4NQRA

The crystal structure of a solute-binding protein (n280d mutant) from anabaena variabilis atcc 29413 in complex with alanine
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
364
structure length
364
Chain Sequence
NTIPIGIALAQTSNVALLGQEQVAGAKIAEKYFNDKGGVNGTPIKLIFQDTAGDEAGTINAFQTLINKDKVVGIVGPTLSQQAFSANPIAERAKVPVVGPSNTAKGIPEIGDYVARVSAPVSVVAPNSVKAALKQNPNIKKVAVFFAQNDAFSKSETEIFQQTVKDQGLELVTVQKFQTTDTDFQSQATNAINLKPDLVIISGLAADGGNLVRQLRELGYQGAIIGGDGLNTSNVFAVCKALCDGVLIAQAYSPEYTGEINKAFRQAYVDQYKKEPPQFSAQAFAAVQVYVESLKALDTKNKVSKIQLPELRTELNKQLLTGKYNTPLGEISFTPIGEVVQKDFYVAQIKMEKDGSQGKFTFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amino acid/amide ABC transporter substrate-binding protein,
publication title The crystal structure of a solute-binding protein (N280D mutant) from Anabaena variabilis ATCC 29413 in complex with alanine.
rcsb
source organism Anabaena variabilis
molecule tags Transport protein
total genus 141
structure length 364
sequence length 364
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13458 Peripla_BP_6 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4nqrA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4nqrA01
3MYYA 3CNBA 2AYXA 4G97A 1QO0A 3DLBA 1NTRA 3HUUA 1JL3A 1SRRA 3CZ5A 2JK1A 4H3KB 3RVLA 1NXOA 4O1HA 3IPCA 3BILA 4NICA 3FFXA 3TO5A 1JHZA 2MYPA 9ABPA 4ETIA 3RH0A 1QNLA 3H5OA 2F8SA 3RVMA 2FEKA 1GCAA 1C4WA 1JBEA 3KLNA 5JNTA 4MQFA 3Q7TA 5FBHA 5ED4A 4F11A 1E6KA 2WWVD 3HDVA 3N0WA 3HXMA 4FE7A 3GWGA 3KYJB 3OMWA 4WXMA 4YGXB 3H5VA 1JH9A 1VLZA 1NXTA 1APBA 3CG4A 4TLMB 1Z26A 5FWXB 2LP4Y 3A0UA 3H5IA 3FFTA 1P6QA 5C5EA 1DBPA 1D2AA 1QKKA 4RK5A 4TLLB 2FVYA 1PNRA 2BGGA 2PE5A 1NY5A 4KREA 4N41A 4YO7A 2QSJA 3CFYA 2MSLA 1PUXA 3ROTA 4YP9A 4G0ZA 4N0PA 5IUJC 4YR7A 4E7OA 4QICA 2YHAA 4MRMB 2L18A 2TMYA 2JVKA 1S8NA 5B3JA 5HM6A 3MQ4A 4DN6A 3HJFA 1ZESA 3LUJA 4Z4IA 5EWLA 3HV2A 5KC9A 1LBHA 4EY3A 4NCBA 4CBVA 2WB4A 1BDIA 4ZJPA 3GL9A 3NNNA 4MR9A 1PEYA 5GQSA 1CYEA 3H75A 5C5CA 3OM1A 3IP7A 4KZKA 4ML3A 3H1EA 5PNTA 3LMKA 1F4VA 3JVDA 3GV0A 1DC8A 2QU7A 5BQ3A 2JRLA 1L5ZA 4W5RA 5DTEA 7ABPA 2XDYA 2RGYA 2OQRA 3CKMA 3SAJA 3MM4A 3Q41A 3FGZA 4NCAA 3K9CA 3HO1A 4RK4A 2MYUA 4MS3B 4MS4B 5FWYA 4MLCA 4MR7B 3QX8A 3HM9A 3LFTA 2R47A 2JCGA 4F06A 3H5WA 1YK1A 2FQXA 1Z16A 5BRJA 3FFWA 1YIOA 5BRAA 1CEYA 1DC7A 3KJXA 1KRWA 4EVQA 4IILA 5D2CA 4G86A 3CZCA 5DGCA 1M5UA 3ILYA 5BR1A 5HKOA 1GUBA 3RVKA 1EFAA 4EVSA 2OENG 4MS1A 1NXXA 2FEWB 2RJOA 3C97A 2E4UA 3DZDA 1EAYA 3QLTA 3L49A 3BRQA 3HS3A 5KI6A 4G0XA 2CWDA 4JOQA 3T38A 3OQOA 5CNKA 4Z4HA 3H6HA 1MB3A 4MQEA 1KRXA 1DCMA 1JFTA 4KK4A 3QX9A 4HNSA 4RY9A 4N76A 1U8TA 1A0OA 2JBAB 5TQ2A 3TX6A 3HK2A 2MSKA 3QEMA 1VKRA 5KC8A 1QQBA 1Y1LA 2FSPA 1ZN2A 3BREA 2FMFA 2NT3A 2ID7A 4IMIB 1AB6A 1J56A 8ABPA 1QP0A 1PHRA 1A2OA 3O1IC 3CTPA 4RSMA 5F64A 6ABPA 3A0RB 4Z9BA 4MR8A 4RK6A 5IEBA 3TD9A 3CG0A 1JYEA 3O75A 3O1JC 3QLVC 2IPAB 4ZPJA 2WJAA 2IDMA 2HPHA 4N0QA 3I5AA 4LDZA 3SNKA 4S04A 4W5OA 4F12A 2Q5CA 3O2QB 3RVRA 2FEPA 3C6QA 4G0QA 5EWMA 3GA5A 4KMRA 3EULA 2IPMA 2I6FA 5EWJB 1LJUA 3E3MA 1ZH4A 3Q9SA 4JA2A 3H1FA 3T95A 4E7PA 2PUEA 3LUGA 3OO1A 4PE5B 4Q6WA 2WY2D 1SD5A 1TLFA 4HYEA 4RV5A 3N8IA 1E6MA 1C0EA 4EVRA 3ROFA 4W5TA 2IYNA 1EHCA 4H3HB 4MQFB 1TVMA 4PICA 1DJMA 4RK0A 4L4UA 3C3MA 4ETNA 2GI4A 4XXHA 1XWWA 4ZMRA 4KFCA 5IC5A 3LUAA 2PUCA 1EWTA 5TPZD 1YK0A 4RDCA 2WRZA 1IIBA 4ZMSA 2P4UA 2PJUA 2LIVA 4QYMA 4GNRA 4EYQA 1SXGA 5CNJA 2E4YA 4RWEA 1L5YA 2PL9A 2QVCA 4XLTA 1ZHHA 2PAFA 1JFSA 3I45A 1ZITA 2R25B 3HUTA 3GYBA 1HEYA 3N0XA 1DP4A 2FTKE 1FFGA 1PNTA 1P6UA 3C3WA 3DGEC 3EAFA 3QLVA 5IULC 1ZH2A 3T6KA 4WUTA 1USKA 2CD7A 2FQYA 1CHNA 5EWLB 1ABEA 1FSPA 3EQZA 1B00A 1EWKA 1XHFA 4LRQA 2RJNA 3QEKA 4OBBA 3MF4A 1PEAA 3A10A 1K66A 3FMVA 2E4XA 4MLDA 5TQ0A 4MR9B 1NXPA 4IMJB 4W5QA 4OLBA 1QP7A 4Q7EA 4RZSA 4KNYA 1KMIY 1ZAYA 1DZ3A 2CHEA 2O20A 2VYCA 4YCSA 2GBPA 4YS6A 1D1QA 2W42A 1U04A 2A9RA 1BA2A 2NZUG 3B2NA 5JNRA 4PEVA 2E4WA 2GX6A 4L85A 4Z99A 2B1JA 1YS6A 3O2JA 4NV3A 1JX6A 3A3KA 3KCNA 3QLUC 1JF8A 1D4ZA 5JNUA 3F6CA 3KYIB 1RNLA 4ZYLA 2ZWMA 5ABPA 2JB9A 3EJWA 4O5AA 3E61A 3JTEA 3NHZA 3NHMA 3D02A 3EODA 3LUFA 4FB4A 1GCGA 2PMCA 1OXKB 2H0AA 5FWYB 2F8TA 4D6YA 5KQGA 1I3CA 4Z4GA 4QPJC 3JVIA 2IPNA 1JLKA 1QO0D 4IRXA 4KPYA 1BDHA 1AB5A 1MB0A 2A9PA 1YTUA 3OLZA 1USIA 1A04A 2JVJA 1DG9A 2E4VA 1U2PA 1T34A 3KHTA 3OQNA 1P2FA 2QR3A 4MS1B 1LJLA 2QXYA 4RXTA 5TPWA 4GPAA 4TN5A 5JS1A 3DLHA 2LUOA 1RXEA 5JS2A 6CHYA 5IBQA 2KYRA 4MGEA 5T7BA 4LX8A 4UHKA 3K4HA 3I09A 4HNQA 4MQEB 3SM9A 4YLEA 5TPZA 3Q7SA 2X7XA 2AYZA 4MS3A 1FQWA 1M5TA 4WZZA 5TQ2B 3QEMB 4MR7A 2PUBA 3S99A 3HDGA 4G0PA 3H5LA 4XASA 1RZRD 3RQIA 2HQRA 3IPAA 5JNWA 1DBWA 3QLUA 4O1IA 3TMYA 1BAPA 3IDOA 1JWLA 2PUFA 2B4AA 3SQNA 1Z15A 2HQOA 4MPTA 4FE4A 3BRSA 2MYNA 4TMYA 3D8UA 5CHYA 3URMA 3LTEA 4G0YA 1VPWA 4MYRA 5KWSA 4P1ZA 1R8JA 1USGA 5KQMA 1DRJA 4JAVC 2N9UA 2LBPA 3DGFC 4EUKA 2FLWA 5FBKA 3F73A 2GWRA 4M88A 2J48A 3KKEA 4IGAA 3LKBA 4JASB 3CHYA 3Q15C 4KQCA 3O21A 2R48A 3OM0A 4D74A 3UKJA 1FFWA 3TB6A 4Z4FA 1JDNA 1RXIA 1LBIA 3LUDA 4Z4EA 1UDRA 2L19A 4OLAA 3ILHA 2YHBA 3RVSA 1NATA 3QK7A 5DKFA 1JFVA 1JDPA 2P9HA 4P98A 4WT7A 1E2BA 3N53A 1DRKA 4UHJA 1E6LA 3CRNA 3HSYA 1SXIA 4LE1A 3T8YA 4KQ9A 3O1HB 2L2QA 2QZJA 2PUDA 2E4ZA 2FMIA 2FW0A 3RVJA 1D1PA 3JS5A 1GLGA 2VUHB 4KK3A 2R4QA 4LE2A 4OTZA 4N47A 1YS7A 3GBVA 5EWJA 1QP4A 1F51E 3QELA 4PYRA 1W9HA 3H5TA 2FMHA 2VUIB 4JP1A 4RS3A 4Z4CA 4KVFA 3SG0A 2PLNA 3MIZA 2ZAYA 3KTOA 4Z9AA 2NZVG 1ZGGA 3IP5A 4RU1A 1ISRA 3DBIA 3P9YA 3OMXA 2VK2A 4XFKA 4OG2A 3UUGA 2A9QA 3MMNA 3CLKA 3N75A 5JNVA 5TQ0B 1EWVA 5I4CA 4RK1A 3NNSA 3I42A 4IF4A 1YVUA 5FWXA 2HJ9A 1NXVA 1Z2EA 4RXMA 1Z17A 1RZRA 4H60A 3JPYA 1P8AA 5HSGA 3SY8A 2FQWA 1Z13A 3Q7RA 4G0MA 5IEJA 5IUNC 1YMVA 4LDAA 2JVIA 1DCKA 5GOTA 1MVOA 2PKXA 3NBMA 4MRMA 1MIHA 3VNAA 2ID9A 2NT4A 2WJWA 3GBPA 1ZGZA 3JY6A 2PL1A 1MAVA 2FMKA 2IPLA 4YWHA 3CS3A 4KV7A 3G85A 3UK0A 3M9XA 1BVHA 1W25A 3KLOA 1TM2A 5TE9A 1M2FA 3IP6A 3LUHA 4RKQA 4W5NA 1U0SY 3CU5A 1DBQA 5KQLA 3KS9A 3HCWA 2QVGA 3LUCA 1FFSA 2FN8A 5DLEA 4EYGA 4DQDA 4PZ0A 5IX8A 2M1ZA 3FDFA 3OLXA 4EYKA 4EGSA 5DCLA 5TPWB 3LKVA 4DADA 1QPZA 3N6VA 4MAAA 3IP9A 4D6XA 1XHEA 1VRVA 4RY8A 3G1WA 1GUDA 1KGSA 2RDMA 4JB2A 2PUGA 4XAQA 4EYOA 1Z25A 5IUKC 4B09A 1SXHA 1LK0A 5E3JA 4RK7A 1RPJA 3KSMA 3C3KA 4N03A 3H1GA 2CHFA 3EGCA 2FN9A 1ZY2A 3M6MD 1ABFA 2IOYA 3W9SA 4MS4A 3NNDA 3M9WA 4KRFA 4YRZA 2FXIA 4F8JA 2IKSA 1Z18A 3GRCA 2NUBA 4JB0A 3OQMA 3F6PA 4RY0A 3OLWA 1NXWA 4YV7A 4NQRA 2DRIA 3KG2A 4LE0A 3OLYA 4MR8B 4Q6BA 5CNIA 1OXBB 3F7NA 1WETA 3GT7A 2WMYA 1TMYA 4RKRA 1URPA 3OO0A 3RVOA 1K68A 3RVPA 1YMUA 4G0OA 5TQJA 1ISSA 2FLKA 2LPMA 4Y9TA 4XARA 1ZVVA 4ETMA 1Z12A 1DCFA 1H9CA 1TJYA 2MYTA 2GKGA 2M98A 2V0NA 2L17A 3LUKA 5EWMB 4RXUA 3RVNA 2PUAA 4F3TA 3L6UA 2A9OA 4HNRA 3HZHA 3OLVA 5JNSA 2JBAA 1JYFA 2MSWA 4WXEA 5HQJA 1Z2DA 3R0JA 3EQ2A 3HEBA 2HQBA 3HVRA 4OATA 1QQAA 1M2EA 5CNMA 4S05A 5T3YA 3VNBA 2QW1A 3BBLA 4WWHA 3O2SB 2FKAA 4QYWA 2QV0A 3MA0A 2HSGA 3JPWA 1QMPA 3RVQA 1U2QA 5B3JC 2H3HA 3LOPA 3H6GA 1NXSA 4Z0NA 5KQPA 3O74A 1BDJA 1ZDMA 3N0RA 3EDCA 1D5WA 4LZLA 3QELB
chains in the Genus database with same CATH superfamily
2BGUA 4X6UA 1AF7A 2YN2A 4FHDA 1CJSA 2YZNA 4LVOA 3RVLA 4MRAA 2VF2A 2OBNA 1RP1A 2AXNA 4QELA 5ALRA 5TEVA 5A1JA 1FOEB 3IVGA 5BW5A 2MYPA 5HMMA 4B6QA 2OHGA 3A6GA 1E18A 1XTTA 2WK1A 4UBKA 521PA 3BF8A 4LBZA 2C5EA 5HVNA 1RXWA 1E1CA 16PKA 1JLMA 1QYRA 3HP4A 1BW9A 1RI3A 3KJIA 3KUDA 3OPVA 4ASUD 5A2QA 2O19A 1CXZA 1DAOA 2PRYA 1MH9A 4L95C 4HGYA 4P22A 1M1YE 3VC7A 4TYWA 2PDAA 2HWKA 3A1FA 3FFBA 3WOVA 1VLZA 2BEKA 1OYYA 3KEGA 3VH2A 3OT1B 2GTIA 1XRRA 5LMZA 1A9XA 1RPNA 4B48A 1KARA 2FW1A 1UBCA 821PA 4PG7A 2PVPA 1XXLA 1VHDA 1XDDA 2X0RA 2BV3A 3R7SA 1K98A 4LOAA 4NXNB 2IH4A 3CUVA 3CBGA 5AVJA 4BKMA 4II2A 4G0ZA 3VPHA 2Q9UA 5C3UA 2ZSBA 1QDEA 4J91A 4E7OA 2ZB2A 3CVOA 2HDHA 3L07A 4K26A 5A7FA 4YMWA 4RSGA 1DPGA 3NU1A 5KO2A 3MQ4A 4KG7A 5KOJA 4F6CA 1ZESA 2UVPA 3MCUA 5AW6A 1T2EA 1FXUA 1DWOA 3C45A 4O4LB 4OJKA 2VHXA 4KVGA 3RF7A 5EHNA 4EY3A 2O3QA 4BQOA 1PD1A 2B2XA 1R00A 1GG8A 2HMTA 2ZRMA 3EXFB 4PNPA 4QVKA 3AG6A 2ZAOA 3OCZA 3GL9A 4WECA 5EUBA 4EFNA 5ISMA 1XTIA 3E22B 4XCQA 1FW6A 2C95A 4BNTA 5BR4A 2P77A 2VF7A 3DDUA 1GSHA 1ST2A 2ZAMA 2Y1WA 5KYXA 4BY9E 1E62A 1IAQA 1XU9A 3P9ZA 4ID3A 2GXQA 1UF9A 3ITEA 3OM1A 4OHVA 4TUYA 5F1YA 2IQIA 3ZVRA 1VM6A 2H4FA 3M3HA 4DKXA 4NABA 5IG2A 2ZJAA 3RC2A 2Q5QA 4AZVA 2XWJI 1PRYA 4P32A 4EIWA 4R8MA 4V3CA 1P39A 3RYTC 4F2GA 4BNNA 4MIEA 3NM6B 1Z62A 3CQ9A 1KYQA 3D4BA 4HPXB 1JQ3A 4YO8A 4DCNA 4W5RA 3GPDG 4EMSA 2AG6A 2H92A 4U3JB 4NESA 4WV3A 3TLBA 2TMGA 1VGRA 1M2OB 1ZONA 2NQTA 3NEJA 3AFIA 1P44A 4JI0B 3KNZA 4WPGA 1WKBA 3KBBA 3UJDA 1BHO1 1RAHA 4DR6B 3Q8KA 4DC9A 3KKLA 4OY3A 3WHIA 1LSSA 3QYPA 3W78A 3ROQA 4E1AA 2Z2XA 1WDKA 1YK1A 121PA 3KC2A 3W4IA 3VU1A 4KX3A 3AKDA 5DHSA 4FPXA 5BP7A 1DC7A 1R15A 4AF7A 4DW8A 1XQYA 2OCYC 5BSHA 5HQTA 2JJ2A 1NN5A 1ZS9A 2ZYTX 3QU9A 4Y6PA 1LPBB 1EFAA 4GM0A 3EXG1 1BRMA 2H7XA 4IIFA 4LFCB 4L02A 5L95A 3MB5A 2I8AA 4U0JA 1XPUA 2AVDA 4G0XA 3LO8A 1YGYA 3ZJ4A 4L15A 1MT3A 1RYFA 4ER5A 3WLOA 2PQ2A 1FQOA 5FUBA 1TAQA 3QKWA 2A9VA 3WIOA 1BEEA 4QQFA 3QEMA 1JE1A 2WM3A 1AKYA 1MKYA 3NIFB 5D5PA 5LMUB 1G291 3BHNA 1K7XB 2VZLA 3U62A 5L3SA 5BXYA 4TVOA 4P0PB 4UM9B 2REQB 1PYOA 2QXTA 2V7XA 4X6XA 3TLEA 4HPWA 1QU3A 4CE6A 1OKKD 3WHPA 2HU5A 1QVRA 2AMYA 5DH9A 1PWHA 3ZE2B 4Y2SA 1P9NA 1D2MA 1RDFA 2EL7A 4PO3X 3KTAA 3RADC 1FJHA 4OHUA 1F5NA 3QLVC 4WJZA 1LGYA 2WJAA 1LPNA 2YY7A 3TM5A 2MIIA 3I5AA 3TW8B 4JOSA 3WLPA 1O96B 3KFVA 2IITA 3HRKA 3K31A 1X87A 4RE5A 3AX6A 3HNPA 1IDOA 2XNCA 1M0TA 1DELA 3HU2A 4RX1A 5DN6A 2ROQA 2R8XA 3TPCA 3G2HA 3QTBA 4NL4H 1ZD8A 2UV8A 2EERA 4F4UA 4K6GA 3WO0A 1NPDA 4D8UA 1E9CA 4RORA 1IHOA 4Y9UA 5H81A 4BTLA 1P7VA 1S3SA 5BWMA 2NSLA 3IDFA 3IV6A 3B9PA 4NJMA 3DZ8A 2I2XB 2OZPA 2R44A 1GDHA 5HRUA 3AF5A 3ZCTA 2KSQA 1H93A 4IJWA 2JLZA 2HI0A 1AXGA 1WCWA 1BE6A 2XB9A 1JG6A 1N9KA 5JS6A 1NW4A 2Y1LA 4XXHA 2XYRA 5CU7A 1QBKC 4UQLA 1JJFA 1CFZA 2JKYA 3MCVA 5K8LA 4MYTA 1LLUA 4L4YA 2WVHA 4A10A 1AS0A 4ESHA 5BOVA 1QE5A 4RWEA 3STWA 2I71A 3CXRA 4XLTA 1GPLA 1M0SA 4JC4A 1RRKA 3LPCA 4K03A 2Y0BA 3PENA 1ZA2A 3QFTA 4A1OA 1DAGA 1WZCA 4LNHA 5J2TF 4M1WA 1Y6FA 1NQWA 1K1EA 2FTKE 2XVMA 5I8ZA 4D9BA 1TDJA 4DMUB 3RWBA 4CIWA 2AFIB 1RWXA 2JGMA 2ZVDA 3F6SA 5E1DA 2EJWA 3IMGA 1MQ9A 1T43A 3KPUA 3QOWA 1MENA 3AY6A 4MRVA 1BCRB 1E2PA 2HV8A 3U7QA 1OYWA 2VC2B 4JSTA 1E20A 1ZJWA 2ECOA 4R2XA 3HPRA 1NXPA 4IMJB 4V0ME 1FX1A 1QQ7A 5IK2A 3SLGA 5I7VA 1HFKA 2PCLA 2OHOA 4YAWA 3X1WA 3BE5A 3IVMA 2CHEA 3L8GA 2B1RA 1I1OA 1L4BA 1E5VA 4IHJF 4QPPA 5L7YA 4RVSA 1QTQA 1CIVA 4LJSA 4MJLA 4C3VA 1LSUA 1QRSA 3H16A 3ZIAD 4OHMA 5AM0A 1E3MA 3OWOA 4B6JA 1TPZA 1U2DA 1TF7A 1X7WA 4Q1VA 1M67A 3A3OA 4EPYA 3W7BA 4QPCA 1DXYA 3QH4A 4QTTB 5HJ7A 2NADA 1RNLA 1SUEA 5JNUA 3VAZA 2CF5A 1C0KA 1KYYA 4RFLA 1FVOA 4AURA 3TEJA 4P81A 4HH4A 2F3RA 1C30A 1GRNA 1BJRE 4GMHA 1V6CA 3ODPA 5IXSA 1WXFA 1JLKA 3BL8A 1VLVA 4IRXA 4P4UA 4UNRA 1YR8A 1KOFA 2PUWA 1EFCA 4KN8A 4XSVA 4MW1A 3T34A 3V1KA 1YQGA 4E2ZA 3RUFA 2I7TA 1U2PA 2W2KB 5EFOA 5AHKA 1XXHA 3PQEA 1TCBA 5EJ5A 1SXPA 4MS1B 2PX6A 4FD2A 1WTAA 1X92A 4GPAA 3VR3D 5G3YA 5JS1A 4W6ZA 5IVKA 1HO3A 2X0KA 4ITUA 3DKRA 1ELOA 2FWPA 3QE3A 3BE8A 5FUQA 1RWPA 3BK2A 3E9NA 4U7HA 2IU0A 1WMEA 3PF8A 3B51X 3EFOB 4ASUA 3NYQA 2O7QA 4NFSA 4YLEA 4ZO6A 1AVTA 3AH8A 5DNDA 1MX3A 1FS4A 2YZ7A 3L2OB 3QPDA 4MS3A 1TA9A 2O3SA 4IFIA 2VXYA 4LWZA 4PLFA 5IH3A 1HLFA 5A5VA 1G5RA 1GAQA 3D3NA 3P71T 5A71A 1DBWA 3MMSA 2UYCA 2ILVA 1QC5A 2Q0HA 4X61A 1EWQA 1U65A 1XZMA 1KEPA 1HZZC 1RXCA 2F8MA 3EC1A 4HWPA 1PW7A 4OAOA 2G8LA 4RCZA 3UV3A 2NNLD 3ISJA 4PZEA 3SQNA 1OXMA 1OWPA 4LTMA 1N2CB 3OA0A 1KDYA 2CSXA 4B3GA 4YCDA 4TMYA 4ISBA 3TRIA 3TOXA 1B8UA 2BZ0A 2HF8A 2JF0A 2PSHA 1H2RS 3GDHA 3GZ4A 4BFWA 5B1EA 1HLGA 2TECE 4X85A 4D9FA 3AM3A 1GKLA 5C4GB 2BDTA 1PU2A 3RJTA 1X86B 4JIMA 4ZYWA 3HKBB 1A96A 2IVFA 3ZGXA 2XIJA 2ONCA 2ZUBA 5D51S 5TGDA 2F48A 4NLLA 5JSUA 3VH1A 4XX0A 2ZT5A 4OAQA 1Y5LA 1Y9AA 4HX9A 2YVUA 3FZYA 1NVXQ 4NPAA 4BV2A 2WQ7A 2PZ8A 1J5XA 1AGPA 2GF2A 1Y8RB 3I4LA 1NDUA 3FYUA 5L3QB 2BKEA 1IOLA 1LX7A 3JYOA 1P3JA 2OXRA 3PHCA 5M2QA 4QPNA 4EI8A 1EX1A 4A36A 1V8PA 2MDTA 1H2EA 5FQOA 3U1TA 2NYRA 1DLIA 1GGKA 2AQKA 3AR7A 3O6VA 2R11A 4CDMA 2QKYA 4BP1A 2PD3A 1V4NA 2EKPA 5HX7A 5LQCA 3A1UA 4NENB 3UK2A 2RBEA 5CXXA 2RAUA 2DERA 1VRWA 1L9KA 2QORA 3DT8A 4L4RA 4ZJZA 3HSYA 3G9TA 2X9NA 1W35A 5D8DA 1PBNA 4FNOA 1U0BB 1OFTA 1GQQA 3F3SA 4IUCS 3C3AA 4N47A 2HCFA 2W2TA 4IO1A 4NJOA 1Z5VA 2F55A 1SCUA 2P2ZA 1Y5RA 3IMEA 3WQSB 1JHUA 1RYDA 1F51E 1L1RA 2ZBUA 3K1YA 3OIUA 4K28A 2VUIB 4OSOA 3QRWA 3BDIA 3TFQA 3ZYCA 1DBIA 2ZR9A 3KQYA 1SUCA 1YVRA 3UPUA 3M5CA 1GTMA 1JU3A 1GDDA 3F3KA 3GUZA 3JZIA 3MYRA 2RHDA 2GTPA 4U0KA 1HV8A 2FF5A 1H85A 1ZGGA 2C42A 3BAZA 2ENWA 2H59A 4TROA 4E08A 4Q9KA 3ZCXA 1NRXA 4I9UA 5AM3A 4LS3A 1AGNA 2DFTA 4WESA 3WLJA 4WBNB 4CR8A 1DO0A 1K5PA 1BOOA 3I0NA 3CLKA 3PUJA 4TL8A 1XLWA 4WW0A 1CQWA 2VJMB 5TQ0B 1CQIA 3DO8A 3H1TA 3ORYA 3R44A 3SU8A 4E13A 2GETA 3B2EA 3A1SA 2WJ4A 3CX6A 3ISVA 1NL3A 1I24A 2PBZA 5HFAA 4DZTA 1LQ2A 1KR2A 5COAA 2PX8A 3O03A 1R64A 2HTFA 3PGVA 4J49A 4HMOA 4G1BA 2V55B 1UDBA 1B6RA 1BG6A 3FCUB 2BJWA 3UXMA 3ONDA 5AVZA 1NYTA 1KVQA 4LECA 1R4MB 4BUCA 5I7EA 5IUNC 4FEEA 3ND7A 1U8XX 4GM1A 4URYR 5KJ6A 4OQQA 3EG9A 4KE9A 3T94A 2W70A 1NQOA 3SZOA 3KQKA 5B1HA 3ZWPA 1KU6A 4CCYB 4FOOA 2FDXA 3JY6A 4M1OA 3F97A 1UAYA 2YH2A 4J0IA 5EKUA 3IQZA 3WWYA 2QQEA 4M1TA 3L0SA 5DN9A 1Q1ZA 3UMJA 3JASB 3WDSA 4CKZA 2QRZA 1AGRA 3M9XA 3GGJA 5EA2A 3TE6A 1T3GA 4K6CA 4PIVA 4HI0E 5TE9A 1ZO8A 3IP6A 4RKQA 3DFUA 3G1TA 5K20A 3CX4A 3LNTA 2G5PA 2Y1KA 3DDWA 3L02A 4DDVA 3KQVA 5FWAA 7YASA 1QAQA 2NZWA 4CM4B 3FDFA 1Y37A 4FMBB 1X9GA 5TPWB 4B8YA 1GILA 3N6VA 4JX9A 2WMOB 3AXTA 1I6LA 1G1AA 3AF1A 3VH3A 1BN6A 4EX6A 3B5EA 3J81A 5DO9A 4JLJA 3A05A 2HPVA 1U9ZA 4JB2A 1ODLA 1X38A 5DB4A 9LDTA 3VC1A 4I2NA 5H80A 1I01A 2Q1UA 2IYPA 2RHCA 4JT2A 4WJLA 4Q16A 4ZALA 5CAEA 1L1QA 1LPAB 1JWAB 2IUEA 3DEZA 4Y2RA 2VSXA 5H9VA 4GR4A 5JHGB 5ARDA 3VU3A 4I50A 2GRJA 5EPUA 1U6KA 1QO9A 3MCAA 4RMJA 2W8BA 3TSZA 5JEDA 3GLRA 3HG7A 3GRCA 4JI3B 1NPTO 3OEHA 3BD7A 3E3OA 4AUNA 4RY0A 4QHTA 4MEAA 3N1UA 3ENQA 1HDGO 1JT2A 5CT9A 4D26A 4X7MA 3GZJA 2PZLA 3CLRC 5ALOA 1A7AA 2DBYA 4C4RA 1XE3A 5KTTA 1UBFA 3EZ9A 2RC6A 2WMYA 1WX1A 5BUSA 2P78A 2PGIA 4H59A 2LPMA 3FVWA 2JD1A 2EX0A 2MWMA 3NTXA 4Y7DA 1AKMA 5I7RA 2CVPA 1P9RA 2IELA 5AT1A 3AHIA 1THTA 1L5QA 1DOZA 1GY8A 1D2CA 3WNVA 3O94A 5KVAA 3G6KA 3S28A 2V0NA 5K4HA 4BN0A 1GL9B 2P2CA 5BWBA 2PUAA 1FDOA 1EVQA 1Y9ZA 4XJSA 1DJQA 5JNSA 4CI9A 4QGSA 2VJYA 3ABIA 4TL6A 4WXEA 4YFVA 5LA6A 5IWCA 5TT1A 3PX2A 3HEBA 4F3CA 2FPPA 1MRNA 2XUAA 2O2ZA 3ZIAA 3VPDA 1P1HA 2OUIA 3M33A 5JBNA 2IBTA 1OZGA 4RCYA 4XYLA 4JDPA 1EQ2A 4F1KA 1VYVA 3QEBZ 1N6RA 4RCVA 1Z08A 2HSGA 1VCHA 3VJMA 1GT6A 4LJKA 4Z0NA 4YT5A 2C2OA 2I9KA 3TRJA 1H1LB 1BDJA 4H2DA 1UMKA 1CUIA 1SG0A 3D0RA 2CCGA 4O29A 5CM9C 3V4ZA 4HOYA 3UNXA 2NO0A 3HFSA 2V5UA 3SHOA 4C6HA 1ZLXA 3CNBA 3OSUA 1HURA 1Z4QA 1ZEJA 2O7VA 3OE7A 3CZ5A 1ZW6A 1O58A 2I9PA 3D6UA 3DLTA 3O73A 1WMBA 4ZO7A 1B0AA 3BILA 5EQFA 4YPFA 4M83A 4RD3A 3C5VA 3QOYA 9ABPA 5AM4A 3FUWA 3C3BA 2CKDA 2I6GA 3RVMA 4RF4A 5E4TA 1Y6RA 3IQGX 3T7KA 3CBQA 3F98A 4GQIA 2F8LA 4DR1B 4UCQA 3VR3A 1TEHA 2VXCA 3CF0A 5TVGA 3O92A 4RZIA 4AWXA 2PZEA 5BVHB 3JZAA 4EJ6A 4BC0A 3FFTA 2WIJA 1IN4A 1Q0QA 1QHFA 2G06A 2GEUA 4BC1A 1XKTA 3RU2A 2ZIWB 3GP5A 2CJFA 2YW2A 4WERA 4FDMA 1MJFA 3O3MB 1GL3A 4LJLA 2WAMA 3X3HA 3O82A 4HY3A 4KQXA 1E3IA 3ROTA 2JLUA 2GKOA 4U4AA 3RFUA 1V1MA 3ZY2A 2ZYGA 2NTVA 1BXGA 2PGXA 3C7DB 3F46A 5DI3A 1I9CA 2Y93A 1OAOA 1RXYA 3G9ZA 1JAHA 3VU9B 1KO4A 3TAXA 3GHHA 3N0VA 5KC9A 5I3ZA 3G8DA 5DLDA 1U2GA 2ODBA 3KWLA 3QHPA 4MH0R 4ZV7A 3GAFA 2OVBA 4IKEA 2AWOA 2Q1WA 1PQUA 1T9AA 4LRTB 5AI0A 1ODJA 3UGTA 3FOCA 2QPTA 4WCVA 3V6LA 4J0HA 2R8BA 2G77B 3OWXA 5GV8A 2JATA 1GSAA 3IP7A 3FLBA 1IBSA 4R01A 1VI5A 3QY9A 1XCPA 1Z6AA 5HPYB 2ZSFA 2CCKA 2QYHA 1VJ5A 1UJNA 3ETLA 4DFDA 3A25A 3DTVD 5DCWA 5EE5B 3IUBA 1EA5A 2ANCA 2JRLA 3B70A 4WH0A 5DP2A 5BUCA 4OEHA 2GGSA 7ABPA 4OHYA 3FSGA 2AT1A 3L84A 3MM4A 3FBWA 2J7KA 3KB6A 4L9AA 3HBFA 3T5BA 4PLVA 2O8FA 3AEYA 5CX1B 3EVFA 2CCJA 1RZVA 4Z1OA 3NYWA 7GPBA 1GUFA 1XTRA 2FZEA 4YC7A 3FNRA 3L8FA 4PLZA 3AR8A 5IAEA 4HB2A 5IHXA 2FQXA 4K9MA 1TXGA 2NV6A 2Y9PB 4GVPA 1E1NA 3W4JA 1LDEA 4JKOA 4K0RA 1G9TA 2QROA 4W8HA 3RBZA 2H9IA 3UO8B 1HBJA 4LK2A 1I1HA 3HN2A 1PNQA 3ZLVA 3FJYA 3OBBA 1QH1B 1KKMA 4EPXA 3O3NB 2AUMA 4XLZA 3IXLA 3WIEA 2FPUA 4YAUA 3BRQA 1OQAA 4MVJP 4MYUA 1ZMBA 2J32A 3NQ41 1UK6A 2H08A 3G2KA 4G84A 1LW7A 2ZSEA 5H83A 4U2GA 3BCUA 1JN0A 3AETB 4QT4A 2ZI6A 3V97A 2EV9A 4IIYA 4RO0A 5TQ2A 1GCUA 4ZHQF 2FV8A 1FLDA 1W5SA 2Z95A 4NI5A 5T4HA 1ZOIA 2O7NA 2FWIA 4DUGD 1LPOA 5EIEA 3S2ZA 2FFJA 2ID7A 4NP6A 1AB6A 3F7MA 1W36D 3DH0A 1QB8A 2J9FB 3UVEA 1SOUA 3O1IC 4W63A 5L3ZA 1BMFA 1OLSB 1NKSA 1N6NA 3PRHA 1ORIA 2ONKA 3DW1X 4BMPB 3A6FA 4EGQA 4W5OA 2NP7A 4KQHA 3RVBA 2Q5CA 5JCZA 4L8LA 4QDZA 4J3JA 4C03A 5CITA 1ID8A 3C6QA 1I5OA 1OLXB 2BTOA 3EZFA 2EFJA 4EUEA 1DT3A 4G07A 3PC8A 5LIRA 1IU9A 5GPBA 2AHOA 4M1MA 1LF5A 3VX3A 5DBOA 2B30A 3WKDA 4BP3A 4R1PA 5KWVA 2Y0DA 2WJVA 5F21A 3OPXA 5AHOA 3TJMA 4C0AC 3C3DA 2GHIA 5KU7A 4BKOA 2AC7A 3TNFA 3OI7A 2AFHE 3ZNQA 2Z2ZA 4GZ3A 4KFCA 3I5MA 4ZJYA 1L6IA 3F47A 2XMSA 3FR8A 4OK3A 3S70A 4DA9A 2DR2A 4J0QA 3SZRA 1JW9B 3DMNA 4YRRA 4N3AA 4UBMA 4MUNA 4Q39A 1Q0RA 1JIQA 4QDTA 4MWGA 4H7EA 4ZA2A 4JC8A 1ZD9A 1JHOA 1LTKA 1Y3FE 2D5LA 4PHFA 5DWQA 1GUAA 4HNAA 5DULA 3DP7A 1YBHA 1KJQA 3PPIA 3DGEC 3JZFA 1B93A 3LLUA 4M55A 3ZX5A 1XO1A 1ZH2A 3HB0A 3T6KA 3TNJA 4TKVA 4BXOB 1W88A 2C0PA 2ZULA 4QAQA 4ALJA 1U5CA 2FWAA 2GUWA 1SCNE 1HT2E 3CUWA 4CPDA 2B5OA 5TS2A 4WLUA 4X1YB 1REQB 3AU8A 5HJEA 1EJ2A 2H0RA 3LVBA 4JQOA 4AZ3B 5CDYA 1LY1A 2DTEA 4WOJA 2PT6A 3K20A 5DMXA 7AT1A 5JZBA 1Z2OX 3G6WA 3EVZA 2K4MA 3OZVA 3ZXUB 2WB2A 2GBPA 4K9OA 3RS5A 5AI9A 3BXEA 5GAJA 4CNQA 2J67A 3PJGA 1VG1A 4E46A 5EHXA 4HNGA 4HN2A 5E7JA 3FGPA 5FTKA 1YA8A 1KI6B 3G0GA 5TVKA 4ZT4A 3WIVA 3KV3O 5KOHB 1W49A 1G7TA 1TD9A 2K6GA 5AJZA 1O4VA 5EMHA 2HLHA 4JVOA 3PTAA 2J0SA 1SB9A 3UJAA 1EHYA 1FTQA 2Q5FA 4O2BF 4B17A 4FWIB 1XKLA 4LPSA 2CHGA 5D86A 4NAHA 4ZU3A 2C7QA 2QLTA 4Y30A 3I8XA 4BNXA 1EFRA 1OSNA 3GFTA 4NRDA 3ZS8A 5HJ5A 1FFXB 5CH5A 4UZFA 1YQXA 4D6YA 4R0NA 3Q8LA 1YNSA 1WW3A 4U1RA 3EPLA 2VYQA 2AMLA 3HUFA 2O54A 5EJIA 3UJ9A 2VRNA 3EQ9A 4ZT6A 1CR4A 1U9IC 1IB0A 2BFDA 3AGPA 4FKBA 1PNOA 1SVMA 3Q3CA 2ZBFA 1JKIA 1ZSYA 1BS1A 3BA1A 4GSYA 2JIZA 4B3IA 3BMOA 1RQNA 2HZ7A 1Z4MA 4U9IS 3CTMA 3H3JA 4IG9A 5BNTA 1GNQA 1AQUA 4UHKA 2QZ4A 3ADKA 1PQWA 4RA9B 4BJHB 4OL0A 4Y2TA 4J0KA 1YFJA 5GJBA 1C1XA 2XMDA 2XOEA 4JOCA 2OFFA 2FWNA 1XU7A 2PANA 3HGQA 3QE0A 4J76A 3SHQA 4BECA 3CVUA 4NMWA 1G5TA 1P45A 3KJHA 3N6XA 1TO6A 4XASA 2HQRA 3FUVA 5DEOA 4GPEA 5FNZA 4O1IA 5LOVB 1CIJA 3EY9A 1UKCA 1XZFA 1I2CA 4FT4A 3CRMA 2Q6OA 2H63A 2Z4TA 4LJ7A 4XUEA 3SR4A 5ITZB 3MCZA 2IHKA 3W2EA 4CCSA 1LUAA 1UEJA 1A5TA 4X97A 4KACA 4HGPA 4OOFA 4JHLA 4EHBA 4WLNA 1T4MA 5IXYA 1GN9A 1N2IA 3HDYA 5JAQA 4TMVA 1WABA 1R18A 3A6HA 4LQCA 3LNCA 4Q15A 1GG5A 3QEOA 3CKYA 4CKCA 3S8EA 3R0QA 1PS8A 2C5SA 2C4VA 3HR7A 4EUKA 4AF6A 4J6EA 4RIGA 5ER9A 1R8YA 1W0KD 3D0OA 3T5AA 1UDXA 3KZKA 3IBSA 2DY1A 4Y2GA 1V5IA 3IOMA 3LKBA 3NR2A 3I2FA 3AR6A 4YJFA 1DOAA 4OHWA 1ZUHA 2PS9A 1WMSA 3LECA 1FUKA 5FBRB 3TB6A 4QNRA 1WY5A 2HJWA 4LOKA 4CG2A 1V6SA 3VC3A 1FMFA 1E4EB 2H4WA 5CVCA 3ILHA 1N7HA 3PZRA 3VTAA 4C6TB 4NU5A 4PFQA 4JT8A 2H4XA 3LX6A 4OJNA 5F77A 1BQEA 2MINB 3BRWA 2P2LA 3M1AA 4X1OA 4KPUB 3TD6A 3S27A 3LHKA 5IRCD 2RGEA 5FTLA 4HPJB 2PT5A 5CK4A 3ZHRA 1JGTA 1BYUA 3N2GB 1OXUA 5B7PA 2XMGA 4MVCA 1ZJ5A 2J5BA 2I2FA 5AFSA 3J7AC 1QP4A 1RU3A 3RRXA 3OLCX 4F92B 1CD5A 2XDQB 3RT1A 1UPBA 1E3DA 2H4JA 4GLLA 4DYDA 5SZKB 4XRGA 5CR9A 1VG9B 1H2XA 3AMVA 5ECYA 2Z2IA 4YP0A 1VC2A 4TLAA 3RG2A 4QQRA 1KYIA 3JWPA 3NH9A 4OG2A 3T06B 3VUEA 3GRPA 3O9ZA 4DLNA 4X8OA 3FRIA 4NYJR 5ALMA 3DE6X 4K9KA 3V4LA 1P7WA 3OQHA 4LYAA 3ECCA 4MV3A 2HFKA 2JAWA 5KCMA 3A4VA 2H16A 3UMBA 1Z8NA 1NBMA 3BDAA 1PP4A 4HMQA 1HOTA 1SC6A 4LDRA 4OHXA 2Y0PA 4FYHA 3UPDA 1QONA 1XLTA 1G8JA 2IXGA 4XQ9A 1P4GA 5FPQA 1HORA 2JJ8A 3INGA 3LDGA 3MT0A 4MUGA 4QFBA 1C29B 5BW4A 4RH1A 3U2QA 2HOQA 3IJ5A 3S55A 3OUUA 3GJZA 1F5SA 1Y8QA 2QAJA 1U3GA 4GBED 1I2MA 5EVCA 4X94A 3ZE7A 5JH7B 3IP1A 5CXSA 4BAUA 4WNAB 2VTVA 3L6CA 2HV9A 1ZOLA 3LBIA 3GDWA 1RBZA 4RHXA 1DIBA 2H1LA 3K0AB 4GP9A 4PYNA 2H31A 4Q19A 3T5DA 1Y5NA 4DMKA 4RVOA 1T8PA 4Z8XA 3V2HA 2RGRA 3RC8A 2EX1A 1E7SA 4HH1A 4KV7A 3WK8A 3PV0A 2W6JD 1OMOA 4DVJA 4M2LA 1X7YB 1Z5UA 4J2TA 2NWQA 4CEJB 3ZUPA 4P80A 5TGTA 1E9FA 1CP2A 3W6OA 3EZ7A 3WMWA 3WBBA 3PR1A 1HOXA 4PS1A 2OG2A 4U7GA 5DNWA 5CFMA 3IBFA 1Q7BA 2P3OA 4RKWA 4TZ6A 1G98A 3G8BA 2RIRA 1VE3A 3ASUA 3LHDA 4IIJA 4E2XA 1XDWA 3RFFA 1GU7A 4IYRA 3R3SA 3RTAA 1U3DA 1E3QA 1AUXA 2DX7A 2Q7XA 2ZRNA 2E37A 1P2BA 3CSSA 2ZI7A 3ZU3A 2D7JA 3BGDA 1JXAA 1VTKA 3C85A 4DNXA 1G8YA 1MRSA 1T24A 2FF7A 2NUPB 1Q1QA 4OB6A 3KOUA 3L93A 2UZAA 1NW6A 3UHPA 4GKVA 1I2ZA 3W3AD 2GPSA 4FP9A 4IDCA 1HM5A 1P9OA 1OI7A 4Z8YA 5EHIA 4UVDA 2DQKA 1ZOPA 2B0CA 3X1KA 3FHCB 1YR7A 2Y2VA 2BR3A 3C5HA 4KRYA 4YRMA 4N6OA 3WK5A 1Z8HA 1QIMA 2DBQA 2NVWA 1HA3A 2C5GA 3AW9A 3I2JA 1SVOA 4J2OA 3WG9A 3HO8A 4D5GA 4CM9D 4D3XA 2QQGA 4TVBA 4YDRA 4LE0A 4D80A 1NSTA 4LOLA 1L4EA 1H0KA 4GLFA 4L5JA 5CNIA 3BTVA 3DBLB 5PGMA 4B2LA 3GT7A 2A9KA 1L1FA 2RD2A 1K68A 1ODFA 2X13A 1OC2A 4KDFA 1NVDA 4D5EA 5BPHA 1S02A 1VL6A 1TW2A 5FLXA 3EGWA 3R1IA 3ZLBA 3ZBTA 1QBGA 1PX2A 2C94A 4R54A 5F7JA 3I2HA 3RC7A 5KWIA 3X43A 2H52A 5FUYA 2YXBA 5EXTA 3NTVA 3NGXA 1KEEB 1TCAA 1G9XA 1XK6A 1NDQA 5DYYA 4EG4A 5BNIA 1UFOA 1EFDN 5ICMA 1R8XA 2QW8A 1TKAA 2XXAA 4DSNA 1ZRMA 4MVJG 1HQCA 1DEAA 4YJDA 4YQYA 4RZXA 2ATVA 2VNAA 3MQ2A 2IYWA 4F8EA 5BV1A 3MTDA 1RC1A 5MFPA 3IMFA 3M9LA 4PTYA 1Q12A 2JHAA 1KVRA 4M7RA 5ERYA 2QE7A 2QX7A 3H6GA 1NXSA 4K81B 1F7UA 1OJLA 1YBAA 3SN6A 2D2IA 3OIVA 2GYWA 4NZPA 4QAJA 2G72A 2QBYB 1ATZA 4BZPA 2VFAA 4I9HA 1LW6E 4M0DA 4RD6A 5C34B 3A58B 3N6RA 1FDTA 2E4AA 2G0TA 1S96A 1T1IA 3MJHA 1UKAA 3PLAE 4G0WA 1P1CA 5U4XA 4BATA 2PH5A 3LXUX 3DLBA 3D2LA 3LP8A 3LX8A 2R97A 1SXJD 5ALZA 2DUWA 2AG8A 4YV0A 2PO7A 3PFGA 3U7IA 5JCXA 2F8SA 3QHAA 1HYQA 4N82A 5HIIA 4G1MB 4TQ9A 2KX7A 2F9FA 4OXIA 2VJCA 2PWZA 4ER0A 4F11A 2PSFA 2YS7A 5GJVC 4MKXA 1ZM7A 4B4OA 3HL4A 3E5HA 4KI7A 4YGXB 4Q37A 3KETA 3RKUA 2C3OA 5FOWA 5TT0A 1FK8A 3A0UA 2AXEA 3TR6A 3IQHX 3RSLA 4H7DA 3E2PA 1FMLA 4O02B 2WAXA 2WW8A 3AEZA 3MSCA 1UFRA 3FDZA 5CHEA 3DDHA 1A2KC 3OUZA 2EW1A 1KDVA 4CMIA 4N41A 1I80A 5TRTA 4X71A 1FTSA 5CLQA 1EFPA 2P4SA 4BEBA 4JXXA 4RPGA 4UDOA 1YNOA 2ZU6A 4PV7A 3F78A 2HHAA 1BNCA 4MVJD 3F8TA 2HA6A 1UBSB 3THOA 1INLA 1SOVA 4FXPA 3T41A 5G41A 3ELUA 4CLRA 1KJZA 3LUJA 3A4NA 1NVKA 1CZRA 1S5PA 3H2JA 2XTZA 1JEEA 3DKVA 2DLDA 5EVJA 1J7KA 2ZUVA 1W581 2KE5A 4YHHB 1DT5A 4JBNA 1PTJA 3A2LA 1T9CA 3GO4A 4CBVA 3ZEIA 3IV7A 3JRNA 3QMPA 2FG5A 3DZHA 5HXAA 1VMIA 2VCYA 3CWQA 3KXPA 3SM3A 2NSHA 1QFSA 2JHCA 3BCRA 4M8KA 1VPTA 2YZGA 3A4LA 5CUQA 2E5LB 5SYNA 1QX4A 4IXTA 1W4CA 1CEEA 4XQ0A 1W0KA 3KUXA 2R5FA 4LRWA 4CNBA 1RJ9A 3G49A 1FSSA 2R85A 4YRPA 3W2GA 1E1RA 2ACEA 1OFVA 1P4HA 3V1UA 1R27A 2M6RA 4GPZA 1YQWA 2V1UA 4N48A 2F67A 2CNWD 1KAMA 5FNVF 4PN7A 4WKCA 4WN3A 4DA6A 2OKGA 2PYIA 3M1LA 3FMPB 1ADFA 2ILTA 1PL0A 2SCUA 2XGOA 5H3HA 2GFIA 3U3RA 2HIMA 3HO1A 3CW8X 1QLJA 4F86A 4V0NA 3RJ9A 1SVUA 4ALKA 1A77A 3HM9A 3D3EA 2QRVA 5FIUA 4OI1A 2R47A 4BQNA 5EIXA 3ID6C 1XMQB 2UYQA 4NG5A 1RKBA 3WGOA 1EUCA 4UOZA 1CUEA 1Z16A 1X7HA 3FFWA 3DQPA 3BBPA 4CQMB 1NVEA 4DSAA 3DE4X 2Z8YA 5JXIA 5BR8B 2NXJA 4FWTA 4TSFA 2AZMA 5J4YA 3ZK8A 4WFKA 2QIOA 3QA9A 4J1NA 2HF7A 2P90A 2CUZA 1HG1A 2JGKA 1QYVA 1J25A 3IELA 3KWFA 3BEDA 3S4YA 5CBPB 2WSSD 4F5WA 1Q17A 4GPIB 1EAYA 1YB6A 4D9CA 1M8FA 1KI8A 2QLNA 5HF9A 4FWBA 4EHNA 5E0KB 4RZQA 4WNIA 5EXXA 4FE3A 3FPBA 2B34A 1QJCA 4D9GA 4HVTA 5IM4F 1AQNA 1FDSA 4KK4A 4LCBA 1YFLA 1II8B 5JQGB 1GZDA 1IM2A 5LXTF 1B42A 1FDVA 2BMFA 1VKRA 1QQBA 2P8SA 3PICA 1ECBA 1Y1LA 3AHCA 3ONEA 5DEIA 3CX7A 4XYEA 4AM8A 3AIOA 1WVGA 4RTNA 3VR5D 1B16A 1TCVA 3INNA 3JWHA 4LEIA 4QBGB 4Z0TA 2XOXA 3DAOA 4V0LA 2WWYA 3D3KA 4AJEA 3LSYA 3BD6A 5D85A 4RK6A 1K6IA 4R51A 3NRJA 3WMFA 1BFDA 1PDWA 5EJEA 5JAUA 5DRTA 4V2UA 4G5OA 2NQ8A 4A2WA 1EBBA 3LWNA 1EXWA 1ZRNA 3EN0A 1MJNA 1R5NA 2D1QA 4RZ2A 1NMYA 1RKVA 1VBFA 4KIWA 3UMSA 4MV0A 3HGMA 3IDSA 2QR5A 3E35A 4MDFA 4M8LA 4OGWA 4XM0A 2SBTA 3FROA 3M6AA 1NN3A 1U7DA 3A1DA 4KDRA 1Y6GA 4E7PA 3LUGA 4PE5B 2X5KO 3O8BA 1WL8A 3U7FB 3KR2A 1P5HA 3H84A 5AOBA 5HGJA 2HCJB 4XTCS 4N7RA 2IGTA 4HQOA 2NPIA 1OZ0A 4WZAB 5BSUA 1A3CA 1G3MA 2VR1A 1GZ7A 3KHKA 4NU6A 4A6PA 6REQA 4MQFB 3V9PA 3QWAA 2EF0A 3CN9A 2O48X 4RVUA 3V4OA 3WGYA 4YGYA 5TQVA 1T0PA 4ENVA 3NBAA 1TAUA 3QWFA 5IC5A 4A9AA 1WDTA 3FOWA 4DDTA 5K0EA 4YVFA 3GZNB 5BY2A 1BHJA 3QF4A 3ABOB 4OP2A 2FY8A 2I2WA 2Q4BA 5BMVB 2IHNA 3OC0A 3I6MA 3VHXA 3VHQA 1P81A 3VO9A 1Z0KA 1WCIB 3MB8A 2NXWA 3P9SA 3WFIA 3W3AA 4BO3A 4Q4AB 2XY4A 4F2WA 2Z9BA 2JH9A 5AJUA 3GYBA 3O8LA 4FN5A 5AICA 2Y2UA 2CT8A 4OQMA 1PNTA 1OWOA 2JFUA 2QL9A 5BQ5A 4JI1B 3QLVA 4C7OA 1YR2A 1KR5A 1J9GA 2Z08A 4P08A 5C31A 2GXAA 3I9JA 2FDCA 1CHNA 2RBKA 5EJ4A 4BL5A 1E5QA 1EFUA 1JG7A 1KFCB 4HGRA 3M1IA 1ZNWA 5A4FS 2IYXA 2OKCA 2UDPA 3TOCA 2WU8A 4EZBA 3MS4A 1P0MA 3M5PA 4GBJA 3P2EA 3KE8A 3P0RA 3DBVO 3ZYZA 2O2SA 2B4TO 3KPJA 4ZQIA 4LKOA 5AKZA 1FP4B 1M2GA 2NTNA 1GU0A 2ZUUA 4P31A 5H1YA 3VR6A 3ZWVA 3WGVA 4YCSA 3L40A 1TAGA 1DKOA 1FFEA 5AOVA 4ZQEA 5AUQA 3S0JA 4ARVA 3NHBA 3UG7A 1WXWA 3INYA 1JKJB 2WDZA 1Y8CA 1E58A 2V5AA 4YRLA 3CRZA 3R4CA 3UBMA 1IJEA 1PR6A 4JVLA 4L85A 4L72A 4Z99A 2J4CA 3THRA 3SQWA 2JLVA 3BHJA 3ELWA 2VEOA 4AC9A 1UIMA 3F6CA 1UPTA 4OQPA 4Q7MB 3VO1A 1ZK1A 4FT2A 1XVIA 5ABPA 1YO6A 1C9KA 2NVUA 3IAAA 2J59A 4B74A 1TRKA 3NHZA 3HWSA 4C0WA 3EODA 4JOBA 3HKCB 3KQUA 1X3LA 3KALA 2O2EA 3KXLA 1B6SA 1XF9A 2IOQA 2PSDA 4OI4A 4K40A 5DK6A 5J2UF 2JLRA 5HA5A 3EMVA 1GR0A 1PIWA 1ZCFA 2QDXA 5CCBA 1BDHA 2AOXA 4X8HA 2AZTA 4F60A 4WZBE 1MB0A 2HRZA 1WLYA 2A3RA 2BLLA 2ET6A 1A04A 4UC0A 1GZ3A 1VLLA 4MYDA 5JVDB 1ETHA 1E69A 2QMQA 4X6YA 1P2FA 2BYTA 4ZVQA 4ZZ2A 2FPXA 2QL5A 3OG9A 5CEJA 3M6FA 4DG5A 3Q3VA 2AD5A 4M87A 2QDKA 1SC4A 1RXEA 1O8CA 1VGVA 5EJ9A 4WN9B 5IBQA 1TB4A 4LFBB 4RTSA 3QA3E 5TF4A 2BN4A 4NAUA 5BQPA 5KEIA 2XWPA 5K3CA 2XUZA 2XA1A 1D1SA 3QFCA 1S6YA 3PB3A 3K6SB 1SHJA 1SUAA 3BHIA 4GL2A 4BVJA 2WAYA 2CL0X 4P0QB 1VKOA 5CCXA 4ZDJA 2CDAA 4NBWA 2DPHA 1J49A 2H1IA 1JHRA 5G1OA 3V8BA 5IDVA 3ZWCA 3SX2A 1THMA 1E94E 3BC1A 1HLDA 3GB9A 3PNMA 4MPJA 4BIIA 2EGUA 4P36A 4DTCA 3GXOA 5CFRA 1MG0A 1CB0A 4DPMA 4E5KA 1YUNA 1TU4A 3GAMA 1UBHS 4MPTA 1TCCA 3ZHQA 1AHHA 3GLQA 3URMA 4MCIA 1I51A 1WY7A 5FRDA 4MVJA 1CY8A 3NTOA 1DGQA 2XSZD 1GPYA 1JLHA 5KQMA 1DRJA 4COOA 5ESXA 3B1ZA 2JHFA 1H65A 3OX3A 5EY5B 4FYIA 4I1VA 4Q48A 4U5XA 4QJ3A 4MRPA 2P9TA 1IK6A 1CDEA 1GXSA 1L5FA 4G36A 4TM8A 2VP9A 5SZJA 2VXOA 3EUFA 4NULA 4ZEVA 4ZREA 1WPRA 3CRRA 4J4TA 4AJPA 1NYLA 5KJFA 4DV1B 3F1LA 3NBFA 3HJGA 2JKZA 3O21A 2HUNA 3P2IA 2VJLA 3UKJA 2JFVA 3PQ7A 3JR7A 1GG9A 1YR1A 3MLAA 2DBRA 4L5YA 2DQSA 2YASA 5GWXA 1W5EA 2WV7A 3RYIA 1YQQA 2ZXEA 2O59A 1OT5A 2OBBA 2Q07A 1NATA 4WVLA 3ZY3A 4KO3S 4YT4A 1TA4A 2VWHA 4NCKA 3UJ6A 3NWJA 1DRKA 4XIFA 1HEIA 4I4CA 3T3DA 3AB8A 3VYWA 1J1ZA 2GCOA 4N5NA 1KAOA 3IRVA 4CCWA 3O1HB 2W37A 1C4KA 5ALSA 2O8DA 1ECGA 3VR0A 3EPPA 5EGSA 4E5PA 2X3FA 3Q87B 4AKTA 4AFNA 2ZYSA 1HZZA 3G0OA 1R2QA 3HU5A 3KVVA 3M1YA 2C04A 2EX4A 2P9YA 5A5EA 5KAPA 2RMKA 3NBQA 4IUDS 5I7SA 2YMMA 3OZWA 4A8PA 4ZCPA 2I4NA 4GR9A 1YXMA 4MKHA 4KOEC 1DDIA 3U56A 2C4HA 2OLKA 3SVTA 1RVDA 1DJLA 2R6GA 1KH1A 4WVFA 3EZNA 3SQMA 4H7PA 3Q8MA 4ZAZA 2NN3C 3OMXA 5JJBA 4H7HA 1GV1A 5FF9A 1HE3A 1TYZA 3SX0A 3WK7A 3N75A 4NCXA 4XRRA 3KOZA 3IC5A 2X4DA 1AY0A 3W0LB 4QTYA 3F8SA 4FGJA 4B40A 3GFQA 3K0KA 3K73O 3PR2B 4M7PA 1E7RA 2KQUA 5DTJA 2AR7A 4JELA 1TFUA 1UWVA 1W7AA 3OT1A 2CSUA 2J9XB 1JHXA 3Q5GA 5M3BA 3IXMA 2INGX 3K0BA 4RC9A 2B6HA 1EXVA 2OWDA 3LU1A 1X3SA 2B20A 3PCRB 4H60A 1ULUA 3LQRA 4N7MA 2I91A 4W7SA 1PFYA 3I28A 3GEHA 1M2JA 1Z0IA 2I03A 4UEWA 1ZG3A 2I22A 3VXKA 1DCKA 2UYOA 4OI0A 1OV6A 3FTNA 4J29A 5T6MA 4QX6A 4MB0A 3VR5A 3G5TA 4P3KA 5AP9A 4JB8A 4EPWA 5LYJB 2O8CB 5JC8A 1G0NA 3TRFA 2H07A 2IUFA 5FTMA 1FU7A 3D8BA 2OOSA 1QZTA 3PGA1 5BN1A 2FUG1 1L3CA 1C7JA 4O4LA 5FPPA 4TTPA 3P20A 1WLSA 1ZVKA 1YCDA 1UQRA 4I4IA 4UE2A 3EXFA 1DIOB 2WYUA 2C5AA 3OZDA 1FF9A 1QAMA 1IEQA 1TM2A 2OT3B 2QJWA 5JCOC 3E22A 2ZJ0A 4YRNA 3EK2A 3IA2A 3SBOA 4KKVA 3VOSA 1WV1A 4U7TB 4EQ6B 3KU4A 1J39A 2XVZA 2ZI3A 2M1ZA 3KKKA 4S0XA 3JZDA 3RAFC 3V4SA 3ADBA 3K3PA 3D59A 4HT3B 3MLBA 1TIKA 3WLHA 1LF0A 3V8VA 2ONZA 2C1XA 5DNUA 1KGSA 2EBUA 4K6OA 3SR3A 4K9PA 4PG8A 1GQFA 4JSRA 2EGHA 5BRNA 4U3JA 1OFGA 2A35A 1H1TA 2V7GA 4UTZA 3ABQB 1M2OA 2UXCB 1S2IA 3IUMA 4BASA 3UK7A 4WFQA 4WQMA 3UWPA 1XL1A 2JLQA 5FPHA 1JU4A 2ZIFA 3LQ2A 1GZ6A 3GDGA 2YQ5A 2OG1A 5LU8A 2FXIA 2PH1A 4N7JA 1NKTA 3IIIA 3BT7A 4JB3A 2QMOA 1XROA 2WLTA 4TTJA 2G6TA 1NQXA 5IJ0B 4HLUC 3TLAA 1B6TA 1CDDA 5DE3A 4QU9A 1CZHA 1MORA 1CZKA 1ZZEA 2RFLA 3ZCUA 1U2EA 3DLCA 1JIXA 2O1EA 4IOKA 2V59A 4UD6A 3EHEA 3B9QA 1YJCA 4J0EA 2CC2A 4KLCA 5TQJA 3NOVA 4JKIA 3I9V1 3TB4A 2QM7A 3VU8A 1POWA 3QKSB 2BM0A 4IIHA 3L79A 5I51A 2R1VA 5AHXA 3K9LA 1MZPA 1P31A 1YBMA 2E55A 2VHVA 3IBGA 4IP0A 2RK6A 2O5EA 3VR4H 3FNGA 1SQFA 8MHTA 1EK1A 1C8KA 3E5MA 3DUFB 5JMTA 1Z4KA 5E9JA 4EQZA 5LJIA 1SD2A 2GJAA 4KQGA 2REQA 1TM3E 3CE6A 1R74A 4BO9A 5HUQA 2OCXA 2X8WA 1Q2UA 4FSHA 1DIHA 3LPDA 4FEAA 1YMQA 3VPBA 1V8ZA 4IDQA 3ZWXA 1Z6XA 2O7RA 2O3JA 1P3DA 2CLCX 3JPWA 2HHCA 3KVOA 3R5SA 4ER3A 5I7WA 4XWWA 2D8MA 4AJ1A 2GWHA 5AHRA 3TW8A 3DEKA 4IFEA 4EY5A 4W4TA 1AX9A 4H0NA 1QOQB 3WYEA 4BJ6A 1R9GA 1N8KA 3CW9A 2UYHA 3K6JA 5FADA 4XWKA 3LQQA 2JJ1A 1FFHA 3K35A 4QA9A 3TSAA 5C8YB 1ZR4A 3P9RA 4KXYA 3KBOA 4NX2A 4HZGA 4AU1A 3EY4A 3PUHA 3R0ZA 5K6TA 1XZKA 2ERCA 1XEAA 1SRRA 1AC5A 1IH8A 2CMDA 2GVZC 2PMWB 3IIKA 3KJFA 4EB0A 3EAQA 4ZAWA 1RHRA 3O4GA 4EW3A 4AULA 2OQIA 5CYFA 3TXXA 4ETIA 3NX4A 1XHLA 3I01A 3G23A 2GJ4A 3AQIA 5IZCA 1UBTS 4WLFA 3L41A 3ZNPA 3ZQKA 1JBEA 1KETA 1NFRA 3K1ZA 2XCRB 2QQ5A 1Y3AA 3EAGA 1IJBA 1TJPB 3L43A 3LLCA 4LBWA 1E6KA 2WVAA 1N5DA 4WI1A 4EUSA 4AP5A 1CQZA 5G2OA 1C7RA 1NF9A 5FI5A 1GLVA 1I1NA 4XKJA 4D3ZA 2IS4A 2C7RA 2X3YA 2XCSB 3NHWA 5EMLA 2H17A 1P6QA 2YJ3A 2GERA 1O57A 2NO1A 3LIIA 4OHFA 4YDSA 1GCOA 2CL5A 3PZBA 4TTVA 4WADA 4YRCA 3IVCA 4KLAA 4BB9A 5DHFA 5FEUA 2OO3A 1JSRA 4GFDA 1HC7A 4W7IA 1P72A 4MQ6A 1VXRA 4YO7A 1ZUD1 3AONB 3IEUA 3JVVA 4P7FA 2PWAA 4PQGA 2MSLA 2IEZA 3GNTA 2QPAA 5LYYA 3V46A 3ZHBA 3I04A 4DLAA 3G0CA 3DMGA 4MQLA 4AG3A 1S8NA 3QSGA 1CE8B 1JPJA 1KY4A 4BZZA 2AFIA 1JEYA 1HEUA 2YRFA 4J16C 4LWOA 4ZU6X 4Z7JA 1JEQB 4PBTA 1GNRA 5AH0A 4AF8A 5CB4F 5ALIA 2H3EA 1ML4A 3AM5A 4ZI7B 3UT5B 1R5OA 1LNZA 1W85B 2NUAB 4Q47A 1N5RA 3TSCA 4Z3DA 1BX1A 1U1IA 4I81A 4IEFB 4M38A 3S8MA 1VFPA 3UBTA 3JCZA 2YWDA 3IUQA 3B36A 4AXBA 5KBYA 4MITA 2AQ8A 4RULA 3FLEA 3D6HA 1OI4A 4TS9A 3TQHA 3WNDA 2A3NA 1Y6QA 1XTBA 4TTAA 2YWCA 1C8VB 2P69A 3H7IA 4HWSA 2AYYA 4EF6A 1HZJA 4ZARA 2D7CA 2GF9A 1I0ZA 2C8KA 2PK3A 2VDMB 3GEGA 4QYSA 1OOEA 4NEQA 3AC0A 1FP6A 4OV6B 1CR1A 1DC8A 1Z29A 2JHPA 3KCQA 2BE7A 3T0GA 3ZIUA 3IODA 2JLBA 2ALJA 1TD1A 3K7EA 2OL4A 4PAGA 4S1PA 4GZ6A 1ENPA 4UMDA 5EQDA 3DQQA 2HYDA 4A82A 1DAEA 4NBUA 3UYLA 4JUFA 1XKQA 4B6SA 1D2GA 3MJ4A 3UQZA 1NJ6A 3MTJA 3EGXB 1MXHA 1A9SA 3B82A 4Q3EA 4CUJA 2R6FA 4B8WA 3CLUC 1OPXA 2QN7A 3A9VA 4Q9JA 2ZRQA 5EZSA 3D6AA 5FV7A 5B7GA 5CB8A 1IVNA 1QZXA 1DDOA 2AH5A 3GGCA 5FOSA 1H6CA 3MJCA 2VPZA 3HHEA 4Q66C 1SEVA 3SEQA 1AIPA 2I8LA 4IR7A 1KZ6A 1WW2A 3OH8A 5D2CA 3UMFA 4KB5A 5DYWA 3TQFA 5BR1A 4KRGA 4IRMA 1U8FO 1GUBA 3GI1A 5FP0A 2XNDA 4MS1A 1NXXA 1W6UA 3QKIA 5HGXA 2Q6VA 5B64A 5LBUA 1XYYA 2E4UA 4K05A 1SCAA 4PNEA 3B3FA 1L4MA 4JOQA 3U4HA 3LO5A 4ITVA 1HYEA 5FA5A 3KSRA 3EFOA 3I2GA 1M76A 1ZJ6A 4URWR 3RR2A 4AQDA 1JFTA 4LF8B 2VZEA 3C7KA 2XZLA 5JLAA 4AKHA 1QQTA 4UU8A 5I48A 1NR1A 3OJXA 3MOGA 1ZJZA 4TRNA 5ALTA 4UKDA 5AJYA 1R0ZA 2JK0A 2WIFA 3NUGA 3P2OA 3SPXA 2NT3A 3STUA 2ZB8A 1CSEE 4IMIB 1J56A 2YCLA 4G5SA 1FJXA 5A1TA 1DAKA 3TD9A 3I1JA 4HADA 3E7DA 3UQYS 4RL4A 4C4YA 4DSUA 2GO1A 2AG0A 1FYVA 3DCNA 2G76A 1SM4A 1H8EA 1B0PA 1DBRA 2RAPA 5ALPA 3ZBPA 5IFLA 3WYFA 3LX5A 3BKXA 3SKYA 5C52B 3CE9A 5JMPA 2R7MA 4JUBA 1W5TA 3FAKA 4M60A 2DH5A 1BE8A 2IXFA 3DVLA 3E3MA 4PIMA 4AY4A 4QLBA 4YJ3B 2FZCA 5A7HA 4IVPA 3HLTA 4EELA 4TS3A 2HYIC 1SD5A 3AY0A 4A4DA 4HRVA 1Y8RA 4HYEA 4Q4JB 1JDSA 4KYIB 4RV5A 2XA9A 4YJ2B 5JROA 5L3QA 3AI1A 3PDHA 2GPJA 1PD0A 1C0EA 3T1TA 1J24A 3AKEA 1CLUA 4PZZA 5ARCA 1B23P 3OZBA 4G89A 4OU5A 2BMEA 1T6XA 2VQEB 1TVMA 2C2KA 4RK0A 4GI3A 3TI7A 1E3SA 3QNUA 4U2EA 4B3CA 3C3MA 4IYJA 3FWHA 4KJXA 2JGFA 4NENA 1Q19A 2WRZA 5GONB 3WRWA 1IIBA 3VNVA 2ZYWX 1CULC 4HAVA 1N9ZA 1J8FA 1XPRA 1IYZA 4DKJA 1SJ9A 4A2QA 1GV0A 4IV8A 1E66A 1N6HA 4F3KA 4ECEA 2EQBA 1L5LA 2VLIA 3K1JA 1N25A 4MW9A 4NE2A 1Y48E 1BDMA 4CIVA 1TUGA 3U6BA 5EXPA 1IHPA 2EFDB 3C3WA 1EBUA 4RTJA 2ZSJA 5IW8A 3L1IA 2HGSA 3UUWA 1QHSA 3GRAA 4L7QA 2I7VA 3I64A 3UT0A 3BTOA 3ERCA 2J0QA 1IBLB 1UBMS 2HBZA 1A72A 2OB1A 1XHFA 4WBNA 1AMUA 2RJNA 3U4CA 4EA6A 2Q29A 5JZVA 2JL1A 1SKUA 1THZA 1NPYA 2VJMA 3I12A 5EIOA 5TQ0A 5CCDA 4IIEA 4EW1A 5MFZA 3GUUA 2ZYDA 2BMDA 3OAAD 4JP8A 3G82C 3QMWA 4HYYA 1BRTA 3IKJA 1O94D 3LT0A 4HFMA 5DYIA 5GP1A 1N92A 2EDCA 3HVUA 5HFNA 3WBKA 2W42A 5B6IA 1DZIA 1XZIA 2A9RA 5DBGA 2E7ZA 3HQ4O 3B1XA 3SVZA 2JGDA 4DYHA 3B2NA 3BL5A 3OZ7A 4TTQA 1VHLA 3SJZA 5LQUA 2VQSA 4UZEA 3OP1A 4R9SA 2F17A 1NBWB 3WLAA 1R4MA 2CXRA 3DOHA 3SZGA 2Z8YM 2Q6IA 4H77A 2EATA 4G5FA 4OLFA 5FFFA 1QYDA 3MS7A 3I0MA 1UDCA 4G1VA 2JLWA 5DI9A 4G01B 4POOA 1QFZA 1D4FA 2EBHX 5FEMA 5GTDA 4CCYA 4GVXA 1I13A 1P6XA 2ID8A 5DBHX 4FB4A 3ODGA 2A4KA 4QJIA 5LUAA 5FWYB 1QTIA 3N86A 4EO9A 2IHJA 4B43A 1KDPA 3JASA 1GTG1 2BFCB 1FNCA 1QO0D 1SKYB 2Y1FA 3BZUA 3GELA 3G2JA 3BXPA 2SKEA 3TCNA 5IZ4A 3ZDDA 1AKWA 1SK9A 3DHNA 4K9LA 1GA1A 2RI0A 2D0IA 1L4LA 2E89A 1HWYA 7REQA 2JKVA 3DTNA 3NIBA 1LDMA 4BQPA 3T9FA 4CM4A 2C4NA 2VHCA 4LIPD 4PO1A 2AE2A 5TPWA 4REOA 1B3BA 4MIOA 4UE3S 4BNDB 2QRKA 3PWKA 3DLHA 1J2EA 1WDMA 2GK7A 2NU6B 1L0BA 4G5XA 1BXZA 1UXHA 3QEJA 2W9XA 2XUJA 4QC2A 1X8JA 2IKQA 3V42A 3FTQA 1H9AA 4WHMA 3WS7A 2VUUA 2R4TA 1I7NA 3IQIX 5KJ1A 3C3YA 3LOQA 1E9RA 4FJ1A 3WDLA 3PA6A 3TLJA 2Y1XA 1RSZA 5KHAA 3TMKA 4LXIA 3ZH9B 9LDBA 3GRYA 2RGXA 4I4NA 4B85A 2NU7B 3DE1X 4FJ2A 1DUVG 1ZHOA 2F6RA 1Y5MA 3L8CA 1Q1NA 3N0TA 3VGJA 2RIPA 3GRVA 4LXXA 1KDTA 1JHYA 2QUHA 3J81k 2ZJ4A 2B4AA 4FBLA 2H29A 3MMZA 2DJ5A 1XMIA 3BRSA 4B83A 1GGMA 2UYYA 3SX4A 2EF1A 1MGPA 1DTWB 4ND4A 4S1WA 5JSKA 2FPGA 1H5QA 3HY3A 4H18A 1C7IA 1FC0A 3AHHA 1USGA 3ZHCA 3IPLA 4AY2A 2ZANA 1Y8AA 2VSOA 5H5JA 3JQBC 2A0UA 1JQEA 1DRWA 4BE7B 3QE2A 3HMKA 2WSBA 2H7YA 3PG5A 4LJ9A 1MABB 5H70A 1U9IA 3ZDZB 2ZR8A 4QKQA 2W2MA 4GEGA 3WLIA 2R48A 5E6UB 4PLTA 2VJBA 2J0EA 4QOGA 2W0MA 5KSWB 2HMVA 2JFOA 3C4JA 5F35A 3ENWA 4PC2A 5FFNA 2OHIA 3KLMX 3UHAA 4GXQA 2WSYB 2PLRA 3HB4X 3K09C 1Q74A 4J4HA 3U49A 1TMKA 1SVIA 2DLCX 1GKYA 4QXMA 1N8TA 3CNNA 4F4HA 4CIBA 2XMRA 2DKFA 4MKFA 3IUPA 1WDLA 2A78A 2PKWA 3KEFA 4KWTA 5LC1A 2QN8A 2G9VA 2XUPA 3P9IA 5JATA 3HWX1 1XYGA 2Q21A 3GAAA 1H1LA 1NP3A 2R4QA 4LE2A 3BB4A 4MPPA 5CW2A 1G1MA 1VZ3A 1Q2XA 2ZRPA 3A8TA 3JQ8B 2VH2A 5EWJA 1YVPA 1HYGA 3H18A 3MTGA 3N8HA 1AKQA 4N65A 4ESOA 4WAUA 2C31A 2NYUA 2DFLA 4RVNA 3TQRA 3RARA 2NVBA 3V7WA 3MIZA 4AJ2A 1V41E 1X2BA 1V1RB 4Z9AA 5GJWC 3WL7A 3W5AA 1XKXA 2V8OA 1KOJA 5JFTA 3DBIA 3MNFA 3VZDA 1N5OX 1VBKA 2PA0A 2X77A 3AVOA 2W00A 5CRIA 1P61B 4LVNA 3TTXA 3C7AA 4PSDA 3EOAI 4ZAYA 3ZZTA 2J3QA 5EIFA 2WWXA 3GVPA 2M6LA 5IDQA 2BGTA 3AY7A 3P9QA 3VDRA 2C1ZA 2QB5A 3B6KA 3PPYA 1YHNA 4ZVOA 2XUQA 3FNHA 3AESB 1V48A 2TMKA 4DA7A 4DLRA 1RJDA 4N5MA 1C7FA 2D54A 1ZZGA 4NC9A 2XT9A 3AR9A 5BVHA 2UZ4A 3R6DA 2XLCA 1OYOA 3ZQ6A 4A73A 3EUEA 1Z2EA 4HNTA 3WYBA 4D81A 3L18A 3R9IA 5DRYA 5GZ1A 2RCYA 4H4CA 4XDYA 3WNQA 4BVEA 1GHTA 1XEXB 2AOUB 3LVQE 1A8QA 3Q7RA 2B6NA 5FWNA 5A4MS 2WKRA 5ELLA 1EZ1A 4LDQA 1CQJB 5DMHA 5B37A 2I6QA 3PWSA 3ICPA 3K0FB 2CMFA 4HXFB 9GPBA 1RFGE 4NZNA 3VKHA 4FZVA 3KT8A 4BV8A 4GC9A 4QT0A 5B53A 3ZZMA 2PL1A 2IU3A 4MWBA 3ISTA 5DHRA 3TDMA 1GPUA 1YJBA 4L51A 3VU9A 2HXYA 4OU4A 4EECA 3EPKA 3QOFA 5FBZA 2C4UA 1EJ0A 4LOJA 3AUUA 3H0CA 4DILA 4Z4QA 1JP7A 2EDAA 4JP3A 2R6ZA 4L6CA 3LZ6A 4XUGB 1M2FA 4AQYB 3MXOA 4BVAA 2WYIA 3PXGA 3BICA 1FFCA 4Q1AA 2VCHA 1FL9A 3NJ4A 3Q2IA 1WIWA 4IJ5A 1A4RA 3P2MA 2ZTUA 4KYVA 4ZZ1A 1FYDA 2YJ5A 4MGYR 4K1LA 1EJ6A 5TEWA 1N2EA 4RVHA 2BE9A 3QVLA 1Z4JA 2H1FA 3BF7A 4RHFA 4A0RA 1VRVA 3Q4GA 5J4LA 3VKFA 4OM7A 4QIHA 3AW8A 3L8DA 1UWCA 1BC5A 3B7WA 1FPMA 2Y1GA 4H15A 4Q7KA 1ZI9A 4UFNA 4BFTA 2EJBA 3K70C 2W8ZA 4IV0A 5DM0A 3SS7X 1G3IA 5KYUB 4TQGA 1TZCA 3RIXA 4ESEA 5CX1A 5FI1B 1ZBQA 4LXYA 5J5AA 1ZBDA 1G8AA 3VSCA 5IDYA 4YRZA 2F3SA 2MT9A 2YC4C 2MJLA 1RYBA 2I62A 3ZDXB 3E3NA 2B61A 3PTLA 5CVEA 1QYXA 3NI2A 4ZU1X 3AK4A 4ZZ0A 5H8WA 5EL0A 1T0UA 3CLTC 4UDXX 4B32A 4KC0A 4KBFA 5DWDA 2IJGX 3ICEA 3TFOA 3A6DA 2HA4A 3ZU2A 3U37A 2WWGA 2D00A 2I2BA 1QH1A 2XAUA 4Y9TA 4AO8A 2WP8J 2AW3A 3DVRX 1TE2A 5LXTA 4JODA 1HK7A 3EVDA 3LUKA 4Q3NA 2GD2A 1KBQA 2O52A 3U9SA 3C5EA 3KQNA 4NOLA 3AETA 4WOPA 4ZCTA 2P4EA 3OJEA 4Q3KA 3UMVA 1RC0A 2KWIA 2OR3A 2Q5HA 1W46A 2C92A 4Q4HB 1QHNA 4QRIA 3SSMA 3QGMA 4XCXA 1QR2A 3OZUA 5K0NA 5AVUA 1QQAA 2OFXA 2Y8EA 1GZVA 3JYPA 2PUVA 2P4HX 3I9NA 3S68A 2XD9A 2ACKA 2J9FA 2VP6A 3RROA 5LSAA 5LD2B 1WHTB 1XRMA 1EVKA 2O05A 1FRZA 2QSYA 4MVWA 9ATCA 4F72A 1IPHA 1OLSA 4F6RB 4L16A 3L6OO 4MSUA 3SXUB 4KXUA 2V7QD 3AM4A 2HA3A 1P2SA 1AZSC 4I4TB 3W5JA 3H4TA 5KNDA 1I2DA 4Z7OB 4PTZA 2A7QA 3H8JA 1OLXA 4OBWA 3URKA 3UUEA 4DBVO 3IR5A 1DAHA 4G97A 1T3HA 3BVPA 1NVBA 1QO0A 2JK1A 5I7OA 1J0DA 1P2GA 2Q3FA 3B5JA 4GL4A 4JU9A 5L7WA 1KMHB 2J3EA 1QG4A 1N5KA 2CLDX 2HRRA 2JFNA 4YB8A 5DSTA 2J09A 4P84A 5JEEA 2XYQA 3K6KA 1GPKA 4LV5B 5EC8A 3HDHA 1H8HA 2QSUA 4IJVA 4XVHA 4CT0A 4YV2A 2ZJ6A 4CM1A 1C4WA 1SH7A 2AI3A 2FG7C 3M0EA 3W6NA 2H11A 4ZO9A 1MW8X 4IW3B 3M82A 2NV0A 2JANA 2ZI9A 2QAGB 2PT7A 4EGFA 3IJRA 1BSVA 1WXDA 4X84A 3VAYA 1RI1A 4PYKA 5CA0F 2OGZA 4DV4B 4Z49A 1DEKA 3KVYA 1ADBA 2NXNA 2WI8A 3H5IA 1TJ4A 5LZ2A 4YNBA 1M6VB 4D3DA 3OFKA 4CGYA 3NT2A 4P86A 2P30A 4QU8A 5BUZA 3EF1A 1FRQA 3GJYA 4TLLB 2FVYA 3A9SA 3W9UA 3W8DA 4KREA 4HVCA 1Q91A 2HHHB 3MTIA 3AL2A 2YWHA 2QY9A 5H3LA 1YU9A 4ZRDA 3ZJYA 1P1BA 2JFBA 3TNYA 3FCOA 3ESXA 2HR1A 2OCPA 1EXMA 1ZD3A 1QIFA 1UXJA 2E1RA 2Y1OA 5JAZA 4OM8A 4L3VA 5B2FA 4MV4A 4NPCA 1KAGA 1XZJA 1O03A 1WU8A 3SDZA 2IYTA 5BWLA 1OA0A 2NAPA 1KVTA 1VP9A 4X95A 1S7CA 1REQA 4C3OB 4AZ3A 4MAMA 2H1SA 2OSVA 3NETA 1LVGA 4QQ8A 4DS3A 3BGSA 1R0SA 3PWZA 1N0IA 4PG6A 1YC5A 2BEJA 1X9HA 5HEKA 3ZV6A 1QTRA 1LXCA 5FV4A 2O3UA 4F0JA 1MP0A 1TNDA 3W6UA 2I87A 4Y0VA 1LZLA 5JARA 3EASA 3NC1C 5CPFA 4RIHA 4U6QA 3UJCA 4NNPA 1ANKA 4A0GA 4DMMA 3LMKA 1KI6A 2QZZA 4X44A 2P3QA 1HTWA 3S81A 3GV0A 2WZCA 2J33A 3EA4A 2J0VA 3T4PA 2GXSA 2I6SA 3N8NA 1CJVC 1WZEA 4DNOA 3DA8A 3Q72A 2RGYA 2IUYA 1WUIS 3Q41A 5CXQA 4FM9A 4A91A 4MROA 2B1IA 4IVQA 3D1LA 3PA8A 2MSCB 3TMAA 4AYXA 1FFXA 1MVLA 1X1BA 2EP7A 3DZIA 3G0IA 4X90A 4CFYA 1KDZA 3UMCA 4RESA 3TEFA 2VSNA 1PDVA 3DMRA 2ZRLA 3CURA 4HDOB 4H0CA 3WKCA 1XTKA 3KPYA 1PT6A 4H1VA 3FYCA 4MQ4A 4ZAFA 4EF5A 4KGDA 2MSNA 2XDAA 3AVPA 3JAKB 1FVXA 3RANA 3DFIA 3UXEA 1LTQA 2WF8A 4L4ZA 1A1VA 2ZKLA 2X2OA 4O4HB 1LNSA 3DEAA 4XYMA 2BFPA 2JIRA 4RA9A 4B3FX 1NUQA 5BYAA 4YRIA 1U8TA 2ZYUX 3RK1A 3ME5A 1E61A 2A86A 2MSKA 5E8RA 2D7DA 3R5XA 1BVYF 3HA2A 1WMFA 5F1PA 4QTZA 3V33A 4HK4A 4MZXA 4DLPA 1P9WA 4MVYA 4KWHA 5J5VA 1QFYA 2COEA 1UQUA 4OFBA 4EJFA 5EXSA 2EIHA 3I3OA 2VK1A 3N28A 7MHTA 3ACDA 3W90A 3I01M 4K5QA 4L8WB 1EB8A 1JYEA 5GY7A 2MTBA 4BO4A 2QR2A 4UUMA 3OPYI 1H3FA 4RMIA 5FI3A 2J7PD 1W93A 2QRNA 4MO2A 4NJEA 4X54A 1U90A 1QGOA 3GFGA 1GZSA 3Q88A 4CODB 1IOWA 4HH0A 3DNFA 2GJ8A 3QEAZ 4EYEA 2OZKA 4HDMB 2PIAA 1DO2A 1R0XA 1WBJB 3A4TA 4MLPA 4TV8F 3V2UA 2XQGA 4OJQA 3OZSA 4CMHA 3IOYA 3OO1A 3HADA 5JR3A 3Q0EA 1AO3A 2GBIA 4N9QA 4RA6B 1GTZA 4B7AA 4BNKA 4Q1FA 2D1SA 1PJTA 4TYPA 3R9KA 4AS3A 4DLBA 1M2KA 1MQ8B 5U4QA 4DV7B 2IDZA 4HB0A 1X1DA 4IDBA 1E4EA 1F8UA 3P0EA 4UTXA 3COZA 4Y6QA 1A5SB 4Y8VA 4C6TA 3MBOA 2HAEA 2PFSA 4XVCA 2PUCA 4RDCA 2MINA 3IERA 1K0UA 5LDGA 1CR2A 2OQ2A 3CEHA 1I0IA 3D1VA 4MTCA 3FHTA 1PF7E 1PTKA 3VAAA 2ZIZA 1QHXA 2JCSA 3N2GA 1GQYA 1GUZA 1P75A 2Q6KA 1QG6A 4PF1A 3L7BA 5AXBA 5FPKA 5DNYB 1JHAA 1IDN1 4JJIA 2QRQA 3QU4A 1T3LA 1MO3A 2HO4A 1KHHA 2GR9A 1Y3HA 2B8JA 2FSUA 4UUOA 4B6EA 2XUOA 3L0ZA 3QLEA 2GPTA 5IULC 5FHQA 3ZV7A 3NCTA 4WUTA 5EI5A 3IQWA 3KR0A 1MQAA 4KRXA 4MQBA 3SS8A 1MCZA 4DJAA 4DPKA 2JS7A 2UZ1B 3K6RA 4CDRA 1H2WA 2W4QA 3BS4A 3NFYA 1QH9A 2Q8NA 1A97A 4DEYA 1PEAA 4OLBA 4HLDA 4FZJA 3IHTA 5G4LA 2R6R1 3HFGA 2B3DA 1DKUA 3DEFA 5TF0A 4EG0A 3ESQA 4JL8A 4I19A 4BNZA 2E2WA 1R4NB 1U04A 1NVWQ 4MKZA 5MN4A 5C53B 4YCBA 5H82A 4JUCA 1JI0A 2C2BA 3UFXB 1BHSA 4PQRA 2ATXA 5LP6C 4BLVA 4AKIA 1PCXA 4DCSA 2B1JA 1Y9DA 1LBTA 1FQJA 3TDNA 3SZLA 4PHTA 2RHGB 5JH7A 4RZUA 4EMTA 4WNAA 4F3YA 2ZM6B 2OK8A 3IPYA 4KH0A 1JXQA 5EIBC 4O5AA 3JD2A 3B1FA 8AT1A 1YZFA 5K45A 4MYSA 1T3TA 3WL3A 4ZXFA 1L7EA 3NHMA 3EGEA 3K0AA 3R3YA 4D0SA 4DRXB 1CUJA 1GCGA 4RUKA 5DF1A 3RUHA 5LDDC 2PLWA 1L4FA 3PPVA 2HMWA 4MUHA 3UIEA 1V4BA 3L7NA 4QPJC 5LIPA 3DO6A 4AAYA 2F3QA 4U7PB 5EEHA 4UUBA 2G3YA 1X7YA 4JT9A 4LXGA 2WLSA 5AIAA 1DOHA 5H3CA 5I9SA 4CEJA 1B26A 3QZUA 4E11A 1GPNA 1A4UA 2AJTA 2YY5A 5TX7A 1IQ0A 2C7PA 3FYTA 1E0JA 4JKYA 2FZWA 4KVAA 3UH0A 3TAUA 1ILEA 4M3NA 4FFNA 4YASA 3C3PA 1Q5PA 2XB6A 2WQ6A 2HK7A 3CLHA 3M4ZA 3P94A 5JS2A 1WRBA 4UTRA 4JYZA 1NP6A 5B55A 4Q1CA 1EP9A 1W0CA 2OYSA 4KFSA 4DWJA 4HNQA 4MQEB 4F4IA 1XJQA 5J1TB 5FO1A 2NUPA 3STVA 4I55B 5LD2C 4LTNA 2W98A 1YTLA 4TTTS 3PHGA 1ZWLA 5L51A 1RM3A 3ZU6A 2PUBA 3PX7A 2FEMA 3INTA 1GRQA 4G0PA 1L1EA 3ZNOA 3PFFA 2P1ZA 3OCWA 4HQKA 3VOAA 2PXHA 5JNWA 1L7RA 3IP3A 4L5CA 4F1JA 2CLOB 2GN8A 4MX8A 4X65B 5FFMA 3ITKA 1BAPA 3WQQA 4IWNA 1CUZA 3A6EA 2GBLC 3EZLA 4TKUB