2I6GA

Crystal structure of a putative methyltransferase (tehb, stm1608) from salmonella typhimurium lt2 at 1.90 a resolution
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
199
structure length
169
Chain Sequence
b'GMTVRDENYFTEYGLTRTHSDVLAAAVVAPGRTLDLGCGNGRNSLYLAANGYDVTAWDNPASMANLERIAAEGLDNLQTDLVDLNTLTFDGEYDFILSTVVMMFLEAQTIPGLIANMQRCTPGGYNLIVAAMDFPFAFEGELRRYYEGWDMLYNEDVGLRFATMLARTA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative methyltransferase
publication title Crystal structure of putative METHYLTRANSFERASE (16420133) from SALMONELLA TYPHIMURIUM LT2 at 1.90 A resolution
rcsb
source organism Salmonella typhimurium
molecule tags Transferase
total genus 51
structure length 169
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03848 TehB Tellurite resistance protein TehB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2i6gA00
4DZRA 4Z2YA 5FQOA 5H02A 5DTMA 2QM3A 5EEGA 4R6WA 4YUYA 4F86A 4CWAA 1X1BA 3OZRA 2Y1XA 2B78A 3DMGA 4EKIA 3LSTA 4EVIA 1NW7A 1SUSA 4U7TB 3ANXA 3DMHA 3KPJA 3SX0A 3TPZA 1N7JA 3C6KA 3O4FA 5KYGA 2QY6A 2VS1A 5KVAA 2N47A 4PINA 4YUVA 3G2QA 4ER7A 2PX5A 3DXZA 3FZGA 1NW8A 1QAMA 1WZNA 4BLVA 4GEKA 2BH2A 3RW9A 1QYRA 2G72A 5EOVA 4FGZA 1BC5A 1O9GA 4QPNA 1M6EX 1R18A 1WY7A 2AOWA 2YTZA 3G8AA 2XVMA 4HTFB 4KRGA 5U4XA 5K0FA 1DUSA 3BGDA 4CKEA 3FTFA 1WG8A 2ZW9A 2G1PA 3C3YA 9MHTA 2IDKA 4XUEA 4M37A 5EVJA 2FPOA 4L7VA 4IWNA 2P41A 5C9ZA 2ADMA 2OYRA 1JSXA 5FQNA 4PGHA 2BR4A 3KR9A 3A4TA 2YVLA 3OPNA 4GOOD 2ZIEA 3NJRA 5DT2A 4GOMD 4QQKA 1KHHA 1JQDA 4WVLA 3NWBA 7MHTA 1VLMA 2V74B 3FPHA 4KIGA 2PGXA 5CVDA 2I62A 3M6VA 5HILA 3QOWA 3BGVA 4HGZA 4DCGA 3CJRA 3ORHA 3OFKA 3PFGA 1P91A 4E30A 4LG1A 4PNEA 3HA7A 4RTKA 4C03A 2ZBPA 3TM4A 2Z6UA 5FHQA 1JTFA 3MGGA 1ORIA 3EVZA 4E32A 3M70A 5KS2A 1X1DA 3AY0A 3KR0A 4IV0A 2O06A 2PY6A 3KPVA 4KDRA 4DQ0A 2Z6QA 1HNNA 2GH1A 4ER6A 1I9GA 2VDVE 2ZBQA 5D1HA 3SR4A 1XXLA 3T7RA 2BM8A 4EMSA 1RI5A 2PWYA 2R6ZA 2XBMA 5DM4A 5EMMA 2P3LA 4X41A 4RTLA 3EGVA 1I4WA 2UZ4A 3DUWA 1JG2A 4RVGA 5EG5A 1QAOA 3HCDA 1B42A 5BXYA 4PYQA 5IKMA 4BP3A 3NWEA 3EVEA 5EZSA 3A7DA 1FJXA 1XJ5A 3SXJA 1F38A 3DTNA 3CVOA 3PB3A 5LSAA 1RJDA 5E1MA 4GF5A 3JWIA 4FSDA 4X61A 4PWYA 1IY9A 1XCLA 3NTVA 4AZSA 5DX1A 3EVCA 5HEKA 3GRRA 3X0DA 1P1BA 3LDGA 3CBGA 5CVVA 5C0OE 3S68A 5ICEA 1MHTA 3R6TA 1R74A 2XYQA 4FT2A 1WXWA 3VC2A 3FYCA 5ICGA 1YFJA 4CXMA 2CMHA 5ICCA 2YQZA 5E8RA 4QDJA 2AOTA 4H0NA 5EPEA 2UYCA 2NXEA 1FBNA 3I58A 4PYIA 3E23A 3FPEA 3HM2A 3KKZA 3L8DA 5EZQA 1KR5A 1O9HA 3KR2A 5HOQA 3MHTA 3SSNA 4V0RA 4AZVA 3MTIA 1VE3A 2FYTA 3VC1A 1PRYA 2IDJA 3GRVA 3R0QA 5BW5A 3FTEA 3IEIA 3I9FA 3DR5A 5KQRA 4MIKA 2WA1A 1TPYA 3GXOA 3LECA 5EMKA 4BP1A 3GCZA 4KDCA 1RI1A 4BLUA 4RX1A 4CTKA 4O29A 3MERA 3GWZA 2I6GA 2K4MA 4P7FA 5FCDA 3ERCA 1BHJA 1L3CA 2JH9A 4OX9Y 4GUAA 4PYKA 1WS6A 4FS8A 1KXZA 3LX6A 2AOTB 1Z3CA 3BWMA 3OU2A 1YZ3A 3M33A 8MHTA 2ZCJA 1RI4A 1EJ6A 4JXJA 1G60A 4OBWA 3GJYA 2YXEA 1EAMA 3PLAE 4RTQA 5K0NA 4HTFA 2IP2A 4KW7A 4RWZA 2AOUB 3EPPA 1AV6A 3P97A 2VZ9A 3GIWA 2BR3A 2EJTA 2OB1A 1L3BA 1FPQA 3EVFA 1KPHA 2EX4A 5HIMA 2OBFA 5EKXA 2G71A 5FTWA 5HFJA 1WXXA 1D2HA 4GBED 3DH0A 4E2WA 4E33A 3FUVA 2O57A 2NXNA 4WXHA 3LPMA 1JG1A 3SM3A 4DF3A 2FK7A 3E8SA 5LQJA 2IFTA 3DLCA 3AXSA 3KPYA 3P9NA 3BXOA 1YF3A 1G6Q1 3LKZA 3UJBA 3VYWA 5GOZA 2C7QA 3THSA 3OFJA 2HTEA 3BWBA 3LDUA 1QZZA 3DXXA 4PIMA 5K0GA 2QE6A 1F3LA 4KWCA 4HGYA 2B9EA 5LQRA 1P1CA 4P7KA 2F8LA 5CVJA 2Z6AA 2PXCA 2AVDA 3TQSA 3WSTA 3UJ7A 4YUWA 5GINE 4BLWA 2UYHA 2OKCA 3K0BA 4YMHA 2PXAA 4CKCA 2HWKA 3FRIA 3SVZA 3KU1A 3ER8A 3BKXA 1ZGJA 2HNKA 3QOXA 3TM5A 4E2ZA 3AWIA 3LDFA 3FPFA 4QPPA 4QDKA 2ESRA 4M38A 5FA5A 3BWCA 1KYZA 4ZTBA 3TFWA 1YZHA 4ER5A 1NBHA 5T64A 3HVJA 1FP1D 2B3TA 4OBXA 3JWGA 5LQAA 1ZG3A 2AZTA 5E9WA 1ZHFA 2AN4A 2ZTHA 3FPJA 3BZBA 2ZZKA 4MHTA 5GIOE 4K6MA 3G2MA 4C05A 3MQ2A 3EGEA 2C7PA 3UJAA 1L1EA 1BOOA 5FADA 3ME5A 1YFLA 3EVDA 3HVIA 3DULA 2P7HA 1VP9A 2R3SA 2ONYA 4IKPA 4YV0A 2YXDA 5EQJB 5F2NA 3LBFA 3PT9A 5DM2A 2IBTA 4M7RA 3ELDA 3TKYA 2FK8A 5B1SA 1NW5A 1YB2A 3UJ8A 3V8VA 1R6AA 3M4XA 4AX8A 1I1NA 2PBFA 4YMGA 3OU7A 1AF7A 1SKMA 3BWYA 1XTPA 4RV9A 3G8BA 2CKDA 3RIEA 3R24A 1XDSA 5K01A 2HV9A 4CTJA 5FHRA 2OXTA 4POOA 3O31A 3M6WA 4XCXA 4ISCA 5FA8A 4R05A 2PX8A 2XYVA 3A7EA 3B3FA 3LCCA 3OCJA 3UFBA 2UYQA 2HR1A 3EVBA 3GRYA 2PSSA 1ZQ9A 1TW3A 4OQDA 4MQ4A 5DSXA 2ONZA 4E70A 3SGLA 4F84A 3ELUA 5DXAA 1Q0SA 4MWZA 1G38A 1N7IA 2EFJA 3D2LA 5DM1A 5K0LA 4B17A 4RTRA 1U2ZA 3FRHA 3HVHA 2GPYA 5BW4A 2WK1A 5E1OA 3R9XB 1MJFA 2ZZMA 1RI3A 2AS0A 5EIFA 3BT7A 4FZVA 3UJ9A 2H1RA 2JHAA 3GO4A 3LHDA 1KPGA 2P40A 1AQJA 3UZUA 4Y2HA 3HCBA 1VQ1A 3HCEA 2YXLA 5K09A 1NT2A 1R8XA 3GRUA 3SSOA 3E05A 5CCBA 4QQNA 4XUDA 1JQ3A 1VP3A 2NP6A 1VIDA 3TMAA 2IH5A 3OE5A 4E2XA 3E7PA 4PGGA 1UFKA 2AOUA 3I64A 3UJDA 5E1DA 3LCVB 3MCZA 3IV6A 4R6XA 2BM9A 3P8ZA 5DTRA 4E2YA 5LQCA 2V7EA 1X1CA 3P2KA 3EEOA 3EVAA 5K8VA 3MB5A 1L3IA 3C3PA 5EEHA 5JR3A 1XVAA 2I9KA 1D2GA 3A25A 3AJDA 3ID6C 3TLJA 5HIKA 3BUSA 3GNLA 4FT4A 1NBIA 4ER0A 1P39A 1INLA 1OR8A 3PX2A 3LGAA 3HA3A 3IYLW 3V97A 2ZWAA 2PWPA 3EEYA 4RVFA 3TOSA 5CCXA 3I53A 4C08A 4DA4A 2JG3A 3FTDA 4E31A 4LWOA 1UIRA 3CC8A 5ERGB 5F2OA 1KIAA 3UA3A 4AUKA 1EIZA 5EHGA 1G8AA 3T7SA 1JG4A 3G2OA 2A14A 4U7PB 1L9KA 3KQVA 5E2AA 2C7RA 3RODA 2O0LA 1O54A 2ZWVA 3G5TA 2ZIGA 3I5UA 4LWPA 5GM1A 2ZFUA 4PCLA 5KQSA 4IV8A 2YR0A 1PJZA 5EHIA 3IHTA 3EMDA 3P9KA 2B2CA 3HP7A 2KW5A 2P8JA 4PYLA 2AOXA 3O7WA 2P3OA 5E8JA 3GU3A 1BKYA 4C06A 2CL5A 3UBTA 3MTEA 3THRA 3P9IA 5DPMA 2ZSUA 1HMYA 3GDHA 2XVAA 4EQZA 2ZULA 1JSZA 4PYOA 2ZLBA 3DP7A 4P7JA 4R8RA 2HMYB 3UJ6A 3KQPA 3H2BA 5CM2Z 3B5IA 1XDUA 3LKDA 1D2CA 1RJFA 5DTQA 4RTNA 1M0EA 1IM8A 1RJGA 4KVZA 1JTEA 4DCMA 2G70A 1AQIA 2NYUA 2AR0A 2YX1A 5CVEA 3UA4A 3C0KA 1KP9A 5K0EA 4AZTA 5K0CA 2NP7A 1SQGA 3VSEA 1VBFA 3G2PA 3P2IA 4PIPA 2UYOA 2ERCA 3R3HA 2IBSA 2QRVA 3KQYA 5FWAA 3PX3A 1ZGAA 3ELYA 4YV1A 1DL5A 5K03A 2CWWA 3HEMA 3MCTA 2I7CA 1UWVA 2XYRA 1T43A 2LD4A 3OZTA 4X1OA 4DMGA 4GQBA 4RYLA 4CKBA 1X1AA 3B89A 5M5BA 3CKKA 2AN5A 4KIFA 2FHPA 2NNWB 4PYJA 4BY9E 2ORED 4QTTB 1NW6A 4RTPA 5GWXA 5E2BA 4PONA 2PX4A 3FPGA 4PCAA 4YV2A 4PYMA 2IH4A 3Q87B 2DULA 5JUWA 3NVKI 1TW2A 3CCFA 4Y30A 4RTMA 3EVGA 4M36A 2PT9A 3EGIA 10MHA 3G88A 5DXJA 2ZIFA 5FULA 3JWJA 5K0BA 5DWQA 1Y8CA 3FUTA 2OO3A 3TRKA 5CIYA 3NMUF 4GC5A 1SG9A 3OU6A 1R8YA 3G5LA 2PJDA 2QYOA 1ZKDA 5DSTA 4RTSA 2QRVB 3ELWA 1V39A 4EKGA 5K0JA 3G7UA 4AZWA 2BZGA 5EIWA 2CMGA 5EC8A 4FSXA 2PX2A 3REOA 4RTOA 2Y1WA 3P71T 2Q41A 1G55A 2G8NA 4YUXA 3KPUA 5E9JA 5LQKA 2VDUE 2DPMA 3FUWA 5F2KA 5HIIA 1RI2A 2IGTA 2ZBRA 5EMJA 2C7OA 3HCAA 5DX8A 2OY0A 2OB2A 5LQUA 2OPBA 1JQEA 1QANA 1NV9A 3NDIA 3LBYA 2NXCA 2BR5A 5FWDA 3HVKA 3SSMA 3FUUA 2WA2A 3KQSA 1R00A 2VP3A 3M6UA 4LECA 5HIJA 2GS9A 4ER3A 5DRTA 5E1BA 1SVUA 5MHTA 2ZVJA 1VL5A 4C04A 1NKVA 1NV8A 2GA9A 3FYDA 3K6RA 5DRYA 5LR6A 3ER9A 3SMQA 5CVUA 1H1DA 1DCTA 4YUZA 3KQMA 1X19A 2NXJA 4RTJA 3A27A 5E9QA 3DMFA 5IH3A 4FR0A 4GOLD 4A6DA 3BKWA 3DLIA 2GLUA 2PVCA 3M6XA 3MAGA 3PTAA 2AOVA 4HC4A 4HRAA 1JG3A 2JHPA 4RVHA 4OA8A 5CD1A 3AXTA 3PS9A 4OA5A 1SQFA 3EMBA 2JHCA 3B3GA 1ORHA 3KHKA 1NE2A 1XCJA 3CJQA 3KPWA 3CJTA 5ICFA 3DOUA 1KPIA 4OQEA 3P9CA 5EKUA 2EJUA 4UOEA 5GM2A 3UJCA 2PV0A 3TKAA 3PVCA 3LL7A 4P58A 1G8SA 3FUXA 2AVNA 4X63A 4PYNA 3G89A 1EQAA 3PFHA 4NECA 5EGSA 3BGIA 2PLWA 2AN3A 2H11A 4HH4A 4MTLA 2ZZNA 5G02A 1EG2A 3HA5A 4GOND 2B25A 3LCUA 3A26A 3C6MA 3HCFA 4GC9A 4HG2A 4HSGA 2P3QA 4XUCA 3NVMB 5K05A 3JWHA 1IXKA 1M6YA 2P1DA 1NW3A 3HTXA 1RJEA 1YUBA 2PT6A 3NDJA 3KQWA 3B7PA 2IH2A 4P7GA 3HNRA 2H00A 4RSRA 5T6BA 1EJ0A 3T7TA 4FP9A 3GGDA 4F85A 2YUIA 3HCCA 5LQNA 3KR1A 4ATNA 4C07A 2GAFA 1Q0TA 2P7IA 3FTCA 3GRZA 3KQTA 2FCAA 3B3JA 3KQOA 3QV2A 4QTUB 4R8SA 2VDWA 5DM0A 3CGGA 5DLYA 2OZVA 2IPXA 5FUBA 5T67A 2O07A 4DM3A 5HZMA 4QVKA 2P35A 1QAQA 1FP2A 3KQQA 1JR4A 4V0QA 1XDZA 5GP1A 5D1NA 5BP7A 4RVDA 4EK9A 4A6EA 3U81A 4QVGA 1SUIA 2JJQA 3F4KA 2PXXA 1VPTA 3Q7EA 4X60A 2EG5A 1N2XA 2FRXA 3NW9A 1KYWA 2E5WA 3OZSA 2O05A 5C1IA 5DX0A 3TR6A 4C4AA 3OE4A 4DKJA 3P2EA 4G56A 5EMLA 5P8WA 3UWPA 3DXYA 2GB4A 2JH8A 3T0IA 2PKWA 5GIPE 2IIPA 5CUQA
chains in the Genus database with same CATH superfamily
3C4VA 3ETCA 4DZRA 5AKEA 5I4KA 5I7HA 5CEEA 4R6WA 4GQAA 3RIHA 5LP6F 2NPIA 4AY6A 4R9NA 2V0GA 1NW7A 1H66A 5FOVA 3OPYA 2X8AA 1EJ2A 1XPOA 1UOOA 2D2VA 4W7HA 4E1BA 1JH9A 4OMFG 1LNQA 1PL8A 4YUVA 2W0MA 3EE6A 4OHKA 3KKNA 2H7XA 2ILVA 5KCMA 3JVIA 4G81A 1R0YA 5D85A 5EY5B 4ZAZA 5AK0A 1HZZA 1VSQA 1EGMB 4XR9A 4AM8A 5HYVA 4XGNA 4HQKA 3AERB 4CKEA 1GYPA 2NVBA 2ZW9A 3AHIA 4MKZA 4W1PA 1CY4A 1TDJA 4M0FA 2P9QA 5EVJA 3UXHA 4OMDA 3I04A 4BS9A 1H3EA 1QRSA 5DE3A 5C9ZA 2ADMA 3AT1A 4KR6A 4QUHA 4PGHA 1K8XB 3TE7A 1WJGA 2CZQA 5JNRA 4IX1A 2AEJA 4OPMA 1KHHA 4UVIA 4LMAA 2GZDA 4FN5A 3RS0A 2IHUA 3WYEA 3WO1A 1NJ1A 4PFJA 3DQZA 1W19A 2I62A 3EG9B 3F4LA 3Q3JB 1UBHS 2Y6VA 2FEXA 3QJGA 4GZ5A 3ZK8A 2H2AA 3IOMA 5IDQA 1DNPA 3PFGA 4FYHA 4MKIA 3NHWA 3GLFB 4KR2A 1RC0A 2GN8A 3HA7A 2ZTSA 3B6MA 3L8GA 3P0JA 2AUNA 3ZNNA 4PLFA 5GVSA 1JTFA 4R81A 1AB5A 1PGPA 1NVFA 5FPKA 1U7HA 4LV8B 1LC3A 4WCDA 1VFPA 2I2FA 3FXAA 4I9FA 4N6OA 4K87A 1M2EA 3OQNA 1N6IA 1YFZA 1B2RA 1PCXA 1WO8A 4OL9A 1V43A 2ZYWX 4TOIA 5ALEA 1SCIA 2R6ZA 2ATEA 3GVHA 3IPAA 5K8IA 3E0XA 1W1IA 3QVGB 2IV3A 3KOWA 2OOKA 4RA9B 1QYXA 1JG2A 3HDHA 2N9UA 1TGYA 1B42A 4OB7A 4KXWA 1I3CA 1F38A 3DTNA 3WQRA 2A5LA 3B1WA 3SYTA 2J48A 1CY1A 3QENA 4M83A 1RZRA 3W2EA 1A8IA 5HEKA 3GRRA 4MARA 4R83A 3I3SR 5BOVA 3GNSA 4KKVA 4RIFA 3AEXA 3AP2A 2XBUA 3CX8A 5JATA 3WGYA 3PDIA 1R4MA 2I71A 2J5BA 2OQ2A 2J0QA 1LPBB 1SB9A 1H6CA 3FFWA 5JDCA 1G98A 1XZNA 2J45A 2NXEA 1PR1A 3FA2A 3MTAA 4N5IX 1V1RA 2RKBA 4IINA 1OBHA 1V8PA 3LOQA 3Q9LA 1B00A 2DBQA 3MWFA 4GWKA 3TL3A 3OICA 1D4FA 2IVZA 4TXNA 3PR2B 2V7QA 3AOEC 4LZJA 4PPFA 5EWLB 5KAMA 3X2FA 4EY5A 1HG0A 1P29A 3LRTA 4Z1MD 2PUHA 1VL1A 4PZCA 2QAGC 3HN7A 3QUSA 4FFLA 2WHPA 1C2TA 3URMA 5JLJA 4CEIA 4I4IA 1OBFO 3GDWA 3VR5A 3ZZNA 2DLDA 2I8CA 3EDQA 3QUCA 1OPRA 4K6FA 5H83A 3U17A 3X1DA 1QFMA 1S3GA 3H6HA 4F3KA 5JTTA 1ORDA 3IKLA 3KWJA 2YZGA 4LMBA 2GASA 3FZNA 3KVNA 2NADA 3B38A 1CUGA 2R6FA 2KYRA 1K7EB 4NU5A 2R47A 1Z5VA 3FNIA 4N18A 2PS1A 4RS4A 1Q91A 4TLMB 4B4UA 4X91A 2NO6A 2HXYA 4DUZB 3HDVA 2JLYA 1F5SA 1EB8A 4R1TA 1DINA 3HGQA 4FLFA 1ZVJA 3VR3D 4F4IA 1LDBA 5SYNA 5DGCA 1EBUA 2C1ZA 4J0CA 4O63O 3N74A 4Q37A 4RYDA 4ZDKA 2A9QA 4DR7B 2GBLC 3P2MA 3PGMA 3C7AA 1Y4ZA 1YZKA 2QLMA 4N0QA 4YAGA 4QOGA 4IY1A 5BWNA 5KB3A 1U0JA 5DHUA 3QBEA 3EQ6A 1F06A 3I9V6 2REQB 1YDGA 4KFSA 3EVFA 1JHMA 3JPWA 4LHWA 5E7MA 5KJ1A 2R11A 1NYTA 1SURA 1Y1TA 3ZIAD 4E33A 3DH0A 1KVUA 3E3OA 1Q83A 4CIWA 3ND6A 1XRQA 4EYSA 1J21A 3R5XA 5B3JC 2WINI 1O2DA 2EP5A 1O97C 1EBFA 2AA3A 3SM3A 3E8SA 1HORA 2EFCB 2OFOA 4IVQA 4RENA 4U5QA 1R7RA 2YJ6A 3WFIA 1BMDA 2ZAIA 1LPPA 5G4KB 3EQZA 3IUMA 5TQJA 1ZDMA 2ZJ4A 1U5BB 2HTEA 3L41A 3SZ3A 2ZE6A 1HR0B 2O52A 1WW2A 2QL5A 3NUZA 3CVVA 2LTAA 2YICA 3CZPA 1IQ0A 3O38A 3PIDA 1ZGGA 3UJ7A 4BFSA 2ATIA 1XHEA 5CA0B 3K2BA 2XDYA 3PNPA 5AKGA 3ZBTA 5LB4A 3NASA 2HU7A 4EQ6A 3ECCA 2NZWA 3DHNA 4CLRB 1O96B 1SD5A 3QPWA 4QRHA 2OCXA 1U0LA 1F7VA 3RQSA 1MRSA 1VSBA 4NBRA 4A4DA 1YVRA 1XUOA 4UNNA 1DT3A 1UJNA 4EB8A 1EA7A 1KYZA 1DMSA 3TFWA 1P80A 2YOHA 1H65A 4A2WA 4TSFA 4K2AA 2HPHA 3E9NA 4AJKA 3GMSA 1OLXA 1X6VA 5AJVB 1OZFA 4MPRA 1F4PA 5E9AA 2QRQA 3W7AA 4OYHA 3BSSA 5B30A 3LUFA 3SZOA 4RFLA 1FXUA 1GVHA 4F2HA 3QEOA 1N36B 4OB6A 3U7HB 4CFSA 3IVRA 2R68A 2XV1A 4AZ3B 1AS2A 4GH5A 1LK0A 2XNSA 1CFJA 4G1BA 1L6IA 4EF5A 4MW4A 4QYWA 5CRIA 3WMRA 1HFJA 4B4WA 2O2XA 2QMYA 3FDJA 3NDRA 4YROA 4DBZA 3SQXA 3A06A 4KN5A 5L3SB 1Y80A 2YWXA 2Y1CA 2YVQA 5JD3A 3ROXA 3WISA 4YRNA 4AKIA 1E20A 1GCOA 1N0WA 4MROA 3HR8A 2CVOA 2HV9A 4K1XA 5K51A 2ZANA 3K70B 3KL4A 4MQFB 2PQ0A 3AINA 2NU7B 3QYAA 4FWBA 1P31A 2QVLA 3SEAA 4E70A 4IIJF 3FFXA 2WM3A 3OA2A 1Z34A 3WNQA 4DBLE 1Q0SA 2A0FA 4LF5B 5DM1A 4P3YA 3MS7A 5EUQB 2AW3A 3BHNA 5T4FA 3NVDA 1A27A 5BW4A 3DV9A 3U62A 1PTKA 1UBUS 3LHDA 3GRKA 1Q0QA 3EUAA 5AXDA 5A1JA 3NWOA 3OM9A 4FFMA 3VJKA 2H5LA 4KFUA 3THOA 3TLBA 4BHTA 2JBWA 5AXAA 1LUAA 1IH8A 1YR8A 1Q15A 4OK6A 4AN0A 3CS3A 1YBHA 2C2OA 2P67A 2PQ2A 2R84A 3D64A 3KYJB 3Q72A 2IT1A 2QAGA 2WOOA 2AFHB 3EWAA 4Q05A 2FW0A 2I29A 1YZUA 3LUPA 4L5AA 1PN3A 3QQPA 3AESB 3E7WA 2UZ1B 1RZRD 4NS1A 1UADA 2AOUA 5C2JB 1ZAKA 5LIRA 3K9FC 2GETA 4ZIRA 3UAOA 4DJ5X 2V0CA 3BJZA 3H2ZA 4KO1S 3WLMA 3WLTA 1Y9DA 5DLDA 1JSCA 2QRHA 2XIJA 5K8VA 4AS1A 2WVGA 4QDZA 4CCWA 1X7ZA 2R8PA 3G8YA 3R8CA 4JI4B 1T5OA 1QHEA 1QHXA 2CLKB 2MIIA 2HJVA 4RKYA 4ER0A 4PZ9A 4RVNA 1A82A 1XJWA 1Z4OA 5CT5A 5CXSA 2CV2A 3NWJA 4RFSB 2V7QD 2E18A 3B52X 2J32A 5LP6B 3UH1A 1BXKA 3UA3A 1RHUA 4E4RA 4WJZA 2E1PA 4DGSA 3PSAA 4M8LA 1S2OA 4JT4A 3X1JA 1P5RA 5AWFC 4DLAA 4GBJA 2CWDA 1WUIS 1NI3A 5CFRA 1FNNA 4WJKB 2H9AA 3VR5D 1JG6A 5IARA 5KQSA 1MX9A 1XLUA 2OV4A 4WX2B 3FR7A 1GAJA 2X0RA 1KI2A 2C5BA 2I76A 3P9KA 4O4IF 1QPGA 2JNWA 3QA3E 2P62A 1U4NA 3IA2A 2COUA 4PYLA 4UATA 4C4YA 5EXSA 2PUJA 3MINB 1T5TA 2IXAA 5LCXA 4FM9A 2IEGA 2O1SA 2XMBA 3GU3A 1VHLA 1Y5LA 4KQCA 5E8JA 1VCOA 3W7VA 1NZJA 4ZQEA 4ZVSA 1WZCA 1Z5PA 2WUGA 4ZYTA 2MR5A 1P3Y1 3BDAA 1JP7A 3CEMA 4PYOA 1PNRA 2PO5A 2XZOA 1I1HA 5A5FA 1G1MA 2A9KA 3AFGA 1L4MA 3FMOB 2A5JA 4HHEA 4EO7A 3TLCA 1TC1A 1D2CA 3HU1A 3NI2A 5AIBA 4CGZA 4OOFA 3H3FA 2YDYA 2C4MA 3GJRA 5F7XA 2J3MA 1PV4A 4A23A 3H2HA 5JANA 1JDJA 3C0KA 4H4EA 2C3PA 4IIXA 1GPKA 4S12A 2C5HA 1YRYE 5I9TA 4Z2AA 2GPBA 1BX0A 9LDTA 1EVEA 1SQGA 2RGWA 4JL6A 4H3KB 4RZ2A 1QKJA 4MUAA 4AMVA 3PEYA 1POWA 2XKJE 2YVUA 2G80A 5F7ZA 1E3JA 1PGOA 2ZJYA 3FKSA 3PIRA 2X3YA 3DPSA 1FQWA 1SHUX 1F4LA 1JECA 1CKEA 2G1JA 1KRXA 7REQA 3HDJA 4JELA 1Q11A 2ZVPX 5JW6A 3SS7X 4ARSA 3ZQKA 3DZ8A 1NMZA 2C2KA 2QXYA 4XDZA 4D96A 1EVLA 3K8OE 1PWYE 4ZU6X 4BMDA 4IQGA 2HLDA 1AXEA 3N2YA 3AFNA 1GARA 3H05A 1P33A 4JQZA 4GKAA 1N6KA 4W1QA 1KH1A 1TQ4A 4Z9AA 1R8YA 1HRKA 3L6BA 1JE0A 3WOHA 1DC8A 4MV1A 4BEBA 1XN1A 4EKGA 2CT8A 3RVKA 1U7XA 4TSFD 2W2LA 3IVXA 4NS4A 3CUYA 3RKSA 2VHJA 4X65B 2CNWA 5BSUA 5F98A 3KT8A 3BJEA 3JPYA 1KBOA 5F5XA 4DCUA 5EZYF 1B26A 1NJGA 3OD1A 1AD2A 4G26A 1JLHA 4W5TA 3L7IA 2C7OA 4DDWA 2OB2A 4NH4A 4FFBB 3T34A 2EP7A 3GL9A 5BWLA 1TQ6A 1XEXA 2YOFA 4OQFA 2HU5A 2V4UA 3H5LA 3K3PA 1M0TA 3RVMA 2B5VA 1GAEO 2PLAA 3II6X 2GS9A 3M6UA 4LXTA 3FI0A 2IOFA 4YMUA 1NVVQ 2BFCB 4Q15A 1SC9A 4OHVA 1NKVA 1NV8A 4WD3A 3HXTA 3V5NA 2WFLB 1QGOA 3H4VA 5SYAA 2BMVA 1MFZA 3I9LA 3HJNA 2W83A 1PR0A 3DMFA 1Q84A 2LWIA 5JYDA 4U7FA 4V02A 2QZSA 3TI9A 1P4AA 4NCAA 2GJKA 1RCFA 3RVLA 4BVKA 4IDEA 2QYTA 2LCFA 2WWHA 1T6NA 3W3AH 4HAZA 3TLMA 4URZR 5CLHA 4WCFB 5DGTA 1HX7A 2G1AA 1KPIA 3LP6A 3QI2A 4G0NA 4OQEA 4LDJA 1EEHA 5EWMA 2BPOA 3N8GA 2C00A 2WRZA 3H0EA 4RZQA 1I80A 2CDAA 4NP6A 4DNFA 3IIEA 4QICA 4Q3LA 6NULA 5BRJA 2H16A 3NHZA 4O4LA 2YHUA 3BGIA 3CZ9A 3V4ZA 4D56A 3OLYA 4L8VA 5KBYA 1I3MA 1FK8A 3ZDYB 3LPDA 1WL8A 4UULA 1SUBA 1GZVA 2B25A 2B8EA 3FB1A 4HSGA 1T9ZA 4I4CA 4KR9A 3Q7RA 2B6NA 3DNMA 1E6WA 4FI3F 1GRQA 4IH1A 1L1QA 3WXMA 3EZYA 3EGOA 1T2AA 2J5QA 4D43A 1MA3A 3VYSB 2VTEA 3IT2A 1DBVO 2IIQA 2QRPA 4BEWA 1JEYB 3MOIA 1SKAA 3S7TA 1EUCA 2OBYA 1RHQA 1TUGA 4GP9A 1N8SA 2VK1A 3SYMA 2HH9A 1E98A 3C8MA 2QN3A 4FP9A 4EGFA 2HA6A 2HBQA 5HDQA 3ANYB 2CHUA 3NC4A 4J94A 3IC5A 2P9JA 1GFSA 3TAXA 3EPLA 4YIKA 4OLAA 4Q7KA 3SX4A 4CI9A 1LSJA 4OI2A 3B6JA 2BFPA 2MSKA 2VJOA 4NV1A 2JZOA 3WBBA 2WIAA 4X8OA 4B3XA 4ZHQA 1PZNA 3JQBA 2DKFA 1KI7A 2P9BA 2CD9A 3FBTA 3IO5A 1C9JA 2MSNA 2I6TA 3A32A 3ILYA 4MQEA 3ISTA 2ZYHA 1E8NA 3QTLA 4X60A 3MHPA 4IZHA 4DILA 2NGRA 1U94A 1MIOA 3GV0A 2N1MA 4CDRA 5EMLA 1A5TA 1LVUA 2GZAA 2ZRHA 3M6AA 4JI5B 3RVNA 3CNQS 1CNEA 4C87A 4BRWA 3OLVA 3E27A 5ARBA 1C1XB 4MB6A 3W9SA 2DVMA 3ICQB 4ZEVA 2RE8A 4YRDA 2CBZA 2PX6A 4FHGA 1LXCA 2JGKA 4BNDB 1XZAA 5ARCA 1Y0BA 4YDQA 3MCAA 2PWAA 5F51A 5IM4A 1TJPB 3NRJA 3I2HA 3C6KA 4MJ7A 5FI3A 3LXUX 1KP3A 4CM4B 2JF0A 4GI7A 4MXDA 4HMQA 2VCHA 2VTKA 4A26A 2J6BA 1N9ZA 1N2CA 2OYCA 3Q3IA 1NONA 2XXJA 3BULA 2HOQA 1TYEB 4FGZA 4IWYA 2FDCA 2I2WA 4WASA 5IF3A 2VATA 1WSAA 3BAFA 4OBBA 1NVXQ 3FPAA 1J0AA 2IVFA 4ZOQI 1I7DA 4IKEA 2XQKA 4NDNE 4ESEA 4F0JA 4TXLA 5FA8A 4IIJB 4Y2YA 3CLUC 3SBEA 1YK1A 4IJWA 1JEAA 2AF4C 1G6OA 1FSSA 4ZQFA 2OCBA 4L08A 1Z2EA 1JQDA 4ZKDA 3BWXA 3EXG2 1VLMA 2SCUA 2QJRA 4AN1A 3FKSD 5LPNA 1E5QA 2G77B 1DG9A 5F23A 4K6GA 5ALTA 1QU2A 2WG2A 3W2TA 3ZW9A 1E5VA 2B61A 1Y82A 3KB6A 4JI6B 2OV3A 3ORHA 4WQMA 3TVTA 1P91A 1KJJA 4TT3A 3TI7A 3LA8A 2YJ4A 3GFTA 2WMYA 5CFMA 2XF2A 3O4IA 3TM4A 3OFND 3MGGA 2Y1LA 4PBSA 1ARZA 3EVZA 5CLGA 3VKFA 5C32A 4PCUA 3P20A 2WTBA 3GJ6A 2HLDD 5DB4A 5DBGA 3KYDA 4IV0A 1F3OA 1WBJB 3EMKA 5I8WA 3UG6A 1EZ1A 1FRZA 3D2BA 1G3MA 3DCJA 2FJPA 1A9PA 2PWYA 1OE0A 5H1YA 1QVZA 3ESRA 2W2LD 3X2EA 3PNSA 2P3LA 5A3JA 4RTLA 4BUJA 2CNWD 4M0DA 1NG9A 3IMFA 2VIIA 1H8HA 5K4GA 1QE3A 8ABPA 1SGWA 5TIIA 2WJPA 1PYDA 1AK1A 4YLYA 3RS9A 2RBEA 1E2KA 3CVOA 1RWBA 3CO5A 3ED1A 4UVEA 5DBEX 1YBFA 1CE8B 5E4TA 3HABA 1WQ3A 1YTUA 1TM4E 1S3IA 1K1EA 1C50A 3PCTA 4Q7MB 4FR5A 4X44A 5LZ8A 5JZ9A 2YJGA 4KR0A 5G1PA 5EN4A 1CJSA 1TVMA 4BBZA 1PNQA 4E5NA 2XYQA 1LWOA 2W8BB 1XVUA 2BMEA 3VC2A 2B98A 2XYPA 3A04A 1P73A 3IUNA 3EXIA 1F0NA 2OWDA 2WZBA 2QM8A 1JEQA 3OD5A 4O4IB 1W1UA 4QDJA 1XWWA 1CRPA 4F5ZA 1S1CA 1WOMA 2VXCA 2YIMA 4CIXA 1IIBA 4GI3A 4H7PA 4DGQA 5B1EA 3CRMA 1EAYA 3HFGA 1C4WA 4ECAA 5IJ0B 4HVAA 4X66B 3CCBA 4LQDA 5TRTA 1A72A 5FBQB 1WF3A 3I37X 3ENQA 1IJEA 3GRVA 4URVR 2ORVA 4ZYUA 4LUCA 4BP1A 4XWWA 1TPYA 4LJ4A 1KDRA 4PX3A 4JA2A 4LXIA 3V2IA 2VEDA 4MV7A 3UATA 3DD1A 3K8QA 3HYCA 3U5ZB 3QXGA 4D8UA 1QFSA 1GSIA 1Z0DA 2C95A 2XWBF 5H4GA 1SUCA 3F3MA 1EWQA 1BA2A 2JA1A 4JQSA 1AKTA 2CV1A 4DIEA 4CUJA 3THYA 1VDMA 5J59A 3JQAA 3GDGA 2EW2A 4QATA 4XGQA 1XJQA 1WRBA 2QQ0A 3MQFA 3OM1A 3TUJC 3WGMA 1I10A 3H97A 1IAQA 1X8XA 4I81A 2BFDB 2CDNA 3ZE2B 1W46A 4BMYA 2IP2A 1JDTA 1KMMA 3EPPA 2WE8A 1DX9A 5IW8A 3HDYA 1A04A 1RVV1 5TPWB 1G8MA 4W8HA 2RJNA 5KVSA 4ZCLA 5EKXA 1D2HA 2AUTA 1HZJA 5T4EA 5D51S 1DKMA 5KU7A 2VO1A 1P6XA 1ZMRA 2FR8A 1WOYA 2R4UA 4NG4A 5EE5B 3VYVA 1ADBA 4BB5A 1PYGA 4KWHA 3ELBA 1Z2CA 1IRIA 3QLTA 4U4AA 1PD0A 1PZXA 2IFTA 3DLCA 3HN2A 3MWLA 4S1TA 5JZMA 4AS2A 4DA9A 2B4RO 1PFWA 2QU8A 3LKZA 3NX4A 3VBCA 1P3DA 3HS3A 3HU2A 4UTNA 4JJEA 2GN2A 5AI0A 2N1BA 3T3DA 4XGRA 4JKIA 3FNEA 1Q0RA 3IMKA 2I22A 3H99A 3GRCA 2HT6A 4LISA 1FFEA 2OXIA 4RIHA 2MSWA 4TS1A 2FP4A 2O3JA 2P2YA 4QOFA 5FEUA 2JEOA 5EZYB 4INPA 4RLHA 2XMSA 2WP8J 4IEFB 4PN3A 2H3EA 3TLKA 1NUUA 1VRWA 2WVHA 1ZH2A 2QD5A 3AM3A 2HD4A 3DBVO 2A84A 4UE2A 5CH3A 1CP3A 1S7GA 5AI4A 1QGUB 1XXHB 4QDKA 2ESRA 1IVNA 3OHSX 3UMGA 3N2ZB 2RAUA 3ZNPA 3HKCA 1L1RA 1GA6A 3T94A 5FUXA 2X2PA 3RJTA 2C2YA 1IN7A 3SYKA 4D9BA 4BKRA 3CTPA 3S1AB 3Q15C 3ZCVA 2Z95A 4G1VA 5E9WA 4OGLA 5JJKA 4INAA 1X2EA 3JWEA 4AAYA 1BEUB 1VCMA 1JU3A 2ZZKA 4KMOA 5JHGB 3WZMA 3G2MA 3ZVLA 4M1YA 2C7PA 2GDJA 3EVDA 2REXB 3TGWA 2VP4A 1U8FO 1TTQB 1WCV1 2RGXA 3IP1A 2X2EA 2ZR7A 5ED0A 3ENNA 2JLVA 2HBZA 3G79A 4HDAA 4ZDIA 5B1SA 4PF1A 2VJMA 3D4BA 2FHSA 1HURA 3G59A 3DEFA 4OP3A 1SXJC 2OCAA 2A0UA 4D9IA 1EH5A 4KLCA 1IC6A 2YCBA 3CNHA 4H7HA 4RSHA 1BDBA 4KP7A 2ZBDA 3LSYA 4CIYA 4ISCA 1J1IA 1C0PA 1HFKA 1C3LA 3CUUA 1JHRA 5AW7A 4AB1A 2VF5X 3QEAZ 4OMUA 4TZTA 4TT3D 1AHHA 3HDTA 1YJAA 4J1TC 3LNCA 3TL2A 1U3VA 4IXNA 4YJ3F 3ZUGA 3FB4A 1BJRE 4CMEC 1C7EA 3GLFE 1U2ZA 2CJXA 5IVIA 4QGBA 2PLNA 3NCHA 3DEIA 5CCDA 2GXAA 4Y7CA 4D82A 3GFOA 4XIJA 1TC2A 1Z83A 5KHOC 3VZBA 1ZUD1 2JIQA 1XU7A 1E7RA 1Z33A 3C70A 3JZIA 1ZBQA 3Q7TA 2VNSA 2YWCA 1NI4B 1H8HD 4PZLA 4OL0A 1S2IA 2MINA 2IU3A 3KAKA 4DR3B 1C7ZA 1MO2A 1ONOA 1YCDA 2H92A 2R2GA 5EKSA 4LOJA 1G8KA 3VJLA 4WOJA 2XADA 1RPJA 2Q7XA 3TB6A 2AE1A 4A6PA 2Y2UA 4GYWA 3UMCA 1YGYA 2H1HA 2IF2A 1VECA 4MWTA 1VG8A 1M54A 3CISA 2B8JA 3EIFA 1OBOA 3CNBA 3VYTB 5HK8A 4F1KA 3A3KA 3KHTA 1KQFA 5IAEA 2F67A 5LQMA 1T2FA 1I7SB 1B6TA 3O1LA 1OCEA 5H3CA 1XMXA 1CBUA 4CLOA 4EZBA 4B7CA 4OQLA 2BEWA 2PLRA 3IDAA 3GJ0A 2VBGA 2SKDA 3F9CA 3IYLW 3SC6A 1ZH6A 2BEUB 4R1MA 3DEJA 4G07A 4LZWA 4Y2SA 4IYJA 4AKEA 4L2IA 4R68A 4I5EA 2NP6A 2KWIA 3AKZA 1EIZA 1E2DA 4CM1A 5CBPA 2OK7A 4XOUA 3VNBA 5I48A 1FUYB 1T1GA 1QHHA 4FBGA 3WGKA 2QYSA 2V7UA 2H1FA 4K9MA 1FIUA 2HQBA 1G8FA 1O54A 1RHMA 1IHYA 2ZWVA 1ODFA 4U1RA 1E1DA 3RGGA 4ZEWA 4FNOA 5IYZA 4B3RB 1ACMA 1I6LA 3REFA 3E81A 3NIWA 5EJIA 3U3DA 4OJTA 3QYFA 5CK4A 3Q8XB 2LV8A 1J2JA 3UBTA 1V3VA 3FAKA 1UDAA 3NH9A 4MPTA 4P6VF 2P1RA 5U4QA 1RBZA 2AFIB 4CCYB 1DWOA 3WLHA 1X7WB 4LNHA 2ZLBA 3FCSB 4PIVA 1T3ZA 4UXJA 5LJLA 4DV7B 3F5DA 4U7JA 1ZJWA 1QPBA 2IYEA 1TPZA 4L50A 5K3FA 4HNVA 4CNBA 3W77A 3S5UA 3C2QA 2CF6A 2RBKA 1EX6A 3OAAA 3IODA 3KDAA 2JAXA 4JR1A 3PJDA 1NNI1 3OTIA 4KVZA 1EP9A 4X1YB 3WLFA 2IJGX 4IQ0A 3KETA 1OTYA 1AQIA 1SCKA 2R25B 3I5MA 2YX1A 5TT1A 4BQIA 5IAAA 3UC9A 1UMCA 3UCXA 1KSJA 4ND8B 1K3FA 1XE3A 3O1HB 4GPTA 3VSEA 4LGCA 1GRCA 3O75A 1R0RE 1L5KA 2ZT7A 2I5PO 3E4CA 3FPKA 1X7XB 3A0UA 2M6RA 3NXKA 4GDMA 4F8EA 3NKVA 3J80A 1QU3A 4ZICA 1M75A 4Z0NA 5JCZA 2HA7A 2I66A 3V8EA 2XYRA 1N8NA 3BRWA 1YB6A 1Y9ZA 2HDOA 2LD4A 2WPDA 2ERXA 3FDXA 4C22A 2FR1A 5M34A 1XRRA 3CKKA 4HKTA 1MH1A 4LHYA 2JFYA 2EWMA 5GONA 3UK2A 2BDUA 2R8BA 6GPBA 2ORED 3ZOZA 1MC1A 4OHMA 4D57A 2VWPA 1K8YB 1N92A 3SLRA 3TUIC 1KH3A 3NEYA 3W5UA 1W96A 1PNTA 2ZSIA 5K8TA 3L46A 4ZMBA 4EY6A 4XDYA 3JQRA 3PC8A 4AY2A 1DHRA 2OO3A 4M1QA 1DTEA 1IPHA 3L7KA 2Y27A 4KFTA 5E7IA 1RXVA 2QYOA 3AH8A 4LRXA 4JR2A 3ZV6A 1ESEA 1M2NA 4MI6A 1FXSA 1KDOA 4TS9A 5EJ5A 5HRCA 3H5TA 2CMGA 2OV2A 2C1EA 4LW8A 1ZNXA 2IP1A 1O8CA 1CW2B 1X14A 2PPVA 4HI0E 3M6FA 1F2UA 1R8QA 3G7NA 4YHBA 1LKZA 4IGEA 4YRBA 1HNXB 4RQAA 2D7JA 3Q11A 1MC8A 4X24A 3BRSA 5BN4A 4EPVA 5C3UA 1WM1A 2RB4A 2WYVA 3CSSA 3EGDB 3VMMA 4D8WA 5CG2A 4EHKA 3HXQA 2IY9A 1RKVA 1M6NA 2IY7A 1ZONA 2ICAA 3N2KB 5SZHB 1G7CA 1GOTA 1YRWA 1Z4IA 1KMCA 1NKTA 2J9GA 2XHEA 3EULA 3O4GA 4JVSB 2C77A 4FOPA 3WNZA 1WZEA 3L0YA 4KFRA 2WKSA 4CCAA 2PYIA 1VJGA 3CV3A 3EXFA 2NPFA 4AMYA 4OB8A 3DTTA 4ZP1A 1MTZA 4PLCA 4YUZA 1YWGO 5I7AA 1NQTA 3SJBA 1GSOA 1R27A 2HJWA 5K7SA 2BP7A 5IASA 2NYVA 3L4EA 2D59A 3PTAA 4BC0A 1OXKB 2C8KA 1BO6A 1A5ZA 4IDCA 2CVHA 5JARA 3AUSA 1B93A 3EUEA 1E9DA 3CF6R 4M2LA 4ZT6A 1D6JA 1MQSA 1KK2A 1QONA 2A1UA 2NNLD 2WFZA 1KI1A 3N86A 4OCZA 1EVYA 5GQSA 5HF8A 5I4CA 5FUMA 1FVFA 3CH6A 2RK6A 1MV8A 4MP6A 5KTTA 2PV0A 3D3JA 3IOBA 3EGCA 4TWIA 4DREA 2AVNA 3BGOS 5KCZA 3T3PB 2A58A 2NT3A 3IAHA 1J7JA 1GNQA 1L5NA 4HT3B 4YJ2A 3SHFA 3E1KA 5G02A 1SVMA 4PHGA 2QORA 4RY8A 1W2WB 4MWSA 3LUAA 4D4JA 3KSMA 3R9WA 3C6MA 4I5GA 2AE2A 3GR6A 3R3ZA 2P68A 2DWPA 3NVMB 3SQLA 1V8BA 3WGIA 1IDOA 1LBTA 1PS0A 2EJWA 4RZIA 2PT6A 3PDJA 1C3VA 4H6XA 4O3MA 3CQ9A 4KQJA 3GUVA 5G3ZA 1ZSNA 1B7GO 4G4SP 4G0QA 4HFRA 2BLLA 2BFOA 5HQTA 2A5YB 3EEIA 4OXQA 2X9NA 3GGDA 1GU0A 3KB1A 5KTYA 4HWPA 1QIDA 2WKWA 4GOXA 3TX6A 3F5FA 4C07A 2CNLA 4ZVTA 4IOKA 2BF7A 4KLRA 4QTUB 1TGVA 2GHRA 1SVNA 1E1NA 3V6MA 1H4SA 1NF9A 2G7MC 2OZVA 1UK6A 5T67A 3CB2A 4Y2QA 2J0UB 1RYDA 3F47A 4DLPA 3O93A 4EL5A 3U4QA 2YIJA 1XMOB 3ENZA 5ILOA 3GD5A 1V7QA 2XCRB 1R9JA 2Y05A 2XOKA 1CUHA 3PD1A 2C58A 4L4RA 3DMTC 2PXXA 3PFBA 3TFOA 3DB2A 3BZUA 5ECGC 1FTYA 4JI0B 4HAWA 3A1TA 2MTBA 4TN5A 1DTWA 2OG2A 1M5UA 3PA8A 1QG2A 3LC0A 4TMXA 3ZDAA 1VKJA 2C2XA 2VSXA 3EZFA 3N7TA 4FCWA 4X20B 2I6QA 3H1EA 4MS3B 4BNFA 1NRWA 2IIPA 4DM4A 5B1YA 3EDRA 3JQ9C 1GPNA 2ACKA 4S3MA 2PMWB 5J3JA 1EM8A 2K6GA 2INGX 2Y1XA 1I5EA 1UP7A 1XV5A 4IZ6A 4G5SA 4IHQA 4RD2A 4ZQHA 4PTYA 2HSZA 3AHJA 3L4SO 2AJCA 5TT0A 2ZG6A 3D3EA 1YZVA 4AJJA 1ZH8A 3UWMA 4GU5A 1QZ3A 1XT6A 3PXUA 5DI3A 4ER7A 2PX5A 1U7OA 2R6AA 3DXZA 5F1PA 5I8PA 4JLSA 2BKEA 4PC2A 4RGVA 1Q44A 1EESA 5ALIA 2V4MA 4XEHA 1VJTA 3R8XA 1K89A 3FDFA 2CF5A 3CUVA 1CUCA 3PTLA 1DUSA 1K97A 2Q5OA 1JPUA 1WG8A 5E6RB 5I9BA 2PUTA 2C3OA 1ZR2A 2LXNA 3PFFA 4GR4A 3CPHA 3D6VA 4Q4JB 3KB2A 1SUFA 1PR3A 4XAQA 9ABPA 3EIUA 5FQNA 1TCAA 3PQ4A 4YJ3B 2IBTA 2OZKA 3N2GB 4IDAA 7MHTA 1F1BA 1SQSA 1QX3A 3L0OA 3HDGA 4J1QA 4LK3A 3W5CA 2IF0A 3R76A 5KDDA 3BRWD 4NX2A 3ZDFA 1GAWA 2W2PA 4H1WA 2WPDD 4L3WA 2AKAB 2IYUA 2IEAA 2DXIA 2YS6A 1R37A 4DT1B 5TQ0B 4HNTA 4XEUA 1N4DA 1F8UA 1E92A 3QXCA 4AD8A 1M2OA 3DE4X 3GJ7A 5DNAA 5CA1F 5HQ3B 3RV3A 5L7YA 3F0TA 2CSUA 2LR0A 5L95A 1IVSA 5J9FA 4OI4A 1YULA 3CEJA 3VGPA 1BWRA 1IFXA 2I2DA 2VCEA 2TMDA 1I94B 1ZEMA 3TL6A 4NZNA 5DNWA 4KH1A 1Z7BA 4BNUA 4DQ0A 4M1EA 4QJIA 2HF7A 3GT0A 4Q9LA 1HNNA 3H84A 5AM5A 5CXUA 2VXYA 2VDVE 3Q0EA 3W90A 3T5TA 3K5PA 1RI5A 3EF0A 1Q1BA 1QORA 1ZS9A 3L7DA 2O1EA 3N0RA 4TVKA 3RREA 1NJ6A 1L4NA 3NH6A 3VO1A 2FWJA 4DLRA 5LQDA 4Y2VA 4R0MA 4Z49A 1X0VA 1VYVA 4RVGA 3EPJA 3HHEA 3LUJA 3HU3A 3EVEA 1EDDA 3AGPA 1EUDB 4JLOA 3EASA 4LHZA 2C8LA 1QH0A 3RFUA 3ZE9A 3AR7A 5E7QA 2HEGA 3RVBA 3F4BA 4M8KA 2Y9MB 3G0OA 2DBVO 1LD3A 4BWGA 4AULA 3QJYA 1XCLA 2QE7A 4M3NA 1CSEE 1I2AA 1MO5A 2KI5A 3LHFA 4MKFA 1US8A 4NJEB 4TYQA 5B4TA 5BN5A 3UCFA 2R7MA 4FGKA 4J43A 4J7XA 5GV7A 4BQFA 4NL4H 1ESNA 3TPFA 3BMQA 4BWYA 2VQEB 2HYDA 4HGQA 3DZBA 4EFMA 3BA6A 1K5DA 1VMAA 2A35A 2GYVA 3TXAA 4COKA 2UYCA 4MVWA 3STHA 4XQ9A 4CR8A 4O4JF 1T8RA 1GG8A 2HTFA 3W8RA 4JT8A 1JHUA 2PT5A 1T4DA 2HK8A 4LHXA 3ENKA 5DKFA 4Z7NB 5L6LB 1PDOA 2O5EA 3LY9A 2EFHB 4QL3A 2IDJA 3DDSA 3QF4B 2LZ0A 4HGPA 2G4CA 3L04A 1RD4A 4NEHB 4P81A 1T1SA 3DR5A 4Y8VA 5JAUA 2V65A 1JBKA 4JJ8A 4UFPA 3K0KA 3QX9A 1JDPA 1ML3A 4NWIA 5CT4A 3RRMA 4KCGA 3WB9A 2ENWA 4JHXA 5B6IA 1B0ZA 2Y4NA 3OY7A 4YJGB 4Y3UA 4K3UA 3FPCA 2GCPA 3T7JA 2XB8A 3FOCA 5C7IO 1XAIA 1U3CA 2YWJA 3JAKA 2ADOA 2V7PA 1X39A 1ZRSA 2R8EA 3CUSA 4ZVLA 4NVRA 2ZM5A 1SH7A 1KI3A 3ZIUA 5F3RA 2HMAA 3BG5A 1G60A 3MFYA 2AW5A 2BUAA 3HZZA 2DU8A 2YXEA 2BIFA 4NMMA 4WTOA 3TZCA 1CFZA 4KPUA 3U7RA 1A9XA 1V3TA 3O0TA 5AESA 1M2JA 5FJJA 4EPXA 1ONPA 4G65A 3C15C 4TYWA 1AQ6A 1L3BA 4F7WA 1F8GA 4GPBA 3GY0A 3RM3A 1ZNZA 1QZXA 2ST1A 1T13A 1PQUA 1ZLYA 4MVJF 1KOLA 3PKIA 4U2DA 5IS2A 3R6LA 1U3TA 1XQXA 2DJ5A 3G9ZA 1QF9A 1JG1A 4IVPA 4DDUA 1XQVA 3JAMA 2Q2NA 3U56A 1BVHA 3A3OA 2YV3A 3GFPA 3P9NA 4Q3AA 4RS3A 2X5XA 3BXOA 1ZX1A 4KO2S 2XOKD 1DCMA 2BGTA 3O2SB 1VHDA 4HGNA 3RS4A 5C46F 2HKIA 3L1VA 1QZZA 5E38A 3G2JA 2WQ7A 3UMJA 3VOAA 1JDUA 1XHFA 2X14A 2I54A 1DAHA 2B9EA 1GR0A 3NBXX 3PYXA 3FKJA 4RCZA 4JP8A 4OP1A 5FBRB 4F2WA 3X1MA 4PQGA 1BCRB 4YCJA 4BLWA 5E3IA 4J90A 3TB4A 1YKFA 4QBGB 3PXDA 5EJFA 3RKRA 4PN7A 4H1VA 1MN6A 3BH0A 3N8IA 1ZN9A 3C3BA 4H17A 3ZZ0A 1IHXA 4J7UA 4QUBA 5DBHX 1OH6A 3WNCA 3U37A 4DV4B 3BWCA 1T8TA 3JASA 3QHQA 1XNQB 1TX4B 4ER5A 4QZVA 4JXKA 1V1MA 4TM7A 3NTRA 4Y6OA 4ROTA 4FEAA 4ZI5A 3BOSA 3KKMA 4B09A 1OQAA 5KQPA 1DMRA 2JCVA 4G5OA 4ZO7A 4LZLA 5GIOE 5IVDA 2IYLD 1WXGA 3A1UA 3ILHA 4Q18A 1L1EA 1BWQA 1F2TA 1B0UA 1G5QA 2D2FA 4K8RB 2F1HA 5AKZA 2Q3CA 5HDBB 3TW0A 2B8WA 4Z3DA 4F6RA 1E9RA 1KKUA 4YV0A 3HJBA 5TJHA 4YLGA 1MV5A 1N9GB 3C74A 4S1NA 1GCUA 3X1KA 1VLVA 1YB2A 4LE2A 1CDZA 5HE8A 4X1IB 1U02A 2C5AA 2Y0DA 4CKCB 4KFCA 3V7NA 1DAIA 3C8DA 2BZ0A 3BWYA 5EUBA 3OWOA 1GTL1 4FXPA 1YQXA 8OHMA 2QG9A 5HMMA 2W7TA 1EFPB 1UQTA 1RLOA 1SKYB 3G9XA 3DCNA 4P22A 1LQTA 3HPRA 3JD4A 5ESXA 4Y67A 1SXGA 5EA2A 2HA2A 3TXXA 1G21B 2VDNB 3OQIB 1JSRA 3O83A 1XAGA 1V16A 1K2WA 1ACJA 2D1QA 2XTNA 4QLOA 1OU4A 3L4KA 3PL5A 3JQ8B 3IGFA 3MWGA 4DPMA 4R1PA 1DRJA 2FUCA 3IJPA 4G3XA 3ZE1B 1GPBA 2R4TA 4JB8A 2HSEA 4XARA 5EJ9A 3BXEA 4BV9A 1CTQA 1UM9B 3KEGA 5E1OA 1J23A 4YVFA 1BVRA 3M6LA 3VUEA 1ICEA 5IWCA 4KAJA 2V7VA 3MQ4A 3KHUA 1HYBA 3GCGA 2P40A 3LHKA 3QJ5A 2VPXA 3QVSA 3GF4A 5KJEA 5C8YA 1L1FA 1E3DA 3TUZC 3HCBA 3NBFA 4EW2A 2PEYA 1NT2A 5KOHA 3SSOA 4MI9A 1IHDA 4JLUA 2W71A 1NDQA 5HR5A 1RHKA 3H2KA 1N5DA 2AEEA 5I7RA 4O4HA 3DQPA 1GCAA 1N6PA 1IATA 2GKOA 3LQQA 4H2DA 2BFAA 3PEFA 4J76A 5JO0A 1PJBA 3B9BA 1TJ5A 2QPLA 2QE7D 3F8TA 1R16A 2WSLA 3I64A 3KHSA 4RZ3A 1EU1A 2HNAA 3EYAA 2YMPA 3WKAA 5K3EA 3IAUA 4CHTA 4LY3A 4B7UA 1ULAA 4NMWA 1NW4A 2V3CC 1U9ZA 5BSRA 4G86A 3TINA 1P1KA 1XVAA 5L3QA 4BO6A 2H0RA 1FUKA 4ZZ1A 4HEA6 1PW7A 2PDAA 1WHSA 4JODA 1QZUA 2CXQA 3LGAA 5LDGA 2YWHA 4LCEA 3TBFA 3OEEA 1M5RA 5I45A 3DF7A 1P2SA 3AB3A 4XOIA 3VX4A 1X80B 5DVZA 3VDNB 3PZBA 2YWFA 5B53A 3ZU5A 2XYGA 4TWZA 4CF7A 1GKLA 1R4NB 1W0JA 2C7RA 2BGJA 4IJMA 3VVBA 4KGDA 2GDZA 4LWPA 2ZIGA 5LUBA 2CLEB 3KRTA 3QG1A 3IIMA 2IUTA 1FS5A 1Q57A 2HCTA 4ND5A 2FQ1A 4B3SB 2VQDA 1Q2XA 3NHYA 4LXHA 1UKAA 1NG1A 1MEOA 3CWCA 2Q5FA 4FGLA 3GP5A 3FPSA 3DUFA 3J7AC 3SD7A 1U2RA 2ZIWB 3JY6A 5KJ6A 3UKDA 3BB1A 2AFRA 3ZGXA 2ZCVA 3VU3A 3N9IA 1HMYA 2QL7A 4NNPA 4HATA 3GJTA 1W59A 5CX4A 3GNTA 2VJYA 3DP7A 5AKJA 4FOTA 4ID9A 2IWRA 3P9ZA 1Q17A 3AM4A 4Q16A 1XRNA 2VF4X 4DC0A 3LKDA 1RJFA 1PLLA 3BD9A 3GJQA 2X7JA 3I2IA 3WFZA 3MILA 5DLEA 4BO4A 1GFZA 4CTOA 4ZRDA 4DCMA 4FDAA 2NU9B 1HKUA 4R51A 1R88A 1M8KA 4GXRA 5AXBA 4XVRA 1Z73A 2F17A 1HYEA 1XMVA 4W1SA 1YRAA 4OUDA 4QIHA 3U3JA 5CA1B 1KS2A 2OLKA 2FFQA 3A9VA 3ECAA 2D1FA 3G2PA 4O1IA 3KKQA 4AUMA 4XSHA 4B3FX 3KQYA 2XQVA 3PX3A 2J0EA 4D4GA 3QM1A 2ZJ6A 2X1LA 4UAVA 5IUKC 2GJ9A 4IDBA 2CDRA 4XSGA 5GTDA 2XPCA 1IEQA 5FJIA 2VUIB 5FOTA 1NBEA 2ZVQX 4RQTA 4YRMA 1O77A 1HDOA 1UBRS 2JHGA 2X19A 2W2VA 4J8PA 1X1AA 4MPPA 4XI9A 4YT2A 3OF5A 1CY7A 1OXSC 3GJZA 5CGZA 3SQDA 4EW6A 3UMVA 3H1BA 3Q2KA 2KQUA 3RUPA 5CJPA 1ZZEA 5K8LA 3ZH9B 4KO3S 1L6RA 2B35A 2DULA 5DCWA 5EYPB 1RWMA 3L93A 4N0DA 3OQ6A 2HMSA 3MTGA 5GADl 1WKCA 10MHA 3VNSA 3DBOB 3DYBA 2ZIFA 4LTMA 3U2QA 4RE6A 4WVFA 1CUFA 3OQMA 5CIYA 1DEXA 1ZW6A 5J4HA 1EFKA 1YRLA 1WW8A 2YN2A 3QY0A 4FHEA 4GUDA 3V7FA 3DC7A 2QTZA 5BQ5A 2XMRA 2J46A 4EUSA 5TMDA 3PGXA 1JW9B 3KTDA 4RTOA 3PGA1 4FSXA 1XJ0A 4EJ2A 3UTCA 1CRWG 3ZPXA 2F59A 2R48A 4B33A 1XXHE 3UWKA 2JLRA 2O5CA 1WEHA 1KFKB 1AGYA 4O4JB 3P2YA 5DX8A 4ZVQA 3U60B 4BX0A 1JHQA 1YA6A 2A0KA 3TYXA 2UUCB 1UDRA 1FDSA 1NV9A 1QGDA 4RY2A 5T3YA 2NXCA 1N0IA 3SBOA 2CLLB 1T3HA 3GLHA 4OIFA 1RZUA 1P77A 1WSWA 2XNKA 3ESXA 2ZVJA 4NOMA 3FH0A 3GHHA 4R31A 2VDKB 2WAOA 4KQFA 4M1TA 3ACDA 1G5TA 4R1QA 3VC3A 1G41A 2XNHA 1OROA 3K0FB 1V8OA 3QWHA 4M7PA 5F76A 1BMTA 1DO2A 4UD2A 2X7XA 3DVSX 5BVHB 3QE9Y 2CLDX 4XVHA 1RWXA 4ZGWA 3O7MA 1RABA 1WP4A 3G1WA 1IQRA 3H5OA 3M8KA 3AVTA 1CUDA 5JQGF 1P9LA 4W5JA 3Q40A 3C5WP 2WD8A 4UQLA 3IEVA 3MTDA 1SCDA 2IHBA 4D0RA 1X1QA 4CV3A 3WYDA 5EE0A 2F3RA 2H54A 3E2IA 3BD8A 2D7DA 3KM0A 2GF9A 4DA0A 3NEJA 2A30A 3PVCA 3OQHA 3LL7A 4FFSA 4LAFA 5BT9A 4MYCA 1M1ZA 2TMGA 4Q5IA 5J1SB 5K3OA 4A27A 2J5KA 2JVKA 3C8HA 4A5SA 4P5DA 1RYEA 1KJ8A 1ZU5A 3CA8A 2O2DA 3TR0A 4HVLA 1CY8A 3IDSA 4I1OA 4AMGA 2IP4A 1IBCA 2ZPTX 1CR4A 4XLTA 4XWOA 1PWEA 1O6CA 3ETLA 3JWHA 2Z2XA 3FNHA 1YK0A 3WGUA 3RK0A 4UNRA 5BUCA 2IYQA 1YUBA 3UHJA 2W5UA 1LRLA 3NDJA 3PPWA 4DKXA 1NN5A 5BWOA 2G5GX 3B7PA 1E63A 3L01A 3BXFA 4UU1A 4AYXA 2I3AA 2IH2A 1ZM9A 2V3WA 2JJ8A 3U4IA 3BIFA 1GADO 2UYYA 2YFQA 2FFHA 3DBLB 4C88A 2H63A 2HBRA 2P78A 2WF7A 4D0LB 1EE1A 3Q4GA 4MGZR 2R0QC 4CLHA 3KR1A 2X5KO 3DQQA 2GAFA 2V7BA 4NCIA 1IWPB 1N1EA 1HE1C 2XE7A 1J33A 2J6CA 4IGIA 4TLBA 3SKYA 1JDVA 3ED5A 2FJ0A 4PG8A 2I3GA 3TLEA 4QVKA 1T2VA 4LSWA 1QQ5A 1OF1A 5D1NA 2CLMB 1OAKA 3V1MA 5JY6A 4OHZA 1P7PA 3PZRA 3MWDA 4ZRMA 5PGMA 2J0VA 1W0JD 4QNNA 5EE9A 4FB4A 2J41A 1N2XA 3DDWA 1DIGA 1ULTA 1XZGA 3TRIA 1ZK4A 5DX0A 3VHLB 4ZT2A 5AFSA 3K9LA 4WOPA 3VM6A 3ZN2A 3GMTA 4DZZA 1MGPA 4FE4A 1CVRA 3O91A 1VHWA 1D4AA 2NIPA 4LE0A 1ZM7A 1ESCA 5KYTA 1WXFA 3AY3A 2NV0A 2O1WA 1DC3A 3LSTA 1SUSA 1M7GA 3KUKA 1R2QA 1KEZA 4WPGA 1U9YA 1CDEA 1ZN2A 3D8NA 4G25A 5KWVA 5KVAA 1DKQA 1VL0A 4PINA 2HF9A 3NT2A 4MI1A 3EZLA 4UNPA 4XPZA 5I9MA 1DSSG 2E4YA 3KXDA 3QXJA 4P34A 4Q7JB 4D0NA 2DBRA 3JARB 5K6AC 2YW2A 1VI5A 2AFIE 3QFCA 2JD0A 4KXLA 3G8AA 3IP7A 1KVTA 4KRGA 2F62A 3GA0A 3IXQA 4LGVA 3FI9A 4XRRA 3HXKA 4OQYA 3TQQA 4KX3A 3SQNA 3QVJA 1E2LA 2JIBA 3KD2A 3O74A 3TW6A 4MZDA 1TU4A 2C57A 3BIOA 2ZJ5A 4FFOA 1NUSA 1CUSA 1TMOA 4DL9A 3OPNA 4EOGA 3MWYW 5HUHA 3A58B 4GSLA 4JSRA 4C0QC 4L15A 4BYGA 1Q6YA 5ULLA 3CKYA 4AJ1A 1NMQA 4QREA 3JQPA 4IVRA 3IIIA 3RYCB 2BKXA 1LA2A 4L7QA 4O2AF 2C5FA 1CX9B 1BEEA 4GI2A 3SFVA 1P9NA 2Y1EA 4CIBA 2FSGA 1SRQA 3SICE 1QKKA 1MZVA 5TS2A 3KO8A 3GLIB 4N41A 5IMBA 2E4AA 4WY2A 1PQ4A 1S0UA 2CLFB 3AX6A 3WWPA 4PANA 3PGJA 5AM1A 4BGUA 2DBYA 1LF5A 2GAAA 2EKPA 2P8SA 2QLLA 3CUWA 1B8PA 2JIRA 3E53A 3T1NA 4RZXA 4QBHA 2EGUA 2EP8A 1UZAA 2I34A 2IITA 3F67A 1TA9A 2VDMB 4PG6A 2EIHA 2BM8A 4MQ5A 3H9QA 1SC4A 4HPWA 4CQNA 3I45A 3EFBA 3UXEA 5L4LA 4AJIA 2X4LA 2FW8A 3R7NA 4ENQA 2EATA 2FI1A 4DY4A 3KXIA 4NBUA 3NTUA 1F48A 1XJ5A 2AI1A 2JEYA 2VDRB 3DFMA 3H2SA 3HI6A 4W7SA 4MWBA 4CF5A 2Q5JA 2E87A 1Y6QA 3LD9A 5BUSA 2O8CB 2JBAB 5A1TA 5JJLA 2GUGA 2VH5R 1NUPA 3Q41A 4IUCS 4UFOA 2V98A 4CQJA 4QG3A 2WIDA 1QQAA 1NIJA 2Y0BA 3OPXA 3SIXA 5BMVA 1PVOA 4CM3A 4ZJZA 1B8UA 4M4SA 1R74A 3UK0A 2NZ8A 4MS1A 1CG6A 5CIWA 2AI3A 4DNXA 3VJRA 2ACWA 2PUFA 2X3FA 4R1UA 4UMDA 2ZJAA 1E1QA 1ISRA 5KYUB 1ULZA 4KQEA 2J31A 4JGIA 5LBTA 5CX1A 2H06A 1V37A 3EY9A 3GQVA 1RM4A 1R6VA 2AB0A 2C2HA 3G68A 3ZR4B 4ZK2A 2ZJ2A 1JZSA 1VKZA 4A8JB 2WDZA 4ARUA 1DKUA 3D8SA 3RRFA 4EYKA 5BURA 3CZAA 3KSZO 1G4UR 5F1YA 2RHHA 5DTJA 3PX7A 1N2EA 1Z2OX 4R2JA 5C31A 4NOKA 3RBZA 3ZK9A 3ZWAA 3MELA 4J0IA 1ADYA 2YV5A 4OM7A 1RR6A 3WLNA 3T5AA 5A0VA 1A7KA 2Z98A 2P9FA 2OFXA 1G7TA 1PZFA 1C80A 3OCVA 3P19A 5L9AA 1UOQA 3IOEA 4YLEA 4G4GA 2OHIA 3VZRA 1QE5A 2XH8A 1KK0A 1V5WA 1W85A 4JUIA 4MGEA 4Q39A 3RLFA 3KWFA 1LJLA 2O0JA 2ZWMA 4N40A 3TMYA 1Z37A 4L02A 5EGNA 2O3UA 5DHSA 4B2YA 2J7PA 5AW6A 1G3QA 3FGPA 1XZQA 3AERA 1K75A 2C3YA 4KW7A 1WPXA 5KDLA 3VH4A 2XUGA 5HJ5A 2VZ9A 4JGGA 1XLTA 5EJGA 2EJTA 3OOSA 3DAYA 1HT3A 3FSEA 4IIUA 1XR3A 2D2XA 2G71A 2W6QA 5FUWA 5TEWA 3V8PA 3THWA 4AG3A 1NWHA 4GZMA 1PZEA 5JYBA 5G41A 3PPIA 2WSYB 3W6ZA 1GA4A 1D1QA 5B3AA 5L6MB 2A1IA 3R41A 1XMSA 2HV8A 3SLGA 2G08A 1DBRA 3FF1A 3WNDA 4UBJA 4ZO6A 2GXUA 2JZCA 5REQA 2GX6A 2Q5EA 3DV0B 3VYWA 4D74A 1GLVA 1YJCA 1Z68A 3C7TA 4UJ5A 5C1OA 3GLFA 3LDUA 4EFNA 3LLMA 4YRGA 5J47A 3CVUA 1D6MA 3OZEA 2K7ZA 3GG2A 4A91A 1HTTA 3AB7A 3MS2A 4J75A 2CVQA 1Z82A 1XIVA 2K2QB 1P1CA 1PD1A 2PKCA 3PHCA 4IO1A 5JWRA 4ADSG 3R9KA 1W2GA 3AL2A 1AS3A 1T4GA 2L0XA 3E9YA 3NGLA 3MS4A 4KVFA 4YMHA 2G4VA 2UYHA 5F12A 3HWX1 4I08A 3MJEA 4S24A 4XUGB 1TF2A 2OKGA 3LCMA 5FI0B 3T0FA 3ZTWA 4LIPD 3BKXA 4QUAA 3I5YA 2XECA 1PK9A 2WDPA 5JECA 5A3SA 2VPTA 4Y2JA 3HVUA 1M1UA 3QVGA 1AMOA 2XRZA 1OV4A 4RA9A 4FYWA 3TQHA 4CW7A 1O57A 2ZRCA 1M10A 4LVUA 1ZXLA 1W0KA 4GGOA 2L17A 2AZTA 1XGKA 3NKFA 1ZHFA 2H2FA 2OHGA 4CVNA 1E9SA 1QE0A 1RWVA 5HJ7A 5KREA 4MHTA 4KXUA 4II2A 1UPTA 1TM1E 2R1TB 3CWQA 5DEOA 4JVOA 3T3MB 3JATB 4LJRA 1H0SA 5DYTA 1DS6A 4ZOBA 1AU9A 2CNKA 1A2BA 3ZCXA 4GSYA 1J8YF 4PLWA 4DRYA 3PQ3A 3PIIA 3R9XA 4JFAA 4YRZA 2XVYA 5JQGB 5T7BA 1FUEA 3WMFA 4JCCA 5JOQA 4F72A 2VYQA 3AIKA 3ZVKA 1R6AA 4MUBA 4KUEA 3QOFA 2JFFA 3P5BA 1MT3A 1Y6FA 4GKJB 3KXLA 4H7JA 3NBQA 821PA 5DO9A 2CKDA 1C30B 2VZEA 3R24A 1X9GA 2YMLA 1GFIA 2QTMA 3R3SA 1GILA 4LQ4A 1ESMA 1DJOA 3RHSA 4IAOA 4BX2A 4POOA 1J0BA 1H3FA 2RIPA 2WNHA 3DOJA 2B1QA 2R9VA 3GAZA 4O0MA 4NXMB 5EWLA 1Z28A 5B58T 4CL2A 4CKBB 4TWAA 3UB4A 1ZW1A 2F7SA 3ROQA 3BCHA 2PZJA 2WMOB 1O58A 3E48A 3WGJA 4F84A 3VVCA 4AWBA 3U7QA 1YOBA 3D2LA 4AL4A 5J2TA 1XA4A 3ASZA 3LJKA 5EE3A 2PA0A 4N0EA 3HB1A 5DYIA 4WLFA 4CF4A 3T0GA 1QPZA 1K9VF 2IYWA 1ONNA 2Y2VA 4OHUA 1RAFA 2R8XA 1D1SA 2OC9A 3BE4A 2FSFA 1E3WB 2PGIA 4PSKA 5GJWC 2OFFA 1XRJA 3W8EA 1JNXX 2G3YA 3LWDA 2EL9A 3UKOA 1WVMA 2X0JA 2FQXA 5TLSA 1RACA 4JDPA 2ZUFA 1USVA 3ZWBA 4PO1A 4QFBA 2QMUA 1ZOIA 1P7VA 2GD0A 1ZXXA 4H60A 4BNLA 2OHFA 3NGXA 3WOVA 4F4JA 4B2PA 4XYLA 2PUCA 1WE2A 3BXPA 3OF3A 4QGHA 5ESWA 4Z9YA 1QH1A 5JSYA 2J85A 3RR2A 2IXTA 5E1DA 3MUFA 1I3NA 3P8ZA 3UAYA 3NOXA 3EG5A 3HY6A 3KV3O 4E12A 4BVLA 4C3OB 3B60A 2PZFA 5EJ6A 3PQDA 2CYCA 1VLHA 5E6SB 3VO2A 5EEHA 1E1QD 1LQ2A 3TLJA 3ZHYA 4C0XA 3VZQA 1AT1A 2OCIA 3AP1A 1E0SA 2BTOA 3EEBA 1W44A 3EW7A 2IXBA 1U5BA 5D3MB 2VT6A 4A15A 4U6NA 5KWIA 1OB5A 3RBVA 1VI2A 1PR2A 3RJZA 4K81B 3URKA 4OXNA 5DHPA 4M99A 2FX2A 4NYIQ 4GZ6A 1ODIA 2CHQA 5CA0A 1C0LA 1SM4A 1Z74A 2VNHA 3ZXYA 5PNTA 2B2CA 3NBYC 2BCEA 3LT0A 1W93A 1YZYA 3RE1A 2KW5A 4CLRA 5JCXA 2WUWE 2AOXA 4JBLA 4GMGA 1G5FA 3S4YA 4FFPA 5B7PA 1B1CA 1AUOA 4RPCA 3P5SA 1VIMA 2L42A 4QYXA 2G0TA 4CFYA 5I6DA 3GGGA 3LLCA 1JXAA 1GV0A 1A4IA 1V7ZA 3O1IC 1Q7EA 1VXRA 3WB2A 2ARKA 2V54A 2PZAA 3LC2O 4TTVA 1DC6A 3QXXA 4C7KA 2FKAA 1C9YA 1SCQA 1Z6ZA 2J7PD 2FDXA 2Y0CA 1TMGE 4KH0A 2IPOA 2WW8A 3BE6A 1L4LA 4MGIR 5A6VA 3DHVA 1NP7A 3C4QA 2F00A 4O2AB 4R2XA 4AZ3A 1HLDA 5HBGA 2C4HA 3M5CA 1XPUA 2ZS8A 2WF6A 2JEZA 4NG5A 4P35A 3DHEA 5K0CA 1FDUA 1AKNA 4K6KA 3KQHA 4BUZA 3JQ7B 3JRNA 1IBSA 4EHFA 2IELA 2I7VA 2V8OA 4LRQA 4YRLA 1ZQ1A 2CWWA 2YMQA 4BKQA 1L5FA 4D26A 4CM8A 1WQ4A 2QMHA 4EX7A 4I99A 1HE5A 2FQWA 3CXUA 4I1VA 1TIKA 3OTOB 1Y7TA 1P45A 2EW8A 2O8NA 2NU7A 2R6DA 4KSBA 4RA6B 4WZBE 2VJBA 1GPWB 4PNZA 5DEIA 3TLGB 3DFZA 2FHPA 4ITVA 3W6UA 3K4QA 1Q1ZA 4ASUA 2DQZA 2DUJA 4C01A 5JH7A 2JIDA 1TNDA 2FW1A 3ND8A 4JSTA 4D4HA 2C54A 3FHJA 4S2EA 2CL7X 4Q1FA 3VDMA 5A9SB 1XMIA 2XR1A 1G2PA 2ZT5A 3VVMA 4GAEA 2JIZA 1H0RA 2PT9A 3LE8A 3GH1A 2PG3A 4HAVA 1OYOA 1Z36A 2UZAA 3GT3A 1DIHA 3QELA 3J81A 1ONBA 2I2BA 2UXDB 4QEDA 2PWZA 2QP9X 4N54A 1N3BA 1U2EA 4L8YA 3RPEA 3WJ7A 4H3VA 4BFZA 4XWYA 5J5CA 1MG5A 5HK9A 3AV0B 5HHTA 2X9VA 1GQOA 2FVYA 1STOA 2HREA 3FTPA 4EJ0A 1W0KD 5KTPA 3QITA 3KFVA 4BV3A 4GPZA 3RG2A 5KHLB 1TF5A 4L9SA 5A3VA 3R2JA 2C07A 4D9KA 4OQZA 2VJCA 1RI2A 2IGTA 2LIPA 3TTVA 4LX0A 3D43A 3OCZA 2ZUWA 3S2ZA 1EUZA 2J67A 3KELA 1FRFS 1Q0UA 3MJFA 2O20A 5IAKA 3MJVA 5AM3A 5JNLA 3UMFA 5C4IA 3GG9A 4A92A 5C3MA 2JGMA 3ZJUA 1DDIA 2A8YA 4H31A 4C0JA 3H86A 1A2QA 3NR2A 4N4AA 2DFLA 5KPDA 1KERA 2GTHA 4FHCA 3OT1B 2FUNB 3DLHA 4CKBA 1CZOA 2NO5A 3K6RA 4L0MA 1XZ8A 4XGIA 5AJHA 2AJ8A 4OX9B 5TGTA 2WTUA 1E2GA 2BFEA 2PGDA 4RFSA 4ZTUB 4PO9A 1KY2A 2J0SA 4Z7JA 1GD1O 4FR0A 3ABZA 3L77A 4OAQA 3KXKA 5SYMA 1J9EA 2GFIA 2XTMA 2YJNA 3FCXA 3OIWA 3HFJA 3RBAA 2WIGA 3K9WA 1XEWX 1FFXA 1PR9A 1XALA 1USIA 3HXPA 1NX6A 1MX5A 1NXOA 3FSGA 3B78A 3PEUA 1SKYE 2EG9A 4ZJPA 1BE6A 4RH1A 1R8SA 2M6KA 2ZYVX 1O6GA 3TEJA 1N78A 2QMOA 2EJUA 3AKYA 3NHUA 2OCGA 4D3XA 4OHCA 2AH5A 1F2DA 4MYSA 4MLPA 4LBVA 5ALQA 4C9BA 1X8KA 5SICE 2JKVA 1P1IA 2X86A 1E5TA 4RV4A 3GQBB 3IQXA 3TF5A 2RJOA 2PZKA 4GC9A 3DV2A 4UXHA 5FIUA 1CJVC 4BEJA 1CJCA 2IY8A 1M0SA 1SAYA 2I1VB 4DLNA 1E0AA 2EQAA 4YJHA 5E7JA 1LC0A 2XSZA 3U44B 2C9OA 4GLJA 1EK1A 3MWEB 4HCJA 4KGZA 4F06A 5AI9A 1UBNA 4GRIA 3N07A 3IAEA 4B6FA 1PEDA 1T3TA 2JCXA 1SBHA 1JE1A 2JL1A 3PC4A 3NAQA 4DV0B 4NPHA 1QP4A 3VSDA 1P7YA 2H4JA 2NVUA 1SMKA 2X6TA 1UXOA 4Q7QA 1WDWB 4JQOA 2AHRA 2R00C 4UASA 2YUIA 4F85A 4PV7A 1FFWA 2WWVD 5I7VA 1KK3A 4Z51A 5IDVA 3CEPB 3I6YA 4E3WA 3N7UA 2JGLA 4YMLA 3AMVA 4AZ0B 3OPMA 5IXJA 3S8YA 5BV8A 4BE9A 3N75A 2GO1A 1UXJA 3DW1X 4O5OA 4IP0A 4FGWA 4EK9A 3B6KA 3A9UA 2QMZA 4BQSA 4X84A 2QJWA 2YJTD 3GN2A 2VP0A 4BFTA 3O8BA 3OX1A 3KS9A 2YJZA 3Q5DA 2R5NA 4OJNA 1O7JA 3CG4A 4MB2A 1Z0AA 1SD1A 4RLSA 1KL7A 1QXSA 2IEIA 2IUUA 1C7JA 3DKKA 4UAGA 4GLOA 5FBWB 1MB4A 2E6UX 1RBYA 4O33A 3FYUB 1QTNA 1FNSA 1JAXA 3A6HA 3HCPA 4C5AA 5JJCA 3Q3EA 1OH7A 4WXPA 5KDOA 4UBNA 3IV7A 5FTNA 1DWUA 5LVAA 2Z3WA 1Z0IA 2Z5VA 1XMPA 2B78A 2E5LB 2E4WA 4ROSA 2VNKA 4GVXA 1GKKA 1FTWA 1P2VA 2REOA 3D1LA 2RHOA 3IX7A 3KPJA 4HB0A 1HH4A 1KTVA 1QOZA 4KGVA 4WFIA 3MCUA 5FOSA 4BNZA 4DNPA 4BX9A 5K01A 3NP9A 3HBJA 5FPHA 1D1TA 1NW8A 2X8LA 1S2GA 3NHAA 1CY2A 1LBQA 2YNMA 1UZNA 1H6AA 1QYRA 2G72A 2GK4A 4HDMB 2MCFA 3RW9A 2VSFA 1UZLA 3L84A 2AOWA 3B1VA 2HRCA 1E1YA 2LCQA 3B8HA 1ID8A 1MABA 3BGDA 2R1VA 4ODIA 3T1TA 3C3YA 5TQ2B 1LPAB 2OGWA 4FB5A 1KQOA 4A03A 1Y8QB 4QEZA 3I5XA 5DYYA 3CLRC 3ZYCA 2V5UA 3DEYX 4INJA 5I9LA 3CPSA 2WFLA 2YVLA 3WXBA 4DG8A 1AQLA 1WDKA 1IEWA 1OPXA 1Q7BA 3I1JA 4HYYA 5CDTA 5LFAA 1OA0A 1DWQA 1Y4SA 2V74B 1OILA 2GBFA 1RXEA 1YKGA 3R4CA 1NVGA 1Z62A 2HC9A 4J9UE 4RESA 5E6UB 3K70D 4HNQA 4XM1A 4PZEA 3T12A 2VDJA 3QOWA 1DKPA 2PSHA 4D98A 1FYXA 4QWMA 5LUAA 1BE1A 5GZ3A 2E4UA 5JSUA 3GGOA 2ODPA 2QTFA 2X15A 4ASUD 2B94A 1ZHOA 5THQA 5EZ6B 2W2MA 3DJYA 4V1CI 2ZBPA 3DGFC 1JTVA 1UBGA 1UMDA 1IIRA 1Z13A 1OI2A 2I7DA 5ITVA 5J4YA 5JAZA 1P0CA 2JIZD 3VPCA 5EXEA 1SBZA 5HE9A 2NWQA 3TO5A 4CT5A 2DKNA 1PR4A 4DV3B 1WLYA 2ZBQA 3VR0A 3T7RA 1Q12A 3TOVA 2GEFA 4EMSA 1WU8A 3FFAA 2NU8B 4OFXA 1G18A 3K16A 4DIKA 2ZRBA 3L7LA 5K4HA 5DM4A 5EMMA 2CXNA 3EC7A 3DOHA 4DR1B 3L92A 1V11B 5H3LA 1UT8A 3WL3A 3RLIA 3PRHA 1LTKA 1W1WA 1EGHA 3VV2A 3RSHA 1DIOB 2F64A 2G1KA 3ND5A 4HQ6A 2W6JA 3LWNA 4ZGGA 2OQIA 3AONB 3UJNA 1EJBA 3JD2A 2ODBA 1AHPA 1ZJJA 3OKPA 5K3DA 3NTXA 3RSCA 2VUSA 4LF6B 4UCWA 1O3YA 2QSZA 5C0OE 3VSCA 4AO6A 3FBGA 4MQ6A 1D0IA 1DLIA 1T8PA 4FMDF 2JASA 4KIJA 2OC4A 2WUFA 5THKA 5HXAA 5L51A 3WSVA 4CEHB 3D0KA 3C3AA 1GPYA 2BSAA 2ZIUB 2CXXA 1PJ8A 4OXKA 1LDEA 1UXHA 2ZBFA 5TVKA 1NXWA 3VSBA 5A4FS 5JNSA 2DB3A 3FNRA 4MR7B 4RQBA 2EJBA 3LKBA 5FB3A 1G9XA 1R0LA 1AKEA 3AKEA 3H3JA 3WAJA 1YQWA 3ZHQA 3OLWA 1P2DA 4OQQA 1FFYA 1LI5A 1S4QA 2G83A 2C9ZA 3L8FA 1MHPA 1FRQA 3JTEA 2PR7A 3FSGD 3DOIA 4LGYA 5JROA 2DEUA 4KWIA 3S7ZA 2FSSA 1VBKA 1L5SA 1SKBA 5GOTA 4GI5A 2HJ9A 4YR7A 4Z7OB 1C1XA 5CFZA 2BHTA 2APJA 1KF0A 2F3PA 2JGRA 3MERA 3NOOA 3UV3A 1QB7A 3JZMA 3ZE8A 1VHQA 3ZE0B 3IHKA 2FQYA 4CODB 3TLYA 1BQEA 1J2YA 4W82A 3PNVA 3W1WA 2FB9A 4HXEB 4OX9Y 1S2LA 3LVRE 1V71A 2CLCX 3I6QA 1KQ3A 4M7OA 5AYVA 4EHHA 4U0KA 3WRVA 4Y6PA 1NUHA 3PXAA 2AOTB 5IWAB 1JWBB 1K92A 4CM4A 2RGNA 1VE1A 3QX8A 1HQKA 4BZXA 1TKRA 1HPLA 2QB5A 3WLLA 4F45A 3HADA 1QIKA 8MHTA 5K1ZA 3D4IA 2XSZD 2B6HA 3FOFC 3PPVA 2HF2A 3K09A 2RSLA 4PO8A 4R9UC 3W6OA 3TJRA 3DVAB 1JT9A 5K0NA 3G9QA 4MVJE 1OAOC 2W11A 2BGMA 4S1WA 1IXRC 2PEZA 4BO8A 1ENZA 1JA1A 2VF8A 1BHO1 3E22A 3GEIA 3IEPA 4JU9A 4IIJA 2PN1A 4FQ8A 1L8OA 4HZUB 1C5KA 1CV2A 3M81A 5HFJA 1FW6A 3TQIA 3PJEA 1FYFA 1B14A 2ZGVA 4MVCA 5EP1A 3M1AA 1J2UA 2G82A 1I4DD 2X1VA 1R5NA 2Q46A 3B5JA 1VXOA 2O1XA 4MZXA 5F4ZA 2PKXA 3R0ZA 2RHTA 2P2ZA 5NULA 1ECCA 3WLSA 1H22A 3B1FA 4C78A 1QJ4A 2CUZA 2WWRA 3KTFA 2ORYA 4Q3KA 1MZPA 2WWYA 3L8YA 4EKYA 1Z63A 3K9CA 1JGTA 4YMSA 4PIMA 1U9IA 1VM6A </