4NQRA

The crystal structure of a solute-binding protein (n280d mutant) from anabaena variabilis atcc 29413 in complex with alanine
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
364
structure length
364
Chain Sequence
NTIPIGIALAQTSNVALLGQEQVAGAKIAEKYFNDKGGVNGTPIKLIFQDTAGDEAGTINAFQTLINKDKVVGIVGPTLSQQAFSANPIAERAKVPVVGPSNTAKGIPEIGDYVARVSAPVSVVAPNSVKAALKQNPNIKKVAVFFAQNDAFSKSETEIFQQTVKDQGLELVTVQKFQTTDTDFQSQATNAINLKPDLVIISGLAADGGNLVRQLRELGYQGAIIGGDGLNTSNVFAVCKALCDGVLIAQAYSPEYTGEINKAFRQAYVDQYKKEPPQFSAQAFAAVQVYVESLKALDTKNKVSKIQLPELRTELNKQLLTGKYNTPLGEISFTPIGEVVQKDFYVAQIKMEKDGSQGKFTFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Amino acid/amide ABC transporter substrate-binding protein,
publication title The crystal structure of a solute-binding protein (N280D mutant) from Anabaena variabilis ATCC 29413 in complex with alanine.
rcsb
source organism Anabaena variabilis
total genus 141
structure length 364
sequence length 364
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13458 Peripla_BP_6 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4nqrA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4nqrA01
3LKVA 4LDZA 4WXEA 4O1HA 2CHEA 2QSJA 2MSLA 2Q5CA 3CNBA 3QEMB 1ABFA 3ROTA 3JVIA 1JLKA 3KLOA 1JDPA 4F11A 4KK3A 1USKA 2P4UA 4LX8A 4W5OA 3EQZA 3I5AA 4RDCA 1ZHHA 1XHEA 1VLZA 5IULC 1B00A 1QQAA 3O1JC 1F51E 1C0EA 1PEAA 2JBAA 4MR7A 3NNSA 4YRZA 4P1ZA 3NHMA 2VYCA 4YV7A 5FBHA 2MYTA 3N0XA 2V0NA 2FKAA 1ZH4A 4GNRA 5BRJA 2GBPA 4F12A 3OQNA 2PUFA 2ZAYA 2CD7A 4UHKA 1MB0A 5I4CA 1DCKA 3H5IA 4OBBA 2FMFA 3RVLA 5CNKA 5E3JA 3H5LA 2H3HA 2GI4A 3H6GA 3SY8A 5KI6A 5T3YA 3GV0A 5GOTA 3R0JA 3O2JA 4JB2A 2PUGA 3QLVA 5HKOA 2KYRA 4L85A 4ETMA 1ZH2A 3KJXA 4KZKA 4Z4HA 3NNNA 3C97A 9ABPA 3MF4A 4Z4GA 2MYPA 3F6PA 5DTEA 2HQOA 1P6QA 2FQYA 3HSYA 3N0RA 1JHZA 3B2NA 3HS3A 3QX9A 3HO1A 4IRXA 4MR8B 1JF8A 4MS4B 1Z13A 1ZY2A 4MAAA 4LDAA 4N0QA 2X7XA 4XASA 1VPWA 4ZPJA 3KYJB 3C6QA 3TB6A 4DADA 3CLKA 1W25A 1YMUA 3KS9A 4QYWA 3RVPA 3DLHA 3A3KA 3A0UA 4PYRA 3IP9A 2NUBA 5TQ2A 3TD9A 1WETA 1LJUA 3GL9A 1Y1LA 2WB4A 3C3KA 4E7PA 1JFSA 4MQEA 4MS1B 1DBWA 3QELA 2A9PA 5JNWA 5FWXA 3JTEA 5C5EA 1ZAYA 1BDJA 3GYBA 3H6HA 4O5AA 2QZJA 4D74A 4WZZA 1RZRD 4W5TA 3HEBA 3Q15C 4EYOA 3QLTA 1D2AA 4RU1A 4NQRA 1NXTA 1ZGGA 5DGCA 1DBPA 2AYZA 2GX6A 3C3MA 3KHTA 4TLLB 1U8TA 2ID9A 3CZ5A 1PNRA 4OLAA 2FMKA 1QP0A 2IPMA 4S05A 3HUTA 1DRKA 4RY0A 1BAPA 5FBKA 1U2PA 3IPCA 3LUJA 1D4ZA 3LUAA 4MGEA 2FN8A 1S8NA 2JBAB 4MR7B 3Q41A 1RZRA 1W9HA 1DCFA 1KRXA 3IDOA 2RGYA 1JDNA 1ABEA 2WMYA 2DRIA 3CKMA 4PE5B 4XARA 5JNTA 5HM6A 5D2CA 2I6FA 4MR9B 1Z25A 5IBQA 1RPJA 3IPAA 4IF4A 4JB0A 3OMWA 4HYEA 3LOPA 1U2QA 1LBIA 4N0PA 4QICA 3F73A 4ZMRA 2A9RA 3HDGA 2WJWA 3ROFA 1FQWA 3Q7TA 3UK0A 4DQDA 1NXVA 4N03A 2P9HA 1D1PA 2PJUA 4F8JA 1GUBA 4O1IA 1H9CA 4XLTA 1E6KA 5IEBA 1JWLA 2A9OA 3KSMA 5JNRA 1ISRA 2FVYA 4MPTA 2E4XA 2LPMA 3GA5A 3VNAA 4ETIA 1RNLA 4W5RA 4LE2A 5CNJA 1TMYA 3FFXA 4E7OA 2LP4Y 3OM0A 4G0ZA 4JA2A 1IIBA 1LJLA 3QX8A 1ZVVA 5IUKC 5B3JC 3G1WA 1DP4A 1GLGA 4W5QA 5IX8A 4Q7EA 3KCNA 3RVJA 1EHCA 3NNDA 3BRQA 4H3HB 2FLKA 3BREA 2PL9A 3H75A 1M5TA 5TQ2B 3TX6A 2R47A 4UHJA 1E2BA 1LBHA 1YS7A 2E4ZA 3FMVA 4MQEB 3HVRA 1FFSA 3QELB 3CFYA 1BDIA 1FFWA 1DC8A 5KC9A 5KQMA 5FWXB 4MS3B 3ILYA 4XXHA 3K4HA 3IP7A 3SNKA 2J48A 4XAQA 2N9UA 3H5VA 2B1JA 2FQWA 1T34A 1JH9A 4HNRA 1DZ3A 1AB6A 1I3CA 5JNSA 3DLBA 4Q6BA 3NHZA 4LZLA 4RXUA 1ZESA 3HM9A 1KRWA 2FLWA 3JPYA 4RK7A 2MYUA 1NXSA 2VUHB 2WJAA 4G0OA 5DKFA 4RK1A 1RXIA 2MSKA 3H1FA 4KQCA 2E4YA 4YWHA 2QU7A 4PEVA 3CU5A 1ISSA 4OATA 4MQFA 3RQIA 3M9XA 2O20A 2FTKE 2FEPA 1QMPA 2IKSA 3MM4A 1L5YA 1SRRA 1L5ZA 1YS6A 4ZJPA 3EULA 1NXPA 5EWLB 5TQ0A 4FE7A 4WWHA 4YP9A 4WT7A 3OQOA 3CHYA 3F6CA 3K9CA 4QPJC 4MLDA 2RJOA 2A9QA 1NXOA 3I45A 3O2SB 4YLEA 3NBMA 1DG9A 5CNMA 1Z12A 4F3TA 5T7BA 1ZITA 2LUOA 1K68A 1CHNA 3O74A 2IPNA 1SD5A 4RS3A 2RJNA 4RV5A 4RKQA 1BDHA 2MYNA 1GCAA 1XWWA 1MIHA 2FSPA 3LKBA 3T8YA 5KQGA 2JVIA 2FMIA 3LUCA 4EY3A 4EYGA 3Q9SA 2LIVA 5IEJA 4LE1A 3BILA 2PUCA 3RVNA 3HJFA 3RVQA 4RK4A 4D6XA 2F8SA 4RY9A 1CYEA 2B4AA 3CG4A 3TMYA 2W42A 3OO0A 3UKJA 5KQPA 4G0MA 2IOYA 2JRLA 3HZHA 3RVSA 1FSPA 4Q6WA 2CWDA 4L4UA 3QLUC 5GQSA 3QEKA 4MLCA 3GRCA 5CNIA 1U04A 3N6VA 3E61A 2L19A 4G0XA 3FFWA 2WY2D 3O1IC 1U0SY 4Y9TA 5FWYA 4LRQA 3T95A 3URMA 1A04A 2NZVG 4DN6A 4RZSA 1BA2A 3ILHA 5B3JA 1K66A 4NV3A 6ABPA 3GBVA 1UDRA 5EWMA 3JY6A 3QEMA 3QLVC 1Z2DA 3MIZA 4MQFB 3MA0A 2M98A 1PEYA 3CTPA 3EJWA 4PZ0A 1M2FA 4EVSA 3EQ2A 5TPWA 4B09A 3A0RB 5KQLA 4EGSA 3VNBA 5TQ0B 4Z0NA 3HV2A 2PLNA 3MMNA 5CHYA 3MQ4A 1ZDMA 3H5TA 4MYRA 3BBLA 3DGEC 3OLVA 4TLMB 1QP7A 3N53A 3UUGA 4N41A 3RVMA 1USIA 4IMJB 1D5WA 3HUUA 3Q7SA 1QQBA 1DRJA 2PKXA 4M88A 1YIOA 5JS1A 1YK0A 5EWJA 1F4VA 1GUDA 3EODA 4XFKA 1VRVA 3KLNA 1LK0A 3M6MD 4MRMA 3H1EA 1PHRA 4Z99A 1TJYA 4OTZA 1C4WA 4KVFA 5C5CA 4W5NA 3IP6A 1Z15A 1JFTA 2PUEA 1E6LA 3CS3A 4LE0A 1QNLA 1GCGA 5JS2A 3OLZA 3JS5A 4KRFA 3N8IA 2R48A 3CZCA 1P2FA 1DBQA 3OLWA 1Z2EA 4RK5A 1NATA 4ML3A 1APBA 1JX6A 4FE4A 3D02A 3I42A 4IGAA 1RXEA 3Q7RA 2QVGA 2AYXA 3DGFC 8ABPA 4S04A 3E3MA 1TM2A 1AB5A 3DZDA 4RXTA 2R25B 5FWYB 4NICA 5ABPA 2YHBA 2R4QA 4TMYA 4ETNA 2PL1A 3KG2A 3LUHA 1EFAA 3M9WA 3FDFA 3O2QB 5BRAA 5HSGA 2GWRA 2FW0A 1KMIY 4EYKA 4N76A 2ID7A 2PUBA 5EWMB 4F06A 4G0PA 3EGCA 1DCMA 2FMHA 2FXIA 4EVRA 3A10A 3H5WA 4G0QA 3OQMA 1P8AA 5F64A 2QXYA 2HJ9A 4YR7A 4KNYA 3OMXA 3RVKA 1YTUA 3IP5A 4Z4EA 5TPWB 5JNUA 3QLUA 3O21A 3OO1A 4PICA 2XDYA 1DC7A 4OG2A 3KYIB 1EWTA 4EVQA 2GKGA 2WWVD 2NT3A 3EAFA 5KC8A 1Z17A 1NXWA 5TPZD 2MSWA 7ABPA 5KWSA 1YK1A 4KV7A 4MR9A 3G85A 4Z9AA 5BQ3A 3OLXA 4EUKA 3O1HB 4KREA 1M2EA 1Z16A 3D8UA 2JK1A 3LTEA 1QKKA 4G86A 4JOQA 5EWJB 3OM1A 4QYMA 2YHAA 2JCGA 4MRMB 1A2OA 1QO0D 1EWVA 4ZMSA 3KKEA 4WUTA 4RWEA 2OQRA 3JVDA 1ZGZA 2CHFA 1OXKB 2JVJA 3F7NA 5TPZA 2QVCA 3RVOA 2HPHA 3SAJA 1R8JA 5PNTA 4WXMA 2QV0A 4Z4CA 1TLFA 4IILA 2FEWB 2L18A 4G0YA 5DCLA 3QK7A 2M1ZA 5DLEA 3W9SA 2NZUG 3EDCA 3HXMA 2F8TA 1QO0A 2OENG 2L2QA 1QPZA 3L6UA 4Z4IA 1MB3A 1MVOA 2IPAB 3FGZA 3N0WA 3TO5A 3SG0A 1KGSA 1D1QA 1ZN2A 2JB9A 1J56A 4YO7A 2HQBA 4YGXB 4YCSA 3GBPA 4JP1A 1QP4A 2PUAA 1Z26A 1MAVA 2IPLA 4NCBA 4IMIB 4MS3A 1NXXA 3RVRA 1SXHA 3OLYA 2PE5A 3GWGA 5ED4A 3C3WA 3SM9A 1BVHA 2JVKA 4FB4A 4Z9BA 4D6YA 3N75A 3H5OA 2FQXA 6CHYA 1E6MA 1A0OA 3LUDA 1USGA 3CRNA 2H0AA 2L17A 1NY5A 3MYYA 1JL3A 4JASB 4RK6A 5TE9A 2ZWMA 5BR1A 4Z4FA 5IUJC 1TVMA 4N47A 2HSGA 3KTOA 4GPAA 4ZYLA 3HCWA 4KPYA 2HQRA 3T6KA 1FFGA 5IC5A 1NTRA 5HQJA 1OXBB 5IUNC 2IDMA 3I09A 3JPWA 3H1GA 4RK0A 3L49A 2PUDA 1JYEA 1SXGA 3T38A 4P98A 3SQNA 1PUXA 1JFVA 1YVUA 5EWLA 1EAYA 1SXIA 2E4WA 4KMRA 4YS6A 2QW1A 4TN5A 3HDVA 3HK2A 3LUKA 4RSMA 1JBEA 1CEYA 2IYNA 3LMKA 2VUIB 3GT7A 4NCAA 3DBIA 5TQJA 4H3KB 2TMYA 1PNTA 2RDMA 4G97A 2FN9A 3LUGA 1DJMA 4MR8A 4MS4A 2VK2A 2WRZA 1YMVA 2PMCA 4EYQA 1JYFA 3CG0A 4KK4A 2FEKA 4RKRA 1VKRA 2LBPA 3LUFA 1M5UA 1HEYA 4KQ9A 2PAFA 3S99A 4OLBA 2QR3A 2BGGA 1URPA 3BRSA 4CBVA 4RY8A 2NT4A 1EWKA 3O75A 4MS1A 1XHFA 3FFTA 4RXMA 2E4VA 5JNVA 1P6UA 3P9YA 4KFCA 4HNQA 1Z18A 3RH0A 2E4UA 4JAVC 4HNSA 4H60A 3LFTA
chains in the Genus database with same CATH superfamily
3ZIDA 3TD6A 4AICA 3FHOA 4JHLA 3HYSA 1T5TA 1V7PC 2MSLA 3QEMB 3IIEA 4M0FA 1ZD8A 4OQXA 4C0JA 3K4QA 2XTJA 1FYXA 4HY3A 3RYCA 1N9KA 2JAWA 2JFQA 1X80B 4D9FA 4RFSB 2Q3BA 2LV8A 2W4QA 4JP8A 3E8XA 4UUQA 3S4YA 2I4RA 4KR7A 4TV9F 5CX1B 4YV7A 2LZ0A 3HCRA 1MG0A 3D4LA 5FR1A 1Y7HA 3WYEA 4AFNA 1CQJB 1PD1A 1Z7EA 2VOEA 1K8ZB 1O5TA 2XCQA 1PS0A 2IYVA 4JVSB 3L0CA 3BB1A 2P7IA 3TLYA 1K7CA 3LX8A 1WB5A 2CC2A 4MB0A 4OBBA 2CK3D 4ZJUA 4BKRA 4PXSA 2OC4A 4NBUA 2P9GA 5IM4A 4YPOA 2X2FA 2VP2A 3A6FA 4HRYA 2BUAA 3NXKA 1E6UA 1UK9A 1X9GA 1RAAA 1ZK1A 2I76A 4DUPA 4RELA 5L45A 3ZDBA 3FOFC 2FP4B 2WUVA 3HCAA 4EPTA 1SM4A 4F4HA 2WKRA 4Q9LA 2C9OA 1QV9A 2Q6IA 9ABPA 2H9IA 1PZFA 3GGPA 3GJ7A 2OZVA 2PPLA 2ASVA 2X1LA 2B99A 2I9PA 4WASA 5EP1A 5ICMA 3GDFA 1X9HA 1HLDA 1LPSA 1QLWA 3KDPA 1TIBA 3BK7A 4HVAA 4MS4B 3T3NA 5CXUA 3SVTA 5FB3A 3GGGA 2IOFA 4MV6A 2YIDA 1AO0A 4LYGA 2VF5X 3FSRA 4G2TA 1HK7A 2ZROA 3RVPA 4DR2B 1N9GB 3BWYA 2NUBA 4PS0A 4UHEA 1CDZA 2QU8A 1KY5A 4HDSB 3DNPA 1EFCA 4E7PA 2DY0A 1Z8FA 1VM6A 2WQZA 3A1CA 3EVAA 3FLAA 2OV6A 2ZB3A 4N82A 1IM8A 1D5CA 2XQIA 2WPDA 2Z56A 5H02A 4C4OA 1FJGB 4X3CA 3A1EA 2ZUFA 2PRYA 1VSBA 4ARSA 3UMCA 1E0KA 1J0DA 1R15A 1WVIA 2GN4A 2ZRCA 4LQLA 2W2QA 4QFDA 4U2DA 1ECGA 2GBIA 4D74A 1RZRD 3Q15C 1HMYA 1QHGA 1ZKMA 4RU1A 4XJXA 3T99A 2Z6QA 3BN3A 7MDHA 3KHTA 1UFRA 4DXHA 4XYBA 1YQTA 3W5VA 5C51B 3GT0A 3LXMA 2C3UA 2WC1A 4O4LB 5KWVA 2QM0A 2IVZA 1PR4A 3MINA 3VO1A 3GVPA 4MUXA 2NYRA 3O4RA 5BW8A 2WYUA 3IPCA 3MW8A 1Z6YA 1QDLB 3S40A 1KK1A 1R8YA 4ZP1A 3PTAA 1QYCA 4JLBA 4WGGA 2YQZA 3NYIA 4PE5B 4YH1A 2P35A 1XLVA 3GLGE 4KWHA 3ZGZA 4ITUA 4IJMA 1Q0QA 2HQ1A 1FFDA 4UBNA 3NBKA 3V2IA 4TWZA 1I1QB 2HEGA 4XX1A 3R5JA 2P0AA 1ECCA 2QNRA 5B53A 2QRKA 3BWXA 4GX2A 4MAFA 4BFSA 4D4GA 3FWHA 4DYDA 2EDAA 4UZFA 3IAS6 3ZK8A 3SR4A 1XTKA 3W05A 4ZMBA 1ONNA 4KLCA 3BKXA 4BKMA 1TYBE 2D8AA 2QXUA 3DDOA 2CDBA 1K5DA 5DLDA 3LI2A 1UXHA 2QE7A 4C03A 1UF9A 6GPBA 1KEZA 2LPMA 3GA5A 4ETIA 5CYOA 5JYEA 3MAAC 3O73A 1TMYA 1YCHA 5A05A 1RI5A 1FUIA 1NYLA 2AVDA 4RGYA 4UNNA 4CMCA 4QLBA 1JSZA 2V4UA 1JDZA 5DHUA 3VNAA 4GYYA 1KI3A 2B37A 1IJBA 4J7UA 2DFDA 1KJNA 2RB4A 1T0JB 2VCHA 3GLKA 1WD7A 3Q3HA 3UAZA 1SKMA 4H3HB 1AXRA 2AFHE 2CHQA 3I2HA 1VL6A 3FVWA 5K0SA 1SVIA 3CNHA 3O9MA 3KQQA 4NCIA 3WBFA 3RVKA 1PZXA 3F4KA 1HLGA 3SD7A 3T7DA 4HFNA 2DECA 2H1WA 4DLYA 2VKQA 1DTEA 1SHZA 1WXWA 4B74A 1QFZA 4C0AC 3MPUA 4GGOA 2I7DA 3U60B 1DU4A 1QVWA 2HHJA 1YA6A 1X74A 2PQ2A 4P32A 1P74A 3BVPA 3UHFA 4R1NA 3BL5A 5LOVF 3I23A 2CEAA 5IM4F 3PLAE 1D2CA 4YJHA 2BFPA 1NUUA 2Z58A 1WW2A 2HLHA 2A9KA 4ZREA 4DLSA 4B7AA 5H1YA 3H1FA 1JV2B 3IOYA 2E4YA 4YAJA 1MQ9A 2XJ4A 2V7XA 2VVTA 5B57C 1TB4A 4Z9XA 2B4TO 2ZE5A 1J9ZA 4CI9A 4EY4A 4K86A 2NPOA 4NXMB 3OUTA 1ZJYA 4HDKA 3CH4B 3QSGA 4MVYA 2WTEA 3CBQA 5HJ7A 4D4JA 5A4KA 2JCSA 2OG2A 3PNQA 4TTIA 5ALKA 4C6HA 2C1EA 4P53A 4PZPA 3REQA 3MM4A 2ZJ6A 2H1SA 3FNFA 4EHJA 2N1BA 3B12A 1ORRA 1CUAA 3GJ6A 4BX9A 4OX9B 1W1WA 4RQAA 1AMOA 2OAEA 1BXKA 5FOTA 2BEVA 4L22A 3O8RA 4C9BA 3IKTA 4BBAA 3PGKA 4KUHA 4BLSA 4ZODA 5FOUA 3OAAA 5J1TB 5G0SA 1IY1A 4DSTA 1UKVY 1ZYUA 3VBEA 2YJZA 1QH1A 4QXPA 4EIWA 2XVZA 1U7XA 3GPBA 1B8NA 1EH5A 1LC3A 1PW7A 3I04M 3L7OA 1LW7A 1TIKA 2HA4A 3RKRA 3PNYA 3M4XA 1UXIA 2JD0A 1P91A 3O3NB 3RO7A 3PUZA 4V1CA 3ACCA 2VWHA 3INTA 1GD1O 2BFDA 1UPUA 3QKSB 2BBWA 5CURA 2Z5LA 4DL9A 4XIFA 1DKUA 4AL4A 4RL4A 3R8FA 1JDBC 5FNZA 3MWEB 4E51A 4LKOA 1SOUA 1A4RA 3JZAA 3RTEA 3ND5A 821PA 1TEXA 3M6XA 4II2A 3F73A 4AWAA 2QL5A 1PNQA 2XAAA 2G80A 3ORQA 4ZV9A 1ZIXA 1KBQA 2PSJA 4IDNA 1UKAA 2O6LA 3T4EA 4UXHA 2HUPA 1C30A 2VLIA 1USWA 3ZHXA 1O94C 4I1RA 2ZE8A 2QEQA 1HY3A 1N25A 3TMKA 3E9NA 5DRTA 4CLDA 3N6VA 1AURA 5IABA 5CW2A 1AO3A 1NQ5A 1TIPA 3DDUA 4JLVA 5BVHA 3ZKWB 5CXQA 1I7SB 2DETA 1DWOA 1Z63A 1P7VA 1QPBA 3P45A 1RAHA 5E4JA 3WZMA 5FWYA 3C70A 4BECA 3ZQ4A 5AKLA 4R83A 3OU7A 2V98A 4NYMR 4E22A 2Q4RA 4R71A 1AD2A 2BAGA 1BA2A 3IR6A 2XKBA 5JD6A 1T9KA 2H5JA 3BAZA 3NDRA 3CEMA 1HLPA 4N9QA 1JHAA 5AKIA 4CLRB 3G9ZA 1N2JA 2VT6A 2X0FA 4MW9A 3VR6A 2BBOA 4NHOA 1T15A 4CL2A 1A7UA 4RD0A 5K5EA 4OCZA 1U0NA 1A2QA 2AXQA 3N76A 4WN3A 4CV0A 1LLFA 1IAVA 3R8XA 3C4JA 1EJ2A 1RQ7A 3RAGA 1KJ9A 3AIIA 4TKVA 3H7IA 4ZTUB 1TGVA 2HNAA 3CISA 1PSDA 2BH9A 3HKCB 1BS9A 1TPZA 5TJ9A 1WCV1 1EI9A 4H77A 4AS3A 4C43A 1Y7TA 2IF2A 5K4HA 4KO2S 2WABA 4GXNA 2BKUA 3RRNA 4A1OA 1Z08A 2OB2A 3K9BA 3VR4A 4CT0A 4XR4A 3DC2A 4YCDA 3BULA 1KEWA 2DUNA 3ZXXA 1P33A 1XHLA 3MXTA 1YA4A 2F9MA 3AERA 1JDVA 1EE9A 5IDWA 4DRXA 2FW7A 4KAXA 1T8RA 4ENSA 1DQZA 2HXSA 2OKGA 1K88A 3CZRA 4B80A 1C4WA 3ER9A 3VZCA 4X8OA 3RVDA 1E0JA 1L7XA 1OHHA 4EGQA 4TUYA 5AHXA 5ALWA 3BQMB 1TLTA 3SHWA 3EZ2A 1FEZA 1RRVA 1FNMA 1UMCA 2DH5A 2Z9CA 3E9RA 3F5FA 1NMEA 4S1NA 4PBRA 3JS5A 5HS6A 4CQLB 4DQXA 5BWOA 5C46F 4EO4A 1KC3A 4OK6A 4BRZA 3BORA 1YOVA 2XE8A 2XAUA 2IZOA 3C3BA 3L1IA 4DM3A 5FHRA 5CIQA 3UMSA 4MV9A 1ZVQA 2YUIA 1HDOA 4FN5A 1JAYA 1VBMA 1FDOA 1RLMA 2O50A 3KU1A 1FQOA 2NO1A 4QDXA 3CA8A 3CWCA 4ECEA 2BFMA 2Y2VA 1Y9EA 2V7VA 3O8NA 4RZHA 3KPUA 4LSMA 1JVSA 1WZIA 2FSUA 4TRMA 5ILOA 4ZHQA 1R4MA 3I83A 3LD9A 4R5HA 1TU3A 2ZCVA 3AKZA 5KAMA 2JFGA 5GVRA 4TQUS 3HCNA 2JEZA 1Y5MA 3QW2A 3EXFB 5IFLA 4LOIA 3H9JA 1XAIA 3EUAA 5HSGA 1SG0A 4QULA 4O4IA 4B8ZA 1OLXA 5ES3A 5GZ6A 3ZHVA 3M6FA 1KNXA 3AETA 3LBNA 1NW7A 4OK3A 1X0VA 3H5WA 3K35A 2XMPA 1GTSA 2ZJ4A 5A5DA 3HGQA 3FHTA 1J22A 3KQSA 3NHWA 1J2JA 2WD9A 2EG5A 2OBMA 3AJEA 2R1VB 5TPWB 1ZA1A 4ER6A 5BWCA 4B8YA 5JAZA 3QOFA 3LRXA 1NUAA 2Y92A 2YFYA 3I64A 1AUVA 2P5UA 4JBXA 4KRGA 5JS6A 3COJA 1MF7A 3EG9B 3LM8A 4A6DA 3ZI7A 2AVNA 4L7VA 1VGQA 1FYEA 2WJ6A 3AR5A 4B6RA 2XMCA 4OXKA 4XEUA 2IS1A 2IU0A 3THWB 2VDMB 1HE1C 2WSSA 4DSNA 3LY9A 1N2CE 1JLMA 1MXFA 1Z8DA 2FCRA 2WU1A 4KE7A 4KXNA 3NAQA 3MGKA 3U7QA 5B1DA 1DLJA 1T6BY 3DFFA 2JZOA 3KUKA 4MP6A 1L5LA 2FPIB 4IHAA 1B6GA 3TCNA 4P58A 4I1SA 2ZVPX 3RWOA 5G4KB 1R4AA 3ZJ4A 2Q1XA 2JPDA 5FFMA 1XZHA 2F1RA 3FSGD 2B78A 1Z35A 2FSVA 3KEFA 1THGA 4QGGA 1NOKA 5C3UA 1H2BA 1UOOA 3IVAA 2O8CB 5DF1A 1JPJA 1Y1QA 1YR9A 2PH3A 3GEEA 2A0XA 5EJ4A 4FMBB 3BD9A 4EY6A 2FPPB 2MMGA 2V03A 4E5UA 3QFRA 1KQFA 4ZIRB 1I3OA 4NFHA 4EI2A 4WLFA 4D80A 2FWMX 3DEJA 4CN8A 5EIOA 3NALA 1NE2A 4DDTA 5F51A 4I2VA 3L6UA 4NC9A 4BQQA 1GTRA 3ZE6A 4RTJA 3FGZA 2PVPA 3TO5A 5MF6A 1N92A 1AV7A 1FYVA 4QNMA 1SD2A 1I0IA 3HXQA 4MUGA 1PFUA 4BXOB 2HCBA 2IY8A 4NCBA 2O48X 4LTDA 4V0MA 3RT9A 2H0QA 2OV1A 3WYFA 2ZSHA 3RBZA 1SXHA 5CB4F 2X5NA 4O2LA 5ITZB 3EIHA 3OQJA 4WCFC 3I34X 3GJ4A 4FB4A 3KCQA 2V9CA 4U63A 5IJAA 5DWQA 5K3FB 5GZ1A 1BRTA 3GJSA 1QMGA 1SCJA 3TIFA 1E6MA 3W04A 2O2XA 1EFHA 4QQRA 3F4BA 3SHTA 1X80A 3CIOA 4RFSA 2DU8A 2MDTA 3N6RA 3NM4A 2J7KA 5TE9A 3GRVA 3RHFA 3A26A 5B1IA 1N1EA 1XD8A 3V8VA 5CX1A 2GEUA 5IARA 2EQ5A 1MT3A 4FFDA 4LRWA 2JBWA 1NF3A 1NVDA 4MRVA 3A4LA 4NEQA 1CQJA 1I5OA 5BMVF 4HUQB 1PNOA 3M5PA 4EWLA 5BV2P 1P5HA 2A2ZA 3HA7A 2BM8A 3NHKA 4IQFA 4OSOA 2BH2A 4FX2A 1P7WA 1R8QA 1TUGA 1GCOA 4GQIA 4KX5A 3W5CA 3T5CA 1T2DA 3WV5A 2HCRA 1I6LA 2BMVA 3EGEA 3OLQA 1JHPA 4DQLA 5JAHA 5LQCA 1JIKA 3PIIA 3WOHA 1NL3A 1UP6A 4EYEA 2ON6A 1CR2A 3ZLVA 1MH1A 2FP4A 4I50B 3HXPA 1E94E 1MNQA 2SICE 3C24A 4I6GA 4B33A 2JCVA 1A5ZA 1XGKA 2QRQA 1UC4B 3KK0A 5J63A 2ZUTA 4B43A 2XB2A 4CG0A 1N2HA 1BMFD 2VNJA 1DPFA 1T2FA 4PAOA 5INTA 3O4IA 1XPUA 2IF0A 3D5EA 3IIMA 1IVNA 2BZ1A 4HWKA 5EMKA 3EWNA 1W0KD 2JFNA 2OY0A 3L46A 2VK2A 2WRZA 4JVLA 4M76B 4MS4A 1XNRB 4KK4A 3ZLJA 5F21A 1M5UA 1DIAA 3A2NA 5E7MA 5HCNA 1EUQA 1D7AA 4BB9A 1N9GA 2PAFA 2QLFA 4QRIA 1O96B 1JKXA 3V4SA 4DGSA 4HDSA 1Z3IX 3FJYA 5K6AC 1P2SA 4EARA 3HUFA 2NT4A 1J07A 2B6NA 4Q21A 4WD3A 5AKGA 3VH2A 1STOA 3THXB 2CE7A 1BDMA 1I3NA 1OMOA 5NULA 2UXCB 5F9FA 2R60A 1K6XA 4ABTA 1EX1A 2FKNA 3KTAB 3FW1A 5T6MA 3NV7A 1V6CA 2RH8A 3H11B 3OOSA 3PF9A 4KRYA 4P22A 2GPSA 2PJDA 2JAHA 3MCTA 4LGYA 5DGTA 5KOJB 4AYWA 3MUOA 1X38A 4JJKA 4OEHA 5LZ5A 1CS4C 2F1IA 1QGYA 3HPQA 2FE1A 4K5QA 4B46A 2C97A 1OBVA 4QD3A 5F7JA 1C80A 2XA1A 5ESDA 3S2YA 1YHZA 3KLOA 1V39A 3I5XA 2DY1A 4FVTA 5AKHA 2FUEA 3LCMA 4I1PA 1KA9H 3GCXA 1J1ZA 2OXIA 2UVQA 2QTBA 4IZ6A 3SLRA 5CU7A 1I1OA 2EZ8A 2FV8A 1NFRA 3EMKA 1B00A 3MSXA 4XUGB 3P4YA 1QZXA 4MJ7A 4QU5A 3I2FA 2ZIGA 4YN3A 1ACMA 2BCEA 4K6HA 1A97A 2C8KA 2IODA 1ODJA 3NC1C 1V7CA 4DJFC 3D2LA 4BV3A 1B6RA 3TTWA 3B3QA 4DDMA 1KVSA 4LY6A 3VTZA 4DR1B 3T0GA 1M1NA 4X1YB 2PQ0A 4M9QA 1KU0A 4NE9A 4MIKA 1G0NA 4YHHB 2WIGA 3K5IA 1EUCA 1UPAA 3B9QA 2VDLB 4AG6A 3WRXC 5TS3A 3G8BA 4TTSA 3O8CA 1CTQA 5GAJA 4Q1VA 4Y0AA 4EHAA 3LQ4A 1BE1A 1DS6A 3C3JA 4PQFA 2HMYB 1FVXA 3F6PA 1E9EA 1J1IA 2BWJA 4HLQB 4RIIA 4BJHB 3GIWA 3HO1A 4IRXA 1IC6A 2YS7A 1E98A 4QOIA 1IVYA 3ETLA 1C3EA 1QPGA 4H17A 1WZ2A 4TTVA 1J9EA 1J1UA 1LSOA 3WKAA 1E7WA 4QYWA 4QG3A 5JEDA 3F1LA 5KX5F 4NECA 2AQHA 1AGPA 1LJUA 1Z5WA 2ZYRA 5EPEA 1W29A 1VG8A 4QGFA 1K98A 4CKXA 1O2DA 3D4IA 3EN0A 1ORIA 2X77A 4MKGA 4QLOA 3V00A 3HLKA 3IA7A 5C4IA 3K71B 3OT4A 4H3VA 1H3EA 3HP1A 3IEMA 4MV7A 3ZX5A 1QGAA 5EE1A 4YLYA 2XXAB 4IO0A 1G2IA 3EC7A 4EYOA 4KXFB 2BSQA 1Z0UA 4BUJA 1NXTA 1N32B 2QRMA 3OKCA 3LWDA 5CGZA 3O2NA 3DD1A 4EBFA 1IZZA 1U8TA 2PBFA 3N74A 1Y4SA 5EMJA 3HKDB 2PLRA 4Y2SA 16PKA 3AILA 2NNLD 1E7QA 1GG8A 4G1MB 4L6IA 4UNQA 5JQGB 1V6SA 4TQ9A 4AZWA 4NOJA 2AOVA 2DUUA 3U4AA 3GFOA 3UWDA 3O5AA 2WILA 3EYAA 4ESVA 1G18A 3M3DA 1C81A 2WIBA 1O3YA 2HIHA 2IDJA 3OJCA 4TKZA 5CCBA 5A5EA 1VYTA 1G8HA 3ONFA 4M36A 9ATCA 1OBCA 5AXDA 2JJMA 3MAGA 2FDCA 1KI6A 2H9YA 2J4CA 2X8WA 5KYGA 1GM5A 5A9RA 1RWQA 3MWJA 1LDGA 2O8VA 4D3ZA 5LUAA 1BCRB 4AZSA 1F12A 3TPFA 2V5UA 1X92A 3SLGA 4RENA 4Q7MB 5HUJA 4DIOA 2D1TA 1YE8A 2ZT5A 1I6KA 2VH2A 4QICA 3EUFA 4NHEA 4BO8A 1FQWA 4JDUA 1ZN7A 1AMNA 3L4SO 4MYUA 4NARA 4JL6A 2NM0A 2YOGA 4L0MA 4R7ZA 3I58A 4ZVTA 1UEXC 4EQZA 4F8JA 3ITNA 5KSYA 2A9OA 2VDRB 3N2EA 3TKLA 4ZDJA 5SZIA 1JG1A 1OFUA 4FW9A 3QKSA 4W5RA 1ZLYA 4FP9A 5SY9A 3FFXA 2VP4A 2Z2JA 4G0ZA 4Z9YA 4Q5IA 3T7AA 3WL5A 4AULA 3DDWA 1TUBB 4X3OA 2EZUA 2GHQA 3MWEA 4KE8A 2A58A 2C3PA 5LQKA 1PWHA 2Q4TA 3QV2A 3JQ8B 3EDQA 1OWNA 5GONB 4TYYA 3WP0A 2HDHA 1T1SA 1ORTA 5EZSA 3C4VA 3FCAA 4KPGA 1NP6A 1NUHA 4MMXB 3M1YA 1CCWA 1YRLA 4K9PA 3S68A 4Z54A 9LDBA 1FFSA 2X5JO 1C9KA 1IMJA 3MCWA 3D2AA 5ALJA 3JD4A 5IKPA 4B47A 4XWKA 4RVNA 4ZCPA 3RFFA 3V1LA 3QBDA 3GOQA 2O19A 3KUUA 4BN5A 3H8WA 4TTQA 4BFXA 1GTMA 1IPHA 2YMPA 2Z1DA 3UQZA 2ATCA 3DTVB 3ZKWA 3ZXYA 1DZ3A 4E5KA 1JALA 5AQ1A 2ZE6A 5FBQB 5LC1A 4BX8A 3W2GA 4GUAA 2FLWA 4LF5B 5K3AA 3ZWNA 1PR1A 1KE2A 4FWIB 1Y3AA 1PFYA 1NY6A 1VGRA 3BF8A 2CUKA 5TGDA 4QVKA 1I7QB 4Z2YA 4JYMA 4KBYA 1D6MA 3H0KA 5GIPE 2YFHA 3T5PA 4B3MB 4OATA 4EA8A 2ZSFA 5IG2A 3GDGA 1P3Y1 4GZMA 1RPTA 2AWOA 3BXEA 4OXQA 4R1LA 1GQOA 3G1UA 1M1UA 3MVEA 4BPRA 3H97A 4DMFA 1T0IA 1VE6A 2JATA 3BTOA 1FRZA 1L5YA 3BQ9A 4GH5A 1J5XA 4PF1A 3AQIA 3GARA 2OCIA 3THOA 5AQEA 1QU3A 3EULA 3HKCA 4PRZA 3HE3A 4ZQHA 5DXJA 3WICA 4B6FA 4DYVA 2WG1A 4MHSA 4JV5B 1OR8A 3V4PB 4HN4B 4B4DA 5AVKA 4OI2A 4D45A 4Z8XA 1CFJA 3F6RA 4V0KA 1UC9A 1DC4A 3O2SB 1H5UA 1OFGA 3EDOA 3SSAA 1DG9A 2DQKA 4MUBA 1R0YA 3CZPA 3EH1A 1NVAA 4F3TA 3U3DA 4FX5A 1NM5A 2C77A 4QBGB 2GZ1A 2WP8J 4AMVA 5JD4A 2UUAB 1NYRA 2MTBA 2NZJA 4LOAA 4RS3A 2P41A 1V8PA 3NEYA 3DE1X 3DKVA 3FJ1A 2VT3A 4XE5A 4HDCA 4RJJA 2SBTA 2WVHA 4YUXA 2WI8A 1HH4A 3PD0A 5CDFA 5JYCA 5FKJA 3R0XA 4C2AA 4D8XA 4EBBA 1YBHA 4QXAA 1VGVA 2AZMA 1PR3A 2RHGB 5AHWA 4CQLA 5KTTA 1XJQA 2AOUB 4XDZA 3OU6A 5I9MA 1KERA 3LAWA 3TXYA 2H4JA 4DIKA 4HNVA 1MBZA 5CG1A 3CVWA 3OPYB 5EKUA 3EZ7A 1PV1A 3DMTC 5K6TA 1QF6A 1T9ZA 4MUIA 1XVTA 3D3WB 5HF8A 4MDHA 3NT5A 4Q6WA 4CF4A 1A4XA 2PYZA 4JI2B 4D1YA 2FGJA 1ULTA 4PQEA 2L19A 1U31A 4G0XA 3DTYA 4U7DA 3BPSA 4ARVA 1NBMA 1XMPA 1RLJA 2HQSA 3UJHA 4LRQA 5KSOA 1SVWA 3TQOA 1AN0A 3DMRA 1XMVA 3EXFA 3OESA 3QH4A 2OPBA 4IUDS 2O0LA 4WK2B 1UP7A 4RTLA 6ABPA 2ZU6A 2VH1A 4D3FA 2WFAA 5IH7A 1CF9A 3IULA 1E58A 2ZPTX 3ECAA 3FGOA 3A31A 3R6LA 3RS9A 3LH5A 2EF0A 3QLVC 2X76A 3NDPA 1RXUA 4ITRC 4EG4A 2VR1A 3ZE0B 1DGQA 4CG2A 3R6GA 1USUA 1FXSA 1JT9A 5A04A 1JECA 2HRRA 4K6OA 3U16A 3OOYA 2A8YA 2N46A 2IGTA 3UGTA 5TPWA 1MV8A 2R1VA 4W7IA 3GJYA 1UBGA 3VNBA 1P75A 4R2IA 3ZLBA 4CUKA 3DMGA 2GVNA 3EG9A 1ZDMA 4X61A 3H83A 1KQ3A 3EIUA 3LGXA 3U62A 5DM70 3EXEB 2XUJA 4AUEA 1BEUB 4IMJB 3PQ8A 2HJHA 3WAGA 1QQBA 4S35A 4R9UC 1XZQA 3KWLA 5ALQA 3UOWA 4K26A 2DT8A 1B73A 1EZ1A 4UDOA 2JHCA 3EAGA 3FJOA 4XFKA 2NXEA 1VRVA 4MWEA 3BWCA 1UK7A 2FPIA 3AP1A 4Q24A 3I92A 4KO4S 4KLZA 1W87A 3BZUA 4KVFA 4OTZA 5AI0A 4O3MA 4MW5A 2G5TA 3ZVKA 4ZALA 1TFUA 1I6WA 2GM5A 3TL3A 5C4MA 3P71T 2RJ3A 5IPFA 2O8CA 4C20A 2Y1OA 1JGTA 4RVOA 3K2IA 3CVVA 4FC6A 2FPPA 2ZQZA 3A14A 5C8DA 3B36A 4Y2UA 1Y4ZA 1EA5A 3NHBA 4ZIRA 3VMMA 1ICEA 2Z6UA 1OAOC 4FE4A 3IQWA 2P75A 4JSRA 2GAFA 4ZCSA 1EWRA 4GPBA 3EOBI 3I53A 3Q0IA 1ZCBA 3ZZ0A 2IT1A 3SYMA 4DLZA 1DOAA 5J4KA 2JIDA 1ZCZA 2V6GA 4UHFA 4BXOA 1HNZB 2OUKA 2XWSA 4ETNA 3AINA 2PL1A 3PPXA 1NN1A 1EGMB 4WK6A 2GJAA 3T7TA 3H1AA 1UT8A 5LDHA 5ITZA 2HZBA 4AKHA 5G53C 2HEIA 3K2EA 1NURA 4C7MA 3GRKA 2HW8A 4EECA 5K3FA 2V1XA 3QWHA 4TS9A 3RSZA 4UJ5A 1IPEA 4UEKA 1H93A 3L7IA 4WKCA 1EFAA 1GSAA 5CXSA 1C3JA 5F12A 2XB9A 3OMXA 1W8IA 4RSRA 3SR3A 3H8JA 4FEAA 2WUEA 1KSHA 1U4SA 3VDNB 5A06A 2GCIA 1Z5PA 1E9CA 4HUQA 4FMPA 1N4DA 1R50A 4F45A 2R79A 4DMKA 3P5BA 4XOIA 4YUZA 1TFRA 2AXNA 3RRXA 3LVRE 3TTSA 1UKEA 3BKWA 3IBFA 4LGCA 4TMWA 5JFTA 5AI5A 3VPXA 3OU2A 5H59A 1E2JA 4R2JA 4DV2B 1V7ZA 4O0LA 5HKAA 5F9MA 4FGZA 4A9AA 1BMDA 4FINA 2CCJA 3NHFA 1KMNA 4I50A 4Y6RA 3UUFA 3TH5A 1RWOA 5LCXA 2CHVA 4DRZA 3IS3A 4MHTA 3PK0A 4NNPA 2BY4A 4HGOA 1B3RA 3E5MA 3AKEA 4I5DA 4GMGA 4WUTA 4OYLA 4DCNA 5FQOA 3S1SA 1ZFNA 2YHSA 4OI0A 1NX6A 1ZGZA 3OSZA 5TB5A 2NADA 4ER0A 4OQZA 3GCZA 2EIHA 1KY3A 2XNDD 1RYEA 4QYSA 4N8EA 3Q98A 5JC1A 2HK8A 4MUEA 2VP9A 1GVNB 1VZ3A 2HDNB 2P62A 3RVBA 4C87A 4JGGA 3UAOA 1O96A 4ZYXA 5HG0A 3ZBTA 1BX3A 1O97C 5EIHA 1OGYA 2ZK7A 2VZEA 2M1ZA 3ESQA 5F78A 4EI8A 2NZUG 4FYHA 3THXA 3OP4A 3Q7EA 2EG9A 3SPXA 1BNCA 1ABBA 1MVOA 1TKAA 1YZGA 2WPNA 4YNBA 4DLNA 4U7HA 1VJ0A 1X3LA 1ULUA 1E4YA 1U4OA 2W90A 2JB9A 3MCVA 1J56A 4L74A 5FA5A 1N2ZA 4BQEA 2ZRAA 5SYAA 3HLTA 2KX7A 5KOJA 1W4AA 4CMBA 5EA2A 2E7ZA 1W49A 4M98A 3ZHSA 2WF5A 2QZ9A 4HWGA 2WE7A 2VHVA 4PTZA 2VAWA 1MJ5A 2MMCA 5CH3A 1WZCA 3VPHA 5JADA 4RTMA 2JZCA 1MRSA 3C5EA 3HBMA 1FW6A 4Z9BA 1BW9B 2P30A 4E09A 2W6ZA 2YJTD 1IIRA 2CVQA 2JJ1D 4O25A 1VPVA 3OCZA 4IG9A 4C2UA 3AT1A 1H0SA 4PZDA 3NIBA 5M7EA 4DA8A 1ZUD1 3EIXA 4LXXA 4ZVLA 1OLSB 1GPLA 5FUVA 1W1UA 3CVOA 1VPTA 3X44A 3NC0C 1RXVA 4ZYLA 3K5WA 3RTCA 1P7YA 3E5NA 3GELA 2HQRA 2ZJ3A 2ZTUA 5HQJA 1MUUA 5REQB 3KB6A 2ZJFA 1GY8A 4X1YA 4B84A 2AUMA 2REQA 2WU4A 2GDJA 4FOPA 2PUDA 3ICEA 4P2BA 2ZJ2A 2YC2C 1UWVA 3ILXA 1I32A 2PU5A 4HNAB 3SI7A 4Z1MD 3F3SA 1YVUA 1T43A 1CFZA 4V3CA 5CYFA 4K1LA 3A1NA 4TTJA 4BNHA 5B30A 2BPOA 1V4BA 4K2HA 2IA5A 3TNFA 4IVNA 1UK8A 2R62A 3O0TA 3T7IA 1XL0A 2XTNA 2O3QA 3BF7A 3M6LA 4OXIA 2BFOA 2X9VA 1IN8A 2F6RA 4PZLA 2NTVA 3U7HB 5IVHA 2H4ZA 4Q3CA 2YCLA 3GLGB 2JF0A 4CTNA 3U7EB 4UBIA 1YQXA 2OHVA 3AG6A 1PFKA 4FR2A 2JHPA 4R6XA 2DF8A 2WYOA 5F35A 1W581 2E6KA 1E9FA 3BGWA 3DB2A 5EZYF 3S99A 4W1PA 5EKXA 5AVTA 3P9SA 1A8UA 1JXQA 4JWKA 4MI6A 5EHNA 1IBCA 3HY3A 3JD0A 3OCYA 4IQ4A 4OHKA 3U3XA 2P11A 2E87A 3VZRA 1J99A 5JU6A 2UUCB 4M1QA 3RH0A 3FYHA 3D5TA 1D9ZA 4FDTA 4BQSA 3ZIAA 2Q0QA 3ESDA 3ZYCA 2XXAA 1F3OA 3BTUA 1XJ0A 3QJGA 1DG1G 2OLEA 2AFVA 5M3BA 4MX8A 1IM5A 4OKIA 2I22A 3FCEA 2FG6C 3G5AA 3HKDA 4RVDA 3H0EA 2DHEA 3GEPA 1JDPA 3V33A 5IJWA 4CMJA 3D8NA 3UBTA 1RAEA 1UWLA 1X1TA 2GF0A 3VKUA 6YASA 1KP9A 4I50F 4LIPD 2XQFA 3ISTA 3OSUA 4FFSA 4RDHA 3IR5A 4LY3A 2OHJA 5E6RA 3QI7A 2HNBA 3GAZA 3NOVA 5ALLA 3HNPA 1C2YA 3O6VA 2E3JA 2Q5FA 3ABRB 5IXYA 1L3IA 4P31A 1BYUA 3W5DA 4WBNF 3ZQJA 4AMGA 5FBHA 2INGX 3UYLA 4FYIA 5FWDA 5J4HA 3PC3A 1XVUA 1ATIA 1QYDA 3M4NA 4GNRA 5BRJA 1GQYA 3QI2A 4ME6A 4NJMB 3OA2A 4EHLA 2RHWA 3G2QA 4UUPA 3RIHA 3TVTA 1BC5A 3GPCA 2JFZA 2IYXA 2I99A 3E3OA 3P0HA 1P4HA 2GI4A 4MWTA 4C0BA 4XIJA 4EFLA 3OT1B 5K0EA 3ZKAA 1LBEA 2HWYA 1ZD1A 1KC1A 1ZNWA 2QRLA 3E9QA 1AHIA 3G6KA 4PYKA 5GOTA 1Z5OA 3ENNA 3PEVA 2O2HA 1OI2A 2CXOA 3PPIA 4QPNA 3ZCUA 2PN1A 2QD2A 2OD9A 3P20A 4PGHA 5JVDA 5K05A 5FFNA 4DE5A 1CUFA 1O95D 4JIGA 3AUYA 2MYPA 3ITKA 5DTEA 4DY6A 4IX9A 1I4WA 2A1TR 2XZDA 3DYBA 5I4KA 3G02A 3B1KA 1HZZA 1OY1A 4B6SA 4BP3A 2IXEA 2W11A 5CVDA 2QM3A 1TO1E 4LNHA 3TRKA 5BSFA 2GXQA 4JUFA 5GONA 4X85A 3GRPA 3RSCA 2VWGA 4BOYA 3K5PA 4WDRA 1ULSA 1MOSA 3L1UA 4NESA 2WB4A 1T29A 2R85A 5I9SA 1RWPA 3H86A 4F3KA 1KJZA 3AIMA 3SKYA 3II6X 2A9PA 1XRSB 5GJVC 1C7QA 5AFSA 4RPGA 4S3MA 2B21A 3AP3A 3W2TA 1RJFA 3L18A 3ML1A 1UDCA 4WZZA 1PV2A 2YV4A 4EJSB 4KXXA 1QAQA 4J16A 4TVSA 3DTVA 3HRIA 4M2LA 3L8ZA 4EHIA 1Z47A 1DBPA 4C6TB 2E0IA 4CMAA 1E32A 2QNBA 4G5FA 1TT5B 4TLLB 3HN2A 4BJ3A 4PC1A 2PWZA 1QUFA 2C95A 1KIFA 3SICE 3BTVA 3RIEA 1VMIA 4GKAA 2DGDA 4RY0A 2CXTA 4XVQA 3WLPA 5BPHA 2JLZA 1V8ZA 2MSEB 4MCAA 4HV4A 3LZ6A 3WXMA 2PD4A 2VAMA 10MHA 1HQKA 2BKAA 3LUAA 4YRLA 1S8NA 1G38A 1IN4A 1L8AA 3GB9A 3F6YA 2YZGA 3CLRD 3CRW1 1ABEA 2HCFA 2QVYX 2DKFA 3WKDA 5ADWA 3R3YA 3MD0A 3CURA 3OZVA 3B2EA 5BO5A 3ZV5A 4B7CA 2V7GA 4HBGA 3WISA 4WLVA 5DW3A 1U9JA 2HTEA 3PRKE 1XFAA 1B26A 2EBUA 2PWYA 2R66A 4AVYA 4BFTA 1W35A 5JJKA 3P0EA 1GGNA 1Y1TA 3SKXA 3TOXA 5F4ZA 1E2FA 1R5JA 4PQRA 4MUFA 1ISRA 1VIDA 4NAVA 1WKVA 3PF8A 4WDQA 5THXA 1PK9A 1W85A 3F2IA 4A8TA 2P6PA 3QFCA 4B40A 5CNJA 3UFXB 4LC0A 4E31A 2QY6A 1JFFB 3VHLB 1P5FA 4FNAA 4FYWA 4U2GA 5I7EA 1Z0JA 2QLLA 2XWBF 3Q5EA 5DHQA 1F17A 1YB2A 3MJFA 4Q7EA 1U65A 2B69A 3AM4A 5FPSA 1DV2A 4ZVUA 2DTDA 1CY2A 1WCYA 2FZWA 4Y9RA 1UCFA 4Q37A 5HEKA 4C22A 2AOUA 3FDJA 5AJWA 4E30A 2QRVB 3UVEA 2E4ZA 3D8SA 3OPYA 4E5SA 1C0LA 1RVV1 1YKGA 3D3WA 4MYHA 3FOCA 3K9HA 1G8JA 2ZRFA 3BXFA 3EA5A 3FPHA 1K2VN 1CX9B 4MGIR 4OHRA 5F5NA 4B9AA 1HDCA 1UMBB 4G3XA 2FI1A 7GPBA 3W7VA 2J5BA 1IBLB 3F9IA 3ZDAA 3QKWA 4JR0A 1ZBDA 2B8NA 4N3AA 1TO6A 4TT3A 4U7PB 4UATA 3BSSA 2IUFA 4RXUA 5JNSA 4AAYA 1T9CA 4NBLA 1AQLA 4JBNA 1SVKA 3S1LA 1THMA 3VI4B 2AL7A 3RC1A 1LPMA 5IMSA 1AH2A 1G8YA 4FYVA 3RHSA 3PP8A 2HHHB 5LA6A 5JVDF 2HY7A 2HA5A 3DAYA 3I4LA 1KFKB 3ZWAA 4OM8A 2BEKA 5J5CA 4DLLA 4DYHA 4IDOA 3KJNA 1NMSA 4BBZA 3OMLA 1XZEA 3ETGA 3KSAC 2TRSB 1Q0LA 4D9GA 3WLAA 1OIVA 2RHLA 4RESA 2YWJA 4Q3OA 4XB2A 3ZW7A 4C88A 1NQAO 5C8YB 1RP1A 1EQUA 1XMJA 5JWOA 4GIBA 4D3YA 2PL3A 5EWLB 4H4DA 4PGGA 2FWJA 1S89A 4FE7A 4EG7A 1PI3A 3BH7A 3L0BA 2GQ0A 1C41A 1HL7A 5ALXA 4B45A 5JYDA 2J46A 1SUSA 4YLEA 5KDDA 4ES6A 2YVKA 2VC2B 4Y6SA 4NDNE 5CNMA 2F9FA 3FWKA 1NONA 4AQYB 3EF0A 4HMOA 1ZITA 2IHUA 4FWTA 1SRQA 3E4DA 2C4TA 1XN4A 1DJQA 3LBHA 1L4HA 1NSTA 3OIWA 2V3CC 4AQDA 1OYOA 2OV3A 3EC2A 4QZVA 3MOIA 3AJAA 3SHFA 1CPYA 3P5SA 2D3TA 5TX7A 3IAFA 4CF6A 2Z2KA 4LV6A 4F9EA 4QGAA 1S8FA 2EGGA 2LIVA 2ZJ0A 2O6HA 2H92A 3VR2A 1SMKA 3JD2A 3ETCA 3RVQA 3IVRA 4TQAA 1GGEA 3LKDA 4FT4A 4AIRA 2FRDA 3GLSA 4C7XA 3ABOB 2BJHA 4YTEA 5KQPA 1EVZA 4I9FA 4JLDA 1PU2A 2PKQO 3SJ7A 2JIOA 4N48A 4NJOA 2CYAA 1FMTA 3RVSA 2XOXA 3U1BA 1N2CB 1VBFA 3OP1A 4J9VA 3DV9A 3L82B 1FS6A 4DV5B 3WK8A 4LY9A 5AD1A 2OAGA 3DEYX 3LCJA 3N2LA 4U7WA 1CR4A 5M04A 4Y9TA 3T5MA 2EJBA 3KV3O 4CHTA 4KPFC 3HDJA 4BGDA 4EPWA 5K2OA 2PH5A 4RCVA 2QLBA 3DZIA 4TWRA 4XJSA 4DOMA 1IXRC 1TM7E 1X7XB 1GA6A 4S2EA 5GJCA 5KVAA 3AESB 4FYMA 2LVBA 1T36B 2AC7A 2RCNA 5KNBD 1J8YF 1MABB 1O77A 2OXFA 5JCPA 3UGJA 3CTPA 1WKBA 4RVUA 3ROQA 2GS9A 1JEEA 2JFXA 3TW4A 3MELA 5HW0A 5LLTA 1KI8A 2IYYA 4HFMA 3L06A 3NHSA 4HLUA 4JBGA 3FMOB 4XA8A 3TLBA 4CXMA 2DYKA 4TV8F 1AK2A 3MFQA 5G3ZA 3SXJA 5FTNA 4B3XA 1IJFA 4KH1A 5ESXA 4HDRA 4OO3A 1UODA 1CZRA 3MMNA 3NTLA 3MQ4A 4KIUA 1KQNA 3N9IA 2FUNB 1P2UA 3P9KA 1IOZA 2YV5A 5LP6C 3OICA 2ILVA 4M89A 4BTVA 1CEQA 3VJRA 3F8WA 3QF4B 2PKXA 2ABWA 2BFAA 4YAUA 4G5SA 4HNUA 3EZGA 5EVJA 5AW3A 3KLNA 3A4NA 1GGKA 1YVRA 3C5CA 3CW2A 1SBNE 1HLFA 5IZCA 3UK2A 2QUZA 3LJKA 1P72A 1WPQA 4EW6A 1COWD 2BP7A 2YWRA 2X13A 3OIVA 4OLJA 1E5DA 1Z15A 5CK4A 1W9MA 4YJ3A 4ZVVA 5CHEA 2X86A 1GLNA 1WR8A 1GT6A 4G8JA 2XGSA 2O3TA 3WO1A 4DC1A 4DLXA 3OLZA 5JAIA 5LA6F 3PFWO 5U4XA 1JBKA 1EUDA 1H8ED 4V0SA 1CV2A 1G55A 4OU5A 2CZCA 2Z9DA 5JMOA 2RHJA 2VDOB 2I71A 2OD2A 1FOEB 3CLSD 3PC4A 4ML3A 4QDOA 1NVTA 2G9QA 3B1XA 3SJUA 4YRAA 2XB4A 5EJGA 1ATZA 1MHPA 3KLBA 4DV0B 3K6KA 2IYOA 3D0KA 2P79A 3IAXA 1RW4A 3NDIA 3JWIA 3ME5A 1MQSA 2JIPA 3QE2A 4LWOA 5B4TA 5LJIA 3STXA 3BJIC 1L5OA 2AA3A 5E6UA 2YHBA 4GG1A 4NZPA 4YQEA 3ILSA 4OLHA 3REOA 8AT1A 1QRSA 5EINA 4AJ1A 4FB5A 4LCEA 4OGGA 4UPEA 1SPXA 4O02B 3R41A 1SUBA 3I1IA 3M9WA 1KXZA 1PYOA 4WY8A 3ZI4A 4CPDA 1Y7LA 4PN3A 1BW9A 1JQBA 1FTSA 2ORVA 1G5RA 1N8TA 5CK5A 5DN9A 5EEGA 1B2RA 2YINC 3ESCA 2J0VA 5D5QA 3WRYA 2HOQA 2X0NA 2Z4RA 3O92A 2XE4A 2QXYA 1V3QE 2HJ9A 1Q6ZA 3M82A 1VKJA 5EXXA 1MJFA 1OLSA 3T7CA 4YR7A 2D7JA 4QJBA 4WHMA 4D6PA 4MVWA 4Y2HA 4PNEA 1H2RS 3U37A 1ZIPA 2Y1FA 3ITEA 5AK6A 4A5SA 4CG1A 1L4MA 1NJ2A 5REQA 1HYEA 3AEZA 1NN5A 3VKFA 4IGKA 4PZ9A 2HJWA 4L15A 3K6SA 1DUIA 4HNAA 5BSEA 3EPJA 1KR5A 1ND5A 4IIJB 3SJZA 1EESA 1N6PA 1RWVA 5AJYA 2RGRA 4X8LA 1PD0A 2QJWA 4OB6A 3NHAA 1RPNA 3LTEA 4N5NA 4J0HA 2Z3VA 1Q77A 2I6XA 1ZN8A 2WUFA 3IT0A 4DVJA 1QRUA 3EK2A 1ZP6A 2ATXA 3KQUA 1W76A 4YROA 1N3YA 3RBXA 2GETA 3CM0A 3IAAA 1PTJA 4JHXA 3OEHA 1U3TA 2CFSA 2Y68A 1NWHA 4H7DA 3GVXA 4I9GA 5FWNA 1UIRA 1WEHA 4RF2A 1V71A 3A36A 4MUAA 3GLGA 4XGRA 1KAGA 1XZKA 4WXMA 3VR6H 3IOCA 3I52A 5CT9A 4IQ0A 3DE2X 3U9TA 1X7YB 2FF5A 1YR6A 1C4XA 4J4HA 3OE1A 3KUDA 2R5NA 2NTJA 1P77A 4ZVMA 1QCDA 4N5DA 1MB3A 1LV7A 4FFLA 2Z5VA 4W9NC 1KDTA 2HRCA 1CT9A 2JFBA 1IULA 2QORA 3I73A 4LAFA 3BFXA 4Z3DA 4RE6A 3P9RA 1TM5E 1R2QA 1CSEE 3FTDA 3MB8A 1YU6A 5CJ2A 3B52X 3JQAB 5BWLA 2JGLA 3SQDA 1OH6A 4GDFA 2BUBA 5CH8A 1A88A 1VL5A 3VR4H 2OQIA 2OGSA 3U1VA 3ND7A 2B35A 4M37A 2UDPA 4P4GA 4R1TA 1U9IA 1P1CA 2E55A 1R0BA 1IB0A 4L8LA 2Y1WA 1RI2A 5JTUA 3CRNA 4A2PA 1THTA 1CQZA 1X9IA 4QDUA 2GHTA 5AT1A 4Z4FA 1FRVA 4MKHA 1IUNA 3P2YA 2EFGA 4IIDA 1RXWA 1JDUA 2CXNA 2FR1A 1Q17A 3EARA 4DRYA 1YUBA 3LT4A 1E3JA 2EKBA 1OFUX 3CRMA 1CP3A 3LDHA 1FUKA 2JLCA 3AONB 5DEOA 3OKPA 4E12A 1O0SA 2I55A 2XGMA 4N9WA 1JYEA 1VCIA 1JMKC 2IEDA 1GR0A 1U3DA 1L4GA 3ORYA 5BWNA 1H05A 1Y7IA 3OT1A 4B3BA 2QDXA 3ZU5A 4M9RA 3PD7A 3SVLA 1DB3A 3LCUA 4ENTA 5FNVB 3UK7A 3IO5A 3TTXA 1SUDA 4KR9A 1T2EA 3A6KA 2H07A 1ISHA 3D0QA 4WFQA 5FADA 4WZ6A 2CNNA 2AK3A 1BZYA 5DMXA 5AM2A 1IBKB 5IVIA 2NZYA 4HKTA 4FU0A 2CUTA 3TL2A 3QXXA 3TSCA 3M6AA 2H4WA 2RGWA 2HLPA 3M1AA 2VYND 2YRWA 2VOJA 3MOGA 1DFIA 4Q9JA 5AXBA 3TSYA 4YCMA 2VRNA 2XWQA 4WFIA 4D0GA 5J40A 3C15C 3JVEA 1NXQA 4OXXA 3BRWA 4YEDA 4GKJB 4TS1A 1I4OA 1ZBQA 5B58T 1DAPA 1VE7A 4OV6B 5AUNB 3WBKA 3T12A 1IJKA 4A23A 1L5VA 2XZTA 1NPTO 4IUYA 1SUWA 5EXPA 2CLDX 5F73A 1DKLA 1CJCA 1R8XA 3PYMA 5TSDA 4X7BA 1P6UA 4MZDA 3P9YA 5JNVA 4KFCA 4HH3C 3U7JA 2VDWB 2C2BA 1LZLA 4LJ5A 2CL6X 3L40A 2I62A 1I14A 3BBPA 2ORED 3JQGB 3EA0A 4QECA 4R8MA 5ALHA 3T5DA 3TQIA 3L8GA 4MDYA 1LDNA 1DX6A 4FXPA 4S12A 4U2EA 2RBKA 4C6TA 5FX2A 1PVDA 5DHPA 2H8GA 4RCZA 1TT5A 3K92A 5A5FA 3IUBA 3KKNA 4DIMA 2ZWPA 2ZBUA 4KYTA 2E18A 3JSXA 4YMLA 3BEDA 1Y6ZA 4MVJF 1N8SA 4D41A 2JZNA 3DMDA 3T52A 4FONA 4A26A 2WWXA 2KMLA 3IUYA 3HG7A 3O1JC 1P0QA 2GN6A 4P1ZA 3SG0A 3L7BA 3ZBPA 1WIWA 5DASA 4IXDA 5D85A 1POXA 1QF7A 2MYTA 3ZS9A 1JXAA 2GJKA 4ENUA 5JARA 1QNFA 1WCIB 3GWZA 5AJUA 4F12A 1E3WB 3A9UA 2BHRA 3KTDA 1Y37A 3OCUA 4M9CA 4V38A 4XOUA 4YREA 5I4CA 5ALSA 3EXAA 4ADSG 1EEHA 3TJRA 1XTZA 3QIVA 4MK4A 2O5EA 1Z7WA 1PX0A 4YJFB 5EIWA 3KB8A 1MTZA 4KN5A 4AM8A 5J43A 4KJZA 4HEA6 5DBHX 2WA1A 3X1WA 3K4PA 4Q4AB 2GARA 1J9GA 4YPFA 3AI3A 4MSUA 4QUGA 1VIYA 3O2JA 3AP2A 3Q0TA 1B0AA 3ZHBA 6LDHA 5H3HA 4W9RA 2OORC 1E96A 1M1XB 3KLMX 1GITA 3FG9A 3L8EA 5FBRB 4HWPA 1FU8A 4BMPB 1HZJA 5AK0A 3OG9A 1NA5A 1QGUB 3K1JA 2HQOA 1P6QA 1CP2A 3UFXA 3R7DA 2XDAA 3V8NA 3NG1A 1DQPA 3KAKA 2V7PA 3OY2A 1GL3A 1JFFA 2EJVA 3V2UA 3NC4A 5A4IS 4M55A 3FIJA 1VPWA 4A0FA 3MLBA 1S01A 1U7TA 1Y5RA 3OEWA 4YT4A 3RUDA 3TB6A 3BE4A 4YMTA 3CLKA 5BV1A 3C6MA 5KKNB 2CDCA 1T9DA 2DP4E 2PMBA 2Z08A 1E9AA 1GNVA 4NVRA 5T4BA 1WETA 1GDHA 2GLXA 1SBHA 1E66A 2AMLA 2BGUA 1MB9A 3C3KA 4A0HA 1JFSA 1B74A 1YBMA 2QX7A 3EASA 1EVEA 5TIIA 1U2GC 4U5QA 3NPMA 3M4JA 1HFJA 2H7XA 1LGYA 2R7NA 3CLUC 3DAOA 1TX4B 3L04A 1YC2A 4XYMA 4YP7A 3I5YA 1UMBA 2GN9A 3ZHYA 3PQ6A 3CTMA 4ZXPA 3HEBA 3QLTA 1D2AA 1XZLA 5H4GA 3AJ9A 1L3CA 4Z53A 1NUSA 4OQLA 4EOGA 3P52A 3WE7A 4OB8A 4OU4A 1M2JA 4L6CA 3TR5A 3JCZA 5H9VA 5CFOA 4S05A 4NZYA 2OM2A 4XPIB 2NO6A 4J7AA 4NV1A 2Q0XA 3WYCA 5CVCA 5K8UA 1CZOA 2HU7A 1ZA2A 1U0TA 4XQ0A 1L4NA 1YI8A 3RYHB 1BQ3A 1H3FA 3OBIA 5K3SA 3PJEA 3R3VA 4HGZA 4KO1S 2ZJOA 3QW4B 5DEIA 1CY6A 1LDBA 3AHJA 4D96A 1O6FA 1M67A 2B92A 3MN1A 3T7RA 3QRWA 1T10A 1HYBA 2R96A 4DIDA 3R2JA 2Y27A 4NCNA 3VDQA 1MC1A 4AQ7A 2CVFA 3L02A 5BN3B 3BT7A 2VJLA 4X7MA 4HDQB 3MPOA 4AD8A 4YRGA 1AKYA 1W2GA 4BBJA 2R6FA 3F3YA 1SXJE 1PLLA 2O57A 1F8YA 4OGFA 3JYNA 4RUKA 3RK4A 1YB5A 3TQQA 3FSJX 2VNSA 2DQ4A 3I2YX 3IBYA 5FR2A 4WCFB 4JQYA 4CKWA 1PKXA 4Q9KA 3UK6A 5J3JA 3TECE 2JBHA 1G0OA 1GKYA 3D1VA 2XODA 3R3WA 3RCBA 2D1FA 4US0R 1PIWA 4IGEA 4IIEA 3B6ZA 3QX8A 4KSBA 2ACEA 2CCKA 3AF1A 3X1KA 1UC8A 3KYCB 1SCNE 3P9XA 5B3JC 4MGZR 4W5QA 3PTLA 5I8ZA 2BEWB 3RVJA 1JW9B 2CVOA 1ZGHA 2FLKA 4LYJA 3AFGA 4JUIA 3T5GA 2JLSA 4J2HA 3RS4A 3H75A 4KXWA 3U2QA 4DCOA 2VPZA 5I3ZA 4CR6A 1MOQA 1NKSA 3EYWA 2CSXA 4C29A 2B5VA 2HMSA 3RRZA 1NW4A 4LCBA 4IHJB 3HUEA 1LUAA 5FBZA 1MX1A 3HV0A 5B36A 3R3UA 5TRTA 5GV7A 1SWVA 3B1FA 2JJ2A 3FKJA 2PLWA 2J0SA 1HF3A 2AD1A 2AV6A 3GD7A 5B5SA 1BN7A 1N2CA 1PFQA 5A0TA 1U7HA 4JC5A 4OXNA 4LDJA 2EYUA 3HBLA 4FGKA 4N6NA 3W7BA 1JQEA 5CAEA 1ZSNA 2IELA 3B1ZA 4RF5A 5B7NA 5FUQA 2QTHA 4ONEA 1KWGA 4JLKA 1C9EA 5K3DA 2I2DA 3R7NA 3N7TA 1UKCA 3B85A 3QYJA 5FBWB 2WSBA 4QUBA 3BZBA 3IQIX 2AZDA 3QNWA 2WJAA 4QJ4A 3S3TA 2QPAA 4DBZA 2B4YA 5FTMA 4CCWA 1X7XA 3L4BC 2DJ5A 4QDTA 4X84A 2WJHA 2ZI3A 2G8NA 4EGJA 2IJGX 4UM7A 1DXQA 3AESA 1BWQA 3F47A 3P9NA 1ESDA 1T36A 2JJQA 4OUDB 2QP9X 2JI4A 1MABA 2FTKE 1AF4A 4HNTA 2EWMA 1LV8A 1V11B 4YAIA 1QJCA 2Q7XA 2VBGA 5H80A 3QU9A 1U1DA 4R8VA 2Z5FA 1T2UA 3I2IA 3K6JA 2HK6A 3G79A 3VM6A 1IY9A 2OCPA 3Q3IA 1E18A 1AZLA 1DTWB 2AG5A 1ZXLA 4RPIA 2F43B 2FEOA 1IK4A 1SVSA 3FGNA 3VI3B 4PU0A 3KXKA 3TZBA 5JY6A 4I1YA 1F8FA 2XA2A 1Z7GA 1WSAA 2OLJA 1F4PA 1VJTA 2XYGA 4FN4A 5BMVB 2AZ4A 4TWAA 3QF4A 4RORA 3U09A 1JZSA 4ZCLA 2XUHA 1Y5NA 5K3CA 3BIFA 1JMVA 2PTGA 1JEAA 1SD5A 4TKLA 4UMDA 2YVAA 1UXKA 1BOOA 1IDOA 1SBCA 1KZ4A 1FXWA 2RJNA 3EWIA 3GJRA 4JN6B 3LE8A 2C5HA 5KQGA 2JH3A 3R6WA 4WECA 2DG2A 4BVHA 4OHZA 4EY3A 1LX7A 1ZIYA 2L42A 3Q8XB 2PUCA 1Z5ZA 1UBTS 4D8YA 4G41A 5JSUA 4GI5A 4RTRA 1Y8RB 2O2EA 1F38A 1WS6A 5L9AA 1YFJA 4CEJB 4C5CA 4CF3A 4EZEA 3DOJA 3O3OB 2WNHA 3SOPA 3TNYA 4EFMA 3NTVA 5D6NA 1ODLA 2V8OA 5I6DA 2H2DA 3EPKA 2IX3A 4R8LA 4XIGS 4LDRA 4MKRA 5FL7D 4YC7A 4MLCA 4L1KA 1G8MA 1LRLA 3GROA 4XUCA 2XMRA 4ND2A 1Z5GA 1CJMA 3WLOA 2QA5A 1ZH0A 1CWUA 1WMBA 1IUKA 1AQ6A 1HFWA 4JKYA 5JJLA 3ANMA 3T95A 4RAQA 1LH0A 3HB0A 2Y67A 3RARA 5F2NA 1K8YB 4BRSA 4J0QA 3J7TA 2ZYWX 2NAPA 3RSHA 3EG5A 1H85A 2QE6A 5SICE 3VU3A 2Z8XA 4KLNA 5J23A 1WQ4A 2Q0SA 2O0HA 1KZYC 1RHUA 2H08A 4TTTS 4EEXA 3A05A 4IP0A 1ULZA 5KTYA 2G0NA 1QTRA 4F8YA 4HCJA 3KJIA 3GRZA 1GN8A 1YZHA 4ROTA 3GLHE 1R6BX 3MWFA 2A6PA 5JZOA 1MTOA 3BAFA 3TTUA 1II0A 1TECE 1HTBA 2ODNA 1VJCA 3BQNB 4KIGA 3ADBA 1V8DA 3V7YA 1LF0A 1L7RA 3UJDA 1SIUA 1GGHA 2ES4A 3BBLA 4NMWA 4TLMB 3KT6A 3PUHA 3EZ9A 5ADHA 4IIJA 2NVWA 4C4YA 5B4VA 7AT1A 2DVMA 4DPMA 4IVRA 5AOAA 4I4NA 4DJTA 2XRZA 1MC8A 4AB1A 1FIUA 1I3LA 2Q9UA 2X5XA 5I9TA 1YK0A 1CVIA 3OTWA 2JHFA 1C9MA 4IEEA 4JI1B 4LBWA 1YT5A 1YC5A 2IEYA 5JXIA 3OOHA 3LQKA 1H5QA 3KXLA 1QIDA 5EPOA 1B0UA 1J0XO 1DEKA 4F5EA 2P27A 2Y6VA 2GZ3A 3VKWA 3R7SA 2TMDA 3OEEA 4RF3A 1ML3A 2PUEA 3GD5A 2ZR0A 4UU1A 4X95A 3TTYA 1ACJA 1M2OB 2R48A 5T67A 1VDMA 4CIBA 1DBQA 2JFFA 1ZD4A 1Z5VA 1X7YA 4HB3A 3AKCA 4PX5A 3HSSA 4TRNA 2LCQA 2Q62A 3IRUA 5TJHA 2ZB4A 1B8VA 3K6RA 3VZDA 3DHWC 2QMUA 3KU4A 4AMZA 3K1ZA 2VXBA 3C8DA 3GC6A 5ADVA 1ZMXA 5E8RA 1JZTA 5DTRA 5I7WA 3RAEC 4MA5A 5AVJA 1ADYA 5TC4A 5K8JB 1AB5A 8LDHA 1K5GA 1YRBA 4I5IA 4OA5A 2DR3A 3SX0A 5AW2A 5ABPA 3UMMA 4ZO9A 1QM5A 3JQAA 4BZWA 1QV7A 1G60A 3NDJA 2HRBA 5E4YA 1KH1A 1ZJ6A 3DKRA 2XGOA 3RUIA 1H5NA 4PRLA 4LJ9A 3W3AA 2PO5A 4Y2QA 1CZLA 2FFBA 4D4LA 3TR6A 2G5PA 3NWJA 1T5BA 3ZR4B 4RPCA 4U2CA 1U0JA 2Q6VA 3NDBB 3SIXA 3KR1A 5TARA 4HGQA 1FXWF 1Z4MA 3PSAA 2XQJA 1F6DA 2YV2A 3KEMA 2QJFA 3N87A 4BEJA 5A02A 3V1KA 1IY2A 1O94A 3AL3A 3RK1A 3TINA 1ENOA 4IOLA 4RVCA 4F6RB 5JNUA 1FL9A 1XCBA 1GQFA 2GB4A 3PFGA 3AHDA 3ICWA 3G17A 1JN0A 2XKAA 2PZLA 2ZBGA 1H4SA 4HDNB 4CLHA 3KKPA 1RQNA 4R1PA 7ABPA 4BNYA 4C1BA 1YH3A 1Z2CA 4Q66C 5H3LA 5GADl 2F1OA 3UJAA 4R98A 1Y3FE 4GLJA 3EW9A 2FZ4A 5FNVA 4DVGA 3KSRA 4JXJA 2HDOA 2DHQA 5F98A 1IZ7A 4P7GA 2GRJA 2OR3A 3DOOA 3GY0A 3HDYA 4QODA 1KYWA 1U11A 5JYBA 4OQNA 2G67A 3NAZA 4NAUA 4OVKA 4D82A 3VFDA 4PLWA 4BRWA 4N7JA 1YZLA 1OXKB 1NW9B 3ERCA 3ASUA 2AFIE 2AI2A 1O4VA 1FP7A 2XYHA 2NSJA 3SAJA 2ZUEA 2IBMA 3RC8A 1NF2A 2RG7A 3E2IA 1TTTA 1FMFA 2BTOA 1MENA 2QR2A 1D1TA 1KO1A 3B20A 5L53A 1AKUA 3WGLA 1NFQA 3ZYZA 4CNBA 2O8EB 1UJBA 3F49S 1U1IA 4EW1A 2ECKA 1RADA 2F8TA 3AU8A 2J3MA 2QQFA 1GNPA 4UVIA 4JQZA 1F2VA 2PVSA 2VDWA 1ECPA 4IWNA 1SHTX 1CULC 3JQGA 3EXG1 3EGVA 1JHUA 2X19A 3EZLA 4INAA 2GJSA 1QP4A 2C92A 2RGBA 1PJRA 2OXTA 1NIPA 2O1WA 4I9HA 2D4HA 1XDUA 1OBFO 3UCFA 4I08A 4M49A 1C9YA 3H99A 4LTMA 4IIJF 4YHBA 2BR5A 4GI1A 2QT0A 2C5FA 5JI2E 4PG7A 1CW2B 4I81A 2VUTA 1NVFA 4FMCB 3UWSA 4CKBB 5JEEA 2NQTA 1LTHR 3CKKA 5IXJA 5JI3E 1KZGB 1TCBA 3AVTA 3OPXA 5HILA 1GV1A 5DN6A 2P2ZA 5DTMA 4F3NA 3PDWA 1JL3A 1RHKA 1IVSA 3QBJA 4KRXA 3LO5A 2E1RA 1Y8ZA 3HVIA 1I2CA 2JFPA 1DIHA 2G9RA 4EDFA 1ZK4A 3MJSA 3PCRB 1KYIA 1WCIA 4IS3A 1GKIA 1ULBA 4L4YA 4YRTA 1E3WA 1W4LA 3EMDA 4PIPA 4KQ6A 4PVCA 4DIFA 5IUNC 4AN0A 3V8EA 5KQLA 2IYPA 4MICA 3FNGA 3OEYA 4QL3A 4YJFA 3TDNA 3FVRA 3IRVA 2H2HA 2OCAA 4P33A 2GESA 1SK9A 1D6SA 2QRUA 4E2XA 5KOHB 1PUXA 1BTOA 4Q4AA 1KP3A 2GN0A 1NW3A 1I8TA 4IQ8A 5I7VA 4FHCA 1X87A 2J0UB 4DM7A 1ZVJA 3N2NA 3UGQA 3E2MA 2GBGA 4ZVPA 3WGKA 2YXEA 3ZGLA 4EMBA 3ORFA 4U0JA 1OGJA 1QGUA 2W6IA 1A4UA 3IVMA 2VJAA 3DL4A 4IFEA 4L95C 4QA9A 5FXMA 1JNYA 2KBFA 3NBZC 1SZCA 1NNUA 3E9CA 1LK7A 3OZUA 4J9UE 4UZEA 3CG0A 4NI5A 4EYQA 1VHTA 1KQGA 1ZG3A 1PJ8A 1RMTA 1MZVA 1T1JA 2X9QA 3Q1LA 3C48A 5TMBA 1BMQA 1XZIA 3HCEA 4B4VA 1PWYE 4NU6A 1VSVA 3VXKA 2QG9A 3IH5A 2QLJA 4CBVA 3ESZA 5EJ5A 3AH8A 1UBUS 5EKDA 3UH0A 1FDSA 1IG3A 3K8ZA 2VSFA 1YI1A 4BU0A 2ZI6A 5AXAA 2Q4BA 3T54A 1NKVA 3MUEA 4B0PA 1QBGA 3HDQA 2FWIA 4UEOA 1QFJA 2WSMA 4HK4A 3BFKA 2NV2B 3SC6A 5IT5A 4C05A 1P9RA 2LCIA 3DFMA 3PNVA 4WZAE 2A7XA 4LV5B 1GGVA 1Q1AA 1Q1BA 2Q5CA 1KMMA 2RHTA 2WT4A 3CNBA 1IH8A 3ROTA 4R9VA 4CE6A 3KEQA 1ACLA 4O59O 2ZYGA 2WQ7A 1KYYA 2UUOA 2C58A 2I1VB 4LJAA 4XPIA 5FNVF 1AY0A 2DMRA 2R7LA 4JR1A 2JAOA 5ILGA 4B2PA 2YDXA 1R6DA 1UJMA 2BKLA 1CXZA 4R7TA 5A4DA 3DHNA 3RYHA 2UYHA 1QQAA 4P7JA 1O58A 4C4RA 1V8OA 3NNSA 2HF8A 3EHEA 4LN1A 2OCGA 4W5WA 4I4CA 2NZ2A 3AFOA 1IUOA 2P9QA 3AEQA 3ZWPA 2DR2A 2GBPA 3PHBE 4EJ6A 1BRMA 2OGWA 2D0DA 2V74B 3IMCA 4LOLA 3BOSA 1NOJA 3WIVA 4II3A 4BYGA 2FSSA 5BN3A 3NAGA 4DCJA 1QTNA 4AKEA 3F3KA 4NOLA 2R6JA 1Y6JA 2D0PB 1J97A 2A4KA 4JENA 4BNGA 1HT2E 2W0MA 2KYRA 4WCFA 3DAGA 4BZXA 5TNXA 3I2GA 1C29B 2BCGY 2SECE 3UKDA 4QO7A 4IZHA 5D1HA 4V0LA 4E13A 5SYMA 2IQ5A 3BCHA 4MW7A 4YALA 1KF0A 1FZQA 4QWWA 3ELYA 3PNLA 1A98A 4UMEA 3QE4A 5ITWA 4INZA 1Y1PA 3HEAA 3KYCA 1YIAA 1CZHA 4MWZA 1NI3A 3HHPA 5BYBA 2R44A 2BEWA 2Y0EA 3CEJA 1Z06A 2YYYA 4G8BA 2W37A 4X94A 1E9VA 4MUJA 1YMUA 2OYRA 3R9IA 2R1TB 1GUAA 4JI3B 4HADA 3C5VA 3PR1A 1JQKA 2JLYA 2JCYA 1QTIA 5LZ2A 1R10A 2W71A 1SJ9A 1VI2A 2ZSEA 4IHJA 5HR5A 1IBRA 1XDBA 4R9RA 5CLIA 1SPBS 1UWCA 3PUYA 5JDCC 4XDHA 1G20B 2HUNA 3HDHA 1JA0A 4J91A 4QJ3A 3GYBA 3L1KA 3SQXA 2F62A 3SFTA 5ICGA 1TJ3A 2JS7A 4NQRA 2GASA 4J4TA 3C8ZA 4FZVA 2UZAA 3HJAA 2VF2A 4KX3A 4XJTA 1DX9A 4QUKA 5DGCA 6REQB 1ZI8A 4E3ZA 1N5MA 2E5LB 2FMKA 1T8PA 1FY2A 1XDSA 4U5XA 5IK2A 1E1YA 3QXJA 3EFBA 2DCUA 1OQAA 3TW6A 5I7HA 3TOVA 1T8YA 1OX5A 1HQDA 4UOZA 3HFJA 1Y8QB 4OUDA 4MR7B 4OP3A 3G5TA 2I29A 2OV8A 5K6AA 1DCFA 3IDOA 4PLCA 5CLGA 5H4HA 3IMEA 1V11A 4REOA 4YXWA 4RE5A 2GBCA 5AW0A 2VBIA 2PTHA 4JYBA 2OEPA 2C88A 2PRIA 3SEZA 1O1YA 1DX4A 4L0CA 4PANA 4PX2A 3QEOA 3ZW9A 1DTWA 2P6RA 3DZCA 1Q92A 2F43A 1A8HA 4ZT2A 4H4CA 5K0TA 1FYDA 3LWNA 4JU9A 3I28A 5DBFA 4RZXA 2YQ5A 4IAOA 3WKCA 3T1TA 3G8CA 2WLSA 3JWGA 2J67A 1P18A 2WV7A 3A6DA 1NW6A 3PQCA 2YNMA 2HMAA 1K6MA 1XELA 3PENA 3QPCA 5BXYA 3INYA 5KYNA 2VL7A 3IQGX 1DBRA 1OV4A 2E4XA 3NV9A 2CBZA 4MPTA 4WKOA 4AWXA 3Q88A 2OP1A 4LE2A 4MIEA 4MRNA 3RTAA 1V3TA 4C07A 4EI9A 3QUSA 4P7FA 5D86A 1TF5A 1B15A 3RUEA 2P69A 4N5IX 1O9BA 2YRXA 3VKVA 1SUAA 4K6KA 3HJHA 3ZWCA 3UAGA 1BXZA 3AUFA 3KCNA 4B9EA 2RGCA 2RE8A 4JELA 3HBAA 3ADCA 3LG2A 4NYIQ 5DE3A 2PL9A 1Y8RA 5L3QB 5TQ2B 3MCAA 1AGNA 3GEMA 3FVTA 2VAPA 3QMPA 4IIFA 1BDIA 5C37A 1CG6A 4OKSA 4C01A 3PT5A 1KE1A 3WGHA 4AJNA 2C61A 3IBCA 2JGNA 3CJQA 4RNDB 4WESB 2Y2UA 3TJMA 1UFKA 4AJHA 4PX9A 4EELA 3WRXA 5DZSA 4KDEA 1GPBA 1ZRSA 2HMWA 2VQFB 1P4JA 2V55B 1QB7A 1QRTA 1T34A 1C0IA 1QFYA 3HHEA 1Z62A 4HD8A 1JLLB 4DMLA 4AKIA 3PNSA 2ZYDA 3RTBA 5F33A 2XE6A 3A7EA 3V1UA 1XEFA 1CKEA 1KH2A 2VQSA 2XHEA 2PPVA 1VL0A 3E1GA 2CJFA 5T6BA 4NEGA 2I2CA 4IXMA 1BFDA 5IAJA 1VXRA 3A3NA 1HDGO 3W1EA 3S2IA 2HWUA 1PGJA 4PEVA 5C3MA 1W0JD 2FDRA 4AI6A 3IPYA 3RQIA 5LKRA 3M6WA 4PG8A 3GXBA 1WNTA 1DQYA 3ND6A 2HFJA 4Z1OA 2YY7A 3C87A 3D7LA 4M0MA 2YFKA 2PGNA 3HJUA 4B83A 2WYIA 4EVIA 1NXPA 1KJWA 1OJ7A 1ZD3A 4ZRMA 4L2IB 6Q21A 1ADCA 2VNAA 3SHOA 1CDDA 3VKHA 2F17A 2OOKA 1REQB 3QWIA 3R0QA 1XNGA 1RWKA 3C6KA 3CH7A 4PG4A 4IJWA 4P93A 5KSZA 1ZHFA 1UMDA 4NMHA 4YPVA 3UJBA 1OBOA 4X7PA 1KIMA 2ZBFA 3IV6A 1S0UA 3FTPA 4IZOA 3VZBA 1E1DA 1D0IA 3QVJA 3E8MA 1ZMTA 2P78A 1XDGA 2H51A 3AHGA 5COQA 3Q6NA 5E7JA 3I61A 2Y1GA 3F96A 4HQFA 3PFNA 3V2HA 1MH9A 3K94A 4QOHA 5IKEA 1GQRA 2YUTA 3AZOA 3ENZA 4FZJA 3SM3A 1DMSA 3WDLA 1QX4A 4BMXA 1PKEA 3PEYA 1TPYA 1Q7BA 3U0BA 1UM9B 3CG4A 2FQ1A 3VV3A 4HDMB 4ZAWA 1BFUA 3CSUA 1GOTA 1RABA 5FO1A 5DIFA 4J7XA 3FDZB 3JATB 1UMKA 2P3QA 3C6XA 2WVAA 3MAJA 4L4UA 4MLPA 4ND5A 2XZLA 3QEKA 3BGOS 5H81A 2J59A 4H27A 1WY5A 3D4OA 3PYXA 3QIAA 5L3SB 3IALA 2H1OA 4OL0A 3TD2A 5CH5A 1VLQA 1JEQB 2PMDA 1VG0B 3AVQA 4Z2AA 4A0SA 1TKRA 4WNIA 3UB2A 4DDVA 1MR3F 1YONA 1JJ7A 1VE3A 3G0GA 4Q7QA 5U4QA 1VJ1A 3RJ9A 1VCNA 3H65A 1ZN9A 3I6QA 5DXFA 4QM7A 2QM7A 2ZIWB 4MVJM 3GBVA 4OP1A 1F0YA 1XTJA 1ZCAA 2KPOA 4CIYA 3DR5A 4BX2A 3RBVA 4IUCS 4CKZA 3RNLA 1L7DA 5LJLA 5AWFC 3MA0A 2IOFK 5DTJA 3B8HA 4DNQA 2C8LA 4OOEA 4ETWA 3IVXA 4IMRA 2EC5A 4QDJA 3UWMA 1RDFA 3DDNA 1TYAE 4CEHB 3E58A 1PGNA 1JG2A 1ZD5A 4EHHA 1ZL2A 1U8UA 1T2AA 2CBXA 2HPZA 2B20A 4F6RA 1XTSA 3F67A 2YHIB 2JDIA 2HV9A 3CWZA 1KP2A 1HFEL 2RCYA 3DXFA 3PQFA 1PT7A 4QQNA 3CUEF 4BP9A 3IEIA 1CJBA 2QSUA 5KWIA 5C7LO 3RVMA 3PWTA 1Q1EA 1QGED 3GRAA 1BHQ1 4IH4A 2WTNA 4L4XA 4UAGA 4WCD