2GDZA

Crystal structure of 15-hydroxyprostaglandin dehydrogenase type1, complexed with nad+
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
266
structure length
266
Chain Sequence
AHMVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALHEQFEPQKTLFIQCDVADQQQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHIKDMIKYYGILDPPLIANGLITLIEDDALNGAIMKITTSKGIHFQDYGSKENLYFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords NAD+-dependent 15-hydroxyprostaglandin dehydrogenase
publication title High-Affinity Inhibitors of Human NAD-Dependent 15-Hydroxyprostaglandin Dehydrogenase: Mechanisms of Inhibition and Structure-Activity Relationships.
pubmed doi rcsb
source organism Homo sapiens
total genus 104
structure length 266
sequence length 266
ec nomenclature ec 1.1.1.141: 15-hydroxyprostaglandin dehydrogenase (NAD(+)).
pdb deposition date 2006-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2gdzA00
1PEDA 1F8GA 4PZDA 4BB6A 2WE8A 4RPJA 4CQMB 3ABIA 3DZIA 4QFDA 2NVWA 1HDRA 5T67A 4BO7A 4R1SA 3ZWXA 4Y6SA 1FDTA 1DIRA 4Y9DA 1Q7BA 2HMWA 2OGUA 5DOVA 4BO9A 1SZJG 2QRKA 2AE1A 4GSLA 1HLPA 3VAZA 3F4LA 2QZZA 2Y67A 5CEEA 4CV1A 3ZW9A 4NU6A 2D5CA 3DHYA 5JC1A 2Q2QA 2YUTA 3H5AA 3TRIA 1SCUA 3ZV3A 4BO4A 1Z73A 3AUTA 4DC0A 1Z6ZA 1H6BA 2VNSA 3SX2A 1XG5A 2Q2WA 3I3OA 1AUPA 2TMDA 1ISIA 1VPDA 4Z3DA 4MIOA 1K2WA 2RHRA 3GQVA 1HWYA 4IXTA 3MTGA 1LEHA 4RF3A 2YW9A 3A28A 1ZMTA 3DZFA 3VVCA 2IYOA 1R37A 1V8BA 1ZUD1 3RSHA 3DZGA 4WOKA 4DQXA 3IKTA 4PZCA 3BMCB 4KQWA 5K6AC 2ZTUA 4R41A 3JQ6A 3FWNA 1XELA 5IZ4A 3GC6A 4OKIA 2EF1A 3GFBA 3LSYA 3WSVA 4BO1A 2FSVA 4H16A 3NEPX 2Y99A 4D0SA 3DBHA 4HADA 1Y7TA 3RFVA 4B7CA 3LC7O 3JYQA 3WXBA 4FB5A 3GA0A 1T2CA 4GX5A 4TWRA 1I30A 4ZQGA 1BVUA 3ADOA 2W8ZA 1CIVA 1GAEO 1LLCA 1UP4A 3JD0A 4KDEA 4NJMA 1P1JA 1CEQA 1PJQA 3Q11A 2VOEA 1PU2A 5COBA 1X7GA 2YDXA 1IL0A 2RBEA 2O3UA 4AJJA 4MO2A 3H9JA 2VWHA 5L9AA 5KVQA 4CM9A 3DFZA 3NGXA 3VKVA 2E6UX 3T4EA 4CLOA 5KOIA 1BGVA 4D44A 3BAZA 2EIHA 3GVPA 1LJ8A 2OP1A 3RASA 4L4SA 5JAQA 3MCVA 5KJCA 3EK2A 4FFOA 3NGLA 1C0PA 4X54A 3E9MA 3EZYA 4IZIA 3I4FA 4MVJF 1O8CA 4KMSA 1DAOA 4BQRA 1ENOA 3WWZA 3PRJA 4LGVA 2X22A 4QO7A 4DMMA 1YJQA 3M1AA 3VKUA 4XX0A 5TT0A 4YT8A 2ZYDA 2CVOA 3WB9A 3MJ4A 1U28A 1I32A 2Q4BA 2JAPA 3PGJA 3FSRA 4Q9NA 4YT5A 2EEZA 1WAMA 4WCDA 1EE2A 2OL4A 1SAYA 1YXMA 3DC2A 2IXBA 3QVTA 3ST7A 1U4SA 4QTZA 1EFKA 1LBEA 1MA0A 3ZNQA 5MGBA 1W8DA 1HL3A 4YPOA 1GY8A 3KYDA 4MVJD 3PPIA 4CMEA 3W8FA 5HBRA 3F3SA 4RQUA 5A9SA 2CDBA 3H8VA 2O7SA 1PQPA 1CDOA 1V3UA 5BSGA 3RFXA 1MXFA 2RCYA 1ENZA 4JQCA 4DTIA 2FPGA 4W4TA 3WGOA 2UDPA 3GDGA 3Q2KA 3UW3A 1BW9A 1ISMA 2P68A 1KBZA 1HSZA 3IDSA 4W9NC 1KVRA 4BO2A 1LQTA 1NPYA 3WOHA 3F5QA 4LMRA 1H93A 4C4OA 3TSCA 3ZNPA 2R00C 4DUPA 3UN1A 1GUZA 1GEGA 3WGGA 3RI3A 4BNGA 4D79A 3D0OA 3EGOA 3KLPX 3IP1A 3KXDA 3ZNNA 2GZ2A 1ZO8A 1A4IA 1JQBA 4N5NA 5DBIA 3AOEC 1HLDA 4E13A 4U8GA 3QY9A 4D46A 1HRDA 3LC1O 3JCZA 1U3UA 3BZUA 2Y1EA 3BYZA 3G17A 3CSDA 4PG4A 1B16A 5G2OA 3QWHA 1FMCA 4P8RA 1M76A 1V3VA 2G82A 1Z7EA 1EDZA 2RIRA 1E3IA 3VPSA 2EW2A 2YFQA 2C82A 2YY7A 1F12A 2FP4A 3ENNA 4GLLA 3WSWA 3MZ0A 4OOFA 4CMJA 5JDIC 3ZZNA 4ZVVA 4QT0A 4EDFA 2WYUA 3I9KA 4UAGA 1BXKA 3RBXA 3VTZA 1EFLA 2BELA 2ZYGA 3VH2A 1ZJYA 4WECA 3U9LA 4PG5A 1J5PA 1C1XB 2C7GA 2NADA 3TZKA 4QSMA 1WDLA 4M55A 4CM9D 2POQX 4PG8A 4YAEA 3D5QA 1E7RA 1PWXA 1IPFA 1Q1NA 1KEWA 2CSUA 3IJRA 2WD7B 3ZH2A 3MJVA 3OJ0A 1U9JA 3ANNA 3NTOA 2DVMA 3ON5A 5DDIP 4CM8B 4RVHA 5H82A 2NQTA 4DWVA 1A9ZA 1GZ3A 3H9EO 5AXAA 5FYDA 4ALMA 3PJDA 5BSHA 4IGEA 2NM0A 3QVSA 1DC6A 1KYQA 5BNIA 4CPDA 4IMPA 1NP3A 2HKIA 3JQCA 3PTZA 4ZQEA 1WZIA 9LDBA 3F5SA 5COQA 1E1NA 1N1EA 3F6YA 2E37A 3FI9A 3IMFA 5G0UA 3FBGA 4CODB 4ZJUA 4GWKA 4DIOA 3NT2A 1XQ1A 1PS0A 1VL0A 1E92A 1GZ6A 1P77A 4E5MA 3WX0A 4RL6A 4QX6A 2GDZA 4IIUA 4CMBA 3NV9A 3TL2A 1U7TA 1HDCA 1LX6A 4RGBA 4AICA 4J4TA 4EUFA 4OKNA 5F21A 1GYQA 4R1UA 1YQDA 1XGKA 2DT5A 1R12A 2WDZA 5F1PA 1D1TA 4NR0A 3BMNB 4A7PA 2HMSA 1WDMA 2Y05A 3CUKA 3ONEA 3AM3A 1ARZA 1LC0A 4L74A 5TF4A 5K0ZA 3LK7A 4BHTA 5L4SA 4JBHA 5JO9A 1H0KA 2DBQA 2EP7A 1ZK3A 3F4BA 2CF5A 3UHAA 1NR7A 4HP8A 1B0AA 2P4HX 3B1KA 3NX4A 3MJTA 4RO0A 1P33A 1D3AA 4KUEA 2C0CA 1ISFA 1QMGA 2DFVA 3L6DA 3ROKA 4BOYA 4QUKA 1HDGO 3HDHA 4XYLA 4JCOA 1NWCA 3HDYA 4BNLA 4P4GA 5ILGA 3RUIA 3I9MA 1M75A 4CQMA 3NRCA 1DFHA 1A4UA 4PLFA 3QJ5A 5DF1A 5JAMA 1QG6A 1L7EA 4QXMA 5B37A 4RLHA 4RDHA 3HSKA 4CLEA 4IZHA 2J6IA 1LLDA 1Y5MA 4WCFC 1DAPA 3WR5A 1M6WA 4XA8A 5FEUA 2OZPA 1ZIDA 1P1KA 2W2LA 5DCYA 4Q3BA 2G1UA 3U3XA 2VQ3A 4BO6A 1X7DA 3QE3A 4S3MA 4XB1A 1E7WA 2PGDA 5AQ1A 4YACA 3W8EA 3E6AA 3H2ZA 1JKIA 1Q2XA 1TT5B 1YO6A 4FIZA 4BMVA 2WEKA 2Q1WA 1ZSNA 5KVCA 1R0SA 1SC6A 3H9GA 1VJTA 3UXYA 4KWIA 1AN9A 3ORFA 2BMAA 3EZLA 3BHIA 1U4OA 2NTVA 2ZJ1A 4Y6PA 2VRCA 3QWBA 3RIHA 1J0XO 3MJCA 5J23A 2Y68A 1NAHA 4K9DA 4XD2A 4DBVO 5GZ1A 5DCWA 4XQCA 1IOLA 1QYWA 1E77A 3GMDA 2B5VA 3WNQA 3ONDA 4YR9A 4I1IA 4D43A 1Y8RA 5EESA 3TPCA 3V1YA 4GKBA 3EHEA 2BFPA 3T4XA 3FWZA 1NR1A 1NASA 4CM1A 4UEJA 3VZQA 1BMDA 1DXYA 1NXQA 3UH1A 4CMCA 3CPSA 4E0BA 4YAIA 1YKFA 2PGJA 1K0UA 3FTNA 1U5AA 3JYOA 4FGSA 4IJKA 1IHXA 2VUSA 1Q7GA 2Q1TA 4EYEA 5JMWA 4CJXA 3ZWNA 3U5TA 2PFGA 6LDHA 2X4GA 1K6IA 3KEQA 4WNCA 3PK0A 3QQPA 1HYGA 2B0JA 3KZVA 1JU9A 1L1FA 2IZ1A 4OH1A 2OMEA 2BGKA 3VHRA 3EDMA 2X0RA 4KP7A 3ZWMA 4J2HA 1E1LA 3D4OA 4ROSA 3ROMA 1I3NA 1NFRA 1P44A 2I66A 2RH4A 3ZWCA 4JN6B 4IDDA 3OBBA 5IDYA 2CDCA 1N92A 1PJTA 3GVHA 4J43A 1RYDA 1K6XA 3SVTA 4D7AA 3SXPA 3ZHBA 1X15A 4FOSA 5JY1A 2FSSA 1GQYA 3O9ZA 3SLKA 4NBTA 1A7KA 2ZK7A 3WGIA 4IDFA 3HB4X 4MVJH 4CQMD 5CDYA 5JCXA 3U62A 3DONA 2CUKA 1ZSVA 1MX3A 1G1AA 4J1TA 4UUMA 4QEDA 3PI7A 5C7LO 2AEJA 2JHGA 1NNUA 4W7IA 4YJFB 1AXGA 1B26A 2JD2A 1H5QA 3GGPA 1CF2O 5JSFA 3AW9A 4LVCA 2X0NA 4YCAA 1DSSG 5JLAA 4CR8A 2EKQA 1M66A 2VYNA 5ENDA 1PIWA 4DPKA 5L7WA 1ZH8A 4BMSA 2IEBA 3OJLA 2QX7A 1N7GA 1YOVB 4MVJI 2BD0A 2ZB4A 1I0ZA 4GX0A 2OBNA 1B8UA 1G6KA 3D64A 3K73O 3QLJA 3QVOA 1BDBA 3OM9A 3C3XA 4MP8A 3BIOA 3JSAA 2ZCVA 2EWMA 4AJHA 5B1YA 1OI7A 2VRCD 4TSKA 1JAYA 2JHFA 4BNVA 1HE3A 4M87A 3O38A 3QHAA 3KB6A 3PVZA 2X0IA 3JQ7B 4GMFA 3WTCA 3PQDA 1DO8A 3VDRA 1XCBA 2NU7A 4IINA 2Y93A 3EAGA 5DULA 5CG1A 3WGYA 4RF5A 2UAGA 2PKRA 2QQ5A 3NYWA 4CMGA 2C20A 3Q9NA 5DBGA 1I33A 3WIDA 3OHSX 1D7OA 4CR6A 3WBBA 4GPD1 5LDHA 4CQLB 3V2HA 3I5MA 3KV3O 4JP3A 2ZATA 3X2EA 3ZWOA 4QQRA 4JJGA 1CJCA 2OHXA 1M67A 4E2ZA 2W4QA 3EC7A 4IDEA 4YAKA 2HAEA 3ZHZA 5G4LA 3EMKA 2HQ1A 3AJRA 4GI2A 4R4JA 4BIIA 3DQPA 1R66A 2X8LA 2J5QA 3BA1A 3FR7A 4B3HA 3GG9A 3OIFA 4KUGA 4Z0PA 1RM3A 1YDEA 3QVXA 2WD7A 5HTOA 4OIMA 1EZ4A 1U2DA 1U7HA 4I9HA 4B7XA 4CUJA 4A10A 3GG2A 4J1SA 1R16A 3DZKA 3P7MA 3PZRA 1DLJA 4R9SA 2EW8A 1RM5A 4UVHA 3KSZO 5EPOA 2E82A 4BGUA 4II3A 3N7UA 2AQ8A 2I99A 3GRPA 2VT3A 1LSJA 3I9NA 1WP4A 3DZHA 1B15A 1VSVA 4K6CA 4NG5A 4HWKA 3DEYX 2NLOA 1YS4A 3AOGA 3UCFA 1QXSA 4CMAA 4DPMA 1E1KA 3SLGA 4FFNA 5ITWA 4ZRMA 3WGTA 4CM7A 4DQUA 1NFFA 2V6GA 1T26A 2UUPA 4NZ9A 1B2LA 2BI8A 4A0SA 4XYBA 2CVZA 3TNLA 3O8QB 1P0FA 1ZXBA 5I9NA 5A1TA 3JD4A 4YRDA 5L4NA 1N9GB 1EVIA 3BMNA 2EGHA 1VJ1A 4HY3A 4IDAA 3WQQA 4Q3CA 1K89A 4XKJA 2A92A 2NUAA 3D3WB 3LZ6A 4G81A 5IXSA 1KIFA 3RUDA 4L76A 4ZRNA 3KSUA 3QIVA 3AY3A 3RUEA 5BR7A 4ND3A 3ADPA 1EVYA 2P91A 1VRWA 1ID1A 5CEJA 1EMDA 3JQ8A 1SBYA 1X0XA 3ZDFA 1EK6A 3LLSA 1E0DA 1I2CA 4PIVA 1YWGO 3JQBA 1DOHA 3RUHA 3FNGA 2YZ7A 1RKXA 4OJNA 2QRLA 4IDGA 3FBTA 2EHDA 5C5IA 1JA9A 2AG5A 3KYCA 2C29D 5KJ1A 2VT2A 5JAIA 2BRUA 1DLIA 1VKNA 4A5OA 1VL6A 1P31A 4GAEA 3V2GA 4EW6A 3UOGA 2G17A 3MWEB 1PL7A 4UULA 1YL6A 3ICCA 1P1RA 1P1IA 5ENVA 3JD3A 2VZ8A 1MC5A 3VOSA 2BKAA 3IKVA 4IIVA 4MVJA 2PA3A 2TMGA 1FDSA 1WZEA 4L73A 1IZ9A 1TT5A 1O6ZA 2OP0A 2X7HA 3MJSA 3P5SA 1HXHA 4WNIA 5BT9A 1P74A 1QRRA 3JD2A 1R4MA 1HE5A 4YJHB 1PJ3A 4F45A 1T2AA 1A71A 4GH5A 2BFAA 5CPFA 4XJTA 3ROPA 1XQ6A 5AYVA 3PFFA 5GZ6A 2BFMA 1ZK0A 4G5HA 1V6AA 5JXWA 4O59O 1YONA 3DZBA 1I2ZA 3WS7A 4CL8A 4CLDA 1HDYA 4LVUA 4WGGA 2OUIA 1HDXA 1IZ0A 2JCVA 5I7VA 2CY0A 1HZJA 3INRA 1M6HA 4OXNA 4FJ2A 4EEXA 1YBAA 2Y66A 1HT0A 2JCXA 4I9NA 2BFOA 4DPLA 3O26A 4GVLA 1D1SA 1GL3A 1I5RA 2C07A 1YBMA 3EVNA 2YHUA 5U9CA 3DWFA 3IS3A 3OP4A 2O3SA 2AG8A 5L7TA 4WLEA 1LDYA 1NPDA 4OAQA 5A9RA 4G65A 1C14A 2JKVA 3PYXA 3DR3A 3L0DA 1OC4A 4KZPA 3RKRA 3H3JA 3ZWPA 4CM5A 2NTJA 3OFSA 2BH9A 1WWKA 4JGBA 3ETEA 1VLLA 1GQ2A 2PNFA 5T64A 4BVAA 2CMDA 2ZTVA 4UUNA 1P9LA 1MB4A 4HKTA 4Y8VA 5KJEA 1EUZA 2XF8A 4FBGA 3S2GA 2FHSA 3WNVA 3BTSA 1GCUA 3NAQA 3QP9A 4NBRA 4R68A 4FR5A 3DBLB 1UDCA 3FHLA 3W6UA 2AE2A 2IXAA 4AJOA 3LT4A 4ZQHA 4YJGB 3K8ZA 3PYLA 3HQ4O 4QFCA 3I1JA 2WJPA 4NI5A 3CXRA 3S55A 3H6KA 2D3TA 4IMRA 4TKMA 5TJ9A 1XDWA 2IYPA 8ADHA 3GEDA 4E33A 2RH8A 3FNFA 3ZI0A 2IE0A 2YQ5A 3IUSA 3DAGA 3SC4A 4R5HA 1TEHA 4JLWA 2UVDA 2OXIA 4FFPA 3JQGA 1KVQA 5KIAA 4JIGA 4PLPA 4EEZA 3L6OO 3ZHXA 1JWAB 3R3JA 4FOOA 2W2KA 2QYTA 4XJSA 4DC1A 1VI2A 1GZ4A 2I5PO 4CR7A 5JC8A 2G5CA 4FW8A 2GGSA 4J1NA 4YJFA 4U0KA 4Z3KA 3I6QA 5I7FA 2X23A 3F1KA 1DIAA 3RWBA 2A35A 3E5MA 4U6SA 4TQGA 1W0CA 1XLTA 1KC3A 1KEVA 3C7DB 4IQ8A 3NT4A 1BXGB 2X9GA 4RPGA 1YOVA 2FR8A 2HCTA 1ZW1A 4A73A 1H6DA 3WDSA 1LDGA 3U09A 1F14A 4XEHA 1RM0A 1MFPA 1V35A 2VHXA 4RPHA 5BQFA 1Z45A 4DIBA 3PZBA 3GF4A 1IY8A 2FZEA 1GD1O 4LW8A 3GY0A 5KNLA 2W98A 4JJIA 1FJHA 2WMDA 2ZB8A 4C7JA 4AG3A 1P1HA 3WQSB 4PZEA 1E7YA 4L9RA 4ID9A 4R5MA 4RZHA 3WGQA 3JQ7A 2VYVA 4AJLA 4NQZA 3A4VA 3RD5A 3RBVA 1K3TA 4NK4A 4RVUA 1YBVA 1R15A 3DZJA 2G0TA 2JD1A 3JYNA 2PZMA 4BNYA 5CEFA 2ZTMA 3CKYA 3OICA 4BGVA 2J8ZA 2YJZA 4GWGA 3PJGA 3AWDA 5IXYA 3HADA 4JJFA 1NQAO 1DJQA 1AE1A 1E5LA 1SB9A 2F1KA 4TZKA 3WIEA 4BNJA 1E7SA 5HWSA 3KETA 1DPGA 4IPTA 4YXFA 3VH3A 5I8WA 3JQ9C 5G0TA 3E9QA 3AUSA 4H3VA 1PR9A 1DFIA 1U3VA 1ZK1A 3P2YA 1TI7A 1ZEMA 2EP5A 3VVBA 2E48A 2NV6A 1AHHA 1ORRA 3GZNB 4E32A 3OIDA 4TZTA 3QRWA 3PWSA 3GUCA 3NDIA 2FN7A 1Q7CA 2UV8A 5FI3A 3LC2O 2WE7A 4GLOA 3LT2A 3WLEA 3RROA 4FQ8A 3U4DA 3IL2A 3L9XA 1MFZA 2GASA 4MIYA 1IPEA 2VRBA 1R4NB 3BHJA 4IDCA 2X5KO 4BL5A 2QHXA 3ZU2A 4GGPA 1BWSA 3HHPA 1I8TA 4TVBA 1OBFO 5G0WA 4B8WA 2V6MA 2Q50A 4XGIA 4XZ3A 3UCXA 2GN9A 1GCOA 4NFYA 4B4UA 3B1JA 3PHIA 5KCZA 4BV9A 1YE3A 3GVXA 3L4BA 4WLFA 3AUUA 3IJPA 2VWQA 2XPCA 4E12A 3VTFA 1XYGA 2QG4A 1YB4A 4GX1A 5TC4A 2PD3A 4I08A 4LRSB 1GDHA 1QP8A 4XCVA 2JAHA 2GLXA 4Z6KA 4I5GA 1ONOA 4IBOA 2PY6A 4RPLA 3EW7A 2NU6A 4E2YA 2NWQA 3MWDB 4J49A 4LCEA 3IC5A 4AJ1A 1GYPA 1N9GA 3WYEA 1NQ5A 5F5NA 3O4RA 2EJVA 3OH8A 1OOEA 2IZ0A 1ZBQA 1J6UA 3JTMA 3TL3A 1SMKA 1LDBA 4FCCA 1O0SA 1UDBA 4AJEA 2V6FA 1LA2A 3D4NA 1YL5A 4R1NA 4W6ZA 2GN8A 3PHJA 2BGLA 5EINA 1AXEA 2GNAA 3LVFO 4Q39A 1E3WA 1NHGA 2P5YA 2X9NA 4FD3A 1Y1PA 1X1EA 3JV7A 4PCVA 2OOSA 3GNTA 1GV0A 2O3TA 2WD8A 1SB8A 3RJ5A 3OA0A 2NQ8A 5A04A 4DREA 1T24A 3KRTA 3DOCA 2VYVD 4JK3A 4LSWA 3WFIA 1I3KA 3RQSA 1NHWA 4WEQA 1EK5A 5L7YA 1NAIA 2XAAA 3OIGA 2Q1SA 3JQBC 4I9UA 1J4AA 1OZAA 2DBZA 5A5FA 1DBVO 2A9FA 1LC3A 1Q0QA 2CDAA 2IZZA 3TOXA 4TVOA 1I36A 4BS9A 2JFFA 4XDYA 1EEHA 1SO8A 1TLTA 3TWOA 1HKUA 1X14A 1UXJA 4YJHA 4Z0HO 3WBFA 4J2OA 3LYLA 2AW5A 3S2EA 1XSEA 4R3NA 4PLCA 2Q1UA 3BMQB 4Y98A 3OQ1A 4IQ0A 5JMPA 2I76A 1PGJA 2ZQZA 3H5RA 3ICPA 4AJNA 4I8XA 1PL8A 1OAAA 4DGSA 1BVRA 3B6ZA 3RC9A 3IUPA 5GY7A 3A06A 3EUWA 4R54A 4ALNA 1XIVA 2O3QA 3ZU4A 4CLXA 4DLBA 2NTNA 4OXYA 4WCFB 4M54A 4DL9A 4LRTB 5EQFA 3P2OA 1SOWA 2XOXA 2Q3EA 3KLMX 3MJEA 4NBVA 4RPKA 4M8SA 1LQUA 2X0JA 3GPDG 2ZB3A 2YHIB 3I9OA 1DEHA 5DOZA 1ZZEA 4W7HA 1TA4A 3AY7A 1CQJA 3GEGA 3W4KA 1XKQA 4WLOA 3BTOA 4FSHA 2IDZA 4GKVA 1QLJA 2OBYA 1SOVA 5IDWA 4R16A 1HETA 3BMCA 4DBZA 1ZEJA 1NX6A 3MOGA 1C1DB 1F17A 2DPGA 5TS3A 3V1UA 1E3SA 3OECA 4J6FA 4Z9YA 3RC1A 4E30A 1IYZA 1H6AA 4L4RA 3U0BA 1E3JA 3DMYA 3ZHYA 2E4AA 5L40A 1H2HA 1Y8QB 3K6JA 4TRMA 4RJTA 4XB2A 2Y0DA 4CM4B 4KDFA 3PFWO 1H94A 3WJAA 4B3IA 2BLLA 3ZWBA 3K9QO 4J9UE 3SJ7A 1ONPA 3H9QA 4BQPA 4CLHA 4DXHA 5JE8A 1WDKA 4NFHA 1U1IA 1SPXA 5TIIA 4IGFA 1DIBA 5JY6A 3GLQA 4OO3A 2GF2A 2V7PA 1DJNA 3Q9UA 1T1RA 2QRJA 5C37A 1Z74A 3R6DA 5U4QA 1PWZA 3DDNA 1O95A 3M6IA 4J4BA 4M86A 4O5OA 4BKPA 4XYEA 3R1IA 4YJGA 4L0QA 3GAFA 5IF3A 1PSDA 2WSBA 3HWRA 1DRWA 2O7QA 2P5UA 4UEOA 5A03A 1GADO 4PG7A 4IM7A 2D59A 1NBOA 1DHTA 4L75A 3PJFA 1V0JA 5HRUA 3GEMA 2BHLA 2HSDA 2RHCA 3LQFA 1PX0A 1WMAA 2VTDA 3AUAA 1UZLA 5L3ZA 2UYYA 4O6VA 3QW2A 1FXSA 1YQXA 4J7CA 3WYBA 1KVTA 4HFJA 2B4TO 4LCJA 2YV2A 4EBFA 5BNTA 3CZRA 1KEPA 4FJ1A 4UEKA 1BXZA 3I6IA 3K92A 1QKIA 3H5NA 4YQYA 3KOUA 4OHUA 4AFNA 5ER9A 1I24A 3TFQA 1DC5A 3DMTA 2AEMA 5DN9A 4DMLA 3PP8A 5CDTA 3C7CB 2YQ4A 1LNQA 5BSEA 1B8PA 2VWGA 2ZQYA 3W4JA 2Z95A 1BXGA 4D3FA 2O3RA 1MLDA 3CZMA 3GFGA 3A1NA 3WLFA 3G1TA 1PZGA 3GVCA 2HRZA 4D0RA 1ZMOA 4Q3AA 2J3IA 5DP1A 4NBWA 1A27A 3HN7A 1CQIA 5JPIA 1UXGA 5EERA 3ZU5A 2NU8A 1IE3A 5B4TA 4XQ9A 3PGXA 3QWIA 4O0LA 4E2XA 1C0IA 1GR0A 4MKRA 3BTUA 4EUEA 3MEQA 1QSGA 1I10A 1DRUA 4E31A 3VZSA 3GVIA 3BMOB 3L4SO 2ZIZA 4A03A 2GYYA 1JKJA 1O9BA 3L77A 1EQ2A 4BGEA 2O23A 2DAPA 1IB6A 2C5AA 4W99A 1JAXA 1NM5A 4WLUA 5TGDA 3FCOA 2PK3A 2Y0EA 2C2YA 3FR8A 1X1TA 2HO5A 4XR9A 1ZNQO 5A9SB 1UZNA 3UFXA 3NTQA 1VE9A 1ZKMA 1GEEA 2R6JA 3JQ9A 3RU7A 4DQVA 5JDCA 2CD9A 1G0NA 1NWHA 3E1KA 4HFMA 2DTDA 1B7GO 5IAAA 3GZNA 3NUGA 3QA9A 1YH3A 3L07A 4NBUA 1S6YA 2FR1A 1BW9B 3F46A 2Q2VA 1T1SA 1X0VA 3LT1A 2PD4A 3PDJA 1CETA 3PQEA 3EVTA 3I9JA 1U8XX 2O3JA 2HDHA 4BNIA 2NVBA 3DBVO 3E18A 5AXBA 1GPDG 1I2BA 3A14A 3UUWA 3M2PA 1R4NA 5DBFA 4BKUA 3KHUA 4CMHA 1C1XA 4RV9A 1WLYA 3NDJA 3QVWA 4B4VA 1PR3A 2Y1CA 5THKA 1E7MA 3G49A 2Q46A 1UXHA 2X5OA 4P22A 1WW8A 4RCVA 2ZKLA 2GR9A 2VNAA 2IRWA 3UICA 5I9MA 1GPJA 1UR5A 4JP2A 1LU9A 4Q3DA 4CM8A 1HE2A 4C7KA 1KERA 3GHHA 3WMWA 1XA0A 3TN7A 4YYZA 2O48X 2Q4EA 3GN1A 3K96A 3CH6A 4PGFA 2FOIA 3RC2A 1XU9A 2ZYAA 3GUYA 2R2GA 5C7OO 5ILOA 1VL8A 2HUNA 3PQFA 3HDJA 1UUFA 3ITKA 3L4BC 3L6EA 4MVJG 3RKUA 1DFGA 1ISHA 2GUGA 4XIYA 1EBFA 5KVSA 2DKNA 3TZQA 3ZCXA 5C7IO 4B3JA 3SBOA 5MDHA 2B83A 5AOVA 3ETDA 3PWKA 4IDBA 4BO3A 1ENPA 3INGA 3C24A 3PWZA 1DHRA 4BNHA 1LSUA 2C59A 3P19A 4B8ZA 2CVQA 3ZN2A 1VJ0A 5A06A 1GFSA 2Y1FA 4CM6A 5B4VA 1ADFA 2EXXA 4DYVA 3OEWA 2H5LA 1X13A 4WEOA 2WM3A 4NJOA 4J4HA 1LDEA 4RQTA 1T4DA 3JQFC 4FFMA 4ZQFA 4OQYA 5COAA 3X2FA 3ZNOA 4ALIA 2DU8A 3G1UA 2O4CA 4AL4A 2V6BA 4KTVE 3I4CA 3VH1A 1JVSA 5KKCA 3GR6A 5IZCA 1A72A 2YV3A 3FD8A 4F6LA 2B37A 3JQDA 5KVVA 2X6TA 1P3DA 1EVZA 1QV7A 2DUWA 4NPCA 3PLNA 2H63A 4RVFA 2HU2A 2O4UX 2VZ9A 1E5QA 1HZZA 3C85A 3KSDO 2HRBA 4MKXA 5HM8A 3PYMA 2EG9A 5CDSA 3KO8A 1MG5A 3R0IA 1DB3A 2I9PA 4NHEA 2PD6A 3Q6IA 1BRMA 2PKQP 1YJ8A 2BI7A 3DHEA 3JYLA 1Z82A 3D3EA 4L8VA 3V2UA 3HNPA 1MV8A 4JX8A 1EVJA 2B4QA 3Q3CA 3D5TA 1DDOA 4ZICA 4QECA 3N74A 3V8BA 2GSDA 2NSDA 4RORA 1QYCA 1LTHR 3AM5A 3B20A 4ND5A 3D4PA 4II2A 3G0OA 1VKOA 5AXDA 1CRWG 3I9LA 4MDHA 2XXJA 1PS9A 5G0VA 2Z1NA 4WOJA 2LDXA 2HJRA 3F9IA 3PIDA 1QYDA 3NJ4A 4JXKA 4RVGA 4EUHA 5IFLA 4OYRA 3COSA 1R6DA 2YHIA 5I8ZA 3SJUA 2FWMX 1ZXLA 1VM6A 4RVSA 5EJ2A 3VC7A 5TX7A 1O94A 4YDRA 3K30A 5KJFA 1PS8A 3JQEA 1PJCA 5IN4A 4R1TA 1C1DA 4TMFA 4H7PA 4HFNA 4EJ6A 2ZTLA 4Z9FA 4BKOA 4BNNA 1ZVMA 4OL9A 1LSOA 3OETA 4J7UA 2EKLA 1Y8QA 2NVUB 1ADBA 4CM4A 2FMUA 4D42A 5L45A 1H2BA 5EN4A 5EIOA 2A94A 2P2SA 3Q0EA 4BB5A 4CLRB 2WWRA 4GMGA 3WWYA 3AU9A 3GDFA 5I9LA 3SEFA 4WASA 3CTMA 3JQAB 1A9YA 3JYPA 3RVDA 5CDUA 2PGLA 3INTA 4PN3A 1B8VA 2O2YA 3QWFA 4AVYA 1V3TA 1OC2A 1B14A 1NFQA 2YDYA 3GRKA 4AJ4A 1NQOA 4LSMA 1C0LA 3GMSA 3WFJA 2AQHA 4ALJA 2PR2A 1GV1A 3QSGA 4ZN6A 4BGIA 3KM0A 4IUYA 3WG9A 4XGKA 3FN4A 1VSUA 3NKLA 1HYHA 2HJSA 2B4RO 3H3FA 3C1AA 4L4XA 4BNWA 3MOIA 4WK6A 1Y8RB 4ZU3A 3UVEA 3PEFA 2VZ0A 4ALKA 4U7WA 5A3VA 1O5IA 4UVEA 5JS6A 4YTEA 4MVJM 2FZWA 2JFHA 3STHA 8LDHA 3UAGA 2O50A 2QZ9A 4FC7A 4HUJA 1ZFNA 1RWBA 4OMUA 5HS4A 1ZCJA 5IDXA 1UAGA 2HMTA 3FNEA 4NMHA 1GUYA 2GN4A 5DNAA 5JYDA 5L4LA 1OMOA 3DHNA 3CIFA 5TLSA 1ENYA 4M49A 3RUFA 4BNMA 3S1LA 4F46A 3V1TC 5EMHA 5T8KA 1BTOA 3EY4A 3HJAA 3ZWYA 4FJ0A 3GN2A 2P9EA 3L9WA 3AU8A 3DMTC 4D3DA 1PQUA 2A4KA 4ESOA 4KOAA 2AMFA 4B4WA 2CFCA 4YT4A 3LLVA 1T2EA 1FDVA 3KUXA 4W82A 3S2IA 5U1PA 3AFMA 4OM8A 5I7EA 3BMOA 3OA2A 1ZJZA 1E3EA 5JO0A 5THQA 4ZQBA 1QYVA 4ONEA 1QR6A 1U2GA 2D8AA 4S1VA 5CHEA 4XR4A 2EGGA 5FFFA 2C5EA 2VWPA 2IEDA 2P9CA 4NH4A 4R69A 1IHYA 4URFA 1H9AA 4P38A 5AVOA 3WMXA 4YRBA 3DL2A 3PJEA 3T7CA 2Y1DA 4BUCA 3E8XA 4MP3A 1MGOA 3DBRB 3DB2A 2HMUA 3M1LA 5A5EA 4XQEA 1Y9EA 4PRKA 5ICMA 4YT2A 2DQ4A 3DTTA 4U5QA 5ITVA 5KTKA 4FFLA 4XRRA 3PHGA 3FPCA 1H6CA 2J3JA 2YV1A 2VUTA 1D8AA 3WJ7A 1N1GA 1WPQA 4R51A 4J3FA 3Q2IA 1DC3A 3IOYA 3UGKA 5G4KB 4IJWA 3KYBA 4UUPA 4CQLA 4D45A 4WLNA 1LRKA 5LC1A 2X86A 2IODA 1LDNA 3GPIA 4CV2A 5JDCC 3W8DA 1JW9B 1W73A 5CPBA 5IN5A 3RC7A 3DO5A 2W90A 1NVGA 2DBRA 2NU9A 2B35A 4KWHA 1M2WA 3PHLA 2E49A 1GQQA 4HFRA 3RU9A 1A7AA 2G76A 2B36A 1U3TA 2OO5A 4KUHA 1R0LA 2O2SA 4YAJA 5L51A 4DYDA 3ZV5A 4BO5A 4YEDA 1BHSA 5HS6A 1UP6A 5TSDA 4R9RA 4YA6A 3ZU3A 1QORA 1T25A 1Y81A 4MJLA 1FDUA 3GNSA 1E6WA 3KEOA 3ZWAA 2Q45A 3CMMA 4NFSA 2HMVA 3U49A 4BNZA 3UKOA 3JD1A 5FWNA 2VHVA 1PZEA 4GX2A 5EL0A 2PZJA 1UJMA 2FPPA 3OJFA 4XGNA 5ADHA 3HDQA 1RYEA 1KOLA 3TZHA 4UUOA 4BKRA 3NDRA 1JTVA 1LSSA 2FR0A 1HYEA 1PQWA 4RDIA 5JNLA 1JDJA 1MG0A 1LLUA 3AFNA 1LXCA 1AGNA 3DAPA 1S7CA 3B70A 3DOJA 2GPTA 2EERA 2HK7A 3AI2A 3TZCA 3V5NA 1I3MA 5B4UA 1JWBB 2Z5LA 3WGHA 1EDOA 4ILKA 4PG6A 2EJWA 1KETA 3O8QA 2HK9A 4MKZA 4Q3NA 3SC6A 2BGMA 1Y9AA 4YQZA 2DM6A 3ENKA 4K28A 4J90A 4N5MA 5IG2A 4DA9A 3U4HA 3HZZA 5L95A 2CZCA 2D2IA 3GOHA 3D3WA 4P4LA 3JQFA 3Q1LA 4U0JA 3RFTA 2HK8A 4B4OA 4I5EA 2GRAA 4H15A 3W6ZA 1XWFA 2SCUA 1XEAA 1P1FA 1EUCA 1LRLA 3AI3A 3LF1A 1HTBA 5BNFA 3U4CA 4PVDA 1RPNA 3GHYA 3OJOA 5A05A 2ZCUA 1O89A 4CL3A 2PV7A 2DLDA 2C7VA 4ZD6A 3VZRA 1E6EA 2AQKA 3D7LA 1F06A 3PHHA 4XIJA 1YL7A 2FY8A 1KS9A 5F1OA 4BO8A 4CM3A 4JNKA 2VTEA 4PFJA 1E3LA 1TXGA 1UAYA 3H9UA 3E82A 4ND1A 1RM4A 4CMKA 4DVJA 1G0OA 1UXKA 4IQGA 4RVDA 1PJBA 4HV4A 3FPLA 1T2DA 3ZV4A 2I65A 1EUDA 5IZCC 4WJZA 1ONNA 3ZWVA 5DZSA 4GBJA 3H7AA 4WPGA 2VHYA 4PLZA 2DUUA 5FF9A 1JVBA 3HN2A 3TF5A 4BNUA 2WYWA 5F1KA 1EBUA 4ZA2A 3TDKA 3R3SA 3DOOA 2D0IA 5JCJA 4N7RA 2UUOA 1EE9A 3I23A 1UZMA 4QO8A 4BO0A 3MTJA 1F8FA 1BG6A 5A02A 5BSFA 1QYXA 3WQRA 1ULUA 2I67A 3AM4A 1ZK2A 2PTGA 3JQ8B 4BNKA 1KC1A 3DTYA 4N54A 2FRDA 4PVCA 5FI5A 5CFZA 3OSUA 4UVGA 3RUCA 3ANMA 4TKLA 4EGFA 1NTOA 3GH3A 4RZIA 4INAA 4LMPA 2V65A 1LI4A 3LT0A 1Q0HA 4UVDA 1Q0LA 3HFGA 2P9GA 3F47A 4WLVA 3S8MA 4TROA 4YWJA 4IY1A 2DFDA 4OGWA 4LISA 2GD1O 4BNFA 2Z1MA 2PZLA 1E6UA 1YB5A 3KYCB 3RAJA 2CF6A 2GCGA 3K2EA 4Q3EA 4E5NA 3O03A 1JN0A 4M1QA 2X1HA 4CMIB 3FF4A 1HDOA 2HLPA 3DAFA 2NVUA 5T5QA 1ML3A 4LK3A 4J16A 3GGOA 3ZW8A 5A3JA 3H4VA 4ZGWA 3LF2A 1PJ2A 4KTTE 1C0KA 2OORA 5GMOA 5T57A 5CDGA 4MVJE 1XU7A 3WYCA 1ADGA 5LCXA 7MDHA 4CLRA 2DBVO 2X5JO 2ILTA 1R4MB 1YQGA 4CV3A 1H9BA 2Y0CA 1U5CA 3JQAA 1HF3A 3N58A 4YRAA 4OSPA 2VN8A 1UXIA 4RF2A 3DFUA 4FFRA 5I7SA 1HE4A 3AY6A 4E5YA 4BNXA 5AXCA 2EKPA 1KY4A 1WMBA 2AHRA 5K6AA 2OFPA 2Q99A 2QIOA 4F6CA 5JBIA 2WYVA 1P45A 4E21A 3DBLA 4FS3A 4IJUA 4O63O 4WKGA 1F0YA 1TT7A 2DPHA 3K2BA 4UVIA 1PGPA 1JLLA 4XWYA 4YVFA 5ICSA 4G2NA 3ZV6A 3B1FA 4J0EA 5T6BA 4Y6RA 3KVOA 1D4FA 5LDGA 4UREA 4I5FA 1KVUA 2X58A 1E1MA 2J5KA 3DXFA 3T7EA 1PL6A 4E4YA 5JYEA 4A27A 4O1MA 2AQIA 2ET6A 3PXXA 4YB8A 3S2FA 3PIIA 3HG7A 4E3ZA 1IULA 3HFSA 4JBGA 1P0CA 4J91A 4K1LA 4XDZA 1Z7BA 4JROA 3DBHB 3TQHA 5B12A 3RBZA 3C7AA 4PLVA 2GZ3A 3GGGA 4R3WA 2H9IA 4A2CA 4ND2A 1WNTA 4ND4A 1LRJA 5JFOA 3E5RA 4EZBA 1ADCA 1NVMB 1N2SA 2BF7A 1FF9A 4NJMB 3WICA 4HX5A 2PZKA 2YFHA 1PGNA 2DC1A 3E48A 3D1LA 1I01A 1YGYA 3W4IA 4FPXA 1PJSA 2AA3A 4WUVA 1T4BA 5H83A 1BSVA 5JCJD 1KEUA 1I3LA 1X7HA 4CLOB 4OSOA 3NJ8A 4MINA 1IUKA 4TRNA 4CV0A 4ALLA 1SEVA 4RLSA 2NNLD 5TQVA 3C1TA 4PLTA 2GERA 2JD0A 2PH5A 4GSKA 5TT1A 3VPHA 3IIEA 5T8KC 1QLHA 4DLLA 3UCEA 4XYGA 1ZK4A 1NYTA 1T2FA 2JL1A 1DRVA 2AEFA 4XRGA 3C1OA 3OQ6A 4BKQA 2YYYA 1TVEA 2J3KA 3OMLA 4NNJA 5C3MA 3JQGB 3QV1A 1C3VA 2RAFA 3OEYA 3ETGA 4EJMA 4FC6A 5ER6A 4YAGA 2W2KB 3BHMA 3DBRA 2B69A 5JW6A 3BTVA 3HE3A 3OF2A 4WE3A 2QYSA 2D5AA 2DTEA 2I3AA 2PLAA 3OQBA 2Q49A 3KBOA 1WXDA 2W2LD 1K6JA 4K26A 1A5ZA 1UP7A 4AJIA 1Z75A 2JFGA 4B7UA 1QV6A 3PLRA 1GYRA 1MC4A 4NK5A 3F1LA 5G0SA 1YDWA 3W1VA 1JKFA 3RCBA 4OQZA 3KYDB 2C54A 4MOWA 5G4KA 4ZHSA 4W9NA 4CMEC 4FN4A 4J7XA 3NTRA 1UDAA 3FNHA 4PLGA 3ASVA 3ULKA 2R00A 3JQAD 1SNYA 4HBGA 2J3HA 2Y1OA 3G3EA 2VHWA 4D3SA 3TFOA 1PGQA 4XYMA 3ITDA 3CINA 4NIMA 3GK3A 3AOEA 3LDHA 3UF0A 4BMNA 4FDAA 1V9LA 2J5RA 4EJ0A 3GDOA 4DLAA 2Y1GA 3IP3A 3M2TA 3ROQA 1N7HA 4E2WA 2VUUA 2GZ1A 4EI2A 2B5WA 2VCYA 3U4IA 4AJ2A 1W4ZA 1Y5RA 5F3RA 1U8FO 4TRRA 4CUKA 1MP0A 2EV9A 2I6TA 4MVJP 2GN6A 3C8MA 4ITUA 3OJEA 1ISJA 2LDBA 4D41A 1B3RA 4J9VA 4NU5A 1B3BA 3CMCO 4MP6A 5CP8A 5JDIA 1ISGA 3I83A 5DP2A 5EQDA 3ASUA 5KWEA 1XHLA 3BXXA 1VC2A 3HUDA 5CAEA 1PJLA 1LUAA 4E5KA 5JAZA 1K5HA 3VPFA 3NT5A 4Y67A 1NPTO 2AXQA 3IAHA 3PDUA 1R0KA 5GZ3A 1LDMA 1HDZA 3ANLA 2P4QA 4J1QA 4YBZA 3GT0A 4J0FA 1FDWA 1YVEI 4R01A 2QW8A 1PZHA 1EQUA 4KQXA 1YRLA 1PZFA 5A9TA 3LU1A 4OOEA 5F5LA 4GL4A 4AJPA 4HNHA 1J49A 4BV8A 3VPGA 1LLQA 2D4AA 4IXWA 3ZGYA 2C2XA 2H6EA 5TNXA 2PWZA 3GZ4A 1WVGA 3FTPA 4PLWA 2DTXA 3H65A 4GQAA 5IJZA 5K9ZA 5A4DA 1ZSYA 3WGZA 3EYWA 4RF4A 4TRJA 1ULSA 1KVSA 4IS2A 1GTMA 1YB1A 2H1SA 3AI1A 1NQTA 2I3GA 4IS3A 4PLYA 1U3WA 3E03A 4B79A 4F3YA 2JJYA 3HB5X 2VHZA 4Z9XA 1DC4A 4U6QA 2GO1A 4MPDA 1CWUA 3VDQA 5TRTA 4MIEA 4NDNE 4K6FA 3RJ9A 1GU7A 1HEUA 3K5PA 4BNTA 3I52A 1PJ4A 3WTBA 5DCUA 4IJVA 4DRYA 1DIHA 2FPIA 1KY5A 3VH4A 1SEPA 4EITA 2JCYA 3CE6A 1GUFA 6ADHA 1NVTA 1PGOA 2XXBA 1E7QA 2PH3A 1BDMA 3AK4A 4M89A 5TJHA 4A26A 2F00A 4JBIA 4XQGA 4YJDA 1W6UA 4CUZA 3KTDA 4E6PA 5HA5A 5KKAA 3TJRA 1CYDA 1N5DA 2ZB7A 4AJKA 4GVXA 2PKQO 2NACA 2WTBA 2X9VA 3CEAA 2VYND 5H81A 3TOZA 5DT9A 1UH5A 4FGWA 2VOJA 1FK8A 3GAZA 5ES3A 3VZPA 1AHIA 3K31A 2D1YA 4I5DA 3ZWWA 1Y6JA 1E3WB 3GNQA 4PRLA 3RUAA 4OXKA 7ADHA 2CNBA 4DIFA 1PTJA 3H2SA 5L53A 1XR3A 3G79A 4LN1A 9LDTA 3BMQA 3IQDB 1OFGA 1RJWA 3VPXA 2ZJ0A 5IDQA 4E5PA 1DIGA 4HXYA 3FRJA 1MXHA 1TB4A 4P4NA 3ONFA 3TZ6A 4N5LA 3E9NA 3A9WA 4WCFA 4N18A 1HSOA 4Z0TA 4PLHA 1MUUA 1N8KA 5KJ6A 3QWAA 4HNGA 4CMIA 1CERA 1L7DA 5CG2A 4GGOA
chains in the Genus database with same CATH superfamily
1PEDA 1RD4A 1RBMA 3T7IA 5DN6D 1DDGA 3HU3A 3IESA 2GJ8A 2RH9B 3UIEA 3HYLA 4PR0A 4QLBA 1TZBA 2DBYA 4P33A 4UQOA 3T1NA 4M9ZA 2FEOA 4EB0A 1TK9A 3GLIA 2EOAA 2ZRGA 3A9CA 4EHKA 3BJMA 4BFYA 3LYHA 1BD4A 1FLVA 3PNPA 4BO9A 1AUXA 1BWPA 2QRKA 2WJHA 3GJTA 2ZSFA 4GSLA 3VAZA 3F4LA 3KPUA 4QUBA 2OBFA 4URUR 2RGXA 4CV1A 4NU6A 4I1PA 3DHYA 4RTJA 2WAXA 2YUTA 3C97A 3COVA 1SCUA 1CVLA 3PC4A 3AUTA 1X8LA 4HDNA 5AVKA 3W7VA 1IN7A 2ILVA 4Q16A 1D5WA 1JX6A 5ITZB 3A9VA 5FQOA 3SP1A 4EI9A 2GCEA 3I3OA 4XEUA 3O7MA 4JV5B 2C31A 3C4JA 1XMIA 3QBVA 1P7CA 1PWHA 3LHDA 4FHEA 1F2VA 1SG0A 3REGA 3LUHA 4IUBS 5JRDS 4V1CA 1W4CA 2G6BA 3FB1A 4RIIA 4IXTA 3V6LA 1T8SA 2V4ZA 4OQ4A 5GM2A 3TD6A 5K3OA 3EDYA 3A28A 5D3MB 1ZMTA 3PQ4A 5IRCD 1QRTA 5C4IA 3RVLA 3V3KA 1F2DA 4QHSA 2F3RA 2FH5B 1O54A 1WR8A 1Y33E 4XFJA 4N01A 4DKXA 3CW2A 1R37A 2WAMA 3RSHA 3DZGA 1NR5A 1CUFA 2OV4A 4LVOA 1PWYE 4RTSA 3N5CA 1GRRA 1W48A 4Q37A 5K6AC 1E4EB 3ZCVA 4UTVA 1P4AA 1KAHA 2AR0A 2FJPA 2WA2A 2X8WA 2CK3A 1EA5A 3GC6A 3LUJA 5CCDA 4O1HA 1C3LA 3AFHA 4UHKA 1YQ9A 4KN8A 3O9MA 1LD3A 3IAEA 1B1AA 2IW3A 2XMQA 4UNPA 4D0SA 4JKYA 2VK4A 2YC4C 4DG5A 2WJ4A 3RFVA 4B7CA 3HU2A 3JYQA 2G6TA 4EKEA 2V7VA 5F4ZA 4B3GA 4CDNA 2R2AA 2XR1A 4O2AB 3EMVA 1P9NA 1BO6A 1P29A 4OHXA 2HMYB 3HA7A 1I30A 3VBCA 2IDJA 3PF9A 3JD0A 3WLNA 2HM7A 4NRDA 3TZBA 1CEQA 1VRVA 3VTKA 1PJQA 2UUBB 3Q11A 4CIDA 3TMYA 3PNKA 4E4RA 3SNKA 1USUA 1BKYA 1NU8A 1QNLA 2YDXA 3QOYA 3ZXUB 1GTSA 4IQ4A 4D8WA 3U9SA 5F98A 3QITA 3K09C 3ENVA 4Q4HB 4X9XA 5KVQA 5AW3A 3QVUA 4DUGA 5EE5B 3HTXA 3PHBE 5LXTB 3FDIA 1YMVA 3AKDA 1LJ8A 1XRQA 2XZLA 2ZWAA 1LFDB 3PC8C 4HATA 3EGVA 2BBWA 1SUCA 5LN1A 5AM5A 3TINA 4BV2A 5C4GB 3HYSA 3GZTB 3PPYA 3I4FA 1RWPA 2AUNA 4KMSA 3VR1A 3I6ZA 1DBIA 1DAOA 4EA9A 5JSHA 2HU7A 2I4MA 1GZVA 4NZNA 5DCLA 4RK4A 4DMMA 4AI6A 1YJQA 1RLOA 3M1AA 4C4TA 2CW5A 4WOCA 2ZBQA 1X7ZB 5TT0A 3V7UA 2ZYDA 2OK7A 3LE8A 3WB9A 4Z9AA 4B6PA 1XCJA 3OCCA 4UTNA 1XZHA 4QIHA 4ZC1A 3CF0A 5HKBA 5DGXA 2PKWA 2IH4A 5G3ZA 3G2KA 2C00A 4KOEC 1JXOA 3FSRA 3NHFA 3NC0C 1XLUA 4Q9NA 5K8TA 3I1FA 1RQGA 1LF5A 1WAMA 3GP5A 1BYIA 4WCDA 5IKMA 5K51A 1FFWA 1B73A 1X9HA 2OL4A 1SAYA 3LSTA 3DC7A 3D7SA 4LGVA 3DC2A 1IQUA 4MR8A 4XUGB 3C0KA 2D1FA 2KI5A 1S8NA 3M6LA 5JD3A 3ST7A 2A9VA 2PL3A 4MPRA 1EFKA 2M6RA 1UBHS 1Z2DA 2I6QA 1ZQ1A 2RCNA 4MVJD 1Y9DA 2R96A 2YJ3A 4HNRA 3WYAA 3WDMA 4CMEA 5HBRA 5TQ0A 2CDBA 2DQKA 2JFUA 2O7SA 2YHBA 5DM60 1JB1A 5K6RA 5LYYA 3T5CA 3U61B 2H18A 3OZEA 4IV8A 2QTMA 5BV8A 4F8JA 2IU3A 3RUPA 1GA4A 4YDSA 1M5RA 5HKKA 4DTIA 1MEEA 2F4NA 3FSJX 4LDNA 1PDVA 2BM9A 4QRIA 3UW3A 2CV0A 4HMQA 3BSFA 1ISMA 3Q5EA 4EJSA 4MVYA 4L6AA 3W6OA 4IRMA 4JLVA 1X1SA 3KJEA 1KVRA 2V6JA 3I2HA 5K0NA 4LWQA 3HDVA 4B6SA 6Q21A 2Y8EA 1AO0A 1U0TA 2IUYA 2PH7A 2CFTA 3ZNPA 3IAFA 4DUPA 1GUZA 3FOFC 1GEGA 1CHDA 2I03A 2PLNA 1W88A 1RJEA 2I87A 2ZUWA 3IFSA 4NULA 5CNKA 2IIVA 1OWOA 3ITEA 3RI3A 2BSAA 3EGOA 4BNGA 3IP1A 2C7RA 1GM5A 4JLSA 4MDYA 3TLXA 4O0MA 5K99A 4N5NA 2WUVA 1LPBB 2C3OA 4I55F 1PLJA 4GR9A 1HLDA 1DG9A 3IVRA 4A4DA 4E13A 5BQXA 1JZQA 2V1XA 3GRFA 1FTGA 1E2FA 3E70C 1H2YA 4HB0A 3TS1A 5E2IA 1GCGA 2ZSHA 2VAPA 3BZUA 3IQZA 3G17A 4P86A 4PG4A 3KZMA 2XDAA 2Y6VA 1B76A 1NJ2A 1C80A 1Z7EA 1EDZA 2G82A 2RIRA 2FQYA 4ENQA 2EW2A 3PCRB 4EPWA 2YY7A 2BFCA 5I7RA 1F12A 3BGDA 3GO4A 3TTWA 3I01M 3OMXA 1RCFA 1QGUA 3MZ0A 1QM5A 3UK7A 3ZZNA 4TGLA 5ALEA 5ECYA 3TTXA 3BG5A 4EDFA 3I9KA 1BXKA 3QU5A 4B6FA 4P9NA 1T9KA 3CNQS 2HFJA 3GBPA 2Q5EA 3VC3A 1BJRE 4HHEA 1A7JA 4Y0VA 1K7CA 1ZJYA 3HYCA 2I7XA 1WY5A 5LZ5A 3U80A 4ZTZB 2D1RA 4WECA 4PG5A 2XKKA 1J5PA 2FWIA 2YBDA 3Q1KA 1RJ9B 2NADA 2JH9A 1EJBA 1K92A 2C5LA 4M55A 3J80A 3L6CA 5IJ9B 4P3YA 1AGYA 1MJHA 5PGMA 4PM4A 4UU0A 2BOVA 4OI2A 1E7RA 1DCFA 2UVQA 1IPFA 3F7TA 2FW0A 1KEWA 1M2JA 5CT4A 2VQEB 10MHA 3IJRA 1ZU4A 2EP8A 3NO4A 1RYYA 2LCFA 3FWPA 4KMOA 4PZPA 3WK9A 1FP4A 1C3JA 1ICIA 1II0A 1U9JA 5DDIP 4CTNA 2JLSA 5JXHA 5EHIA 5TMEA 5HRCA 2O7RA 2WU4A 1A77A 2TMKA 5KNDA 2XB8A 1BCSB 4DWVA 1A9ZA 3H9EO 1UDRA 3ESQA 3CUEF 4ALMA 1Z8FA 2FEPA 3PDIA 4LZNA 2AJBA 1VG1A 4G0QA 1OZHA 1X9IA 3C15C 4IGEA 4UJ5A 5K0JA 3HEBA 1NBMA 4QFBA 1WF6A 5F2KA 1QZZA 1N77A 1UPXA 4KMRA 2F3PA 3JQCA 3WADA 4ETNA 4FIDA 1VB5A 4YCSA 2C2OA 2IYNA 2Z04A 5KAMA 3LFTA 4WBNF 4M37A 4QJBA 5HILA 2GKOA 1N0HA 3HJBA 1N1EA 4ZK6A 5ABPA 3IPCA 5G0UA 1MJNA 4CODB 1RPJA 1YZ3A 4DIOA 3D6UA 3IDOA 5J40A 3VKGA 1XEWY 1JP7A 3L40A 1PS0A 2Q9BA 1VLJA 3LI2A 1E92A 5JCZA 1XAIA 3E9ZA 2CCJA 3H1GA 3ECSA 1GKIA 3KXIA 4QX6A 2GDZA 1SKYB 5HK9A 1T9HA 2NUTB 4J4TA 3DMPA 5H4HA 4EUFA 5JBQA 4OKNA 5F21A 1GYQA 1W4BA 3T5PA 2HBRA 4NYIR 4R2XA 1YQDA 1S2LA 2EWWA 2V55B 3A3NA 3IPYA 1XGKA 1ZD1A 1R12A 4P31A 4RA6A 2QTFA 4JJKA 4NR0A 1WDMA 5FBHA 5HKKD 4OSEA 1LBTA 2GD0A 4Y9RA 1HX7A 3CUKA 4L74A 1IWOA 2COEA 1O97D 3UANA 4E1VA 4F4JA 3WNBA 2F4VB 4ZDIA 1H0KA 5HQ3A 1E2NA 1VRCA 2C61A 1NR7A 2P4HX 2BCEA 3TW0A 1YI0A 3H4TA 4RO0A 1XNGA 4MB6A 4L78A 5HX7A 3BHNA 1JDUA 4KUEA 5H3CA 2HTEA 1N5MA 2CUNA 2OUKA 2O5CA 2F1IA 4F3NA 1UBMS 2C9MA 2OG1A 1NWCA 2WJYA 2BL4A 2EG5A 5ILGA 5BT8A 2OM2A 3NRCA 1DFHA 4J2TA 2IA5A 4WA8A 1O5TA 1W75A 2W0SA 3O8NA 4QXMA 5CH8A 5DF1A 5B37A 2QQFA 1PN3A 3DEJA 4DM4A 1RQLA 2WFLA 1XUOA 2IK8A 2W11A 1E5VA 4MS3B 3MWFA 1M6WA 1IBRA 4XA8A 5FEUA 2VJDA 5LQJA 1GCIA 2W2LA 5DCYA 3GLGE 2I4NA 1QS0A 2P30A 5AVTA 3DEAA 5BPHA 1FTYA 1SUBA 3QNMA 4PZLA 3SVZA 4BO6A 1RHRA 3LBIA 4WZ6A 3D81A 4RABA 5INTA 1CXZA 4WKOA 1DC7A 1K3FA 3L04A 1C8BA 4JS0A 5LB4A 3AQIA 2VNHA 5GWXA 4P0QB 2HV9A 3E6AA 3S4YA 2ZBUA 1QIMA 3HYRA 1Q2XA 4IHQA 3COPA 3ZBUA 1RCUA 2WEKA 4TOIA 2GX6A 5JSKA 1ZSNA 2YXBA 2H4JA 5JROA 2J07A 2DY0A 3AR6A 3VO8A 3KFXA 3NFYA 2CXUA 3WGJA 3EZLA 5HDBB 3BHIA 4QDXA 2ZJ1A 3VYTB 2B8EA 1BX0A 3I9V1 3M4NA 1YZGA 2XMSA 3H1EA 4U2CA 3H0EA 4ZMRA 2JBHA 5J23A 2Y0BA 2B1QA 5I51A 1JQ5A 4DBVO 3HU1A 2DHCA 4FQ5A 3RS8A 4RNCA 4QGGA 3KOZA 5MFPA 3LCJA 4Q1VA 2KX7A 1OA1A 1QWSA 2OECA 4UXIA 3R75A 1IOLA 3RG2A 5LU9A 1ZKDA 4CWAA 3G9TA 3GMDA 1QH0A 3NEAA 2B5VA 1YB7A 4QRHA 4FMPA 5EHQA 3WK5A 2QBYB 5KNDD 1JHPA 4POAA 1GZDA 2NW6A 3QK7A 3T5TA 3A8TA 2Z5VA 3W34A 2PMDA 2W2QA 2JFYA 3WGLA 1KBQA 1X92A 4U02A 1AKUA 2AMJA 2JEZA 4POOA 1JEQA 2GN0A 1FUYB 2AD5A 3O3NB 4OXXA 4ZVPA 4COKA 3LO8A 4CM1A 4K40A 4MW7A 3F5MA 1BMDA 1DXYA 1FS4A 3UTDA 4BDSA 4CMCA 1S1MA 3HCNA 1NYLA 2ZI6A 5H70A 3STXA 1T5BA 3BAFA 1Z08A 4X7RA 3R6TA 5AMXA 2PGJA 3KUCA 1DKNA 1Y4AE 2WF9A 1YNOA 5KHOC 4FGSA 4IJKA 2VUSA 2G09A 2IYZA 4M60A 4V3BA 1UJ4A 1J2TA 3RIGA 2DEUA 1BDIA 2CCGA 1YQQA 3IV7A 1AF7A 2F64A 4DDTA 3DWEX 2C2GA 1X19A 2X4GA 3KEQA 3BUSA 2HXSA 3PK0A 2CB0A 4GYYA 1SWVA 2GWHA 4NEGA 1HYGA 5HMLA 2IKSA 3KZVA 4UW9A 1JU9A 3FCXA 3U44B 2G4CA 3OE5A 3T5DA 5EXEA 1CC1S 3WAGA 4UE3S 5D00A 1RHQA 3ICOA 1R0CA 3B51X 3EDMA 3UZUA 5F7OA 2CLSA 3MRXA 1CQWA 3LDUA 4KLZA 4O4JB 3CJQA 3FHCB 2I66A 4BQFA 5JQGA 4JYAB 1AK1A 1XTRA 2AG6A 2AFHB 1ULBA 3ZZ0A 3HGQA 3PX7A 2CNLA 1NW6A 2CDCA 5ADUS 3RHTA 3GVHA 1N5IA 3ONWA 1U8EA 5SV2A 1K6XA 5A4AA 3C4QA 3MHPA 4RKFA 2MR6A 2GWRA 5KTYA 1UIRA 3EG9B 3LAWA 2FSSA 2G71A 5CYFA 4AIIA 3BE5A 3BD7A 4O2BA 3U3RA 2WKSA 3O9ZA 5KTNA 1OFHA 1A7KA 1XQVA 2ZK7A 3F5DA 5J2TB 1WQ1R 1ORTA 1U3GA 4MVJH 2GAFA 5CDYA 3F6SA 2A4MA 2NO5A 1XP5A 3N2KB 4PFKA 4CKEA 2CUKA 1MX3A 4OK5A 4OCZA 3FZQA 4Q1CA 5KC9A 1UKZA 1L5HA 4CCWA 4PZ0A 1J06A 3QKRB 5K0FA 4OMDA 1NNUA 2CDRA 2NZ8A 2PS1A 4YJFB 2RAVA 1B26A 2R1TB 2VUHB 2ZI7A 2B78A 4L8FA 2HTFA 3F2VA 4LVCA 5JSFA 4P58A 2EKZA 3P1JA 3DXZA 2X0NA 5EJ5A 3IDAA 4M7OA 3G8BA 3IOMA 4CR8A 1M66A 1QFZA 1Y9ZA 1PIWA 2NZ2A 4M0LA 1ZH8A 4OXQA 4GVPA 4OBWA 5L7WA 1GGJA 3CX7A 3WL7A 5GIOE 1TVKB 4QRDA 1P7YA 2FI1A 5CNJA 1YOVB 2ZQ5A 3N3BC 4IL5A 1CUAA 1UINA 2FPUA 1G5QA 2PT9A 1I0ZA 1S2GA 3BE4A 4UAJA 1RRKA 4BAGA 3LECA 3RSLA 2XZOA 4EFKA 1BCRB 2PZFA 5CTAA 2ZIXB 3QLJA 1K6MA 3OM9A 2CLMB 3C3XA 1Q91A 4MP8A 2ZCVA 4OYHA 1SVKA 1OI7A 1U4NA 3EVZA 3T1YB 2JHFA 4LTDA 4DG8A 1DAEA 4NAVA 2V7BA 1HE3A 4KGDA 1SXJB 3L18A 3ZY3A 4AUKA 3QHAA 3PVZA 4G26A 2SKCA 4HEQA 4Y1RB 3Q9LA 1Q1ZA 3A6LA 3AFOA 2I22A 4PAMA 3VDRA 4F06A 3QVGA 3R7BA 4IINA 4S24A 5HP4A 2Y77A 3L7DA 3PQCA 3QFFA 4I50B 1FTQA 3CY6A 3MCAA 1UFKA 2UAGA 2QX4A 2QQ5A 4RF5A 3W5IA 1JEYB 4BQOA 5KSYA 2C20A 1VBKA 1QX3A 1I33A 2YXDA 2BSQA 3O4VA 4EPTA 5ULLA 4BCCA 1RLJA 2JLQA 4IMJB 4RL4A 2JZOA 4GPD1 4I4LA 3V2HA 2BWJA 1K7XB 1L0BA 1NJSA 1FPMA 4YX9A 3CX3A 5JNTA 3ZWOA 2OXCA 1ZBDA 4C22A 1C5KA 2VEDA 2NT4A 2WHYA 4QQRA 3HXOA 4LY3A 1X74A 4K5QA 4E2ZA 4B87A 1QRSA 3BA6A 2H65A 3HJGA 3GRAA 3RW9A 2QTLA 4URZR 4CDMA 4ZCTA 5KNBA 1FW6A 3EMKA 5HK8A 4GI2A 1O9HA 3MINB 3DQPA 3SE0A 2VLIA 2X8LA 4L8YA 1T2UA 5C8XA 2XUZA 3FFXA 3OIFA 4KUGA 2WD7A 1IJKA 3BX1A 5AOAA 4GPAA 4A8HA 2REXB 1Z12A 3MMPA 3DKPA 4KVGA 1FLNA 3TGLA 1U7HA 1N6LA 2Y4OA 3O4IA 4A10A 3GG2A 4PWZA 2YVQA 3JPWA 1OX4A 3PZRA 4UVHA 4ESHA 3TPFA 1RM5A 4KXQA 5A2QA 3KSZO 3AL2A 3OFNA 2PX4A 1KQFA 3WGVA 4ZRDA 5IYZB 3N7UA 1I51A 1ZY2A 3OIUA 4HF7A 5DJ5A 4AUMA 1NW8A 3P0HA 2I99A 2XTNA 4R2KA 1TA0A 4LJAA 4P98A 5FFNA 2VT3A 1U63A 2IHBA 1DC8A 3P9NA 4S2EA 1PV1A 2WW8A 4E3WA 3PNBA 4NG5A 2OCXA 1ZL0A 1AS3A 1ZI9A 2FU5C 4I1YA 2NLOA 1YS4A 4MX8A 2PMWB 4D92A 3FFWA 3P8ZA 4DPMA 1MCZA 3PICA 1RS0A 3MG9A 5E1MA 4L7QA 4NMWA 4C30A 4RJKA 1SBQA 1SHKA 3G2LA 3U3ZA 4EGCB 1U02A 4CM7A 1E96A 4IDOA 1H66A 2UUPA 4CI9A 2C3UA 4QL3A 4A0SA 2CVZA 3ISVA 4CU2A 1NVKA 2B8TA 4A0GA 2XA1A 5C53B 1P0FA 1ZXBA 5I9NA 1CLEA 3RHFA 1DWOA 1GAWA 3WGNA 1T15A 2BTQA 3QEOA 4C43A 3U19A 2IS1A 1E9SA 1EVIA 1N0VC 1TW2A 2EGHA 1XT6A 4IDAA 4G9BA 4JT2A 2FZLA 5LQDA 4EO9A 3UAVA 1XTPA 3EF3A 3DTVB 4KXVA 3LZ6A 5E8JA 4W9MC 2QTZA 2BPOA 4ZRNA 3DULA 3AY3A 2PXXA 3QIVA 4MW4A 2ZSIA 1XD8A 3KQWA 2NSJA 2BFDA 3ADPA 1NVVQ 4DF3A 2Q5FA 1EVYA 4EW3A 2BM1A 3PQ3A 1GT6A 2H92A 2WTEA 1EMDA 2X6QA 3B3GA 2X41A 3DVQX 4EKNB 1SBYA 2FWBA 4I5IA 1MH9A 1SHUX 2AFIA 2VBCA 3V7YA 3DV2A 2D5IA 3FWKA 5E9AA 4A0HA 4BJ5A 5JCOA 4BATA 2GT1A 2BW0A 1HTWA 2WVHA 1DOHA 2GAOA 4G5YA 4X1OA 5JJLA 2YZ7A 5FA5A 3H42B 2D4HA 2Q8PA 2W6IA 2DHEA 5EQJB 3DKRA 1KFJB 2HA2A 1KZ9A 3T3NA 4E5VA 5EJ8A 2MYNA 5JUWA 5IM4A 2AG5A 2C29D 3REFA 3EVFA 1C9JA 1XL1A 3NMUF 5B53A 3WYFA 4ZEXA 2FW1A 5LQMA 4HMPA 1DLIA 1VKNA 5CVUA 4GAEA 2B2XA 2G0NA 3V2GA 2VBIA 4IF6A 4C3OB 5TV2A 2H1IA 4IDNA 3TG8A 3KQKA 1D2GA 3GLSA 1VJGA 2W58A 3O1IC 3CO5A 1P1IA 4PCUA 3COZA 2NZXA 1FYFA 1MC5A 2VZ8A 3JD3A 4YK7A 2BKAA 3QVVA 3ZE8A 3J7AC 4UBOA 1T3HA 2BZSA 1U8UA 2TMGA 3ONNA 1E5XA 5E7MA 2GD2A 4BX9A 2IYLD 1T9BA 2GCOA 3CB2A 3MJSA 5BT9A 1HXHA 5KPDA 2NQ2C 5K05A 1DXOA 1QG0A 1AS2A 1YA4A 4F04A 4ODIA 1HE5A 3A4LA 1PJ3A 4P4TA 4F45A 1T2AA 4CIXA 4MW6A 3HBAA 5JZVA 2BTOA 1Q74A 1NDUA 4WXRA 4GH5A 1W7AA 4OLHA 3ER6A 1IIRA 2C4KA 3QHQA 4DV6B 1XQ6A 3N2ZB 2G25A 1S2DA 3N5KA 5AYVA 3E9RA 5GZ6A 3LUBA 5I48A 5KNBD 4G5HA 4G5SA 1F2TB 3VDMA 5JXWA 4CL8A 4CIBA 4XOIA 1HDYA 1UQTA 5AOBA 1J1ZA 3OKCA 2GN1A 2OBBA 4EB3A 5KNDH 1IZ0A 3UWMA 2JCVA 5LQSA 1FZTA 4K87A 1W36D 4MWEA 5I7VA 3FYUB 4KE8A 1XI2A 2CY0A 3INRA 4P2GA 4JI6B 4EEXA 1VL5A 2XYVA 2A3NA 3KKLA 3NLLA 4WXHA 4X71A 1M1YE 1MRZA 2Y66A 1CQJB 3OFND 4I9NA 4PGAA 4MQFB 1JR3E 3CBGA 3LRPA 1I5RA 1LY1A 2E0IA 1YBMA 3EVNA 4GE0A 5JAOA 3JZIA 1J8VA 2FMTA 1X7YA 4LFCB 1LDYA 4CXMA 4OAQA 4DJFC 1OJ7A 3TLKA 4NESA 2JLZA 2R7NA 3EDQA 3SHVA 2WQZA 1AGPA 1XO1A 1NVEA 1J2RA 2JKVA 3PYXA 3CU5A 4GM1A 1XZ8A 3DR3A 5DEOA 1LZLA 4OG2A 3TXYA 3UJNA 2C04A 1QIHA 4GDMA 3I0NA 1DEKA 1ICEA 2BH9A 3AUJB 3B2QA 3OFSA 1TCAA 2Q6TA 1VLLA 1A5SB 3EBOA 1G3UA 2PNFA 1JLHA 3VQTA 3C8UA 3IAUA 2GH1A 1P9LA 1MB4A 3LUAA 4HKTA 2XF8A 4RYLA 3ER8A 1ST3A 4Z1MA 1O6FA 2IXTA 3WNVA 3BTSA 1FOEB 3NAQA 4NBRA 2AG0A 4RY2A 4EHBA 2OYSA 1T9ZA 3DBLB 2D0OB 2XDQA 2ZANA 2C4HA 5J4YA 4EPYA 4LJ7A 2AE2A 5JJIA 1JBQA 3JQQA 5E6UA 3DP9A 3IH5A 1KQPA 1USKA 3HQ4O 4D5EA 1H0RA 1TIBA 1ZIPA 2OXFA 5M29A 3S55A 1ONBA 1TUGA 2HLDD 3PGLA 5TJ9A 2L0XA 4DCCA 2IYPA 1CF9A 5FOUA 1AV6A 4YAWA 4E33A 2RH8A 1TYEB 1ZC4A 3TRJA 2B2NA 2R1VA 2J3DA 3D7MA 3RSGA 2EIXA 3AP2A 4RMIA 4Y6GB 3ZI0A 2IE0A 2GHRA 4JLMA 3IUSA 1YVDA 3QENA 1UPFA 1COWA 4JLWA 5FBRB 5I9TA 4D8TA 1EFAA 1DADA 1MVOA 4GPIB 3JQGA 1KVQA 4JT4A 4LSZA 2AZXA 1KSJA 3OTQA 1E2LA 2B92A 2W6ID 3UV3A 1SCQA 2TYSB 1A82A 3C3AA 3L6OO 3HXQA 2H7XA 3R3JA 3L82B 4C0JA 2GS9A 1V9CA 4FOOA 1UBSB 2HQSA 2VPQA 1X8KA 2OVFA 3G9XA 3I76A 4ENPA 4LOIA 4QDZA 1UM9A 3QF4A 2GGSA 4FW8A 1K4YA 1JFSA 4N48A 4U0KA 1AZLA 4Z3KA 3VX4A 4RVOA 5JEEA 3C5HA 1KK0A 4R1LA 5K4AA 2MSDB 2X23A 3UV6A 2O7VA 5GM1A 1AMUA 3NNNA 3ZIDA 1RLTA 4DCPA 4PXAA 1KEVA 4PX2A 4B6RA 2C8LA 2CL0X 4J1TC 3I3SR 1UK8A 2DWCA 3ZKAA 2SKEA 2WSMA 2BEJA 2WWYA 5J4LA 1YFJA 4XEHA 4FFBA 1V35A 2VHXA 4O4HF 4Y2QA 1UFRA 1T35A 4JDUA 4ZQCB 5I8PA 3ZLUA 4Y1EA 3LCMA 1IY8A 1QFXA 2JGDB 4Y7DA 2NU8B 2Z0MA 2WILA 1MAUA 3EQ6A 3R7AA 5KNLA 1MORA 5LVAA 2HA6A 1OYYA 1ORWA 3ZWKA 4C7JA 5BOSA 2OBXA 1YZQA 5D85A 1NMQA 2CB9A 4JEHA 3WQSB 2QB5A 4R5MA 4Q9LA 4K0KB 4QYXA 1NXWA 3JQ7A 5J2TF 4YLYA 3DL7A 1V26A 1IRXA 1E6MA 1TQ4A 4K9QA 4KO2S 3RBVA 3RD5A 1HNXB 2G0TA 1DS6A 3D8BA 1OE0A 3TQTA 1Q16A 3UWOA 3CKYA 3OICA 1Q20A 2J8ZA 4MR7B 2QTVB 3O47A 4Y2SA 1V6CA 3AWDA 3S7TA 4QTUB 1ZM2A 1Q95A 1DJQA 2H5IA 3GD7A 4FNGA 3UWDA 4CFZA 3K4PA 2IVFA 2RGYA 1AM4D 3QVKA 5HWSA 4WY8A 4KE7A 4JY7A 2WQ7A 3H9CA 1PP4A 3BULA 2ABWA 1PKEA 5G0TA 1YRYE 3T38A 3E9QA 4BN5A 1OWNA 1YS7A 1C9EA 2XYHA 2PNJA 1I7NA 1Z5ZA 3BK1A 3GQBA 3E22B 5AKJA 4F3CA 2E48A 5AO9A 2J31A 4E32A 4XVUA 1TVMA 3QRWA 3PWSA 4XD7A 2GM4A 4Y0AA 5A4IS 1YRAA 2FN7A 2Q9AA 3C5WP 3Q41A 3PPWA 5FI3A 2DECA 3E7FA 4XFDA 2QM0A 4F71A 1FXUA 3B6KA 1Z2OX 3CH4B 1ND5A 4RA9A 4Z1MD 3WLEA 1GARA 4O3FA 2UXBB 2B9VA 2R8BA 2WLSA 1NI4B 2C5HA 2EX4A 2H7CA 2FPOA 3E3MA 5GGXA 2BM8A 5REQB 3C5EA 3U4DA 3IL2A 1L4GA 1K6EA 1R4NB 3SWWA 3QELB 5IJXA 1C8LA 2BKXA 2RGEA 2C9DA 3RTGA 2UYQA 4HAUA 5MN5A 4E70A 2XBMA 4GGPA 3JTEA 1P0PA 3C3MA 4G07A 3S70A 4P0PB 1B42A 1OBFO 3F4KA 2V6MA 3Q0TA 1O7JA 5AP9A 3RSQA 1CS0B 3UCXA 2GN9A 1GCOA 4NFYA 3B1JA 3PHIA 3EH1A 5KCZA 2YV4A 5BUCA 1YE3A 4P3OA 4WLFA 1L7AA 2GMWA 5CAEB 3KSAC 2A1UB 1XPRA 2SBTA 4GKKB 1GNTA 3MRTA 4E12A 4FNAA 4FINA 5JSYA 4EB6A 4ZOBA 1COWD 1HV8A 3N6VA 5ICEA 2AOUB 4QHTA 2PD3A 2O0HA 1MPTA 5J47A 1SRRA 1W85A 1JLMA 3QUBA 4J8PA 3PUHA 2IFTA 4AM8A 3F0TA 4RTKA 1BH6A 2PWAA 1ONOA 2I2FA 3E8SA 4I5GA 3UAYA 3W2TA 4A1FA 5F52A 1K4KA 4PE5B 1ID8A 3G1WA 3MWDB 2J9GA 5AICA 2GVDC 1NJ5A 2ZJ3A 3L79A 3IC5A 5D6OA 5C8VA 1N9GA 3WYEA 2GEFA 1NQ5A 5EUBA 5F5NA 3U13A 2EJVA 3TQIA 3OH8A 2QROA 1MR3F 3JALA 1D0IA 5KZMB 1JHXA 1SMKA 1LDBA 3GFVA 2X1LA 4ZKDA 4FCCA 5KYUB 3TEJA 1O0SA 1P4SA 4B46A 2GEKA 5CXXA 1LA2A 5BWLA 3RTDA 1QTRA 3K20A 4PX5A 2OPHA 1KDPA 1YL5A 4FNOA 1X1QA 2P11A 2BGLA 1UT5A 2F6RA 5K3AA 3ZBPA 1OI2A 1LI5A 3LVFO 4WXPA 3GJ8A 3L8EA 1U0BB 4EPVA 1T9AA 5F7JA 3NWEA 2X0FA 1Y1PA 2P9HA 4QPZA 2HNBA 2FWJA 3OFVA 1P0IA 2YY5A 4IO0A 3LGAA 3QI2A 2NZYA 2O3TA 4XH9B 3OA0A 1B0PA 4N0QA 3N3AC 2NV2B 2AZMA 3AVYA 2Q6LA 1NSFA 4RV5A 1QGED 1KKUA 3ZDZB 2I8LA 3VR0A 1NVDA 1G7SA 3OLQA 2JFZA 1DU4A 1T24A 4LIPD 3CJTA 1WOYA 3WY9A 3DOCA 3MJDA 1SXGA 3T4UA 3Q6MA 4MKHA 3WFIA 2FE1A 1FSSA 1FTSA 1HMPA 3H18A 5KOJB 5LJLA 3KE9A 3WP0A 3RIYA 3N76A 1YQTA 3ZHQA 1QG4A 2C3YA 3MWEA 2XAAA 2BBTA 2Q1SA 1SU7A 2RJNA 2NX2A 2BDTA 2FN8A 1XRNA 3O9VA 2D06A 5B6IA 1RQRA 3TGWA 4QE3A 4W8OA 3GLFB 1SXPA 3ZLJA 1GILA 1LC3A 2CDAA 1GITA 4KQIA 4D0LB 5JECA 4WZAA 3ZDYB 1SKUA 4AKTA 1S2OA 1I36A 3OLVA 2JFFA 1MQ9A 5DXJA 1C29B 1VPWA 2AJTA 3H8SA 2Z9BA 4LBZA 2QVYX 3HCRA 1X14A 1C4OA 4YJHA 2R6CA 5IBRA 5K3DA 2J9YB 3CR3C 1PR1A 3S2EA 5KNBH 5L3SB 2HNKA 3GUVA 4LCBA 4PGMA 2VVTA 1K9VF 3KT3A 3AUXA 4G8DA 4Q4AA 1PGJA 3H5RA 4XD7D 2R7AA 4AF8A 2GXSA 5ECWA 1OAAA 4QXPA 3ZE1B 4DGSA 4YJ2F 1ORHA 1H23A 3IUPA 3KOMA 3LL4A 3BH6A 3A06A 2JIQA 3IHLA 1YVUA 1JILA 4MYUA 3VOTA 5FO1A 1EM6A 1GXSA 1XRJA 2LTAA 2NTNA 1AY0A 4DJAA 3WRYC 1U1EA 5KSOA 2O8CA 2O8NA 3CVWA 3C4VA 4NENA 4D4GA 5E6SB 3WZMA 1N2GA 1SOWA 2ZXEA 2Q3EA 3KLMX 3MJEA 3P2OA 4HYQA 5JAHA 4H1VA 4BU0A 3ZEIA 2OOKA 1M1YA 2RC5A 1L5VA 1TA4A 1XVUA 2DPYA 1JR3A 1XKQA 2Z2KA 4WLOA 4FSHA 1DQPA 2JNWA 2JI8A 1QLJA 2P7HA 2YWJA 4OIFA 1RWXA 4BPRA 5DX0A 1SOVA 5IS2A 3D6TB 5EP3A 3PEWA 1Q1QA 3DM9B 3GLIB 3CURA 3MOGA 3T41A 2WD9A 3DT9A 4YWHA 3V8PA 1O3YA 5F1YA 4ATNA 4E30A 3GLVA 2ACEA 1D04A 2ARKA 2YZGA 4XWAA 5H16A 1ISRA 1KK3A 2E4AA 3OURA 5B58T 3IDFA 3AR9A 5L40A 5CFNA 3K6JA 4TRMA 4ZEMA 1ZQ9A 1W6RA 2OB1A 5MHTA 2D2EA 4QATA 3ORHA 3P0JA 1KU6A 1FX0A 4HDNB 2BLLA 3WJAA 3TIIA 4O4HB 4E1BA 3SJ7A 1UT8A 1ESZA 4CCYA 3G2HA 1WDKA 4ZCQA 1DP4A 1WEHA 4QDKA 5JY6A 1QKJA 4OGFA 5AHXA 1XTSA 2V7PA 2P9BA 1UZAA 3EMDA 3DDUA 2QRJA 3Q9UA 4V1CB 5GONA 1PW5A 1G8GA 4I1OA 1O95A 2K2WA 1CE8A 2C5FA 2JFXA 2PUGA 1J1UA 4F3KA 4B40A 4L0QA 4KLNA 3U26A 2WSBA 1TMGE 4WSOA 1DRWA 2P5UA 3V46A 3LPDA 4GXTA 4X3OA 1FNMA 3UJHA 3M49A 1NBOA 3K94A 1DHTA 4EX6A 4NP6A 3DXYA 2VXBA 2QS9A 3ES9A 1K27A 3PJFA 1FRFS 1QH1A 1VYHA 1JWLA 2XUAA 3GEMA 4HNAB 3M70A 3FB4A 4U9IS 5DU2A 3WDKA 3NBFA 4AMBA 5JJ5A 2HWYA 3M9WA 3C70A 5JZ9A 3T06B 2PSDA 4CRWB 3CS3A 2MR5A 4ZMSA 5L3ZA 3IAXA 1AGXA 2NUBA 3ZQJA 3T3IA 5JMOA 1Q6YA 1FE8A 4NSNA 3QW2A 1DQYA 3CZAA 3D3NA 2B4TO 5B2EA 3EXG1 2MSNA 3NU1A 5DGTA 5E1OA 4UEKA 2A14A 3GJ3A 1VYTA 2E89A 2Q5LA 3H5NA 1QOZA 1SZCA 3EF1A 4HLUC 3L0PA 2PUEA 1RI2A 2WJGA 4EARA 5SYNA 3TOCA 4WUTA 3RRXA 3SD7A 4C3ZA 3OPQA 3TFQA 1FXWA 3CZ5A 3PB3A 4YN3A 3DQQA 1DC5A 3DMTA 2FVYA 4M8NE 5AW8A 3PP8A 5CDTA 2X14A 3C7CB 1SC3A 5CW2A 1E0AA 5BSEA 1V45E 4YCCA 2E4WA 1U6KA 3MS7A 3IOBA 3CZMA 3GFGA 2EJUA 1AX9A 4F4CA 1K66A 4Q7JB 3QPBA 1PZGA 1NKSA 4Q00A 2RMKA 4BV3A 3ELDA 3OT5A 2RHOA 2YIJA 5IKXA 4DCOA 4E7PA 4IYJA 3RSZA 1T0IA 1A27A 1CQIA 5E7JA 1UXGA 2XUOA 2C97A 4PBTA 3ZU5A 2I55A 5B4TA 5CCEA 4WDQA 3RU3A 1JS1X 3PGXA 4RTRA 3FRHA 4KWEA 4PSDA 4IOMA 3G68A 3UWKA 4EUEA 3IHTA 1CY6A 3UJ9A 3HB9A 2QVGA 1IOWA 4A16A 2P78A 3LL7A 4MQUA 5FBVB 3L4SO 1W44A 4A03A 3KB1A 4H4EA 1JKJA 1TIKA 1ZJ5A 4Z8XA 5EKTA 1B0UA 1P6QA 1G18A 1Q7TA 1VIDA 1SD1A 2ON6A 2VDKB 3KVNA 1G20E 4Y2VA 5ESXA 1N2EA 3GYBA 2XCTB 3MRVA 1JR3D 4WLUA 1Z35A 3WRWA 3EF0A 1MA3A 3MJFA 1JNXX 2QMZA 3THWA 4LHVA 1FVOA 2Y0EA 3ORSA 2E1RA 3P94A 4IH1A 4Q21A 4RZQA 5AM4A 3ZS8A 1S2NA 4XR9A 1ZNQO 2WAYA 4R1MA 3NPAA 4C29A 3J81A 1IHDA 1VJDA 4KNWA 4HN4B 1GEEA 3JQ9A 1TUBB 2RKWA 3A1DA 4MVXA 3ROGA 1P7ZA 4E08A 2Q5CA 4MDEA 3ZTYA 1KEEA 1C2TA 4EW2A 1L8OA 2GBPA 2DTDA 2OZLB 1B7GO 5AK0A 1KMNA 5BVHA 1U0HC 2RBKA 1XEFA 3NUGA 1YS1X 4LJ9A 4LV6A 3ASYA 5AI8A 1UK6A 4NBUA 1S6YA 4V0RA 3B13B 4DQDA 3IBSA 3HXLA 3PDJA 5L3VA 1CETA 2GI4A 1XU4A 1XYVA 3OAAA 3TKYA 3I9JA 4U2DA 3DUFA 2CLDX 4ER6A 2B3DA 5BYBA 4BNIA 3AB3A 4DR2B 2NAFA 3DBVO 3PQ6A 3KUUA 3UJ8A 4KYIB 5EJAA 5AXBA 3I5AA 2OHVA 4WIAA 1YKGA 3CW9A 4R8MA 1IATA 1O95D 2WF7A 5BN5A 1V5WA 2DFNA 3NWPA 5KYNA 4AUEA 1WLYA 1KO1A 3A2MA 5AK3A 4CT4B 2HUPA 1DNPA 3G49A 1Z37A 2A1TR 3BFKA 3PHCA 5E95A 3I9V6 4ZYVA 1UXHA 2X5OA 4G23A 2FQQA 3GRCA 5KNCA 1WB9A 3X2SA 3HM2A 3D1VA 2H48A 4QTYA 2VNAA 1T36B 4DAEA 1RZRA 3UICA 4ZOAA 5I9MA 1GPJA 3VKWA 4E09A 4JP2A 1HE2A 4C7KA 1RJGA 1TKBA 3GHHA 4LHZA 3UXMA 3DGFC 1B6SA 3JY6A 3NRBA 4QQFA 2A5FA 4DJDC 1XU9A 2ZYAA 3DD1A 3GUYA 2C7PA 1V11A 4I9GA 4KG7A 5ILOA 2RHGB 4C9BA 3HNOA 4YRGA 2IX3A 4DA0A 4PPYA 1YZUA 5IAEA 3WO0A 2M6SA 5DO9A 1P81A 4MV6A 1O58A 3C74A 1G9SA 1UUFA 2CNOA 2E5FA 3H16A 3L4BC 3U31A 2ZM6B 4WFKA 1DAHA 5HFJA 1OYVA 1WCWA 1KJWA 2WVJA 4XIYA 2AWNA 3QXJA 4HQOA 1Z88A 4UFOA 1M6YA 2DKNA 4KKXB 1TO1E 4KR0A 1Q1EA 2MHCA 3TZQA 2YTZA 4BX2A 4JBYA 5AOVA 3H1BA 3ETDA 3WGKA 3UGQA 4RACA 1RBQA 5HKAA 2W93A 4BO3A 2GCNA 3DE1X 3RFCA 3C24A 3PWZA 1RR6A 2D7JA 4RFSB 1OPRA 4HSEA 5AM1A 4ZJYA 5KQRA 4FHZA 4EY4A 2NO1A 5AVXA 3DLBA 3ZN2A 1FP4B 3MPUA 3GV0A 1VJ0A 1GFSA 4ND7A 2H85A 2GJKA 3FYHA 3DO8A 4KMMA 4P32A 1ABFA 3K1AA 1PT6A 4DR1B 1UBRS 1YIOA 4WEOA 2REBA 2WM3A 3BQMB 3E7XA 1RADA 4NJOA 2GILA