4N6GA

Tailoring small molecules for an allosteric site on procaspase-6
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
268
structure length
257
Chain Sequence
FYKREMFDPAEKYKMDHRRRGIALIFNHERFFWHLTLPERRGTCADRDNLTRRFSDLGFEVKCFNDLKAEELLLKIHEVSTVSHADADCFVCVFLSHGEGNHIYAYDAKIEIQTLTGLFKGDKCHSLVGKPKIFIIQAARGNQHDVPVIPDTNITEVDAASVYTLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYGSSLEFTELLTLVNRKVSQRRVDFCKDPSAIGKKQVPCFASMLTKKLHFFPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caspase-6
publication title Tailoring small molecules for an allosteric site on procaspase-6.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 87
structure length 257
sequence length 268
chains with identical sequence B
ec nomenclature ec 3.4.22.59: Caspase-6.
pdb deposition date 2013-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4n6gA00
2CJYA 2QLBA 4N7JA 1M72A 4QUHA 3KJFA 4JJ7A 1RWKA 5I9TA 2H48A 3E4CA 2C2OA 4ZVPA 5IAEA 2FUNB 2Y0BA 1RWVA 4I1PA 2QL5A 3EDQA 4QUIA 3OD5A 4DCPA 4EHNA 2H4YA 1K86A 1SC1A 4JR1A 4QU0A 4HQRA 4QULA 4ZVTA 4QU5A 2J32A 3GJSA 4JR0A 3V6LA 1I4OA 3QNWA 4D3XA 5K20A 5IANA 5LU9A 2DKOA 2C2KA 2C2ZA 2XYHA 3PD0A 4DCJA 4QUGA 2HBRA 1PAUA 2QL9A 4N7MA 2CNKA 3V4OA 4EHKA 4QU9A 1KMCA 2H54A 2Y1LA 4JJ8A 4PS0A 1NMQA 2C1EA 4N5DA 4FXOA 3R5KA 1RHKA 3GJQA 4EHFA 1I4EB 1I3OA 5IASA 4PRYA 5LU8A 2H4WA 2HBYA 3R6GA 2CJXA 4JQYA 4NBNA 2CNLA 2WDPA 3NKFA 5LUBA 5IBRA 4QUDA 4ZVSA 3D6MA 2QL7A 2P2CA 1RHQA 3RJMA 4EHLA 1F9EA 5IBPA 3EDRA 3V3KA 5H0IA 1CP3A 4FEAA 2CNOA 3DEJA 4QU8A 4AWBA 3R7BA 4EHDA 5IC4A 3SIPA 3R7NA 2AR9A 1RWWA 4FGUA 3H0EA 1RWMA 1ICEA 5IARA 2CDRA 3UO8B 4PRZA 3V55A 4QUAA 4NBLA 4QTXA 4JB8A 1SHJA 4NOJA 1NMSA 4N6OA 4LSZA 1IBCA 3NS7A 1NMEA 5IAKA 5JFTA 2H65A 2H5IA 3IBFA 3ITNA 4JJEA 1GQFA 3BIJA 4HQ0A 4QUBA 5I9BA 1QTNA 3P45A 2QLJA 3NR2A 3SIRA 2K7ZA 2QLFA 3DEKA 2H5JA 1QDUA 4EHAA 5IAJA 3P4UA 1F1JA 4EHHA 5IABA 2J31A 4NOKA 4ZVRA 3H13A 4ZVQA 4IEFB 3KJNA 4N6NA 3GJRA 4N6GA 4DCOA 1RHJA 4FDLA 4ZVUA 3R7SA 3DEHA 4JR2A 3UOAB 1RE1A 2HBZA 2J33A 3V4LA 2C2MA 2XYGA 3V6MA 1RWXA 2XZDA 3R6LA 4PS1A 1SC4A 1RWOA 1SC3A 4JQZA 5IBCA 4AW9A 3H1PA 4I1RA 5IC6A 4NOLA 1GFWA 1NW9B 4D3ZA 4QUJA 4EJFA 5LUAA 5IAGA 3KJQA 2J30A 3H11A 1SHLA 3S8EA 2HBQA 3DEIA 1PYOA 3PD1A 4QUEA 3PCXA 1BMQA 1RWNA 1RHRA 1RHMA 4M9RA 4NOMA 3D6FA 2CNNA 2FP3A 4QTYA 1RWPA 1I51A 1RHUA 1QX3A 3IBCA 3S70A 3H11B 2XYPA 2NN3C 1JXQA 4AWAA 4D3YA 3K7EA 1K88A 3R5JA 4ZVOA 4IYRA 1CVRA 2FQQA 2XZTA 4NBKA 2H51A 3GJTA 4HVAA 3D6HA
chains in the Genus database with same CATH superfamily
1TD9A 3G9XA 3HJNA 4CQMA 2WK1A 1TLLA 1JG3A 3PNLA 2C5AA 4FM9A 4RMHA 2W9XA 1KFBB 2J3LA 2P4SA 3HCFA 2EZ8A 3MTIA 2WVGA 4JJ7A 1QQTA 1D7AA 1SUPA 4ZVPA 1E1LA 2AXNA 4CKWA 1ENOA 1E89A 3NJRA 4EB6B 3LW8A 5TVKA 2FPPA 3W79A 4EHNA 2L17A 2GEJA 4ZVTA 2J0QA 2J48A 3AL2A 4Q37A 3BGOS 5TSDA 3T41A 4AG5A 5TNXA 3ZCXA 3KPJA 1E5XA 1ZC4A 2BONA 1PNQA 3DLPX 2FI1A 1YJBA 2BD0A 2JBAB 2VCYA 4R6WA 1D3AA 2NQ2C 2VA9A 2KSQA 2W4QA 4A0HA 1F8GA 1U2EA 1QQ6A 5JCJD 1ZXXA 4EY6A 3I6MA 3ZVMA 3GEPA 3N8KA 2R8ZA 3EMBA 3GPBA 2R7KA 2FFQA 4H15A 4PS0A 1WY5A 3BTOA 2PRSA 4JOQA 2MOKA 2N1BA 4S1TA 5EC8A 2I91A 2O59A 4X1IB 4LJYA 4P3PA 4AIRA 4DYVA 3DQQA 1C9NA 1A2QA 1QVVA 1A9QA 2JVKA 5HTKA 3VZSA 5CG1A 2GXAA 1Z4QA 3LO5A 4X8MA 1B8UA 5HHTA 5JRDS 1WDMA 1G63A 2GRAA 5F23A 4B6GA 4ZQCB 2YIVX 3QM1A 5AXAA 1L5NA 1TIBA 2QL7A 1VHQA 1YS6A 5ALMA 4R16A 1JSLA 3BIOA 3KAQA 5IBPA 3F4LA 4GLBA 2TS1A 3COVA 1BXKA 2VYVA 4HDAA 2VK1A 3DAFA 3HBMA 1RPAA 3O8NA 1Y1QA 1VI6A 3ORFA 1G3IA 1T5DX 3IAM1 4HTAA 3SIPA 4BFCA 1MG5A 5TT0A 5IVHA 3RSCA 3F5DA 5C4GB 3UFXB 4I4NA 1UPFA 1CUGA 2QW0X 4QAJA 1VMKA 1WCYA 1Y9EA 3E0XA 3BOSA 3IDSA 1QRSA 1E20A 1ILWA 4JJGA 1A4RA 4ZGGA 1N1DA 3NUGA 4G0ZA 3Q3JB 3RK1A 4HUQB 5DVZA 3U44A 1DADA 2HF9A 1NN3A 3A8TA 2RJOA 3SZUA 1C0IA 1CRPA 2CVQA 1DJQA 1GZVA 2Q5OA 2VLBA 3TMYA 1WQ3A 3OQVA 3SIRA 1JLSA 3IAHA 1EFRA 3JQ8B 5A71A 3ZI7A 1GTJ1 2Z5GA 4Y2QA 5CPFA 3D43A 5BN5A 1SBNE 4D8TA 1RU3A 2ID8A 1ISPA 4HN4B 4HL6A 1M2JA 4IDCA 5DRYA 5FUXA 1Y3HA 1CXZA 2AEEA 4LJSA 3GJYA 4YK7A 4DM7A 1RMQA 5CJJA 5FTJA 3VZRA 1QGOA 3AP2A 1ABEA 4V2UA 4HRXA 4JYPA 4PC6A 4QQRA 4I19A 1OFUA 2E1RA 2G5CA 1E2MA 3ME5A 4MS4B 2FE1A 4PLTA 3W6NA 2QJTA 3K9WA 4KAXA 2II6A 3ECSA 3UAOA 1WB4A 4AJ1A 2I8AA 4BP1A 4UUQA 4X24A 4BCBA 2FKAA 2Q0SA 4FJ1A 3LCRA 1P44A 1RHMA 4HY3A 5JCZA 2WT8A 2D4HA 2OGWA 3QEBZ 1DO0A 5TS2A 3BCSA 3M1IA 1BGWA 2FH5B 3LM8A 3WLSA 5LMZA 1EINA 1BCSB 4Q39A 1T5BA 1I33A 1QUFA 1PU2A 1DTSA 1CQXA 1YTLA 4CEJA 4HAXA 4Y6GB 3E1GA 2IV3A 1CEQA 3AUXA 1FMFA 4WY5A 5EMLA 1NU6A 3DNMA 1GKKA 1OROA 2YJZA 3G8YA 3V1LA 1G6KA 1ZQ1A 2QA5A 1L5GB 3KJFA 1MLDA 3K8YA 2AG1A 2JAQA 1JJBA 3LHKA 3TQCA 2JBWA 5BNZA 4IDEA 3T12A 2ZE6A 3B85A 1L8OA 4J7CA 3TJRA 3PXCX 2OXFA 2Z8YM 4LZWA 4DMUB 5JNLA 2J32A 2O0LA 1Z4LA 2HQRA 2FZ4A 1KR5A 5E6UA 2K2WA 3HI6A 4HJRA 1ZHOA 1V9LA 3WYFA 5EYPB 3DBIA 5CR9A 3MJVA 4N3GA 1GZSA 1H2XA 2ODAA 1QKJA 1YHYA 2ZBRA 4YCAA 1WXWA 1PV1A 4UUAA 4DMGA 1X39A 2OT3B 3GT0A 1N2OA 3TLJA 2ONYA 1T4DA 1IAVA 1CUEA 2BKLA 1FRFS 1Z22A 1ZOOA 2EV9A 3RC1A 4DNQA 1GARA 5K0FA 5CCBA 1CY1A 2NAFA 1M34E 4JUAA 3MG9A 3K31A 3QF4B 3UH0A 3MCUA 3MJDA 4LZOA 3GLFA 1XJWA 2O8EB 2F3PA 3RI3A 1W47A 3DA8A 3IMEA 4LV8B 4L28A 2EDAA 2PLRA 1W9MA 2QP4A 5CNKA 1F7VA 1TPYA 3SWWA 1CF2O 3IBYA 5DHUA 2FUEA 4CHTA 1TEHA 5I8WA 1NKTA 4XEHA 4CTMA 3UJ9A 5JRZA 1Z2CA 3VQTA 4BVEA 1A95A 2H0AA 1TRKA 1E6CA 2GNPA 3A3NA 3ZY6A 5HOQA 2HM7A 1QO9A 3ASUA 5L4NA 4DLBA 4OM8A 1XPRA 3UW3A 4II7A 3SD7A 2O8FB 2GHTA 1FXUA 3CM0A 4DUGD 2ZU6A 1IOWA 2JIMA 2UUCB 3KLOA 1PQ4A 4JMPA 2DCUA 3TLKA 4FYJA 4CUZA 1LJ8A 4N40A 2H08A 1WTAA 3K73O 1NA5A 4Y6QA 1FP4B 5AK6A 3GLHA 3VR0A 4CI0B 4ARZA 4DDHA 3ORYA 2CYAA 4RPHA 3LUAA 3HA3A 1BOFA 1DAOA 1E2FA 1Z5VA 2QLJA 2RGYA 2XT6A 4CEIA 1KFEB 3H5IA 3BQMB 3QUBA 3GRUA 1ONSA 3UK7A 3BDIA 5MN6A 3O3MB 2YV4A 5BW6B 4NH0A 5BMOA 3T38A 2PUDA 1LDBA 2NU9A 2Q9CA 2GPWA 1LTHR 2FFRA 2EX1A 5ELXA 2GCGA 4PN7A 1JR3A 2AHRA 3IXLA 1U0NA 2PK3A 2XTAA 1EP1B 2WJYA 1AD2A 3ZGVA 4DZTA 3BGSA 3D7NA 3L6BA 2F9FA 1GKIA 1SO8A 4BQSA 2VQDA 2YYSA 3Q85A 3R6LA 5EQFA 3D7KA 2PH3A 5E6RB 4AX8A 2MWMA 3UGQA 4XVQA 2RC6A 1NW9B 3PJGA 3V4SA 1AOXA 4MQMA 5IXJA 1P74A 1Z4JA 1SG6A 1WB6A 1PK8A 4DLLA 4DEVA 4G97A 3ENNA 3MB8A 2VF8A 2B5OA 1JNXX 1NBMA 2XMQA 1Q44A 1Z0UA 3EAQA 3G2PA 4MV8A 4OXQA 3OPYA 3DE5X 4YV2A 5LD2B 3A14A 1VPEA 1Z0KA 4MQBA 4OQEA 4LMRA 5BVGB 5FOUA 1C0LA 2R96A 1Z35A 4KBFA 5C1IA 5C32A 3IMKA 3LC0A 5TC4A 3VU0A 4DUZB 3NASA 1ABFA 1H2BA 2X3YA 3VI4B 3BXHA 2X2FA 5CFRA 4BC0A 1MMFB 1P6QA 2FPKA 4V1CA 1AKNA 1KDYA 3BG5A 4M0MA 3MYYA 4KOAA 4L0DA 2HB6A 3QYAA 4Q18A 5IP5A 1SNYA 4RQAA 1Q92A 5KVQA 2IEZA 2NTVA 1GUAA 3BRSA 3FFTA 1YR8A 5JPCA 3PNYA 4NULA 3JALA 4WN9A 2XMCA 4IVPA 5JNTA 1L2TA 3ZDQA 4DNXA 4CXMA 1G55A 1BFDA 3FKSD 1EFPA 2YC2C 4AX4A 3V8QA 1OXBB 2BGUA 2OG2A 3EVEA 1FB5A 3G8CA 1VE5A 3GLVA 3HDYA 5E38A 5ER9A 2ZJFA 1Z8FA 2YZMA 4L02A 5F77A 1GRVA 1KR2A 1QVZA 2PUHA 5JZOA 3JD1A 2LVBA 3D3NA 3LUGA 3MINA 4U6QA 1F2UB 1BMTA 3KR9A 1G2IA 4KQFA 2H4FA 3OMWA 5KS2A 5AHOA 1FFEA 1JQ5A 4OI2A 5C53B 3A2LA 2ZI3A 3VKFA 4LA4A 4LVOA 3NUQA 2I1QA 2VHEA 2ERCA 1I36A 1ACJA 1CQIA 4Z4QA 3O82A 5E4JA 2OZLA 3OPXA 2AEMA 3L8MA 1ECPA 2D5AA 2XDAA 4RE6A 1OPRA 1YACA 3K9CA 2FP4A 1SKBA 1M6EX 1VSTA 4U7TB 2A3RA 4FNMA 4ZEWA 3F5FA 1AKMA 1CPYA 2XQKA 3FMFA 3O74A 1MF7A 5EKDA 5BSFA 3PPIA 1JHXA 1JZTA 2A0FA 4MJLA 3WG9A 4WGFA 3ZE0B 4EA7A 1TE2A 1LRKA 3OJLA 4HN2A 5EHQA 3RUPA 3F67A 1ZESA 3EYWA 5EUBA 2JAXA 4G8DA 1O96B 5IN4A 2DVMA 1TOAA 5J5AA 3A58B 3DBLA 3BHJA 4R2KA 1XZNA 3E2PA 4Z54A 3OZTA 4TSRA 5TQJA 1GAQA 1S1CA 2W2KA 1JB9A 3G02A 1W4AA 1TFUA 1WBJB 3EXG2 1QPGA 3G79A 1WPXA 4KLCA 3TZQA 4GG1A 2Z04A 3TEJA 1N5MA 3CXRA 3SKYA 3VUFA 5JAMA 2UZ0A 2XDQA 1ZBQA 2KBEA 4YAJA 3NFRA 2CJWA 1S1MA 4FI3C 1KE1A 3NIGB 2BFDB 3WRWA 4DA9A 5L3SB 5LWHA 4B43A 3AF3A 3CCBA 5AM0A 4QPNA 5JFGA 2B82A 2NAPA 4JP1A 4C4SA 2AEJA 3FHLA 3Q3HA 4ZKDA 2DT5A 5K2OA 4JB0A 1YHZA 2J33A 4GZ6A 1E2GA 2WM3A 3T0GA 1NE2A 1T4CA 3GZNA 1N2IA 2RGGA 3GD5A 3KVYA 3AZOA 1PN3A 2AUNA 3F6SA 3O92A 2VP2A 1DTEA 4LWPA 4BU0A 2G08A 3WLAA 3E4DA 3ZGNA 3D3WB 3VKVA 3QELA 4MS3B 3C7DB 3C43A 1Z9BA 2X0EA 5JH7A 5JSZB 1TCVA 1OTHA 1TVCA 2XTJA 5KJEA 5KNBH 3RS4A 3K70D 1KAGA 4J1TA 2AF4C 1OJLA 1E6KA 3TTSA 3BCRA 2G77B 1PR2A 3BD9A 4PONA 1VBNA 3OT1A 3BWXA 3R5JA 1JG2A 2QRVA 1MABB 1BVRA 3FUCA 4LS3A 2WD7A 2GKSA 3JAKB 3DMHA 4TMWA 4GQIA 3QWHA 1B8NA 4MP6A 5DBEX 1FMLA 4ZQIA 1C30B 3TR0A 5CDHA 4EW2A 3REGA 3KEFA 1KDRA 2P9HA 4D9GA 5A02A 3K0CC 4RTLA 2BR4A 1OKKD 2EQ5A 4NEHB 5E1DA 1AF4A 2ZREA 1J7JA 4WKNA 3EVDA 1Y8QB 2WJ4A 5HJ5A 2W6ZA 4J0FA 4ESEA 2M32A 3OLZA 1NXQA 5JECA 3GN1A 1FDRA 1KSJA 4C29A 4YA6A 1P6XA 2AXQA 3RS7A 3FYTA 3ZWOA 4ZOLB 4EIWA 5LMUB 5FI5A 1J9EA 1GZ7A 3K9LA 4D3DA 4NPAA 4O4IF 3SYRA 4TWBA 1MV5A 4KYUA 3SBXA 1DG3A 1N8SA 4JYMA 4X41A 4ISCA 3SXUB 1RLUA 1V8ZA 4I5GA 2QYHA 2WRZA 3IVXA 3L84A 1M2VB 5DX8A 5HUHA 2WE8A 4ZEVA 3QI2A 1E2IA 1VM6A 3QFSA 3OHSX 1Z5NA 2PWAA 4L0CA 4M8SA 2B92A 2C4HA 5DX0A 4G24A 5A1JA 5KQPA 2ZRMA 1L7EA 1SURA 1DPFA 1ZIXA 3DE0X 3I6QA 2ZW9A 4TUYB 3RHTA 3ET5A 5TQ2B 3VBEA 3VPHA 1P2GA 3OTGA 1G8AA 4AECA 1E0KA 2VATA 1ZWLA 3IA2A 4KMMA 3J7TA 3KYCB 1ID1A 3L8EA 3QITA 3W9BA 1CEEA 5AM2A 1MO6A 2GUGA 1TW3A 1GNVA 1Q7RA 1J25A 3ISVA 3QEOA 1X7YB 1SVSA 1YOVA 1J6UA 2NZYA 1NNSA 2XMPA 3IAM6 3QLEA 4JVSB 4PFSA 3PGJA 4Q1AA 2C88A 4A8JC 5EJ4A 1VXOA 3DFIA 3KE9A 3A6ZA 4R05A 2ZRFA 4MUKA 1Z2PX 5I6DA 3SPXA 5L95A 3W34A 2A5YB 1SKUA 3WC4A 1BXRB 1NATA 3P7MA 4OVKA 1KOGA 3ROMA 2IJGX 4CLOB 1IBCA 2Y05A 3H3XA 3O7MA 4RJLA 5AI9A 2YNMC 2ZXFA 3KQLA 1JECA 3GPIA 3PHCA 2O06A 2PBLA 2I62A 5FD8A 1RXCA 2QLLA 4YCCA 1RQXA 3GPCA 4QXOA 4JT9A 3VO2A 4YMSA 2RBGA 1KJNA 4DCSA 4XX0A 3DB2A 1BD4A 1EWKA 2E55A 5ERYA 3VSCA 4IIUA 1Z4IA 1Z5GA 4NEGA 4GPZA 2WIFA 4OH7A 4PX9A 5GQSA 3RFFA 3WWCA 4BZXA 3PC6A 3AVWA 3BFXA 3GLGB 3RYFB 3SBEA 2ZQ5A 2A67A 3AJ8A 1NFFA 4NHEA 1NXPA 2FRDC 2VJKA 3NC4A 3MJEA 4V3BA 4B6EA 4PAWA 4BEJA 4HUTA 2XSZD 5IPFA 1WTCA 1UBFA 1CQPA 1LBIA 1RTKA 3OJWA 3GNTA 4HXEB 4Q4AA 4XQCA 4BNMA 4HYQA 3F7MA 2FU5C 5K05A 5ARCA 2FW8A 3F4BA 3V8VA 3AERB 3DBHA 1Y8RB 4Z0NA 3RB8A 2V6MA 1ZL0A 4W63A 4ENWA 5JS1A 5B3AA 1DWQA 2ADFA 5F3DA 2O5VA 3AFGA 4EKIA 4TKMA 1GCIA 1JEDA 2EFYA 2IS6A 4DAOA 1C2TA 4NFSA 4YECA 1DEAA 2EW2A 1G0OA 3IR7A 3FJ1A 3HXOA 2ANBA 4JGGA 5AJHA 2I2WA 3CG0A 4I0WB 4HVAA 2WD8A 3ZYZA 1X7GA 4LFAB 3K0FA 3DMRA 3K0AA 2DOKA 3MAGA 4CIXA 3U1TA 1CR0A 2OAP1 3QU9A 1NG9A 4NJEB 1Q3KA 3G0HA 1RYDA 3P0RA 1DT5A 1Y33E 5F5LA 3C3DA 2HWYA 5LIRA 4TL7A 3FRJA 4M1YA 4WLFA 3AX6A 1FP2A 2WF8A 4RHCA 4N41A 4Q7LA 4QDXA 3DHVA 1ZSNA 2Q8PA 2RB5A 3BVPA 2GRUA 2GJ9A 4KVFA 3ZY3A 4KXMA 3S4YA 4A6PA 1OH5A 1O0CA 4I9GA 1UP6A 3H2JA 4HUJA 1XRPA 2J9XB 5FPHA 1QH0A 1AN0A 3N8DA 3IR6A 1KWKA 5A6VA 1NC1A 1ORHA 1TYAE 3LDFA 2QGNA 2GAOA 3I2HA 3QWAA 2EAUA 4M76B 5JCJA 1TZKA 1VBMA 1NVMB 2XMDA 3CPSA 4TV8F 4EHFA 5FLXA 2W00A 4KFRA 4KIFA 2BGKA 2J9GA 2OORC 4YJKA 1XD9A 3CWQA 3G8BA 1C9MA 4QJ5A 5HUJA 1W1WA 1EVKA 3OPMA 2GASA 2VS1A 2HLPA 2WFZA 4Q24A 5I7WA 3IPLA 2XCQA 1DBWA 2Z2ZA 3N7UA 1S0UA 1WQ1R 2HIHA 1CZNA 3WGLA 3S68A 4W5TA 2IV7A 1V16B 4ND3A 3Q7PA 1D8AA 1FW6A 4UCXA 4QU8A 2WAXA 3OZBA 4NAHA 1VZ3A 4YAEA 2W6OA 1P5HA 1FJHA 2FSIA 3QY9A 5C18A 1NX9A 5DW0A 2UZ4A 1I7PA 3FTEA 1WXFA 3I8OA 3FZNA 3VC2A 4BO8A 1K63A 2HSDA 4MR9A 1IVSA 4Y2XA 2C8JA 3B1KA 3IP6A 3JARA 2GVZC 2I76A 1U0OC 4CCSA 1VJ5A 1CB0A 5J4VA 4Z4EA 2MSDB 2AS0A 1RRPA 1XWIA 3DTVD 5DT2A 4D9NA 1E0SA 1OI2A 1U11A 1VFNA 4FN5A 3F6YA 1NWCA 1JYSA 3LKBA 1LI5A 4GSKA 4TVSA 3U09A 3QVXA 1PJTA 2AXPA 2PX3A 2ZWPA 2VEOA 3VNSA 4BO5A 2XB2A 1U1IA 3MS7A 4GBMA 5CT9A 2FFAA 2JJ1D 1QR2A 1UT6A 3IQEA 4JLDA 5E9QA 1KAMA 3DKVA 1MH1A 4EH1A 3DUFB 3JATA 3E7XA 1ISMA 2HHAA 5DM2A 3GQBB 4I55F 1RHJA 3VGJA 2YVLA 2HCBA 1YZGA 2F3UA 4JJ6A 3DKPA 3BWYA 4L08A 2NU8A 1NG1A 3OC6A 4OHRA 1QIEA 1LDNA 2NO9A 1S89A 4G85A 4RSMA 5LBTA 2J6BA 2C77A 4KYVA 3TTTA 4JOBA 3NC1C 3O1LA 4GMDA 4OYHA 1NYQA 3ZWNA 4BMZA 4U6SA 2FG5A 2I2FA 4BLQA 2IYLD 3RJTA 2Z5LA 1MG0A 1UC4B 4IGEA 5EPOA 4UVHA 1RAEA 3FCSB 4QVIA 3ZHBA 3ZV4A 1ZN7A 2H5EA 2QV0A 3H0CA 2PUBA 1NJFA 1P2DA 4R51A 5SY9A 4XI9A 2FPIA 5JZSA 3QZUA 5DIFA 2G1UA 4IWNA 4E03A 1QK4A 1FXWF 1QDLB 4B17A 5DULA 5BN4B 3VOBA 4OQFA 1N4AA 1DS6A 4D9BA 4EYKA 3M6IA 5DHAA 4PYOA 4CM3A 2V7UA 1H5UA 2HYDA 3OFNA 2PZFA 3M6LA 3O26A 2JIZD 2IEBA 1SA0A 1SUAA 3CO5A 3DV0A 3GJ8A 4FCWA 1LBTA 1OT3A 4Q47A 1AF7A 4HPJB 3RIEA 4DRYA 1AK1A 4Z4FA 121PA 4R7ZA 2IZ5A 4IY1A 1I3CA 2GBCA 3EBLA 1YE3A 1SXHA 2FW9A 3GARA 3HVUA 4NWIA 4QUIA 1BROA 1BRTA 3SC2A 3ZEIA 4AN1A 1II8A 4F2HA 1P17A 1KI9A 3EVFA 1CUJA 1MHPA 2X14A 4BFZA 1XTIA 5J58A 4KXVA 3QX3A 1J1UA 3BKXA 2X4IA 5IMBA 5IS2A 3A1UA 1R6BX 2ZJ6A 3VC3A 2A4MA 1Q7GA 3GXBA 1AQJA 5K0GA 1QQ7A 2XYQA 3PK0A 4HSEA 4N7BA 4OAOA 3OUZA 1QGAA 1AQLA 4JXXA 3ZU4A 1F4VA 1EWVA 4GQAA 3AONB 4BVKA 4EVSA 1KVTA 2J87A 3MC1A 2PL9A 4WKPA 1F3LA 2RJNA 3BRWD 3EUEA 1F4LA 3IDQA 3KZXA 3GAAA 1OTYA 3NC0C 3DCYA 4QYXA 3ETLA 4UAJA 3WL7A 1ETUA 4FJ2A 1K8XB 2DCMA 3AEZA 3KKOA 1EMDA 1F5NA 1CJTC 2YX1A 3CR7A 3RJMA 5KMGB 4KQWA 1CDEA 1A9TA 1WEKA 2EERA 4LJ7A 2HF2A 4IF4A 4K9RA 1T1GA 3IKJA 4EUHA 5H7XA 1SQGA 1MJHA 3B53X 2OBNA 2IZ0A 3AR4A 4UBNA 1ZN2A 1A76A 2WSIA 1ND5A 4ZDKA 1L5KA 2R1ZA 5IM4A 4JJKA 3S2IA 3EIOA 5ALGA 3JWPA 2PT5A 4LHZA 1H1LA 1PYDA 4YLEA 5K8VA 1XAHA 3NT5A 2VAXA 4DUGA 1XZBA 4FOLA 5DJ5A 3TYXA 3ANLA 1V1JA 1SCDA 1Y5MA 3LK7A 5L4SA 1UMKA 4EG1A 4DQLA 3IP5A 4F21A 1EBBA 4XYBA 4HDRA 1NR1A 1QHHB 4TMKA 1LWNA 3GNLA 1TVMA 1AKYA 1X1EA 2PUAA 1MOPA 1YDHA 3G13A 2OCYC 5TRTA 3STYA 3PF9A 4EBBA 5JEDA 1SQ6A 2L0XA 1W49A 1DKUA 4RV5A 2FEXA 1RVV1 2AMJA 3T0FA 5JIBA 5FRDA 2I7XA 3A1WA 2ZXEA 2XA1A 4LF7B 1M67A 1ZVKA 1SUWA 1E1YA 2I65A 1TAHA 3FZEA 3Q11A 3JQAB 1PD0A 1RYZA 3LY5A 1G59A 2PWPA 1UBHS 4HKTA 4Z6KA 5EXXA 4B2YA 2R6CA 2IYVA 4ZV4A 3IOMA 3GUYA 3U56A 2HLDD 4D02A 3GFPA 1T5OA 1UDCA 1Z83A 3AY7A 1N7GA 1EJ0A 3IP8A 3EIWA 1TM5E 3E2IA 1NY6A 1H8HA 2R44A 1XTSA 4IV0A 1ULZA 1ITZA 3OIGA 4HRYA 4K9DA 4M98A 5KYXA 1A8SA 4AKGA 1OX5A 3ANNA 5EHNA 1PT8A 1FLDA 4E1AA 4CN8A 3X1MA 1SOMA 4WOJA 2H52A 3FSRA 3W8EA 2P9CA 3IEMA 2CXSA 2YZGA 2XUOA 5JLJA 3CHYA 3I9FA 3AI1A 1PZFA 3T0IA 3FSGD 5FYDA 1UT5A 3OCUA 4B7CA 3L7IA 5GJWC 2HF7A 4C22A 5KTKA 1V5FA 2F43B 1E3IA 3M2TA 1ZNWA 2WM2A 3K1ZA 4JUCA 4MX8A 3ZW8A 5ADUS 3PD7A 2XUQA 3VDMA 2HDOA 3O1IC 4MRPA 3ZOKA 3C1UA 1E99A 2VNIA 4MP8A 1Z5UA 5B7GA 3SYLA 4MVJF 4P4NA 1ZH6A 4CNQA 2PWBA 1GADO 5BRJA 4B9EA 3U61B 1RXYA 2VJPA 4J4BA 2JW5A 1QP4A 3R8XA 1JFTA 1BZYA 2PMFA 5D6NA 5BQ5A 2YY6A 4AY2A 2B4YA 1ADFA 2DUWA 3I52A 4XUGB 4DL9A 1PLKA 5KTYA 3KQMA 3L7LA 1RPZA 4YV1A 1B0UA 1L1QA 2AVDA 3NOOA 4H77A 1BG6A 3RTCA 5JI3E 1ORDA 2W4MA 2HBRA 3FKSA 4UU8A 3Q3VA 1TJYA 1ZDMA 3T94A 1PUIA 4Y6OA 1PT6A 3CEPB 4F9TA 5CEJA 2B2XA 4XCXA 1D2GA 4D80A 1S6YA 3DFUA 4KVZA 3SOZA 2CYBA 3WQBA 3ETNA 4LECA 3A4YA 5CIQA 2JATA 2PZAA 3CH5A 1CUWA 1KJQA 5HF9A 3ZDZB 3VNVA 4YDSA 1EDEA 1GV0A 3CNEA 3CH7A 3F8TA 4TZKA 1QJ4A 4MITA 1T5HX 1BTOA 5CDGA 5IKXA 5JCOA 1EQUA 5H0IA 1P81A 2PX0A 1CP3A 2P69A 2BGJA 2WTBA 5AVXA 2JKVA 3QVJA 3VX3A 1A9PA 4B75A 1DMRA 3UOGA 1PKEA 2XUKA 3H42B 2I33A 2H1HA 3O4RA 4WESB 2PDAA 2BKXA 4XUEA 5A0FA 4EDFA 4FGSA 4P31A 5IZ4A 5K8JB 2Q0XA 2IH5A 3I2FA 4AJ4A 5ALSA 1NRIA 2Z8ZA 1MORA 1QV6A 1G21A 5CEFA 5IJ9B 5HKKD 4JC0A 3RRFA 4IFEA 4ZU6X 1G2QA 1T4MA 2H65A 3T8YA 1PT5A 2C5FA 4F8JA 1D8TA 3KYDB 2REBA 5K0LA 2IHZA 2XUJA 2UV8A 3H9BA 1RCUA 2A9KA 1ZXBA 2F00A 3GA5A 5JVDB 3QJYA 1R9JA 1ADBA 3EJ6A 5SY6A 4JDUA 3AG5A 5THKA 6Q21A 2XKKA 2ZULA 3G9QA 4MB0A 1VLVA 3FH0A 3PUZA 4KFUA 3IP3A 4MRNA 3U9SA 5DX1A 3K1YA 1Y3BE 1IIRA 1Z0ZA 1ZCBA 2I2XB 3JSXA 2D54A 4ID3A 4MKHA 1PBTA 4FVTA 4YMIA 1YB5A 2OO7A 4MYCA 3IQHX 5FT9A 3LZDA 1RBMA 5CVEA 3ICVA 5B3KA 3OI7A 1ZLYA 1YZLA 3LLMA 3O4HA 3IOBA 5JS2A 4J6FA 1DO2A 4ARAA 1WUIS 3Q5GA 4GX1A 4MUXA 4EGCB 4F6RA 5BOSA 3KLMX 3IL2A 3BGWA 2HLHA 3AEYA 3FY4A 4UARA 4BAZA 2GZHA 4JOCA 2JFZA 2FFJA 4OLFA 4RKEA 2JI6A 2OC9A 4TV9F 1ODSA 4AY6A 4BFXA 4FPXA 2NVWA 4NABA 1EX6A 4DG5A 1T3GA 2GAAA 1F6BA 1ENPA 2G70A 1RWPA 2WM9B 2PGIA 2Y1FA 2C2GA 3IB6A 3H1TA 1KMQA 2NV0A 4IXDA 1ANKA 3T9EA 3OP4A 1CUIA 2ZUCA 1DEKA 4P53A 1DB3A 1HQYE 1NOJA 1QGYA 2R6GA 4GD3Q 3OZRA 3W2EA 1NUTA 3BZUA 4KN6A 2WU1A 4OI4A 1ZCJA 1P2BA 2P1DA 1NQAO 5FB3A 2X4DA 3KTAB 1ZXLA 1D5WA 2DFPA 3DW3X 4OY3A 3L3BA 4YUVA 3V7FA 2ZIXA 4QOFA 3ZGZA 1L0BA 4JOSA 1BHSA 1KO4A 2OZVA 4LMPA 1Y4ZA 2GARA 1OKKA 3PE3A 4D96A 1RWVA 2V6GA 2HQOA 4OXNA 2CEKA 2LZ0A 3UOWA 2O8DA 3DC7A 2INGX 1HNZB 1OLSA 1YV9A 621PA 3F8SA 1VMDA 1XJCA 4GO1A 3P2EA 2FMIA 2PGDA 1UAAA 3K9HA 4B48A 4F2DA 1OC2A 5I7VA 2IOQA 2P90A 4YP0A 4TXLA 1NJ1A 4EGSA 3URMA 2BZGA 2ZYSA 3RIMA 3A27A 3TZHA 1WXGA 1S2MA 3KEGA 4FFBA 3KOYA 3QHQA 4FYPA 3SJ7A 4DR6B 3DXFA 5J1SB 3I64A 4LJLA 3AR7A 3CLTD 4YAFA 5IASA 3ISTA 2ZIZA 4R81A 5A4KA 4EVQA 3WAKA 2P1RA 3VSBA 4JZKA 4B87A 2Z43A 3FM9A 3SE7A 2F62A 4TWRA 4O0MA 1IG3A 4TGLA 4Q9IA 1U63A 4L27A 4YQEA 1MZVA 1TJPB 4LHWA 3V34A 4E5NA 2ATIA 2PMCA 3COSA 3LD9A 4F2WA 2XNHA 2C7BA 5EIXA 1C29B 1JL3A 3ZI0A 4E6PA 1U2ZA 5JBNA 1X9IA 1Z0SA 4CDGA 1YUBA 3EJWA 3HCRA 4Z4IA 3VRHA 5ENZA 3LXXA 3VYRB 2NP6A 5AM4A 2R60A 4PG5A 3V5NA 1ILEA 2GCOA 3HP7A 2BVNA 2FN7A 2AG6A 4O4IB 3WMWA 3BE5A 2AHOA 3ZWKA 4KE7A 2Q99A 4LZNA 1Y1PA 4LWQA 2Q4OA 4D8VA 3SVZA 4ZI3A 2WAMA 1ID8A 3UENA 4P22A 1C3EA 1AQIA 2GPJA 5IC5A 4LRSB 2QVLA 4N8EA 4YRFA 4DKJA 2EIXA 1MFPA 1M1YB 3PFHA 1M75A 1UBCA 3DEKA 3S44A 3RAFC 2V54A 3QLUA 4UDYX 1KOLA 2XT9A 3D4LA 3WGQA 3WWDA 4DANA 4WBNA 4RY8A 4F92B 3MRTA 4PAOA 4HZUB 1RYNA 3M4JA 2XBUA 4MW7A 1E0JA 1FYWA 3QWIA 5EP2A 2YWGA 2VZLA 1MEJA 2R8BA 4DEXA 1F38A 4DGQA 5TV2A 1WVMA 5KKAA 4EY7A 4MUJA 2HWKA 2HEIA 1WS6A 4P4GA 2AYZA 2MU1A 1KVRA 2DHRA 4D3ZA 2BMDA 4OGGA 1MIHA 2XSZA 3V8NA 4TXHA 1M6WA 8GPBA 3DEIA 3WFJA 3PQDA 2G6BA 3ODPA 4OFZA 1E9AA 3H19A 3B48A 2FY8A 2FA9A 4XJXA 4IX1A 1MX1A 2O07A 5LYYA 4LE2A 4XCQA 5JXJA 1UEIA 2HC9A 1NYTA 3E2MA 4RWZA 3UAXA 4RPLA 4AWAA 5CX4A 1GIAA 2IU0A 3J80A 1LH0A 4NYIQ 3N05A 5BWBA 1VG9B 2NSDA 4EL0A 3T3NA 1A2OA 3CO0S 1U99A 3EAFA 3DUWA 4PR3A 5J4HA 1Z0FA 5DBHX 9LDTA 2HHHB 1XCGB 4DR3B 1UEJA 3QV1A 1QWSA 3S5JA 2RKWA 5ALFA 2ILVA 4MA4A 4WECA 3U1BA 3MRXA 3I6ZA 3M2PA 2RARA 1R3UA 3KQHA 3THXA 2KLBA 1CY4A 1EFVA 4QO7A 4JLWA 3UWOA 1Q22A 1V2HE 2WJWA 4MYRA 1GUDA 4DA4A 1HLDA 1I1NA 2WDZA 3QPBA 4UZEA 3T5GA 3U7GA 1S3GA 2OQ2A 1XJQA 2O52A 3EZFA 1Z4NA 4QRDA 3NIFB 1DI0A 1E2UA 1AXRA 1C50A 3GUUA 1SB8A 2QRQA 5L53A 2WIJA 3VBCA 5KOHA 1Z16A 4KN8A 3KDSE 4Z4CA 3HYLA 2KHZA 4BUCA 1GY8A 1OWPA 1QJCA 3K1TA 5KI6A 4G84A 4LJ4A 4EB0A 4J29A 4UNSA 1Y5RA 2GERA 4GR9A 1V6CA 1SZCA 2Z57A 1XOIA 4LYAA 4QXAA 3UH1A 4MZDA 4FSDA 1NXSA 3PRKE 3AJDA 1LPPA 1R74A 2EP7A 2XB9A 3AYXB 2ZCVA 4FWIB 4NZNA 4Q1FA 4U2BA 4X54A 3RUAA 3TX2A 4PQEA 2QT0A 3ESDA 5CFZA 2FXVA 2YFQA 4FMBB 3FUVA 1WPGA 4NJMA 3KETA 3FTFA 3ASYA 1IWOA 1LS6A 4I81A 4EGAA 4BPBA 4UDOA 4JX9A 2RHRA 3RW9A 3KKLA 1JXAA 1H69A 1N8NA 4RO0A 4REQA 3AXSA 5HZMA 2D2EA 4NF2A 1KI8A 1KMIY 2W2OA 1O5TA 3A1VA 5B6PA 2CHEA 4TZ6A 1GRCA 2WFAA 3IT0A 3R0XA 5IFLA 5LA6A 5J2UA 1YC5A 1T2UA 2P2GA 2QG6A 4JHLA 4XGQA 2QLNA 1Y1SA 4Q00A 3WLKX 2ZM6B 2DLCX 2O8CB 4UVEA 5A9SB 3EZ6A 5K8TA 3DD1A 4Q34A 4BPRA 1FPMA 3RFUA 4GPIB 4JLSA 2X9NA 5EEGA 1XWFA 4J1TC 1VDMA 2LPMA 3M1YA 3O8BA 4DHWA 1GUZA 5HRUA 4N54A 3DTVA 3B70A 2VRWA 1WB5A 3G5LA 2WNIA 2JK1A 1GGVA 4X8HA 1HK7A 2G6TA 3RSQA 3Q2OA 2JJ1A 1V2GA 4KWTA 4Q15A 4J3NA 2PXAA 3O4VA 5B58T 2UZ1A 3DOIA 5MFZA 5KZMB 2Z83A 3MK31 1K8RA 3V4ZA 1LSOA 1PEAA 1VKZA 2WV9A 1HDOA 1K5HA 3CZPA 4KMSA 3E15A 3C6KA 3U81A 1IN8A 1RWOA 3U48A 4Y1FA 1O0BA 4TT3D 1IXZA 2JANA 4W9NA 3O9ZA 2DSNA 3FA2A 5EUCA 3E7FA 5FQOA 1DLJA 3GLRA 1R0KA 5K09A 2HBQA 3G0OA 2D6FA 4WXEA 1XX6A 2F55A 3LYLA 1GPAA 3DFKA 5I7AA 3FDXA 3D6FA 5D85A 4CMEA 3WXMA 4TMZA 1OYVA 4ND2A 3OA0A 3OE5A 2NNWB 3RKSA 4RKWA 2FHPA 4RACA 4YDQA 2XECA 2JEYA 4IP0A 1PLLA 5G53C 2Q46A 4P35A 1KC3A 3O1JC 4DV1B 1R8XA 5K3SA 3GZ4A 4TQAA 1NI4A 2Q6VA 4EF6A 3GJTA 3UXEA 3ND7A 5KWVA 5KYVA 5JQGA 4P34A 2PUVA 4J6EA 2MSKA 3ADKA 3ND6A 3RYIB 2JCSA 1RLIA 1NQTA 1P75A 2JF0A 2RIPA 3AI2A 3CX7A 1T9ZA 3QJ5A 4GWKA 3MS4A 2VRNA 4UTXA 4JYZA 4I55B 4L2IA 2JIZA 4BNJA 5JNSA 3S40A 2HADA 4FN4A 4YCLA 1GT6A 3HM2A 1DKMA 4G8JA 3X1KA 4EYEA 4UULA 4F56A 1UDAA 5DBGA 2WJZB 3CA8A 4BMVA 2LKDA 3UBTA 2XIQA 3V6LA 4EA6A 2OFPA 4DSOA 3DZBA 4GNRA 1I4OA 3GY0A 1E8NA 3K9BA 1I14A 3AUKA 3IH5A 4TLLB 3RTAA 3WO1A 5KNCD 5BUQA 2XYVA 1C14A 4ZK6A 4J0CA 4H7HA 4TTTS 3I92A 1JN0A 2BFOA 4X0EA 3UGTA 2YTZA 1E8DA 3DWIA 3GJ4A 3GGPA 3SVLA 3QPAA 1YI0A 3M33A 4LYEA 4EHKA 3UXMA 1J8MF 1ADJA 1KI1A 3AOGA 2WHPA 4JEUA 5KYUB 3EEQA 2A35A 4ZDJA 4OK3A 2ZPTX 4YP9A 3AF5A 4BEBA 1QIDA 2P4EA 1OFIA 4LJ9A 2GPTA 2P27A 5AI8A 2P5SA 3D7LA 3KFLA 4LKRA 4RQUA 3B1JA 5FPQA 3UQYS 2P11A 4UEQA 3UWSA 3DLHA 1YB7A 4DC0A 2R2AA 3G2LA 5HF5A 1T2DA 2F64A 3FDFA 5IUKC 1QFMA 1PR3A 3BRWA 2PPLA 3GGGA 3A4LA 3IPXA 4LY9A 1T6YA 5I9NA 1FVXA 1RRGA 2QJRA 4BJ3A 3FW1A 1B6GA 4JC8A 3GA7A 3TB6A 1V0JA 1PX2A 5HIAA 2WZDA 2I6SA 1DQPA 2JFFA 2HPAA 4F4HA 3HDVA 3PU6A 5GZ6A 5C4MA 1NZFA 2A9JA 3UO8B 4AF8A 2C8KA 3IBSA 2AQIA 1UFQA 2NVUA 3FNEA 2HWWA 1BC5A 3HCEA 3CTPA 3OO0A 1YQWA 4MQFA 1LDEA 4XYEA 4O1IA 4D92A 1C7IA 3U4AA 4DT1B 1YRYE 3ZJTA 2HD4A 2UVDA 5HEKA 2WPDD 3HDGA 4R31A 2P9GA 3LJKA 1MXHA 2ZWMA 4UD2A 4Y7CA 5DH9A 3U6BA 1AX9A 2E6UX 4EFLA 2YBEA 2BCJQ 4TRRA 4XB2A 4B6RA 4DPKA 4HJXA 4YO7A 5CEEA 4RTSA 5E6SA 4DCVA 3PSAA 1R15A 4H27A 1XROA 3DWEX 3O5AA 3LK6A 1OLOA 4AO7A 3CG4A 4MUFA 1IJKA 3EXHA 3W90A 1M7GA 2WE7A 4C4AA 5HQ3B 5AVVA 2YUIA 2CLCX 3L8YA 3G82C 2BGGA 4F45A 3ICQB 5A2GA 4U7JA 2V3VA 1MB2A 4IIJF 1GAXA 2BFAA 2Z6UA 1F0NA 3BF7A 4AZ3A 3PJRA 1V6AA 5DT9A 3PTAA 4PQGA 2AMVA 1IAQA 3NRJA 2XTNA 1HLGA 4GR4A 2HLDA 2QMOA 3JQEA 4QATA 3MRVA 1CHNA 1KARA 1MIOA 3HB5X 3L7YA 1HDRA 1X0VA 3UXHA 5CFNA 5L9AA 3T34A 2JHAA 2XHEA 3ENVA 3TQIA 1E5TA 5I3ZA 3A6JA 3RS5A 3JZAA 3H9QA 1E5QA 2EJVA 3DMPA 3PNSA 3Q3EA 3NWEA 5T41A 5UKDA 3T7CA 3H1GA 2R84A 4M7OA 2JZCA 4KUGA 3UG6A 4GMKA 5B4TA 1C1DB 2QMHA 3DHWC 1SUIA 2O2SA 3KJHA 3FSGA 5EUMA 3N2LA 1LX7A 4J07A 5AHWA 3RIGA 4E09A 2NOAA 5EN4A 5CA0F 3L04A 4EMTA 4Q4JB 2ZS7A 4V2IA 1MV8A 3B52X 1A4XA 2JLXA 2IYEA 1H1TA 2O0JA 4PPFA 3AMVA 1EGMB 2GD2A 1O03A 4YJ3A 3T52A 3DL2A 4BJ5A 4MCHA 3LBFA 5DNUA 2XJ9A 1AHHA 2PV0A 5B3JC 3HNPA 3X2FA 3HEMA 4AJNA 1T13A 4NU6A 1W6UA 4MULA 2HTFA 1BWPA 2CDNA 2KYRA 2PSJA 1LQTA 4RK6A 2G9RA 3M34A 3CVOA 4ALNA 3K6SA 2D1SA 3AINA 1ORWA 3Q5DA 3WGZA 5I47A 1Z75A 3I32A 3N8GA 3RVLA 2D2VA 3KE8A 2X77A 4IIBA 4Q3NA 2PT9A 3FSEA 1FNCA 1R4NB 4IZIA 1LRJA 1C3XA 1QNLA 2O1WA 2XUHA 2VHUA 3DE1X 3QLTA 4M8NE 4EKGA 2IL1A 3PPXA 4AL4A 5IKMA 2FZKA 3TOSA 2AC2A 1NBIA 2QZ4A 3GK3A 4MEAA 4X8LA 1V3TA 1C4KA 1GR1A 1Z6XA 4K6GA 1FYDA 1EZZA 1U7DA 4QG7A 4UM8B 3PRJA 4FGUA 4XLTA 5THQA 5KOJA 1KQPA 3T4PA 1ICEA 2JFYA 5DM1A 1VHWA 3WP0A 3TVDA 1ZM9A 2VXYA 1CEXA 1I7QB 5AR1A 4KGVA 4AJPA 1M8GA 3D1JA 2C0PA 1LDGA 2WUFA 4IW3B 4NCBA 5HKKA 1P4SA 3L0OA 3ZGLA 3HJFA 2NLOA 1WJGA 2I7CA 4IG4A 4B34A 1KERA 1QIGA 2BMVA 1QHIA 3R44A 2UXBB 2X7XA 3FTCA 4J0EA 1E77A 2JCYA 3BTSA 3SF8B 4WOKA 3WRYA 2JNWA 3O2QB 3FWPA 4ZKEA 4JUDX 4N4AA 1TK3A 1QPBA 1Y7PA 3OH8A 4LSGA 4OOFA 5CBPB 3V4LA 4Q1BA 1NYLA 2PGLA 4G2NA 1JG4A 4CM1A 5MGNA 4C08A 1QMPA 4JT2A 3R9XA 3OCVA 2QV7A 4OQLA 5AH0A 2COEA 2V58A 4XRRA 3TCKA 3KIPA 2GBFA 1YD7A 2WW8A 4IDBA 3QMPA 4D0SA 4PXYA 4RA9A 4KL8S 3ET4A 3RTDA 1AUXA 1PEKE 3OIDA 1EESA 3OLYA 4HQFA 5B6IA 3V7WA 5EIEA 2JLBA 3DW1X 3D4IA 5AO9A 3RYCA 4AB1A 5ALNA 1PI3A 3BSWA 4JI1B 1EQ2A 1JYFA 2DWPA 2H59A 1GPYA 2WT4A 3ZX5A 1IWBB 4B8WA 3KXLA 5KPJA 3O47A 4MA0A 1U8ZA 4NPHA 1UXGA 3AEQA 3PUYA 4FYKA 4HQOA 2MSCB 2RI6A 3VOAA 1G6OA 3RU3A 2B3DA 5B30A 2XRYA 1MVOA 1PKXA 2IA5A 3EGOA 4N12A 5TJHA 3D54D 4G65A 1UM9B 3KZNA 1ULUA 1DJPA 2ZYTX 4YWJA 4BNKA 4HD8A 1Q1AA 2Z4SA 1HTWA 2BP7A 4YN3A 1TTQB 4EFDA 2E5LB 3V9AA 1CLUA 3FCCA 1VCMA 1YMVA 3SR4A 2DPGA 3IMCA 4RHYA 3PHIA 5G1NA 1DBSA 1ZJ4A 3HCAA 3ONFA 2IE0A 4A10A 1ZA1A 3TS1A 2JIDA 2C4MA 2Q2OA 1ZNXA 3P5SA 2IX9A 3K6RA 1VL0A 2WWYA 5ECDA 2DYKA 4H0NA 1Y1KE 4YQZA 1Z47A 1JJVA 4QGBA 5JWHA 4G37A 3GAZA 3KWFA 1N6LA 1XXHB 3CURA 2DQ4A 2YDYA 4JQOA 2JFGA 4TV9B 3S1AA 3WB1A 4CKEA 5CB4F 4JI3B 3KU4A 4R2MA 2FK7A 1XQXA 2GXQA 3I61A 5H8WA 3DDWA 4TL6A 4E3ZA 3ECCA 5E4TA 3FYUB 2C84A 1SOAA 1V1RA 3HKBB 3N59A 3TLBA 2FMKA 2D2XA 2V3WA 3BFJA 1XAGA 4K88A 3F74A 1BWRA 4WY2A 1SXJB 4HTFA 4WT7A 2FG6C 2OV1A 1DFHA 2GS9A 2VNSA 1WSDA 2XCUA 3KB8A 4IXNA 2X8AA 4RADA 3ELWA 4YMVA 2G04A 4PNHA 1X94A 4NR0A 1KH1A 1FX0A 1ZUHA 2WU3A 2PZKA 3A6DA 2QD3A 2YWBA 4PIVA 4C1NA 1GDTA 2QTMA 3B36A 4AG3A 2B2CA 1H6CA 1GZ6A 1SPXA 2CVOA 2EX4A 3LAWA 5LZ8A 5KDLA 4Z3KA 2VHTA 2QX8A 2PX8A 3HBLA 3CW2A 1HZJA 4B3BA 2GJ8A 4Q3AA 1CYDA 3P9YA 3B8HA 3Q41A 1UMDA 1T2CA 1E94E 13PKA 3F9IA 3Q3CA 1YE8A 1TECE 3IYLW 3AFIA 2ZAIA 3IXMA 4IZHA 4DJTA 2HEGA 2WJAA 3LBAA 2FPMA 1NBEA 3ZE6A 1UKAA 5IABA 1W29A 1ULHA 1CT9A 2DUUA 2ZJOA 3CKYA 4N6NA 1PYGA 1N25A 1QUEA 1G291 1XAIA 2D0OB 1XF1A 1LJLA 1IDOA 1FP7A 1M9NA 2PBFA 2VSNA 2ZVJA 1NXVA 5JJIA 2ZTMA 4KPEC 4BMCA 1AS3A 2QBYA 2VK8A 1ONBA 1WD7A 4NFYA 2XH8A 2XZDA 1JDVA 5I7FA 3OKAA 1G6HA 3PDIB 5TLSA 1QRAA 5F5NA 5HGJA 2FHSA 4QYTA 1AXGA 5K4GA 2F8TA 1Y98A 5TF4A 1Q19A 4FFOA 1R8QA 4JLJA 2CXTA 2IDKA 3DO8A 3LCMA 1XD2A 1DDGA 3WGNA 3SYKA 2Z6AA 4FNAA 3KALA 4MKGA 4BV3A 1J7KA 2YIJA 2QQ5A 3IE0A 2RGNC 4OP1A 3GRFA 4LC9A 4Y1RB 3PRHA 5JO0A 4CLDA 1U0LA 1KETA 4LRTB 2QTRA 5JZBA 3AVYA 2C3UA 4C7OA 4AIIA 1NW8A 2VUSA 3W4JA 4HDSB 4CCYA 5KPDA 1A7KA 2F9LA 1E60A 2RGDA 4A26A 1YCDA 2GI4A 4FYYA 3U5TA 3HWRA 5AHKA 5IDYA 4PC1A 4EG7A 2I55A 2LP4Y 2C3OA 2BFPA 4WK6A 4B40A 4CKZA 5JCOC 5ERXA 2DBZA 5JJ5A 2AZ4A 1BQ4A 4MMXB 1Q0LA 3JVUA 4DRXA 1P0QA 4PZLA 5EL0A 4N01A 1J09A 1X80B 1NVXQ 1EM6A 1PGQA 3ANYB 4EYGA 1DOHA 1P1KA 3I04A 1R4ZA 1E32A 1RKXA 2Q2QA 1BU8A 3IPYA 4UHHA 4B81A 4BWFB 1WULS 3FNGA 4M8IA 1H2EA 2WJHA 3EXIB 3R6WA 3NO4A 2QZSA 4IEEA 1DRWA 2YZNA 4YCDA 5E9JA 2X9LA 2ZB7A 4U7DA 3QXHA 1PWXA 4EARA 1QFSA 1VJTA 3FBGA 3KU1A 2Q3FA 3CNHA 2H3EA 3AP3A 3L7KA 3LUPA 1QS0B 1VB5A 4CN9A 1W87A 4G63A 1D2NA 5A5VA 5CDYA 2J3DA 5EI5A 5JDIA 3PGVA 4DREA 4HF7A 3RGWS 4TKVB 3U40A 2CGEA 5AIAA 1H8ED 5ED4A 3G5UA 4G3XA 1AMOA 3D6MA 4UUNA 2AQKA 4BNVA 1L3IA 1GAJA 3TRIA 1QHGA 1N5OX 3V3KA 4MI6A 1NJ6A 2QXTA 4IJVA 3GX1A 4IMPA 4Z7OB 2GGSA 2JIOA 1RNLA 1I9CA 5KO2A 3EIUA 2C58A 4PCUA 1N9GA 4S1NA 4ZXPA 5FV7A 3L0SA 1P60A 5T57A 5KQLA 1YGPA 4AVYA 3BA1A 4L9AA 4NOJA 4M7RA 3UT5B 4D9FA 2Z2KA 3NS7A 4MWZA 1CP2A 4M1OA 1C0PA 4OSPA 3U49A 3K5HA 2CXXA 2DBYA 3SSNA 4BKOA 3K70C 4HNAA 5LYJF 1T2EA 4MK4A 3CONA 1XQVA 1PR6A 3B5EA 1GPBA 3GRVA 4E5UA 1B6SA 1YWGO 3A6EA 4IEFB 3E7WA 1T5IA 2WU4A 1Q1NA 1QHYA 3GGSA 5JXIA 4A0QA 4Q93A 4TPKA 5J9FA 4F9EA 3BXZA 1W4RA 2J08A 4UNNA 4TWIA 3BHNA 3PQ6A 4IHJA 4Y2PA 4YRKA 1WDTA 1X1BA 3E9ZA 5CVTA 4L50A 3F6RA 4LAFA 1ZWKA 2OV6A 4TTIA 1TJ4A 2XJ4A 2ZDGA 1TQ2A 2C7QA 1JG1A 3AIMA 2VXOA 1PL7A 2CEAA 2FZLA 4C1BA 5C81A 1NUHA 4WDRA 4TT3A 1A77A 5JAUA 2B6NA 2BFBA 1NW4A 1OLUB 1T15A 1YQTA 1NMYA 3N70A 4K87A 1EE2A 1T3SA 2RH8A 2C4KA 1ZICA 4G4JA 3LF2A 1KDVA 3RYTC 3ZX4A 5LR6A 4QG3A 1NF9A 3PI7A 3QEJA 1N3LA 2DR0A 4EFKA 5KCZA 3J81k 3B3JA 1M1UA 3AEKA 3THYA 5THXA 4KVAA 4QJIA 4LZJA 1FUEA 5SV2A 4FYMA 1NM5A 3EAGA 3IV6A 2CFIA 4ED9A 2FZ5A 5CFPA 4B2IA 3H9CA 2R8YA 3K9FC 4ROTA 1ZUNA 2TMDA 2CJYA 1Z08A 1IWPB 1PDWA 4MMZB 2H2DA 4R9NA 1I2CA 3SNKA 4GI2A 1A5BB 3Q15C 3F71A 4A16A 2RD2A 5EVCA 5F7ZA 1YA4A 3R2JA 1JH8A 2J9RA 2ON6A 5FUVA 1TEXA 1WEHA 4MI3A 4DBLC 3ZBQA 1DHRA 5DYYA 3T5BA 3G7UA 2QN3A 2HJSA 1KAQA 3L9WA 3LZ6A 1T9HA 4JI8B 3QKSB 4NENB 1DBQA 2NO4A 4D6PA 1TM2A 3CR8A 3WQRA 2IGBA 3OQMA 1OE0A 1X13A 2WFLA 1PFVA 1VHJA 2GA9A 3BIFA 3KJZA 1T9BA 3DXYA 3BMQA 4S12A 4YC7A 3T5DA 3C5WP 4B0OA 5BW5A 5KNCA 4RX1A 5KTTA 2C99A 1G8SA 1L7AA 1ZH0A 4MV9A 5CW2A 2VLIA 1NVTA 2HA5A 1PGJA 4Y6RA 5CNJA 5FWXA 3MGAA 1V1MB 3S2GA 4RTNA 1Z5ZA 1E1RA 3FJYA 1VOTA 2VWPA 2ZBEA 3BEOA 4BBJA 2GUWA 3CUVA 4NMXB 6CHYA 4S1PA 3C6ZA 2CL5A 1P1HA 3FKQA 1L7QA 4HMPA 4LKOA 1L5HA 4F7DA 1YZVA 4W8OA 5L3QB 4WFQA 2ZCJA 2H1IA 3RWOA 1UJCA 1DQZA 4NARA 2XE8A 2GZRA 1WXEA 2YV1A 1R4AA 4Z99A 3RAPR 4BFLA 5KYYB 5GJCA 3RROA 1FFXB 3M1AA 1I6WA 3PDHA 1XFAA 1O94D 4Z8YA 3NTRA 3OM8A 3T99A 2ZJ3A 4YRQA 3ID6C 2VPTA 3CEMA 1KP2A 1CJCA 1G8YA 3TK1A 1KRXA 3UZUA 4TL9A 3X1XA 4C01A 4U7PB 2CLIB 2QTAA 1SCAA 5JYCA 4DTCA 1YR2A 3LV8A 1JEQA 1DUIA 1MH9A 2AKAB 3BD6A 4J16A 4JODA 2ASVA 2HX1A 2QAGA 1CRLA 1GJRA 4NVRA 1NMSA 1YKSA 4A7PA 1U0FA 1KJZA 2ICAA 4DM3A 1ODIA 2YJ5A 4HS4A 1Z26A 2BM8A 2X8BA 3VNUA 3ICPA 3EGWA 3QVTA 1Q7TA 2WPDA 4FQ8A 4GI7A 3ZY2A 5HSGA 1I2BA 2GT1A 1Q7BA 1QDUA 3QMMA 3VH4A 4AZ0B 1ATZA 3F7NA 3TL2A 4PZYA 5EMHA 2VDWA 4HQ6A 3N58A 4XM0A 2VJMB 2R48A 4N18A 3S7TA 2FWJA 4KE9A 4MHOA 3RUHA 3WOHA 1ODJA 1J21A 3EVZA 1MEOA 1YR1A 4D3SA 3EG9B 3EXAA 3QE3A 1JAYA 1TNDA 3RVQA 3K16A 4M21A 4BNDA 4D57A 1Q0HA 4ADSG 5TT1A 4JQZA 2VH1A 2C03A 5EE9A 4M6WA 3TL3A 1A72A 4KN5A 4C06A 3AKZA 2X76A 4GAEA 3FNQA 1L5LA 2Y99A 3BFVA 4GT1A 2QROA 4HG2A 1C9YA 4I4TB 1OAKA 3F46A 1UEXC 5HCIA 4LZLA 1WSWA 5JD4A 1TT5B 1KXJA 3P2YA 5ECWA 1SBZA 4UFNA 4XGRA 4ZA2A 2IOFA 2XPCA 4RYLA 3IX7A 1DAKA 3ROZA 4Y0VA 3V32A 9LDBA 2QRGA 5FIUA 1P0PA 1MUUA 2JGDA 2XNDD 3HXTA 1QIFA 3C6XA 3ACBA 2WIBA 3V7YA 3W5DA 3L4KA 4ZVVA 1MQ8B 4I1YA 2Q5CA 3C7KA 5EMNA 1V5WA 1QP8A 1Q0SA 3TMAA 3HB9A 4W5NA 4EUFA 2PS1A 1DRVA 4IYRA 4QXRA 2YXNA 4X1OA 4CTKA 4N65A 3H4TA 4RK5A 1P2VA 4BGUA 4PTZA 1E6WA 1U7PA 5F52A 2FEKA 2G7MC 2ZTUA 2IFTA 4FQ7A 3UUWA 1PL8A 5K3FA 3A4MA 1F48A 2C00A 3ZC3A 1VJ1A 4WKOA 4V3CA 3CZRA 1P5ZB 3QKRB 2P6RA 1PS9A 4CQLB 5CB6A 4I4LA 4J1NA 2PYIA 2CC2A 3OZUA 2CLKB 4L85A 2MINA 1RRMA 3II6X 3BGVA 4HNQA 2JHCA 3AL3A 3L92A 3OM0A 4K1XA 1Y3FE 4K26A 5JAOA 4N82A 3GLKA 4TLDA 1V8FA 1TL7C 1K6MA 4GKJB 4DCJA 2WUEA 3FXAA 2WLSA 3OZVA 3KXKA 4FFSA 4GGPA 1HYQA 3GMDA 5AK0A 2PWZA 4AZTA 3G7NA 4GLFA 2I8LA 1A9XB 2F9MA 4MYHA 3T3GA 2RDMA 4WI1A 4UHEA 5CD9A 1X92A 2ZYHA 1G20E 5HVNA 5CYFA 4C0XA 1BH6A 5AMXA 1JVNA 3ZCSA 3JASA 4FT2A 2IE8A 4IZ6A 5CIYA 2ZJ8A 2NUPB 1W59A 4QOJA 1T9CA 1GGJA 1ZITA 3EFOA 4C0JA 4B1FA 4B9AA 4XPZA 3DZJA 2FQYA 2WSBA 3QX8A 1IULA 2YOGA 5REQA 4BRUA 4IVQA 1JSCA 4RY2A 3LDHA 4GXRA 4ZYZA 5FTLA 3QPWA 3WGTA 5AFSA 5BV0A 1HT2E 5JALA 1U4OA 2G82A 1EWQA 1T8YA 5AVOA 5CA0B 2VYND 3FWKA 4W9NC 3ILXA 3S6JA 4AMVA 5ITZA 4L75A 4CG1A 4RPGA 3V55A 4ENVA 3PT5A 4FE7A 3JWIA 4XJTA 1UINA 3SEQA 2Q62A 1SCKA 4CMGA 3M3PA 2YINC 1FY2A 4CMEC 3RC8A 1MB4A 3X3HA 1R9MA 1U8YA 1TD1A 2FPXA 4CLRA 4A6XA 5KX5B 3OCXA 3GDHA 1VG0B 2CL0X 2H18A 3PDCA 4OHUA 1A5AB 4IRUB 2WMDA 2SKEA 4WFKA 1OWLA 1QH1B 3NV7A 4FHCA 1NLYA 3TW8B 3DL0A 3H9EO 4ENSA 2EF0A 4KP7A 3MOGA 3HSYA 5DP2A 4RIEA 5A5GA 1GYQA 2QE7D 4FI3F 3RU9A 4JBWA 4RMIA 1UKZA 2YJ4A 2A59A 2Y77A 4LNUA 4K9KA 2NT3A 3KVRA 2R47A 3NVAA 4WQMA 2HBZA 5ALDA 2FR8A 3VPCA 3ZV5A 3L4JA 2AH5A 5ALOA 1L7NA 3DVQX 4PLYA 2Z30A 1C3JA 2VSOA 4WGGA 3ZU5A 4GR5A 1SULA 2YHSA 3TINA 1RYFA 3CZQA 4FZ5A 2R7AA 4KO4S 4AYXA 3NEPX 4FU0A 1PYOA 1GLNA 1WZNA 5AW9A 3ETGA 2AR7A 1ES9A 3E81A 4NX2A 4PLWA 5JSYA 1KOJA 3WYCA 2G40A 4J4HA 4ERNA 4EA9A 5CK4A 4V1CI 4MLDA 2AKEA 4KX3A 1AQNA 1YZUA 3IESA 5HG0A 4AZVA 2P9EA 1K0UA 2WKQA 3DEFA 1XTZA 4US1R 3LPLA 3ER6A 5AKGA 5KCMA 1BDHA 2DQZA 2ZG6A 3HWWA 2IXAA 1CY2A 1DXYA 1N2XA 1QHEA 1QZTA 2EJTA 3NHMA 3OEWA 3D7MA 4YO8A 2B35A 2D62A 2QD5A 4YHBA 1GPWB 2GZ3A 3P71T 1UZLA 3KK0A 4QOGA 3UB3A 4F2PA 5HFNA 1TDJA 2P77A 3AEXA 3BD8A 4LXXA 2CK3D 2JGKA 3G49A 3OKPA 4CF7A 4RJKA 3V1NA 1LZKA 4Y6PA 3EDYA 3UT6A 1XQWA 3ZKWB 1PG5A 1MOQA 1EAYA 1PWZA 3RS0A 2PUCA 3BYZA 3EYAA 3GGDA 4IQFA 1AN9A 2Q3JA 4MVJH 3LIIA 1OQAA 4F91B 3VHXB 4MGZR 4LRWA 1HETA 2V8OA 1L5SA 1CQJB 2FPOA 2P3QA 3FB4A 1RYBA 3DBRA 4FLEA 1DC7A 5D3MB 2BRUA 3LWZA 3MCZA 4JJ8A 2GDJA 5ALPA 4GOLD 4EB6A 3BT7A 1FFDA 3ANTA 2GYYA 2CHUA 3SZOA 5KTOA 4RNCA 1ZGHA 2X0IA 3I2JA 4K46A 4Z3DA 4AJJA 3VJKA 4RA6B 1X3LA 3FHCB 5FO0A 1Z7YA 3G59A 4KIWA 2C8VA 3DMNA 5LUBA 3SGLA 1PV4A 1CZLA 5EPEA 4DJDC 3EDMA 4CFSA 1KTIA 1L7PA 3U3KA 3BMXA 3HU5A 3TEFA 3LHSA 3CSDA 3F2VA 4YLYA 2NUAA 4HQKA 1DOAA 2BAGA 2VSQA 3EXHC 4FT4A 2V6IA 5ALZA 5CM8B 4PCLA 1ORVA 3KTFA 1HC7A 4MUAA 3WJ1A 4CBVA 3WLRA 1SQ5A 5HRAA 1EEHA 3ZHYA 3WV5A 5CLFA 5KQRA 3W6PA 3ZHVA 3EZNA 4XUDA 2B8EA 1TJNA 1B76A 1XQ1A 2NU6B 2RC5A 3QG1A 3QYFA 3Q9UA 3U9LA 4JLUA 4PRZA 4ZYWA 4FGLA 1SOWA 2H2AA 4R1TA 5KSWB 1XVVA 2P1ZA 2VP4A 4D8YA 1P77A 3F9CA 4UNPA 3ILHA 4O4HB 1UPBA 4GYKA 4QEDA 2F90A 5IAKA 3TKLA 2D0DA 3QPUA 2MR5A 1RJ9B 3EFHA 4NZMA 1P9NA 4XR9A 3D0RA 3TRHA 4AO6A 1F6DA 2X3UA 3TG2A 1KZ4A 2R1TB 1V7CA 1V4VA 1T2NA 3DDOA 3HG7A 2DX7A 5CLHA 1ZA2A 4OH1A 3ZJUA 1EX7A 3QKTA 2QZZA 3F6BX 4HGQA 4DDWA 5JHHB 3OF3A 4FW9A 5CLIA 4XWKA 4MW1A 1Y82A 3JZDA 1FX1A 1WV0A 4MYSA 4RVCA 3D02A 4MV1A 3TFWA 3TSCA 5ALXA 2BKEA 1QG4A 1QFXA 1ZW6A 4P82A 1FFAA 4TM8A 3S2YA 1HI9A 1U0SY 4HUQA 3KSDO 2HFKA 4UJ3A 1E1DA 4C6TA 2DT8A 2OFXA 3AKCA 3NGLA 4AW9A 2J59A 2CVHA 3T1TA 2JG3A 4EJSB 1TUGA 3JQ8A 4PX3A 2CMHA 1Z45A 4X3PA 1B73A 1DXOA 4LBZA 4IS3A 3EG5A 1ZFNA 1B0PA 3IJPA 1J2YA 5ED0A 4Z0HO 1W4ZA 3U80A 3ZCPA 1I6LA 2V5AA 3FZYA 3EX7C 1TEVA 5HK8A 4HGYA 2OGTA 2F1IA 1JYEA 2IW1A 4I08A 3KB6A 4IGAA 4MWGA 5I7HA 4BXOB 3AM1A 2WB2A 5AT1A 2Z95A 2Q29A 1Q5PA 5L6MB 4NZ9A 2VJDA 1C9KA 2YASA 4V0ME 5GV8A 4A8HA 3U7QB 1TQDA 3ROFA 4MTCA 1GQOA 4GRAA 4KKVA 3GLIB 1VJCA 4CCAA 3C70A 1W6RA 4RCYA 1U02A 1Y6FA 3GCGA 1IHDA 4EY4A 1A4UA 3U3MA 3V4FA 5B6JA 4IKPA 1XYGA 1CZKA 2OHIA 5CYPA 5F51A 2GVNA 3I53A 1MJGM 1J20A 3C3MA 4GOXA 3UQZA 3C4JA 5C5DA 4RTRA 1ZU5A 2A58A 4HS9A 2IEAA 3RASA 3WISA 5C5IA 4V38A 1U0RA 3X2SA 1RJWA 4IO0A 1T24A 3MGBA 5BW4A 2X8JB 4IOLA 1LBSA 1Z74A 4CT0A 5JSFA 4B3RB 2OAEA 5HP4A 4D25A 4FXPA 5DOVA 2NZVG 4ALIA 1PTKA 1Q74A 3A37A 3EXG1 1M8JA 1JALA 3OY7A 2QL9A 2NU7B 2NZWA 4KXNA 4OL0A 3UMJA 1HE2A 4N7MA 4W1RA 1HZZA 1R37A 4NHOA 4JVOA 2NP7A 1O5IA 2HO5A 3EQ7A 1UJ2A 2O7NA 2ZI4A 1X38A 3ZE7A 5J2TF 5SY4A 2XOKD 2QVCA 1KY5A 1SHKA 2HA0A 3JWGA 3OLXA 3O95A 4Y2RA 4IUCS 3GFVA 2A5JA 3D2AA 4OLAA 1AJEA 4MRAA 1Z5WA 2QVBA 1B0AA 4MSUA 3BMNB 3WRYC 4X93A 5EYPA 5I51A 5BSEA 1IZZA 2MMGA 1XCMA 2W11A 2ZEJA 3LLVA 3VKUA 5IXSA 1F9EA 2DZDA 1H8EA 4B8YA 5IF3A 1N2CE 5JWOA 3EUAA 1D4FA 1YS9A 2X2PA 2V9ZA 3H1FA 4MICA 3KD3A 4I1VA 4QVKA 3ZLUA 2ORYA 3NHJA 5FR2A 3WIUA 5FEUA 3ZWBA 3ON5A 4XAQA 3RT1A 1RC1A 4D9KA 5K6AA 1SBQA 2YY7A 2O3UA 2O8EA 4KQJA 1KDOA 4H6WA 4KAJA 3VZDA 1E0AA 1ADCA 1W1IA 4I9NA 1Z0AA 4N48A 1ATIA 1T0BA 4Q6WA 4QQFA 3UWPA 3ZXIA 4JZYA 5AW6A 5BURA 4M54A 2PV7A 4HXFB 2EXXA 3B3AA 3Q40A 5GPBA 1TZMA 5TE9A 3AIKA 4BFYA 4F11A 4LXUA 4DILA 6GPBA 5HGXA 2DXIA 1LDMA 3PHLA 1YFKA 2GPNA 1Z7GA 3C1OA 4PV7A 3WGJA 2O8FA 2PMWB 5LSAA 4DCOA 3Q9SA 4JI0B 2X0FA 4P93A 1Y6ZA 3L0BA 3L05A 1HA3A 3GAFA 5P21A 1GZUA 1XMPA 3BJEA 1FP4A 3A6HA 4QL3A 1YS4A 3IO5A 4KH1A 2JHFA 4PZPA 5DK6A 1WKCA 1TUIA 1CC1S 1ZW1A 3BSFA 3EVNA 4N03A 1IHOA 5DPMA 4BBAA 1TQ6A 2AX4A 2CNBA 3IT2A 2YVQA 3G17A 5LB2A 4DIDA 3AVPA 4KKXB 1L7XA 3PJEA 1HYBA 1QRUA 2V7QD 3A4IA 3STUA 2D7DA 1JLMA 3CN7A 3MAJA 3MERA 3UJHA 2P9ZA 2YJTD 4NYJR 3EPHA 5DNCA 5A3VA 2JPDA 2WKWA 4V0QA 4X5OA 1QF9A 3AIIA 4KK4A 5H3CA 1W5SA 1Z15A 4LCEA 4ZCSA 3UMRA 2KS6A 3CPJB 1GWNA 2AJBA 1F20A 2IYNA 1KY4A 4MPTA 4BDTA 4PYKA 5LYJB 4MVJE 4EQ6B 4U4AA 3TNYA 4LYHA 1BA2A 1IFXA 3CLTC 5A9RA 4GP6A 2QRNA 1KVUA 4OQNA 2X5OA 2H2GA 3LQ2A 2ZUVA 4GZLA 2P0EA 1D6SA 2H48A 1MCZA 4N0QA 5A7GA 3NEJA 1DSSG 4XSHA 1IVYA 3VMFA 3D64A 1QB8A 1E4OA 4ALJA 3H6GA 1EWYA 3E5MA 4D4JA 3Q7TA 5BVGA 1K2WA 2I66A 1UJ5A 1RJDA 3WGKA 3WTBA 1AGYA 5C3UA 1GSIA 1HURA 1X77A 3UKJA 1QV9A 4B8ZA 5BV1A 4PLFA 4R9RA 3DMTC 1QANA 3BILA 3FLEA 2X8WA 3TI7A 2BPOA 1B2RA 1CF9A 2BOVA 3MWDB 2LW7A 1OFUX 5EFOA 1DJOA 4ITUA 2Q5EA 1GQYA 3ESZA 3RF7A 1C1XA 5D84A 2B36A 1RJEA 1VGRA 4MZXA 5DI9A 1N5DA 3B1ZA 3EK2A 3UJ7A 1NQUA 3OAAD 4P36A 1M76A 3JSAA 3MUNA 4UEOA 2W6CX 4NKRA 3V8RA 1DKRA 1XIVA 2CJXA 3CX6A 4B7AA 1M2OB 2MSNA 3LUBA 3ZZ1A 3O3CA 5DHPA 3OECA 4MYDA 1GNLA 1LC3A 4K81B 4H7KA 2QU7A 2B21A 1JPJA 2B4RO 2EQAA 3L1VA 2YW9A 4LYGA 2B69A 2AX3A 2CZCA 1T8WA 5FQNA 4OHYA 1EXNA 1F8FA 1Z2OX 5KAPA 1Q3TA 4TTSA 2IELA 1DC8A 2AJDA 2YOHA 1TRHA 1ZEJA 1DT3A 3VTZA 3H7IA 1NNUA 2RK6A 1O94A 3HB7A 1I9GA 4I1SA 5BSGA 5JJKA 5KDDA 1FJ2A 2Y1GA 4PSUA 3RYHB 4BLSA 2VKQA 3GFSA 2A0YA 1H0KA 2F1RA 4NV0A 5HFJA 6REQB 2NQ8A 1GT91 1K8YB 1F8XA 2IYTA 2N42A 1M2HA 3BE8A 3DNFA 3ESRA 1J5XA 2IU6A 2OV2A 3QU4A 1NQXA 5T3YA 3RUFA 4GICA 2FSHA 2JLCA 1OX4B 5F9FA 4FC6A 3A6FA 5JCPA 1RM3A 2JI7A 1DIAA 1BEZA 1ZMOA 3M3HA 3M6MD 4V02A 2WIAA 2OCKA 3HFJA 3REQB 1QHXA 2R8OA 5A3JA 1M6HA 1UBTS 1XKLA 2CWDA 3QSGA 1FXSA 4BTLA 2X0KA 1OXXK 2WQZA 1XZGA 3IEXA 3KKNA 3IJRA 1VIVA 2A9QA 1EYZA 5F2OA 5ADWA 1OXKB 2B7LA 3OOJA 4G0NA 4EVIA 2WG0A 1L1EA 1U9JA 1XZQA 2PUTA 5KIAA 2DHCA 4F46A 5L3SA 2BFDA 1J33A 3CF2A 4RXMA 1AUVA 1QDEA 2DR2A 4FYVA 2V4ZA 2QX4A 2IIBA 3G1TA 3NV9A 3M8KA 1ECGA 3HV0A 4MUIA 3UV3A 5DN6D 1WF3A 1KFJB 3LBHA 5LVAA 1KQFA 1C7FA 1X15A 3TAXA 4DR4B 2XNDA 3DMDA 3OHMA 4ZT3A 2EBWA 3HA7A 2BGMA 4KQIA 4UPDA 4W9RA 3WK5A 1W85B 3TKYA 1VLQA 2E4VA 3DCNA 5JDIC 2IPLA 4W5RA 1T3ZA 4NXMB 1JFFA 1GCGA 1QMGA 3D3WA 1NXXA 2E7ZA 2G0AA 2UKDA 3AHGA 1L7MA 1UKBA 1Z6PA 4G23A 4GEGA 3E4CA 2BBSA 2YQ5A 5K8CA 1TF5A 4Q9NA 3AV3A 1YJ8A 4Y3UA 2O2YA 3LT2A 2FKNA 4C7XA 5ALHA 4OK5A 4EHIA 3GL9A 1JWAB 4I14A 2F6RA 1NXWA 1MABA 4RS3A 4AY4A 3ELBA 3AHCA 1S2GA 4JD5A 2IYSA 3NTVA 4PXAA 4V0RA 1RCTE 4N9QA 1TCBA 1C30A 1U80A 4YRSA 1AQYA 3U39A 4OKSA 1N6KA 3FGNA 3EW7A 2ACWA 2PYDA 2AJLI 1VGQA 4EG0A 2PLAA 3OUTA 3OLCX 1E3WB 2GX6A 3FVVA 1YRHA 1PCXA 1AMUA 3IC5A 2QTLA 3C8MA 1E63A 1JHPA 3DAOA 3KT0A 3ROQA 1NVDA 2HA4A 3COPA 4B3HA 2AFHE 4ZOLA 3ADCA 4Q4LA 1Z6GA 1EZ1A 4L0QA 2OHFA 3A70A 4H7FA 4YRDA 3ZV6A 3HTXA 4XFDA 1UFRA 3LXMA 3EGEA 3NBMA 1GNSA 1TVKB 4YUYA 3SC3A 1FW8A 3ETHA 3I5YA 4EDHA 2VEDA 3HY4A 5ECGC 4R8VA 1ZS9A 2WB4A 1EIWA 5F35A 1HQCA 1D2CA 2GNOA 2NSLA 1Q77A 1N2GA 3W1EA 4KDFA 3NBKA 4CL8A 1JTEA 2VZ0A 3Q1LA 4TUYA 3QJGA 3INTA 3QY0A 3TL6A 4B7UA 3LH5A 2VYNA 3EXFA 3TZEA 1QQ5A 1ZUD1 3H4VA 3CPHA 5K1ZA 3UMVA 1J0DA 4B3DA 1GCOA 1I3MA 4BNHA 2GWHA 3KYCA 3W5VA 4BVHA 2HU5A 4G0OA 1HWYA 2Q5LA 1LF5A 3FPJA 2F4NA 3O8OB 5BY2A 1R5BA 1X7YA 3QU2A 4PZ0A 5DZSA 4OXXA 1JTVA 3G88A 1V4NA 2HSEA 2ORWA 1NM5C 5KJFA 1Y9AA 2Q7XA 4TYMA 4NG5A 1O54A 5FBWB 1GGFA 1V26A 1NQOA 2WKRA 3B6EA 3EB9A 1BXRA 2X0NA 2CCJA 2UUOA 3CKLA 3HDTA 5FLYA 4D3FA 3QKUA 3VPBA 2ZT5A 5HUQA 2QRUA 2W6QA 3K30A 4ZU3A 3ZE2B 3DOUA 4DQXA 4DLNA 4CLOA 1XD8A 2QSZA 1BRMA 2VDUE 3SSAA 4HCJA 2QE7A 3A2KA 1M1NB 1YB2A 4OLBA 2Y1EA 5AI6A 1SC4A 4GS5A 5HZHA 4KXWA 5I8PA 3IGFA 4JELA 1VRVA 4KYIB 3KSMA 4LQCA 3NETA 1K92A 2O5RA 3E70C 1JX6A 4LI0A 4XIGS 2CUTA 4DZZA 5IFKA 2WZBA 4UW9A 5CUQA 1VJ0A 3D7SA 5F64A 5HBGA 4UXJA 1QK3A 2ISQA 4E46A 2G4LA 4B3CA 5EWMA 2COKA 3TOZA 1ABBA 3RYFA 1S3IA 1EFDN 1V8PA 3NBXX 3NW9A 3W4KA 3BK1A 3GLGA 3NEYA 1ESMA 1RXIA 2VDRB 3T5PA 1ZJ6A 3G2JA 2KE5A 2I2CA 1E5LA 4PHFA 5H02A 2QM8A 3L8GA 1PEDA 2B5WA 3RS3A 3AESA 4CZ2A 4E6EA 2IS4A 3UG7A 5E9WA 1Y8RA 4A6EA 3PF8A 3ROXA 3B9RA 2I0FA 3FUWA 1SVOA 2CXUA 2EFGA 5U9CA 4M4SA 1SCIA 2FEAA 5ICFA 5JATA 1E2EA 3LKZA 5A4IS 4IJQA 2PKWA 1GZDA 4G0WA 1KI4A 4EUKA 4DN6A 4PX2A 4KE6A 2CK3A 4TTAA 2GZ1A 2XODA 4F6LA 1JR6A 3PQ5A 3OX2A 2IHJA 1A7AA 1AXEA 1R10A 1Z37A 1Z68A 4YROA 2YMLA 1U0HC 4HH1A 1RPNA 3JQFA 4MW9A 1UFKA 2PJZA 5AW5A 2EQBA 2JAUA 5T6MA 3VJLA 1H0RA 2QAGC 1PWYE 4E11A 3WDLA 8ATCA 2QUZA 4NJEA 4RGYA 4Q01A 1EXDA 3HV2A 1SIWA 4H1UA 3AM5A 1M1ZA 2HMSA 3WA7A 4OREX 3OU7A 1CUCA 3RO7A 1T9DA 1Y89A 2GK4A 4DAEA 1Y80A 5H3HA 1C8LA 3R23A 1KEWA 5JY1A 3WGHA 2E37A 3HB0A 3PZRA 4IMIB 4FLMA 4QGFA 1JI0A 3BE4A 4UNQA 1SGWA 1V95A 3OOYA 1FOEB 4ZP1A 5EJ8A 1ISSA 1W2WB 3BXFA 1QHSA 1RHQA 2CVFA 2NXWA 2JD1A 5I4KA 2C7OA 3MLBA 3W1WA 1JU4A 3IAUA 3NMUF 4RF2A 2E82A 3VO8A 5HM6A 1T8UA 4LJ6A 1Y3DE 1FQWA 3ZWPA 4AMZA 5C8XA 1CD5A 3R7BA 1XTPA 2YWHA 4EG6A 1IEWA 2P6UA 3SZRA 5T5QA 2CDRA 1MX3A 3OD1A 3QBDA 4TRNA 2BSQA 1JJFA 3BRQA 1EK1A 3EASA 3LZCA 4D99A 2P65A 3L1JA 4WXHA 5BNWA 4DXAA 1G98A 1T1SA 1MB9A 4TKLA 1P1IA 4POAA 5LPNA 1N4DA 4NZPA 2WNSA 4RDIA 1V16A 1WUKS 3OP1A 4GX2A 4CR6A 4YRAA 2Z58A 1NJ8A 4BMSA 1IXRC 4MCIA 3UJNA 2KB0A 4XM2A 3QUCA 3DMGA 1B93A 1KZYC 3BH6A 5DLQC 2OTCA 1DL5A 4HDNA 2Q07A 2VDJA 2O5CA 2FQXA 3HB1A 5EG5A 2KJQA 1PFUA 2H1CA 3RVOA 1JHMA 4MPDA 4O8CA 1GITA 1QFYA 1ZJZA 2GD0A 4NMMA 2AI1A 1LNZA 2RAVA 2OECA 4NPCA 5AW7A 4MVJM 2JKYA 5ALRA 4KO2S 5TR9A 3PZBA 3DE3X 1OZFA 2V03A 2BUCA 3GZJA 3QGMA 4MQEB 4RAOA 2QGFA 2CSXA 1W5EA 2X5XA 4G5RA 3TCNA 1RKUA 1G3RA 4PYMA 3ZDBA 2V98A 1KTVA 1AZWA 4C0QC 3QEMA 4DSNA 2O1EA 3JY6A 4P2BA 1SKAA 4HFNA 4S0ZA 3WJ2A 3RUDA 3TDNA 4E2YA 4TT8A 1BEUB 1E9EA 1DFIA 4BS9A 4MV5A 5EJ7A 2ZETA 4I3FA 4YJFB 1JWLA 5T8KA 3SQWA 4B82A 3I83A 3CR3C 3IHLA 4JP8A 4MKXA 5KWEA 2XGGA 3CUYA 5FWYB 3PQEA 4X71A 2DFKB 2GN4A 3OZWA 4PG4A 4EENA 2AB0A 3LGSA 1T9GR 4FUQA 2BGRA 2H51A 5FUYA 1PJZA 2DTDA 2SCUA 2AF3C 1YA6A 3G2IA 3OE4A 3PGMA 3U60B 5K8IA 3RH0A 2BISA 1U3CA 3EN0A 4LC1A 5FEMA 5JSHA 5H9VA 2ACKA 1VCIA 2CUZA 2HHJA 2ZITA 1QF7A 3JYHA 1M2FA 1ECLA 3EDQA 3I1JA 5FTKA 2O7SA 4MWDA 1RFGE 1O6BA 3UJCA 4EM6A 3L4EA 4F4DA 3U7FB 4PYRA 3TIIA 4L72A 1AIPA 1BXGB 1TMYA 2QMUA 3FCOA 3IQXA 3Q5EA 2C5LA 2G5GX 4IEIA 2PN1A 1CJBA 1PFQA 4MXDA 4TL8A 5T4BA 3LG2A 2VUUA 3AKDA 1EE1A 3V7UA 1CNMA 3NVMB 2R00A 4MR8B 1H4QA 2H92A 3MFQA 1B8VA 3NAGA 1VI2A 1XDWA 4R69A 1A50B 1FUIA 1KDPA 2VJOA 1MQ9A 4GI1A 3ZQKA 1QG0A 5JBIA 2D1YA 2DG2A 4G4GA 1DPGA 3P9PA 1HNXB 2ID9A 4YIKA 3L43A 2BGLA 2IUTA 3VAZA 3Q4GA 2QTHA 4ETNA 3AVOA 4MCJA 4XASA 2JLVA 4BNYA 2VPWA 3EUFA 3LCUA 2IYFA 2XOKA 3WAGA 1EFTA 2GN9A 1MRNA 2PANA 2V5VA 4TWZA 2XGMA 3DYVA 3QIAA 3LY8A 1FEZA 4FFPA 4I36A 1OVMA 3B6JA 4X6YA 4ZVSA 3V7NA 3DGFC 1AUQA 3P9KA 3ZDFA 4G26A 3C16C 4XIFA 4KDCA 5T3UA 5ARDA 2FR8C 2L19A 5B2FA 2JFWA 3N74A 3F3KA 5DDIP 4ZDWA 5EFZA 3SQNA 2PKYX 2F1OA 1A8PA 1DWOA 1WMFA 1ZK2A 3E82A 3NH6A 1SVKA 4PEVA