2I6GA

Crystal structure of a putative methyltransferase (tehb, stm1608) from salmonella typhimurium lt2 at 1.90 a resolution
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
199
structure length
169
Chain Sequence
GMTVRDENYFTEYGLTRTHSDVLAAAVVAPGRTLDLGCGNGRNSLYLAANGYDVTAWDNPASMANLERIAAEGLDNLQTDLVDLNTLTFDGEYDFILSTVVMMFLEAQTIPGLIANMQRCTPGGYNLIVAAMDFPFAFEGELRRYYEGWDMLYNEDVGLRFATMLARTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative methyltransferase
publication title Crystal structure of putative METHYLTRANSFERASE (16420133) from SALMONELLA TYPHIMURIUM LT2 at 1.90 A resolution
rcsb
source organism Salmonella typhimurium
molecule tags Transferase
total genus 51
structure length 169
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03848 TehB Tellurite resistance protein TehB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2i6gA00
3LHDA 4PIPA 5KYGA 1SKMA 1JSZA 2PWPA 3FPGA 4OBWA 2OXTA 4C05A 2EJUA 4DCGA 5K8VA 3A7DA 5HIKA 1NBIA 4H0NA 1X1DA 3HA3A 1NBHA 2ZVJA 3KQYA 4DMGA 2ESRA 5K0GA 4EMSA 5LQJA 5FULA 4BP1A 4E2WA 1R74A 2P3LA 4OX9Y 2I62A 5DLYA 3FPFA 2OYRA 4QPNA 4LWOA 3FPEA 1BHJA 3VC2A 5GWXA 3GWZA 2C7RA 5EHGA 2Z6AA 4NECA 4C03A 2ZZMA 3MTEA 4PCAA 5E2AA 3NWEA 2R3SA 4O29A 2CKDA 3MTIA 3EGIA 3IYLW 3NJRA 5HILA 4DCMA 1NT2A 3R3HA 2ZBPA 3FYCA 1VPTA 3EGEA 2JH9A 3CC8A 1XDZA 5BW5A 2PKWA 1BC5A 2ONYA 4KDCA 4P7FA 1YB2A 4XUEA 1AV6A 3LBYA 5T67A 4POOA 3L8DA 3EPPA 2R6ZA 3HVHA 4V0QA 3HCAA 5FHRA 2ZSUA 2PXXA 3EVAA 5EEGA 5FTWA 1I1NA 2P8JA 5HOQA 2BZGA 3EMBA 2C7PA 3K6RA 3ELWA 3KQSA 2ZBRA 3EVDA 2HTEA 2P40A 2OZVA 3BWMA 3DP7A 3HCCA 4B17A 2P7HA 2B25A 2ERCA 4RVFA 5E9WA 3PT9A 3OCJA 4CKBA 1NW6A 1AF7A 3SX0A 1O54A 3ID6C 1L3CA 3LKZA 4R8RA 1SUSA 2GA9A 4GBED 1Z3CA 3TQSA 2B78A 2UYHA 1QZZA 2NP7A 1IM8A 2PSSA 3T0IA 1X19A 3G8AA 5FWAA 3MB5A 5E1BA 5FUBA 2G8NA 2PXCA 2IDJA 2AOUA 2ZIEA 3A27A 3BWCA 3HVIA 3KQVA 1FBNA 4IWNA 4RWZA 4BLVA 5KQSA 2WA1A 2ZIGA 3NW9A 3REOA 4PYJA 2HR1A 3HEMA 2NP6A 2BH2A 1IXKA 3NVKI 5EZSA 4P7KA 3UJ8A 3FPHA 3FTEA 2PWYA 1XJ5A 3O31A 2QY6A 3C6MA 3MCZA 3RODA 4CKCA 3E23A 4RTLA 5CVJA 2IH5A 4YUVA 2IP2A 1JG1A 2G71A 1P91A 4HC4A 2PGXA 2V74B 2VP3A 5CVEA 3G2QA 4RTMA 2Z6UA 3V97A 4QQNA 2C7OA 3P97A 3GNLA 2YXDA 3DLCA 3RW9A 4EVIA 5BXYA 2Z6QA 5DXJA 4QQKA 1DCTA 3QOWA 4FT2A 5EMMA 3M6UA 4FP9A 3UJAA 2UYCA 2JHAA 2NNWB 3OZSA 5CVUA 3UJCA 3FUTA 5MHTA 7MHTA 4F84A 4QTUB 4ATNA 1L1EA 1Y8CA 4K6MA 3M33A 1HMYA 4QDKA 9MHTA 3M70A 2XBMA 1KPHA 3KQOA 1KR5A 1XDUA 2OB1A 1EJ6A 2ONZA 2QRVB 3KQTA 3OE5A 2K4MA 3FZGA 4L7VA 5DX1A 3R9XB 2PX2A 3OPNA 4QDJA 1ZKDA 2UYOA 4YMGA 1WS6A 4DM3A 3FRIA 3LDUA 3THRA 4YV2A 4GOLD 2AOWA 5K0LA 5DX8A 5E8JA 3G8BA 1MHTA 2CL5A 3Q87B 5T6BA 3DXZA 1XCJA 3DMFA 3NTVA 4RSRA 1WXWA 5EMJA 5K09A 3BWBA 4ISCA 4GQBA 3TPZA 5ERGB 1M0EA 4RVHA 3LECA 2WA2A 3KKZA 3BGDA 4MTLA 3BXOA 5U4XA 3TMAA 4M7RA 3GU3A 2CMGA 2NXEA 1ZGAA 3B89A 1EG2A 4QPPA 2XYVA 5K0NA 2XYRA 5DM0A 1U2ZA 2ORED 2CMHA 4DQ0A 1L3IA 3A25A 3EVBA 3FUWA 1EJ0A 1RJDA 1JQ3A 2IFTA 5FADA 1NW5A 5FQOA 5K0BA 3UWPA 3DMHA 3MGGA 4IKPA 2C7QA 2FYTA 5HZMA 1YFLA 5CVDA 3HVKA 3I9FA 3PFGA 5CCBA 1RI4A 3G7UA 3M6VA 2NXNA 4C08A 5CVVA 3A26A 3EVCA 2ZFUA 1P39A 2PX4A 1WG8A 1QAOA 1D2HA 4Y2HA 3TKYA 5BP7A 4KDRA 5GINE 1QANA 3K0BA 4V0RA 1EQAA 4KRGA 3G5TA 1L3BA 3B3FA 1RJEA 3OFJA 3E7PA 2XVAA 5ICFA 4QVGA 3KQMA 3G89A 3OZTA 1RI2A 1FP1D 3BKWA 2P7IA 3HA5A 4AZTA 4XCXA 3B5IA 3OFKA 2ZIFA 1G6Q1 4PGGA 2ADMA 2B3TA 1RI1A 2YR0A 2ZTHA 4PIMA 5K05A 5K0FA 2AVDA 2FPOA 3VC1A 5EHIA 4AZWA 3P2IA 4GC9A 3P9KA 1R8XA 3BGIA 3KPYA 3P9CA 3EEYA 3GCZA 3V8VA 3CGGA 3KPUA 3TLJA 4DF3A 3A7EA 1ZHFA 5P8WA 3LPMA 2PX5A 1VBFA 2AN3A 2O07A 3CBGA 1INLA 4C07A 5HEKA 4ER3A 5DX0A 3DLIA 4UOEA 2NXJA 5K0CA 4RX1A 5CD1A 3CJQA 3UJ6A 3EVZA 2IBSA 4CTJA 3CVOA 2YXLA 4E2XA 4P7JA 1KYWA 3ELUA 3TOSA 1XVAA 2XVMA 5K01A 4PYOA 4PYIA 1SG9A 2H11A 4MWZA 5K03A 3D2LA 5CIYA 1JQDA 3AWIA 4PYMA 2GB4A 3M6WA 3QV2A 3AXSA 4HGYA 2AOXA 1VQ1A 3P9NA 3TRKA 3M4XA 2ZWVA 1BKYA 1DUSA 3MAGA 3QOXA 2YQZA 2LD4A 2CWWA 1PJZA 3VSEA 5E9QA 3BGVA 4M37A 4M38A 5C1IA 2YVLA 1BOOA 3IEIA 4OA5A 2FHPA 3MCTA 5K0EA 2YTZA 4FGZA 4AZSA 1Q0TA 2Q41A 2YXEA 4PGHA 4XUCA 1FP2A 3ER9A 5DRTA 5EOVA 3OU7A 4KIGA 3PTAA 3G5LA 4R6WA 1SQGA 1PRYA 4RVGA 4U7TB 1EAMA 2BR5A 2PBFA 2V7EA 2AOTA 2P3QA 4YMHA 1N7IA 5G02A 3NMUF 4PONA 4OBXA 3B3JA 5E1MA 1D2GA 4GUAA 5D1HA 5LSAA 3F4KA 4MQ4A 3G2PA 3O7WA 4RTQA 4BLUA 2JJQA 1VLMA 2NXCA 1G8SA 3UJBA 1YFJA 3OZRA 4KW7A 5HIJA 5JR3A 1R6AA 2PY6A 4CTKA 2EJTA 2HWKA 2O06A 2PT6A 5DPMA 2FRXA 3P2KA 2I7CA 4E70A 4KVZA 3UZUA 1V39A 3EVEA 3HCFA 4YUXA 2VDUE 3LDGA 4E32A 2YX1A 2HMYB 5D1NA 2P41A 1UWVA 4Z2YA 2GPYA 3GRYA 3HCBA 5LQUA 3TFWA 3KR1A 10MHA 3NDJA 5HFJA 4C04A 1NW8A 1I4WA 1SUIA 3GRVA 2EG5A 3KQPA 5DT2A 4CXMA 4RTOA 1G38A 5LR6A 4BLWA 5IKMA 2ZCJA 2PJDA 4R05A 2IGTA 2G1PA 2P1DA 4DZRA 5GOZA 2VZ9A 5E1OA 2AZTA 1ORIA 3SM3A 4EQZA 1JG2A 1KHHA 2I6GA 3ELYA 4E2ZA 4PNEA 4RTSA 1VE3A 3GRUA 3JWJA 5GIOE 4EK9A 5CM2Z 4C4AA 1QAQA 4PYQA 4MHTA 3HM2A 2JHCA 2PVCA 3C3PA 4FSDA 1R18A 4OQDA 5EGSA 5EPEA 4QTTB 2FK8A 3AJDA 4Y30A 3UJ9A 3KU1A 4YUYA 4EKIA 1T43A 3PX3A 3UBTA 3UJ7A 3CCFA 3DULA 1RI5A 2DULA 4U7PB 4RTRA 5EKUA 3BT7A 1ZGJA 4RTNA 3NWBA 4P58A 3JWIA 5EKXA 1M6EX 4PYLA 2AVNA 3VYWA 2YUIA 3C3YA 3X0DA 5E1DA 1XTPA 3MQ2A 2ZULA 1HNNA 5KQRA 1R8YA 4M36A 1FJXA 1TPYA 3ERCA 5EZQA 5DXAA 1RJGA 2AOUB 2ZLBA 3GXOA 5H02A 2Y1XA 3UA4A 3Q7EA 3EEOA 3GRZA 5EVJA 4HSGA 4E33A 4LG1A 2PXAA 4YUWA 5ICGA 2E5WA 2WK1A 5DM4A 4JXJA 4EKGA 2DPMA 3SSMA 2VDVE 4HTFB 2ZZNA 1UFKA 3A4TA 4R6XA 2G72A 3SR4A 1KPIA 4A6EA 4BP3A 3U81A 4HGZA 3LKDA 2N47A 1WY7A 3LDFA 3TR6A 5DTQA 5E9JA 3H2BA 8MHTA 5EG5A 2PV0A 4HH4A 1D2CA 3BZBA 3P9IA 2AOVA 2AN5A 3HA7A 5DRYA 3DXYA 1JTFA 4PYNA 1X1CA 2GAFA 3FUVA 4OQEA 4E30A 2Y1WA 3GO4A 5E8RA 3EVGA 1P1CA 2HNKA 4E31A 1RI3A 3MERA 5DTRA 1SVUA 2UYQA 2UZ4A 5EIFA 3FTCA 4R8SA 1YF3A 3HTXA 2PX8A 3ME5A 5K0JA 5EMKA 5C9ZA 3PB3A 2IBTA 3PX2A 2P3OA 3AXTA 2AR0A 3FTFA 2OBFA 1YZHA 1G60A 3DR5A 2OKCA 4G56A 4F85A 5KVAA 1VL5A 5FHQA 3MHTA 1KXZA 2H1RA 4CWAA 4ZTBA 1JG3A 1F38A 2QRVA 3BUSA 4FS8A 5FA5A 4AX8A 2A14A 4GOOD 5EMLA 2B2CA 4IV8A 1NW7A 5GP1A 3DUWA 3R24A 5LQRA 2EX4A 1NV8A 3AY0A 3P8ZA 5F2OA 3C0KA 4RTKA 3HVJA 2JHPA 3IHTA 4FSXA 3I5UA 3KPWA 4RTPA 2OB2A 1QAMA 4X60A 5T64A 4X1OA 2QM3A 4ER0A 1P1BA 5DSTA 3BKXA 3NDIA 1AQIA 2IH2A 2OPBA 1KIAA 1XXLA 3I58A 3KPJA 4RVDA 5FCDA 3T7TA 5F2NA 3T7RA 2FK7A 1O9GA 3GGDA 5BW4A 4RTJA 3CJTA 3JWGA 1IY9A 3DTNA 2O05A 5GM2A 2F8LA 1JG4A 5GIPE 3UA3A 3LBFA 1MJFA 3R0QA 2JG3A 1JQEA 2EFJA 3B3GA 1FPQA 3LCCA 5EC8A 3ELDA 4PCLA 5LQNA 4IV0A 3DXXA 4ER7A 1G55A 4GOMD 5CCXA 4GOND 1B42A 3LL7A 1F3LA 1VP3A 3LSTA 2AS0A 3TM5A 1H1DA 3KR2A 1L9KA 5C0OE 3G88A 3LCVB 1EIZA 3SXJA 2OY0A 1KP9A 1NV9A 3NVMB 5JUWA 2G70A 4XUDA 3SMQA 5FQNA 2PT9A 3PS9A 3EGVA 3CJRA 3FPJA 5GM1A 4CKEA 3OE4A 4OA8A 3GIWA 3RIEA 5LQCA 1VIDA 3PVCA 3BWYA 1XCLA 4HTFA 3KR9A 4BY9E 2H00A 3CKKA 5ICEA 5B1SA 1SQFA 2P35A 1KPGA 1NE2A 4YV0A 1R00A 1WZNA 4C06A 4HG2A 1DL5A 1O9HA 3ANXA 4FZVA 3LGAA 4FR0A 5EIWA 3UFBA 3UJDA 4WVLA 2PLWA 2GH1A 1NKVA 1M6YA 2OO3A 1JR4A 3FRHA 3THSA 4PWYA 3B7PA 4QVKA 3P2EA 4GEKA 2IH4A 5DM2A 4LWPA 2FCAA 2JH8A 3FTDA 2B9EA 3FYDA 4HRAA 5FA8A 4ER5A 4F86A 4GC5A 2IPXA 5KS2A 3KQQA 3SVZA 5EQJB 1G8AA 1KYZA 3HP7A 3P71T 3T7SA 2ZW9A 3TKAA 2QE6A 2NYUA 3IV6A 1ZQ9A 3EMDA 3G2MA 1X1BA 3G2OA 4WXHA 1OR8A 2BR3A 2XYQA 3KPVA 5DM1A 5DWQA 3EVFA 5ICCA 1NW3A 5LQAA 3O4FA 4X61A 4DKJA 3GDHA 2BM8A 1AQJA 1TW2A 3DH0A 4MIKA 3I53A 1N2XA 1UIRA 3LCUA 1VP9A 1ORHA 1I9GA 1RJFA 5LQKA 2GS9A 5HIIA 4PINA 1ZG3A 3E8SA 4LECA 4AUKA 5DSXA 1WXXA 2KW5A 2VS1A 3KQWA 3SSNA 4ER6A 3S68A 3OU2A 5FWDA 1YZ3A 4X63A 5DTMA 2VDWA 3KHKA 5CUQA 2IIPA 3SGLA 4YUZA 3DOUA 2ZZKA 4P7GA 2IDKA 1YUBA 3HCDA 3OU6A 4E2YA 4GF5A 2AOTB 3FUXA 4KIFA 2GLUA 3E05A 4FT4A 5EEHA 2AN4A 3PFHA 1TW3A 4X41A 1JSXA 3HCEA 1X1AA 2BM9A 1XDSA 3TM4A 3PLAE 3GRRA 2O57A 3R6TA 3WSTA 3HNRA 4AZVA 4A6DA 1JTEA 4YV1A 1N7JA 3KR0A 4RV9A 2O0LA 3I64A 2BR4A 3GJYA 3C6KA 4RYLA 5E2BA 2ZBQA 3DMGA 2QYOA 3SSOA 3ER8A 2ZWAA 3LX6A 5M5BA 5HIMA 3FUUA 4KWCA 4DA4A 2I9KA 3JWHA 1QYRA 3ORHA 4PYKA 2HV9A 1Q0SA 3M6XA 5IH3A 5F2KA
chains in the Genus database with same CATH superfamily
2VJAA 1JNXX 2H31A 3WAGA 1KJZA 2XUPA 5KBYA 3ZDCA 2HK6A 2Z9BA 4DBLE 5CH3A 3RTDA 1JR3A 2LP4Y 2J3MA 3JV7A 2YS6A 3U7FB 1JNYA 4GHWA 5JW6A 1GPYA 2R1VB 3E53A 4HWOA 4EMSA 1M2OA 4OHZA 4E2WA 1R8JA 3BXXA 3H0EA 4ZAGA 2I62A 2P1RA 3KZCA 2ZDHA 1OXTA 1UBGA 5ALIA 2FKNA 3PIDA 4DLXA 1TVKA 1HKUA 1Q3KA 3LC7O 4EWLA 2C0QA 4I4TA 3T1QA 1G2OA 1ZNZA 2AEFA 2TYSB 2PG3A 2GXSA 3OUZA 4O29A 1X7GA 3QE2A 1HRDA 4X91A 4DJ5X 3WP0A 4LGVA 5C4IA 5LMCA 2QE7A 3GQBA 4RVCA 3TD2A 2QSZA 3LC1O 3RI3A 5AUOB 3DFKA 1CEYA 1CF4A 1OFHA 4E5KA 3DZDA 2ACEA 4NBKA 2WG2A 3AR3A 2XNKA 4HR7A 3TTUA 4MW9A 1L8LA 3L8DA 5J63A 1H6BA 1WPQA 4IL5A 5JQGA 2O7VA 1XFDA 1PYGA 4U0KA 1CB0A 3PXGA 3T3PB 1GXSB 3UGQA 1ECCA 2BZGA 2QVLA 1HZJA 3QKIA 1HSOA 2HA2A 3FYUA 4AMGA 4B17A 1IQPA 3PVZA 3RVQA 3SZUA 2B25A 3WGQA 4CKBA 2C29D 2PVSA 4D6YA 1Q50A 1M2GA 3SX0A 3WGGA 2FW6A 4IVRA 3G13A 2C9CA 2YWEA 2Z9DA 1KEWA 2R6DA 3KRTA 2UYHA 4EYGA 4GZLA 4Q00A 3THWA 2R5WA 4NBNA 2MHCA 2F55A 4HVCA 1SN7A 3IUMA 3MB5A 3H17A 5LP6C 4MV3A 2BONA 2HLDD 2MJLA 4OI2A 4PRLA 3WYGA 2YNMC 1UJ2A 2R85A 3DDUA 2OA0A 3VBEA 4AJ4A 1LPMA 3PFBA 2WA1A 1AUXA 3AB3A 2WV9A 2EFGA 4MR8B 4ARSA 1T8YA 1XJ5A 3MHPA 3JQ9C 1XFAA 2PBLA 1BVRA 4D9FA 3SF0A 4KCGA 3Q3GE 4EY4A 4P2BA 2F1HA 4FGJA 1H0KA 4OXIA 1U4OA 1NYQA 2BI4A 2Q0SA 2Y1EA 3A0UA 1GVHA 1HV8A 4H17A 2PGXA 4L4RA 5UKDA 5JU6A 4B7ZA 2JJ2A 3N86A 1WEKA 4KACA 4BNXA 4WLFA 2J7PD 3FETA 1RCFA 3BXZA 4MRMB 3C5CA 4B31A 1RBYA 2A9OA 3NBMA 3PRHA 4BZWA 2FCRA 1SCKA 2XDYA 2FPIA 1TJ3A 3GJRA 2NNWB 3H2KA 3M5WA 2C2HA 3R5HA 4GR5A 1XQ9A 3C15C 4NFSA 8GPBA 4LYGA 1Z0DA 4JJ8A 1EJ6A 1EDOA 1GGKA 3K6JA 1M66A 3NUQA 3VR2A 4H1WA 4PZUA 1X13A 1YJCA 4PBSA 5EWLA 4IYRA 2GZAA 4O4JF 4WN3A 2QI9C 1ZM7A 1Y7PA 1YD7A 3IUSA 1U2GA 1JHUA 1NBWB 3D8BA 2MSDB 3U7GA 2R1VA 1OPXA 1W75A 2Q45A 5E8JA 1YA6A 1E2UA 1ZS9A 3TNDA 3UCEA 4MP3A 3N0WA 3T41A 2OWEA 1UDAA 3LECA 4DCPA 4TL7A 2OAP1 2MDTA 2BTEA 4BNDB 4BKQA 3AVVA 1CUCA 1E1LA 1GKIA 3H9EO 1U5AA 1IEVA 2IZ5A 1PR6A 1Q74A 3HXKA 4GGPA 3B89A 1ONPA 4N8SA 4QPPA 5IK2A 4B79A 5FUMA 1RLOA 3LGXA 2OSVA 1IYZA 1YB6A 3DO6A 4PHTA 5DLQC 4XGQA 2VUTA 4O5OA 1Q5PA 4Y0AA 3WJAA 3EVBA 4Q21A 5H4HA 4XTRA 5BSMA 5HPYB 1F8YA 4EF6A 5FADA 5JWRA 4IXNA 3Q98A 2H1WA 5CM9C 1D0SA 2J0SA 1H4QA 1GXSA 3LJKA 3WL7A 1G18A 4OM8A 3L6RA 2D1QA 5DJ5A 5DIZA 3CLKA 1JLSA 2SNIE 2R7AA 5EPUA 1CZRA 5LIPA 1A8QA 1JDTA 2ZTVA 4QLBA 2Y67A 2OQRA 5A9RA 4V1CB 1QRSA 1ONOA 4WXPA 3ZS8A 3J80A 4XWOA 2Z56A 1KJ9A 4HNVA 2VYFA 3RSFA 2OXIA 3GUHA 3E7PA 2Q1TA 4I3FA 3GBSA 5FB3A 5F77A 4HYTA 2GF2A 3EWNA 4DARA 2WKWA 3GX1A 4WCFA 2YJNA 4FR2A 1B2LA 1L8QA 1GOTA 4FXOA 2HJGA 3EF1A 3CURA 1G6Q1 1YI8A 5I7AA 1XL0A 1DIRA 3PI6A 1PCXA 3AJ9A 4TTSA 3WFZA 2FDXA 3OPYI 4A6PA 3ZK7A 2A7QA 3IQEA 1ZO8A 4OO3A 4JVMA 4HAWA 4C29A 5TY0A 3U1BA 3RF6A 3IDZA 1M1ZA 4DWVA 2PX5A 1TAHA 4MRMA 4BUCA 4RK7A 4YIHA 3GPCA 1KE2A 1P1JA 2FDRA 1B1AA 3FIUA 4Q3OA 1OXVA 4FD3A 3GPIA 1Z2PX 2BDTA 2VZ8A 4X9XA 3PP8A 4TYQA 3I23A 3C43A 4XOIA 1JDBB 3OQOA 3CMCO 4LSGA 4GAEA 4Z0NA 1C3OB 4E6PA 4TKZA 5JARA 4PYOA 3JASA 4MWZA 2ADOA 1NVTA 1Q1BA 2Q8QA 5A62A 1G3QA 3A9UA 1O6CA 3GEGA 1V1JA 3X1MA 1C29B 2VDWB 5JJIA 1NGSA 4EEXA 1M6VB 2JI7A 3FWNA 5CB6A 4EUSA 1PTKA 4KWIA 5FR2A 4FILA 2VDRB 3OETA 3TLXA 1EGQA 3AHFA 2GCOB 2W0MA 4BNDA 4V0MA 2F43B 2HX1A 3TXXA 1TUEA 1TMGE 3AX6A 3EAGA 1YA8A 5L3VA 4R2IA 2OHFA 3G68A 4HDMA 1R0XA 4AY6A 4KBYA 3FVQA 5CA1A 3N8GA 3TOVA 2BGKA 1RAIA 1ISPA 2H52A 2J09A 3GT4A 1KP3A 4GQAA 1V3UA 1XZMA 5L8VA 4X66B 1U9IA 4NJEA 4JT2A 2WD7B 4HNAA 4RTQA 2I2AA 1Z35A 4KO8A 3ZJ5A 4I1VA 3WQRA 3DB2A 2E4AA 3KDPA 4YALA 3L7NA 2PY6A 2DVMA 2IOYA 3G9TA 1KK1A 5J4VA 4RK1A 2X2EA 5DHFA 1W25A 4RENA 4Z3OA 3KO8A 3A4NA 5H5JA 3FG9A 3D3JA 4O2AB 3IC5A 4M1TA 1FXUA 2N1BA 3MSCA 4HLUC 4BGEA 4HATA 1UWVA 3O8QB 3O4IA 4L95C 3EQ2A 2O2YA 3IIJA 5EXDA 4US2R 3PWKA 3WOHA 3VR1A 4OJMX 2ODBA 3D5EA 3JYHA 1ZN9A 5F9MA 2IYLD 3PUWA 1X7WB 4OQ4A 3ZEIA 2X9VA 3OTWA 4K6KA 4WKPA 5FL3A 4QZVA 2O5VA 2OG2A 3W8RA 2FQ1A 1I6WA 5KX5F 1Q11A 3QPCA 4K3UA 3T9BA 4NV0A 5KNDH 2JIQA 1Q12A 1X8LA 3C2QA 2VBGA 3JQEA 2P4EA 4GM4A 5DH9A 1QNFA 4FSDA 5JTUA 2YASA 2RK3A 1ZESA 3FA2A 4IG4A 1E7SA 3HBAA 3GW8A 1LEHA 2JAOA 1Y1PA 1NMQA 3QYFA 2J9FA 1M76A 4MW5A 3RAPR 2IWHA 1M8JA 4ANFA 1UMBB 3PZBA 4DZZA 4F3CA 5B6PA 1QRDA 1XE3A 3NWBA 2KM1A 3N2IA 1W30A 1S3FA 1TZ2A 1Y3FE 2WU4A 4FK8A 3RIHA 4MS3B 4FYIA 3LT0A 1C3OA 1GCOA 1GZSA 2EKBA 1W8IA 4F21A 5JJLA 1B6TA 1XRJA 4V38A 2AKEA 1SVLA 1W4BA 3KYBA 2XZPA 5KQGA 2R6GA 3RS5A 1H4VB 1C0EA 3PL1A 4GKVA 4O5AA 3H65A 3Q7EA 2Y68A 4Q4LA 3GRZA 2IOHA 1Z6ZA 1FS5A 4HSGA 3V34A 4U5QA 2QLNA 4D80A 4R1SA 3ETEA 4BMYA 1XQVA 2CGEA 4KUHA 3AEYA 3U3OA 4YP7A 4RQBA 4EHKA 5I9MA 3U7QA 2GCOA 1NUAA 5COQA 1GSIA 1HY3A 5NLLA 3K70D 1Z75A 1JSLA 2YVAA 1GNVA 5AKEA 5DTQA 2WF7A 5KPDA 1QG6A 4EGQA 1SHLA 4S05A 2QBYA 2PV0A 1TVMA 5BORA 4AT1A 3E58A 1ONBA 4R5MA 3JAWA 4GBMA 1IB6A 1P5ZB 2ZRFA 1P5JA 3P9IA 3QXHA 4JENA 1JTFA 2X0FA 4F93B 1X3SA 3QLVC 2GAFA 2NUAA 4RDHA 4DMCA 3E7FA 2V7QA 4NL4H 1X1SA 1CJBA 3GO4A 1SA0B 2XKBA 3EZYA 3OQHA 1W0KD 4PTLA 2A3RA 3MERA 2WD7A 3IAFA 1QHYA 3VO8A 2GN2A 2DHQA 5TPZA 1BIFA 3I2FA 1KWKA 2W6JD 3T7IA 2UZ0A 3PB3A 1JR3D 5LBTA 1AB6A 3R1IA 2Z8YA 1T8WA 4FFOA 4FFMA 3K7EA 1ZZEA 2OKCA 4IQ0A 3KV1A 1HO3A 1F5NA 3G7SA 3JVUA 2LZ0A 3TVYA 3O8QA 4ZTBA 1PW7A 1W85B 1JG3A 2QRVA 4WZAB 5DNVA 5AXAA 3TTYA 4BGUA 4Y98A 2PD3A 1DJPA 1C0KA 1EFTA 1KKUA 4E07A 4DJAA 5HOEA 1MB4A 1X7WA 3RSSA 1VI5A 4RL6A 3ZBQA 2EX4A 2H63A 2Q9UA 4LHWA 3UK2A 5HKBA 1WP4A 4K5QA 3MBOA 3FVWA 2JHPA 4KZPA 4U7GA 3AJAA 3GFPA 3QWBA 4AYXA 4QM6A 4BZXA 4JL8A 4EUKA 3GLIB 3NHUA 3A6JA 1U3WA 3GJ3A 1P1BA 4BC1A 4HV4A 3GLGB 3ESAA 4MWSA 3CPEA 3I58A 5CNMA 2GOYA 1PG5A 1IHPA 3N9IA 5CHEA 5GOTA 1H6CA 1D1PA 1O9GA 1V1MB 1GNRA 3GMIA 3HSYA 1BHO1 1IY9A 3DFUA 4FZJA 3SEZA 3TQRA 1E7QA 3QNMA 2AXNA 5K0SA 1VHWA 2FSGA 2P2NA 5G1NA 2PUEA 1UMBA 1QHIA 1DJMA 1ANKA 5KTKA 1P7VA 2J0UA 2I3BA 3S55A 1VMDA 3C4QA 4D25A 2YMMA 2CXTA 2AS0A 3UJHA 4P4UA 3HK2A 4FYHA 2QJRA 3OIGA 3GMTA 3SXJA 2OY0A 2WJYA 2OYSA 5L7YA 5A3SA 3RUDA 1G21B 4AG3A 2WWHA 2GHIA 2VWGA 1A5BB 2YUTA 1IJKA 3AG5A 3O1LA 1Y4AE 2FG7C 2LW7A 1QHXA 3IIEA 5F7JA 5P21A 1HR0B 1J0EA 1M8FA 3DFMA 5LU9A 4XIFA 1R2QA 3DLHA 3R44A 4HF7A 4MI9A 4QQRA 3OTHA 4KRFA 1JWLA 1SBQA 5TQVA 2F1IA 3GJZA 3ZKAA 2CLOB 3HR4A 2CJFA 1Q0RA 3WSVA 1NI4A 2GH1A 3ROKA 1M6YA 4GPTA 3BOSA 4I5EA 5H9VA 4EB8A 3D2CA 2EZUA 1XRPA 4WK0B 2D4HA 3CX7A 3JD2A 3SOPA 3AM3A 4J0EA 1E6LA 4MV0A 2IPXA 5BMOA 1F4LA 3KQQA 4QJ3A 1SC3A 3ENZA 4RDIA 1D4OA 1SKQA 3I1FA 1U3TA 1GKYA 2CVZA 2XNDD 3VR2D 4QODA 2N1MA 1Y98A 4E2YA 3PGLA 3RREA 3N58A 3UC5A 4D3FA 3E8MA 1VLHA 2W6ZA 2ACKA 1GU0A 2NVWA 2VJLA 3NNDA 1G9SA 1ODCA 3FVVA 3OM9A 5DKFA 5CGZA 1AKEA 3SFTA 1DARA 5IT0A 4RHTA 5I45A 1QE5A 4ZEOA 1U63A 1W85A 4WZAA 1CW2B 2JL1A 1NYRA 2WUEA 5EJ6A 2YHUA 5CIWA 3A36A 3R7LA 1P4RA 2NO5A 4MVXA 1A95A 3HZHA 3VNRA 3HHPA 1QOQB 1Q0HA 2QD1A 2MWMA 2PFGA 3S68A 2ID4A 4BN0A 2XCRB 1GPWB 1MX3A 1YJXA 2YIJA 1CC1S 1OZHA 2VOEA 1JDSA 2F2TA 3PRYA 3MUOA 2GM3A 5ETJA 4AY5A 1MNQA 4P7GA 2J4FA 5J23A 5J5CA 3QVWA 1H4TA 3H4MA 3INTA 5AHXA 5A7HA 3VR3A 4B76A 3GLIA 5TT0A 3DE5X 4L8LA 3R2JA 4WFJA 4TLAA 5A0FA 3WI7A 4AN4A 1C3XA 4K26A 1J25A 3GLGA 3BD9A 1SC4A 1M2JA 1X1TA 1U8TA 1L7QA 1OAOA 2WJ4A 1GTMA 3BMCB 3D3WB 1VRVA 2DUNA 1QQTA 2PT7A 3I04A 3G2IA 4DDMA 3HCEA 3UAOA 3AF6A 4C21A 3X2SA 3PEWA 3A32A 1WNFA 2O57A 4GGMX 3HNRA 4YV1A 1XRQA 4JJ6A 1P7WA 2X1HA 2HGSA 3I64A 1NMYA 1FQOA 1QH8A 3BGOS 2ZBQA 5AKHA 5HDQA 3HACA 2XZLA 4DYDA 3QVTA 2RK6A 3PDJA 4BNTA 3T4UA 1SO8A 3L4JA 1TE2A 1FPMA 2WVJA 1Q0SA 3NH6A 1Q14A 3HMKA 1FMJA 3NJ8A 2F3QA 4R1NA 4D3DA 3KXDA 4XCQA 3GJQA 5HF6A 2HMVA 3BSWA 1SKBA 1U99A 5HJ2A 3H18A 4H35A 1DBIA 1G21A 4KIWA 5JEEA 3A7DA 3IE0A 3BE4A 4JGIA 4E4RA 3HP1A 1I3OA 2P2CA 3IP8A 1MB9A 3B8HA 1RYBA 3GAAA 4IJUA 4QXPA 4OQQA 1VPWA 1SCJA 1KNQA 1H2WA 1VJDA 4OX9Y 1JTVA 1TZBA 4PPQA 4I9FA 4K3VA 1XZKA 4KVFA 3AHIA 1QB7A 4H31A 4M9ZA 2X1VA 3N05A 5H7XA 4FDMA 1I13A 2KBEA 2OVBA 2IP1A 5IH7A 3QKSB 3A9SA 5IVKA 2RAVA 4IF4A 1VMKA 2XD4A 2HFKA 1K7YA 3I9JA 4J2OA 3NJRA 1GFWA 3CX4A 2H08A 4DNXA 2XITA 4D4HA 2ZI4A 4FFRA 4AO8A 3DZ8A 3PJGA 4UASA 4OL0A 4M1WA 4X8HA 2AYZA 1VIMA 2V0CA 2W4IA 5G4LA 3HYNA 2RGGA 2JZNA 4NBTA 2HQOA 2YY6A 2V5VA 1DP4A 4TV9B 5JBQA 3OJEA 1VJGA 3KWFA 4TT8A 2PU7A 5DTJA 1RJ9B 4MKGA 4E5PA 2DR3A 2IYSA 3DMYA 5IVDA 3E61A 4G3XA 4OJQA 2JLUA 4PHFA 2ZJ2A 1NVAA 4K40A 4JYPA 4MI1A 4W5QA 4E5MA 2DBQA 4R8RA 4LWQA 4OGWA 1MJ5A 4KV7A 3C5EA 4KOAA 1HE8B 4WPGA 5TRTA 4DHWA 5BRAA 1WHSB 3G8AA 3L8ZA 1KDTA 3C8HA 3CUKA 4UXIA 2OFWA 5JYEA 2ILTA 1C9YA 3A14A 2ZIGA 4A7PA 1YBMA 2FLKA 4I1YA 1P74A 2C03A 1OX6A 3LRPA 4I9NA 1N25A 5ULLA 3B8EA 3L0DA 4ZHQF 4KKVA 3UPDA 1RM4A 2FR0A 4BIIA 2HPAA 3EW9A 1EUZA 1P91A 3OO1A 2WSBA 3K0SA 4O4HF 4DDUA 3F7MA 2HSGA 2XUIA 3BMCA 2VP3A 3IUQA 3HRIA 1WQ4A 3RFFA 2GCIA 4FYXA 2Z3WA 2Z6UA 1AM4D 1Q3TA 1R0YA 4NOKA 4E09A 4ZIRA 3CSSA 4DT1A 2BE7A 4KYUA 5AVTA 5JJ5A 2FUG6 2WSIA 2UVQA 4BMCA 5LMUB 4D8VA 3F1LA 3HSKA 3LF1A 4Q37A 3NBKA 5IBCA 3AR7A 4PAGA 3M9LA 5KMGB 2H2FA 4YJHB 2P62A 2D6FA 3W6UA 1R3UA 2F62A 2PMFA 2BJHA 2AQKA 2JLAA 3OJWA 4N39A 5ALOA 1GLGA 3UMBA 5KNCD 1DLJA 1MRZA 2PQMA 1P2DA 1WTAA 4BLWA 5JO9A 5I3CA 3IP1A 5IUNC 3KE9A 1HQYE 1L9XA 2PX2A 4OSPA 5DX1A 1OASA 3R5XA 1T2NA 3QHPA 3G8DA 4N12A 5AI0A 3BMQB 2FUEA 4EPRA 2G0NA 1D4AA 1G1AA 4GOLD 5AOAA 5JAHA 2OGWA 5I6DA 1QR6A 1WX1A 1FCJA 4FB4A 5T4EA 4HVLA 1UOOA 2V7UA 5TDHA 3K20A 4YDRA 3JYPA 2XCQA 3LRTA 4DPKA 3ZJTA 1YHYA 4XYLA 2Z2YA 1M2VA 3LUPA 4WBSA 4IXDA 2CXNA 2H2IA 5C37A 4HH1A 1GPH1 1OXKB 2HV8A 1G19A 4YRJA 5BSVA 3FZYA 1Y9JA 1UWLA 2CMHA 4OHCA 2YS7A 2QPAA 5JZOA 3WBBA 1J7KA 4MUMA 2JFGA 5JE8A 3OP4A 2DR0A 4F6LA 1NW5A 3DOFA 4TV9A 5ISMA 2AUNA 2XRZA 2O8FB 1KKLA 2ZRGA 4ERNA 1G4UR 3ZI7A 4LF8B 3H9CA 5DYIA 4ESHA 5SZKB 1SCNE 1R37A 3D3KA 3CTPA 4EY8A 1C1YA 3OZAA 1VGVA 3CZCA 4JWTA 2O8BA 1SHJA 2CDRA 4S1PA 4RQUA 5T3UA 5GINE 3ZDAA 4H1HA 2I78A 2P6OA 2SBTA 3ZIDA 3JVVA 1E1CB 2UUCB 1EA5A 2VHEA 3OFJA 5ICFA 3ZHOA 3KKQA 1SHKA 2VF2A 5FUWA 4XCXA 3H2YA 3OFKA 2D2EA 1NDHA 3D0OA 1NVEA 3H3XA 3QVLA 3BMNA 4Z0PA 1KO1A 1GA1A 2G7ZA 4JT9A 3ZWXA 3ZK8A 1AE1A 3LC2O 5DVZA 3ESDA 4GD3Q 3ZWCA 2P2SA 5ADWA 4ZZIA 3GCZA 3NTXA 4JFRA 2YL2A 3AOGA 1UXGA 3A7EA 4B3MB 3IPAA 2LCQA 3U17A 3GL9A 2AN3A 4JH0A 4QU9A 4LCBA 3WX0A 2UXDB 3MEQA 5SYNA 3JZMA 4MJXA 2FX5A 4EB3A 2HA6A 2VJNA 3DEKA 3WRYA 2GKGA 1LNSA 5A3VA 3WWDA 3Q5EA 4NPHA 2ZTLA 3RTCA 1BS9A 4G8DA 1MOPA 2JCGA 4U7WA 4WNYA 3SDBA 4CTJA 1BH6A 1FYFA 2IXGA 1DOZA 3L6OO 4IM7A 3BMOB 1VKJA 4Y9DA 5CH5A 1UM9A 3DD5A 1V4BA 3C48A 3NBUA 1BE6A 1GRNA 1K0UA 1HDOA 4QLOA 2YWHA 4P9NA 3QU9A 1SXJC 1A9QA 5FYQA 4UE3S 5JO0A 3M4XA 1WUYA 3VOAA 5LP6A 3I9KA 3BCUA 3R8XA 1U8CB 2C58A 1YI1A 1ZHHA 2PMCA 2EL7A 1FOEB 2YNMA 3H1AA 4MWTA 4PANA 5JTTA 4ARVA 1U6IA 3SHFA 5HKOA 2A5YB 3OTGA 1TCAA 4WV3A 3JQ9A 1I6KA 3IHLA 3EUWA 4OJKA 4QUIA 4I2NA 2OK7A 2Q3LA 3I9OA 4PNPA 4BNIA 3H9BA 3NV9A 1P7ZA 2UZAA 4PWZA 5ALSA 3USZA 4PG4A 3UAGA 4NYMR 1V3TA 2CFTA 4HEQA 3GFVA 4JCCA 1G6KA 2QN7A 3CRZA 3JQBC 4RF3A 5ED0A 3ZLUA 1ZFNA 5JXJA 5ARCA 2AW3A 5AD1A 2ZWMA 1DQYA 1JEQB 3ZXSA 2FUNB 2KLHA 4QBFA 4KPUB 3GYBA 1YBVA 2GVNA 3FMVA 1IHXA 1VLMA 4QQFA 1YE3A 4LXTA 4Y0NA 1SU4A 1PJRA 2DY0A 3P7MA 1L4BA 4C0LA 2BW0A 1SPBS 4EHAA 5C8ZA 5JR3A 4OXKA 2HUPA 4TTPA 2IS1A 3VJKA 2FRXA 4K88A 5AOCA 2YVQA 1WABA 4E70A 4I5DA 3MRXA 3HCFA 1FMTA 4C87A 4YUXA 5JMWA 4LE2A 5IRCD 3KTFA 2YHIB 5BR7A 1MD9A 3HGQA 1I80A 2BYTA 1PD0A 2J0EA 2YJZA 3FLBA 4P3PA 5BV2P 3AG6A 1IUOA 2O8DA 3W6NA 7MDHA 2CNLA 3K09A 5AVZA 5FAXA 4ND8B 5TGTA 2W8BB 3TWOA 4E7OA 4L2IA 2IGTA 4ZYTA 1YB4A 3CNHA 3EDQA 3KBOA 1KY4A 2VZ9A 3ORQA 2IYWA 1XVLA 3ZWWA 1JJFA 4ZN6A 3QVXA 4YDSA 1ZOIA 4NOMA 3BMXA 3VZPA 2Z1MA 4CGZA 5LDHA 3WHIA 3C7KA 2GDZA 2V1XA 3MZ0A 4B5LA 4BDTA 4MHTA 2IKSA 5HDBB 3P5SA 4R69A 4DR5B 1RAAA 3FN4A 1PFKA 1ZU5A 2PANA 5BT8A 2BFPA 5KTYA 3QEKA 2EWVA 4D4LA 4DUGD 3CYFA 4YUYA 2RKBA 3F6BX 3D59A 3QJYA 5G41A 1KO8A 3AUYA 2W2XA 2Z1NA 2EEZA 3F6SA 1TMKA 1K8YB 1Q1QA 1DC6A 2D5LA 3FPKA 3H1FA 5IYZF 4YECA 3V1YA 4JD5A 3GLUA 1GQSA 2O8EB 1GGHA 1T10A 2Z2KA 3TLMA 4ZYYA 5KHLB 3PQ4A 1OXSC 3AIIA 1H22A 4PXYA 4IDFA 4NYIR 1LPAB 2X8BA 4M36A 1OV6A 1VLLA 2R1TB 3F6YA 4M1ZA 4D9BA 3M5CA 1CUSA 4IIJF 5IKOA 1VLQA 4MWEA 2P90A 3ON5A 4Z7QB 1KQPA 2I6QA 2JLSA 4LG1A 1X8JA 2PXAA 3QQPA 4YUWA 1JHZA 1QRTA 3RR2A 3VR3D 1P7CA 1NVWQ 1JHYA 3U0BA 4AS3A 4UHFA 1FSSA 2QTLA 3OQIA 3D6JA 1DHRA 1JHDA 4G4IA 4L0QA 3G3EA 3V4PB 1E3DA 2C3PA 5CW2A 5EG5A 4DUZB 1SIUA 2BCGY 4UNIA 2OBMA 3Q88A 4XCVA 2AFHB 2Z5LA 1XWFA 3ZVNA 1MAHA 2W4MA 3W5VA 3PL5A 4OGLA 3SFVA 4DLNA 4DVGA 4YRRA 3W8NA 1JEQA 3WIBA 3HDYA 5EN4A 3OVMA 3V8EA 1CU1A 1P1CA 1OOEA 2WTXA 4IHJB 2HBZA 2PZGA 5DEOA 3VBCA 1GO2A 5B7GA 1C4OA 3FTCA 4LNUB 1GUFA 4X7PA 3RH0A 1VIVA 5C9ZA 2Z4RA 4L4XA 1KK3A 3L43A 4ZANA 3L4KA 4Q7EA 3RS2A 4C6TA 3OEHD 4LOIA 2IX9A 4A5OA 4TS3A 2BRUC 2AN9A 3HKCB 1Q92A 2YW2A 5E3JA 2YHIA 4UOZA 1G7CA 4OK3A 5KO2A 2PRZA 3S7ZA 3T61A 3KKKA 3MIIA 2DH5A 1VCOA 4ZVNA 1Z6TA 3VYTB 3O9VA 4GOOD 4ND8A 4WK4B 3HDQA 3TIIA 2X5XA 3EOZA 3PSHA 3GGCA 5F2OA 1MIHA 2RHCA 4HHEA 4LXHA 4N8EA 2OG1A 1QTQA 5BXQC 1Z5WA 3Q6MA 2XVZA 1F4PA 3U1TA 5B2FA 3JRXA 2WMDA 1WRBA 2IY7A 2RC5A 3EPHA 3Q11A 2B3DA 3CCCA 3GFBA 2QGZA 3KYDA 3NDIA 3QA3E 4NNOA 2WHPB 5IW8A 2WM2A 4L3VA 1Y7HA 5EJEA 1G3RA 4NMHA 1N78A 4RZUA 4CEHB 3JWGA 1MPXA 3NV7A 4OHWA 3V3TA 1FDTA 3ICVA 1QVAA 4HWTA 3TRDA 3LX5A 3ZI4A 1JG4A 1UC8A 4IHKA 4N0MA 4RE6A 1OKKD 4GLFA 1KDVA 1QCYA 2VZ0A 2UYYA 2QL9A 3RJMA 1PSZA 1OD6A 3VU9B 1GL6A 4I36A 3OEYA 2O8EA 2G83A 4B81A 1Z0KA 1YO6A 2PYDA 3PJRA 3DEZA 2QMOA 2VAXA 4BB5A 3CZQA 4XPIB 4A2CA 2GPWA 5L40A 4MDFA 3SEAA 1DZIA 1ZONA 2PUVA 1LB1B 1KMCA 1EFKA 4NXNB 4BQQA 5HQJA 2CKMA 3FROA 4TUYA 4DC1A 3EGVA 1HT1E 1MQAA 2QAGC 1Z62A 4JP2A 1ZOLA 4N82A 1L5WA 1EDZA 3N6VA 4RAQA 1T9CA 4U5XA 4B74A 1T3LA 3H2JA 4BNYA 1YQXA 2X6QA 2WF6A 4MVJI 3EGDB 1PR3A 4HG2A 5IP5A 2N9UA 2A1UA 2CHVA 2ZE6A 3C5WP 3K9HA 5KWEA 3KT6A 2DQ4A 3AZPA 1N9ZA 5BOVA 1UDXA 1PJBA 3FRHA 4V1CI 4DDVA 2QYSA 3ZX4A 4LPSA 1Z22A 2ZB8A 2VKQA 2HREA 3F97A 3FYDA 1ESCA 2B9EA 4HAZA 2XY4A 3FZNA 3QVGB 4BU0A 3BH7A 5BUQA 1T25A 1V41E 3CUYA 1UZAA 1JIKA 4M54A 2VRWA 4N76A 3TKAA 4B71A 4JI2B 1GA4A 2BI8A 1LS6A 1CXZA 4LNUA 4NCJA 2BR3A 3ZVKA 2GWHA 3QBJA 1D8TA 4M86A 1TU0A 5DGDA 3M4NA 4UNSA 1Y1TA 4ZU1X 1DAMA 3KAJA 5AKLA 4XDGA 5I4BA 4EKDA 3UMFA 5CA0B 1V8OA 2FPGA 1MAAA 5TV2A 2ZJ8A 2JCBA 1B73A 4E14A 3E8SA 2FU5C 1H5NA 2OR3A 3GJ4A 4MPTA 5DSXA 2Z58A 4MVCA 1JWBB 1JR3E 3CKYA 5HGJA 1CDOA 5H8WA 1FMLA 2WAYA 3EB9A 1W36D 4NENB 2PIDA 1NVGA 1U8AA 4RD0A 2V8OA 4GRIA 4J2HA 3RK4A 1A4XA 1LRKA 1UM8A 1SBYA 1Z17A 1T6YA 2PL5A 5D00A 4IDPA 4BYGA 1M83A 4EI9A 5I7OA 3RC2A 4EF5A 1M7GA 3R3SA 2M9MA 3MUEA 3IESA 2YYAA 4ZK2A 3I2GA 4JEUA 2VNSA 2WHPA 3OA2A 1Z12A 2UAGA 2PUDA 1RP7A 2B1JA 2ASVA 1PBTA 2P6NA 4HB4A 2ZBVA 3Q0TA 4ND4A 4CJXA 3UMYA 1M75A 1QYIA 4I9UA 3LZCA 4QLAA 4URHA 4M1SA 4LXUA 2X77A 2MYNA 4XM2A 4HEA1 2ONJA 1T3TA 4FX5A 2WJIA 2VVTA 3IB3A 4G0ZA 5HIMA 2XQKA 3ZQ4A 5LWQA 2X15A 1EJBA 5JDCC 2FMIA 3EA0A 3I6ZA 3MT7A 2G82A 3K31A 1M54A 3LIPA 4ZO8A 1QGOA 1B14A 2V7PA 4XPIA 5KYGA 1SKMA 3DE0X 3H7IA 2NSDA 1JYFA 5IM5A 3WDKA 4D46A 5K8VA 1QLHA 2P9TA 2WUGA 3NAQA 4G84A 2FMFA 4DMGA 4DTCA 4LJSA 4Z53A 5ALMA 1RXSA 2ASEA 3ILHA 3BXHA 5AW3A 2FW7A 3DGEC 1TPZA 4M0FA 3LQYA 4XH9B 2DFPA 3JQGB 3T34A 4GMGA 4HH0A 1CHNA 1BHJA 3DG9A 4Y1RB 2Z6AA 4YCCA 5T57A 2O2XA 3SF8A 2HCRA 1YI0A 2JAXA 4CGYA 4BO3A 2WU8A 2WINI 3JQRA 2CKDA 4IPTA 1IVSA 3PWZA 4JMPA 1J70A 3Q2KA 1JV2B 2NN3C 2OFOA 1EX7A 4KMRA 3PITA 4AP9A 4HFJA 3O4VA 2WQZA 4Z54A 1EGVB 2IF2A 3QVGA 1MMFB 3A10A 3EVNA 4W99A 4US0R 5GMOA 3FNRA 3PD7A 2VBIA 5BV1A 3F5MA 2L18A 1AA6A 1Z18A 1BJRE 2L82A 2J5BA 3A3OA 3C87A 4KQEA 4L22A 5K4AA 4W5TA 3GFTA 2H1CA 3PDIA 3KK0A 1A4UA 1CJSA 3KXLA 4M7WA 2AG5A 3DONA 4NARA 3IIKA 1E8DA 1D9ZA 1E1NA 2O4CA 5A7GA 2HCTA 3Q8XB 1DZ3A 4W5JA 5CA0A 3U9TA 1B7GO 1O54A 2PMWB 3ESXA 3JQ8B 4GLJA 4Q3AA 4F4CA 3MINA 4GBED 1ZJ4A 2VDMB 4M1MA 4BBAA 3AR9A 1ONNA 1Z4OA 2LKDA 4QFMA 3UXHA 5LIRA 2ZWPA 4TWIA 1BWRA 2P78A 3RUFA 5EJ2A 1J9EA 1XI2A 2AC2A 2VDJA 4FLEA 4OYRA 5IZCC 3UUGA 3STVA 5KQSA 2ZPTX 5FF9A 4UNQA 2VJKA 5IJAA 2DB3A 4G1EB 3UJ8A 5KHAA 1KETA 1IL0A 4N54A 4CKCA 3CWQA 3TTTA 3UWDA 3W2TA 3GN2A 2HU7A 2HRDA 2FZ4A 1RQRA 3R0ZA 4QBKA 1YRWA 3CRNA 2GN0A 3L46A 5EE3A 4OAQA 4AX4A 1RWVA 1LDYA 3QE3A 5TEWA 1JKIA 1FFDA 3OFSA 2MOKA 2X4LA 3H04A 2QSUA 1FFHA 2Y99A 3C85A 3KX2A 5B5SA 2WYVA 1IAQA 3K0CC 2HJHA 2QD3A 5LYJA 3WZ2A 4C22A 1DXOA 3II6X 1BMFA 5IAGA 4BYMA 4YRMA 4YCBA 3BQ9A 4FT2A 3MJVA 3TW0A 3EMVA 1JAXA 1LQUA 2ODEA 3KOOA 4MLCA 5E6UB 5EFOA 5FLEX 3IKLA 1P61B 3TNFA 4F84A 4HYQA 3TBHA 3STUA 1SIOA 3FWZA 4KREA 4M9SA 2ONZA 4EEKA 3PXEA 2PU5A 4KQGA 4L7VA 3S2EA 2HWXA 4JGGA 4JUFA 5TB5A 3FSJX 2RG7A 5HTOA 1UBTS 4TKUA 1IBMB 5AUQA 4BKOA 4JJ7A 2JLRA 1XLVA 3ZE1B 3DMFA 1UDBA 3A11A 1SG6A 3GP3A 2V8BA 3Q2OA 4MLPA 4MNTA 4RSRA 4KN5A 2Q5IA 4V0LA 5CAEB 3VYVA 1PFGA 4Y1RA 2I54A 4CIBA 3U13A 2YWBA 4JLVA 4TTQA 3V4OA 4NS4A 2W11A 5CDGA 4DR6B 2D2FA 2MYTA 5U4XA 1XTIA 4OXRA 4V0SA 1NXVA 1UXHA 3DCNA 1XYYA 4LX0A 4OL9A 2WABA 4D7AA 3F78A 3SBOA 4BE7B 4KITB 3RT1A 4BRWA 4K28A 2RAPA 4ZVKA 4CUKA 2XTNA 1F2VA 3N8KA 1CJCA 1U2ZA 2B34A 3LPAA 3F8SA 3IPXA 4IRXA 2FFHA 3K9CA 2EHJA 3PGJA 5JS7A 1D2RA 4MYUA 2ECKA 4IMRA 4ZAZA 1CS0A 2QD4A 2NSYA 3JQCA 3Q8WA 2FZKA 4KRYA 4RNCA 4M8IA 1XYVA 4YJ2A 1LQTA 4Q1VA 1F5SA 2M98A 2BEUA 3Q3IA 3CM0A 4RCVA 3I9FA 4LQLA 1CVRA 5JG7A 5BR8B 5CCBA 5DMXA 2YJGA 1AV7A 3EQ6A 3ND5A 1UBFA 1JLLB 1JAYA 6ABPA 1YQTA 1TYAE 1DG1G 1WG8A 4MGHA 4DV3B 1KZYC 4DCTA 4WLEA 1QANA 4R41A 3TEFA 1XELA 3T52A 3RV3A 1GPNA 3SYRA 4QJ5A 4AJEA 4JU9A 4LMRA 1KF0A 1P1HA 3R6LA 4C20A 3WISA 1EE2A 1TIBA 2X6TA 5EXXA 3Q6IA 4AZTA 4HMPA 2ZJZA 3O4HA 4RHXA 5IDXA 3L41A 3P2OA 1CRPA 2YR0A 3QYAA 2VNJA 3KXKA 3OO0A 2UUOA 3R3XA 3M9WA 4V0ME 2BMVA 1JBQA 1O6GA 4JGBA 4PC3A 5H16A 4FNMA 3VXKA 4EKNB 2BI7A 1ZD3A 2VHYA 1J22A 3EZ6A 4S0ZA 1S8AA 1DIHA 4COKA 1JMKC 1XCGB 3QE9Y 3K0HA 2J1LA 3ZGYA 1S01A 2Q46A 3HJNA 1GUYA 2I91A 4KBGA 2A9PA 1MLDA 3GH3A 1TM4E 3B20A 3A9VA 4HWKA 4O4IF 1N3BA 5JJBA 5HIAA 1QYWA 3EQZA 1D1SA 4YB8A 2VUSA 2W90A 3AHCA 1CR1A 2V3WA 4I50F 2REXB 1M2HA 1NVFA 1O95C 4TTRA 4YQZA 4JX9A 3DTVB 4N49A 5K01A 4B6GA 4PYIA 1EXVA 1LQ2A 2H2AA 3R5TA 2Z8XA 2HMAA 3NP9A 1WBJB 2PH3A 5HF5A 2Q5HA 1DC8A 1L7XA 3LOUA 4U6NA 1PJZA 3AVXA 2CLMB 1T4DA 1DC5A 1BX1A 3D8TA 4FDUA 4FE3A 4Z9XA 4GNRA 1A5AB 1RHRA 1YC2A 2GEVA 5AJVB 3MT0A 4PTZA 4QXMA 4F9TA 2IHBA 4GP6A 3SYMA 1BH2A 4D26A 4WRRA 1VG1A 5FI5A 1UMCB 1XMQB 3DV2A 1SUEA 4J7XA 1XMXA 3MT8A 3DF9A 3GD7A 3NT5A 4LQDA 1AA9A 2PH1A 2X3YA 1YWGO 3QEAZ 3SQXA 2VQDA 1ZH8A 3VPFA 4YMHA 1IBSA 5CCEA 2OFFA 4PONA 4DDTA 5D1HA 3PPXA 4N5MA 4FEEA 1Y7TA 1OIWA 1NDUA 2JJQA 4OBEA 1II0A 2JGEA 3R7BA 2HDNB 4ZAYA 2AXQA 3T15A 4M49A 4EG1A 1U3GA 2AC7A 2QQ0A 2WM3A 4ON9A 3TK1A 2QPLA 2YFKA 1T34A 3K3PA 1MOZA 1XZAA 1MRNA 2IYNA 4Q48A 1E6WA 3CX3A 4J16C 3ZE8A 1ZVQA 4BJ3A 4E15A 4X8LA 2QU8A 1RW4A 2CC2A 4UM9B 3DMRA 2F1KA 3WQBA 2NX2A 3IOMA 1NW8A 4UMDA 3E5MA 3GRVA 4UU8A 1G38A 2O0HA 4LGCA 4KXUA 5LR6A 4UATA 2G1PA 5DN6A 1UPTA 3U5TA 1G8GA 2AZTA 2EAUA 1HDXA 4UXHA 1MRSA 1W29A 1NW4A 3OIVA 5HSGA 1T4CA 2JIRA 2AJCA 3N5CA 4BFLA 4YRKA 1PZGA 4TGLA 4X44A 2P6RA 3QXSA 1P60A 1UADA 1M0WA 1WM1A 2G76A 3DD1A 3EIXA 4ISBA 4M9UA 2ZR9A 4O2BB 5FPSA 2BPOA 5LU8A 5IM4A 3AJDA 1E9VA 5GJWC 4ASUA 5JNTA 3O3NB 4IS2A 4UHEA 1A27A 2Y1GA 3PX3A 1ODKA 2GD1O 4CN8A 1VCNA 3E3LA 2NO7A 1IEQA 4BO6A 3KM0A 2YUIA 1U2DC 5F33A 1QX4A 3FUCA 3OZVA 2ZULA 1SCQA 5DYWA 4JLMA 4JDUA 2GEUA 2VI5A 3R5SA 3MOGA 2ID9A 2IPLA 3WIVA 3WKDA 2OQIA 3C1OA 3L0OA 3OX1A 4GI1A 1LWNA 2ZSJA 2CHQA 2D8AA 2VO1A 2X4IA 4K6OA 4RWEA 3V4FA 3AEUA 1RPJA 1TK2A 2OYCA 5DM4A 4JXJA 4YFYA 5TMDA 1FDRA 2ZZNA 4MVYA 4HOYA 2AG8A 3Q72A 1PAUA 1XCPA 2Y6UA 3JD4A 2HIHA 2BEWB 2O2JA 3GA7A 2XVXA 3KFLA 1B8PA 2R96A 1OGJA 2W0SA 2V0GA 4KQFA 4ZO9A 3O93A 5CFQA 1JKJA 2XE6A 3RYIA 5JWOA 3V4SA 2V98A 4RBNA 2GERA 3RRBA 4EGJA 1XDWA 1GWNA 1HFEL 1WV0A 2D3WA 2FPPB 3DV9A 4OQEA 2NVUB 2Q3EA 3VI4B 2FE4A 2Y1WA 4EB6A 2OWDA 3KT3A 1RR6A 1GTG1 5LN1A 1Z15A 1T6NA 3MW8A 4LJKA 5AI8A 1B8NA 5D6OA 4BNZA 1G8FA 4DCJA 8AT1A 5BSWA 3EC2A 3O2NA 4RESA 4YJ3B 2GM9A 3O90A 3NDBB 1W93A 3HCWA 2I8CA 1H2RS 4RETA 4C4XA 4ZI7F 1SXJA 3ANNA 2H0AA 2NZXA 3QIVA 5BQPA 4B85A 3A6LA 3K94A 2FA9A 3IE1A 1MW9X 3IMFA 4MH0R 4BMNA 2EJWA 1PZEA 4DNFA 1Y42X 1FC0A 2B2XA 5TT1A 3VH2A 4IV8A 4PBTA 1J24A 2H4HA 4GYJA 1N0VC 3HG7A 3L4EA 4RK0A 1XXHA 5DOVA 5LQRA 4YHHB 1I7DA 4TZ0A 4J29A 3IPCA 4BLPA 1E3SA 1LKZA 3M9XA 3FF1A 1X7YB 1Z74A 3CPHA 3KEMA 2H2GA 3JQPA 3Q7SA 4X1OA 4IDOA 1H8HD 3F2VA 4PLCA 2WJPA 2IUSA 3JQBA 5FNVB 4LF9B 4TQGA 5F2NA 1WMAA 2D59A 3T7TA 3ZNPA 1DVRA 1Y82A 3F5DA 4R9UC 4J4HA 4UUBA 4B3FX 4L5JA 1RZRA 3I61A 2PJRA 2F8LA 4EH1A 3TSCA 1RLUA 1HSZA 1DRJA 5BSEA 3T3EA 1JX6A 2PAFA 2V6GA 3GEPA 3LCCA 1U2TA 5KJEA 3ZHUA 1USVA 4JC0A 6Q21A 4GVLA 2AMVA 4CCYB 2VQ6A 1B43A 4J9VA 5DHRA 3O7MA 4EKYA 4AY2A 2IBMA 1ZJJA 2CHUA 4MUJA 2Y92A 4MW6A 4U7FA 1DIOB 4EDHA 3BIOA 3AR4A 3MTQA 1EK5A 5JRJA 4D74A 4U4AA 4KR3A 1IZ7A 2QLFA 2I4TA 3IODA 4XQGA 9GPBA 4XUDA 3VR4A 1RE0A 3HH8A 1X7ZB 4BBZA 4GO1A 1XLUA 3IJRA 1U1CA 4IEIA 1ZQ1A 3NIDB 1SHZA 1DIGA 1V7QA 2NM0A 4UD6A 3RIEA 3WMRA 5IX8A 5LQCA 3H1PA 1KMIY 1L5QA 3BQMB 5IU6A 4LTMA 4LI3X 3EIFA 3TW8A 2E6UX 3J7AC 2ZATA 3K1ZA 2CXHA 4YAKA 1OIXA 1WV1A 4JOQA 1CUJA 1F60A 3K9FC 1VPDA 1QFJA 4DIDA 3K9WA 4JA2A 1F14A 1G20B 1KYXA 2NOAA 3PYXA 4YT8A 1N3LA 4BE4A 1I3LA 2OO3A 2PKRA 4MB0A 3PLRA 3S1AA 5J2TB 3GLGE 3ZY3A 3UQYS 2NVUA 3H1GA 1U0FA 3PNYA 4QA9A 4TTIA 5F51A 3EXIA 1XLTA 2R7LA 3KG2A 1GYQA 1U7DA 1L7AA 1BX3A 1V5GA 1BHQ1 3IT2A 2E4WA 3EN0A 3AONB 3QEJA 1JEYB 2VRNA 1CUHA 2ZJYA 4W9MC 1NW3A 1GUAA 3ND9A 2Z09A 1NXXA 4HDCA 5JVDB 1ESEA 1UJCA 3KVYA 4B4WA 4ABTA 3TDMA 4IJVA 1GARA 1Z7YA 5B57C 2WMNB 3NRBA 4M8KA 2EBFX 1S3GA 2NV0A 2VXYA 3EFEA 4NNPA 1ZOSA 1I7SB 5HFNA 4I3HA 1G21E 4B7UA 1YXMA 1JHVA 2FRVA 3EGCA 2RCNA 3FZEA 2AMJA 3JD1A 1P0FA 5G1OA 3TAXA 4G0YA 5GZ3A 3ICOA 3SGLA 3O82A 4EIWA 2G28A 3OQNA 3QNUA 2O0JA 3K2IA 1YS9A 1Y5LA 5FIUA 1C2TA 2AMFA 2OM6A 5A1TA 4EJSC 1TW3A 5TS2A 1J6UA 3IUJA 2A7XA 3I05A 1WEHA 3VUEA 3D4LA 4BFVA 4A23A 3AEXA 4QM7A 4ALIA 3G0GA 3ZQUA 1D6SA 1NRWA 3PNSA 3COSA 4FNGA 2OFPA 3DMNA 4HN9A 1W4LA 4KWHA 3ZU4A 1N5JA 2O0LA 2VTBA 1CFZA 1YIOA 3C6KA 3IVXA 2HMWA 1PS9A 2QYOA 3DEHA 3NO4A 4N6OA 1GN8A 2C8LA 5DO9A 2GN9A 4F4FA 2R8EA 4FEYA 2HRZA 2AZ4A 5HR5A 1W4AA 3I0MA 4JBWA 3PD1A 4IO0A 1LJLA 1LVHA 1GGEA 2HA0A 2X0JA 2C7PA 4RV4A 1VI6A 1SELA 3LPCA 2BRUA 2A35A 4FKZA 3VVMA 4TZTA 2FG5A 3QHAA 2FJ0A 3NATA 5CP8A 5JNSA 2GBLC 5K6TA 4FN5A 3DEAA 2XB9A 4D9NA 2XOXA 4CIXA 1WXFA 4EHJA 4IUDS 3UQZA 2ECOA 3VNBA 4L8FA 1NVVQ 1HTTA 4QPNA 2OYRA 1U6KA 1ZD5A 2QX9A 3I9NA 2WKPA 3GWZA 621PA 2R1ZA 5C3UA 2AFIB 3URMA 3R8FA 5AR1A 3KSMA 1R0LA 1CCWA 1RWBA 4YREA 4BNGA 3WIUA 1DRWA 1G20A 3DWIA 5HILA 3TIGA 5BYKA 5JROA 1BEUB 3LBIA 3ZDEA 2AJBA 1L7OA 3IQIX 4AJLA 4C5BA 4CIVA 3U61B 5AK4A 2ZJ6A 3EFBA 3RC3A 5A6SA 5JSHA 3CVXA 4RK4A 1OIVA 1DE0A 2ZI6A 2POCA 3HBLA 2INGX 3WLHA 5IJWA 3G8YA 3MGKA 2NUPA 4M9XA 3L9XA 4H6XA 3W4IA 3VU3A 4A8JB 3ANSA 4GRDA 4E4TA 3I9MA 3A1DA 1COWA 2W8ZA 4C88A 3SLRA 1R9GA 3K6RA 1CJTC 3CGWA 3JQ6A 5EZYB 3F74A 4YK7A 3UY4A 3KLOA 1BJKA 1EBFA 3RRZA 3J81A 3PG5A 1HKHA 5KTOA 2P9ZA 1HEUA 3WSWA 3F8WA 5B4VA 2X8LA 3QITA 1G59A 3EMKA 3C3KA 1L3CA 1UPAA 1SVOA 2QTNA 4LBZA 4PFJA 4UFNA 5EI5A 2HJSA 2GA9A 3U7RA 5L6MB 2AQIA 3IR5A 3O92A 3M1LA 4HLCA 1IM8A 5FFFA 2YC4C 2C7BA 1WPXA 2VAWA 4CR6A 3L2OB 4DEYA 2Q3FA 2QAGA 5E1BA 3C7TA 4TMYA 4K03A 5C81A 3WGIA 4O02B 1M5UA 1WXGA 1O4VA 4QECA 2PWYA 5B6JA 4A8TA 4R1UA 3WJ7A 1QMPA 2EOAA 2NTEA 3CXRA 4A0RA 4CU5A 2VJCA 4Q01A 1JZQA 5EHZA 3DBHA 1XMOB 1GL9B 3Q4GA 1EXNA 1NUUA 1SBTA 3RKUA 2GYWA 3RQSA 5D5HA 5A71A 4TLBA 3VC3A 4FYMA 2YYZA 3PC6A 2FWRA 5FTLA 1TYDE 1BG6A 3EAFA 1XTVA 3LO8A 3Q9NA 1XMIA 3EFHA 5B3AA 3RTGA 4AJ2A 1AQYA 5JS8A 3F8TA 1U5BB 2JHAA 1XEXA 2LGJA 1WDKA 3U16A 2GEFA 3G1WA 3GFGA 5E0OA 4QUEA 4X20B 2F6RA 2HXSA 3BJZA 1EZ1A 1KR5A 2J6CA 5BVHA 5FBHA 4KX3A 1YL7A 4X8MA 4F6CA 2PYIA 2PX0A 3DMTC 1XX6A 1ZKDA 1Y8RB 1WS6A 2ZI3A 2W4QA 4H0CA 4UARA 4RELA 3MAJA 1KRWA 1E2BA 4DJDC 1A9SA 1XCBA 4D8XA 3I28A 2VXOA 5K0LA 3G8BA 2O1EA 1DEKA 4KODA 4RV5A 5HK9A 1ZGHA 3AF2A 2DQKA 1IDN1 1NG1A 1XCJA 3K35A 4IXMA 5JPCA 4GH5A 5BQ3A 1UEJA 1J8VA 3OPQA 1Z4MA 2RB4A 2J08A 1P73A 3GRFA 1PK8A 3A6EA 4N3AA 4LFCB 3R74A 5LBIA 3S5JA 3V80A 4ZJYA 5KSZA 3BAFA 4EHLA 4YO7A 4HAVA 1LPSA 1UT8A 3AR2A 2ZCVA 2XT6A 2OV6A 1FYEA 521PA 5CDUA 1AS3A 4XXHA 1AUPA 5IAJA 3DT8A 4P54A 5G1PA 4UAJA 1ECLA 2IHJA 4BDSA 1F7VA 4RCYA 4BIMA 4ZU6X 4DBZA 1XVUA 3CZ4A 2AL7A 2ORYA 4YPOA 2IUFA 3NWJA 5K0BA 3GMDA 3VPSA 1VL2A 1WU7A 3KOYA 4J91A 2W7TA 2CV0A 3NM5A 1G6OA 5EZYA 1FFXA 2C97A 5MN5A 1FNSA 3U37A 5JDCA 2JGMA 3G7UA 2PO5A 1IWPB 2C2XA 4G9EA 3FFTA 2RI1A 3IXQA 2X9NA 3ZWPA 3FI0A 1PQ4A 1GAWA 1PQYA 3F4BA 4PX2A 4CM8B 2I87A 2HF2A 2XE7A 4RHYA 4RMHA 5C7OO 3GLFA 4MW0A 5FBVB 1RC0A 2HRRA 1L4MA 3KQMA 3DWFA 4MUNA 1J90A 1WSWA 2D54A 2NZWA 4MQ6A 1W4CA 1FRZA 4YAOA 1Z4NA 2I4RA 3OKAA 4GKBA 3OCVA 4RDCA 1M5TA 4WFKA 3UNXA 1VMIA 5IPFA 4WW0A 1C4WA 1T1JA 4PIMA 1JJBA 3VC1A 3KD2A 4B45A 5ARBA 3BRQA 2V6MA 3KJZA 4QFDA 1E58A 3ADPA 3BB4A 5JC8A 1RAHA 3IKJA 4PZDA 5TPWB 3VHQA 4OMCA 5AW7A 2JRCA 4B4VA 3A8TA 2OHXA 5C51B 4RJLA 2OO7A 4AIRA 4ER3A 1JSCA 1DX6A 5A02A 1BTOA 1GCGA 3LS2A 1X70A 2P0EA 2RGXA 4KR7A 1XZHA 1OVMA 3CVOA 1W47A 5FAKA 2O3QA 2GN4A 3LX8A 3OMWA 1KYWA 2PA3A 1TGVA 2QTTA 3BN3A 3NTUA 4OGGA 3KSUA 4Z7NB 3N8DA 3RDPA 3B53X 1JFLA 1E63A 4HDSB 1TTQB 1Y8RA 3JY6A 2NUTB 2V7BA 1E9SA 4G67A 3TRKA 4CKCB 5IHPA 2ZWVA 1RADA 3JU3A 3M8KA 3WA7A 3I62A 4K9MA 4A15A 1X86B 5A3JA 4J43A 4D8WA 1OXXK 1XEWY 5LZ5A 2VSYA 5FD8A 5A0TA 2CL0X 3FDFA 3GZ4A 3AL0C 4ZVSA 3IEIA 2DC1A 3UENA 2QR5A 3FAKA 5KQLA 2ZWOA 1RLMA 4MDYA 3SHOA 1X0VA 4C3UA 2ZAIA 2F64A 3LKVA 1EB9A 2BP7B 1SQGA 4CF3A 1W6UA 2DYKA 2PRKA 2QRNA 2XV1A 3N39C 1N6NA 3NVAA 4U7TB 1JFTA 3N2LA 3NBQA 2V59A 1E5QA 1VDMA 3DB1A 4U0JA 5E1MA 4GUAA 4CTOA 2QHXA 1PT8A 3G23A 2CXSA 3OT1B 1PLKA 1MX9A 4H7HA 4P53A 3U56A 3U4QB 2XMBA 4IQFA 3FHOA 4HP8A 2SKEA 1DJNA 5HIJA 3R0VA 3D7NA 4YONB 3VR4D 1JIQA 1H2XA 5DM60 1UBEA 1C7ZA 2NTYC 4CTKA 1O6BA 1H94A 1QC5A 3JZAA 3R3WA 2E2WA 2R8BA 2C5AA 4OLHA 3D7SA 4QXOA 1SOWA 4RKFA 5TJHA 4IDBA 4KDFA 4A0GA 4K9SA 2VDUE 4BRZA 4UBMA 5CK4A 5DULA 1XRNA 4CM8A 4OTZA 4JYZA 4G24A 2CFSA 2XUOA 4JOBA 4MTCA 4XJVA 3ZDXB 1E0JA 3M1AA 4DIKA 1OH7A 3N3AC 2JEYA 1ZOOA 1G3UA 4ZVMA 4FFWA 4PBRA 1TJ4A 3N74A 5AH0A 1F4VA 5B4UA 2QPTA 3RG8A 4MSUA 4ZDIA 3WNDA 3SM3A 4P80A 3RVMA 1SC6A 4IIGA 1VECA 4B2IA 4O4JA 1XT6A 2BN4A 3T1NA 4BNHA 1TEXA 1FVXA 3VNVA 2GQ0A 1MGOA 4J0IA 4J0GA 1K3TA 3ABIA 2PVCA 5DYGA 3IAAA 5D3QA 3B7GA 1YHZA 2XJ9A 1TM7E 3IURA 4I1RA 1L5VA 4O3FA 3WB2A 1H2YA 4GSLA 4V3BA 2I7XA 3NT2A 3NUZA 1JEJA 2XF2A 1UP4A 1PUJA 5KJFA 1Q17A 1M6EX 3QBVA 4G0NA 3PIIA 2JCVA 3SG0A 4QGAA 5IAEA 1PNVA 2I8LA 2IDMA 3A58B 4IMPA 4MUAA 4POAA 3SNKA 5I4CA 1AQLA 2RGYA 4C0QC 1FFSA 3RRYA 1O4WA 2A5LA 1YS6A 2BEVA 1Z4LA 2QMHA 3PSAA 2J3JA 1Y1KE 2FFAA 3QEMB 4ILEA 3JALB 4Q34A 2W2KB 5B3JA 4UZEA 3BTUA 2NUTA 2Q5OA 5LLDA 2Q5FA 3H13A 2R0QC 3D5QA 1MC8A 2XWQA 3MNFA 3NOXA 2CW5A 1N0IA 1USKA 2NZVG 2X9QA 4Q9JA 2ZB7A 4G37A 1KDZA 2ZSIA 1XALA 3A4TA 2A58A 3SR4A 4CM5A 2F8SA 1UT6A 1TOAA 2ONKA 2YCBA 2FOLA 2VBFA 2ZUWA 3KSDO 3DVAB 2N47A 2C77A 3QM1A 1VYUA 4Q9LA 3VISA 2C59A 4E03A 1XWIA 1T5TA 2PRIA 3PNQA 5JZ9A 4LFBB 3T5AA 4N3NA 1E3WB 4AJJA 2SCUA 4CKXA 4IX1A 1PZMA 2JD0A 1XTJA 4HGRA 3H84A 4K8OA 1JU3A 2FMXA 4KZKA 2WM8A 1PK7A 4D81A 4YAUA 3TFOA 4D6PA 4CFYA 1JE1A 1FSGA 5C8XA 2DOKA 2ST1A 3U6KA 3OT1A 3U4QA 3NAGA 5IVHA 2MINB 1OYYA 3D7MA 3SS9X 3WRXC 3U3DA 5FO1A 3ZE9A 4NULA 4RH1A 2Z2JA 2ZE5A 3L0CA 1HNWB 1IATA 1HXHA 3DR5A 3ZHQA 3CV3A 4UM7A 2D06A 1DPFA 1L7DA 3DE7X 3HHEA 1C7QA 4JVLA 1IHYA 2BMEA 4NK5A 1WU8A 4S1WA 3VX4A 1GDHA 1XEFA 3RSZA 1G5HA 1W5EA 4XX1A 4BVBA 4YGXB 2JFNA 3W1EA 2AR7A 2QTWB 2WFAA 4JELA 2HJRA 4N0PA 1TIKA 3P8ZA 1GTJ1 4EPWA 3C3XA 4LXXA 1VBKA 1BVUA 1V6AA 1N5OX 1R0BA 2FWNA 2ZYAA 5BYAA 5ALXA 5IJ0B 2AZXA 1PV1A 3KL4A 3S2FA 1KI4A 1ORRA 3S8EA 4H7JA 6YASA 5FCDA 4FKMA 1CT9A 1NASA 4MYRA 1Z8DA 4CKYA 4HX5A 1IUNA 3ZCQA 1EP3B 3ICPA 1OV4A 1PU2A 5GM2A 1Z88A 4H1TA 2OBBA 2OZLA 5GIPE 5ENVA 4BTVA 3R0QA 4Y8VA 4LPKA 3VR5H 2BGIA 3AEQB 2WUDA 1SURA 3B3GA 3PE6A 2PKQO 2V55B 3GLSA 3PLNA 1YR9A 2ZTMA 4H60A 4B83A 3NHMA 4K05A 5CM8B 5ALVA 5CXSA 2ZQZA 1EE1A 2JAUA 5F5XA 2IL1A 4LOAA 3LL7A 1KIFA 5LB4A 3AYZB 1P3DA 4R2LA 1KEPA 1FFAA 1MJHA 1IN7A 2D0DA 2I2FA 2R751 2NYRA 3CEAA 2PV7A 2VKTA 3VPGA 2HUNA 3BJRA 1MVOA 3JALA 1S2IA 3JX9A 3S3TA 3HGTA 2IJGX 1KP9A 1YL6A 4XDZA 3TINA 2G70A 1WLSA 2PD6A 3SU8A 5FQNA 2RD2A 3IR7A 1VYTA 4IJWA 3A05A 3RCBA 1CRLA 5BO5A 1WTCA 4TYMA 1I3KA 1QF9A 1TD9A 1Y48E 1J1ZA 3I5AA 4A92A 5TF4A 3SHTA 4B7XA 4NAHA 4XYBA 4LI0A 3F6RA 4HAXA 3V42A 1A7UA 3QTLA 3RD5A 3ZWMA 1KPGA 3G2KA 3QKWA 2C9DA 1IN6A 1GQ2A 4QYMA 1DU4A 2Q1XA 5DGHA 1VA5A 3DVAA 2AJTA 2PJZA 1N3YA 4HFNA 4BQIA 3SJ7A 1HF3A 3SYKA 5K0TA 1G0NA 2I4NA 4JUIA 4MW7A 3M5DA 4L5YA 1KQNA 4WVLA 1E3WA 3KSZO 1P0MA 3TZCA 1I7QB 4DQVA 1X9HA 1JVBA 1EHYA 1NR5A 5BNFA 3WNZA 1AHHA 3VTKA 1A9ZA 1CD5A 4W1SA 5B12A 1JP7A 2CNDA 3QKRA 5KX5A 2V4MA 3T7SA 1FLNA 1WB9A 4UHDA 4HNRA 4HYYA 5KVVA 1AO0A 1OR8A 2G1UA 4XASA 4OP2A 3V4ZA 1TVCA 3OC6A 2B7BA 1C8LA 4YJFA 2BM8A 1NONA 1ZGZA 2AKYA 3OX4A 4BVGA 2Z4TA 5DCYA 5INTA 2C00A 3CUWA 4OHKA 4LYJA 2QP3A 3DM9B 5C5IA 1RJFA 1T5LA 1YZUA 2WTMA 4PQRA 4PCVA 6PFKA 3WV4A 1Z47A 2CZCA 2D74A 4WCDA 3PUHA 1YKSA 2QWXA 4WEQA 3RIMA 3GJ6A 2KW5A 4W1PA 1NNUA 2RBKA 4R54A 3HLKA 4DAEA 2ZSAA 2QP9X 1BSVA 3B1YA 1AQ6A 1YZQA 1JFRA 1U3UA 3MM4A 3TZEA 1SOUA 1NZJA 2G88A 3N53A 3KHKA 3NHFA 1SVMA 3KBBA 4ZRDA 5FWYB 2XMSA 4OGFA 3WGKA 1USIA 3A1TA 3EUFA 5ALGA 1Z37A 1UK6A 1IK6A 4WNAA 1K7FB 4ZCQA 4QIHA 1J5EB 4F60A 4G0UA 1VJ1A 1RWXA 1MXHA 3HCDA 5J1SB 3MGBA 4N0EA 2JGAA 4HXYA 3BIXA 3LT4A 5I9NA 1GLNA 2RHRA 3BRCA 3QELB 4D4GA 1VSBA 4HNSA 3ZDQA 1PWHA 1IEWA 4ZVPA 1XDSA 2C2GA 2R2AA 3PLAE 3GRRA 1F0KA 2ZT7A 5IABA 2CVFA 3CVVA 3AEQA 1W5SA 2BR4A 3SSOA 3G17A 3T5TA 3X44A 1Y4UA 2ZVPX 5IWCA 3T3MB 2ZWAA 4ZT6A 1EFRA 3WC4A 5KQMA 4IWXA 1XNHA 2FEOA 3U19A 4A2PA 2YFHA 1QYRA 1Y9AA 3R41A 3MWFA 3TZ6A 3MA0A 1EWYA 3MVEA 1KSFX 3C3DA 3A6PC 2OXTA 4ND6A 1YRHA 4DCGA 4R1MA 3IMGA 1KBOA 3OLVA 4B48A 2SHKA 2IW3A 1KJ8A 3PEUA 5KNLA 5DHUA 4Y6OA 2G36A 4GDMA 5ALUA 3LDAA 3ULKA 4DYHA 3I5YA 1IC6A 1TX4B 4LWOA 5I8PA 1T36A 3HU3A 3P2JA 4GG1A 4PZ0A 5GWXA 4ZHQA 4NONA 1RNLA 3B1FA 4OHBA 3OECA 5KTNA 1VE5A 3CNNA 5E2AA 5T7BA 2NZUG 3QU7A 4MB2A 4FU0A 2ZREA 4JJ4A 2BKLA 1LJ8A 4BE9A 4EJSB 2V0NA 4MO9A 3V4LA 1BA3A 821PA 4NP6A 3V8PA 3H99A 4RIFA 4L8GA 3EGEA 2ZJ4A 2O9JA 3CC8A 4HGPA 4E3WA 3ZHRA 4NCBA 4LXIA 4CQLB 1PX2A 1F1JA 3B5JA 3P19A 4RJKA 1UBHS 4BLTA 4PC1A 3T5CA 1A8HA 1SZJG 4V0QA 2P8SA 1RBQA 3BTSA 3OKCA 2ZBFA 3OZWA 3AW8A 3BB3A 2B4KA 2VQSA 3MUNA 3U4IA 4JB3A 5FL7D 2PZFA 5B7NA 1J39A 2CNWA 4NK4A 3SS7X 1WUHS 4JSRA 2ATVA 4EEZA 1BDBA 1CRQA 4ZV7A 4UTNA 2ERCA 5JALA 4KUEA 4NU6A 3FPBA 1QG4A 2AV6A 4MAAA 2OAQ1 4ZEWA 5EMHA 2CZQA 2QJFA 4MP8A 3VSBA 4BHTA 4KVAA 2B98A 1HMPA 3D2AA 2B78A 2R6HA 4OKNA 1QZZA 3VNQA 4U2BA 2XUQA 1SVKA 1QK5A 3S40A 5L3QB 2IDJA 4MQFA 2G25A 4KNVA 4Q9KA 3N76A 5CLIA 4B2PA 1PG2A 3NTQA 4BP8A 3IMEA 4CMEC 4ECEA 2JJMA 1FVOA 4LRQA 3TRFA 2E4ZA 5FWYA 1Z83A 3RV4A 3O31A 3TLBA 3U44A 2VT6A 4URYR 1EBBA 4TV8B 3GR6A 1MZPA 4BMVA 4X7BA 5G0UA 3AF5A 5CVJA 4UTZA 4PNZA 1T0PA 4X7MA 2RGBA 4ZVTA 3KXIA 3ZWBA 4GBGA 3CHYA 1J7JA 2K6GA 2C5LA 5FRDA 3RW9A 1MC5A 1NIJA 2VYNA 1PFWA 3LWNA 2QRLA 4AVYA 2OGSA 3QOWA 5EMMA 2Q2VA 1DCTA 2C2OA 1V43A 4V0OA 5B2ZA 3B48A 2DM6A 3QUSA 1PLLA 2FF5A 4JZKA 1S9DA 4D98A 5F7OA 4ZYLA 4NBVA 2KI5A 3RYFB 1OFGA 3PR3A 5JNLA 3PJEA 2C57A 4IP0A 4N9QA 4QDJA 1N2EA 4RIEA 2DWUA 3VMFA 4BFWA 1PNRA 3H1BA 3I6IA 1TEZA 2EFYA 1W1UA 4UDYX 9LDBA 5E4FA 2H06A 4MVJM 3Q8LA 4KIUA 1IOVA 1KFBB 2A0YA 3IQGX 5YASA 6CHYA 2L69A 3KEOA 4NFLA 1NLUA 1QHEA 4HZGA 2A9FA 4Y2SA 4OHUA 3FKQA 2D7DA 1CY8A 2G77B 1R15A 1HYQA 4H3KB 4EQ6A 1M8KA 3KKZA 3DEJA 4MTLA 3UIEA 4B87A 1YBAA 1FQJA 4PAWA 1C7JA 4MUIA 2GFHA 4EJSA 2ERXA 4AMVA 2XUJA 4JI3B 5J2UF 3CLVA 2RG1A 1XDGA 4GMKA 1P45A 1U7TA 1ZXLA 2HK9A 2VG8A 2PSEA 4MRRA 2GARA 4IJMA 5BW6B 1UJ6A 4BQEA 1FFBA 4CQLA 3WLEA 4D82A 2NO4A 1RQGA 3W34A 2C8VA 3HY4A 3RS0A 2KB0A 1KYVA 2WJGA 1T35A 4UEQA 5HZHA 4HH3C 2IKQA 5TIIA 3HFSA 2WWVD 2CLIB 3PVSA 3VV3A 3KZVA 1OLSB 4IO1A 4F3TA 2PSJA 1Q2UA 1QIFA 3F90A 4FQ5A 4O4HB 1KS9A 1OBCA 3BWVA 3SN6A 4CMAA 3KLNA 4UUPA 2VHZA 2HQBA 2HLHA 1AY0A 1UKZA 1ZD4A 2GBLA 5KI6A 3HKEA 3O3MB 4GOXA 4KDRA 3GP8A 2E18A 2M2IA 2GAOA 2LBPA 3DR3A 4EP1A 1RWKA 1WDWB 1L4FA 1YR3A 2XVAA 3HO6A 4J1TC 5FYDA 2WAMA 3PTZA 1BOFA 2FQYA 1LFDB 3B5IA 1P44A 1NY6A 2YWGA 5I01A 3HR8A 3M2PA 3FR8A 1N1MA 3BRSA 1N5KA 2FG6C 3PDCA 5CLQA 5IARA 1K63A 2HCBA 2YXNA 3I4FA 2F9MA 2YYYA 4AZWA 1LW7A 4B47A 5JPDA 3C6XA 1P0CA 1JAZA 3L8YA 4J0JA 5JCJD 1RTKA 4UEWA 1I0IA 2E4UA 1W7AA 3I2KA 3LDHA 1MH9A 5DGIA 4OOEA 3PEYA 1O95D 5F7ZA 4TKVA 1XZJA 2JK0A 2ON6A 4TRJA 1O87A 4LVNA 5EAIA 5CFOA 3OJOA 4P8RA 1E0AA 4IDGA 1NVBA 3CUSA 3UK6A 2Y0EA 3EY4A 4ZZ2A 2QZPA 1SQ0A 4RL4A 1YVEI 3CNOA 3O8DA 3WWZA 2V7VA 3ZQ6A 4V02A 3MOIA 3DVQX 4EL5A 1L1RA 1F2UB 1PE0A 5BMVF 1YAHA 4WFQA 3AR8A 2XVMA 2GCGA 4IIXA 3V8BA 4C76A 3O8RA 4O25A 2EFDB 2W2LA 4N5LA 3V32A 3D2LA 2C2BA 3OSUA 3NHYA 3OBBA 4CIDA 4ZU3A 3QV2A 4FZ3A 2AOXA 1R12A 4R3NA 3V4VB 4FI3F 1NF9A 1Q6YA 1VSTA 1ZICA 1YL5A 4QATA 5IMSA 4XQ0A 3DAGA 4PG6A 2Z8YM 3AHJA 3BGVA 1MBZA 1CY2A 2D3TA 3NP7A 3EVTA 5TR9A 3RTEA 1WCWA 2E6KA 3D02A 3QVOA 4R3UC 3O9ZA 4HDNB 4TL8A 5DEIA 3E4DA 1YCDA 1EVEA 2WAAA 4PYRA 3AFOA 1HE5