2I6GA

Crystal structure of a putative methyltransferase (tehb, stm1608) from salmonella typhimurium lt2 at 1.90 a resolution
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
199
structure length
169
Chain Sequence
GMTVRDENYFTEYGLTRTHSDVLAAAVVAPGRTLDLGCGNGRNSLYLAANGYDVTAWDNPASMANLERIAAEGLDNLQTDLVDLNTLTFDGEYDFILSTVVMMFLEAQTIPGLIANMQRCTPGGYNLIVAAMDFPFAFEGELRRYYEGWDMLYNEDVGLRFATMLARTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Putative methyltransferase
publication title Crystal structure of putative METHYLTRANSFERASE (16420133) from SALMONELLA TYPHIMURIUM LT2 at 1.90 A resolution
rcsb
source organism Salmonella typhimurium
total genus 51
structure length 169
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03848 TehB Tellurite resistance protein TehB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2i6gA00
2ZSUA 3G2MA 5DSXA 3QV2A 4V0QA 1NKVA 2AVDA 3F4KA 3HVIA 4HG2A 5IKMA 3AJDA 4RTQA 1XJ5A 3AY0A 3CC8A 3UJ9A 5HOQA 4HTFB 2E5WA 3HA3A 4GOMD 3HCDA 2PV0A 4QQNA 3VC2A 4E31A 3IV6A 4GOOD 3UJ6A 4FS8A 4GOLD 4YV0A 3OPNA 3ANXA 4RTLA 3SMQA 1YFJA 10MHA 5E2AA 5EOVA 5LQRA 2NXEA 3UJ7A 1XDSA 2PX5A 3HVKA 3BGDA 1V39A 3LDUA 1KIAA 5EHIA 1JG3A 3HNRA 4DMGA 1SQGA 1N7IA 3ELWA 4KW7A 2PXCA 5E1MA 4A6DA 4F85A 4DA4A 5FA5A 3SM3A 3GJYA 5DRYA 5DXAA 3M6WA 2NYUA 4QPPA 2OZVA 3ELUA 3OZSA 3GDHA 1JQ3A 5FHQA 5E9QA 2P35A 2WK1A 3P9NA 3Q7EA 5CVEA 5EVJA 3AXTA 1YUBA 1T43A 1RI2A 4Y30A 4R6XA 5LR6A 2ZIEA 1ORIA 2ZVJA 4R8RA 5K0LA 3LBYA 2NP7A 1WXXA 3B5IA 2BR4A 1RI3A 3NWBA 5HZMA 5BXYA 3LKZA 3MAGA 2O05A 1KYZA 1VP3A 3ORHA 4E2WA 4RSRA 1I9GA 2CL5A 2H00A 1BKYA 3CBGA 3HCAA 4QDJA 5B1SA 4E32A 4AUKA 3I9FA 1UWVA 1N7JA 5DX8A 5FQOA 4GC5A 3NWEA 2B3TA 1NBIA 1RI4A 2ZZKA 3KQVA 5GOZA 1D2CA 1SQFA 3DXXA 4KIFA 2IH5A 3HCBA 3I64A 3GRZA 4OX9Y 3UJCA 1WS6A 3BWMA 5K0GA 4WXHA 1JG1A 4A6EA 3FPHA 3BWCA 5D1NA 1VBFA 3QOWA 1WZNA 2V74B 3T7SA 4V0RA 3BUSA 3M70A 3TPZA 3E05A 3TKYA 2JHCA 4BLVA 5BW4A 3FUVA 5DRTA 5LSAA 5E8JA 3ELDA 3MB5A 5GM2A 4EK9A 3NVMB 3LX6A 2B78A 3BZBA 3D2LA 2WA1A 3HVHA 5EGSA 3RW9A 3P8ZA 3QOXA 2ZULA 4OA8A 5FA8A 4HC4A 2IH2A 4PCLA 1L3IA 3B7PA 4RWZA 8MHTA 2ZFUA 4X63A 3TMAA 5EPEA 1VL5A 4DCGA 1I4WA 2CMGA 5HEKA 1DL5A 2YQZA 3TR6A 1X1AA 3UJ8A 1WG8A 2OKCA 4CTKA 4LG1A 5JUWA 2PX4A 4GEKA 1VIDA 3GNLA 3LBFA 3UJAA 4MTLA 3GRYA 3SSOA 2LD4A 4PYKA 3CJRA 2QYOA 3EMBA 4MWZA 5DM0A 3DXYA 4ATNA 1I1NA 1L9KA 2PBFA 3NVKI 5K8VA 2P7IA 3CJTA 3NMUF 3GXOA 5E1BA 3KPYA 3OE5A 1VLMA 2VDUE 2XVAA 3B3GA 2H11A 3UJBA 4GOND 4IV8A 4PCAA 3OCJA 1FBNA 2AOXA 1KR5A 4QDKA 5KQSA 5K0BA 2P7HA 2IGTA 3LCCA 2GA9A 2AOVA 4FP9A 5E9JA 3S68A 2IH4A 2PX8A 2Y1WA 2P3OA 3FPGA 4HH4A 2ZWVA 3OU2A 2P40A 3HP7A 3KR2A 4RVDA 4E2ZA 3PFHA 3UWPA 4E30A 4YMGA 3C3YA 2ZZNA 3C6MA 2HWKA 4QVGA 3LGAA 5ICEA 2JHPA 2Y1XA 2JJQA 3X0DA 1NE2A 2CMHA 2AVNA 3B3JA 4PIMA 1R6AA 4LECA 4MIKA 5DX1A 2EJTA 3B89A 3A27A 4PNEA 4HGYA 5U4XA 4BLWA 1NT2A 1TPYA 2I62A 1YB2A 2GPYA 2YVLA 3PX2A 4P7JA 5FQNA 1BOOA 1P39A 3GRVA 3DMFA 3LSTA 5ERGB 5F2KA 2GS9A 2XYVA 2WA2A 2C7PA 1RI1A 2YXEA 3BT7A 2FYTA 3NDIA 1HNNA 4BLUA 3UA4A 2ERCA 3BWYA 2HV9A 3P9KA 3BWBA 1M6EX 2I7CA 4AX8A 4KWCA 2NP6A 2AS0A 3BKWA 3R24A 1NBHA 4GF5A 1B42A 2G70A 4U7TB 2AOWA 1KP9A 4YUVA 1TW3A 2G1PA 3TM4A 3DR5A 2XBMA 3FTFA 1KPHA 1RJFA 4AZVA 3BGIA 3M4XA 1EJ6A 1UFKA 1VE3A 3LCUA 3K0BA 5DM1A 1FP2A 1YZHA 3OFKA 1R74A 1XDZA 4BP1A 5EMKA 4BY9E 3FTEA 3I58A 1NV8A 3HA5A 1XXLA 4E33A 1G38A 2G71A 5GIOE 2UYHA 3KQPA 4KIGA 1WXWA 5EIWA 3VYWA 1FJXA 4P7KA 1YFLA 1ZHFA 3E23A 1G55A 2Z6QA 3RODA 2P3QA 3UZUA 3M6UA 2AOTA 1X1CA 4M36A 5DTMA 4O29A 4P58A 1QAQA 3L8DA 2DPMA 5K01A 1G6Q1 5T67A 2K4MA 5M5BA 2BH2A 2BZGA 2QM3A 2EX4A 2R6ZA 4PGGA 5EZSA 4C08A 1DCTA 4YUZA 5K0FA 4RVHA 3KKZA 4QQKA 3MQ2A 1AF7A 1NW3A 5LQAA 4GUAA 4EQZA 2YX1A 2ONZA 1RJGA 2YXLA 2VDWA 2B25A 1JTFA 2Z6AA 4B17A 1RJEA 3G2OA 5H02A 1HMYA 5F2NA 5GWXA 4IWNA 5DWQA 3RIEA 4U7PB 4R8SA 4F86A 2N47A 3KQMA 3ELYA 4X1OA 3FYDA 3Q87B 3EVAA 3G5TA 1XVAA 3SR4A 1X1DA 2OO3A 4C03A 3OZTA 1H1DA 2AN3A 2NXJA 2HNKA 3I53A 4RYLA 3P97A 1QAMA 5LQKA 1AV6A 3WSTA 5BW5A 1EG2A 2GAFA 2PY6A 2UYQA 1IY9A 2P41A 3H2BA 5HIMA 4HSGA 4C04A 1WY7A 1VQ1A 3TQSA 4MHTA 5DX0A 4PYMA 3MCZA 3B3FA 4EMSA 1JR4A 3ER9A 3V8VA 3LKDA 3GO4A 3P2IA 4PYNA 3I5UA 4OQEA 3CGGA 1F3LA 2UZ4A 1KPIA 3P71T 3LHDA 2AOTB 5CVVA 3TFWA 4ER6A 1XCJA 5FULA 3T7RA 2F8LA 4RX1A 5DM2A 3HCCA 3FUUA 2DULA 4YUYA 4RTJA 3GIWA 3REOA 5EQJB 3EVBA 1NW5A 2ZLBA 5E1DA 2IDKA 3T0IA 2JH8A 2G72A 4PONA 5G02A 3THSA 5E9WA 5K05A 3C0KA 4X61A 4CKBA 4EVIA 1SKMA 3KPJA 2JHAA 3LL7A 4E2XA 4F84A 2YXDA 5CCXA 3EMDA 3ID6C 1U2ZA 3KQTA 5DXJA 3DLCA 3KQSA 3DMHA 1F38A 2VZ9A 3R9XB 3EGEA 2BR5A 5HILA 4YV1A 2OY0A 4KDRA 5ICCA 4LWPA 1KXZA 2PXAA 3UFBA 3O4FA 5KYGA 2O06A 1D2HA 1R00A 2VDVE 3CCFA 3EPPA 3CKKA 3KR0A 3NTVA 3GWZA 3O7WA 5EKUA 5EMJA 4CWAA 5CCBA 1O9GA 2UYCA 3E8SA 3DTNA 2PWPA 3OZRA 3DH0A 4P7FA 4GC9A 5DTQA 2XYRA 2HMYB 5LQJA 3NW9A 3EEOA 3FRIA 3PX3A 3PFGA 2OB2A 4Y2HA 1INLA 3C3PA 3P2EA 2PT9A 5BP7A 4HGZA 4OBXA 2BM8A 2P8JA 1ZKDA 2EG5A 2Q41A 2ZTHA 3MCTA 5EHGA 3SSMA 4BP3A 4DKJA 1SVUA 2I9KA 2QY6A 3EVZA 3HVJA 3G5LA 3KQQA 3KPVA 3G2PA 4PWYA 4E2YA 1BHJA 3JWGA 3JWJA 1Q0SA 3PVCA 2ZIGA 3FUTA 2FK8A 9MHTA 3TM5A 3LECA 1QYRA 1AQJA 2UYOA 2CKDA 2HTEA 1BC5A 5HIJA 5CIYA 2FRXA 1NV9A 3DLIA 3DULA 4FT4A 2ZBPA 4FT2A 4KRGA 5IH3A 4POOA 4DCMA 3IHTA 4GQBA 5D1HA 2P1DA 2PT6A 3M6XA 4X41A 1XTPA 3MHTA 3G2QA 5K09A 4RTMA 3M33A 4ISCA 1IM8A 5T6BA 5KQRA 5CVUA 3PLAE 2ZW9A 4G56A 2ZCJA 3ERCA 4KVZA 4OBWA 1JQEA 4IV0A 2FPOA 4YUXA 5K0NA 4RTRA 2IBSA 4OQDA 1NW8A 3HCFA 4ER5A 3CJQA 4XUCA 5FTWA 4RTNA 2QE6A 4XUEA 4WVLA 4AZWA 2NXCA 4NECA 3BKXA 4AZSA 3TKAA 3O31A 3MTIA 3G7UA 2QRVB 5KS2A 4PYQA 5EEHA 2I6GA 3DUWA 1SUSA 4ZTBA 1EQAA 1SUIA 2EFJA 2OB1A 3OU7A 1Q0TA 1D2GA 3K6RA 5GINE 2FCAA 2ZBQA 3EVCA 4CXMA 3AWIA 5EKXA 3PT9A 3U81A 3VC1A 2JG3A 3GCZA 3TOSA 3FPEA 5GM1A 2H1RA 2GB4A 3FRHA 1QAOA 5GIPE 4XCXA 4KDCA 5DLYA 4MQ4A 5CM2Z 3R3HA 1RI5A 3EVEA 1KPGA 2AZTA 3KR9A 4DF3A 2OXTA 3P9CA 4ER3A 2IPXA 3FUXA 2XYQA 3NDJA 3IYLW 3E7PA 3R0QA 2A14A 2IDJA 3HTXA 4CKEA 1O9HA 1DUSA 2PLWA 1EAMA 2JH9A 5DM4A 2C7OA 1G8AA 3R6TA 2FHPA 1R18A 1R8XA 1R8YA 3FPJA 5DTRA 2AOUA 3FTDA 3G8AA 4RTSA 1KHHA 2NNWB 5C9ZA 2G8NA 4LWOA 4XUDA 2BM9A 2VP3A 3GGDA 2O07A 1L3CA 3PB3A 4C07A 2AR0A 1XDUA 3A7DA 4HRAA 5EZQA 3KHKA 2IFTA 4CKCA 2HR1A 4QPNA 2PVCA 4DZRA 5FWDA 3LPMA 1Y8CA 2ZWAA 4M7RA 5LQCA 4RTPA 4YUWA 4R6WA 5DSTA 5C0OE 3FTCA 5EG5A 4FSDA 1ZG3A 2ORED 2PXXA 4YMHA 1YF3A 3UA3A 2EJUA 2VS1A 2PGXA 3SVZA 2GLUA 3T7TA 5CVJA 4EKIA 2Z6UA 3KQOA 1JTEA 3MGGA 3A25A 2ZIFA 5CUQA 1VP9A 3EVGA 4P7GA 5K0JA 1Z3CA 1IXKA 3LDFA 1FPQA 4R05A 1XCLA 2NXNA 2R3SA 2ONYA 2YTZA 3C6KA 3P2KA 5LQNA 3GRUA 2ESRA 2OBFA 2PKWA 4AZTA 3EGIA 3GRRA 2ZBRA 3SXJA 3G89A 4M38A 3G88A 1G8SA 5JR3A 3MERA 5DPMA 4YV2A 3ER8A 5T64A 4OA5A 4PYOA 3SSNA 3V97A 1N2XA 2PSSA 2KW5A 3HEMA 1MJFA 5F2OA 1PRYA 1G60A 1X19A 3M6VA 4JXJA 2OPBA 1YZ3A 1TW2A 2AN5A 4PGHA 4FSXA 4RVGA 3EVDA 4X60A 2P3LA 3UJDA 4RV9A 2CWWA 2GH1A 1JQDA 1KYWA 2O57A 3HCEA 3NJRA 1VPTA 4FZVA 5E2BA 7MHTA 1EIZA 3G8BA 5K0EA 4ER0A 4M37A 5LQUA 5GP1A 5EMLA 3DP7A 2B9EA 3SX0A 4UOEA 1L1EA 2FK7A 2IP2A 3EGVA 2AOUB 3KR1A 4C4AA 1QANA 5CD1A 4PYIA 2OYRA 3VSEA 2QRVA 1RJDA 4EKGA 4H0NA 4C05A 4GBED 3EVFA 3A26A 1NW7A 1QZZA 2ADMA 2O0LA 1M6YA 2YUIA 3KPWA 3HM2A 4L7VA 2YR0A 3DXZA 3MTEA 5CVDA 2IIPA 2AN4A 5HIKA 5FCDA 5FHRA 3EEYA 4IKPA 1NW6A 5FADA 3KQWA 4PYLA 5EC8A 4Z2YA 2XVMA 3KQYA 3LCVB 2V7EA 5C1IA 4CTJA 5K0CA 2C7RA 1SG9A 4HTFA 3FYCA 3HA7A 4DM3A 3TRKA 1JG4A 1P1CA 3DMGA 3KU1A 3OFJA 4QTTB 3AXSA 3KPUA 3CVOA 3JWHA 3OU6A 5HIIA 1ZGJA 5MHTA 4RTKA 5FUBA 4ER7A 2BR3A 2B2CA 1PJZA 3A4TA 1M0EA 4FR0A 2PJDA 3FUWA 1JG2A 3IEIA 1P91A 5EEGA 5KVAA 2PX2A 5FWAA 4E70A 3THRA 2ZZMA 1ORHA 1O54A 1AQIA 1EJ0A 4QVKA 1ZGAA 1ZQ9A 3PS9A 4C06A 3LDGA 5EIFA 3PTAA 1JSZA 4K6MA 3FZGA 3ME5A 4RTOA 5ICGA 1OR8A 3OE4A 5EMMA 3JWIA 3P9IA 1JSXA 4DQ0A 1MHTA 3BXOA 2PWYA 4RVFA 3SGLA 3TLJA 4PYJA 3UBTA 2C7QA 3GU3A 4QTUB 1L3BA 5DT2A 5E1OA 3DOUA 3BGVA 4FGZA 1FP1D 4PIPA 1P1BA 4PINA 5P8WA 1UIRA 2IBTA 1X1BA 3FPFA 5ICFA 5K03A 5HFJA 3A7EA 5E8RA
chains in the Genus database with same CATH superfamily
5HYVA 2FG5A 3LY9A 3ONVA 4QASA 3QV2A 1K4YA 2Q45A 3I92A 3ELBA 2GXUA 2QX6A 4I5EA 5JI3E 1IN7A 4D3ZA 1DOHA 4I46A 4IQ0A 1LBEA 4DLPA 4LXGA 4U0KA 1W46A 3H5NA 4K6FA 2VUIB 4PZ0A 4TKZA 1JX6A 4B5LA 3VGJA 1ES9A 1G5PA 1NXXA 3RHZA 3L6BA 3HYTA 1UK7A 1PBTA 5EOVA 1BVYF 2XNHA 1OXXK 4KDEA 4RF2A 3V4RA 4LFCB 3Q11A 3GT4A 4F45A 3TIIA 2AFHE 1IBSA 1WQ4A 2D4HA 3L4JA 3HNRA 5BUQA 3AFMA 5EVCA 1E1YA 2QTRA 1GV0A 3SYKA 3RRXA 4A6DA 1ZXBA 5KJFA 1XAIA 2CCKA 4Q7EA 4ZOLF 2BSAA 2NOAA 5A3QA 4FWIB 2L69A 4P08A 4HDRB 4C0KA 3T95A 1NMXA 3IELA 1GZDA 2P35A 2FNAA 4JNCA 2GEVA 1NUUA 3TFQA 1NE7A 2KJQA 1EVEA 1JUDA 3Q1LA 1H65A 2BI8A 7YASA 1FSPA 3G7NA 4UBNA 1EUYA 3WYCA 1UP7A 4U7DA 3AOEA 1E0DA 3J7AC 2JGFA 1E0JA 1LDBA 1HDGO 4OQFA 3H9QA 3NWBA 2WKPA 1QHYA 1XNGA 4JLJA 2OV4A 4K28A 1BX3A 3MJDA 1EESA 4F71A 2PUCA 4W9RA 3SIXA 4CG3A 3LBNA 4R6WA 1ONNA 2JDID 4I4NA 2PRJA 3A4MA 2EVWX 4JB2A 2A78A 4NOLA 4QDJA 1YVRA 1GOTA 4HX9A 5TGZA 5BSWA 4ZGBA 1Y6FA 4BNHA 4CQMA 3DFZA 4N03A 3KG2A 1AKUA 1QQ5A 1ZI9A 2QLJA 3OOSA 1SZDA 1F6WA 5AR1A 3SCZA 2FOLA 3S5UA 5HTKA 5K3BA 1DIBA 2J45A 2J5XA 2R2GA 3MZ0A 4C0SA 4D45A 1XN1A 3GB9A 3HJGA 1BA2A 1F9AA 1R0YA 3C3CA 1DHRA 4B09A 1BU8A 2QNBA 3O93A 5DYIA 3UUEA 5JPIA 1TCUA 3QI7A 3K0AA 4PLCA 5KKCA 2B4TO 1TCBA 4O4LB 4RHUA 4KUHA 2CCJA 2VSFA 4CR7A 4NCAA 1L7BA 1A7AA 1XRLA 1U94A 4HDSB 4RA6A 1NATA 1J0XO 2JKYA 5CA0A 1L1RA 4URUR 4HFMA 4MV5A 3ZDCA 2O8CA 1K7EB 4YJGB 3QJYA 4L3VA 3D7RA 3OLCX 1OV4A 1BEZA 4M88A 4IXNA 5AJTA 2P9BA 5EPEA 4Z4FA 1VL5A 1G66A 3EQ7A 4QBKA 2XZTA 3LC7O 4ZT3A 2YN0A 3PCXA 4CM9D 2HQOA 2XCSB 2OKCA 4QU9A 2PEZA 5EPUA 4HEQA 2P9EA 4CTKA 1VIDA 3WK5A 4PRZA 1Y82A 3EDRA 3W3ZB 4V0ME 1D1PA 1H94A 3I2KA 1J1IA 2AFRA 3H2JA 2PZFA 4BVGA 3N0RA 4H0CA 2O23A 2PRSA 4GBGA 5KTYA 1EFVB 1U6JA 4X1IB 4ZRMA 1QPZA 3GXOA 2XEDA 1QZ3A 1KU0A 3QXHA 2I4OA 1SA0B 2ONJA 2XVXA 3EIFA 1YC2A 3REFA 3DE2X 3AEUA 1RAFA 4PCAA 4AJ9A 4DBVO 2RARA 3LNCA 2WTEA 2YASA 4JGGA 2PR7A 3HJRA 1MP0A 1OIXA 2YY7A 2GBPA 2I7TA 2IHUA 4YRFA 3R7SA 1Z6ZA 2RGYA 2C31A 5AKJA 1X8LA 4U5QA 4PNZA 4DANA 2BGWA 3ZTWA 4QVGA 4FJ2A 2JHPA 2Z2KA 1YVEI 4M8LA 1E92A 3X0DA 4M9XA 4GX0A 3ZCQA 4BMZA 2BDTA 4OV6B 3BSSA 2FGKA 4FNAA 4RY9A 5EYPA 4PNEA 1U9CA 1ZXXA 4P7JA 4OHFA 1OAOC 3LHIA 2Q3DA 4CHTA 5KJCA 2NSYA 1PU2A 1E1MA 2J9XB 3L7MA 3V2UA 2HRQA 5FOUA 3ENQA 2ZTVA 2VDPB 3G2NA 1MG5A 3TL6A 2HV9A 3FTPA 1XVVA 1L4NA 2OHGA 1PK8A 4TXNA 3RS2A 1H8ED 2FWIA 3HEAA 13PKA 4JJIA 4WWHA 2YWDA 2G1PA 2DWCA 5BOVA 3EW9A 1MGPA 2WOJA 4RFSB 1KETA 3L93A 4K1XA 3IP7A 3IRVA 3K5PA 4R2HA 4BBAA 2AWOA 3BGIA 2QD1A 1TQ6A 3M4XA 3VU8A 2WTBA 2VP2A 4WKPA 4E5KA 1HNXB 1T0HB 3H13A 4U6SA 5EMKA 4B3BA 1A5ZA 4AJHA 4BRWA 3FOZA 4OK3A 4RH1A 2ZRCA 1M1XB 2OD9A 2R86A 3HBMA 3JSXA 5JU6A 4G0PA 2WF9A 4QODA 3LPNA 1JW9B 3SLRA 3ESRA 1G6KA 3HB1A 4KQKA 3VO9A 4LF9B 4AUMA 2YDYA 2J6HA 3UH0A 4E4RA 3H2KA 5LBTA 2Z6QA 2REXB 2V9CA 5I47A 2A4MA 1UJNA 1PS9A 3AZPA 5CH8A 3IEXA 3IQWA 2A58A 5F5XA 4DRXB 5KBYA 1QF6A 1QV6A 5KMGA 4IO0A 5EZSA 3QX9A 3GD7A 5JS6A 1K98A 1LX7A 3HU3A 3PA6A 2YRWA 1VPEA 1HDRA 2WICA 4U2EA 3W6ZA 3OP4A 1IOWA 3G23A 3VO2A 4MV8A 2E89A 5I9IA 4ENSA 3TQCA 1YA4A 3MWEB 3GLFB 2JFXA 1EE2A 3C3EA 3QKRB 4J7UA 1JTFA 3PQ3A 4C7OB 4HADA 2JW5A 4OHKA 1MZVA 3RROA 1Z38A 4MI6A 2FG6C 3HB9A 3AR3A 1MA0A 2I87A 3HJAA 4RIHA 1Z5OA 2RGNA 2NUBA 2I80A 3IJEB 4ZCIA 2Q9AA 2ZJ7A 1YS6A 3CINA 2GLXA 3KQMA 4R54A 4ZMRA 3KBOA 5B3AA 2WB4A 4ARBA 5D5PA 5I01A 4HRXA 4J1NA 4Q9DA 5JASA 2XCQA 3BZWA 1LSOA 1H1DA 3OI7A 3OIWA 2NXJA 2EL9A 1F8FA 2G9VA 5KNBD 1XEXA 4ZVPA 5AUNB 1K88A 2A0FA 2IC5A 4PZAA 1CNMA 4BB9A 1QMGA 5KYYB 5M34A 3LQ2A 1RZRA 5FRDA 2BEVB 2RAUA 1JEJA 1UMDB 2BUCA 4UVGA 4MHTA 1TADA 3AR6A 2JAUA 3NDBB 1MU0A 2PRIA 4QJIA 1RYYA 2BGJA 2H5EA 2QJOA 2I3DA 4FGJA 4BLPA 2OHVA 3DOOA 4U7WA 4YCJA 1FU7A 4PS1A 4BO7A 3DZ8A 1PZNA 4MUYA 2PZBA 3RRJA 1CETA 1DCFA 1PWHA 1E2DA 2F8LA 1ACLA 3FNHA 1IN5A 3G0GA 3HCCA 3KVNA 4G07A 4WGFA 4K3VA 5CM9C 1ETHA 1T36A 4YC7A 5ALIA 4AROA 1CZRA 5EQJB 3OZFA 2ZLBA 3BE8A 3X44A 1G8YA 3OUZA 2JH8A 3PUYA 4MS3A 4ZI7B 1ESDA 3OJ0A 1C29B 4R2IA 3EPJA 2C2XA 4EVIA 5B2FA 2Z08A 2FKAA 4XJXA 1SKMA 2VDWB 3G49A 4QUJA 2WBLC 3GLFE 5DLPA 2DWUA 2Y1DA 3UTCA 3OJWA 4ND2A 5JFTA 1N3IA 2HSDA 5JO0A 2R4UA 1IU9A 3GH3A 2YIVX 4KI0A 4LAFA 1NVFA 2PX6A 2J0UA 5IX8A 2GM4A 1HSOA 2AG1A 3IHLA 4QIHA 1DAPA 5KYGA 3CCFA 4D3YA 4MSUA 4B2PA 2DYKA 3U4MA 3GVIA 3S2IA 2GX6A 2Z4SA 5E0KB 3FMPB 2XE6A 1VHLA 2CNBA 2FEXA 2VTBB 3HO6A 5DNAA 1KYYA 4EHNA 5E4YA 4D2IA 1E2BA 3EEOA 2JD0A 3H6KA 4F4IA 2DY0A 3F1LA 5C3UA 3H05A 3P2EA 3RYHB 4C7XA 4DWOA 2PGAA 3NBAA 3ORYA 1N8KA 3IMCA 2PUDA 1ZNZA 5JS7A 1E64A 2AJLI 1TYZA 5A02A 2FJPA 1HLPA 1BNCA 1JVSA 4N54A 4KMOA 5DBHX 2X77A 1ML3A 1VMDA 2CD9A 4NK5A 4R40A 4XDGA 1X7ZB 3IKVA 2ZI4A 4LXXA 4V24A 4QG7A 4OH1A 3PVCA 2BAGA 2QV7A 4QFCA 2WQ7A 4OLBA 3UV7A 4WK4B 5JJCA 5SZKB 2BJWA 3KB8A 2BHRA 3D3NA 1AQJA 4J0JA 3NDRA 4EJ0A 2JLBA 1JFRA 5SY6A 3CZ4A 2C8KA 3I52A 2ZDQA 4D82A 4DMUB 1VOTA 4AWAA 4K1LA 4NS1A 4I8XA 5IYZA 3M6XA 2HRCA 3IQZA 4MUMA 1GZSA 2XT0A 4OCZA 2Q2NA 1OYOA 4G0ZA 4P8RA 5B30A 1DFIA 5ESDA 5I7UA 3JZIA 4NBRA 3T1TA 1U8CB 5CR9A 1JQEA 2FPOA 2J0EA 2F4VB 4I4LA 3AIOA 4H6PA 4I0WB 1G5FA 4D1YA 2Q49A 1N5KA 4NCJA 4NWIA 1WW8A 1ZWKA 2BVNA 3T5BA 4LGYA 2XUOA 4HAIA 5LBIA 121PA 4WVLA 2NXCA 5F5NA 5AW8A 3BKXA 4NF2A 1KIMA 3ZS9A 2XTNA 1NOIA 4BWYA 3BAZA 3PHHA 4CGZA 4NBWA 3UUFA 3JQFC 2HSZA 5KTSA 2G88A 1SUSA 2CLFB 1CZLA 1NVBA 2W6ID 1I4TD 2XQFA 3A1SA 4L4UA 5I9TA 3W34A 1X7YA 3LP6A 5EQFA 2IS2A 1T4GA 1X3LA 4EFLA 4TN5A 4OGLA 5LXTA 3QFRA 4GRDA 1V1MB 3VNQA 2NU6A 1OH6A 2JG3A 2ZI6A 1XHLA 3RADC 1CHNA 2J31A 4H7FA 3S1SA 2HRDA 1L5MA 3T1VA 2W4QA 3PHBE 1XX6A 3KE9A 4J2OA 4KDFA 4MYDA 3GLUA 4UVHA 4BQPA 5I3ZA 1C8VB 2CJYA 4KXXA 3WB9A 1BX1A 3Q6IA 1P5ZB 3FF1A 1S2GA 4I8DA 4QICA 2WFMA 1Y7IA 1XKLA 4IKOA 1M7GA 2IDJA 4QBFA 3IQGX 1Q1BA 5CAEB 1A5TA 4YO7A 4A8JC 4OHYA 5CA1A 2J9GA 4ZD6A 4JMLA 1O95A 4JI8B 3R6TA 4B6OA 2IEGA 5CLLA 2EGGA 2QVBA 4XD2A 1GJRA 5EJMA 3KJHA 1G8HA 2VXOA 1P6QA 2FG7C 5JCJA 1BWPA 2F90A 1YL6A 1RD4A 5TX7A 1QH0A 5CMLA 2VP3A 1G0NA 3FWPA 1KKMA 4ASUD 3MWFA 1DEKA 3CPJB 5THQA 1XDUA 4HNQA 4KXFB 3TLAA 3HVUA 4EPXA 4YCNA 3PFIA 4RE5A 4LOIA 4LYFA 2PVCA 4BUZA 3QPWA 1KS2A 4GNKA 3UMYA 2R4QA 4C4ZA 3HDHA 3ZDRA 1Q0RA 4UNSA 4WDQA 3IXMA 1A4IA 1JI0A 1TRKA 3FSGD 2R7LA 3RTDA 3UA3A 5JAHA 5JOQA 2DT8A 1AY0A 2PN1A 1JYEA 1T3LA 1DVRA 1DBIA 2OTCA 2PZEA 1Z0DA 3HXLA 4A27A 2AMYA 1EK6A 4TOIA 3S40A 3ZLVA 2D1YA 2HA6A 2P5SA 3DKRA 1AKNA 4YMLA 3UMSA 4XTCS 3C16C 5F52A 4LF8B 1FX0B 1Q16A 3E9EA 1TEHA 4NZPA 4PLFA 3WGYA 5AW2A 3BORA 2J09A 2DUNA 5ILGA 1MH9A 3CBQA 4AMUA 1PUIA 4B3GA 4RCZA 2EU8A 1FUEA 1FP6A 3GCWA 3AF1A 1OREA 2J3EA 1BXGA 2XRZA 2BMFA 2HIHA 4GXQA 4BWVA 4Z0HO 2FFRA 3OQNA 1R7RA 1VYVA 2DH5A 4HN4B 4HWKA 3V8QA 2GH1A 2FWNA 3ZZUA 3T5MA 1SURA 2H08A 3RU7A 3N6RA 5E2BA 5J2UA 1CZHA 3RLIA 1SEPA 4UZSA 4KH0A 1FF9A 1CR4A 3CO0S 3K53A 4C4AA 1UZAA 1MAHA 1RJDA 4DDUA 4MJ3A 3TG2A 1JDTA 2Z6VA 4K6CA 2DR2A 1U9JA 4BV8A 4YBRA 4I99A 5LD2C 5TJ9A 4IJUA 1TK2A 1TK3A 4RVSA 1Q1ZA 5CX1A 4HGRA 3JTMA 2XVMA 4MUEA 3PUJA 1VG1A 2E0IA 5B2ZA 5F1YA 4DFDA 1GDTA 1OXSC 1L8OA 4O2BF 1KSJA 3O84A 3FBTA 3NAGA 2R62A 1GNLA 4LDZA 3W77A 4DSOA 2WIKA 4I1VA 4ND1A 2TMYA 4Z4IA 4RA9B 3FWZA 3VR5A 4DWWA 4EPTA 1LPMA 2PO7A 1OOEA 5BW6B 3I2HA 2QM8A 4XVCA 2WIAA 3E1GA 3NJ8A 2VZLA 3ETCA 3K9CA 3GJRA 5U9CA 5K8CA 4J0DA 1P2SA 3GRAA 5TXGA 1IRIA 3NFRA 1LB1B 1O54A 1YQ9A 3THRA 3ZNNA 2V7QD 2XUGA 1ZGAA 3H0CA 3PS9A 1XTRA 4XUGB 2CV0A 1A97A 3BMCB 4E3WA 1ZR4A 2B7LA 4CDRA 4JV5B 1W96A 2XV1A 3FZGA 2WKSA 3RYFB 2DLNA 1EDZA 1JKMA 4G36A 2GN0A 1AQ6A 1P72A 1YJBA 4DQ0A 3CRNA 3VPCA 1KYVA 3CO5A 3SR0A 1XMXA 4GLBA 2GZSA 1QTIA 3AG6A 1DX6A 4L6IA 2BEJA 1AHIA 4PINA 4PZEA 4V03A 4MI9A 1UXGA 4HPJB 2FEMA 3QVTA 4A0GA 1N36B 1NLUA 5IAKA 3DAYA 2EW8A 1Z73A 3R9XB 4XQCA 3GJTA 1RXVA 2YHIB 4TLDA 3OZAA 3BFVA 3SPXA 1A98A 2WYUA 3E5NA 4CMEC 2G0TA 4TPKA 3QG5A 5HRAA 3DONA 3KKPA 1XDBA 2G9RA 3R5KA 2E5WA 2HHAA 2WHXA 1B0ZA 3HA3A 3HCDA 2QDKA 4JAVC 3LT0A 5DF1A 5HF5A 5JECA 1ZRSA 3VC2A 1MDFA 4GHWA 4CTOA 3FSJX 1QHSA 2DFNA 4KOEC 1E63A 5E95A 2Z3VA 1NKTA 2J3HA 2Y93A 2QG4A 1F0NA 1GU1A 2BEWA 3FZQA 4S0ZA 4N0QA 1V39A 2EJWA 4KYUA 3T8YA 2YJ4A 3BMOB 5LA6F 1SQGA 5BNFA 4YCMA 1UAGA 1ZEMA 4G81A 2FZLA 2OXEA 4LNAA 1R88A 3RS0A 4E2WA 3RNOA 4GPZA 4QSHA 1CRZA 5BQ3A 4DTIA 1S0UA 3DV2A 2QJFA 3H04A 1QHXA 5LWHA 1WSBA 2B6NA 5D2CA 1WUHS 3RUCA 4JLUA 1T43A 4GKJB 1VL0A 2WF6A 2VP4A 2ZIEA 4DYHA 4EJ6A 2FWPA 1A9XB 1OYYA 3ZD7A 1ZKMA 4W5WA 4OQZA 5HZMA 3LZCA 1DMRA 3L92A 3RYIA 4D4IA 5F77A 3M0EA 4CE6A 3OLZA 5EIEA 1UXKA 3MOIA 4KQWA 4P5EA 4Q66C 3LY7A 2Q4DA 1E9RA 2BCGY 1KY5A 2MHCA 4LOKA 4NCKA 4KFUA 5SV2A 4BBPA 2CL5A 2H00A 1DLJA 2VK2A 3VOTA 4AJIA 2EAUA 1XD2B 3DE6X 3UK1A 4IZ6A 4MUHA 4AUKA 1R10A 3KLMX 4N6OA 2O8FB 3GRPA 3KT6A 4H7IA 1QVRA 3ZGZA 1Q92A 4OO3A 4YJ3F 5BT8A 1IM2A 5GOZA 1WPGA 2WJ6A 3WNVA 3I64A 3SQDA 3TZLA 4IFEA 4LTDA 1Q3TA 1WS6A 3MPOA 4LCJA 2C82A 1OXVA 2QL7A 3C3MA 4BMOB 2VK1A 2MINA 3NEYA 4F3RA 1NI3A 5I6DA 1FYXA 5EXXA 3E05A 3HFRA 3Q7IA 1KE1A 3RIMA 4G0UA 3ZWVA 4CM7A 3AKZA 1D5WA 2NVUB 1ZZEA 4ZVNA 4QKQA 3CVYA 4BXOB 3E5MA 5M04A 3U7QB 4M49A 3D2LA 1KFJB 1XZFA 2WA1A 2J46A 3P96A 3U9LA 4R1UA 3DTVB 1JDPA 4OTZA 1SQ0A 5BUCA 1A7KA 4ZEXA 1KDPA 4C7MA 4W5OA 3W5CA 3K1AA 3HJFA 5I4BA 2GNOA 1P3Y1 3SBEA 1K3UB 1REQB 1J70A 3IJ5A 2PCLA 4C88A 4HN9A 1L1FA 3O9MA 2SCUB 2Q3JA 3BAFA 3WB1A 3EGDB 4UOQA 3CLTD 1U1CA 2ZJ3A 2VBIA 4OK5A 5BV0A 5AP9A 1L9KA 1ZK2A 3B85A 3DAFA 3EXG1 3HBAA 4PHHA 4HNSA 1JHDA 2OBMA 3LFTA 4AMGA 4V1CA 1G1MA 3QV1A 3HJHA 1NBEA 2PRYA 3D3EA 3GGCA 3MUEA 2BY4A 3DNMA 5BV7A 1O2DA 3KIPA 1HY3A 2PX8A 2Q5QA 4J43A 5KVSA 2VZ0A 3G02A 3KTFA 3KOWA 3SM9A 1A8HA 3FXAA 4J91A 3OQPA 1GZUA 3IQHX 1ISGA 1PDVA 1JH8A 2QSUA 3A14A 3CISA 2YMPA 2R1TA 2M6KA 3LXRA 3RF7A 3UGTA 2RC5A 1C0EA 2R5FA 3F98A 5D5QA 5HGXA 2KYRA 4HGYA 3JQQA 3PA8A 5I9LA 2FMIA 1FMFA 2Z1NA 2FSUA 3DE3X 2EFHB 3HA2A 1VJ5A 4WKNA 5ALTA 1V8OA 3VU3A 4MKGA 4AN4A 2O8EA 3DHNA 3HXPA 4IJWA 3V4VB 5IJZA 4ZTZB 2V6MA 1ZN7A 2XJ9A 3CCCA 5DGIA 3BIWA 4Y1FA 1PJRA 4KO4S 2BI7A 4CM5A 4YHBA 5DNYB 4S04A 4HWPA 5LKRA 2J9FA 5H70A 4J76A 1RWMA 2ANBA 3NBZC 1TKAA 2JAPA 1KJJA 3LCMA 2PFSA 1M6EX 3O8QA 2R96A 4MV6A 1I4DD 2I7CA 3B20A 3PCRB 3ZPXA 1R9GA 3BMNB 1B14A 1W2HA 1OBFO 4HVTA 4EYKA 2DCUA 1M2OA 5KQMA 4LF7B 4MW7A 3I8OA 3P9PA 5KSZA 3IP5A 5LMNB 4QPJC 4M6WB 1FP2A 2DLCX 3JCZA 1R74A 1ZNYA 5IZCC 3IXQA 3BDAA 2BF4A 3NASA 3AJEA 4RHCA 1CY4A 1G38A 5JE8A 5FR2A 4NZOA 2AI1A 4UE2A 5FLEX 1SCIA 1YR9A 3KQPA 1WXWA 2QMYA 4MKZA 4OLJA 1Z8FA 3L9WA 4DIUA 1T13A 1JKFA 3UGKA 2JCBA 4TLBA 2VCYA 3R9KA 1GT6A 1NC1A 2ZT7A 2XGOA 4HDSA 4M36A 1K8YB 3QU2A 3FA2A 3HM9A 1KR2A 3N1UA 3NPMA 3FNRA 1JQLB 1S3GA 4C08A 3AR7A 3B60A 1S3SA 1XQ9A 1IUKA 5E2IA 3OX1A 3UHFA 2AD5A 1AKRA 4FYYA 4YAGA 3WLTA 3MYYA 5DBEX 4BS9A 2CE2X 2WD7A 2PAAA 3EUAA 3SP1A 4YY3B 2JLZA 3GPCA 3O47A 2C5AA 2AG6A 4FZ5A 2JKZA 2HLHA 2B25A 2C1XA 4R31A 4WLVA 4B17A 1ULHA 2QRKA 3L82B 3F74A 4C76A 1LFDB 4D9CA 5EIBD 2GF0A 5A4MS 4TL6A 2Z83A 3R6GA 5GWXA 3BB1A 1OLUB 1DTSA 5LP6C 3U6BA 1F0YA 3H86A 1A4UA 1VCIA 5IT0A 1W52X 2WABA 4MS4B 2KLHA 5BOSA 5TEVA 2XNDA 1GL3A 3U4IA 1IHYA 1GGFA 3A3OA 1U65A 2GAAA 3Q87B 4TS9A 1X0XA 4ILKA 3SI7A 3M1IA 1JXOA 3SR4A 2OO3A 2PUFA 1SXQA 2PIDA 4ZFNA 4FUTA 3KJIA 1V9SA 1H2EA 3RTEA 1ZJWA 3NAZA 1J7JA 4IMRA 5JJLA 2UYQA 2HHJA 4PHFA 3UMBA 4IIJB 1QOPB 2ACVA 4FE4A 4M0FA 4TTSA 3PHCA 2ZJOA 1PL0A 3SE0A 4ZANA 2VAVA 3GA7A 1WD7A 1WXGA 2OCKA 3PUIA 3Q41A 1L8QA 3V8VA 2P6OA 3S2ZA 2A1UB 4NG5A 2FP3A 3S2EA 3LXXA 4WL0A 5AHWA 1XFDA 3CMCO 3I04M 2E1RA 2VHVA 3CVUA 2GK3A 4XJTA 1KOGA 2C9CA 3ZXUB 4RABA 5JVDF 3A1EA 3D4OA 3HSSA 3VR3D 4KH1A 3EOZA 1E99A 3AP2A 3BTVA 2IDKA 4V38A 1SUEA 4BNIA 1JYFA 2OXRA 5G02A 4JJ4A 2VK4A 3HR8A 5E9WA 3UWDA 2ILTA 4IEFB 1IUNA 1XA4A 2H1FA 3OZUA 3VR5H 3K5IA 3LL7A 1ESCA 1W5BA 1FMTA 3DG9A 1G9TA 1JLSA 2YZMA 1U0HC 1U2ZA 3EMDA 3NBMA 4LJAA 1NUPA 2HU2A 3DMHA 4L4XA 5ALYA 1QC5B 3QSGA 1WDTA 1SK9A 3DDZX 4M8NE 4Q3LA 3UT0A 3TQQA 1PVOA 1N5OX 4H1TA 4G8DA 4JNKA 1RZRD 5IBRA 2YHBA 3EWAA 3KHUA 4HLCA 1GZVA 2B8NA 1CIJA 1UMCB 1GRCA 2JEOA 3FMIA 2UYCA 3E8SA 3U44B 6YASA 2RGCA 1V8ZA 5GJCA 1I5OA 5AW6A 4AJ2A 1OX6A 3VUFA 3NTLA 1XTJA 3GJ8A 2EHJA 4FFLA 4XSVA 1CQJB 3Q3EA 1T8UA 3F3MA 3H75A 4KGVA 5TT0A 4BLSA 1INLA 1FDSA 3D8SA 3I5XA 5BSTA 1VPVA 3VVCA 5LIRA 4YLEA 3KXIA 4BNUA 2ZT5A 2JFGA 2XD4A 4IIBA 2VPWA 4QE3A 2HLDA 2QTVB 2XRMA 4GG1A 4L4RA 1TZBA 4FWTA 2MTBA 4RY0A 1C30A 3MWKA 1BHJA 1SC6A 3LT4A 2HJ9A 2TSYB 3TIXB 1OGJA 3TL2A 2VN8A 4Y0VA 2GJ4A 1C8BA 3F2IA 3GQBB 5SY4A 4C4SA 2CEKA 2ZSEA 4DB2A 1FVHA 2FVYA 4JUIA 5FOTA 2CJWB 3MJTA 3KVYA 2YVUA 1FY2A 4X41A 5TR9A 1O89A 3DOEA 4P3XA 4RTMA 3T35A 5T5QA 1SXPA 3AUUA 4CGYA 5DHTA 1XWFA 5HCUA 3BWDD 2F48A 4LWZA 1U5BB 5K0NA 1KYIA 4G84A 4R8VA 1GU7A 1LQUA 3NANA 5FV7A 5FBVB 3ANTA 1Z2NX 1AGYA 1N3YA 2IYTA 4NAUA 5GONF 4G4IA 5ECDA 4A9AA 3M4ZA 3A6FA 3O31A 1ZVVA 3G1UA 1SU6A 4MWCA 1CPYA 1XZBA 5HZKA 5KS2A 4Q93A 2P11A 4ZTBA 3M9XA 1VL2A 3ROKA 2CHGA 5AK4A 1J24A 3TKLA 4BQRA 3JAMA 3FFXA 3A9UA 4IWXA 5ADVA 4A2QA 4K9RA 5IK2A 3BQ9A 1GR1A 5ER6A 1VIAA 2GEJA 3SOZA 4KYIB 2NZ8A 1QHHB 2JS7A 2OMEA 2WD9A 4MQFA 4I19A 4ITVA 4FYIA 4MYSA 3SF0A 4FB4A 3DBIA 1CJUC 2WF5A 1UOOA 2DQ4A 4MQEA 3TOSA 5JS2A 3AVYA 2JFQA 4OBEA 2CMDA 2EL7A 4PO3X 2SKDA 3ZWPA 4RMIA 1HYEA 5K1ZA 5J4YA 2W9XA 4MK4A 5F9FA 3LMKA 4PV7A 1KPGA 4MYHA 2JZOA 1VM6A 2XNCA 3K2EA 5EE3A 3KUCA 3U37A 3ZN2A 2GASA 1R0XA 3GMIA 4TMXA 2YV4A 1C2YA 3EK2A 1BYIA 2JBWA 5ILQA 5CT5A 2EW2A 1J8MF 1CRQA 3PD0A 4QZVA 5LQMA 4V2IA 1E9DA 2LZ0A 2C83A 3IJRA 4NEHB 4AJPA 1NYRA 2AOUA 2Y99A 2IPAB 2KM1A 3F3YA 4RLQA 3VSBA 2H1SA 2QIPA 3QNMA 1XZPA 1BG6A 1P61B 1FVOA 3WAKA 2G8NA 2HWXA 1QMPA 3N07A 6NULA 4XPIB 2NU7B 2JI4A 4KV9A 1YZVA 4YJHA 2YOFA 5B7QA 5FUMA 2VTBA 2AR0A 4HRAA 4RJLA 1E89A 1H5QA 4CKWA 1D6NA 1DAFA 4RJIA 5TV2A 5KWEA 4E07A 3LPMA 1C7JA 2C9ZA 3RYHA 2YVQA 4IEIA 4UAJA 2NTJA 1CUHA 2COKA 3UMMA 3E9DA 1XAHA 1EAYA 4LTMA 4Q15A 3A3YA 2YZNA 1ZL2A 2PKQO 3M5WA 5CVJA 1PZGA 5J40A 2JGIA 4N9QA 4WFIA 1X7ZA 2C2MA 1E7WA 3CGWA 4BVBA 5I4CA 5AW3A 4M7PA 3ZK8A 3FNBA 1O95D 3BHNA 1ILEA 5IULC 1JFVA 1SHJA 2OBFA 2YZ2A 3VX4A 6REQB 3T3OA 1T5DX 2C4UA 3NEPX 1ZITA 3ZI0A 3HWWA 3TNFA 4BCBA 5JCJD 1RPJA 5D51S 3PHGA 5CG1A 3TGPA 2ZJZA 4LRQA 4WK6A 5DTJA 3M6VA 5F2OA 4RVGA 2X8WA 5IW8A 4PGHA 3FHTA 5A0TA 4JP3A 3ZIAD 4PHGA 2P9TA 1AF4A 1QTQA 1UANA 4UULA 4XWAA 2W70A 1KZ6A 4R2KA 5JV5A 1OIWA 1RVDA 3RAEC 3HS3A 3LUHA 3C5CA 2RI0A 2HBQA 2X8LA 2DHQA 3DEHA 2QV0A 4X45A 521PA 1FJXA 4B3SB 1YZKA 5CGQB 3OHPA 4EW2A 5DHSA 1P31A 1W5TA 4CDMA 4BEWA 3NHBA 3A1WA 3RG2A 3WJ7A 1KBOA 2QMOA 1DG3A 1QP7A 1U7TA 2AJCA 4LX0A 5CYPA 4DABA 1WW3A 1N2JA 2D2IA 4IJMA 2A9FA 2A7QA 2QTFA 4JVNA 2MIIA 4NMWA 3AVOA 4ZKDA 1CYEA 3K70B 1JAZA 1H2XA 1T6BY 1PW7A 3FDZA 1W4BA 3GGSA 3N7AA 1I5RA 2LNDA 1YDWA 3PC3A 4HQLA 1CXZA 4RO0A 5T3UA 1WMSA 2B8TA 3V1KA 4CMHA 1RLUA 3L0BA 3KZOA 1FP4A 1RM4A 3QW2A 4Z0PA 2X1HA 5TMDA 3OH8A 5CAEA 4BIMA 1AKMA 4EO4A 4HEHA 3IEIA 1J2TA 4JA0A 2D62A 4X95A 1X3SA 2HMSA 4DLVA 1Z0KA 1ZUNA 2XTAA 3FGPA 5FLKA 2V1UA 4UJ5A 5LB2A 3LL4A 1ODJA 4HJXA 2X6QA 2HRRA 5D6NA 3HWSA 4JI6B 3SHTA 4E14A 1RC8A 4TYQA 3WHKA 1X9IA 3Q12A 2MSDB 5BMOA 3EZ9A 1XU9A 1ZIOA 3FB4A 5BRNA 4D8WA 1QG0A 3QBEA 1XCOA 4Q48A 3DVLA 3E9MA 1YB1A 2FVXA 1JHXA 1KAEA 2FI1A 1N5JA 4I5FA 4PG7A 1TMGE 2NLOA 3SKXA 3TLJA 1EHYA 2V7UA 3LPDA 1NTOA 3OZEA 4IINA 2PLNA 4PTLA 3ZLUA 3ZWNA 8ATCA 2A1TS 1YL7A 2GRJA 2O2XA 3AOGA 1KJQA 1S89A 2WQZA 3Q8XB 4RZHA 1VSUA 3DDOA 4WNIA 1E5VA 3RUAA 3B1YA 3FPFA 1IZ8A 1YS2X 3LYHA 4FFOA 1I2CA 4JJ8A 4PZ9A 1HRKA 1OYVA 3ZIDA 1T3TA 5JSZB 3BH6A 2CHEA 2X7XA 1FX0A 5JBQA 4AJNA 1MIOB 2WYVA 2QT1A 2XUHA 3NNNA 3TSYA 2H29A 4P22A 4DGQA 3WRYC 1K7CA 5JXGA 1T4BA 1CRLA 1JEYA 3ENNA 4GPD1 2WKRA 1WB6A 1QCCA 2YOHA 3K0EA 4QT0A 4JB3A 4AC9A 3L06A 2ANCA 2Y0BA 3B9QA 4IAOA 3TX2A 2Z5FA 3CZRA 3ZIUA 3E03A 2R8PA 2LVBA 2FPLA 4L8YA 2I1VB 2XE7A 5KNLA 2PX5A 4OYLA 4PQGA 3DNPA 3OQ1A 4EZEA 5BRJA 4RV5A 3CNBA 3GUVA 3VH4A 2BFDA 4EHHA 1K89A 1EFLA 1TNDA 2A35A 3DO8A 4QNMA 4YRZA 1YR3A 2F1IA 1N7IA 2H31A 5H3CA 1Z0IA 3BX1A 4G5SA 4LSZA 1KQFA 1ADJA 2L18A 2YS7A 1XEAA 1AKQA 3U1VA 2WFLB 3GD5A 1JE1A 3DT6A 2GZ3A 1MEOA 2B21A 2UUOA 3I39X 5CVEA 5FNVA 4HUJA 4G2TA 1U8FO 5BXQC 4E13A 3H1BA 1JDJA 1Q50A 1O6FA 3WNDA 3CVXA 1XRPA 2JJMA 2P4UA 2F1HA 4PC3A 1K7SN 3OE1A 1YVPA 1BMDA 4PQYA 3NT2A 2PUAA 1IK4A 1GRRA 2FTKE 4QU0A 3JAWB 4UQOA 4D56A 4E4TA 1OQAA 5G41A 2VPYA 1MAAA 3IHWA 3MINA 3G5MA 5JH7F 4JJEA 5LOVF 2Q29A 1VI2A 3ILVA 1I9GA 3N2EA 5ALVA 3IRUA 1TM1E 3NEJA 4MEBA 1S8AA 2BUAA 2EBWA 3AVQA 2IF0A 3E58A 1Q7EA 4LCBA 5BWBA 1IMOA 1X8KA 3QVGB 5H3LA 3DBLB 2A30A 1DV2A 1N7JA 2F62A 3UXMA 3OQBA 5I48A 1ZN8A 1D2CA 3BDIA 4CT5A 1BHQ1 5AW1A 5GTDA 2DJIA 2PMCA 4CQJA 1B2LA 4NI5A 1E1NA 1JG1A 3QBVA 4HYTA 5CM8B 3TSWA 4LTNA 3DV0B 2Z9DA 3QOWA 2ZUWA 1WULS 3D3WB 3OP1A 4RY2A 3T7SA 4Q4AB 1Z6PA 3D7KA 3HCPA 3H8WA 4K3UA 3TKYA 2ZJ4A 1AQYA 1V71A 4DCNA 2E4XA 4EK9A 5BVGA 1GIAA 3PENA 4S1WA 1TKCA 4MIYA 5G53C 2WIFA 1KVQA 4W5TA 5FA8A 3UYKA 1JDBC 4BFVA 3MK31 3V5NA 1SHUX 4DLAA 3CZPA 1XO1A 3IT0A 2XQIA 1P7WA 2K2WA 2NZXA 2WJ3A 1QPBA 1ZJZA 2YQZA 4LFAB 4YAIA 3D6AA 4P0PB 3PUKA 4ZCPA 1UJMA 1FSSA 1OZFA 2YHIA 4B1FA 1GP2A 3AYZB 2F1KA 4C3VA 1YKFA 4B76A 1R0SA 5IAOA 4GZ5A 3DB2A 2PEYA 3JQAB 1BKDR 1OBOA 1E98A 2Z2ZA 3IULA 4JI1B 2DUWA 1WXFA 4EUFA 3H0KA 2P7IA 3LVQE 4HQNA 1TAUA 3QHPA 1TUEA 1VECA 1LDYA 2WJYA 4UMVA 4QDKA 2G9NA 1PNRA 5DHAA 3ABOB 3A0RB 3E35A 3LCCA 4MYCA 2GA9A 1SU8A 4FEGA 5E9JA 2FUG6 2ZS9A 4RLHA 4PPYA 3RJTA 2W2KB 4JITA 3B38A 4K05A 2Q6OA 3K4PA 2PJUA 1RJ9A 5G0TA 3R75A 1GAQA 1JLKA 2MYUA 3NTQA 2Y67A 4BO4A 3T7CA 5LZ2A 2PJZA 2ZZNA 1DAOA 3LGAA 4F4UA 4Z3DA 1TTPB 3ZYCA 2Y1XA 1ZCJA 3C7AA 3E8MA 1J6UA 3DW1X 4D44A 4NFYA 4W7IA 4EDHA 1HEYA 1KDVA 3RKSA 1S01A 1S6YA 4MIKA 3S7ZA 4PN3A 1Q95A 4B4KA 1GYRA 5BR8B 4NYMR 4OUKX 1TPYA 2I62A 4GI1A 2QYSA 5FQNA 5C5CA 1B4DA 4CZ2A 2C7PA 1KH1A 3LSTA 1O77A 1NRXA 2ZYIA 3V7NA 4AO8A 2ZWOA 3H6GA 2XBLA 1HTWA 1FTWA 2FYTA 3A05A 2DBZA 4TKUB 5LLSA 1YVUA 1BCRB 1RHQA 1OAAA 3JR7A 5K8LA 4LJKA 3S1AB 4C4RA 5A9SA 2L17A 4C2AA 4AX8A 5H16A 5L45A 1RQRA 1U2SA 1Y9JA 2X23A 5AVUA 1XD2A 4TWBA 1Q11A 2VF8A 4U7TB 1YZFA 1VFPA 1N9KA 3A9VA 2Y4NA 5DH9A 1L7DA 3B6ZA 4LRTB 5G4LA 2MR5A 3U7EB 3CG4A 2WUEA 4OLFA 4UD2A 4D4GA 2JVJA 4Y6RA 3N70A 4KC0A 4OAPA 4AJEA 2AC4A 2GN4A 3WS7A 2FEOA 4GR4A 4I3GA 1CZOA 1NI5A 2UYHA 2BFFB 4X90A 1DLIA 2H48A 5BNIA 1Y1RA 1BOFA 1Y7TA 1MMFB 3EIWA 2RMKA 3RSHA 4ECEA 1D09A 4B83A 1C9EA 2VQDA 3CUKA 2YWEA 3KFVA 1G20B 2FN4A 1QHEA 1JALA 3OF3A 1ENOA 5I9SA 4TVBA 4BXOA 2IZ6A 2HBRA 2GMWA 2J3JA 3A36A 4G5FA 5DTMA 4KRFA 2FP4B 3L8DA 4RZ2A 2DPMA 2ORWA 5YASA 3O8LA 3CX8A 4H1WA 1KDTA 1U3DA 1EHCA 2V96A 3HYSA 3QMVA 1L5QA 5JCOA 4HS9A 1PYGA 2Q1SA 2GJ9A 2QEQA 2OO5C 4EO9A 1NW3A 2A59A 3N8HA 2DOKA 4JA2A 2ONZA 4AIRA 1BVUA 3CZ9A 1ABFA 4BJ1A 2IYSA 1G9SA 3R7DA 1ZXLA 3AP3A 4AY3A 4DVJA 1OC4A 1AGPA 3ECAA 4BB0A 4N48A 3KKOA 3QLJA 5GJVC 3PK0A 3FVQA 1T25A 4MPPA 4ETMA 2QT0A 2Q4RA 2W43A 4FGUA 4P5PA 1XNRB 3DMTC 5L6LB 1OZHA 1LLDA 1Z4MA 2AXNA 2WT8A 5D00A 2QRGA 3OJLA 1H2AS 1THGA 4MPRA 5A6SB 3ZDEA 1ACJA 3F7NA 3A6HA 1SQSA 4BHTA 1OB2A 5JD5A 4ZO7A 2VJBA 1GAEO 4QO8A 4UUMA 2DKNA 2IXGA 4YVFA 2DSTA 5HQ3A 3KOMA 2EQ5A 4J0KA 4PYRA 1JP7A 3F6SA 1CZKA 3RCBA 3WGIA 2VT3A 3BSYA 2C03A 5AKKA 2JGJA 3E81A 3ROGA 5JISA 4FBMA 4QULA 1ZS9A 2RBEA 5LB4A 3OCUA 1JS1X 3TCKA 5GJBA 2IIQA 1YL5A 3PLNA 1CVRA 1W0KA 1DNPA 2Q1UA 2J7PA 2ALJA 2G4CA 2W6ZA 5H9VA 4GR9A 3U7RA 4Z4QA 3TN7A 2V1XA 4MLPA 4PXYA 2WTUA 2CUTA 3ZE2B 4RQAA 1T5HX 4YCDA 4IS3A 1UEIA 4OQEA 2RAVA 1G20E 2UZ1A 3OSUA 1W25A 4XYMA 2AOTB 3GARA 4FFWA 3VZDA 3TZQA 3CUSA 2M1XA 3H5AA 3L7OA 3PDCA 4HZUA 3K09C 5KQGA 1BMFA 1L4BA 2H4WA 3KEQA 2XNDD 3AL0C 4TL8A 3T15A 2JLWA 1D0IA 2CXPA 1LF5A 5AXBA 1U7ZA 1UDAA 2VCEA 4MKIA 5B6IA 2J0QA 1E2NA 1WHTB 3M3DA 1QIMA 3KPJA 5KAPA 4QTYA 2ZYVX 3PTZA 4M6WA 3ZV5A 4XUDA 2PAFA 2BBSA 2HA4A 4CR8A 2PPLA 1GDDA 3KLBA 1CUSA 3EGEA 4C3OB 1Z2CA 1GAXA 4BN5A 1QFJA 3H83A 4RCVA 1B6TA 2OY0A 5A3SA 1VIYA 4NONA 1A5AB 2F3UA 1UJ2A 2L19A 2Q3FA 4NKRA 3ZDXB 1RXUA 4V0SA 2FQYA 1JSCA 1MJNA 1F0PA 3HMKA 1CRPA 2K6GA 4IIGA 1NDQA 3ND7A 4X64B 5C7IO 2EEZA 2AJBA 2VH2A 3LVBA 4Z51A 3DVAB 4BRSA 1ISFA 2WRZA 4MRMB 5ED4A 1K08A 3GJXC 3SHOA 1KI6B 4PE5B 3ROPA 4DMKA 3GJ0A 3H1GA 3NHUA 4HGZA 1XMVA 1NFFA 1VRCA 2WHQA 2YWHA 4PHCA 2QTHA 3DZKA 5AXDA 3SSMA 4QTZA 3WB2A 1AKWA 3A3NA 2LW7A 1DARA 3HVJA 4UHBA 5HS6A 1WW2A 3K4QA 2O3QA 5FT9A 4JX9A 3B6JA 1OU0A 4JI7B 3LOUA 4YRDA 5B1IA 2C4NA 4IDFA 1YOBA 4FFDA 5FPPA 3ZBUA 1D6JA 3QU9A 4DJFC 3A6PC 4CMBA 3QE2A 4FWBA 1N3BA 1BH2A 3EWSA 1WSDA 4L6CA 2BLNA 4MS4A 5B4VA 3MHTA 5JRZA 1N2EA 2J48A 2MT9A 2QB5A 3G2QA 1JR3E 1ZK0A 4ZTUB 2W4MA 3RVLA 3RS3A 4G4GA 4RSGA 5L3QA 3C1AA 1QH8A 2D3TA 1DIGA 1IQRA 4LXIA 5LUAA 1M0TA 1E6KA 4JODA 2P9JA 4FZJA 2ZYUX 4LSMA 4R0VA 1HLFA 4RTNA 1T5BA 3DZFA 5CT4A 5A3JA 4OX9B 4QLOA 3W6UA 2WE7A 4R1TA 2AHRA 1KVSA 2XTJA 4BJ3A 1E3SA 1HT1E 2HLDD 3EW7A 5B58T 5JJ5A 1GTRA 3C7KA 4J49A 4DBLE 2V0CA 1XPOA 2A1UA 1ESZA 1TOAA 4KQFA 4PVCA 1QQ6A 2VYCA 4H1UA 4GYKA 3C3BA 3K6RA 2FCAA 1W6UA 3T3DA 3UMFA 3GEBA 3ZK7A 4KFTA 3IAS1 5DB4A 5FBHA 4LCEA 4AF7A 3JPYA 1DBVO 1PLLA 1E2IA 1RZVA 1Z0ZA 2J3IA 1ORWA 4LGVA 1CS0B 2C3OA 2OHXA 2Y2VA 3DBRA 2C5SA 3J80A 1IC6A 1RXSA 1C3JA 4NV1A 1DXOA 2A6PA 4O0LA 1HFWA 3FN4A 1RTKA 1U3UA 2P6MA 3PNQA 5JIBA 4ER3A 1J2YA 1J7KA 5ANRB 2ZUBA 3HTXA 4BZWA 3DFMA 4KNVA 3IDQA 1N34B 3L0IB 3FM9A 4UTPA 3D4BA 2POQX 4TMYA 5ADHA 4EUSA 2JBAB 3MIIA 1UMCA 1Y98A 2EDAA 2Z3ZA 5K3SA 1WXEA 3V2GA 2W37A 3A8TA 1KOJA 1YRHA 3GUZA 5K0TA 1USGA 3TZCA 1EWKA 1NVVQ 3OJXA 5IK2D 4Y2GA 2ODBA 3KEOA 4WFJA 1E3MA 1CWUA 3QE4A 4ENVA 3T9DA 2DWOA 3I32A 4B3CA 3P9ZA 1U0TA 2SKEA 3ZBQA 4YMHA 2WW8A 2EJUA 3QPVA 1O58A 2GN2A 3WDSA 3IAEA 1VA5A 3B1XA 3M83A 2QTVA 4HDNA 2POCA 4P7GA 4RELA 3ROTA 3AP1A 3D81A 5I5GA 3DHYA 1T9GS 1U28A 1IY2A 1QFXA 2B94A 2OR3A 3FVVA 3WMXA 3E7FA 4CUJA 5L51A 4I5GA 3RWMB 2FOXA 1X80B 3UFXB 4WXEA 4ALLA 4Q1CA 2FFBA 1PZFA 4PX2A 2NU9B 5DDIP 4CJXA 1ZESA 1QGOA 2Q2OA 4BJ6A 2BGGA 3QBTA 1BTOA 4FPXA 5G0SA 1OH8A 1OH7A 1PUXA 5IJXA 5JSHA 1PDWA 1NBOA 3L6UA 1R1DA 1GY8A 4MUGA 2XDQA 4C30A 2RH5A 3GPLA 4A0RA 4FOPA 4KPYA 3HRIA 5ALRA 3AKDA 1YJ8A 4M60A 3SY8A 5LNK6 3ZY4A 5LQUA 4KQJA 4RVCA 5HRUA 4KO8A 2HK6A 1W36D 3H9UA 4XA8A 5BSKA 2B3DA 4JT2A 5ELLA 2E18A 2G63A 1PR0A 3UCFA 1HKUA 3JWPA 4MW0A 4RCYA 3KNZA 4UNIA 2V0GA 1HDXA 4FGLA 2KI5A 2FQWA 4C05A 2WILA 3AHGA 4G4SP 3BHMA 2BT4A 3GGJA 2IPOA 2YUIA 3C3JA 3OEWA 3IAHA 1O0SA 1YDGA 3IH5A 1DEOA 1BIFA 1CS4C 2IS4A 2C2OA 4F3KA 3RT1A 1NRIA 1S8OA 2QVCA 4GL4A 1CG6A 1E79A 5EC8A 3KQYA 4FI3F 1Z68A 1SG9A 4Q01A 1QO9A 3HADA 1KY4A 5ALEA 5CDGA 1ZD4A 1HYHA 2HFJA 1M6HA 4IDDA 3DSRA 3PRJA 3EQ8A 2GBLC 5JHHB 2A5LA 1AHPA 2VXBA 3GCXA 3KPUA 3HUUA 4FFRA 4PQEA 3NI2A 1NVEA 1NNSA 1U9IC 3GA0A 1BYUA 3TW8B 2WD8A 4ER7A 3OQOA 4W5RA 3D7NA 1QIIA 1Z5WA 1LQTA 1BXKA 2PH7A 1HZZA 1EXMA 3FMVA 4V2UA 4D0NA 4DYVA 1V41E 5IKEA 3I83A 4X20B 3CRVA 1G5HA 2HXYA 2N9UA 4XPIA 3CUVA 1CNEA 2K87A 2XT6A 1ESMA 1CX9B 5EIFA 3M4NA 3RYCB 4Q3KA 2I4IA 1U0RA 3PTLA 1PX2A 2UXBB 1Q1GA 2ZJ1A 1EFCA 2NV2B 3GEEA 2D5LA 4J94A 1NSFA 5BY2A 4IDCA 1ZOSA 2A1TR 2UUCB 3AU8A 2DWPA 3LUJA 3MTDA 4YXWA 3QX3A 3A28A 4N47A 3PKJA 2GZAA 3BL8A 4PYJA 1GPLA 4OHVA 1OU4A 1X74A 2P2LA 2C3MA 4YDQA 3U6KA 4TMZA 3C97A 4FGWA 5DHRA 3C70A 4JP5A 3IFSA 4X1KB 4UHJA 4F5WA 4ZIRA 3COZA 1PUJA 1LGYA 2XR1A 1EGAA 1CV2A 1OTHA 4UU1A 4ZPJA 2XGGA 1E3JA 4B3JA 4E6PA 1E7QA 1H2WA 1QVZA 1SU7A 2BKXA 2W2MA 4XGQA 4I81A 4YDRA 5K3DA 1EUQA 4R1QA 3ZCSA 3JQPA 4TYYA 1EB9A 2GESA 2RHLA 3AV3A 3WOVA 5BUZA 5CFQA 4ZYXA 3CEAA 2Q3HA 1GD1O 4GOMD 4HTFB 3DAHA 2FB9A 1GEEA 3Q9NA 3A58B 1L2TA 5AHKA 2ADFA 3T5GA 3VQTA 3IV6A 4GO1A 5E6SB 5HM8A 3ANXA 1U1GA 3K94A 1V43A 4ZHSA 1GAWA 1DRJA 2D0DA 1SVOA 2JANA 4PPQA 1KIAA 3L5OA 2ID4A 1QX4A 2AMJA 4CDNA 3I5YA 2ZSHA 1WB4A 3PFFA 4JFAA 2ADOA 5DRYA 4RUKA 4AYTA 1IULA 4FFNA 1XZIA 1LWNA 4XD7A 3V4OA 2ZI7A 4QAQA 5A7FA 1N0UA 4D5GA 1QB7A 1QQBA 2J32A 3OY7A 2ZJ8A 4IEEA 4P3YA 1EEXB 1UMBB 5DT9A 5EVJA 5ECWA 4A0FA 8OHMA 4UZFA 3FIJA 2H2DA 1CDEA 1RXEA 3MM4A 1KRWA 1G63A 2NP7A 2P5YA 1XRQA 1Y4UA 2ZPTX 1UZNA 1OLSA 2ENUA 3AM5A 1EJBA 1UWCA 1KYZA 4X8LA 3T41A 3VHLB 1ZJ4A 4EEXA 1OBHA 2ZBGA 1OW3B 3B1FA 3ORHA 4JUAA 1P19A 2FV8A 5BMVB 4RSRA 4LF4B 1IQ0A 2KB0A 2J07A 2NSHA 3L8MA 5BT9A 3V7FA 5EWJA 4EVRA 3HVRA 3U4AA 2H1VA 5B1SA 4DCSA 4GXNA 4J2HA 1CEYA 3RS9A 3NWOA 1QHFA 4RDIA 1M9NA 1YDEA 2FFQA 2LV8A 3ANNA 3DXXA 3OLVA 1CT9A 3UAOA 4X7BA 1Y9ZA 1URPA 4GECA 3TDMA 1EXNA 3P9XA 3ZWDA 5JC8A 4C21A 2FHSA 2ZAIA 3WYDA 1UDWA 3GMSA 3FPHA 5FTMA 1KERA 1FB5A 1GT91 2C0PA 3SR3A 1NR5A 1PYDA 4MW5A 4PG4A 1U98A 5ABPA 3MCVA 4CEJB 2JFPA 3BC1A 2FF7A 3QXJA 2HQ1A 2VFAA 1THZA 4BASA 4BLVA 4O8ZA 3RFUA 5HKBA 2YMQA 2BJHA 2IDZA 2ZROA 2FMXA 3W79A 3JYQA 1Y9EA 3QIVA 4REMA 2D5AA 3FPLA 3ZE6A 4D6PA 4RH0A 1KK1A 4Y1RA 5EGSA 2C78A 4DSTA 3RVOA 2VC2B 3Q3VA 4OA8A 2OL4A 3DM5A 1F2UA 2XEXA 2ZFUA 4DUPA 4QGSA 2PL1A 3NONA 1RKBA 4RXMA 1U3TA 4D25A 1EQUA 4GZLA 4NFLA 5AYVA 1E3WA 3WL3A 3OQ6A 5ALDA 5IAGA 4GEKA 5JSZA 5KX5B 2QVGA 3DJYA 2DTDA 5L9AA 1NQ5A 3SSOA 3S2UA 1R4NA 2BCEA 4DLNA 4MWZA 4I1UA 3LVRE 1RP1A 3QMWA 5I7OA 4Z7JA 4GM1A 3NVKI 4MYRA 2ZRFA 3VSDA 3KYCB 1IHPA 4QUEA 2XCUA 2AOXA 1JDUA 4W1QA 2ABWA 3STXA 2HBZA 1LC3A 4OI4A 3STYA 1EZZA 3O95A 1M8JA 3USCS 1Q2XA 2PMEA 5FWYA 3CKLA 2AQHA 2AK2A 1R3DA 4FR2A 3D1LA 4QQRA 2YICA 2HF8A 2VHQA 1C3VA 4XFKA 2X8AA 1H8HD 5FWXB 5HKOA 2WHEA 1ECCA 5MDHA 4DUYB 1Q44A 1TJ4A 2VSNA 3FNEA 3WRWA 1GM5A 1WEKA 3ZUGA 4K9NA 4RAOA 1QQAA 1RZUA 1M2EA 3T3PB 4Q9NA 2QAGA 2C0QA 4YRCA 5FUXA 1A2KC 3GQVA 3HUFA 5HVNA 1E9AA 3JAWA 5KOIA 4IPTA 3IR5A 3RIXA 2N46A 1UF9A 3L8GA 3LBAA 2NP6A 1LVUA 1P9LA 4GOJA 1NBHA 4LWQA 2XA2A 1POWA 1Z7YA 3FMFA 3IDZA 3JQ8A 4TTTS 4U02A 1RDFA 2PZAA 3WK4A 5BWMA 2XBMA 4G4SO 3LRXA 4DS3A 4JLPA 4BC1A 4ZCTA 3IIMA 4UBLA 4EGQA 3EXIA 4UCWA 4FYHA 1U3WA 2HI0A 3I0MA 5FAXA 1IN1A 4U6QA 4RS4A 4HB4A 1F8GA 4I55F 4UPDA 5L95A 1M2JA 1NMQA 1Z7EA 4MGZR 1YWGO 4R9SA 3WLLA 3T1OA 3K1JA 5A5DA 1JKJA 4TM7A 1ULBA 3E23A 4B4WA 3W7AA 4TV8A 2ZYWX 3KB1A 3M1AA 3QQ5A 3DDCA 4P4LA 4WW0A 2QTAA 1GPH1 4R1NA 4LI0A 4IQ4A 4K9QA 1UXOA 2BZGA 3SC3A 4BTVA 1SXJB 5KU1A 3PQ6A 1DCTA 4GDMA 5BNWA 4MLDA 5IF9A 5G0WA 4BRUA 5JBNA 1CUIA 2CZCA 4B6QA 3AIMA 4GUAA 2R68A 3HZHA 1E0SA 1V25A 4ZICA 3TS1A 2ZSBA 5K4HA 2C04A 1KMNA 3SZGA 4JENA 2A7XA 5T57A 3RS8A 2A0XA 1YRLA 3WP0A 2QP4A 1XLUA 2I1QA 1LRJA 1ZD3A 3CB2A 3GVHA 3HZOA 3JQAA 2IE0A 1R27A 2H9IA 2JGKA 3V9PA 4FHZA 4TZ6A 4N3AA 4IVQA 4ZZ3A 1G7CA 1DG1G 1U8TA 4UEWA 4WZBB 5ENDA 1FRFS 4F4HA 2HCFA 2XXAA 1IEWA 2D2EA 2O2IA 3NS7A 4EA7A 1UBOS 4J75A 1CEEA 4EITA 3GL9A 3FAZA 4FMBB 2H0AA 4OXRA 4N5NA 2G82A 3FVTA 3EVAA 4A8JB 3ZWKA 2FSVA 2BM1A 4LXUA 4LXQA 3QKWA 4IHJB 3R3WA 3AUAA 4LC9A 4EIWA 3F4LA 4J3FA 1FUYB 4JBHA 5I8WA 1FDTA 2R8XA 3ANLA 3DS8A 5GMOA 2DSNA 3ZXXA 5CLGA 1QG4A 2P41A 4EBFA 1SCUA 3O21A 2R4TA 2I29A 1GL6A 2ZRMA 4D4KA 2YIJA 4D81A 2BFEA 1JR4A 2GD6A 4QOJA 2YMMA 3WFZA 4ZEVA 5CDSA 1NW9B 1Z4OA 4AZ3A 1AV7A 3ZHSA 1KZYC 1O7JA 3CGGA 4ZMBA 1PFUA 5CVVA 2NSDA 2CF5A 2BGMA 2FW6A 1FNCA 1K63A 3SX2A 4YIHA 1KDZA 2Y0CA 3S1AA 4ZYYA 1NULA 1V7CA 2IYWA 3DCYA 5CHEA 4E5NA 1LLCA 3U3OA 1SXJE 4O0MA 1NW4A 2Q3EA 2J30A 5EXTA 1RYFA 4PRKA 4M0MA 5BWOA 1KE2A 3C0KA 3IQFA 4RXTA 1SBNE 1WHSA 3LI2A 3W4JA 3KQTA 5AFSA 1KVUA 4II2A 3AR9A 2VZ9A 4JR0A 2NV0A 1W1UA 1FQKA 4MMYB 3TJZA 5D84A 3VKGA 3OCZA 1UFRA 2J7PD 1ZIYA 3WMGA 2DU8A 4Q4HA 1R6BX 4OQLA 1R0KA 1GFWA 3MOSA 4WZBE 4ZOQI 1E4EB 1FYWA 4W8HA 3U19A 2ZSDA 1GNPA 2G7MC 1O1YA 1TIPA 2JLSA 4FQ8A 4BNFA 4JDUA 1JPJA 3C1UA 4RPIA 3B9BA 5ALUA 3PNVA 1MCZA 4FHCA 3R3SA 1YBFA 5F3WB 3RS5A 4O6VA 5DLDA 1ULAA 1GEGA 1FU4A 1JBEA 5H80A 4HAOA 1OWPA 1PFVA 4MW1A 4BGEA 2ZE7A 2WWVD 1VB3A 4PPFA 4PW0A 4U8GA 3KSZO 3RREA 3RVDA 3UO8B 2D3WA 4DLSA 3PGLA 5EHGA 4E94A 2D54A 5TMBA 5KOYA 5EHNA 4RHYA 3CRRA 1GZ6A 2ZUCA 2ZYRA 1L7XA 3L5KA 1KK2A 1P1JA 1LLFA 1SC1A 1PJ2A 1YZYA 3LQQA 3P26A 1UBRS 2NUTB 3DMPA 3HFSA 1G16A 4ES6A 5B7GA 4WESB 5T4EA 3UT5B 1RE0A 2OBXA 3S1LA 2F4NA 2ID7A 2PUGA 3N8DA 4X6LA 2PT6A 2FF5A 4F46A 4ARUA 3PX7A 1PS8A 3C7TA 3MWLA 2M2IA 1BSVA 2ZAMA 3HYNA 1NBME 1V0JA 3OEEA 1OWNA 4Z1OA 2OCBA 2V9ZA 2ZM6B 2BV3A 1MRZA 3L8ZA 4F3CA 1YD7A 3AEQB 4WHMA 5AKEA 5BRAA 1TO6A 3F8SA 4E0BA 1H3FA 4L16A 1O6BA 1ZDMA 5J9FA 3UB3A 3VH3A 4JWTA 5E38A 1ZK3A 1M0WA 1AS0A 2B4QA 3CTMA 3WGMA 5H5JA 1RNLA 2VHZA 2QXYA 2IV2X 3W5JA 3M5CA 4FIDA 2OB1A 4ZODA 3K5WA 4RGYA 1C7EA 3HJBA 4DPKA 1WUTA 1QGAA 1U8EA 4AKTA 1W19A 1IVYA 1IATA 1K27A 2R44A 3KYIB 3UCXA 5I7HA 2OV6A 4JP2A 3QLEA 4RLFA 1G4HA 3O2NA 3JAKB 3ORFA 1DQZA 2OSBA 2DF8A 3MA0A 5GM1A 4JKOA 2QUBA 5C4GB 1N6PA 1UKCA 1OT3A 2KLBA 2XZPA 3H5OA 2QN1A 3NM4A 4HT3B 3T3GA 3HDTA 3VHRA 4AJ4A 1PFGA 3AT1A 3H5TA 2X9VA 4FEAA 5CH3A 4RNCA 4H60A 3PQCA 3GFSA 3Q3GE 2W2VA 1R6TA 1YV9A 3BIXA 5DM60 3OD5A 3P0EA 2I0FA 2IY7A 3EODA 2HMAA 3Q0TA 2JJ2A 3BS4A 3DCJA 4KLAA 3VVMA 2CV1A 1BXRB 4W5JA 1DINA 5AM2A 1OASA 2CUKA 2XIJA 5C7YA 2EKQA 4X8OA 4XWGA 1HFKA 1PR2A 1GG5A 1OVMA 1TIBA 1V6SA 3ETNA 3PUZA 4FC6A 4E1AA 1J99A 3DOCA 3I8XA 4YAOA 1N9ZA 2J4DA 2IFTA 3WRXC 1P60A 3HYRA 4QXRA 5B36A 2HR1A 3N3BC 4M7RA 4TN1A 4URZR 4OFXA 3IO3A 5DSTA 1J42A 3ZHUA 3KV3O 4QHSA 4GX5A 1DBRA 1V4VA 2OMKA 2GUGA 3FMGA 3IUQA 3QLUC 1T9GR 1TLFA 2W2XA 3SVZA 2FPUA 1PSWA 1DPGA 4WBSA 4GZMA 4WBNF 1NN5A 1TT5B 3WKAA 1UADA 5D3ZA 5CUQA 1QVVA 3HKEB 2I65A 2CXQA 2O7QA 5A3VA 2WINI 4R05A 5TE9A 2CYBA 4G5OA 2YTZA 3FH0A 3O9ZA 2KE5A 3QVWA 1LWOA 5LMZA 3Q8KA 1XLTC 3PXCX 3QWBA 4AZTA 1GCAA 3NLLA 2PMKA 2KWIA 2R8RA 5JR3A 1AM4D 3M4JA 4UNRA 4DV0B 1IEXA 5AHOA 3V6MA 4C2BA 4N01A 3ONNA 2KW5A 2YNMC 4RORA 4ZOLB 3LZDA 5CLJA 1MO4A 4PANA 2ZRQA 4RJ2A 1TW2A 5BSMA 3P2YA 2AC2A 1EM8A 4EEKA 3BGWA 1KTIA 1QHIA 2C95A 3AG5A 3WG9A 4ND4A 5F5LA 1FFXA 3TD6A 2ZXEA 3CZCA 1VPTA 3KVOA 7MHTA 1LDNA 3F3KA 2EKPA 5GP1A 3MT7A 1BFKA 2MMGA 3ZDBA 1GHTA 4PBSA 5CD1A 1R16A 1SRRA 2VPZA 3OICA 2IX3A 2VG8A 2BD0A 1QYWA 2GXSA 4OI1A 3UY4A 2H7YA 3U7GA 2PH5A 3OCWA 1NW7A 1QZZA 3IOCA 2Q7DA 1RC0A 2I3ZA 3L0OA 1ZD9A 2WV7A 1WOMA 5CVDA 5J23A 5CTJA 5HIKA 1A9TA 4WH0A 5JT1A 1IEQA 3GUUA 3D6UA 4FOSA 3TTYA 4PYLA 2G28A 3AX6A 3LCVB 4RDHA 1P1KA 3DCIA 3HN2A 3BJRA 5C1IA 4B75A 5JANA 1CS0A 1NXVA 3HXMA 1QK3A 4DDTA 3DO5A 4DM3A 4DLXA 2O6HA 2JCXA 4MVYA 2QL5A 4W6ZA 3F49S 3BSFA 3OFJA 4A23A 4CKXA 1D2MA 4BV2A 1KO8A 1RBMA 2Y8EA 1NGSA 3MWDB 4CLHA 3A4TA 1W4LA 1JG2A 1SEVA 3L8FA 1H6CA 2GAOA 3FX2A 1EGHA 3PQ7A 3T52A 4EW1A 1R6DA 1HE1C 1DTWB 4PPNA 4ITRC 1DAMA 2WNSA 2Z1MA 2XVYA 4HGNA 5CVTA 3FBWA 3VUEA 1EJ0A 2BGRA 3A0UA 3BILA 2EXXA 3GG9A 4JP8A 5KAMA 2WDPA 2OZLB 4PTYA 1PL7A 5AW5A 3AB8A 5KYTA 3QKIA 1VHQA 2Z2XA 3DHWC 2R2AA 4AXXA 2B6HA 1QGYA 5DI3B 3OE4A 4H0FA 1SCQA 1E79D 3BXOA 1USKA 5DNWA 4X6XA 1EVQA 4D97A 3TE6A 2O0KA 4TUYF 5HUQA 4I50A 2UVPA 1I3NA 3CF0A 3EULA 5DT2A 3G0CA 2B2NA 4YT4A 4IXWA 4KP7A 2H7XA 4BFCA 2PD3A 1GUZA 3RBAA 8GPBA 3RE1A 4C7BA 2IBTA 3R44A 1BX0A 4HZGA 4H7JA 1L5LA 3H65A 1K66A 2Q5OA 2VNKA 4JU8A 3WDKA 3EPKA 4CM3A 2CFRA 2QTMA 1V47A 3KVRA 5EJIA 4C7JA 1Y3IA 5H8WA 1P8AA 4LQLA 2ZR9A 3GLHA 3T0GA 3ABQB 4AW9A 221PA 3EC2A 1J1ZA 3EOAI 4B7ZA 4CBVA 3AH8A 1V7QA 1Z0UA 2FW8A 4L8LA 3MGKA 3DMDA 4C5AA 5AOAA 2VYND 1IOZA 2FQQA 3NHKA 3IAFA 1LVGA 3PL1A 4XSHA 2IWRA 4BNJA 4B5KA 4RTLA 4B3TB 2GDJA 3DGFC 3LP8A 5IASA 3HVKA 5KWIA 4YXWD 2GVZC 1JQBA 5CCDA 4F97A 1G42A 1XOIA 2VSQA 5B3JC 1P2GA 1B00A 4FUQA 3IV9A 2PXCA 3QUQA 2HM7A 5FA5A 1DCMA 4QM6A 3M6AA 1RACA 3ELUA 2GPNA 2V3CC 4D0SA 4XWTA 3WL7A 2QU7A 1IDN1 3AI2A 4KMRA 4LV8B 4LF5B 2IITA 2GD1O 5MFZA 2DFPA 3G59A 3TLGA 2AV6A 2OVFA 4EHJA 1PTKA 1A3CA 3FNFA 5JARA 5LN1A 2QP3A 3IBGA 2DY1A 2O1WA 4QBIA 1PR6A 3UK2A 5AJWA 1SIWA 1JZTA 4UAGA 4GPAA 2V4MA 4YRTA 4D8TA 4MV9A 1KWKA 3A2NA 5DZSA 3RARA 3WYBA 4A8PA 4IIUA 2X0IA 2EZ4A 1TLLA 4M9SA 5E3HA 1IY0A 3PQ8A 1RIFA 1TU4A 2PPVA 4KE7A 4M8KA 1GGEA 5D6OA 5JWHA 3WFIA 3CZ5A 5EP1A 4DQDA 3AR2A 3HB5X 4HQ0A 5LP6B 1WPXA 1DC6A 1FCJA 1ZCAA 3Q5EA 1J9GA 3JQ7B 3TAXA 5HW0A 2JRCA 2I2DA 3B70A 1OTYA 4B82A 2W2NA 4X20A 3GRZA 3DBOB 3L1KA 1BWRA 2OFOA 4XD7D 3PUVA 3PHIA 3UC9A 2A5FA 2WF7A 4LX8A 1MPXA 1RHKA 2O20A 2OHJA 2XGMA 3I28A 5D1NA 4HB3A 5K6TA 3LOQA 3ZVNA 3TRHA 1WKVA 4MEJA 1U7WA 3OJFA 3V4PB 2HOQA 3DB1A 4HKTA 4ONEA 4AX4A 4ZQIA 4AFNA 3ZKWA 1KMHA 4QXPA 1ENYA 4EF6A 8MHTA 3BB3A 1LFAA 4P0QB 1I6MA 2WJIA 3EXEA 1WG8A 4HDQB 1TC1A 3CH6A 1NZFA 3DMNA 2PX4A 1R3UA 2ERYA 3EG9A 1Y3BE 4L78A 3GNLA 3UJAA 4Q3NA 4EHIA 4E12A 3NOOA 4ZPXA 2RONA 4D4MA 4K46A 3EVNA 2PA0A 5IU6A 9LDBA 4QNRA 3FNIA 2XDYA 2YUTA 4MUNA 4ZAYA 1N9GB 3SFTA 4HH0A 4MB6A 2IYOA 3OSZA 5C1PA 3KSDO 4OEHA 4IIHA 5LQCA 3KQUA 4MVJA 5E6SA 4O5AA 3R8CA 1E0KA 5JZBA 3UWKA 2X9GA 4L51A 3S68A 4Z7OB 2ACEA 3FPGA 1ICIA 2UUAB 4HLUC 1TD9A 1KAMA 2Y27A 4DQXA 1YOVB 4RFLA 4ISBA 1XI2A 4QPCA 5K8IA 1AA6A 1PX0A 5CIQA 4W99A 4S2EA 1XQYA 1OFGA 1FRZA 1CQXA 3PHJA 3C6MA 1TYDE 4KUEA 3DA8A 4X3CA 1N57A 4V0NA 3UPDA 5KU7A 1V8PA 4DG5A 1T9CA 2OLJA 3ZHVA 3GAZA 1UMBA 2X1VA 1L0BA 5AIBA 3GVXA 2X5XA 5U4XA 4JBXA 2GPYA 2IXBA 5JSFA 4KIWA 3SLGA 1KARA 2ZXUA 1BOOA 2FMUA 4XIIA 4TX1A 3KWJA 3JXEA 2PU5A 1BHSA 3TNYA 1OVGA 5A03A 4DV3B 1QH1B 1XBTA 3GP3A 4GBJA 2WMDA 1WKCA 1GPMA 4EO7A 3AI1A 1EJ2A 3F8TA 3NFYA 4BLUA 3CKYA 3UAZA 4NDAA 3BWYA 5BMVA 1CF4A 3I34X 4KLRA 4MR8B 1NHGA 1QCZA 5MGNA 5ARCA 4IH9A 4GF5A 3ZVKA 2IP1A 3EJ6A 4YUVA 1EVYA 3LFHA 4K86A 4PLVA 1C41A 5F4ZA 5I4KA 3C41J 4Y2PA 2FR1A 1UFKA 4L9AA 4CQLB 2W93A 3BXFA 4KXLA 4BY9E 3O3OB 2R00A 1T1GA 2WTMA 2YFKA 4HB0A 4XYGA 1RM3A 3AYXB 4HPWA 5REQB 4XVHA 2NVOA 2DHRA 3ZHBA 2HWUA 4P84A 4E46A 2IY9A 3DDSA 1UR5A 1L4EA 1A4XA 5FUQA 2J3LA 1L5VA 4OYRA 1KQNA 2BFAA 3OWOA