4N6GA

Tailoring small molecules for an allosteric site on procaspase-6
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
268
structure length
257
Chain Sequence
FYKREMFDPAEKYKMDHRRRGIALIFNHERFFWHLTLPERRGTCADRDNLTRRFSDLGFEVKCFNDLKAEELLLKIHEVSTVSHADADCFVCVFLSHGEGNHIYAYDAKIEIQTLTGLFKGDKCHSLVGKPKIFIIQAARGNQHDVPVIPDTNITEVDAASVYTLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYGSSLEFTELLTLVNRKVSQRRVDFCKDPSAIGKKQVPCFASMLTKKLHFFPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tailoring small molecules for an allosteric site on procaspase-6.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Caspase-6
total genus 87
structure length 257
sequence length 268
chains with identical sequence B
ec nomenclature ec 3.4.22.59: Caspase-6.
pdb deposition date 2013-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4n6gA00
3NKFA 3GJRA 2Y0BA 5IAEA 3GJQA 2CJYA 3DEKA 5IBRA 2QLFA 4N6NA 1JXQA 1BMQA 4NOJA 5LU8A 4ZVSA 2QLJA 1IBCA 5IBCA 4QUJA 3OD5A 4QULA 2XYHA 1F1JA 3ITNA 1K86A 4EJFA 4AW9A 2CNNA 2C2KA 2H65A 4HQRA 1QTNA 3H11A 1RHMA 4HQ0A 4PRZA 1GFWA 4FXOA 4QUIA 2FUNB 3D6MA 5LUAA 2K7ZA 3IBFA 4JR0A 4EHNA 3K7EA 3BIJA 2AR9A 3GJSA 2HBQA 4DCOA 2QL9A 4PRYA 1RWMA 2P2CA 3R7BA 4D3XA 2XYGA 5I9TA 3R7SA 4AWBA 3D6HA 1RHQA 2QL5A 1RE1A 3SIRA 2XZDA 4M9RA 4ZVRA 4N6OA 1NMEA 3V4LA 3KJQA 3H1PA 4FDLA 3H13A 4JR1A 4EHFA 1NW9B 2H4WA 5IAJA 5IAKA 3R6LA 2XZTA 3UO8B 2C2MA 2CDRA 3DEIA 2H51A 4I1RA 5IABA 2J30A 3R5JA 3KJNA 4JQYA 2H54A 3EDQA 4QUDA 4QU0A 3PD1A 4QTYA 1CP3A 3NR2A 4ZVTA 4QUGA 1SC1A 4EHDA 2H5IA 3H0EA 2FP3A 4DCPA 1RWVA 4FGUA 5H0IA 3RJMA 1PYOA 4LSZA 4N7MA 4JJEA 5I9BA 5LUBA 4EHHA 5JFTA 3V3KA 3S70A 1M72A 3KJFA 4AWAA 3UOAB 4IYRA 1K88A 4EHAA 3IBCA 1I51A 1SHLA 4NBKA 1RHRA 5IANA 2HBZA 4NBLA 4ZVPA 3D6FA 1I3OA 3GJTA 5IAGA 1I4EB 2NN3C 1GQFA 1F9EA 4PS1A 4N5DA 2FQQA 3DEHA 4JJ8A 4ZVQA 4I1PA 2WDPA 3V6LA 4EHKA 4QU8A 1KMCA 3PCXA 3EDRA 1SC4A 4JB8A 3QNWA 4FEAA 3SIPA 3V6MA 3R6GA 4PS0A 4D3ZA 2H5JA 3H11B 4QUHA 5IASA 1RWOA 4DCJA 1RWKA 1CVRA 4N6GA 2CNOA 1PAUA 2C2ZA 3DEJA 4QUAA 2HBRA 5IC6A 3P4UA 4HVAA 1NMSA 2CNLA 2HBYA 4NOKA 2C1EA 3NS7A 5IC4A 5K20A 2CJXA 2H48A 2J32A 2QL7A 2XYPA 4JQZA 4QUBA 4IEFB 5IARA 5IBPA 4D3YA 1NMQA 4NOMA 4QU5A 2H4YA 1RHUA 2DKOA 4N7JA 5LU9A 1QX3A 1SHJA 1SC3A 3PD0A 1ICEA 3V55A 4ZVOA 1I4OA 4QU9A 4JJ7A 1RWXA 4NBNA 3R7NA 1RWWA 2CNKA 3V4OA 4ZVUA 1RWPA 4QUEA 3P45A 2J33A 1RHKA 1RHJA 3R5KA 2QLBA 2J31A 4NOLA 2Y1LA 4QTXA 4EHLA 1RWNA 3S8EA 1QDUA 2C2OA 4JR2A 3E4CA
chains in the Genus database with same CATH superfamily
3ZJUA 1L7BA 3E58A 1UF9A 3AF1A 3RFFA 4FX2A 2IOQA 5LPNA 1W2GA 3FGNA 3FNHA 1BO6A 3MBKA 1GCAA 4JWTA 4YAEA 4JJGA 4N12A 4RTMA 1QWOA 4N5LA 5J4HA 2NUPA 5HEKA 2Q5LA 4JLPA 3M33A 2ZPUA 1A8HA 1GPWB 1AKWA 4K1XA 2VA9A 4Z1MD 1QHSA 1ZGCA 1U5CA 2FWPA 1W2HA 2C0PA 1BX3A 1K86A 1NUPA 4JLMA 4UBIA 3Q7TA 4DPMA 1N8KA 3LP8A 5KCZA 2ZZMA 1W96A 4YRDA 3H11A 3JPWA 4YDSA 4X90A 4L73A 2JEOA 1BVHA 3H9CA 4DR2B 1A0OA 3K5IA 5SY4A 4NU8X 2SICE 3CV3A 3I58A 4ZOCA 1OLSB 4URUR 3LPDA 2QE6A 3LJKA 1TJNA 1E3WB 2VJAA 1OT5A 3VPAA 3CW9A 2ONKA 4RJKA 3KVRA 5LLSA 5GJCA 3MUOA 3DBRB 3T7TA 2ZCUA 1PFVA 9LDBA 2DY1A 4YAOA 3D0OA 5J4LA 2J3KA 4D0GA 5A0FA 5JTTA 1IN6A 1EVIA 1NMEA 2XWPA 1X1BA 4MB6A 3SJCA 5TIIA 3CF0A 1Q1NA 5DE3A 5I4CA 2P5SA 2O5EA 4RY8A 3IPLA 2MWMA 1QJCA 3AEKB 2CDRA 1NIPA 3DTVB 1FSZA 2A3RA 3FI0A 3ELDA 2D2VA 2DHCA 1UMDA 3JZFA 3RYIB 3LO8A 4H08A 1N7GA 2C9CA 2HLDA 2H5IA 2QPOA 3DOJA 3E27A 5KZMB 1TVEA 1YS9A 1K7XB 2FN8A 1U8CB 3DKRA 2RAFA 3CTPA 3Q7PA 2R1UA 1YZVA 4G5RA 2ZIXA 1TJYA 1NVDA 1YR1A 2IYXA 3F7MA 3QHQA 3QNUA 1ORWA 3NKVA 5SY6A 5JQGA 3WBJA 4IYRA 2CNWA 2WZQA 1IB6A 2GF0A 5DNWA 5DO9A 1RHRA 2V9ZA 1L5KA 5T41A 3NHJA 4RPLA 4D6YA 3CSSA 13PKA 3D6FA 3QXCA 1Q84A 4G89A 2QL6A 1U2RA 4Z0PA 1YI8A 5ULLA 2JFFA 5ALDA 4ESHA 3F73A 2B92A 2YV1A 5K0NA 4DA7A 1Z8HA 1PFQA 2M32A 1Z12A 1U7HA 4G5YA 4MCHA 4C6RA 3FOEC 2JJYA 3HCNA 4PBTA 4TKUB 2Z08A 5LBTA 4AP5A 4BE4A 4W9MC 4LC0A 2W90A 2HEGA 2WILA 7YASA 1H2FA 3WL8A 3OZIA 1GKUB 1UPCA 2J4CA 2ZB2A 3G2IA 1SPXA 1XEXB 3PGVA 3ZQ6A 1V9SA 2HQOA 5AQ1A 3V2UA 3WHLA 3A25A 1QCDA 2XTMA 4R7ZA 3I42A 5TEWA 2P8SA 1CDOA 5EKSA 3WL4A 1UMBA 2NWQA 2JAPA 2VSFA 2J3EA 4QFDA 2WHQA 1MT0A 3KVNA 4HX5A 4ZEMA 1DAEA 4HLNA 2X8JB 3MWKA 3KETA 1H8HD 2WAOA 3IKLA 3KDAA 1ZEJA 5L4LA 5SZHB 4U3JA 3P0JA 1F8YA 1UQRA 2AI2A 3DMPA 1Y80A 1ICEA 2BRUA 1KDZA 1YZYA 1AVTA 2EATA 2GHQA 2XKBA 4OI2A 1U63A 3T4PA 2JFZA 3ZCQA 1S2GA 1CRZA 1U2GC 1RI5A 3CF6R 4QBFA 4RY9A 1EK1A 2G83A 3TNDA 1JG7A 721PA 5AVRA 4WUVA 1U2QA 3B7GA 1QQBA 4RACA 4GKKB 2FSFA 4UNRA 3HYRA 1Z28A 4NDNE 4I0WB 1Z7GA 3GO4A 4IFBA 3NT5A 2J5KA 4QAQA 1YR3A 4G0XA 4MW7A 2E5WA 3I0NA 2J0UB 1J20A 1XZCA 3QVJA 1SXJE 4YAGA 1M6VB 2P77A 1CXZA 1D04A 2A0XA 2PUWA 1ZONA 4J6EA 2DQYA 2FZCA 4I50B 3UC5A 4DIOA 4KQKA 2G0TA 3KT6A 3O4VA 3SQNA 2FK7A 4DPLA 4XDZA 3K1TA 1RHMA 1WMEA 2W42A 3NH6A 1NHGA 4MW4A 4ND7A 1JDBB 4EGQA 2HXYA 5GZ1A 4TZTA 4WL0A 3REFA 4F4FA 3SQXA 5DNYB 3QYAA 4IDGA 1IXSB 4AQ7A 4PBRA 1EVYA 3NDBB 2QRLA 1U9JA 2CF5A 2RGWA 4LBZA 3B1VA 4LWQA 3T4XA 4WK6A 3TPCA 2Y67A 4L8FA 3UA3A 3ZCUA 3U0VA 1J23A 1KJ9A 3DOCA 3Q3VA 1HK7A 3NBQA 2P40A 4JVOA 1ZBQA 4C5BA 3B89A 4D9NA 2XB2A 1LSJA 2WUVA 1I6WA 1QCZA 3BXGA 3WRXA 1IATA 1JHXA 1FL9A 4ZAVA 5IM5A 1YR9A 1ZJ6A 3Q8KA 3NXSA 2FTKE 2NUAA 4PGMA 5CAEA 3EGEA 1GZ7A 1T9HA 4AF6A 2CGEA 3A0RB 2YXPX 2DSTA 2NADA 3L4SO 5A2GA 4UVDA 2EWWA 1GHTA 4JAVC 1BNCA 1JR3D 1U7UA 3LPAA 3AJ8A 2UZAA 1PYOA 4NDZA 4FDUA 2VUTA 1N33B 1A8PA 2XBLA 3BILA 3SXUA 1P6QA 1NC3A 4LJ6A 1JG1A 5A4KA 3CZMA 3LQFA 4PFSA 1ESZA 1NBME 3GLGE 2CLKB 1E99A 1P1RA 2N1BA 4P81A 3HB7A 4UCFA 3PFHA 1RADA 5EXPA 1ZS9A 3UJBA 5AD1A 1E6WA 1GEGA 4YCAA 5EWJA 3IEIA 1XJ5A 4GKVA 3AV0B 1WPRA 1A7KA 1BH2A 1SG6A 5LP6C 4L9SA 4R3NA 3OCVA 3R3VA 1T1SA 3F7NA 3OOYA 1UM9A 3PITA 3R20A 2ZTHA 4TKZA 3QXGA 3TZHA 2I1QA 4XR9A 1W4BA 5DWDA 1ZN2A 1WULS 3GPIA 3MGCA 3IE2A 1OHHD 3FCEA 4U8HA 3OFKA 3OESA 421PA 4DMUB 1EQUA 1FSFA 4MEAA 4CCSA 5G41A 4XB1A 2CK3D 2OBLA 3R6GA 1ZN8A 4LIPD 2OHJA 4BFXA 1U2ZA 3IPYA 1D6NA 1CZUA 2J85A 3PHHA 2H2HA 1KFKB 1RI1A 4EVRA 4DV7B 3OCCA 2FEAA 2Q9CA 3N75A 1OXVA 4M86A 3U3JA 1E58A 3JX9A 3IAEA 2HBYA 5DHRA 3CX3A 3BMNA 3MQFA 2GVDC 3DZDA 3WK6A 4DDKA 4MGZR 1B15A 3AUKA 3HA2A 4D3YA 1EE9A 4HZUA 4ZDWA 3RWBA 2Q6IA 3H83A 1R5NA 3KOZA 3PFIA 4NEHB 3ZZ1A 1AV6A 2WWGA 4BOYA 1ID8A 3KFXA 5LQNA 1SR8A 2C57A 4LVNA 2ACEA 4V0ME 2VHZA 2RH8A 4BMYA 4GVXA 5DEIA 1KI1A 3K0HA 1E9EA 3UJPA 3BS4A 4LNHA 4NBSA 3UB4A 4BVLA 1GZSA 3EW7A 3E4DA 4RSRA 3MTGA 1DQRA 3T3OA 4KQFA 2C78A 4B3MB 1PR5A 2J9FB 1EFLA 3I8SA 3LRPA 3QWBA 2GPBA 3MHTA 3MRVA 2LRHA 4HN9A 2ATCA 5AICA 3S0JA 2G4LA 5CLHA 3QFCA 2BKXA 5IBRA 1PKXA 4K9RA 2CK3A 3EOZA 5B4UA 3L6BA 4J7UA 1WOYA 2HMWA 4R2KA 4ZEWA 3U4HA 2ONZA 1FFCA 1PS9A 3AEQB 2XUJA 3HU1A 3MMPA 5B37A 2YHBA 3QOFA 4WLOA 5AUQA 2H00A 3T61A 4WNAA 4QXQA 1GJRA 3AI7A 3V2IA 5ALPA 3WK5A 1I9CA 4K81B 4RHYA 5AW3A 2P9CA 2W2PA 4CR6A 3FVTA 1EK6A 1QONA 1UBSB 3BGWA 1V2GA 2ZRDA 2YFQA 2PUVA 3BJZA 3FSRA 1Z37A 3RVKA 8MHTA 5IKMA 4BFUA 1SRQA 2WTXA 3G5UA 4UE2A 5EJGA 5KYWB 3VYVA 4AIIA 1U8XX 1OKKD 1JJ7A 3PA8A 3NX4A 2FK8A 3PFWO 4D5EA 1WEKA 2X0IA 2QTHA 1P33A 3QTBA 4KLZA 3PNKA 4QICA 2W6ID 4J2TA 4MQ6A 2J7PD 3QKIA 4AB1A 2N9UA 4P3KA 2SNIE 3UT6A 2WHXA 1UBOS 1LK0A 3AFGA 3FDIA 4UAUA 1NQVA 1JJFA 2DWQA 4KJXA 3B9RA 4JX8A 1USUA 1O9GA 1IDN1 3S68A 3BJRA 4FFWA 5TT1A 4DS3A 2GXSA 3FCCA 1E94E 1I94B 4O4IB 1RAGA 4C4ZA 3JD2A 2UYGA 1LX7A 1RWVA 2V5UA 4BEBA 4CETA 5I9BA 4E31A 1NNUA 1EFPA 4JUCA 5FPHA 3CZRA 1KIAA 2I22A 3P71T 1MNAA 3NWEA 3TEFA 2V98A 1EGVB 2HJGA 4EJSB 3MGGA 2JCYA 1E9SA 3WO0A 5I7UA 1QUEA 1YZQA 3BX1A 4BWYA 3O4JA 2QSJA 2ADMA 3H2KA 4MI6A 4QBGB 4OQMA 4B8YA 1SB9A 3CX8A 5CVCA 3ZVLA 3WOHA 4ZTZB 3OOHA 1CY8A 2FUG6 2CHQA 1JEDA 1EDDA 1QG6A 2BF4A 4QQKA 4C0QC 1J25A 1G64A 1UDRA 1VLZA 2GEVA 2YHSA 2DQ4A 3G17A 4U63A 3A2LA 3C5EA 3FCOA 3T8YA 3VZQA 1XZDA 2YN2A 5HWSA 1DOHA 1M6NA 2R5NA 3I9OA 2VP3A 4JYMA 3TR0A 4F1WA 3W2GA 3DTNA 1F17A 1Z7YA 1H94A 4REOA 4GWKA 1J9EA 3IVMA 5AM5A 2BFCB 4QJ3A 1LFDB 1R8YA 3B1FA 3IOBA 3WG9A 1Q0TA 3PLRA 2YMQA 1Q1QA 2OFOA 3VAYA 2QRQA 5F4ZA 4HTAA 1R4MA 1MABB 4GZLA 4HUQB 4Q3EA 1E0SA 2QI9C 4CCAA 1U5BB 2D5LA 1QU2A 3IULA 3ND7A 2UU9B 4GZ5A 1I32A 3TXAA 1HLPA 1IEWA 2A59A 2IRWA 1Q0UA 3I1IA 4O3FA 4TL7A 4M8SA 3IHTA 3SHQA 3GIWA 2XTNA 3MRTA 1EBUA 2Z5LA 2PSHA 4BMPB 3RJ5A 4QHYA 2W2KB 1ZM7A 2PL1A 4DJTA 1G0OA 2GH1A 2J9YB 3PKIA 4BNUA 3KDPA 5AXAA 1UOPA 4G0QA 2GCIA 2OMEA 2ZAYA 2ESRA 3HYLA 3H84A 3PQEA 3P9RA 3QNMA 3EDYA 2AC4A 3FR8A 4M0FA 4U2KA 2CBZA 4L2IB 4S1VA 5ADVA 2GGSA 3FROA 4FOTA 2AYZA 2HWXA 4RJLA 4YO7A 1LDYA 3K9FC 1E1RA 3CRRA 2WUWE 1BWPA 2IYSA 1E5TA 1RYYA 1GN8A 2P9QA 4F6RA 3PV0A 1NAIA 2VDWB 2JGKA 4MKRA 4M46A 4TMWA 4YGXB 1XROA 3MS4A 2NNWB 1NTOA 1TUGA 2ZRBA 1H2YA 1LF0A 3EG5A 3H05A 4KWHA 2C2WA 1ULHA 3KB1A 1KAHA 1V4VA 2AR9A 2EZTA 4RE6A 5FOSA 2H57A 2YYYA 1PQYA 4JQCA 1BEEA 2PYIA 4CV0A 1WP9A 4GPBA 5CJ2A 1E7YA 1K6XA 1V16B 2H2FA 2FA9A 3OQOA 2EX4A 4QBTA 5KYXB 4OQFA 1AQ6A 2AK3A 4BO7A 3L7OA 4D9BA 3NIFB 3TQQA 2JC3A 1UC9A 4AYTA 5B12A 3ZDCA 4RABA 1QO7A 1QCCA 1UZMA 1NFFA 5M04A 4MYCA 1PT7A 5G02A 3P94A 4NZPA 3TFOA 1P18A 1KHHA 4X7MA 2NT4A 5REQA 1H2XA 3JQAA 3G49A 5CW2A 2FR1A 5F78A 3SZOA 2ZUBA 5KOJA 1YKSA 2ODWA 1EEHA 3HVHA 5DH9A 5NULA 1W1IA 1BRTA 1PSDA 1Z74A 5MHTA 1PG5A 5HE8A 2QJWA 1X15A 4G85A 4IDDA 5KNBD 1NWHA 3QITA 3UVEA 4KNYA 4X41A 2PUTA 1Z8NA 3COPA 1KZ6A 1RSZA 1TJ5A 1A76A 4H60A 2CMDA 5AVYA 5KQMA 2AJ8A 2QDXA 2J0QA 1UOOA 1XLWA 1DJMA 2BP7A 2NXNA 3CNEA 2HK9A 3QVUA 4YP1A 1VJTA 4BCDA 1MT3A 1U2GA 3M2PA 5EXDA 3RDPA 4J3FA 1XTSA 1WR8A 4MIYA 3BQMB 3OCUA 5BURA 4NI5A 1RXVA 3T35A 4KRGA 4WZBA 4C5AA 4ZT4A 2PLRA 2XOXA 3E1GA 1G55A 4WOJA 1AMOA 5KYNA 4QKQA 3CWZA 3GDOA 4P5PA 3OA2A 4DQ0A 4C07A 3STXA 4K03A 3VPSA 2C5LA 2IYEA 2JGFA 1X7WB 3OU2A 1TA0A 1U1EA 3NGXA 1V1MB 4G9BA 1CUFA 1ECGA 2Z8YA 4RANA 4BBZA 4Q15A 4B3TB 3A7EA 4RHXA 4KQ9A 1T0HB 1SUDA 3IUPA 1V6SA 2L18A 3JAWA 4V0OA 5U9CA 1DO8A 1NMSA 3KL4A 3QMPA 4RJ2A 2FG5A 3DHEA 4F04A 2FPKA 1BXGB 1FFXA 4LDAA 5IARA 1TT5B 4V0SA 2ZRLA 3HXPA 1BW9B 1DIRA 1PGJA 1XO1A 2B8EA 3KQHA 4Z51A 4R0VA 2D1RA 5BRJA 3LF2A 3C98A 3E9CA 2IODA 2EJBA 3LO5A 4N7BA 4NG4A 2XY4A 3SVZA 3HP4A 1YSCA 3EN0A 1QVVA 3KTDA 2VJDA 1L9KA 3RFUA 4XFDA 1AMUA 1UBJS 4YPOA 3TOZA 1SK8A 2WTAA 1X7YA 1C7FA 9MHTA 2ZQ5A 2Y9MB 3EXHB 1DTEA 4GRAA 4YRMA 3K4HA 4BLWA 4TTQA 2JFGA 4FR5A 1DWQA 2PGXA 3UMSA 4AC9A 2VT6A 2GBLA 4I5IA 5A7GA 2AOUA 3LPLA 1XMSA 2BHRA 3SIXA 4EUNA 1B43A 1VBNA 4DMMA 2QU8A 1OGYA 1SBHA 2H1RA 1A50B 1U7PA 4MWDA 5G1NA 5AKYA 1B74A 3GGGA 5TV2A 2BFDB 3C3DA 3HUDA 2R6DA 5C4GB 1XZIA 2WJHA 1TKBA 1VL6A 1GWNA 4HEQA 4EVQA 1SVOA 5TEVA 2JLSA 5U4XA 3UB3A 3N2IA 3V00A 1U4NA 4RPGA 3CY6A 3NHZA 4UNPA 5EMHA 3R7LA 4H1WA 1ZRSA 2XH8A 3LDHA 2ZJZA 2CXRA 1N5LA 3K1AB 3LS2A 1O4WA 1DKMA 3WGUA 2ORYA 3KAPA 3N2ZB 3OTIA 3QBTA 4WV3A 1J97A 2AV6A 4RL6A 1BXKA 2W8BA 4RULA 3PTZA 3PQ4A 4A5SA 1Y81A 1NMYA 2R1VA 5JVDF 5BNIA 3P9XA 3KE8A 3RBXA 1EU1A 3QSGA 1Z5ZA 1IJBA 1IULA 4Q4HA 2CYCA 1G291 4WVFA 1I8TA 3NDRA 4UD6A 3AVTA 3NBXX 3WI7A 2XWBF 1VSBA 3TR5A 1WD5A 2V59A 3RS9A 2R8RA 5DNUA 5JY6A 5K20A 4BMNA 4A82A 3OJLA 1DVRA 1NF9A 1X8KA 4P53A 2OWDA 1HURA 3H18A 4G5HA 2VSXA 4J0KA 3IVXA 4UBMA 3PUXA 3PQFA 1OAKA 3GQBB 2V96A 2MSWA 3IJRA 2C31A 4EYOA 4FD3A 4OTZA 4MS1B 5BSVA 1JYSA 4IXTA 3IE0A 4TS1A 1JFFB 3O4FA 3TSWA 1CQXA 3WJ7A 1YNOA 3OIWA 3PQCA 3D54D 5AVKA 4N0DA 2PSJA 2NQ2C 3WWYA 4CM8B 4DREA 2ZJ1A 5DCUA 2QYSA 3TIXB 1BWQA 4NFLA 1H9BA 3KWFA 4MPTA 4NSNA 3F8WA 5EEGA 5L8VA 4ZI3A 3LSTA 3FBGA 3N74A 4CIBA 2XUQA 4LYGA 1W35A 4XSHA 1GT91 1FVXA 1UPXA 2R84A 2QTCA 2WFAA 2H1OA 1OX5A 4D8XA 5JMPA 1MOZA 4E5PA 2EZ8A 2Z1DA 3CEAA 3QXSA 4NDAA 3MIZA 5ECDA 4BFZA 1U7OA 2MSEB 3RLIA 2ZJ6A 1UBFA 3JR7A 4BO1A 2J9GA 2PA3A 4KXWA 3CH5A 4ARZA 5T7BA 2V0GA 2FJUA 3T5TA 4LV8B 1O03A 2HH9A 3DWEX 2FKNA 5FFMA 4LCJA 3MIIA 3NTRA 5JH7B 3N1UA 4PGGA 2EKQA 2F48A 1VFPA 2OOSA 3KQPA 1KKUA 3L8ZA 4H0FA 3W1EA 4NQRA 3W90A 1JN0A 2A7XA 1GOTA 3FCUB 4UNNA 3TAHA 3NS7A 3WSTA 3A10A 3RARA 4D0SA 3RIXA 3UMRA 1M6YA 4FFOA 2A6PA 3AUJB 3H1AA 3I92A 1L8QA 1XTTA 2J08A 4NU5A 4NX2A 3G6WA 4D46A 3DFKA 2HU5A 2J46A 1VMEA 2OPBA 3FNRA 3N8DA 3PXAA 2FN3A 3GNQA 3QM1A 4QYMA 4DFDA 1XVUA 5BVGA 2RI0A 2PKYX 5CB4B 4EPYA 5CVVA 1LLFA 5DM2A 2XKKA 1W36B 2OP1A 3HABA 3AIKA 3GLVA 4N39A 4Y1EA 1SU8A 2IY8A 2P6NA 3L0PA 1CY6A 6PFKA 3HN7A 4JL6A 4KDCA 5JT1A 5LFAA 3INRA 4CQMD 4DA0A 3BCSA 3CINA 4WESB 3KQQA 3KQWA 5I5GA 5C35A 1LH0A 3K8QA 5KB3A 3FCXA 1PL7A 2HUNA 1L5FA 1S8NA 1Z3IX 1XA0A 3W5UA 3OKCA 4XD2A 5IK2A 3BJIC 5AW2A 2YXNA 4BVAA 1U8ZA 2EJWA 4CIXA 5KUTA 3ZG6A 5BN1A 3B9QA 2YZ7A 2QIOA 1UKAA 3O82A 4NCXA 3T9DA 2RIRA 1P9LA 2H29A 3MXTA 1P2TA 1RJGA 5FWXB 3G5AA 4JC0A 4A4DA 3JASA 2XQGA 3O3CA 1N2OA 2TYSB 3O8BA 3AIMA 4AN4A 3I2YX 2PUHA 3PIRA 1G4HA 2NZWA 4GPTA 4TWJA 1Y4UA 3N7UA 1U11A 3AESB 4FN5A 3SS9X 4UZFA 3ZNOA 3S2UA 1EB8A 4ARZB 5CLLA 4BN5A 3RFXA 3H2HA 4CEHA 3GDGA 3G85A 1P9WA 2ZQZA 5KIAA 3E9MA 3ZJTA 2HY7A 3HLKA 4HRYA 4X93A 1F2TA 2Z43A 3OE5A 1UKVY 4HQFA 4MQBA 4W8HA 2FMFA 2J30A 4NP6A 3D2CA 4BLTA 3I9V1 4ZV9A 1JHZA 3OE7D 4KQ2A 5B58T 3ROTA 1R66A 4P7JA 2BW0A 2SHKA 1Z2DA 4NFHA 3ZDXB 3ICVA 1HYBA 3SXPA 3RJMA 4Z53A 3I72A 4LSZA 2FETA 2VK8A 1IVNA 1U0BB 1KIMA 1CNEA 2AD5A 1OWMA 1Z6QA 3WMRA 4E14A 4CFYA 3W77A 2VWPA 5DVZA 1RKVA 1FJHA 1XR3A 2W4QA 2VDQB 2YW2A 3C3JA 3PEEA 3SHVA 5FOTA 3DAHA 4RTKA 1ZW6A 1XRPA 2W9XA 3BDIA 3DHNA 2GF2A 2PANA 3WJ2A 4QL3A 1RAAA 4IFEA 4OHYA 3O8OB 5L51A 3EE6A 2XE8A 1A71A 1GQFA 4HFMA 3R3WA 3DDNA 4M1TA 3IE1A 3MPOA 2C07A 3A37A 3WWZA 1NV9A 2FQ1A 3DPIA 1CKEA 2PQ0A 4IDCA 1UEIA 5CDYA 1SBIA 4DEXA 1F6DA 2X4LA 3TLZA 4KREA 3DCYA 2EYUA 2IP2A 1J1IA 2PEZA 3S40A 3G2JA 2QBYA 4N6GA 5EZQA 1RJEA 4E11A 5J58A 5K3OA 4BQIA 3HK2A 3G8YA 5IU6A 4HWRA 2V7BA 2YC2C 3KTAA 4B33A 4B81A 4FZ3A 4YALA 1VI6A 2XWSA 1EP2B 2RB5A 4PQEA 1DT3A 4MNTA 1GXSB 3MQ4A 1XKXA 2H7XA 1RRGA 1ADGA 2A9QA 3KJEA 3MJVA 4R16A 5DYWA 4K6OA 3GJ6A 3ZWMA 1KC1A 5HBRA 1IUOA 1BXGA 3VTFA 4ZV4A 1C0LA 1US8A 2OXRA 2P5TB 4KIUA 5LLDA 5AI8A 4LK3A 2EKDA 5LQSA 2EVWX 1BQEA 3VH4A 1QH9A 4G4IA 4JFRA 1ECFA 1RHKA 5TDHA 3W9UA 1A8UA 4NHEA 4EKIA 4PN3A 4CKCB 5HX7A 4KZKA 4KAXA 2VVTA 1I0IA 3IIIA 3DR3A 3G88A 3W4KA 1SVWA 2QX7A 3W7VA 4YYZA 1HG1A 3S2SA 2AF3C 3ZJ5A 1FDUA 2BHLA 2MINB 3IHKA 3FNIA 2CJYA 4ND6A 4HC4A 1P4AA 2QN2A 2IYUA 3EXHA 4H1VA 4OYYA 2YJGA 3HZZA 3VVBA 1N6PA 1Z0ZA 3BWYA 1NBEA 4MLCA 1QFZA 5EPEA 5TMPA 2HA2A 4BU1A 1EZZA 3A58B 5LZ5A 2C95A 5LQRA 1G5QA 4JHLA 3H3FA 2OV2A 1FFAA 5KEIA 3BQ9A 4RO0A 3P9NA 1L4EA 4U7FA 1QHYA 2MSDB 3HCBA 3AVOA 4RC9A 4L8LA 1ZWLA 4QGSA 2OCDA 2BLLA 1XCJA 5ER9A 2P6MA 2Z6AA 1XJQA 4ZYTA 1X2EA 2I7TA 3EBOA 3LXXA 3VZDA 4TPKA 5I47A 2G9ZA 1WRBA 1DDOA 1T8PA 1BMTA 1OX4B 3ZZNA 4YVFA 2NM0A 3UXYA 4ARSA 2Q8QA 2BMEA 3FUTA 3ROEA 1ZR2A 3ANMA 3HB0A 5ALFA 3VNBA 3TO5A 4TXJA 1EJ6A 3KD2A 1V8OA 1IM8A 3A6GA 3MB8A 3TS1A 5KWIA 4XX0A 1SG9A 1N2BA 4J8PA 2FWBA 2CLHB 4YLEA 1FRZA 3AR2A 5AHOA 2JGMA 3WIUA 3NJ4A 1GNRA 2IZ7A 3OU6A 1ODCA 2XMBA 3KJHA 5TS2A 3U26A 1XZFA 4QLOA 4IPTA 1J1ZA 5U1PA 1CRWG 2ZULA 4UEQA 1AN9A 2I87A 1QGYA 4ZMBA 3OT5A 3LX5A 4DLWA 2YHIA 1D7OA 1XDWA 2GOYA 1NVXQ 3AFMA 3OX2A 4KGVA 3A3OA 4KQEA 1XCLA 1O08A 4FFBA 4KX5A 2CLOB 4BIMA 2E18A 2QB5A 1WE2A 2VJBA 4BVJA 5KKNB 1CVIA 1C0PA 3D8HA 4RAQA 3D64A 4XDGA 1WXEA 1G3MA 3DFFA 4HZGA 5B3JA 1JA1A 1KEEA 1JDTA 3D8UA 5K9ZA 3UOGA 4NMLA 1X3SA 4L08A 1I3OA 2HQSA 2Y1XA 2IIBA 1L5SA 1C9KA 3L8YA 4K9LA 5AJZA 1S0UA 5JO9A 2MR5A 4DVJA 1JR6A 1UIRA 3DZIA 2BGMA 1MA3A 4W9NC 2GXAA 2GPJA 1YOVB 2ZE6A 2A30A 4IEIA 4Q9DA 3WWOA 2HCJB 4PZDA 4A8JA 1P62B 4L8GA 1LV8A 4EPRA 2YYSA 4C22A 2K5UA 1I1HA 4UZSA 2Y76A 5DP2A 3DL2A 1WXFA 3NBMA 4EY6A 5LIPA 3K71B 1T5LA 2V65A 3O2NA 1ZRHA 2GHIA 3E61A 3OCZA 5EWJB 4Q00A 2X1HA 5FKJA 2YASA 5TJHA 1W5EA 4JU9A 3A4TA 4US0R 4LXHA 5AK5A 3RSGA 2IHUA 2AG6A 3II6X 5E3JA 3RHFA 3WK8A 1C8KA 4X5OA 3EWSA 3NAMA 1OW3B 2AS0A 2ZU6A 3UJAA 4ME6A 4B6QA 3W8FA 4DNPA 3K8YA 4YS6A 3SHFA 2PX8A 3R5TA 3HKBB 5JPCA 2G1KA 1W75A 1IPEA 2RGDA 3GRFA 1SXHA 4B5KA 2QORA 3KUXA 1NW6A 1XZBA 3TE7A 2EFGA 1U04A 4G1VA 1H1TA 3RIYA 3VHXB 1H4TA 1Z4JA 1DEAA 3F78A 5FD8A 5KJ6A 1M73E 1EQ2A 2XTJA 5UKDA 3W3ZB 4AQDA 1M8GA 1E1CA 3DG9A 3ZGXA 2FF5A 1DP4A 1TIKA 2ZUCA 2VLBA 4JLBA 4O0LA 4YQZA 2QRKA 4KO4S 1ZJYA 1ZOSA 2CLMB 3VNAA 1RE0A 2QQGA 4HATA 4RMJA 5BNFA 2H0AA 4EHBA 1HDIA 1KPHA 5LR6A 1OHHA 2XA2A 3OD5A 3LNTA 2C4TA 4I08A 1F1JA 3UZUA 4YY3B 2ZI9A 4AKHA 2N46A 5A2QA 2E82A 3HDHA 5K6AC 1MVLA 4C2BA 2XB8A 2XI4A 3EPHA 1O94A 2LW7A 1G9XA 4S3MA 4XDHA 3A4YA 3FRJA 4RK4A 4IWNA 4IHJB 2IGBA 2FLVA 4HGOA 3OCJA 3CB4A 3ZCRA 5PNTA 4TYWA 3UV3A 4GOKA 2WZBA 3CFYA 4OYRA 4UE3S 2YIJA 3HB1A 4M6WB 1PSZA 4F3KA 3QYPA 2J48A 1HE5A 2FEPA 2AFHE 4K6KA 2H2WA 4K28A 2WMDA 3L8FA 1CE8A 3O4RA 2Y2UA 3FE2A 4OGFA 3RU9A 5FTNA 1TKCA 2AN1A 6GPBA 1NXPA 2KHZA 3TSYA 1N3LA 4J7XA 5IVIA 4C05A 5JHHB 3BWBA 4RMIA 4QTYA 4UHHA 3QX7A 1M1XB 2IGTA 3DVLA 1WZCA 3ZGZA 4D3DA 2HV8A 2QUBA 2AW3A 3L4EA 2D7CA 2BDUA 3DA8A 5KYWA 3IIEA 2OCBA 1DFGA 1EX9A 1PR6A 2C4NA 2IDZA 2WWVD 1TAUA 1ZINA 1CTQA 4LYEA 4XQ9A 4D57A 1Z15A 4QO7A 3T9CA 3ESQA 4HAZA 4GF5A 5H68A 4D9EA 3BD8A 3ONDA 3P4XA 3RREA 3TIIA 1CUBA 3VTKA 1XFDA 5LYJB 3T1NA 4L4ZA 4LS3A 3FYSA 1QAQA 2NAFA 2VKQA 3IJ5A 3IUMA 4Z6KA 5FJIA 3ZY6A 1LBSA 2AUNA 2JIZA 4HJXA 1KI2A 4N8SA 1U02A 1YFLA 3F90A 4A8JB 4ASUD 2ILVA 2VPXA 5A4MS 1UJBA 2W8BB 5HNKA 3JTEA 3THXA 2FMXA 5F9FA 4LOLA 3IB3A 1U8UA 4DUPA 3G2LA 2D2EA 4B7CA 4OI1A 4FW8A 3W4IA 1IBLB 3Q7IA 4MJ3A 4WTOA 3UGQA 3UBTA 2GDZA 1J9GA 3KLOA 2O8DB 1VJCA 4BNLA 4AWXA 3ZHXA 2ZIAA 3BH7A 2OO5A 4IHQA 1ZXLA 4BKOA 1AURA 3BSFA 2VHXA 3VSAA 3HV2A 4D2IA 1YK1A 1PEDA 1J00A 2XDAA 3IERA 3NWOA 2YZNA 4MVJH 2D0OB 3X43A 2I2CA 2QVLA 3CCCA 4JI3B 1EXMA 3I0MA 2XNJA 3WLMA 3Q6NA 3W05A 4Y0AA 3WK4A 4A0HA 1QUFA 4BTVA 4MP8A 5JNUA 4OQQA 1UMCA 3BK2A 3S99A 4KTTE 1QU3A 1Q7RA 1YJBA 3JPYA 3IHLA 1SOWA 4WCFC 2I80A 4EG6A 3V7WA 3UJNA 1MO5A 4FQ7A 1QVRA 3MWDB 2Z56A 2OM2A 4E5MA 1R10A 3G7UA 1RHJA 1BN7A 4G09A 3IVRA 7MDHA 4PM4A 1JAIA 1EWYA 4YN3A 4QJIA 1AN0A 5KOYA 2QW1A 1CJTC 3F97A 1J0AA 2OILA 1IVYA 3A1VA 4IIJB 3N0TA 3UA4A 3AHCA 2C94A 2IW3A 1C5KA 4QFCA 3SSMA 4Z4FA 3ESDA 4ZCLA 3IEXA 2D7JA 2NUTA 5IWAB 3Q8WA 2QNRA 4KQMA 1Q17A 2NYAA 4Y67A 3RU7A 1QF7A 5DX1A 5AVUA 2DJIA 2XZLA 2QD4A 5I45A 3WLEA 4DY6A 2IDJA 1HMPA 2H8KA 4X3PA 2UZ4A 1UMCB 2I4RA 3JU3A 1ZR4A 1ZWKA 1IZ8A 2PGDA 2Y0CA 1EM8B 4KXXA 4FIDA 4G0VA 1PNRA 2ZRAA 2HDNB 3LUDA 1D4AA 4DMKA 5DHAA 2IXTA 5H7XA 1E89A 2K2QB 2ODTX 1HEIA 4BNXA 3MK31 2GK3A 3UN1A 4OL9A 1E69A 4KN8A 3RFVA 3P20A 2V97A 5AI6A 4JENA 2WE7A 1UBEA 3WLQA 1KAOA 4DSZA 1TQ8A 2W6MA 2H0QA 1JG2A 4JP2A 1G8JA 2O5VA 4KO2S 2E6UX 5LZ8A 3P19A 3VR1A 5BSHA 1H8EA 2X40A 1ZISA 2QBYB 1NW9B 4EJ2A 5E38A 2JLBA 1KMHA 4ZHQA 5IVHA 3O3OB 3WIDA 2AFRA 2HJHA 4FYHA 4DLPA 5AH0A 5MN5A 3KJNA 3RF6A 1JILA 3OO1A 3H2SA 3LP6A 2GVZC 3KZXA 4QU0A 3EZFA 3TZCA 3UWPA 5L3VA 3OHSX 4OOFA 4JJEA 2O1SA 2WKRA 3IEUA 16PKA 5BR1A 2Q6OA 4AS3A 2PL5A 5ESXA 3PG5A 2GFIA 3L79A 2GUGA 4OX9Y 3Q9NA 4FCCA 1PGOA 3EXG1 4F85A 1VKRA 2C9MA 2OCYC 3FMOB 1SUCA 3EZNA 3I9MA 3LT1A 1MO2A 1T9AA 1KYIA 4NBWA 2ZAOA 3KQOA 2A9VA 2PLNA 4ENSA 5DV9A 4EKYA 1PSWA 4WZAE 4X64B 4HFNA 4NMXB 1VG8A 5FLXA 4ZOEA 3B36A 3FVVA 5JNVA 3RM3A 2GQ0A 2RCYA 1QIDA 3EAFA 3DEHA 1H2AS 4GPIB 1JI3A 2OR3A 3AB3A 1F0KA 3GT3A 3MGAA 3GVXA 2MSLA 3FDXA 5AXBA 2H4HA 3U3DA 3DW1X 4ZHQF 4E5DA 4KODA 4Y0NA 3P0FA 5EKXA 1FTNA 3CPEA 1YBAA 1YL5A 4LHVA 2XUGA 4QARA 2JCSA 3NORA 4MK4A 3UJ9A 3HJNA 2VNIA 4JWKA 4OHXA 3V97A 4L7VA 4U2EA 1Z2CA 3DT9A 4BVKA 2WSLA 1D4ZA 1WXWA 3WWEA 1Q83A 3Q10A 5H80A 3ZBPA 1WB5A 2OVBA 4ZREA 2YN0A 2PNFA 5T8KC 2IX3A 4J29A 2H52A 1ZESA 1RPJA 4UM9D 3DBOB 4D56A 4G0WA 2XQFA 4QG3A 3WMFA 3WKCA 2AYXA 3CPSA 2JAUA 3G9XA 1ZITA 2PM8A 3L77A 3LKDA 4TVSA 2I62A 4FWBA 3GY0A 3EQ9A 1P4HA 2RBEA 4MUEA 5JAPA 4AG5A 4NYJR 2C5EA 4C08A 1ITZA 4TN1A 1PVOA 1RBMA 3DDHA 2J9ZB 3F6CA 1QKKA 1XU4A 2WFLA 1IHDA 3LQ4A 3FRHA 5DISB 4PHGA 1N2JA 2WMOB 4EO9A 1MR3F 3NM6B 1N0IA 2YR0A 4Z9XA 5JVDB 1UOQA 3VUFA 4CM3A 3T5PA 2NTEA 2R11A 3V4SA 2LCFA 2E5LB 2JG3A 2NPIA 3C41J 1XMVA 2AJBA 3PNPA 1FP2A 2RK6A 1IZZA 2O20A 2CLCX 4FSHA 4LRYA 3GG9A 3JYHA 5TB5A 1SY7A 1C81A 1PZNA 3PF8A 5AUNB 9GPBA 4KNWA 3CBGA 4OSPA 1PZXA 1YDHA 4FDAA 1L4KA 1XRNA 2WWRA 4BNWA 4BNKA 2JDIA 4BP1A 1ZRMA 1TFUA 4UM9B 1KPGA 2ANCA 2DAPA 2OHIA 3W2TA 2Y05A 2ISCA 4DRXB 4G56A 2P90A 4IIGA 2J6IA 4UHCA 4XIYA 4UU8A 3M6FA 2BGIA 1T29A 4YQYA 1P7WA 1SNYA 4H0CA 2OHFA 2RI1A 1MDBA 1U3CA 4KN9S 4RD1A 4BRUA 4PIMA 5T4BA 5JZVA 2D3TA 2R9VA 3L1UA 3KEGA 3WKEA 3IAS6 2QV0A 3ZE1B 2OK8A 1NQUA 4EKEA 4ZU6X 4CKXA 1VKZA 5ITZB 1WUHS 3IO3A 1I33A 2QW0X 3WA7A 4M7RA 1Z25A 4D4LA 1HLFA 4WXRA 4TLEA 3R3JA 1I7DA 3SICE 3R40A 2J6CA 1Q6YA 5KVAA 4O3MA 3JV7A 3DZJA 5F12A 3NP9A 2HDOA 1QTQA 2GKSA 4UUAA 1L5OA 1W44A 1KR2A 1P1IA 3REGA 2VYVD 5D2CA 2C96A 5JRZA 1BMDA 1KYVA 1AC5A 1QPZA 3R7FA 1SC6A 3U40A 2JJMA 5EJ2A 3OQJA 4GO1A 3E0XA 3CZAA 2H4ZA 2G88A 2QZSA 3FLEA 1CRLA 3QW4B 1DC3A 4IQ4A 2GX6A 1FIUA 5FBWB 3BSYA 3DCJA 1RPTA 3G82C 4NJEB 1TYCA 3VNQA 1CDDA 2C29D 4KVZA 4RKWA 1E0DA 2V55B 2V9CA 3G0OA 1V9LA 1S4QA 1MGPA 1YS6A 3DE6X 1DJOA 4XB6B 5BRAA 5K6AA 1G5RA 3ZZUA 4Y9TA 4XE5A 5CFMA 3EFOB 4GBGA 4KK4A 1ORHA 4I4NA 3BMOB 3NFYA 1OB5A 2ZBFA 2BTQA 2PR7A 3LBNA 4JK3A 5IC6A 1BFDA 1QHHB 3QMVA 3QY0A 1EIZA 2ZDQA 2Q5FA 1J8VA 2ZJ8A 2EIXA 4L6AA 4TYQA 5GAJA 1HT2E 4Q1BA 1FRQA 3GZ4A 3GJ8A 4P4UA 4RV4A 1NGSA 1NW8A 1QX3A 4HHEA 1L5MA 3RIHA 3VRHA 4WAUA 5GQSA 5TS3A 3WWPA 1NQ5A 3W1VA 4ZVOA 3PLAE 2ID7A 3IMGA 4GR9A 4YIHA 1UXKA 1CQIB 1I6KA 3N7AA 3DOOA 4GS5A 3CJTA 4KYUA 2FZGA 4MVJD 5K8JB 4CTKA 1EK5A 1TYZA 5GADl 4CG3A 4K6MA 2F8TA 2C2OA 4GKBA 3WHKA 4R1OA 4ECAA 3AHHA 3CR8A 2AZ4A 2P4UA 1OLXA 1R0BA 2QKYA 3RSLA 3NVAA 1JAHA 1KO8A 1OZGA 1V5GA 1WD7A 1YQQA 2X3UA 3C4VA 3DYBA 3TLBA 2GERA 3V4RA 1TCUA 4I99A 1H3EA 5A5VA 4KMSA 4CM8A 3RHZA 3D31A 3F98A 5IZCA 2OCPA 3C6YA 3FMGA 3N87A 4WY8A 2Q6LA 2IBMA 1DUVG 1Q2XA 1XP8A 4I9HA 4WLNA 4ZZ3A 5JJIA 3SFZA 2VYCA 3I6IA 1NW4A 3TCXB 1TVKA 3DV9A 4EX7A 3SC4A 3LGAA 2PFGA 2GBIA 4KKVA 4P3OA 3TAUA 2O5RA 2G5GX 3B5IA 4PLWA 1YUNA 5KHLB 1MQ8B 3COVA 3H0KA 3IKMB 4XD7D 4IVRA 3WHIA 3GZNB 5BP7A 1R6BX 1QHNA 2Y77A 4KFTA 4JEUA 1OE0A 4HAIA 1KERA 5E6SA 4ZDKA 5AK6A 2IOYA 3KWMA 4KQCA 5BUZA 5CRIA 1DOAA 3QXJA 2WB4A 4MRRA 4YDHB 1G7SA 1TMGE 2ZPAA 5EHNA 4K8OA 2C82A 4X6LA 4Q9AA 5LN1A 2IPXA 5HFNA 5EJ6A 4MO9A 2OB1A 4EMSA 4YMTA 2YY6A 3QPCA 2UYYA 4Q1AA 1WLSA 2CD7A 1JB1A 4COKA 5I4IA 3O47A 4K6HA 3RS4A 2FZLA 2WJGA 5BWCA 1MRSA 1NXTA 3FOCA 1EVLA 4B6PA 1W8IA 4NMMA 4EL5A 4RWZA 4HYTA 2NXWA 4AWAA 5HTOA 4LA4A 3TCKA 4H77A 1BKYA 3RGGA 1VBMA 3JAWB 3BZBA 1P17A 2CXSA 3U0BA 1TU4A 2OO3A 1P72A 3VVCA 2UZ1A 4JUDX 5BORA 4HPJB 2RE8A 1PYGA 2B0JA 1DJQA 2HA4A 5AW4A 3ABOB 3EODA 2F59A 3K0EA 4LJKA 4WZAA 4Z7JA 2GN2A 1MHPA 3EPPA 4DGQA 4DT1A 5MN6A 3TCNA 1ZOPA 3PGLA 2C1XA 4CPDA 4EW6A 1JBQA 2XVAA 5HIJA 3E9NA 2C5FA 2HLNA 2HQBA 1GPAA 5BV1A 1T1EA 4BEJA 2R97A 4BUJA 2HRRA 3QNWA 1EZ4A 3FPKA 4MOWA 2P35A 1II9A 4DMCA 4PS0A 2AOXA 1WPQA 2CKMA 4JJKA 4OCZA 4I14A 5DPMA 3ZW8A 1PX2A 3GVPA 3T7EA 5IPFA 2VL7A 2JGAA 1QNLA 2SBTA 1Z08A 3ZU5A 2FPGA 4FDMA 2C00A 1SGWA 5LWQA 1C80A 1M2KA 1I36A 2BKLA 4E1VA 2PZLA 4ZZ1A 1VLLA 1R3DA 3GUUA 2AJLI 3QVKA 3LW7A 4HB2A 4HWKA 1JQBA 2PT5A 1REQB 1CVLA 1OI4A 4R2XA 4P32A 1JKIA 4YBZA 1U2DC 2G1AA 3MFQA 1QGUA 5D3MA 4BO6A 3ORHA 3ZIAA 1O0CA 2VCYA 1SBNE 3NIGB 1ENPA 1M2NA 3FZQA 2Y0DA 4ZU3A 5JNSA 3ENQA 1BS9A 4LJ5A 4Q1VA 1ETUA 1K5HA 2QYHA 4P4NA 4WOPA 3EFHA 3Q1KA 3ZIUA 1L2TA 3VBCA 2YRXA 4ZDIA 4Q7MB 3FGZA 5B36A 4EL0A 5CB6A 5KSYA 3IPCA 3BGSA 1Z26A 2QW8A 2WF7A 4HMOA 4LYDA 5ES4B 4ND8A 3N05A 2FPUA 4LF7B 3C6MA 1JEJA 3GJRA 2JEZA 4HDMB 5K3SA 3LBHA 3TWOA 1JDPA 1O89A 4TTIA 4WZBB 2WJYA 4LDNA 2X8BA 2HW8A 1DS6A 2C2HA 1PR1A 4UUPA 5GM1A 5L53A 4JI7B 4K9NA 1O54A 2PR2A 1FTQA 1Z0FA 4WJKB 4BIIA 4RJTA 1L4FA 1U1DA 2Q28A 1B2RA 2ZE7A 4O02B 4DYVA 1IL0A 3PTAA 3K9BA 1UJCA 1P2FA 5KINB 3OIGA 2QWXA 5TQ2A 1DX9A 1U2SA 2E89A 4TS3A 3K6SB 4LG1A 3Q41A 4H6WA 1HORA 4O63O 1TGVA 2EHDA 3KQLA 2RGBA 3F3KA 4JLNA 4ARUA 2IWRA 1RWMA 4IHKA 1ISHA 3EIFA 4I4TF 5BW6B 3K70B 2O2YA 1VP3A 5ICCA 5A0TA 3L7KA 1KOLA 4K1LA 1UXGA 3LYUA 3BJEA 2RHWA 4YT5A 1NVGA 3RNLA 3WLHA 3X1JA 5LYJA 1CF4A 4D4JA 5DTRA 1Z35A 1HQDA 2ZB3A 1Y8AA 3MPUA 2E4YA 3GUVA 3O1IC 1BE6A 1XVIA 1ISJA 4C01A 1KP3A 1VPTA 3ML1A 2PLWA 2E2WA 1FSGA 4IJVA 5MFPA 2A8YA 2FZWA 2ZRGA 3T7JA 1DXOA 5LXTA 4R1LA 1I7PA 2GPYA 1ZRNA 5C46F 2DT8A 4Z0NA 4FCWA 1XXLA 2FRXA 2WG0A 2PCJA 4O5OA 4DV0B 2NV6A 3AGQA 4KO1S 2ZWOA 4ZYUA 1AF4A 3R0QA 3RTEA 2X7XA 2X19A 2Z5FA 3OJCA 2GJ4A 4RD6A 4Y6LA 1AS0A 2QAGB 3BXPA 3ESCA 4GPZA 4I8DA 3C87A 3PA6A 4J9UE 1ZIYA 1MH1A 2PJDA 2PD3A 4O4IF 1OUMA 1Y33E 4LW8A 5ESDA 4NULA 3GBVA 7MHTA 2XW6A 4D6PA 4Z7QB 3MC1A 2XD4A 3PKZA 2QZPA 2PKQP 1YA8A 2ZGVA 3AFIA 3FETA 1MFPA 3H42B 2EFEB 3COWA 4NXMB 2NU9B 2DECA 3IJPA 1E0AA 1B8NA 4UDXX 3E53A 2ZS7A 1JIVA 1BJTA 2ISSD 3CLRC 3DDOA 4N0PA 4R2WA 5CJJA 2OPHA 1XQ1A 2AT1A 4L4SA 3K8ZA 4XWOA 1T43A 5G0WA 3LIIA 5GGXA 2ZJBA 1XK7A 4KXUA 1B3RA 5IASA 1JWLA 1LI5A 2OD9A 1GGVA 1H42A 4KE7A 5BSFA 5FQOA 1KE2A 2KBEA 3H6KA 5FORA 2ZWVA 5LQKA 4DXAA 2CL6X 3K20A 2PQ6A 1JQEA 2OXCA 2MJLA 3OQ6A 2VWQA 2F2TA 1E92A 3B3QA 4KXYA 2R7NA 3JTMA 1HDOA 5EKUA 4HT3B 1Y5RA 2I29A 5K0BA 1NE2A 4QNRA 3I32A 4P4SA 3NC0C 1J90A 3ZZTA 1VRWA 4E12A 2LWIA 4ACBA 1RQ2A 4AJ2A 4PLZA 3FSGD 4W1RA 1IZ0A 2BHTA 1C7EA 2I6XA 3MCTA 1NN1A 1PW5A 3UNXA 1KSJA 4PSUA 1FDRA 4C7BA 1G20A 4J1SA 1ECLA 3ED5A 4EELA 4B48A 2W6IA 3IUEA 5CDHA 4QOFA 4TX1A 3QKWA 3WS7A 2I2AA 1I9GA 3E3NA 4BP8A 1U8AA 1PDVA 1KXZA 1M33A 5ILGA 3SF8B 4OSEA 3SFVA 3AWDA 1FLAA 1SUWA 2BN4A 1PF7E 3EHEA 3CVUA 4QFBA 1VGVA 3WBBA 3QI7A 4RKYA 4OY3A 3L6UA 4ZTUB 4GBJA 1HPLA 4C5CA 1NP3A 1QR6A 2HTEA 1NVKA 2FFQA 2A9JA 4HGQA 3YASA 4BTLA 2Y4NA 2D5CA 4FOPA 1YGPA 3Q2IA 5H82A 3JQPA 4KR7A 3NRCA 2VNHA 1CPYA 3ABQB 2AQ8A 4Q5IA 4RA9B 4FFNA 4PPQA 1XUOA 2IS1A 1S2DA 2QMOA 1M74A 2YHAA 1GTJ1 3CG0A 4HDKA 5IJ9A 4K26A 1Y3DE 5JD6A 4W82A 2APJA 1CIVA 3A8TA 3ELYA 3LL4A 4KEAA 4Q7JB 5KYVA 3RYHB 4B0PA 4OKIA 1M2JA 5JJBA 1GTZA 5FPSA 1IJKA 4MI9A 3ZE0B 2XZDA 3BB4A 2ZBDA 4Q39A 5DNVA 5EFOA 3ASYA 4Y2QA 4S35A 1M76A 1QM5A 5KO2A 1YI0A 4TT8A 3PZBA 1J0DA 4O2AF 2GESA 4XTCS 4KQWA 1W0KA 1VMAA 2CF6A 1XVTA 1NNEA 3UAWA 4LX0A 5AW7A 3V1YA 4KAJA 1EFAA 3KKPA 1X1DA 2R47A 1EHCA 3Q15C 4GQIA 3UUWA 3JATA 4CW7A 4DNQA 5BSWA 5CVTA 3PQ3A 2WNIA 5DSXA 1WDKA 3WOVA 5H4GA 1JMYA 4EB0A 2YYZA 4GMFA 4ENTA 4ZYYA 2BWJA 5I9NA 2YTZA 3FXAA 5LQDA 1LWNA 5IYZA 4BZXA 1A72A 3O03A 4YXWD 4EMTA 5LB2A 2OXEA 2ECOA 3OLCX 1WWKA 2BMVA 4G1FA 3GEEA 4UPEA 4NBLA 2QMHA 3B3FA 4GBED 4CMIA 5EIBD 2AN5A 2PMWB 3Q7RA 2EKZA 1GD1O 3HQ4O 1SZDA 2QK4A 2GXUA 3IURA 1NVVR 3KZVA 5EPUA 4GX2A 3WYAA 1RJ9B 4LXTA 2ZRJA 4CL0A 1H0HA 2W2TA 2Q6VA 4KQ1A 3RK1A 2VQ3A 2NYRA 2VJYA 3FYHA 4RIHA 5CDFA 2IP4A 2C03A 3SZLA 2H06A 3IIJA 1G17A 1G6OA 3FCAA 3TLXA 3QZUA 2QTZA 1N75A 1SQ0A 4BP3A 1MW9X 4A23A 4HX2A 1GN9A 2JJ2D 4GM1A 3J7TA 4BNNA 1EFDN 5MGNA 1Q7BA 2XNHA 2Z3WA 3FLBA 3KG2A 3H8SA 4JMLA 4LSGA 3LKBA 4FIZA 1E63A 4R68A 2O2EA 3D5TA 4B8WA 3SNHA 1U3FA 4JYPA 2FP4A 2JKYA 2WZCA 5D87A 2DPMA 3EXHC 1WBBA 1CUDA 4Q3OA 4W6QA 1NQTA 1O2DA 3VV3A 2XV1A 2ASVA 2TMDA 2RSLA 4BZPA 2H2DA 2Y68A 1ORTA 1UFKA 3CN9A 2ZYHA 4RMNA 1AKTA 2IKQA 3HR7A 1CC1S 5JSZB 1PV4A 3L1JA 2ZJ5A 5C8XA 5JFGA 1JG3A 3F8TA 1SXJB 1GGKA 3OX1A 3U1BA 5EL0A 1U0NA 2AJDA 2R6GA 1BJRE 2PFKA 2ZUUA 3GLTA 2JI6A 4KBFA 1TF5A 2G77B 1OH5A 2D13A 4W8OA 1DBPA 1FTGA 1UDXA 4NECA 1QZTA 3RF7A 2ZYIA 4W6ZA 3UBMA 1U28C 1JSLA 1Q92A 1W9HA 3IBGA 3NAZA 1YMQA 2C04A 4YONB 3RK4A 4GP7A 5KDLA 3GGJA 3D4IA 3TEJA 4BGIA 4KJZA 2WPNA 3I9JA 4I19A 4O8ZA 3G8AA 4HAWA 2XWQA 3E8MA 4PNHA 3U7QB 3ISJA 1U3VA 3I37X 1U8YA 1YDMA 2CVPA 2Z4SA 4HQRA 4OUDB 1Q7EA 3T34A 4EB6B 1V0JA 3H9EO 1M6HA 4OGWA 4CR7A 5TR9A 5BW4A 1E9CA 3BM5A 1Z7BA 1NBMD 1U98A 2XITA 4HDNB 4CQMA 2O2ZA 2OBYA 3C39A 3HWX1 1KPIA 2C8JA 3KFVA 5CHEA 2O8BB 4Q6BA 1UOEA 2XB6A 1F12A 4PO8A 4Z0TA 4GDFA 5AJHA 3OPXA 5C5DA 1Y42X 1KVQA 3AKDA 3HHPA 4GMHA 4KVAA 1JI0A 2BFAA 4JEIA 2PGLA 4WW0A 4B7UA 5CG2A 5I7FA 2O2HA 5HK8A 1MB2A 3FMPB 5TMDA 2PT9A 1S9HA 4R31A 1HLDA 3PCRB 4ENWA 3GEIA 3VR5A 3D3EA 3ZDAA 3GFSA 3A1TA 1JLSA 2GYUA 1M8JA 2A9OA 3KCQA 2B8JA 2NSDA 3IA2A 5ITSA 2C2MA 3EC2A 4OI0A 4CEJA 1VL5A 2VP9A 2LKCA 3BD9A 4MUXA 3IMEA 3CE9A 4OUDA 4LMRA 1Y1PA 1QRAA 3P9QA 1VGQA 2PFSA 4MS1A 3VX4A 3UOWA 1B73A 4M76B 3H4MA 1RPZA 3I5UA 5ICEA 4GL2A 2A3NA 3GP8A 5BSGA 2F1HA 2IJGX 4PO9A 2ZBVA 3Q2OA 5ALMA 4F8EA 2NZJA 4LRXA 5EIOA 4ZAFA 2JIQA 3WNCA 4CFSA 2JFXA 1X94A 5HS4A 3BG5A 2VKTA 3ENVA 3MCVA 1UWCA 1SXJA 4UUBA 3TZEA 3VU9A 4O4IA 3H8JA 2BT4A 5B6JA 5BMVA 1K06A 1P0CA 1FMLA 3R6TA 1FE8A 3IFSA 5BQFA 1Z4OA 4DCUA 1F6WA 2JFBA 3AQ4A 3U61B 3ZDDA 2WEKA 3HCPA 5B7PA 1ZK0A 2EHJA 5F1YA 2J5XA 5THKA 4B1FA 4DLZA 1M66A 2YJ5A 1H22A 3A2NA 4HGPA 4CDMA 5CCBA 5LXTF 4M0LA 1N4DA 2PIAA 2IS2A 3N2KA 1HE3A 4MINA 1KY3A 3M70A 3LDFA 2ZT7A 5K45A 4KUHA 1P44A 1OV4A 1Z13A 3AR4A 3ES9A 4YAWA 2JH8A 1P2GA 2BFMA 1VPDA 1D3AA 1EE2A 1IJEA 3IQIX 3ONNA 2X9VA 1EE1A 4EFDA 4EG3A 4PGFA 3RTAA 3JZMA 4O25A 3AJEA 2RGCA 4TYMA 2WA1A 3AP2A 5AW6A 1X1EA 2NX2A 4KHZA 4X95A 4Q4CA 2V9PA 4N3CA 1TCBA 5AVXA 1P7PA 3AF3A 1QK4A 4XVQA 4TQUS 2I4IA 5ERGB 3CZCA 1T3ZA 4TTPA 1CR6A 4P38A 3VU8A 5BYKA 4BB0A 1BZYA 4C2UA 3NGMA 2B83A 3LCMA 3MNFA 1EUDB 3OSUA 3THRA 4XM2A 4JT2A 3DGFC 3CLUC 3KZ1E 1W94A 3QOYA 4QGFA 3S2FA 3ENZA 3U7HB 1FU8A 3LZCA 1E2NA 5K8TA 1TM5E 4LTNA 2DE0X 4N6NA 4R8VA 3VNRA 2WM9B 1KWGA 2G25A 4XWGA 2OCXA 4MVJM 3EISA 1T9CA 5A4FS 2VPTA 1ZUNA 3LT0A 2WNHA 4AZ3A 2VAVA 4CDNA 2PWBA 3LUFA 1W59A 1L1FA 1D8AA 2YJNA 1VSUA 5CG1A 1T9ZA 2Q21A 1GKIA 3EBPA 5EUQB 2JGRA 3PJEA 1G3QA 3NBZC 1GUBA 1MQSA 8LDHA 5IYZF 2ZYTX 1LPMA 1EHIA 3I1FA 2HSWA 2C2YA 3N2GA 4GX0A 3FPSA 2R6CA 5F23A 1E3EA 2XJ9A 4TTJA 5JAOA 4WA7A 4JROA 3Q7EA 4Y2TA 1DCKA 3EF1A 4PR0A 5BYBA 4ANFA 5KYYA 3GLFB 4FOOA 4J1TA 1NONA 3ZK8A 3IAS1 3QF7A 1H23A 4G1UC 2DUUA 4ZKEA 3JQQA 2VQ6A 3K0KA 2VYNA 3GFVA 4RHTA 3BWVA 4D8UA 1YBHA 2RIPA 3OPYB 5HIMA 4ZT6A 2HSDA 3MT0A 4HOYA 1X8XA 4EG7A 5F3RA 3PRHA 3ESRA 3K09C 3LCCA 4PQRA 5M29A 2OHOA 1MC1A 4AY5A 3PFBA 1C9EA 3VKWA 5A02A 2VNJA 5C5IA 5JC8A 2QM0A 2RD2A 2FPIA 5LD2B 1WBDA 1KY4A 1IPHA 1FDSA 5K2OA 2B3TA 2ZP1A 5G0SA 1ACMA 1INLA 3HBAA 3U80A 5IULC 1NMZA 5HTKA 1GRCA 1M2VB 1T0BA 3WP0A 1XI2A 4K2HA 2ADOA 3NI2A 2WYWA 3OJOA 1CNFA 1P6UA 3KLPX 2G9VA 2YFYA 2EBUA 3GLHE 3TH5A 5JDCC 3FVWA 4RZSA 1X6VA 4ZO8A 1I7LA 1UC4B 3AK4A 3DCNA 3AI1A 2FW8A 1L6RA 3Q0EA 4OH7A 4C0SA 2MINA 3GEPA 2JLVA 2HYIC 3WSWA 1N8SA 3IV7A 3JQ8B 3EYAA 4H1UA 4Y2RA 3WIVA 3GJ5A 1NWCA 3OHMA 5GMOA 1UJ5A 2EEPA 2YVAA 3FPHA 3I9FA 4TXHA 4B6JA 1T4CB 5HIKA 3LNCA 4DR6B 3OMXA 1BE8A 2VXBA 3MLAA 1W49A 2GD2A 4YT4A 3SOZA 4GLOA 1TD1A 4H3SA 1TGYA 2XCOA 4WD3A 3I01A 5KCMA 3PIDA 4OKSA 4WNCA 1L5NA 4Z4CA 2N3ZA 4CGYA 3OE1A 4EUFA 3K0CA 5L6LB 4IUCS 3UV6A 5TPWA 3DO8A 1Q0QA 1ZCFA 1X7HA 3WA6A 1Q22A 4AJPA 4R9NA 5KTPA 2LDBA 2YWGA 4KIJA 4QXPA 4RDCA 4Z3KA 4B9EA 1T6YA 2YV4A 4LYHA 4PPNA 2MMCA 2PKCA 1P31A 2H07A 2PUEA 4WDQA 1RLUA 5DM60 2VJQA 2GBFA 4WCVA 4D8VA 1GARA 2YVKA 4NR0A 3ZXSA 3O4IA 3L7AA 3QE0A 4JI5B 2IEAA 4P4SB 1KK1A 3GD5A 4LJ7A 2OV4A 4NJMB 3JZIA 5BN4B 3TTXA 4B31A 1ZD5A 2P91A 1LPBB 2IZ1A 2ZI7A 4GNRA 1WM1A 3SM9A 4MVJF 1GSAA 3LF1A 2JGJA 3TLYA 4QTXA 5A7FA 1D9XA 2VEOA 2X2PA 3OJEA 4IH9A 5K7SA 3Q0TA 3CONA 4AJNA 1L1QA 1R8QA 2B2NA 2G28A 3PF9A 1O8BA 1UBTS 4P80A 1DDGA 1V48A 4PW0A 4Q05A 4Q4DA 3ZV4A 4D8YA 3M6WA 4DSUA 3IR7A 2Z2JA 1MBZA 2DBZA 2W6NA 1R00A 4S0ZA 4QULA 1GP2A 5HP4A 2WSMA 2QPTA 4GU5A 5ES3A 3IP1A 4DIFA 2QS9A 4UUQA 4G63A 3UF0A 1Y1RA 3X1KA 2G0AA 5I7AA 2E5FA 1KF0A 1BHO1 2EARA 1BDBA 1V1RA 3M6VA 4L3OA 4ZCRA 3TGPA 4FMPA 1QANA 2O2SA 3MVEA 3VR3A 4DCOA 4X62B 2QPAA 1TYEB 4HDSA 3UCFA 4XJVA 4URVR 4EVIA 1MJGA 4LF5B 4FINA 1WDLA 2QD5A 5LP6A 3TQHA 1M7GA 4G41A 4L0CA 4DQLA 1X13A 3KTOA 5CFQA 2WTUA 2I76A 5GV8A 2ZYWX 5HW0A 1APBA 1Z83A 2BH2A 4RZUA 3BE4A 2BY4A 4YJ2F 1J49A 2E55A 1OV6A 2W0MA 3UJHA 4IOLA 1RXIA 1ML3A 2I6UA 4X7PA 3RYCB 2QUIA 3F46A 2REXB 4IILA 1TTHA 1YDWA 4R8KA 4JA0A 5ALHA 4ZXFA 1M6WA 1YQ9A 2WZDA 3M9LA 4YAJA 1YIDA 4ZIRB 1N77A 4IMIB 5G0UA 3MBOA 1GV0A 4WVLA 5H59A 5CVEA 3S1AA 4BNGA 3DMHA 5BR8B 2D1SA 4PLVA 3TXXA 2QUJA 2WHRA 1M34B 2N42A 3K15A 1XP5A 1CDEA 4A6XA 5J47A 2W2LA 3EVNA 2WHPB 5F7ZA 4FILA 3C15C 2Z8ZA 4L8VA 2PHZA 5EP4A 4DARA 1JYFA 4ZZ2A 1L7MA 1F4LA 4LZNA 2O7QA 4L28A 4X91A 1F14A 2P0AA 2XT9A 1VJRA 4IJKA 1T25A 2R5WA 3B6IA 4G97A 3EDOA 4JI8B 3LKVA 4KFRA 1XK6A 3LUGA 3T54A 1C1HA 4D92A 4FFVA 4U3JB 1Q12A 2X0FA 1T9KA 3WKDA 1GPKA 2OGTA 3OF5A 3OCYA 4ODIA 1L8OA 3OM1A 4P9NA 5D86A 4OHZA 4NONA 5HUJA 2Z4RA 1QGUB 1UWLA 3MS7A 1MRNA 1NM5A 2HLPA 3I6YA 1IRXA 4MQEA 1U99A 2QE7A 4Z2AA 4ZARA 3H7IA 4WOKA 4BNTA 2R68A 1DX6A 1XEFA 4F6RB 3EAQA 1T2UA 1Q7CA 3S29A 3G02A 1NR1A 4Z5XA 3W6NA 2OCAA 3WL6A 3TSAA 1V7QA 4IIUA 2C8VA 1N3IA 3L18A 4FCVA 3P2KA 1HOTA 1XPOA 3RHSA 2CJXA 4NU0A 1K75A 2ERYA 2VXYA 1R5OA 2I2FA 4MXDA 3IUJA 5KX5B 2B1RA 5IF9A 1VQ1A 2GM9A 2IZ5A 5BYJA 4E1AA 1HDZA 4ZVLA 4CLDA 1GTSA 2D2XA 3NWBA 3ZH9B 2GPTA 4Q3BA 3ICEA 3VO2A 2CXUA 4NK5A 4A0GA 1DLIA 3BORA 2KPOA 4TN5A 1QAMA 5IYZB 5KYUA 2EZUA 4FW9A 4EW2A 2J31A 5IN4A 2HZBA 2I2DA 1K7FB 4M1QA 4XGNA 2ZI3A 1G6KA 1W4CA 1L7QA 1NVWQ 2I3BA 4MUGA 4DDUA 5J3JA 3FKSA 2UUAB 4PAQA 3F6PA 1YZLA 1M7BA 2Y99A 3MYYA 5CT6A 1NW7A 4TOIA 1NFQA 2B5OA 1Q6ZA 2YVLA 3P2JA 4G6ZA 1PE0A 2QI9F 1FJ2A 4PU0A 5JADA 5FULA 3UMVA 1S2OA 4F71A 5CCXA 2QG4A 2AW5A 3ZWQA 4FMCF 1COWD 1CUXA 1T26A 1Y0BA 2WFLB 4BATA 3EHDA 4X60A 2N75A 4XVCA 2GM4A 2X5JO 2A14A 3BRWD 2WYOA 4FYKA 3K6KA 3LUBA 4NY1A 4MRAA 5H1YA 4BNHA 3K6RA 4C7MA 3UWKA 3UK6A 3D2BA 4OQPA 4EAAA 4F84A 3AY6A 4P8RA 3OP4A 4CG2A 5DSZA 3W6UA 2DLDA 1G20B 4UQLA 1A69A 5FBVB 3DD1A 3RV4A 4XEUA 4LF8B 3JAKA 4K9QA 4B09A 3HRKA 2ATIA 2NT3A 4CQLA 2IUYA 3H9JA 3VU0A 4C4TA 4DIBA 3FBTA 1D1QA 4F3RA 4IDFA 1E8MA 4JS0A 4DV3B 4NZNA 1ADJA 1BSVA 2J3JA 1NULA 3LU1A 2TECE 4IVQA 3TLJA 5J1TB 4CL2A 3VMFA 1WB6A 4GI5A 5KWSA 3U6BA 2FPIB 4HXGA 1CY2A 1G5TA 2WU0A 1FYWA 2QYOA 1IY2A 1JTEA 3H1GA 3NIDB 3OF2A 3PL1A 5KDDA 2ZZNA 3QUCA 1Y7PA 3DUFB 2OGSA 4UBJA 3TQSA 1V45E 1H5UA 2IYPA 3NHMA 5G3YA 1DV1A 4OIFA 5T6BA 1I7SB 2PLFA 4JP8A 4WKBA 2CCGA 1Z5UA 3F6EX 4K9KA 3H5VA 3LX8A 1PJRA 2FI1A 1SEPA 1BD3A 1OGJA 2QTWB 4LKOA 5FHQA 4NBKA 3QKTA 1N1GA 5FI3A 4O08A 1O97D 3K73O 2CZCA 1PNVA 3PQDA 4NKRA 4RSMA 4YFYA 4UBKA 4C7KA 1KEWA 3CLUD 3TUZC 1CUJA 1S3SA 5F7JA 1NMXA 4BJ3A 1H4QA 4K05A 2YJ4A 3CNLA 4ZMSA 3A4MA 3D4LA 2AEMA 3GJ7A 3MUEA 1PFKA 1KTIA 1Q3KA 1DBWA 1SIWA 3MT8A 5ISMA 5DNDA 4EUHA 3INYA 1VFNA 2C2ZA 3T95A 2NYVA 5F76A 2DKNA 1D2GA 5DOVA 3OPYA 2Z98A 3H75A 5FEUA 3O94A 4D9JA 3B38A 3DZKA 1D2AA 1G3UA 4L8YA 3UYLA 3GUZA 1PUJA 3FHJA 3F6YA 4F6LA 2Q3LA 5L3QA 1VHJA 2AA3A 1B23P 3B1ZA 2DWOA 1OYWA 4W7HA 3OZAA 1E4EB 2Q1SA 4RVGA 4L8WB 1XCMA 5T6MA 1HG0A 1ECJA 1LNZA 1ISFA 2UDPA 2Y1EA 3KKKA 2ZIWB 1JQ3A 1YWGO 3A9SA 1BA3A 1U7WA 4FGKA 1GFIA 4HNRA 3C24A 1EFRA 1WY7A 1M83A 2I4TA 1EM8A 1ZZEA 2UYOA 3KAJA 4MUAA 5C1OA 2OAGA 3NM4A 4F6CA 3H5OA 3ZZ0A 4W5NA 5JQWA 3Q3EA 3LQYA 5DN6A 4GECA 2BEUB 4MGIR 4OBWA 4DSOA 4PV7A 4BO5A 2OCGA 3PNOA 2D5BA 2YHUA 1BX1A 2ZSJA 2PU5A 2R96A 5AVZA 1JFLA 4KDRA 4B4WA 3I6BA 2JHGA 3HM2A 4RAOA 1Q7GA 1H69A 1KYWA 5EWLB 1OXBB 1JS1X 2VO1A 2OXIA 3AR8A 1Z5OA 3AFHA 2ZRHA 3K0BA 3QXHA 4KUEA 1NJ6A 1K6JA 2YOHA 4O2LA 5CLFA 4JYCA 3UATA 3GMIA 3VTAA 5TPZA 3THXB 5L45A 4O59O 3HO8A 4RHFA 3TVDA 2YV3A 5JXHA 4C4AA 5ECGC 5HJ2A 1Y7TA 1G8AA 2QDKA 3ZHRA 4EX6A 4AROA 4KX3A 1ST3A 4ZU1X 3O8RA 2OFFA 2D06A 2AFHA 4DY4A 5HYVA 5BOSA 3MWFA 2JGIA 3P96A 2CB9A 3HKCA 4ZIRA 4JJ4A 5KYXA 3THYA 2ENUA 1QHEA 1YZGA 5DW3A 1E5QA 1EP1B 3Q7QA 5A4JA 4CXMA 1X7XB 2NSYA 2ZEJA 1MRZA 4FXPA 4M9XA 4PZPA 2OXTA 1GL7A 1KI8A 3DBIA 4IGEA 4ZCPA 3RWMB 5FNVB 1LBIA 2CJWB 3EXAA 3KV3O 3R9KA 1C7QA 1YA6A 2ODQA 2GRAA 4JVMA 4C4PA 5HM6A 3RYCA 1E9VA 1YK0A 2BZSA 5JARA 2JLWA 1P9NA 4M60A 3V8QA 4M87A 4F96A 3JQ7A 3MWEA 2VJOA 3WRYC 4PN7A 1GGEA 5IJWA 3RO7A 4LDZA 3STWA 3WQHA 3EULA 3QXXA 4FNAA 3UWSA 4B0OA 1LBEA 1HSOA 4EDHA 5CFPA 1PS8A 4MPPA 1NBOA 2BGJA 4MIOA 4IX1A 3VHQA 2QNIA 2W48A 2XDQB 3E22B 1G6HA 4MKXA 2H4JA 5EIBC 3RT1A 1KZYC 2NYUA 1M7HA 3ICCA 1HL3A 4CTMA 1AT1A 2OCKA 2BCGY 2ZAGA 1C3XA 3P9SA 4F9EA 4YV0A 2DWPA 2X8WA 4AO6A 5SZJA 2BFWA 1M1YE 4XOIA 1LVUA 1GDDA 1UK8A 2REOA 4P36A 2OBNA 2JIZD 4F11A 3HKEB 1K27A 2WTEA 5ER6A 4BJ1A 5K4HA 3PHJA 1HDRA 1DBRA 1KGDA 1UZAA 4PSAA 3DL4A 5JQGF 1AHPA 2XMQA 3KPYA 3VVMA 1QH1B 2PKQO 3KOUA 4EGAA 3ADDA 1I6MA 2O7NA 1L4GA 3OLQA 4LXQA 5B1SA 3ZK7A 1UAYA 5E4YA 5HR5A 1O5IA 4CMBA 1PNOA 1QB8A 2AEEA 4O2AB 3S27A 1B14A 1DRUA 1MJNA 1ORRA 3EUWA 3K09A 2X2FA 1F4PA 4KACA 2FSIA 3FHTA 1ANKA 4H1HA 3AUAA 5SYMA 4LXXA 1AO3A 4QSMA 1GPJA 2O2IA 4XCQA 3QJYA 3B48A 4QJ5A 2H9YA 5EZYF 4TS9A 4RHUA 5L4SA 4Y3UA 4MZDA 4OQ4A 5AM4A 4XQ0A 5E4FA 3PD0A 3NFRA 3VDMA 1KC3A 5A3QA 4JI0B 4DG5A 5DX0A 2ZR8A 2PO7A 4U0KA 4E88A 2CCKA 5T5QA 2ZKLA 4LDQA 2AE2A 4DLBA 1T1RA 3I53A 4BWFB 4A2CA 1N0UA 2O23A 2RGNA 3ECSA 5AHRA 5L7TA 2RGRA 1E6EA 4G0PA 3VSEA 4L16A 3GN2A 4DR4B 4LZOA 3UQYS 2FG7C 3NHRA 3OBIA 4AUMA 4FSDA 4OHBA 3E7FA 4QASA 4D4IA 5C5CA 1NI4A 4CIWA 3H97A 4JU8A 1YR7A 3IP9A 2EW2A 5IX8A 3FI9A 1WDTA 3HN2A 1UJMA 2OEPA 3NPAA 2NO6A 2V1UA 2XUDA 3RRBA 3HSYA 5CUQA 4HQKA 4AZTA 1DMSA 1N2ZA 4A8PA 2Z6UA 4A36A 4CQLB 4HWGA 4Y1RB 1KQOA 3T7IA 4IHAA 4LNUA 1CQIA 1ZKMA 2VHCA 2P9TA 3SVLA 1YT5A 1T2DA 1VIYA 3A6JA 3EUEA 4MARA 3DF9A 1A9QA 5T67A 2BMFA 2HADA 2O07A 2J7PA 2WICA 1HMYA 4R7TA 1TU0A 1QG2A 4LWOA 1PT6A 1DSSG 3FZYA 3ZWOA 2GEFA 1KXJA 4Q47A 1AZTA 3EGIA 2JGNA 2NQTA 5C1BA 1N57A 2PRZA 2EZ4A 4X7RA 4AJLA 4TYYA 3Q4GA 4FLEA 4ACAA 1O95C 1ZA1A 3NDJA 2H7CA 2BCEA 3S8EA 3G0HA 1LK7A 1NUHA 3W3AA 1D5CA 3VZPA 1UPFA 2CLDX 4DCNA 1LRJA 4ZO6A 2FMTA 4B34A 4MV3A 2IZ6A 4R98A 4P5EA 2A9FA 3BBLA 3ZY3A 2P6OA 3GRZA 3OZTA 2YZKA 4R71A 1XT6A 3M4NA 2NV0A 5CA0F 5CA1B 2YQ5A 1CIJA 2VYVA 1V25A 1Z3CA 4M1EA 4D4GA 1V7CA 2WM8A 3HG7A 2GPAA 2ZVDA 3E9DA 5HJEA 2WU4A 3WQBA 2HT6A 1CJSA 3GPBA 1ORVA 1OBOA 4QQNA 2GBCA 3OTHA 3PK0A 4MTCA 1F0PA 1J56A 4MHSA 4MWTA 4I6JA 4Y6SA 3DULA 2PYZA 1P8AA 2R7KA 1N32B 1F8UA 4LHXA 3N0RA 3GCWA 1LNQA 1ZAYA 1ZOOA 3AEXA 8ATCA 2LBPA 4EEKA 4MIEA 3ED1A 3H2GA 4PC7A 2CL7X 3KEMA 1RCFA 4R6WA 4ZGWA 3L8MA 2ZM5A 3BGDA 1CS0A 3IUBA 2DETA 4L9RA 5FBQB 1I24A 2IT1A 2C5SA 2WI8A 3U9TA 4F2GA 3DZHA 4O29A 1L7OA 3IDSA 3VC7A 3PXGA 3QFSA 1V3VA 2V7QA 5D00A 1RI2A 5L4NA 4B74A 1YOBA 5JZSA 1CVRA 4QQFA 3SE0A 3KVVA 4WN9A 2OENG 2JLXA 5TF0A 1P9OA 1BA2A 4CFZA 3EARA 1BQ4A 1PJ3A 3JQAB 1O4VA 3WXMA 1ZHOA 3KE9A 3N0VA 5FL7A 4ZJYA 3C48A 1E96A 2AF4C 1OU0A 2QN6A 4Z7OB 4BGDA 3U4QA 2JGLA 2Q6TA 4WY5A 4QOGA 5B57C 1WUKS 2ZT5A 2GB4A 1ZCZA 4F5EA 3SAJA 2LCIA 1UC8A 1XCBA 2BFEA 2YS6A 4GZ6A 5CBKA 5AO9A 2O05A 1SUAA 1SXJC 2BJVA 2ZS9A 1WNFA 4TV8F 4Y18A 4DG8A 4DZTA 3OECA 3OU7A 2LTAA 4GQAA 1T6NA 3G5LA 4ER5A 4KPEC 3PWSA 2ZIUB 1X70A 4M98A 3FYTA 4NH0A 1HFEL 2BCJQ 2IU3A 3ZW9A 1TFRA 2IYAA 4HB0A 3DKIA 2R6HA 1JLLA 1XRJA 2ZPTX 3A31A 2COKA 2DJ5A 2FPMA 3EOAI 1EG2A 1ECBA 2B4KA 3NKFA 3R6DA 4LYAA 3E5RA 5A3JA 3TW6A 2NZ8A 1FYDA 3OIVA 4DV6B 2F90A 2GEJA 3KOYA 4RKEA 5CVDA 3C3CA 3R8XA 1RACA 4EI2A 2PRSA 4RTJA 3PQ5A 3Q8XB 1QF9A 2P2NA 2VEDA 4HH0A 2VP0A 2FPPA 3KQTA 3PDIB 4KU4A 3IOMA 4KLCA 2QSZA 2E4VA 4EPXA 1IN5A 2RI6A 5BMVB 1UBMS 2QJTA 1Z4PX 2V7EA 3MCAA 4I1VA 2W0SA 4GM0A 4PYQA 4J43A 1TU3A 4ZEOA 3AETB 3OZEA 5LUAA 2J5QA 2AB0A 1ZHFA 1L9XA 1MJHA 4BGUA 5B6PA 4LJYA 1BU5A 2EQAA 4D9GA 3TQFA 3KWJA 3RT7A 4BGVA 1DZIA 1P1BA 4IGAA 4YT2A 5EKDA 2YS7A 1P75A 1L3IA 2B9EA 3D6HA 1LBHA 3M1AA 2Q1YA 2JFQA 2KLHA 2XR1A 3DV0A 4WKPA 3BFVA 4X1IA 1BVUA 1KO4A 1ZK4A 3SKVA 4IDQA 4GMGA 2JHAA 4LV6A 3RS8A 4MUHA 2C9OA 2Q0QA 3NQ41 1Z4LA 1PTJC 2A1TS 1DQSA 5C0OE 5E3HA 2NQ8A 3VU1A 1VBFA 5CFZA 2NSHA 4XM1A 1IJFA 2AZTA 3GG2A 2XXAA 4XGRA 4C0XA 5BV2P 1HX7A 4JFAA 4BX2A 3WAJA 1O95A 4EY7A 1P0QA 1DMRA 3VKUA 5A3SA 2DR2A 5AJTA 2GRUA 4DQUA 4EHJA 2EX0A 4L3WA 4Q3CA 1F5NA 2VNSA 4MUNA 5C31A 1GSOA 1M6VA 2BMJA 1TZMA 2GN0A 4Q01A 3KR1A 1RLJA 3PPWA 2Z2IA 1E1CB 1W5TA 3RVNA 3UJCA 2E4AA 4DBLC 2N0SA 3WLNA 4W5OA 2Q62A 521PA 4Y7DA 5FP0A 4GXQA 5ARCA 2QZJA 4OHMA 5IAGA 1BDIA 1D4OA 5AWFC 1HR0B 4I55B 1CCWA 1QZ3A 4QE3A 1CWUA 1WSBA 3NYRA 1Z18A 1JQDA 3O74A 1OLUB 3A14A 4LF6B 1BVYF 2XXAB 1ZKDA 5C80A 4LWPA 4JLSA 1XRLA 1LZLA 1J2JA 3ZBTA 4EYKA 4PG8A 1CT9A 1MO3A 1P7VA 3D6AA 1ZA2A 4FGWA 4I55F 5COQA 3FY4A 1CP2A 3PQ7A 4HF7A 3UPTA 2IYZA 3MJ4A 2W2QA 3EH2A 4YUXA 3DC2A 5EQJB 1Z6YA 2AI1A 3KX2A 1LD3A 1YRWA 1W36D 2J5BA 1KZ9A 1F2TB 3U44A 2EZ9A 1LBTA 3BIWA 3D6JA 1QYDA 4U2FA 3B3JA 5IJXA 3IUYA 3WKBA 4BDSA 4AQYB 3M4XA 5IH7A 3NMUF 2OAEA 5CD1A 5TLSA 4YA6A 1JA0A 1DT5A 3V55A 1UJ6A 4DLSA 3Q5DA 2XGOA 4EB6A 3V32A 4MEJA 4F9TA 2FPPB 5C37A 1OXUA 3AOEA 2Q9BA 5K05A 4G8JA 2NZVG 1GRNA 2JJ2A 2RHRA 1XDZA 3ABIA 5JHGB 5LSAA 4ENUA 1LSOA 2R4QA 2Y1KA 4I8XA 3OZDA 1CDZA 1AHIA 4G24A 1DHTA 4LXUA 4B4OA 2XNDA 1GCGA 1JR2A 1BX0A 2OV8A 4EI9A 1SKYE 1NT4A 2H31A 3R5FA 4M8IA 3GJQA 1TLTA 4WFQA 2GYWA 1Z82A 1Z0UA 4I1YA 4WNAB 4OEHA 3RPEA 3WDSA 1E4YA 1O7JA 1E4VA 3A06A 5D1HA 3G2KA 1JIUA 1HL7A 3PLNA 2PMFA 2OD2A 1Y8QA 1NAHA 4PCAA 1X1CA 1JRLA 4OYLA 1YASA 2BAGA 2UZ3A 2X0RA 3IKJA 3MWLA 4L1KA 3CZ5A 2JANA 3ROGA 5MN4A 2X4IA 1UMDB 3GK3A 4WASA 5A9SB 2CUZA 4LOKA 3KD3A 1L4LA 2G40A 5ALUA 3U7IA 3EVCA 2WRZA 2O6LA 2BDTA 5ICMA 4KC0A 4L0DA 4N40A 4RVCA 3L82B 1EXNA 1J99A 2BUAA 4UAVA 1OBFO 1D03A 4PXAA 5FL7D 4XX0B 3HCCA 5AI9A 1X8JA 3TKYA 1M1YA 2Z6VA 3VYWA 2ZK7A 1FXWF 5BVGB 5KYTA 1XHEA 3CNBA 1KVUA 2HJSA 3HXLA 1Y6QA 4M1KA 4C03A 4MUMA 1UAGA 4BO3A 3OLZA 2B94A 4IUYA 4IIBA 1N6RA 1RQGA 1ZI6A 1OWLA 3K6JA 4MQUA 4EA8A 1C2TA 5BV7A 1T3TA 4FWIB 1O95D 4DANA 5K0JA 4DQDA 2A5FA 1XHLA 3KXKA 3U9SA 4PAOA 4JUFA 1E7RA 2NLOA 1P0IA 2P79A