE8A 5ELXA 4ZAYA 2G6TA 4DWOA 2GZMA 3T3PB 4B31A 4F6CA 2G04A 4I9GA 3MHPA 4EK9A 2O0HA 1Y82A 2F62A 3VI4B 4P4UA 4MKZA 2IOFA 4HN9A 4NBKA 1PBNA 3QBVA 5JS1A 1PFUA 4M46A 3K9NA 3H75A 2RGCA 3FYSA 4TTJA 3G49A 4I36A 1PGNA 4A0SA 2QLTA 3CH7A 5GGYA 3QVUA 4E5DA 2Z58A 1QG4A 2J5RA 2IBSA 1U8CB 1UKBA 1YOBA 2GUGA 1OA1A 4KRGA 1ECBA 2JGDB 3IUPA 3BS4A 2DQSA 4TMZA 4CIAA 2IYWA 3GROA 3LU1A 4OU4A 4V0NA 5HDBB 5JOQA 4K0KB 1M1YE 2W2QA 4M6WB 4G1FA 2DH6A 5LC1A 2NVBA 4D0LB 3FCUB 4B3XA 4LXHA 4EIWA 4OB8A 3ABOB 4OB6A 1RBQA 2RMKA 2GEFA 4GR4A 3KPUA 4RMGA 2J7PA 3Q5DA 5D3KA 3ROXA 4AF6A 1D2CA 3OLYA 4CKEB 3E0XA 1TVKA 1A4RA 3W2EA 2XNDD 1PZMA 2AOVA 4GKVA 3N76A 1N2HA 4MJ3A 3U80A 4AYXA 5D84A 5AVRA 4L16A 2Q4OA 3NBFA 4L5JA 4L5CA 1J2UA 3KXKA 5HIJA 3U7GA 3T1VA 4MS3B 4E1BA 4WDQA 3L8EA 2ZYTX 4BKQA 4MQLA 5ULLA 3CIFA 3WK6A 3JPYA 2RBGA 1CZOA 5FEMA 5KSPA 3GWZA 5C31A 1JEOA 1DAKA 1ONNA 5GY7A 2KSQA 3UIEA 3TLMA 2WFZA 2NTEA 2EF1A 1T9CA 3AZOA 4JP2A 4ZU6X 1NE7A 2EFDB 4XCQA 3IIKA 2BHRA 1N2JA 5CURA 5CX1A 3DZCA 5IEBA 1QORA 1KO4A 1E1CA 3JQ9A 1KAHA 3D4NA 4TTQA 1GKUB 3CH6A 3TIIA 3TZKA 4ZOQI 3GG2A 4YRNA 3EPKA 5KWVA 2RH4A 1QLHA 1CB7A 2FLKA 3JW8A 2HA0A 3Q6MA 4NFSA 4G0UA 2P9TA 3K6JA 4HQ0A 1LLFA 4LGVA 5AXBA 2WU8A 3GGJA 2PUEA 2JEYA 3WGNA 1U8XX 4E5UA 4LXIA 3BE5A 1RXYA 3T7CA 4CUZA 2QK4A 4NYMR 1WLYA 5E38A 5F2NA 2CXNA 3ETGA 1MAUA 4U0JA 1I33A 2VYND 3L7IA 3B9BA 4E2WA 2XNSA 3QH4A 3A1SA 1UJ5A 5FBWB 2NMVA 2IZ7A 4UDOA 1L5HB 2PHZA 3OZVA 4JYZA 1OXBB 3C3DA 5GAJA 1AF4A 4D1YA 1YL7A 4OLBA 1PGQA 1YB7A 1CETA 5INTA 5JI2E 3AERB 3WFJA 1RBYA 4KH1A 4MUYA 4JKIA 3V3TA 2DERA 4RGYA 4X1OA 5H8WA 1EGVB 3EF0A 2ODEA 4DC1A 1IN7A 1JHAA 1PWHA 1TK9A 3MMZA 4A4DA 3PS9A 3RBVA 2PT9A 4Q4CA 3H1EA 3IUQA 5IAEA 4DPKA 5AUOB 5F5XA 1N3IA 2JH9A 1P18A 5JSZB 4N03A 2IIPA 3A6GA 1M8KA 2V6FA 1FCJA 4AVYA 1ECLA 4XVUA 3C1OA 5JMWA 1AMUA 3H0EA 4R8RA 5ALYA 4EG5A 3PGKA 2XH8A 4MW6A 1OLXB 1L7PA 4A10A 4Q5IA 3RFCA 4QSHA 3UMJA 3CU5A 3V4RA 2CN1A 2IEAA 4AG3A 4PC6A 4AKTA 5GOTA 1QAQA 1D1PA 4KQIA 4C0AC 4EI9A 2PZGA 5J23A 2H4JA 2I6SA 3SYLA 4IO1A 2YHIA 3I2KA 3MRVA 5FL3A 4I1UA 4O08A 1Z63A 3A8TA 3OU6A 4RZHA 1ODTC 2Q1TA 1R6XA 1BQ4A 3OKFA 1RT9A 1QRDA 3FM9A 3D2LA 2O6HA 4M49A 3K92A 3QPWA 4DNOA 1LDGA 2D54A 3FFXA 4JWTA 3KWLA 1I9CA 1NC3A 1M5TA 3QXXA 2CK3A 3ITNA 3EDCA 4Y30A 3WHKA 1RFGE 2OFXA 3JATB 4IHAA 5ICCA 4FFWA 5E4JA 3AXSA 3S1AB 2VCHA 3FWYA 1I4WA 1MB2A 3LPAA 4Z5XA 2H1IA 3PT5A 1PNRA 4ASUA 3LWBA 4W1PA 4B7CA 1II8B 2O0KA 1JKIA 2PL3A 3EXEB 4XKJA 4KRYA 4D44A 1XXHA 3FGOA 5BN3B 3EQ2A 1P5FA 4FQ5A 3L8FA 3Q1LA 1MX5A 1OWPA 1QHHA 2FWJA 1SRQA 3JXEA 4NZPA 5FBRB 3R8CA 3HEMA 4DV1B 2X0NA 2WJJA 1ISHA 4RJTA 1WHTA 3Q8XB 4DNXA 4ZCPA 3KQUA 4DLRA 3ZWDA 2RC6A 1PJ2A 5GZ6A 4ALKA 4CMEA 1ZH4A 1A0OA 1YZTA 4RH0A 4QUJA 3RSGA 2OENG 1ZM7A 2COEA 2O5VA 4RHFA 4TXJA 1U0LA 3SZRA 5AUPB 3O4VA 2EWMA 1T6NA 4W1RA 3RG8A 5DNUA 3TE6A 3DM5A 1GR1A 4MDFA 1X2BA 3DT6A 4FMCB 3HCNA 4C29A 4RV4A 4C6RA 1XJQA 2QXUA 2IV2X 2EW8A 4GGOA 3P97A 1C3LA 2IY8A 2WV7A 3OFND 1W4LA 3KKNA 4DCGA 2XZLA 5L7TA 3WYEA 4KUEA 4AJLA 3DLBA 3LLVA 2EBUA 2ZBEA 4JKYA 3EG5A 4J8PA 3PXUA 2G72A 1OXVA 1Q57A 3I9NA 3G3EA 2XCLA 1NQ5A 4OXKA 4DYVA 1Z6XA 3EHDA 3KKMA 3HN6A 2Q3EA 1P2TA 2OWEA 4C43A 3GOHA 1MO4A 4U8HA 5KNCA 1JU3A 1RM5A 1UJMA 4MWOA 3GK3A 3SF0A 3TCXB 4CMGA 2VDPB 1PLLA 1KO1A 4CN8A 3WQQA 4QRDA 1VGQA 3UFBA 5D3QA 2P9FA 4PLPA 4WZAE 5ALZA 3DHYA 4MJXA 5HE8A 2VHTA 3L49A 3LDFA 3C39A 3CCCA 3F8WA 4EB3A 2W9XA 4RF3A 1QRTA 1DQPA 1UMDA 1NX6A 2DR0A 4K9OA 3EOAI 1YRWA 4NOJA 3BRWD 3FOCA 4BNWA 3CUUA 4YRTA 3PEFA 3AXTA 4P3KA 3HKEA 3JQ8A 4S1OA 4XLTA 5JRZA 3QUBA 4UBOA 1KC3A 2ALJA 1FTWA 2ZIXA 3CEHA 4AUKA 1Z7GA 2AT1A 4WXRA 3TIFA 2HJRA 3L0ZA 3FI9A 6NULA 3RTCA 1QK4A 4ZVQA 5JWHA 2GPNA 2OHFA 3P2IA 4QJIA 3W78A 4A03A 5JTUA 5M04A 1WKCA 4Q4HB 2ZSEA 5EXXA 1B41A 3UJ3X 1ZW1A 5A4KA 5BV8A 1I3MA 4HS9A 3D6FA 5CCEA 5AW3A 5C18A 1KQGA 4A91A 3FGZA 1ZNZA 2GERA 2C92A 2ZJ2A 4ME6A 4D4HA 1QANA 1IZ8A 2G80A 1KEEB 5EHGA 2BZ0A 2QUIA 3L79A 1EUCB 4KXNA 3FCYA 1T3LA 5KNDD 4EDHA 1H69A 4RKRA 3GZTB 3GT4A 4CCAA 2Y27A 3WGZA 2BFAA 1SFRA 5FTLA 4XEUA 1A9OA 1JQ3A 2B20A 4YX9A 3FOZA 4RTOA 1NPTO 5F5LA 13PKA 2FR1A 3AR7A 3GVXA 3RHZA 5JNRA 3WRXA 4ZO6A 2H5EA 2WNHA 2XMSA 2Y2VA 3DYIA 1D4ZA 1QV6A 2C83A 4PSDA 2O8NA 2XDQA 3HP1A 1T5SA 2BFDB 2WT4A 3L6UA 3ZZNA 2B4QA 2B7BA 2GMWA 1MQAA 3NBKA 2A5JA 5E9QA 2EC5A 2EJWA 5B37A 3COPA 3DDSA 4ZA2A 3ZVRA 3NOVA 4ML3A 1AY0A 1J0CA 2PA0A 2XHEA 2Y1KA 2AG8A 3K9GA 4PCLA 4RL6A 1II9A 5DGDA 2J9XB 4MEJA 4U7PB 4RKYA 5SV2A 1YRYE 2R48A 4GVPA 3GB9A 5CVCA 4C76A 4DMFA 1V4VA 1XMJA 1DHTA 2PH3A 5HJ2A 2HCRA 2IHNA 1JQAA 5EZQA 4C89A 2C1EA 3FNFA 5JCJD 1W0KA 2VXBA 3TFQA 3THXA 1KE1A 2P2DA 2LIVA 2DHDA 1CCWA 5C1BA 2ZVPX 2PUTA 2G07A 1T8WA 3KJZA 4LF8B 8ATCA 3MAJA 2V5AA 3EZFA 1CR2A 4RGBA 5CA1A 1X9HA 3TCNA 1G0OA 2IVZA 3N1UA 1TM1E 3ZV4A 4F2GA 4ZOCA 1KY2A 5EHIA 3GT7A 2HCTA 3OQBA 2CEKA 2OV4A 1YRLA 5B4TA 4RDCA 1YRHA 2OAEA 1GDDA 1LY1A 1WSAA 3WRYA 1W1UA 1UXIA 1FX0B 5C8YA 4BO7A 1LSSA 1E1QD 1I10A 1D2GA 3GOQA 2BOVA 4NEQA 1GXSA 3LKVA 4OHWA 3VKHA 3OIGA 1HE4A 5AKZA 1ISSA 4PFSA 3DNFA 5JZVA 5ED4A 4MO9A 3TZLA 1PJCA 3W5JA 3P9RA 5BNWA 1RM0A 3B70A 3BCUA 3N74A 2WU1A 4UPVA 5AM4A 2IEBA 4QJBA 2J87A 4UDNA 1Z2OX 2NUPB 1PQPA 4A2CA 3NASA 2OORA 2AN3A 4L4SA 5IN5A 5CB6A 2CNBA 2BGWA 1HFWA 2O8VA 2Y9MB 4YHBA 3MINA 3ENZA 3UGQA 3ZU6A 1TTQB 1JEYB 2BN4A 4YHHB 1BDHA 1L4FA 1XDBA 3RHSA 2QTCA 4CL8A 4O6VA 3ZHUA 2A0XA 4WN9A 4B3FX 1AD2A 3Q40A 1AIPA 2VP3A 3FOWA 4FT4A 3HJUA 4LMPA 1FNNA 2QPLA 5FUMA 1WBDA 4CL3A 1DV2A 5A0TA 3I5YA 1IQUA 1JSRA 4NL4H 2FK8A 3MOSA 1G9TA 3GFFA 2Y71A 1QO0A 3U3DA 1WPQA 1NG1A 1D9XA 3LL7A 2X3UA 3WQBA 5FO1A 4A6XA 4BTEA 4PTZA 4B3GA 1ABEA 2B34A 3ASVA 3RIEA 4JI6B 1NIJA 3JQAD 1J25A 5DCYA 5EI5A 4BO5A 4ZDKA 4HD8A 4PG8A 5EJ4A 5JPDA 1JR3D 3KT8A 2YR0A 4ADSG 3NM5A 4KQEA 5HZGA 4TRJA 1PYGA 3VGJA 4N49A 4G81A 4PGGA 4BFYA 3PDCA 2HWXA 5ELMA 4RPCA 4IUCS 4M6WA 1KU6A 3TNYA 2IRWA 1VL1A 2VJCA 2VDUE 2XI4A 4RVSA 1EA7A 4HHEA 1Y9ZA 1RJGA 3NKVA 2VDMB 1ACMA 1SD2A 3IGFA 4L0DA 4RVGA 3U49A 2BI7A 1SZCA 1RDFA 3FKSD 4XUGB 2Q9BA 4NEGA 4KJXA 1JKXA 2XLCA 3NTLA 3RIYA 4EPWA 4C01A 3QYJA 2YMLA 4AY4A 2L69A 1EP3B 1ISIA 1M1UA 2IWRA 4FD3A 1G7TA 4CCSA 4DMGA 1UPFA 1NE2A 4OL0A 2DKFA 4TLBA 4ER6A 1KZ6A 1RXEA 1TUEA 2HGZA 4I4TF 4X61A 4IWYA 2HQOA 4QQNA 4MS3A 5CH3A 1G6HA 1VCOA 2XF2A 3KV1A 2YUIA 2V7VA 4S2UA 3CNEA 3SC6A 4RIHA 3CG0A 3AYZB 1IAQA 2H9AA 3N8HA 2JDIA 2QN1A 1Y34E 4IVRA 4UZEA 5F2EA 5KCZA 3K4PA 4S35A 1R37A 5CNKA 5FUXA 5DSZA 2TMYA 4G41A 2XMZA 2AW3A 1XKXA 3COZA 1RZRA 1WM1A 3OICA 3QFFA 3EGXA 4I3FA 1NFFA 4XCVA 2H00A 3MAAC 3WOHA 1EM8B 4UHCA 3CMCO 1Z06A 4QUBA 4ZZ1A 1JXMA 1UADA 3ZDZB 3D3WB 1P60A 3ZHXA 1D1QA 1LFDB 5BR8B 3A70A 3TOVA 4B82A 2L42A 4BN4A 5JD6A 1TYCA 4D74A 4QQKA 2PV7A 3L7CA 1Q15A 2IDJA 2UUBB 3P2KA 2NUBA 1TYEB 3IT2A 5LD2B 5M2QA 1S2GA