4NQRA

The crystal structure of a solute-binding protein (n280d mutant) from anabaena variabilis atcc 29413 in complex with alanine
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
364
structure length
364
Chain Sequence
NTIPIGIALAQTSNVALLGQEQVAGAKIAEKYFNDKGGVNGTPIKLIFQDTAGDEAGTINAFQTLINKDKVVGIVGPTLSQQAFSANPIAERAKVPVVGPSNTAKGIPEIGDYVARVSAPVSVVAPNSVKAALKQNPNIKKVAVFFAQNDAFSKSETEIFQQTVKDQGLELVTVQKFQTTDTDFQSQATNAINLKPDLVIISGLAADGGNLVRQLRELGYQGAIIGGDGLNTSNVFAVCKALCDGVLIAQAYSPEYTGEINKAFRQAYVDQYKKEPPQFSAQAFAAVQVYVESLKALDTKNKVSKIQLPELRTELNKQLLTGKYNTPLGEISFTPIGEVVQKDFYVAQIKMEKDGSQGKFTFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amino acid/amide ABC transporter substrate-binding protein,
publication title The crystal structure of a solute-binding protein (N280D mutant) from Anabaena variabilis ATCC 29413 in complex with alanine.
rcsb
source organism Anabaena variabilis
molecule tags Transport protein
total genus 141
structure length 364
sequence length 364
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13458 Peripla_BP_6 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4nqrA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4nqrA01
2E4WA 3CNBA 3OMWA 1ZHHA 5IBQA 5T3YA 6CHYA 3CRNA 1JHZA 2NUBA 1JH9A 1U8TA 4F12A 3MM4A 4ZMSA 1DC8A 4IRXA 4YS6A 3RVQA 5CNIA 1Z18A 2P9HA 1D4ZA 4G0MA 3QK7A 4MS1B 1UDRA 4Z9BA 5HKOA 3A0RB 1YVUA 3B2NA 4RZSA 1OXBB 2ZWMA 4EYGA 4XAQA 1NTRA 4RK4A 2HJ9A 2PUFA 4LDZA 1U04A 3RQIA 4G0QA 1CYEA 2I6FA 1CEYA 1PHRA 1NXWA 3K4HA 1Z12A 5HM6A 2NT4A 4NCAA 4W5QA 3N8IA 3LUHA 3Q15C 4Z0NA 3QX9A 3N75A 1LJLA 4RK1A 5KQLA 4O1IA 3O1JC 3HK2A 3I45A 4Z99A 4RSMA 2FLWA 3HEBA 1QO0A 3CU5A 4JP1A 4KK3A 2MYNA 2WRZA 2HPHA 2MYUA 2RDMA 3RVJA 4MR9B 3JPWA 2NT3A 3T8YA 2QVCA 4KFCA 1Y1LA 4IMIB 3ILHA 4LE2A 1JFSA 1M2FA 4N76A 2X7XA 4JB0A 1K68A 4P98A 3JVIA 1Z16A 3VNBA 2PUEA 1PEAA 4UHJA 2LBPA 1W25A 3H5WA 3GYBA 2BGGA 1VKRA 5BRAA 4O1HA 3DBIA 3HDVA 1QP4A 3CG0A 2L18A 5BRJA 1CHNA 3JPYA 4G0OA 4MLCA 3C3MA 1XHEA 3N0XA 1PUXA 2PL9A 4E7OA 7ABPA 3BILA 2IPMA 1QQAA 5ABPA 2JVKA 2RJNA 3H6GA 3IP9A 3KG2A 5BR1A 3H5VA 4WZZA 4LZLA 5TPWB 1TLFA 3O2SB 3OQNA 4D6XA 1GUDA 5CHYA 3URMA 2QU7A 1L5YA 2MYPA 4MR7A 1A2OA 5T7BA 3IPCA 1DCKA 2E4VA 3RVNA 4MS3A 4RV5A 3HUTA 3LTEA 2JBAA 3L49A 1EHCA 3IDOA 4PYRA 3KHTA 4KQ9A 4EYQA 1BVHA 4G0ZA 3C97A 1DRKA 2AYXA 2IYNA 3HCWA 1ABEA 1DRJA 1F51E 1J56A 3RVPA 1GCGA 1P8AA 1P6UA 4G97A 4MQFA 2MYTA 2IPAB 2JVJA 2FLKA 4RKQA 5CNMA 4S05A 3OMXA 3QLTA 1MVOA 2IPLA 4KK4A 3TD9A 2F8TA 3OM1A 4LRQA 4EGSA 3IP5A 3DLHA 4EVSA 3SAJA 3RH0A 1APBA 3EDCA 4YR7A 2L2QA 1RPJA 4Z9AA 2HQOA 3CS3A 1PNTA 4HNQA 3HS3A 3M9XA 3OLYA 3H75A 3C3WA 1IIBA 3DGEC 3OQMA 1F4VA 1ZH4A 4RK6A 1GLGA 4MQEB 3H1GA 1XHFA 1ZN2A 1YK0A 3R0JA 2FQWA 1KRXA 3QEMB 4Z4HA 3MF4A 1AB6A 3OLVA 3KJXA 4G0YA 2GKGA 4W5OA 2WB4A 3RVMA 2M1ZA 3FGZA 3GWGA 2RGYA 1QNLA 5TQ0B 3EQZA 1A0OA 4MRMA 4MS4B 5I4CA 4F06A 5KC8A 3DZDA 2CHEA 2VYCA 4ML3A 4KREA 1YMUA 1SXGA 3UK0A 1JWLA 3EQ2A 4EVRA 2VUIB 2MSWA 4LX8A 3QELB 4MAAA 5EWLA 3UUGA 4H3HB 4FE7A 2PKXA 3A3KA 5TPZD 1L5ZA 1DBPA 3O2QB 5PNTA 1H9CA 1SRRA 1I3CA 1DC7A 4Q7EA 5KQGA 3RVKA 1MB3A 1C4WA 3TMYA 3NNSA 4HNRA 4TLLB 4E7PA 4EVQA 4KNYA 4N03A 1ZESA 4MLDA 4TMYA 1E2BA 4PICA 5JNVA 3H1FA 1USIA 3BBLA 4JB2A 4M88A 1M5UA 1RXIA 1B00A 1NXSA 4DN6A 5IUNC 1DJMA 3G85A 3N53A 3SNKA 2HSGA 1BDIA 3OLZA 3NNNA 2A9RA 4G0PA 4Z4FA 1Z26A 2E4YA 3OO1A 1RZRD 4H3KB 1U2QA 4KVFA 2A9PA 5EWMB 3KKEA 4QPJC 4ETIA 2FMHA 3T38A 5IULC 1USKA 2QR3A 5FWYB 1DG9A 1M5TA 3CFYA 2A9OA 2JVIA 3O2JA 4NV3A 1JYEA 3LUDA 4O5AA 4PEVA 2FVYA 3N0WA 1D2AA 3F7NA 4G0XA 5IEBA 3LOPA 1OXKB 3L6UA 1AB5A 3FFWA 2M98A 4GPAA 4FB4A 5KC9A 3F6PA 5TQ2A 4XASA 3O75A 5DGCA 1JX6A 3JVDA 3CZCA 3N6VA 4D6YA 2IDMA 4RK5A 5HSGA 4HYEA 1SXHA 1JFTA 5D2CA 4IMJB 4KPYA 1R8JA 1NXTA 2V0NA 1QPZA 2B4AA 4NQRA 3OLXA 5EWJB 2JB9A 3SQNA 1DZ3A 3O1IC 3O21A 2H3HA 3KCNA 3S99A 2WWVD 4CBVA 2E4ZA 4PE5B 1DCFA 3KS9A 3LFTA 4HNSA 4TLMB 2J48A 3ILYA 2PLNA 2CD7A 3EJWA 4JAVC 5JS1A 3LUKA 5BQ3A 1Z2DA 3DGFC 4MR8A 1NXVA 2GI4A 3T95A 4YV7A 1QQBA 3W9SA 3F73A 5JS2A 3EODA 3G1WA 5IX8A 2N9UA 2TMYA 2PJUA 3UKJA 5DTEA 4N0QA 5FWXB 3MQ4A 3P9YA 4EY3A 3MA0A 1YS6A 4KRFA 2QV0A 4DQDA 5JNTA 4W5RA 2OENG 1VPWA 5C5EA 4MYRA 4YWHA 2DRIA 2R4QA 4P1ZA 4OG2A 3QEKA 3LUCA 2FQYA 1ISSA 2OQRA 2MSLA 3QLUA 1SD5A 2R48A 1ZGGA 1T34A 2GWRA 2PL1A 5KI6A 1NATA 2CHFA 4IILA 4ZPJA 1EAYA 5C5CA 4ZMRA 6ABPA 1BDHA 3H1EA 3NHMA 3LMKA 3HZHA 4RK7A 3M6MD 3A0UA 3RVLA 1ZVVA 1NY5A 2L19A 5IC5A 2MSKA 4MS1A 4ZYLA 3RVRA 2FXIA 4JOQA 4W5NA 3BRSA 4Z4IA 4TN5A 2FMFA 3CHYA 3Q41A 1YTUA 3GBPA 5IUKC 2WJAA 4OTZA 1C0EA 1FFGA 3O74A 3TB6A 5IEJA 1RNLA 3GT7A 5FBKA 1KMIY 2WMYA 3HM9A 1TJYA 4QYMA 3CZ5A 3DLBA 1ISRA 2LP4Y 1PNRA 2PUDA 3EULA 1VRVA 3KTOA 5TE9A 2JRLA 2YHBA 2NZUG 1ZH2A 3A10A 3KYJB 1RXEA 2QXYA 4LE1A 5GQSA 3RVOA 3EAFA 5KQPA 4IF4A 1D1QA 3OO0A 5ED4A 1NXPA 3QLUC 4LDAA 3CTPA 4MR9A 1Z2EA 3N0RA 4YCSA 2WJWA 4KV7A 3LKBA 1LBIA 1S8NA 2QSJA 4KQCA 3MYYA 4MR7B 4RU1A 2FQXA 1KGSA 4Y9TA 1Z13A 1GCAA 2AYZA 2PUAA 3O1HB 4MS3B 1QP7A 4RDCA 9ABPA 1EWKA 1TVMA 3Q7TA 4Z4CA 1DCMA 2PMCA 2R47A 1QKKA 2JBAB 3OM0A 5B3JA 4Z4EA 3LUFA 3H5OA 4S04A 1Z25A 2R25B 3E61A 4GNRA 4WUTA 3KLNA 2O20A 4UHKA 1BA2A 4B09A 2GX6A 4EYOA 3LUGA 1GUBA 1LK0A 3FMVA 1E6LA 1BDJA 2IKSA 3HSYA 4EUKA 4MQFB 4OLBA 3GL9A 3D8UA 1FQWA 4JASB 4ETMA 3IP7A 4KMRA 4ETNA 5TPWA 1QMPA 3FFTA 3IPAA 5TQJA 4L4UA 3GV0A 1JDNA 3VNAA 1W9HA 5JNRA 3BREA 1P2FA 1ZITA 1MAVA 4D74A 3HV2A 1D5WA 5DKFA 3HUUA 5HQJA 3NHZA 2FW0A 1U0SY 5FWXA 5TPZA 3I5AA 4RY0A 1JF8A 2FEKA 2ID9A 2F8SA 2FSPA 1MB0A 2CWDA 2ZAYA 1XWWA 3H5LA 4IGAA 3QX8A 2FKAA 4XFKA 1KRWA 5JNUA 3SM9A 1ZAYA 4RY9A 2LIVA 4G86A 8ABPA 4MRMB 4WT7A 1JL3A 5GOTA 5B3JC 3C3KA 4OBBA 1DBWA 1NXOA 4MGEA 3T6KA 5EWLB 1TM2A 2ID7A 3LUAA 2FEWB 4WXEA 3I42A 1JBEA 2LPMA 2L17A 4OLAA 1QP0A 3F6CA 1JYFA 1JLKA 1FFWA 5FBHA 3HVRA 4WXMA 4YGXB 2P4UA 2E4XA 4WWHA 1RZRA 1K66A 3K9CA 4RKRA 1YMVA 5KQMA 3GBVA 3JS5A 3Q9SA 4QYWA 3H5TA 1D1PA 1URPA 3H5IA 1DBQA 1P6QA 4MQEA 4L85A 2QZJA 3EGCA 4LE0A 4NICA 5IUJC 4DADA 3QEMA 1WETA 2LUOA 1PEYA 3SG0A 2HQBA 4ZJPA 1Z15A 4OATA 4PZ0A 3ROTA 5DLEA 1TMYA 3C6QA 5TQ0A 4MS4A 3MIZA 5JNWA 1EFAA 1DP4A 3KYIB 2A9QA 3LKVA 1LJUA 2HQRA 2JCGA 4XXHA 4YLEA 3GRCA 1ZY2A 4RXTA 3QELA 3KLOA 2RJOA 4YP9A 5JNSA 5CNKA 5DCLA 4RWEA 2FN9A 3NNDA 1VLZA 2WY2D 2GBPA 1JFVA 2H0AA 1YS7A 3RVSA 2VK2A 1E6MA 3HDGA 2FEPA 1JDPA 3D02A 3TO5A 3QLVA 2Q5CA 1ZDMA 3CLKA 4XARA 4F8JA 4Q6WA 4XLTA 2JK1A 4N47A 4YO7A 4F3TA 4RXMA 2QVGA 5TQ2B 4F11A 4RS3A 1E6KA 4H60A 2FN8A 5E3JA 1BAPA 3LUJA 5F64A 2VUHB 3JTEA 4NCBA 2FMKA 3OLWA 3IP6A 3ROFA 3FDFA 4RK0A 2KYRA 4MPTA 1U2PA 2PUGA 5EWMA 3MMNA 3CG4A 2XDYA 2PE5A 1NXXA 1ABFA 2PUCA 2QW1A 3JY6A 5FWYA 3NBMA 4RXUA 4FE4A 4RY8A 2FTKE 3GA5A 3OQOA 2IOYA 3Q7SA 3SY8A 3M9WA 4MR8B 1ZGZA 3KSMA 1EWTA 1SXIA 1A04A 1EWVA 2E4UA 3E3MA 2NZVG 1LBHA 4N41A 3TX6A 4Q6BA 4YRZA 2B1JA 3HXMA 1MIHA 4W5TA 4Z4GA 3QLVC 4KZKA 3CKMA 1YK1A 2IPNA 3I09A 4QICA 5CNJA 3Q7RA 2W42A 4JA2A 2FMIA 1FFSA 1HEYA 2PUBA 1M2EA 1QO0D 2YHAA 5EWJA 3HO1A 1Z17A 3H6HA 1USGA 1FSPA 3FFXA 5KWSA 3BRQA 1YIOA 3HJFA 4N0PA 2PAFA 4EYKA
chains in the Genus database with same CATH superfamily
4LHEA 3EDYA 3OMWA 4UPEA 4G1EB 3NYWA 2I6QA 4ON9A 2DOKA 5CIQA 2JJMA 4XW2A 4HI0E 2IHNA 2CFTA 1WMFA 4LMBA 3H2JA 3EZFA 1JH9A 1YZ3A 3LKDA 4B6JA 2OB1A 3EGXB 3EXIA 5DEIA 2I4RA 3RS4A 1L7OA 4K9QA 5HOEA 1WD5A 3QBEA 4PRLA 1GTZA 2OBXA 2PH7A 4XVQA 4G09A 1D4ZA 2WIBA 4L9AA 4E31A 5A02A 5I7VA 1TCAA 1TTPB 1ADBA 1VHWA 4B6FA 3SOZA 4DE5A 2WZBA 4XAQA 3IL2A 1NTRA 2WP0A 1POWA 1I6MA 3F6BX 1JMKC 1U04A 1GITA 5HCUA 3VSAA 2Y9MB 4ZOLA 4UVDA 4R8RA 4BFZA 4PTZA 4DUGA 4PQRA 5FUBA 3WKEA 4NXMB 5MDHA 3VOTA 3THXA 1I5EA 5AUPB 5IF9A 4BO3A 3RFFA 1QBGA 2XVMA 3N2YA 4HPWA 2EL7A 4O1IA 1ECBA 4U3JB 2QM8A 5A5DA 3G5TA 3VNVA 4YPVA 4ZVQA 2ASEA 2G71A 3HH8A 4FGWA 1Y82A 2EF1A 4YRSA 5LQUA 2FX3A 2VPPA 3WGLA 1BFUA 5ITZA 2QD3A 4CL3A 1EB9A 1H2YA 3T8YA 4O02B 1GTVA 1TKAA 2PD4A 1YQXA 4RQAA 3R7NA 3E5NA 2UZ1B 5A0FA 2BDEA 3UWMA 5F3RA 1YI0A 1P39A 3O8DA 1QRDA 5KBYA 4LJSA 3QEBZ 1OJLA 1DAHA 1NYRA 1VSBA 2BCGY 3H5WA 3IE2A 3OJWA 1WHSB 4HT3B 5ICGA 2XKJE 1EB8A 5B53A 4XQEA 3ZY6A 2ETXA 1E1KA 2GQ0A 4KIWA 4ND8B 1Q0UA 3HDVA 4DLPA 3KD2A 1T9ZA 4YRGA 2DULA 5LP6F 5JHGB 3AUAA 2Z4TA 1XO1A 1ZSNA 4K88A 2OEPA 1NBME 2GAJA 5HRUA 3D5EA 3GMSA 3GX1A 1SOWA 2CZGA 2NTYC 1Z5VA 5CU7A 1Q0PA 5C81A 2LE0A 4W5WA 1BKYA 3E3AA 4C14A 3B3AA 4DYDA 3ZVMA 1XRSB 2HF7A 3H5VA 1QR6A 4X41A 1NHGA 3G2QA 4QBKA 4EMBA 5CB8A 4BZQA 2EX0A 3PFBA 5IMBA 1OW3B 3N2GB 4XI9A 1P2SA 1P80A 1L5YA 4HLCA 5IDYA 1FNNA 3VR1A 1II9A 4C89A 4M9SA 1LDGA 4UCWA 2QTVB 3H7IA 3DR5A 4NOJA 4G5QA 1W2WB 5DNUA 5JPIA 2H2DA 2KM1A 3MQ2A 4CDNA 4DCPA 5CT4A 4EBBA 3WWDA 3KQLA 3B9BA 4XPZA 1MABB 3GH3A 1R74A 3H16A 4JUBA 3ER9A 1S8FA 4J91A 4IDGA 3TKYA 4ISCA 2AHOA 2PLFA 2X0NA 2BV3A 1ZGCA 3OECA 4Q7JB 3MILA 2MT9A 4KWHA 2JA2A 4NYIQ 4LWOA 2A0KA 1NNSA 1T4MA 1GNPA 3RC9A 3OZAA 3AI1A 2JAWA 4NPHA 3CRW1 2RHOA 4BJHB 3NBAA 3B48A 2MU1A 2PSSA 3AFOA 4XSVA 3QLTA 2C7RA 2JFQA 3H1BA 4WK2B 1XELA 3LC7O 2F8TA 5IDWA 4JBLA 3FZNA 5GJWC 4YJFA 2RONA 1E5QA 4Q37A 4DJAA 4ARZA 2O2DA 3LUPA 4LJ7A 5J59A 4D0SA 1JPNA 1MPTA 4ITRC 1J2TA 3DV9A 3HR7A 4P81A 3DE2X 5HIKA 2OCBA 3OLYA 2PT9A 1UP6A 1E2LA 2GOYA 1T5IA 2P4QA 4J3JA 1GTMA 1VGVA 1ZJJA 1VOTA 4TSFD 5KCMA 2O8BA 2AG8A 2ODWA 1U7OA 1T6YA 4D98A 2JFFA 2XWQA 2KLHA 2IGTA 4YRQA 1YDGA 2GKGA 1M1NB 1TPYA 4KN5A 3GRUA 4PZ9A 3EOAI 2A9JA 3QFRA 1H6DA 1H8HD 1L4YA 1UAGA 5TQ0B 4IJ6A 5LA6A 4F2PA 3NJ8A 1K4KA 1SAYA 3FTNA 5AKKA 2YZGA 2JLBA 1IH8A 2XSZD 1D7AA 2ZRFA 4MAMA 4MPPA 1L5HB 5GONA 4LX8A 4BX0A 5BPFA 2ZTHA 1Z3CA 1RWOA 1QHSA 2REQB 3HR4A 3EUWA 4IX1A 1QH1A 1EFUA 1EINA 3ABQB 1A8SA 4S1WA 3KX2A 1E7WA 1G4UR 2F1KA 1CUXA 4ZEOA 4FGJA 1L7QA 9LDBA 4ZP1A 2ZWAA 3RIEA 4P5PA 4ZZ2A 1QTRA 3TN7A 4H7EA 4MICA 3TEFA 2OZLA 1RMTA 3GRZA 1LX7A 4DV7B 4GVLA 1CUIA 5JI2E 2BMAA 4AMYA 4OUKX 3V2GA 1F4LA 1MX5A 3IHLA 1YKFA 5KVCA 1OV4A 1K6JA 3QI7A 3V5NA 1EDBA 4S1OA 4YRDA 2XYHA 4DCGA 1N8KA 4EUHA 1OQAA 1TT7A 3ASUA 4L22A 1DXYA 2FEAA 2OA0A 1MF7A 5AM3A 5EIFA 3ISTA 1I7QB 4F91B 4P83A 1T43A 4NZPA 3D3JA 2ZJOA 1NQWA 4V24A 3QVTA 3TNYA 4EO7A 2BWJA 2CKDA 2YZKA 1FTYA 3DZCA 3E1GA 3ONFA 1KBOA 2C07A 3QPVA 3SZ3A 1GAXA 4TWZA 4WZBB 5HIJA 3BWBA 3T38A 1SCNE 2ZB8A 3SHFA 2EBWA 2NXEA 1YC5A 4ED9A 1OI4A 4QZVA 1HYBA 2A9OA 3UG7A 5AVTA 4JLBA 1XAGA 3SYTA 1N5OX 3EIEA 3MOSA 4IOJA 2W4QA 3RHTA 3H0EA 2C77A 2XB9A 4R98A 1GKLA 1ZN7A 4NBNA 1C7IA 1SXJA 1PG5A 4O33A 2FSHA 2WJJA 2H5JA 4O2AB 3T7EA 4WBNF 1GY8A 2V0CA 3W9YA 1G60A 1WW2A 1PTJA 4FB4A 1KO8A 1A9SA 1YJQA 4I1IA 3PDUA 3W6PA 2YWRA 3JALA 1X0VA 3IEKA 3RANA 2XR1A 5F7ZA 1KYZA 3PPIA 4OQDA 5AI5A 5THQA 4JI6B 1J9ZA 5IFKA 1EK0A 3PYMA 1XQ1A 3IHKA 4IMJB 4WJLA 1QPZA 1MAUA 2I1VB 4DDUA 1T5HX 3G8DA 2H9AA 2PNFA 3V2HA 3PS9A 3VPDA 2HA4A 1JBKA 2JA1A 3S99A 5U9CA 3ZWQA 4FBGA 5BSVA 1C4OA 2I55A 4L1KA 3HR8A 3ZCRA 4WLUA 2BH2A 1U0LA 3DT8A 4LNUA 3QE0A 3RTDA 6LDHA 2OZKA 1ZC3A 5CD1A 4PN7A 3TDKA 5DM2A 2NXWA 3PQ3A 4RPLA 2VRBA 1Y5RA 4HPXB 3I53A 4R83A 5E1MA 3GUCA 3RBXA 3VYWA 5E38A 2X8JA 4BV9A 2VUTA 5JZBA 1E5LA 2CB0A 4Q3EA 1ZNXA 3CYFA 2OCGA 3M6LA 2AXQA 3H7AA 5DT9A 4DRYA 5TVKA 1CIPA 3DJYA 4W4TA 2R2AA 5DGXA 5J2TB 3T3GA 5B55A 4B4WA 4BB6A 4HDKB 3W1EA 5K3OA 4RV9A 4MTCA 3M4NA 3VR6A 4EPVA 1GNQA 3I04M 4OG2A 1PAUA 2PZGA 3SXUB 1W1UA 1ISSA 4JA0A 2ZU0C 3BK2A 5JROA 1R4MB 3H18A 2RAPA 4N7BA 4CMBA 1EP2B 2R48A 1C3EA 3PKJA 3QVGB 2GPTA 3F74A 2Z9DA 5KI6A 4L5YA 4BNDB 1JQLB 1MKYA 2QM7A 2Y1GA 4QOFA 1P61B 3K0CC 2OG2A 3OETA 4FZVA 3PGA1 3TX2A 4N40A 4DIOA 3EGXA 4DC9A 4TMKA 1SUCA 3UK1A 2P9GA 1N2SA 2VWQA 3NCTA 3WDKA 4FCVA 2JBHA 2C04A 2W4MA 4JOBA 5HK8A 1KOGA 1E1QA 2FSVC 1ATZA 3BRSA 3TYXA 4RIFA 3HB5X 3WJ7A 1OZ0A 2OHFA 3U3JA 1P2TA 4AJOA 4RO0A 1RKQA 3FNRA 5DGHA 4Z1MA 1J6UA 1T1JA 2FRVA 4EYSA 2WQZA 3EA5A 1PNRA 3DLBA 3ROPA 1QIEA 1RIFA 2R8ZA 1VRVA 4DQLA 3KTOA 2XMCA 1VMAA 1LSJA 2I7DA 2VNKA 3FSGA 4QQNA 4U3JA 2D1SA 5L4LA 2BD0A 2QTLA 2KX7A 4CPDA 1MUUA 4NOKA 1U11A 2XVAA 2VJKA 3CRRA 3DWFA 3IUPA 3KP1A 4WNCA 2RK4A 5L3RA 1E8NA 4LF8B 3CLSC 3QVVA 3TWOA 4OXIA 1RR6A 4P0QB 2WJWA 1X7DA 2FUG6 4AW9A 4CL8A 1JG3A 1BCSB 2ZKIA 3WO1A 2WV9A 4LJKA 5K8JB 1LC3A 1YZHA 4WJZA 4CRWB 2UZ1A 4QYTA 4AD8A 4UBLA 4BFUA 4D8YA 1KI4A 3UBMA 1QP7A 1K63A 1GGMA 2ZIEA 3A2LA 2PMCA 4FDUA 3FPJA 1QKKA 3OM0A 2ZOSA 4JJGA 4Q3CA 5T3UA 1WHSA 4BQRA 2VSOA 3QNMA 1SWWA 1NJGA 3OE1A 4DNPA 5KO2A 4ND8A 4URWR 4S24A 5FTWA 1A98A 4QWWA 4WUTA 1HDEA 3CMCO 4J94A 1G98A 5K0TA 2YKGA 3WAGA 3RF6A 1REQB 4A6XA 1FFBA 4JLPA 3MS4A 4RVOA 3OU6A 4V0LA 2B34A 3ME5A 3OQBA 1E63A 1OU0A 2QTTA 4BO4A 1L4KA 1G55A 4XJSA 3LWZA 1GZ6A 2FB9A 2P65A 5IKEA 2X42A 3E35A 2ERXA 2M9MA 1PYDA 3LO5A 3L7DA 3PJDA 5ELLA 2ORIA 5KNBH 2I4LA 2JNWA 3EF0A 1FY2A 2Q4DA 3N2GA 4PQGA 1MX9A 1WKCA 3HV2A 3L0DA 5KU1A 1X39A 2HRBA 2QTVA 3DAPA 3I8XA 4A03A 4PIMA 2RJ3A 3T7CA 1E0AA 3DVLA 1T5TA 3S81A 3GOQA 3GA7A 1RRKA 2WFMA 2XWJI 1TO6A 1TUIA 4XD7D 3PHHA 4IGAA 4TPKA 1MABA 2EG9A 1NNUA 4PINA 4WUVA 3UAXA 5JWOA 2JZNA 1P44A 4G23A 1ZAYA 2QVXX 1BN7A 1E9CA 1FUEA 3F6YA 3D4BA 4X8MA 1OASA 2V4ZA 3HL0A 4RJLA 4UPVA 3MXTA 4CF6A 1KMCA 4OHRA 5EKUA 4F4IA 2VRWA 2LCIA 3LGSA 1PR0A 3MMXA 1H1TA 2XYPA 4IZ6A 1TK3A 3MELA 4L9RA 4RMJA 2UZ3A 5MGBA 3CKYA 2W8ZA 1C9MA 2REOA 1Q57A 3I4CA 4X0EA 3RYHB 4XWGA 3PWKA 4QLBA 1G8PA 4KMMA 2I66A 3AQIA 3OOHA 5KTSA 4NU6A 3LO8A 2HAEA 3Q9SA 1FEZA 4QREA 3BSFA 3E03A 3NAQA 3QRWA 3THOA 1HMYA 3VR6H 1E96A 4JI3B 4LECA 4JHLA 3BAZA 2Y3IA 4IW3B 1M1NA 2VOEA 4QNNA 4FS3A 1KAHA 1RAFA 3FNFA 5T67A 4U7WA 1FMTA 1R5JA 5TQ0A 2GASA 2IELA 3FLBA 3P4UA 5JNWA 4I6JA 1EFAA 4JI2B 2BTEA 4C7OB 2BJVA 5DP1A 1LJUA 1U3DA 3Q5GA 5DPMA 1L5HA 1ICIA 3JYLA 1THMA 2PZFA 3P9CA 1G3QA 4GRDA 4RXTA 5CNKA 5DCLA 3PI7A 4JL8A 2REQA 2W93A 4QSMA 5FUYA 4JU8A 2XITA 4R69A 2YFQA 4KQJA 1WOYA 2PXCA 3PQ6A 4PV7A 3KPJA 1RC1A 3LIIA 3MGBA 1GQYA 1Q3HA 4XARA 1O95A 1U8CB 1QK4A 3AILA 3O4GA 4YONB 3UJ9A 4O0LA 2WG0A 4GZ6A 5FI3A 2FR0A 4D56A 2I6UA 3P2YA 1ZK1A 2XADA 2O2EA 3W2GA 1YUMA 2XB4A 1U94A 1WZUA 1W1IA 2CLCX 3C5EA 3IO5A 3PIIA 4NYMR 3PFWO 4FI3F 4ZIRB 5CLGA 1J23A 4JEUA 3AQ4A 4JLJA 4E46A 3R44A 4FIDA 5D84A 1SUFA 2HTEA 4H6WA 4RK0A 4BRWA 4TGLA 4A26A 1NSTA 4KXUA 1DU4A 1GQSA 3S28A 1YB6A 4M1EA 2DF8A 2LR0A 4WZBA 1NPDA 5EZ5A 1CY6A 4B35A 4OEHA 2WU3A 3I76A 2HLNA 2VHUA 4U2CA 1OB5A 3R7DA 1EEXB 4HEJA 2FSGA 4U7TB 4AM8A 5EHQA 1CC1S 3QU4A 3OX3A 4KTTE 2IOYA 3HBJA 4MJXA 2RC5A 1I2MA 5IXYA 2G4VA 4EB0A 1CRWG 5K8CA 3OA2A 3TBKA 2FEOA 2VJOA 4PZEA 1A04A 1C50A 1XK7A 2J87A 2PMDA 3G2OA 3OUZA 5LIRA 4ZZ1A 3MD9A 5BWCA 4O2AA 4Q05A 1G7RA 2DR0A 1ZR2A 3T7AA 3B78A 1D3AA 3HXMA 2POCA 2WAMA 1ZJZA 1AKWA 1YB4A 2XD4A 2Y27A 3EMDA 2QRNA 1Z0IA 1P0MA 3DCYA 3GRRA 3KTFA 4GNKA 5CNJA 3VR5A 2A1UB 4XM0A 2FMIA 3O9MA 1IUKA 4PNHA 5HIMA 2Q3DA 1J8VA 3EEBA 3OZIA 3RJTA 1X8XA 1YQTA 2ZXEA 5JSUA 1ZUNB 1AU9A 2ATIA 4F86A 4BN4A 5GJCA 1EJ2A 1B8PA 3I5UA 3PX3A 4JHXA 2KB0A 3T9FA 1SHUX 1G4HA 1TTQB 3I9FA 2E4WA 1C8VB 1EJ0A 4KO4S 3HV0A 4Q3NA 4TMFA 5H70A 1BU5A 3I5XA 4NDZA 4CIWA 4X61A 5CPBA 3V8PA 3I6MA 3M4XA 3TJZA 1NMXA 1JR2A 4AMGA 3KSBC 1DADA 1E2FA 1GRRA 3GLTA 2PV7A 3U7QB 1ZD8A 4WN9B 5DHQA 1OY1A 2PX8A 1EXDA 2Q07A 4GOJA 1OD6A 5DYNA 4CKBB 3QK7A 3MWYW 5GINE 3JYPA 4YH1A 1J2RA 2K6GA 1L1RA 4U6QA 1WZEA 1GCIA 1GT91 5J2TA 3UAZA 4HDKA 3VUFA 1E2JA 1ZM9A 4YN3A 3RVBA 3AZOA 1S8OA 4DLNA 5I9NA 2JBWA 1K88A 3BDAA 4FFLA 3AF2A 1ESCA 4YJ3F 3SXUA 3OM8A 3ZYZA 3OIUA 3H3XA 4QDKA 5TSDA 2PCJA 5HM6A 2EFHB 3DXFA 1R4MA 2K87A 2ZJ1A 2D5CA 1UKAA 1JG6A 1QR2A 3QVGA 3DEJA 3DDCA 2CHQA 2PUHA 4KO8A 4XYMA 3RIGA 3MCTA 4BNDA 3S4YA 4G2NA 2H16A 4J2HA 4BMXA 1Y48E 2GB4A 3D0KA 4OREX 4I55F 4X24A 3ZZ1A 3ZY5A 2GN0A 2RHRA 1FE8A 1H2RS 2NOAA 2EW2A 3TRIA 4DUZB 1XEFA 3U7FB 1P9OA 2CVPA 1UZMA 2P3SA 1T24A 4LXUA 1Z0AA 3R76A 3T54A 3EGVA 1UOPA 2YWJA 1KI8A 3MC1A 4MHTA 1SC1A 5FBLB 1Y9AA 3FTFA 1R6XA 1QGYA 2AOUB 2ZVPX 2G25A 1YZUA 5DOVA 5H80A 2OXTA 4H35A 4J3NA 3K9FC 4MEAA 3S2GA 3HB7A 1NNI1 2ZBDA 3FD8A 3B1KA 3K0AB 4IEIA 2ZXUA 4E51A 3B6IA 4KQ1A 1ZRHA 5IPFA 3HXTA 2AMJA 2WJVA 2MSDB 1P3DA 3BILA 3M6VA 5K3SA 1B26A 2QZPA 1UMKA 2QIOA 2NLOA 2P7IA 3BCHA 3CSUA 3WMWA 1Y8RB 1TLFA 1XKLA 2WSSD 1Y1RA 1DEKA 1BCSA 2O2XA 3AETB 4K9NA 5KVAA 2YY7A 5K09A 1XIVA 5DBEX 3RIHA 4PNEA 4I36A 4LDPA 1XNQB 1F3LA 4BO8A 2XMPA 4DIKA 2R9VA 3EEYA 3V1LA 3WDMA 3X2EA 3F49S 3TE6A 3REQB 4F1WA 5LBTA 1M1YB 1RWXA 5AQ1A 5KPDA 1A96A 3DV0B 4DANA 3VKWA 5F1PA 4EYQA 5K8UA 5HG0A 1Z8NA 2OBNA 4YHBA 4DR3B 1ZD1A 4OHCA 5ULLA 2KLBA 3MBIA 5KQRA 1C2YA 1OX5A 2SICE 1REQA 2JGLA 3HCWA 5BQOA 1OH7A 4YHHB 1EK2A 3LSYA 3VVLA 4F56A 4G37A 3LOQA 4S1NA 1T5SA 1YULA 3UUFA 1C9DB 1JIJA 2QRLA 4H0NA 3I2FA 4QEZA 3AH8A 5F51A 2I22A 3PFHA 2IPLA 4JC0A 3GNTA 4QDUA 1QYRA 5DCUA 3C15C 4QSHA 3RUDA 3UXYA 5ALVA 3RYFB 4YR7A 1G16A 1SC9A 3NYQA 2HQOA 4H3SA 4ZHQF 3Q3JB 5ESRA 1BGVA 2NUAB 5F98A 3ICQB 1OA1A 2G5GX 2O3JA 1Z6GA 1HDGO 2UKDA 3KKKA 3SN6A 4XVHA 1UPUA 4PBSA 1JSLA 5B3KA 2A78A 3DDZX 4BV8A 4DZRA 4NH0A 3L2OB 3LPAA 5DTMA 4LMAA 2BBSA 4R2IA 5DT2A 3QEMB 5E9JA 4A8JB 4BIIA 2HMSA 1PD0A 3HBNA 3OLVA 3WZ2A 3PNVA 1TZCA 3L77A 2KW5A 4OBWA 5G41A 5DVZA 4QYIB 2PR2A 2WHXA 4UU1A 4ZKDA 1YNOA 2O2YA 3NVAA 2P11A 4CE6A 1QH8B 1I94B 1UXGA 1PD1A 4GXRA 5ES3A 3U6KA 4OKNA 1E2KA 1NW5A 1MB2A 3A06A 2NZXA 3SE7A 5JVDF 4DEVA 1J2YA 2QUJA 4LSWA 1MT0A 1ZKMA 4F8YA 3R5KA 5TPZD 3DOEA 1Q84A 5EXPA 3RBVA 2AMVA 4ARVA 3RYHA 4FT2A 3JQEA 1O0CA 3PUZA 5GJBA 2ZIVB 1A2KC 5K03A 1CR6A 1N7JA 2X0RA 4L57A 16PKA 1K0FA 1OGJA 3E8SA 3HY3A 2IH5A 2I7VA 3OCWA 4NL4H 3ZCXA 4UM7A 1M8KA 3GXOA 3D3WB 4J07A 1TQ6A 4DBLC 1NYLA 5KIAA 1GTG1 1NBEA 1AGYA 1JSRA 3BBLA 3H2BA 4U9HS 2FCRA 6NULA 1E5XA 2OGZA 1C1XB 3AFGA 5IUNC 1KZ6A 2XBMA 1YRQA 3DDHA 2Z5VA 3AO0B 1IE3A 4Q3KA 4C7OA 4M8KA 4D9EA 3FDXA 2OY0A 3NNNA 5JRDS 1MB9A 1MP0A 4YPOA 1CEEA 1GEGA 3EAGA 3NTVA 1G17A 4KQWA 4KVFA 5EESA 1GZHB 2O0KA 1Z4IA 1U7UA 1KIAA 4FC6A 4HV4A 5AM2A 1K8YB 5EA2A 3ZGZA 3U4DA 2QGNA 2C2BA 1A72A 3GVHA 4BEWA 2ZSFA 2FPMA 5CBKA 4DMFA 2WWHA 1ZK3A 2ENWA 1H69A 3TSZA 3WV4A 1R5NA 5L4SA 3E2PA 1IOVA 2LGJA 2XUDA 2YXDA 3GG2A 4QGBA 5LPNA 1NP7A 3WS7A 2R11A 5J2UA 1OKKD 5FBQB 3W5SA 4L5IA 4LMPA 3VHQA 1NQXA 1XZPA 3LX8A 4GF5A 3FB4A 1OAOA 4ZIRA 5ILOA 3FPEA 3N6VA 4MDHA 1LNSA 4J7AA 5B58T 1B73A 4DLTA 3L4SO 5JV5A 3LQ2A 2UZ0A 5AHOA 5D3ZA 3T12A 3FYUB 4AY2A 1Q12A 1UH5A 2FK7A 4JK3A 4NQRA 5EPOA 1FLNA 1R0LA 4W7SA 2NADA 1GZDA 2G0AA 3O1IC 5GGXA 3ZU3A 2H7XA 1UK8A 1VGQA 4MK4A 3KS9A 3NHKA 4QPPA 2VPQA 1D2MA 2IOFA 2Z95A 3BGDA 1IU9A 5U4QA 4CKYA 4WXPA 4D1YA 2PNJA 3VZBA 5TMPA 3KEMA 5JS1A 3ND8A 1Z2DA 4DJ5X 3TRFA 1Q0HA 2X14A 3HA7A 5AICA 3WLPA 2XT9A 4R4JA 1LSOA 2Q2WA 4OSPA 2B7CA 1H2ZA 3L0SA 2BEKA 3UKJA 1QORA 1W8IA 1XI2A 5CVDA 2PX4A 4MVJF 1I1OA 1QYDA 4GI1A 4Z9YA 2ZTMA 4F3KA 2A1UA 4WD3A 2F3PA 1NN3A 1GN8A 3F3KA 5CT8A 3RW9A 4AO7A 3C3JA 4DCNA 3P5BA 2DY0A 5KSYA 2WQ6A 2RB4A 5IH3A 4QNMA 1W0CA 1ZUNA 3B3GA 3H17A 1LI7A 3OC0A 4DJEC 5KB3A 2Z43A 5E7QA 3ZU4A 1B8NA 3LCCA 5JSHA 3CLUD 5KYXB 1MXFA 1OXMA 1ZK0A 2CC2A 2V7QD 1UINA 2W7TA 3H2IA 3AP1A 3JZMA 4PZLA 4Q5IA 1JIIA 1EFVB 3EY9A 4B46A 2GVNA 2HO4A 3LQFA 1IEXA 1NATA 3C7AA 4C21A 4BFYA 1SXJE 4JI1B 2QMQA 2QAGC 3ZGLA 5KOIA 1BOOA 2AVNA 1IY8A 1SOUA 1T4DA 2JIDA 3I8OA 4M0CA 4PF1A 4UHHA 1KK2A 4F2HA 4UOEA 3U7QA 2C7BA 3OJCA 4WN9A 5DW3A 1BVRA 2HCTA 4HRXA 4O6VA 4QG7A 1NY5A 2OBLA 4CKBA 2NTNA 5FI5A 4QTYA 3ED1A 2PPVA 2ZJ7A 5GVRA 4EY4A 1G5RA 1ODCA 1R0SA 2YV4A 3TIFA 1R37A 4F6CA 4RZIA 4BQNA 4J0JA 4OB7A 2P5UA 3FMGA 4BLOA 4I4IA 5EMLA 4G85A 821PA 1W46A 3HM9A 3MGAA 4ZTUB 5KTOA 4I1RA 1NNEA 1YZVA 2X15A 5CDFA 3K9BA 4A5SA 1X7YB 2JRLA 3GFRA 1PT7A 3TTUA 3ZXSA 3L1KA 3U7GA 2CLFB 2W6JA 4LY6A 1P2DA 4F7DA 5C2JB 3VR3A 4PWZA 4D25A 1K7YA 1SKYE 2JJYA 4TTRA 3HDYA 4EUEA 2R0QC 1WXEA 2Z6UA 2B7BA 1AM4D 2BEWB 1PJCA 1T6NA 2QR2A 4RF2A 1X1EA 2VSXA 2GN6A 4YA6A 5HMMA 1H85A 2GCNA 3I5YA 2AMFA 2VZ9A 1E2QA 4OMFG 5JEEA 5G0WA 3JQCA 5P21A 1PVVA 5K3FB 1JKJB 4Y9TA 1Z13A 4KLCA 2G7ZA 1VYUA 2AYZA 3TRKA 5AJVB 3DP7A 4RDCA 1QIMA 4W1SA 4WQMA 2JBAB 4RVUA 4C4YA 2HJGA 4FFSA 4EGCB 2BKAA 3UMYA 1CR0A 1A5BB 1IONA 2AOUA 4YJ2F 3TLYA 4XH9B 5FBRB 5L51A 4BAGA 3AJ9A 1A97A 4PG7A 2HHJA 2ZJ4A 4CF4A 1GUBA 2A92A 3K0AA 4UM9D 3UXHA 4JEHA 1VI6A 4JWTA 3HSYA 4NRDA 2XA1A 2Z8XA 2HA5A 4UUBA 4R16A 1B6RA 2HMTA 1NJ5A 1KE2A 1MJHA 4RFVA 2DEUA 1BWQA 2W2TA 1WQ1R 4AP6A 1GNLA 3O31A 2OAGA 3HU2A 2GHIA 3P9SA 4PC6A 4U2KA 4C5BA 2EFGA 1JDNA 1AXGA 4EA8A 3TL6A 1AK1A 2ZR0A 3AETA 4EPTA 1NONA 4WKGA 5JSFA 4P22A 2X6RA 5FWXA 1U0SY 3KTDA 1L7DA 1ZSVA 2NYRA 1NL3A 2ZULA 3REQA 3S44A 5K99A 1M1YA 3BH0A 2CWDA 1ENPA 3H5LA 3DV0A 3JYQA 2HV9A 1HR0B 2G76A 4NAHA 2X2PA 1U3TA 1V3QE 3REGA 3ZDEA 1XYYA 3NTRA 2VNIA 4BO7A 3N86A 3HWWA 5TT1A 1XDWA 4UC0A 1ILEA 4WE3A 1UMBB 1RC8A 1UBRS 3JWHA 1XDSA 2BMFA 4P4SB 1QVRA 5CFLA 3RKRA 1TK9A 5JJLA 1PJSA 1EFHA 1US8B 1I2AA 1R12A 3VPSA 4BZWA 4CKXA 5ADHA 3N1UA 3GQBB 1XVLA 4UXIA 2X3YA 4FCCA 2Y1CA 1MLDA 4YRPA 4WXMA 3RYFA 3MJCA 1ORHA 2JH9A 2AZDA 3BIFA 4YASA 2NUAA 3UPDA 3WLIA 2R8XA 1L5OA 1BX1A 5KQMA 2ZUUA 1CY8A 1BRTA 1DBQA 1NW3A 2QRZA 2ZJ3A 1N2CE 3EGCA 1RM5A 3NW9A 4HB2A 4NPCA 2FUCA 3PEWA 1DFGA 3PGJA 1J0CA 3QEMA 3ZU6A 4A8JA 2V9ZA 4BOYA 3Q2KA 2BM9A 4AAYA 1YR8A 4TVKA 4LHWA 3R3ZA 3RFVA 5A9SB 1TM1E 2YHSA 2XKKA 3OG9A 2IYZA 2LD4A 4EHFA 5JRJA 2CK3A 3AVWA 4I4NA 4QYIA 3PJFA 5EQFA 1TMYA 3IEXA 2OYCA 4C7MA 1V71A 1U8YA 3PTZA 1QH8A 2D0IA 2XOEA 4RX1A 2BGKA 2JCGA 3JU3A 1IB6A 1AXRA 3TXYA 3A7EA 4LOJA 1UBUS 1WE2A 1JR4A 3OEEA 4R51A 2BELA 2Q3CA 3DFFA 4RWEA 1BN6A 1BWRA 1AZTA 3ETCA 5ILQA 2HLDA 4Z5XA 4D80A 1ULHA 4MUNA 4FFWA 4LGVA 3PPXA 1DKRA 3PXEA 3TO5A 2PAAA 3AERA 5BQPA 3NHAA 3RSQA 1C3VA 2GO1A 5F5LA 2ZIXB 1Z4PX 2O9JA 4CM9D 3EBOA 4DIEA 2RGWA 1GZ5A 1X3SA 1Z4MA 1YRBA 2FPKA 3D3WA 3NYRA 4RE5A 5AI8A 5GAJA 4BMDA 4BVEA 1H6AA 1YFLA 2AN5A 5IHXA 1C1XA 4LDQA 3A1FA 1PKXA 1ZJ5A 4QT0A 2RE8A 5DGTA 3JTEA 2B5VA 2R1UA 3OFNA 5K4HA 2PYZA 3CCBA 2HJHA 3NALA 4RD1A 4XB1A 3DNPA 2HT6A 4AKIA 4DAOA 3UFBA 3H84A 4DMMA 4IL5A 3NIDB 3F78A 2QAIA 2ADOA 2PE5A 4QFCA 2XMDA 3JY6A 4Q01A 4INOA 2I4TA 2EVWX 3PL1A 3WGQA 4DQUA 1ZEJA 4K9MA 1EDEA 2NU7B 5FL7D 5FFNA 1M0WA 2QD2A 3SY8A 1AMUA 5LQRA 3EXEB 3H3FA 1ZGZA 2WYOA 1EWTA 4FYVA 5H0IA 4AICA 3V1NA 3NCHA 3UHAA 2YW2A 5KREA 4ZAYA 1LW6E 3VKHA 3UWDA 5GZ1A 5TS3A 4YRZA 5KDDA 2A9FA 4QUIA 4JXZA 4WN3A 2D54A 3SP1A 4CM6A 1U2DC 3BQ9A 2PJDA 1KY4A 2IZ6A 2JGAA 3CKMA 1CR1A 3C45A 4BUZA 1AX9A 5IM4F 3WLFA 1ECFA 1YB2A 3ACBA 4LOHA 5LMCA 5I7OA 3FYUA 2CEKA 3LWNA 2Q3MA 3IEUA 1IBLB 1B0PA 3L6DA 3AVVA 1HC7A 1V96A 5GV7A 2RH9B 4DA7A 2YN0A 3NBUA 2EARA 2XMQA 4FCTA 3BXPA 4BNVA 4B3FX 1IWOA 4OL0A 3TTTA 3TW8B 1VKZA 1Z5OA 3EVNA 4NK5A 3LHDA 3SZMA 4BV2A 1OH8A 4C4SA 3PHBE 1CS4C 1GU7A 4ASUD 3EZ2A 2IP1A 1RYFA 3GCXA 3V7NA 4DMHA 1UM8A 3AP3A 3GMIA 3IMCA 2XVYA 3K70C 2H1LA 4YS6A 5A71A 5COBA 3STVA 2JI4A 2R4UA 2YW9A 2PS0A 3Q3CA 5E8JA 2XWSA 2PFKA 2JIOA 2VF4X 2D5LA 5COAA 1DKNA 2P5TB 4M1TA 4ENUA 4RCYA 3CCCA 3CLUC 3WSWA 1C7ZA 3QI2A 2ZVJA 4HFMA 4IS3A 3PSHA 4LXIA 5B58C 5CFRA 2O3QA 4WZBE 1C81A 1JVBA 1L5KA 4LHSA 5FLKA 1T3LA 4C0SA 2YYZA 4NCAA 3RK0A 2AFHB 3WIBA 4NBTA 5KYXA 4GSLA 2WM2A 1QK5A 4ONEA 3H2ZA 5IARA 1EFVA 2DWQA 5L3QB 2OXFA 2MYNA 3D0OA 1JUDA 5JAZA 1I8TA 3TQTA 3IQFA 3WLAA 3PX7A 3F1KA 1CJSA 1CQWA 1R0RE 2ECKA 4TL9A 2Q5LA 3MPUA 2X9LA 1TMKA 5HDQA 1RXYA 1HKUA 2QVCA 2V7XA 5LP6C 1EI9A 2WG2A 5EHIA 3ZV6A 1NV8A 4OSEA 2QZZA 4JB0A 4EFNA 1QQTA 3MERA 4IINA 2A1TS 4V03A 3ZK8A 1W96A 3HG7A 3KKOA 4K9OA 1AO0A 3LP5A 1UANA 4UNPA 4NPAA 3BKXA 1FZQA 2YS6A 1WABA 4F3RA 2GSWA 4HB0A 4L8GA 4Q3BA 2OR3A 4LWQA 5AKXA 2XGOA 1HYGA 1L3BA 1KVTA 2YUIA 3T3HA 5JJBA 1BX0A 1GP2A 1NF8A 3A9RA 4C0QC 1MRNA 1QB7A 1UCFA 2WTNA 2YN4A 2XVXA 3D7NA 2QT1A 3E2IA 1X7YA 1EZZA 1J2JA 2ENUA 2JEOA 3K2IA 3H99A 4EELA 4AQ7A 1PEKE 3K0HA 3HYCA 3EGIA 7ABPA 3IV6A 1XZ8A 4EI9A 4ZYZA 3HFSA 3Q40A 3EK2A 2CCGA 3S40A 4M9UA 3AHCA 3KDPA 2BEWA 2D74A 1QJ4A 3B82A 3NHRA 3O4JA 2MHCA 2GM3A 4KO3S 5HEKA 4MV9A 4IZOA 3SBEA 1JJBA 4EX6A 2C2MA 3EYWA 1QRAA 5K3FA 1I7SB 1JKJA 1VCNA 2QL5A 2HOQA 2GHQA 5BMVB 2WAOA 3H9QA 2WT4A 1OX4B 3SEZA 4HZUB 1LBSA 2PS9A 5IYZF 5CMLA 4CMJA 4EMUA 1FTQA 2JBAA 4LMRA 4M36A 1LSUA 3EXHC 4EX7A 3G5LA 3IDOA 1DJQA 3L1HA 4H3VA 5M29A 3K9LA 4KQ9A 2HYIC 4KWTA 6YASA 5FFMA 1VG0B 1H5UA 2AYXA 2P62A 2FJUA 1FDUA 4EQZA 1YO6A 3HM2A 4ICIA 5FWDA 1Z75A 3A05A 1E2PA 4MO2A 1K7XB 4J0DA 4FQ8A 4WLFA 1DZIA 4GYKA 2FDCA 1ZOPA 1OE0A 4QDZA 5CNMA 3V8BA 4UUMA 1PSDA 5JZ9A 1PJ4A 1MPXA 2JFOA 3AEUB 1TX4B 1XLWA 2P5YA 1E1RA 4ES6A 1RAHA 3IP5A 2QLMA 3KHKA 4H7HA 4G01B 2Y1KA 1E5DA 2FPLA 1N6HA 4X97A 4A15A 4HNQA 3CM0A 3FWZA 4UE3S 2QVZX 4PO9A 3M9XA 1IATA 3RS5A 1NRIA 1MZPA 2FG7C 5E95A 4OKSA 3QG1A 3V33A 4MQEB 2QSZA 4NFLA 1XZEA 5J23A 3T5GA 2M1XA 3R40A 1AB6A 2Q29A 5NLLA 3ZN2A 1FTSA 4MLZA 4L4XA 5B1HA 5CCDA 1E4YA 1ZD3A 4I08A 3EZYA 3D7RA 4AJJA 4G89A 1TGYA 3ETHA 1A0OA 4CR8A 3VR0A 1UMBA 4I1YA 1TZMA 1YTLA 2AHRA 2ODQA 5T6BA 3RE1A 1QDLB 5UKDA 2WAYA 4P4SA 2ZP1A 3QVSA 3P9IA 4ZVMA 3OCUA 5BPHA 1EDDA 2GEDA 1D2GA 1US8A 2VRCD 2IXDA 4MINA 5K2MA 4BB5A 1ECLA 3QLEA 2IZOA 3MWDB 3GQBA 4Z3OA 3P1JA 4K6CA 4PQEA 4OV6B 2V6FA 1AUVA 1VI5A 1KO5A 1VZ2A 1EVJA 2VBIA 3HCNA 3KWFA 1X38A 1ID1A 2PGOA 3WMFA 4L16A 1BMFD 3VHRA 2Z1DA 3CH4B 4JX9A 1T36B 1XRPA 2Q5EA 3NV7A 1Z2CA 1B16A 4QXRA 3WB1A 3QITA 2GAAA 1UWLA 4R1TA 3EVDA 1HH4A 1MTOA 2PSJA 4MLDA 4TSKA 3RFUA 4IO1A 4DF3A 4KMSA 4K6OA 1R5BA 3AC0A 5A9SA 1HFJA 2NZ2A 1DCTA 2Q8QA 1HDYA 3T4XA 4BBPA 4D4JA 2VAVA 4ZGWA 5LOVB 3KO8A 3UJNA 1BGWA 3DCNA 3Q1LA 3WRWA 3IOYA 4YI3A 3OTWA 1K7EB 2C3OA 4Q3DA 4E08A 3MHPA 2P6OA 5L6LB 1M54A 1V8FA 2C2HA 3IVRA 1G8MA 1UDAA 3CE6A 2QPTA 3QA3E 5GY7A 2RH8A 4GPTA 2LDBA 2RGRA 3AHIA 3D3EA 3GVXA 1OTYA 2VS1A 3IV7A 1P7CA 4KOAA 3D81A 4FW9A 2M6KA 4KRYA 3TCXB 1ODLA 4OH7A 4N0EA 5DP2A 1BG6A 3IOEA 4P4GA 3IDFA 1JECA 4L76A 5AVOA 2ASVA 3FKSD 3N0WA 4KVZA 4WFQA 1BIFA 3F97A 5EHNA 2ECQA 1TI7A 3OFJA 1YZGA 5KNDD 2O5EA 3NWPA 1D2EA 1RYNA 4M21A 4US0R 3G9TA 1CPYA 4B7AA 2ZIXA 4YTEA 3FFWA 5A0VA 4Z7OB 3VPCA 2H4XA 2VP6A 1NULA 3T34A 2OCDA 4IDOA 1UFQA 1M7BA 2HPVA 4JGIA 1ORRA 4OGWA 1GFWA 2GN4A 4R41A 2VBFA 3TJRA 4CZ2A 1SHKA 1X2BA 3G2PA 1X6VA 3JQFA 3P2EA 4I4TB 3ANLA 3H5AA 2BCJQ 2YWHA 3BMCB 3ZGOA 1KQFA 1JZQA 2A14A 1G5FA 2Q4OA 1WDTA 4MROA 2QQ5A 4IH4A 1TM4E 2D8MA 4KSYA 5AVVA 4MHSA 4RVNA 2V6MA 3T4EA 1Y0BA 3HA5A 1CB7A 4PE5B 2XCSB 2OAEA 4ND2A 3UTDA 4HXGA 3OMLA 2OO3A 4K9PA 5FADA 2NU7A 4ZEXA 1DEXA 1NUHA 5BSKA 2I6GA 3DOJA 3EXEA 4AMUA 4DREA 1GZSA 3W3AA 3BGIA 1CB0A 3VTFA 2BGLA 2I2WA 3KPYA 1GTJ1 3BA1A 3P2JA 2IKQA 5EG5A 3GLFB 4TZ6A 1SD1A 3G1WA 4BNGA 1GG5A 3W77A 3VH3A 1SHJA 2YUTA 4AXBA 2QTZA 2AMYA 3A2MA 3CVVA 1PS0A 2VUSA 3T5DA 1I2BA 1Z62A 5ALUA 1RWBA 4PX2A 2QVLA 4B9AA 1RWMA 2QV0A 1QHFA 5DK4A 2AGVA 1F8YA 1CERA 2ZPTX 3HA3A 4JBXA 2OQRA 1XF9A 3F6EX 3G2HA 4OHUA 3TW8A 1JFFB 1EFRA 4HYTA 5DN9A 4Q00A 1P3Y1 1VB5A 2N47A 3R5SA 1PX0A 2OUKA 4P4TA 3MRXA 4ZD6A 1WMEA 2HBZA 2WYVA 1WZCA 4CQMD 1T5OA 3GAMA 4WFKA 3H1EA 1CUJA 3NHBA 3L6RA 2PA0A 5IK2A 5IC5A 1SVSA 3VU3A 3FYCA 3FYDA 3U48A 4JT4A 4J16C 3ICEA 1HLPA 5CAEB 3G9UA 4Q1FA 3GLQA 1JEOA 1Q5PA 3HJHA 2VAPA 2ZXFA 3TFQA 2AE1A 5M04A 3HVIA 4ALMA 2WYUA 1WKBA 3HN2A 3N39C 4H0FA 2B4RO 2RGCA 2YDXA 4EABA 4EHBA 2OXRA 3EPPA 5AJXA 1L6IA 4OMUA 5CDGA 1EGHA 2AFHA 1GJRA 3AEZA 3HDHA 4BQSA 5CX4A 2IK8A 2YHBA 4QOJA 1ZH2A 2YZMA 1X42A 6AT1A 4BQIA 1Z47A 1E9SA 5L3QA 3BIXA 4ER0A 1MGPA 4JCOA 1IN5A 3HCDA 5C52B 4RPIA 1JLRA 3GRPA 4AJPA 4R9VA 3QPCA 2YVLA 2GK6A 2Q0QA 4LN1A 1GUYA 4LOAA 1IRXA 1WU8A 2VIIA 4TWAA 5E4FA 1YL5A 2GPAA 2OFPA 4LDAA 5BNZA 4AU1A 4AKHA 3R0QA 2ZRQA 3EPHA 2P78A 3ZCPA 2C2XA 1SM4A 1WZIA 3IOBA 2ATXA 2BFFB 2CY0A 3C3BA 3DD5A 5FUXA 3UEOA 1C41A 3COSA 3P9RA 4XQCA 1HE4A 4M6WB 9ABPA 2PD3A 2C1XA 2O7SA 4O63O 3ZJ4A 4Z4EA 4Y2PA 3DL2A 2ABWA 1V47A 3VJMA 1HZJA 1Z25A 1AA9A 3DSRA 3JYNA 4GNRA 3KLNA 5KJEA 4TLCA 4P4NA 1JKIA 4YQZA 3DD1A 1Y1QA 3WYGA 1UADA 4P7BA 1DO8A 2DQ4A 4MGKR 1FP1D 5A5EA 2B8NA 2YINC 3QJ5A 4GYWA 5CH8A 4H7IA 5H82A 3UGQA 4UMEA 3SYMA 2RCNA 1CFZA 2DM6A 3L8CA 4ARBA 3ZDZB 3X1JA 4JASB 3AWDA 1RE0A 3C7DB 3RCBA 4CJXA 2ZJ0A 4EMSA 5CXUA 2VXOA 1PT8A 4E1AA 4GRAA 1MZVA 1SB9A 2PU5A 3WLLA 2YV1A 3WGMA 4FHCA 5JNRA 3P2KA 2VO1A 2NXCA 1JAXA 2D4HA 4LC0A 5EP1A 2E85A 4RBNA 4ZXFA 5A3SA 3V6MA 3V48A 3WSTA 1I4DD 4HUJA 3UB4A 3QEJA 4PZPA 5BMVA 1NVFA 1U2ZA 5EP3A 5EIHA 1OX4A 1RWNA 1JIKA 1I3LA 3ESBA 4HZUA 4QE3A 1OC4A 4IHJF 1STOA 3M6UA 2I2CA 3R3SA 5JAQA 1QLHA 3ZKWB 2WWXA 1LQUA 4UDNA 2PVCA 1N2IA 1HNXB 5CDFE 1PFKA 1RIIA 1WPXA 4UAUA 1SQGA 4XFKA 5A2QA 4K6GA 1HI9A 1CIJA 4WEOA 2GM4A 1TXGA 1KVQA 1G6OA 1WPGA 2WUEA 5AVSA 1T2DA 3KKLA 4NS4A 5LQCA 4Z53A 8ABPA 4V0KA 4X3CA 1QVZA 3MOGA 5GOTA 5GOZA 1UDBA 1IDN1 2I03A 2ORVA 4UVEA 1HL3A 1FMJA 3K4PA 3OPXA 3PHIA 4ZVRA 3VR4H 3T6KA 2IHZA 2C5BA 3OQJA 4R54A 1M7HA 3AEUA 3AVQA 3O6VA 4G9EA 4OYRA 5ALMA 4HTFB 3BD7A 2L17A 2ZBQA 3P32A 4U7JA 4XSHA 4E2XA 5FBHA 5M7EA 5FUMA 1QP0A 2A0UA 1UBHS 4WWHA 3EMBA 2XQFA 3VZCA 4CKZA 5AW2A 1ULBA 1EZ1A 2QX9A 1KO1A 1DGQA 1G8HA 3ACCA 4CVNA 1ZA2A 4MQEA 4BZZA 2WJIA 3FVWA 2QZJA 5F76A 3L7MA 1GQFA 2EJVA 2PMBA 4NCKA 5L8VA 2DHDA 3B2EA 2I1QA 3GLSA 2HJSA 3U9TA 1F9EA 1TJ4A 4C03A 4F97A 2HQBA 4YQEA 2HPAA 2CFOA 4RH3A 3ZWPA 3HCCA 3B60A 3GK3A 4PZ0A 1VHLA 1G41A 2VCYA 3IVAA 1UJ5A 3DMGA 3LXUX 2WILA 4QX6A 5DLEA 3T5BA 3O4RA 3ZBUA 1LTKA 4KU4A 1J42A 1QZXA 2DPYA 2B69A 2C9YA 3QUCA 4PRYA 1UJMA 2R8OA 2X1MA 4FNMA 3SBOA 1GZ3A 1J07A 1GRNA 1QIFA 4IH9A 2FZ5A 2JI7A 3K6JA 4NYMQ 1YE3A 4QXQA 1BKSB 1E3QA 3AF3A 3MWDA 5ICCA 5HJ5A 3DE3X 4JS0A 2F7SA 2G40A 1VKNA 4FI3C 1E6MA 1E0JA 2VTDA 5FI0B 4CMGA 3HDGA 2FEPA 4K9RA 3U4MA 2HUPA 1M1YE 1F0PA 4ZO8A 2W90A 4YYEA 1COWD 1T36A 3UB2A 2XVZA 2UXCB 1EH5A 1PLKA 3ENKA 4HNVA 3C5CA 3OEHA 3VSDA 4LIPD 5AW7A 4NFYA 2GNPA 4PN3A 1SELA 4BE7B 3PPYA 1C0KA 2IU6A 5LOVA 1KOFA 3E8MA 5HQ3B 3MTAA 1D2RA 4OQYA 3UJDA 1XV5A 4NCBA 4KG7A 1YVDA 5MHTA 3EIFA 3GDFA 4ZVNA 4PX3A 3IX7A 4XGQA 3C16C 2WIJA 2GZSA 2HL6A 3S68A 5FH9A 1CUYA 1HOXA 1QHGA 1XRQA 4ACBA 1G2QA 4EG4A 5GZ3A 2D62A 3ZHVA 3ZLVA 2ZRBA 3HKEB 3NAZA 2WKRA 2X5KO 1KY3A 1ZBQA 5CYOA 1CX9B 1WHTB 1INLA 1IBRA 2PS1A 4N82A 1IB0A 1U0HC 3OD1A 4AMZA 3QUBA 4MGYR 3GLHB 2QN2A 1Q3TA 1V25A 1Z4QA 4UE2A 4JR1A 4HG2A 4N41A 4MVJD 3MJ4A 3TX6A 3LVRE 2MMGA 4HX5A 4XGKA 1G1AA 1H0HA 4EP1A 1CUBA 3M83A 3W7BA 1Z0KA 4F9TA 1AKMA 2E7ZA 1G9XA 1UBEA 1KP3A 1B3RA 2FHPA 3RSLA 4I4TA 1TZ2A 3NH6A 4IOKA 1MN6A 3BRCA 3BMCA 3SU8A 4D4GA 4FBLA 1ZUD1 2ZSBA 3ZD7A 4G4SO 3MGKA 2XRFA 4Q1VA 1R9GA 2Q7DA 1JIUA 3ZDFA 5DYIA 1L3CA 3IVGA 1MOPA 3BHMA 3F6SA 3HC7A 3NV9A 2ATCA 3VYTB 4UBMA 1D7OA 3I83A 3BC1A 2K7ZA 4FLEA 4IY1A 5I7WA 3WYFA 1RKXA 2ZRJA 1U8ZA 3P8ZA 2QZ9A 3RAPR 1H9BA 4MKGA 1R6VA 1ZH6A 3TTVA 1WQ3A 3ZS9A 3EUEA 2P6RA 3PT9A 4EECA 1DIAA 5KNCD 1ZWLA 2AKAB 3B52X 3HYTA 2C3UA 5H4GA 3GLFA 1RJEA 1E5TA 1QYIA 2C31A 4N9QA 5L7TA 4HQOA 1VYTA 3VUEA 4BB9A 1N75A 4G2TA 2FFRA 2KI5A 2Y93A 3LFUA 4C4PA 3F5MA 2EGUA 1PJLA 4M0MA 3PF9A 2VR1A 5ILGA 3ECSA 4HVCA 4MW0A 2VPZA 3K5PA 5C3MA 1CYEA 2R6AA 3CSSA 2JDID 3JQ8B 4X6YA 1PN3A 4RDHA 3SHQA 1PHRA 2TMDA 4ZT5A 4XQ0A 3GEGA 2PGAA 2FJ0A 4R7GA 2HSWA 1Y4SA 1HKHA 3FN4A 1YIAA 2IITA 3Q9NA 1JFFA 4BGVA 4RK1A 5LQMA 4HF7A 2QAJA 3C3PA 3WYNA 3IMKA 4AS3A 4EPWA 2FLWA 3H9CA 4KK3A 2J3JA 4E6PA 4J0GA 3OJOA 1EVEA 4OO3A 4BFVA 1EU1A 4DJJA 1KDPA 4N5LA 5IJZA 5K5EA 1H8ED 1K8ZB 2B3DA 4P3PA 4F45A 1Q20A 2I1LA 1Y1LA 4JC4A 4PSCA 4ECEA 3WYEA 2YJ4A 2A88A 3DLPX 4AUKA 2BZ0A 3I12A 1M1XB 1HSOA 4A73A 4LW8A 1HY3A 3JVIA 3K53A 5CAEA 2X23A 1SVOA 2JZCA 4F2WA 1OIXA 3Q9UA 2XNHA 4FK8A 1KI1A 1KFEB 2J7PD 2ZYTX 4XJXA 4C06A 4MAFA 1ZCBA 4LV8B 4QXMA 1KYIA 1HETA 2FETA 3DBIA 1GKKA 1V5IA 1XJCA 3LCMA 3WDSA 3PA6A 3LWBA 5HWSA 2BY4A 4BXOB 4QUGA 4IQGA 2HU8A 2XT6A 1UK7A 3HJAA 4QWMA 1M8GA 2IEZA 4GPD1 4MCIA 3EWSA 3T3OA 1M74A 4M4SA 2NP6A 2Y66A 4HX2A 2X1HA 4N5MA 3IP9A 5KUTA 4DLVA 4OQFA 3DB2A 4DG5A 2QX4A 3DPIA 3JARB 4JMPA 2Y68A 1E3WB 1VFNA 2C2OA 2EW8A 3SS8A 4JR0A 1QIIA 4BRSA 2MYPA 3O4VA 3QU7A 3T5AA 3GELA 3K94A 4RPKA 2AFIB 2BFFA 4NKRA 4QBGB 4NBSA 2ZB2A 2OMKA 1NOJA 3WQRA 4M6WA 1UBGA 4N6NA 5JYCA 1GIAA 5K0ZA 1KMMA 4RE6A 4KI7A 5F3WB 3NT2A 1TF2A 4RTSA 3EIWA 3ABOB 1XJQA 3N58A 4TMZA 3UV7A 4DDKA 3ZZUA 4D0RA 1XZCA 2PUJA 2W0SA 3QXHA 4OLFA 4KSBA 3N05A 3ES9A 1HG1A 3QEAZ 1EEHA 2RBEA 1L5WA 3RVPA 1QG0A 4RMHA 4FOTA 2ZI5A 3PQ5A 1EBUA 1Q6ZA 4BWVA 3AUXA 2BPOA 3DMFA 3OMXA 1CUHA 1R8YA 3U3XA 1XXLA 1L4FA 5G02A 1RRCA 4DXAA 2AC4A 3AJRA 1C7QA 2D1YA 3NONA 4M9CA 5F2KA 1JKFA 4P31A 5D51S 3G68A 1NVWQ 3HS3A 4I4CA 3H75A 2GUGA 4O4IB 3WQHA 4RK6A 5CGQB 1N5JA 3DULA 3HFGA 1NT4A 3ZKWA 4FEGA 1E7RA 1WB5A 3IAM1 3PHCA 4G1VA 2Z04A 3AONB 3BL8A 1T2UA 1QAQA 2NO7A 3V7WA 1S89A 3RNLA 2JLWA 1C14A 1L0BA 1RXCA 4YUXA 1U6JA 2DR3A 1WCYA 4NHOA 4ITUA 1U0RA 2IF2A 1SIWA 2FSUA 1NVEA 3RD5A 4BLPA 1C1HA 2VWGA 2WV7A 1GZ7A 3TRHA 1RRFA 2NU6B 1U7PA 3HNOA 1P7ZA 4X9XA 4EVRA 2JGIA 3UT5B 1X1RA 1XQVA 1K4MA 1NW8A 4KMOA 4TOIA 1KRHA 2HSZA 3EMKA 3BUSA 2A33A 2IY8A 1KXJA 4HTFA 5IT4A 4NWIA 3RC3A 1RBZA 1CU1A 2XKAA 5CVUA 1OVMA 5AWFC 3W8EA 4BFXA 1E18A 3PFNA 2WIAA 1VPVA 1EFCA 4JT9A 4XFDA 5J5VA 3PBKA 4EVQA 3KDAA 2D2FA 3NT5A 4M8LA 4MPJA 2YQ5A 5AJYA 3Q3HA 1G21E 4DM4A 1ZNYA 2HMYB 1HNZB 3BERA 1Q19A 1SZPA 1LXCA 3QWFA 1ZIDA 3IOCA 4PO1A 3PITA 4QBFA 3R3YA 4PTLA 1NGSA 3ICOA 3KQPA 4P3KA 5A7HA 4PS1A 3N53A 1FQKA 2XH8A 2XMGA 4HJXA 2BZSA 1Q1BA 4ZYTA 1FC0A 4RCZA 4CT4B 1U5AA 2I54A 1JXMA 3FPBA 5F78A 4D97A 3RGGA 3QOYA 2EHDA 2OGTA 1QK3A 1NDUA 3KZOA 2GCIA 3UTCA 1QFXA 3FIJA 2CLIB 4B4KA 4BL5A 1USKA 2C5SA 4ZI2A 5LLDA 2PZ8A 5DFAA 1DG9A 4XYLA 3U56A 4N12A 1MXHA 4O5AA 1YZFA 2FVYA 2G9QA 1TMGE 1QGZA 4QUAA 4WHMA 3AZPA 2CFIA 4EHDA 4G24A 5IASA 3IQIX 2G4LA 5ECGC 3LI2A 2OQVA 2I91A 2ZTVA 3ZGNA 2PO5A 2C7QA 3V55A 1V5EA 3DWGA 2ODEA 2XECA 5DGCA 4JU9A 5HQ3A 1YR3A 4P35A 3RRNA 3GG9A 2WZDA 2KWIA 4GKVA 3V1TC 5ITWA 3ADPA 521PA 1GPUA 3DAGA 3OZXA 3TTXA 1N2OA 3K0CA 3NEYA 4F5YA 5CLFA 2BM1A 4LAFA 4HNUA 5I7EA 4G9BA 2ZSAA 3HLYA 4RA6B 4MQ4A 4YUVA 3HKEA 1IDOA 2P2ZA 4KVAA 2OPHA 2PLNA 2CD7A 3FLAA 3QPDA 5JBIA 5KNDH 1WHTA 2I6SA 2FSVA 3VNQA 2Q1XA 2QLNA 3S8YA 2R7LA 2FRXA 1V16B 1KJYA 3OE7D 1P9NA 3GLHA 5A2GA 2GYUA 2WTEA 4W1RA 1KFCB 3Q98A 2F90A 3RV3A 3TIIA 1J2UA 4GR4A 3UHJA 4CQJA 3ZZ0A 1IJEA 4YT2A 4F4UA 2C96A 6ADHA 1I33A 3TM4A 4FILA 1N2GA 2A0YA 1L5LA 4AO6A 1AA6A 4DQDA 4NAVA 2FPGB 3R3JA 4MWBA 2OHOA 1A5TA 5AK4A 2WABA 2MCFA 3HRHA 3I4LA 4ZEWA 4R9NA 3T1TA 1P62B 3NTXA 3TCNA 1DOZA 3TFWA 9GPBA 2Q4BA 3S3TA 5FTKA 1VPLA 1ZCJA 2X1LA 3PDJA 1SNYA 1R50A 4ZU3A 1YQDA 3UHFA 2HK8A 2OFXA 5DYGA 1T5DX 4Q7QA 3DL0A 3FETA 2IYOA 1V4NA 2AZMA 1U98A 3FZQA 3ZW9A 3A11A 4PAOA 1I7NA 2PRKA 2JCSA 2RBGA 4X5OA 1CJKC 3AB7A 4F72A 4B5LA 1C7RA 3A0UA 2V4MA 1ZVVA 5JSZB 4KEAA 5F9HA 2FWNA 5JARA 1ZH8A 2LCFA 1Y8ZA 1F6WA 4Y2VA 2FOIA 1MFZA 1IY2A 1UP4A 2PXAA 2YY5A 2GZMA 3Q41A 1NDQA 4ZCPA 3ZBQA 1BS9A 2WJAA 3T9DA 3PV0A 4A0QA 5CA1F 4BEBA 1XJ0A 3B6ZA 4F04A 2GXSA 5I4IA 4LA4A 2GUWA 4DV4B 3NM4A 2IS2A 3JQ8A 2YASA 4Y7DA 3L7OA 5IDQA 5FBKA 2QMUA 1KMIY 1NU8A 4IHQA 2HWXA 1QDEA 5JSKA 3SXJA 3WP0A 3K0FB 2LP4Y 5AKEA 4HK4A 4DLZA 5LD2B 5EVCA 4I2VA 5BT9A 5D00A 8MHTA 2OGUA 2XNDA 2ZITA 5J2UB 3M6IA 5D6OA 3DM5A 4TT3D 5GQSA 1I6KA 2L0XA 4UOZA 4EPXA 4EGFA 4A16A 4FDVA 4LYEA 1I0IA 4BP8A 2FR8C 2H7VA 1UDWA 1TKRA 1VMDA 3CWQA 1OLXB 2H5LA 2V7TA 3GF4A 4GGOA 3I23A 1MVNA 4OQEA 3ZX5A 5JQGF 3MYYA 1LKZA 3CX7A 2AJCA 3ANYB 4GZ3A 4JMLA 1O0BA 1I6LA 1OYYA 5CXQA 4PNPA 1VKOA 1JDTA 2ZSKA 1QZUA 3B13B 1DELA 3O1HB 3NRCA 2R6GA 3BCRA 3COZA 1V45E 2VLBA 1R3UA 1OXUA 3E2MA 4J7CA 1SPBS 1WAMA 1WCV1 2DUUA 2SKDA 4YPFA 5AW9A 4RNCA 1XD8A 2JLAA 4WY2A 3VKGA 1TYAE 3PEUA 1P7VA 2LW7A 1DAMA 2R25B 3Q88A 4PZYA 1PP4A 4EYOA 4UHFA 3I2JA 3LY9A 4X8OA 4YP1A 3RS8A 4ZEMA 4BXOA 2RGDA 2CSXA 3WMGA 4TSFA 2OV1A 4DY4A 2HN9A 5HF6A 2HCBA 1WKVA 2ZB3A 2NYUA 4EUKA 4CIAA 2QLFA 2VJAA 4KIGA 3LT5A 4BKMA 1C3JA 2NSLA 4LUCA 3SJBA 5DB4A 3ZEAA 3K15A 1CEQA 4IJ5A 5GM1A 1YC2A 1H8HA 2ACEA 5LDGA 4ETNA 1Y3HA 3JARA 2ZM5A 4L4UA 3KXDA 1BZYA 2HJRA 2VUUA 4G67A 4MMZB 3RI3A 5G1OA 3LQYA 5AUOB 1ZITA 1XEWX 3KOMA 4LS3A 4DHWA 2G77B 4LBWA 1F2UB 1Y33E 3PXCX 2AFIA 3L7NA 2PN1A 3NHZA 4PM4A 3MMSA 3DHVA 5BO5A 4XEHA 4NZZA 4JQSA 4QARA 2F8SA 4E13A 5AW6A 4BTEA 5AVYA 4I2NA 2AFHE 1RZUA 4Q16A 3ENQA 2VSNA 2GKSA 3NAMA 1KRWA 1ZINA 1OBCA 3HMQA 2EKBA 1N9ZA 1NLZA 2HWUA 5E9AA 5J40A 4AI6A 1R0XA 3M5PA 4PSDA 1ZK4A 4FPXA 3IT2A 4BLQA 1QKIA 2W70A 2X4LA 1R0ZA 4HAXA 1AY0A 3IT1A 1N57A 3A58B 3C2QA 3HY6A 4Y9RA 3AI7A 4OM8A 1L8LA 3W5BA 4PAGA 1LWNA 1Y7HA 4US1R 5D5PA 2VF7A 4TKVA 2X8LA 2DSTA 2O05A 4D4MA 5IC4A 2JGDB 2XOXA 5IVHA 2AF4C 1U2GC 1NLFA 4EIWA 4O4IA 2PUWA 2IUFA 3GAZA 3IILA 4FX2A 1FLDA 2X9GA 3QVOA 4K5QA 2FG5A 2YMQA 2AQ8A 4QYWA 3M8KA 1XLUA 3ZIAD 1J7KA 2HK9A 3H05A 4Q1DA 1FTNA 2LUOA 4ZODA 5DF1A 4XB2A 2NXNA 1Q7BA 1B0ZA 2RK6A 3FCXA 1BJTA 4BS9A 3Q0IA 3DZKA 3HYNA 3M5WA 1I1QB 2SKCA 3QVXA 4RVSA 3SEAA 4FMCB 4B6EA 1Z9BA 5CH3A 2NU6A 4S0XA 4KFTA 3STHA 1NWCA 2WI8A 1FX0B 2VYVA 1XFDA 2PFSA 2P9CA 5KSZA 3GEIA 2O2GA 1XPJA 5TB5A 3KEQA 3KLOA 3UT5A 2HR1A 1FXWA 1U4NA 2Q46A 1PG2A 2PH1A 3FNQA 4E94A 1RCTE 2AG1A 3FGPA 4L3WA 1V8BA 4E5DA 2JAUA 3BMNB 1UOEA 2BKUA 2DHCA 5CM2Z 5JXWA 1FS6A 2H1HA 4MV6A 4IG9A 5ALGA 3SOPA 4FMDB 2RI1A 3ND7A 3M7IA 5FD8A 1TM7E 1TCVA 4MYDA 1WZ2A 2V98A 2NO4A 3FSJX 1JDVA 4G8BA 1RM3A 2CUZA 1SEPA 4PHCA 2QVGA 1LF5A 1M75A 2XX3A 4G5XA 4WOJA 2JLVA 3P0JA 3BSYA 5E3JA 2AI1A 1COZA 3T5MA 1T2FA 3C8UA 1T1SA 1GL9B 1E1NA 2ZE8A 3G0IA 3KSUA 3RF7A 3SQDA 3OLWA 1XTRA 1N0UA 2GARA 5LM3A 1E2EA 4UULA 3GEPA 5SY9A 1NZFA 1X14A 2QAGB 3KJIA 3QUTA 1DQZA 1HBJA 3D4OA 3QWHA 2DE0X 4WEQA 5ETJA 4ZXPA 4E15A 2LXNA 8OHMA 4QVIA 5EHGA 3KQKA 2IC5A 5C8YF 1FUYB 1ZGAA 4IQ4A 1UP7A 5KVQA 2MINB 1JG1A 1JAIA 1SVKA 2RHTA 2YBDA 3DBLB 5IT5A 2A4MA 4WKPA 5DWVA 5FLYA 4MCHA 2ZJ6A 3NHLA 1NBOA 3F3MA 5DXFA 2FJPA 4JQZA 3KSMA 2JG3A 2NVBA 2QPOA 4YROA 1DC6A 3ZCUA 3QQ5A 2G82A 5IJ0A 1V6AA 5IW8A 1I5RA 2PWYA 1ZUWA 5MFZA 2AUMA 4PGGA 4AN1A 4EKNB 2HFKA 3WNQA 1UJ2A 3N7TA 4LC9A 2IXFA 2TECE 3GJ7A 4Y6PA 4XX0B 5K01A 4MUXA 2WNIA 5G40A 1TAQA 4ME6A 5LFAA 4KPFC 3FUXA 1UOOA 2W8BB 2XPCA 1M2EA 2QZSA 3TTWA 3AR9A 3LBFA 2FWBA 5JMPA 3KXPA 3FFXA 5DLPA 1IPEA 3BKWA 3K9GA 3SMVA 4RA6A 3F5QA 1Y9DA 3JQ7B 1R2QA 3GUZA 3QOWA 4TMWA 5IN5A 3H9EO 5C4IA 2GRUA 2QUIA 4NQZA 1UF9A 3HXPA 1PFGA 4P38A 1MJNA 1PQYA 5TMEA 1V16A 1TQDA 5HXAA 4BFTA 2HNBA 4K26A 2ZI4A 3CNEA 4I3FA 1IQRA 4JUIA 1KZGB 4KDFA 4XD2A 4EZEA 4LPSA 4TMVA 2WVHA 1SO8A 3M2TA 3HEAA 2RHDA 5DNDA 4ZU1X 1NR7A 2C8JA 4B4UA 4ABTA 3K1JA 1U9JA 1YVUA 2XWPA 4HVAA 4IFIA 4QULA 1OXBB 4KKVA 4PLZA 4OHYA 1J22A 2PGIA 4TUYB 1W36D 3IV9A 2FPGA 2WE7A 2I6FA 3KQSA 3LCVB 1I80A 4OJNA 2J9XB 1JIVA 1VBNA 2HIHA 4C4XA 5C7LO 2REBA 1E3IA 3QFTA 4S2EA 2EJWA 2P30A 3LT4A 1LPBB 3MJHA 1RP7A 4ZO4A 3HVJA 3GMTA 3QPAA 3I9MA 4P92A 2IHJA 1A88A 1OX6A 3AUFA 4LSGA 3PXAA 3C6BA 5E2IA 2WG1A 3UW3A 3BSSA 4HDSB 1GDDA 2F43B 3INRA 1WUTA 3OPNA 4UXJA 1ZAKA 3QWBA 4P32A 3WL8A 3FDZB 5JTUA 1VPTA 4RGVA 5FORA 2HDNB 1RLOA 2QYOA 1OAKA 1KFBB 2IHTA 1X80B 3AIKA 1HA3A 1UKCA 4X64B 1GO2A 2GKOA 1A9RA 2VP9A 3MOIA 1SK9A 3CF6R 3PJGA 4HYQA 2HRDA 5JSZA 1YJ5A 2XT0A 5FNVA 3TLCA 3E5HA 3KOUA 4A7PA 1FRVA 1T9BA 2H1VA 3IEMA 1NA5A 2R751 1RPAA 1CZRA 2LBPA 2VNHA 3FKJA 2AXPA 3GYBA 5CW1A 1G8YA 4A6PA 1XNHA 5BRAA 5H9WA 2IH4A 2AR7A 2P2LA 1UXJA 4HWGA 4O1HA 4Y6GB 1BA3A 3M6XA 4Q34A 4D44A 5TY0A 1EG2A 3K0FA 3CX4A 3WQSB 3ZDYB 5C8XA 1WP4A 2CXSA 1NJFA 2PMKA 3GNLA 3LPDA 1PV1A 4INZA 4XD7A 2BF7A 4OJMX 1SXQA 2GM5A 1Y3DE 4MIKA 4R1QA 5FT9A 3PUKA 2XTZA 1FYXA 4IO0A 4UMVA 1LW7A 2C42A 3PFKA 3RTCA 3X2FA 3GLFE 5ADUS 2SHKA 2X8WA 2RCYA 4RGQA 3NR2A 3RVDA 1VXOA 2RGEA 2ZWIA 4C4OA 5IXSA 3WKDA 1OLXA 4IUCS 2XEXA 2XXAB 4OHFA 3V1KA 4II2A 2J0SA 4NLLA 1K2WA 1CUGA 1MVLA 1DCKA 1TF5A 1S7GA 2BH9A 3BWCA 3C8HA 3ZD8A 3BXOA 5F2OA 4DIMA 5A3QA 5HZMA 2ZUDA 5FEUA 2W2PA 1BEEA 2HDWA 2XCUA 1EDZA 5AKGA 2GDZA 5FHRA 1L4BA 2QDXA 3HE3A 5DN6A 1O58A 2DFDA 3NRBA 1IN6A 2H48A 2E0IA 2OCLA 1ABEA 5F3DA 4YREA 1ANKA 2QL7A 3AJ8A 1ZH0A 2F64A 3QY0A 3RSGA 2CCKA 5SZKB 4L75A 1LCIA 3C3YA 3F9CA 4OVKA 2FZ4A 3ZK7A 3F3YA 2QUZA 4NG4A 3NFYA 2C2WA 5I01A 1I9CA 1Q7TA 2XMSA 1F2UA 2E5FA 2HREA 5K0GA 2C57A 5JJ5A 4QIHA 2CBZA 4MUYA 3U9LA 4E70A 1ONSA 2YX1A 3L18A 3N28A 1U7WA 5JWRA 3CVUA 2I3BA 2XY4A 1SBTA 2QRUA 5DRYA 3SDSA 1GPKA 3H1GA 4BO0A 2OC4A 3MT7A 4P4UA 2HXGA 2NVOA 4C7JA 4EUNA 4DA0A 3DXZA 4ZT6A 2Q8PA 2PVPA 3MS7A 3EB9A 1GAQA 1OUMA 3FGZA 4PQYA 3UWSA 1LFAA 3IVXA 3KIPA 4M98A 3BX1A 2A5DA 4IUYA 1MGOA 3ZLUA 3O8RA 1O5IA 3OA0A 2VYCA 1JNYA 2VH2A 4ZC1A 1F20A 4R7TA 4G65A 2XCRB 1SXGA 3QHAA 4ODIA 3UK0A 2AN3A 1O4WA 2BAGA 2IXTA 1EGQA 1H05A 5TC4A 1OWOA 4REQB 1NVAA 3UUGA 4UNNA 4LRWA 2FZEA 3Q8MA 4ARUA 2Z58A 2RAUA 3K2BA 1X2EA 2QY9A 1X9IA 4MUFA 4D3FA 5A7GA 2VRNA 1P75A 4HAIA 3ZXUB 2YIDA 3ELUA 4G1MB 5F4ZA 2B4TO 3EQ7A 4LOIA 2F1IA 4F5ZA 2JFNA 4HNTA 4INPA 1PZMA 2J7KA 1GG2A 2HHLA 3FFAA 2B1IA 4PBRA 4BLVA 5JDIC 5ITSA 1E2BA 3WLEA 1VLHA 3I0NA 3BD8A 1OBFO 4GWGA 3WLNA 4PC3A 4BNFA 4F9EA 3S8EA 1WTAA 3DEKA 3ELWA 4B4DA 2IUUA 2PSHA 1OHHD 3ST7A 3EDQA 1NE2A 1KL7A 1SQ0A 3SNKA 2WWFA 1E7QA 3EMVA 3DTVB 3RKSA 9MHTA 5DNVA 1FX0A 4MNTA 4K9LA 1XALA 3TSAA 5BNWA 3ZWNA 2AG5A 1U2QA 1UWVA 2A1IA 3B7PA 1T5BA 3AGPA 1PQ4A 4BQFA 3S70A 1KAQA 4QUHA 2HJVA 1A2BA 3GEHA 3ZDCA 3K70B 3BMNA 3B3QA 4I9GA 1U3UA 1H2XA 4A10A 3W2TA 9ATCA 3LZDA 3MWFA 2WD7B 2BFDB 2H11A 1ZM3A 1DBRA 4HUTA 5BYKA 4RCVA 4BTVA 4HDRB 4IQ8A 3UJHA 4URZR 1KY2A 1DQYA 2IZZA 5H4HA 4TVOA 2NVWA 4EAAA 2ET6A 2ZRLA 3AKDA 3F6PA 2Z56A 4INAA 4JFRA 3W2HA 3ZWWA 5ALDA 4IM7A 1OIWA 3E5MA 4RK5A 1ZI6A 2PBRA 1W47A 2YWXA 3N07A 4I81A 3Q8WA 4R2JA 4AZ3B 4YAIA 1JFTA 4JP3A 3CNLA 1Y1PA 4GIBA 1UPXA 5AK3A 3MRSA 2A0FA 2WF9A 3I52A 3W6OA 2QAGA 4KV9A 3MWKA 1LV8A 2K4MA 4M87A 4WNYA 1NBAA 3ZZMA 4B40A 3REOA 3FBTA 4EW2A 3PCXA 1FU8A 1O96B 3C8ZA 3A70A 5LP6B 5C9ZA 2MINA 3DBLA 3ILYA 4DV5B 4Z0HO 4PYKA 4AT1A 1IG0A 4Q0MA 1QF6A 4EA6A 5DLYA 3N74A 4B1FA 2QJFA 4IDHA 4X62B 1NXVA 2ZVDA 3DB1A 2NU9B 3T95A 5HQTA 2DTXA 1HGXA 1IBSA 1Y3AA 1HYHA 2AEJA 3O5AA 3IURA 4LZJA 4XEUA 3MLEA 3VX4A 4M22A 3ZWYA 1D2NA 1PEDA 3CZRA 3INYA 4A27A 4CTJA 4DKJA 3BE6A 4YQFA 5FDFA 5DTEA 1D0IA 1PR9A 3A6GA 3K96A 1AK2A 4N0QA