2OPBA

Structure of k57a hpnmt with inhibitor 3-fluoromethyl-7-thiomorpholinosulfonamide-thiq and adohcy
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
257
structure length
257
Chain Sequence
ASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWALRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Phenylethanolamine N-methyltransferase
publication title Enzyme Adaptation to Inhibitor Binding: A Cryptic Binding Site in Phenylethanolamine N-Methyltransferase.
pubmed doi rcsb
source organism Homo sapiens
total genus 90
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.1.1.28: Phenylethanolamine N-methyltransferase.
pdb deposition date 2007-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2opbA00
4BLWA 5HEKA 5KVAA 4CWAA 2YUIA 1RJDA 2OY0A 3R6TA 3NMUF 2IPXA 4RTSA 1NW7A 3UA4A 3GDHA 4IKPA 1WY7A 3PX3A 8MHTA 2AN4A 1I1NA 5CVDA 1ORHA 3E7PA 3G2MA 5EOVA 3UWPA 1NW5A 3DMGA 4A6DA 3E23A 2QRVB 2C7RA 3TR6A 5FA5A 2C7PA 3KR2A 2F8LA 5FUBA 2ZULA 3NTVA 3PX2A 2IBSA 3BWCA 5ICFA 2PJDA 1Z3CA 4X61A 4A6EA 3LCCA 3BWBA 3EGEA 1G6Q1 5DTMA 4RTPA 1VL5A 1KHHA 4L7VA 2PSSA 3THSA 2NP6A 4XCXA 2JJQA 2G1PA 2P3LA 1JTEA 4H0NA 1AQIA 3AJDA 3P8ZA 3UJ6A 3ME5A 3LHDA 5E2AA 1FP1D 2UYCA 1NW6A 3CGGA 5DM4A 3VC2A 3Q7EA 4PCAA 3OFKA 2AOTB 4GEKA 1RJEA 3SR4A 3HEMA 3TM5A 4X1OA 1SVUA 3CCFA 5EZSA 3KQPA 2NNWB 4PYJA 1R8YA 3GGDA 1H1DA 2V7EA 2ZSUA 3DLIA 4RVGA 1UFKA 1ZGAA 4GOOD 4R8RA 5KQSA 5E9WA 5E9JA 4YMGA 1R6AA 5T67A 3CKKA 3K6RA 1AQJA 3ER8A 2UYHA 3HTXA 2VP3A 1ZGJA 3TKYA 4M37A 4UOEA 2FCAA 4YUXA 1FPQA 1RI1A 2YR0A 3I53A 3NVMB 5GP1A 1MHTA 3C6KA 5KS2A 2IP2A 3OE4A 5DX0A 1VQ1A 5HIKA 3LSTA 5DX1A 4PINA 1O9HA 4CXMA 4PYLA 1KPIA 2Z6AA 4NECA 4HG2A 4HGZA 3EPPA 3NDJA 5FWAA 4E2ZA 5DRYA 4YUWA 1VP3A 2LD4A 2PY6A 3FPEA 1P39A 5EG5A 5K05A 1QANA 2E5WA 3KHKA 4R05A 3DULA 5EEHA 3SSOA 3HCBA 2IH5A 3OU2A 3PTAA 3HA5A 4ER6A 1RJFA 1G55A 3GCZA 3LCUA 1L3BA 5LQUA 3KQVA 5BP7A 3AXSA 3KQTA 3V97A 4XUDA 2IBTA 2ZZNA 3FUWA 3EVFA 2NYUA 4R6WA 4CKEA 3T7TA 4PNEA 5LSAA 1NBIA 3BXOA 2PLWA 3ELDA 4RWZA 4KDCA 4F84A 2G72A 1HMYA 3GIWA 4AUKA 5FADA 5EZQA 2FPOA 1KP9A 2AOUB 3A25A 3B7PA 3HVKA 4E70A 3P2IA 3V8VA 5FCDA 4E2YA 5ICCA 2ZBPA 3GRVA 2IDKA 1NW3A 4QQKA 5LQJA 1FP2A 1TW3A 3KQWA 3WSTA 3FTEA 5FTWA 3DP7A 5FQOA 3ELWA 4GF5A 5EPEA 2QRVA 3M6VA 5K03A 2VDUE 4PONA 2O57A 7MHTA 3S68A 2Z6UA 1AV6A 4LWOA 2AN3A 4GQBA 4HH4A 3AXTA 3MGGA 2P1DA 3FUTA 1JR4A 2ADMA 3KQYA 5CUQA 2JHAA 4RTJA 3BGVA 1XJ5A 2XYRA 5EKUA 2ZVJA 1JG2A 5DXJA 4GC9A 2PGXA 3BWYA 3SM3A 4DMGA 4QPNA 2PBFA 3HCAA 1SKMA 3B3JA 5EHIA 3LDGA 1T43A 5FHQA 2OBFA 3KPWA 1G8SA 5CD1A 3T7RA 3LL7A 1WXWA 2CMHA 1VBFA 3KR1A 4QDJA 3HNRA 4QDKA 2BR5A 2N47A 4E33A 1VE3A 3EVGA 2QM3A 1BC5A 4F86A 2AOTA 2NXEA 2CL5A 4F85A 4P7JA 5ICGA 2P7IA 3DXXA 3PS9A 4RX1A 1WXXA 1SUIA 2ZBRA 4IWNA 4OX9Y 1ZKDA 3KQOA 4BY9E 3TKAA 2ESRA 2IIPA 5CM2Z 2DPMA 4RTRA 2HMYB 4ER0A 1D2HA 5HIJA 5FQNA 2ZIGA 3P9NA 2P40A 1M0EA 3CJQA 2AOXA 2ZZKA 3A4TA 5F2NA 5K0CA 3TQSA 1MJFA 3B89A 2XVAA 4GOMD 3BKWA 3GRUA 2Y1XA 5DTRA 3UJ9A 3Q87B 2GS9A 3GWZA 5P8WA 3RIEA 3BUSA 3KPUA 4MIKA 3B3FA 2OKCA 4C03A 1SQFA 3GO4A 1V39A 5LQNA 3EVEA 1PJZA 4OA5A 3UJBA 2BM8A 4RTKA 2GH1A 3BGIA 4PIMA 3VYWA 2DULA 5K0GA 3LBYA 1FBNA 1JG1A 3B3GA 2P8JA 1JQEA 2OYRA 4LWPA 3FTDA 3EGIA 4GC5A 1R8XA 3HCEA 4YV2A 3P9CA 4RVFA 4EVIA 2ORED 2I62A 1JG4A 2PWPA 4Y2HA 3A7EA 4EKIA 3MCZA 2VS1A 2EFJA 4FZVA 3BKXA 3FUXA 1DCTA 3FYCA 5E1OA 1YZHA 2BR4A 1D2GA 2JH8A 3R24A 4OBWA 5CVJA 5FULA 3SSNA 5K8VA 1KPGA 1NE2A 3DH0A 1YUBA 3KPVA 1YB2A 4C06A 2ZFUA 3KPYA 2PT6A 5EMJA 2PXCA 2ZWVA 3NW9A 4EK9A 3IV6A 3KU1A 3RW9A 2WA1A 3EEOA 1EJ0A 2HNKA 1UIRA 1IY9A 2EJUA 2B2CA 2FHPA 3EMDA 4R8SA 3MCTA 3EVZA 5E9QA 1B42A 4CTJA 3JWIA 4KW7A 4OQDA 3GXOA 5CCXA 3DR5A 1P1CA 5DM2A 3SMQA 4XUCA 3NWBA 2B78A 4HSGA 4FS8A 3TOSA 3G5LA 3FTFA 3ORHA 3MQ2A 3B5IA 1TW2A 3FPGA 3P71T 3SSMA 1IM8A 4DZRA 4RTMA 3TLJA 5E8JA 5IKMA 4RTNA 2KW5A 2EJTA 4PYIA 4RTLA 1L9KA 3GRRA 2ZWAA 4QVGA 4E30A 1NKVA 1PRYA 4BLUA 5K09A 3C3YA 3UJ7A 2AOWA 1NV9A 5E2BA 3THRA 1EIZA 4RTQA 3R3HA 3IEIA 3PFHA 5ERGB 2PXAA 3IHTA 3R0QA 4KRGA 5KYGA 1X1AA 4QTTB 4HTFB 3P9IA 1X1DA 2IFTA 3QV2A 4E32A 3DTNA 4PYMA 3NVKI 3OU6A 3R9XB 3T0IA 5IH3A 4YV1A 3IYLW 2AS0A 2B25A 3LBFA 1XDUA 4ER3A 5HOQA 5K01A 5KQRA 3O31A 3C0KA 3E05A 3MTIA 5BW4A 3KQQA 3PB3A 4YMHA 2PV0A 4AZTA 4AZSA 2Z6QA 3G2QA 3KR0A 5DT2A 1G60A 4P7GA 2Q41A 5HIIA 4CTKA 4C08A 3HA3A 1YFJA 4WVLA 3QOWA 2O06A 4GOLD 3E8SA 4EQZA 3A27A 1NV8A 4K6MA 2IDJA 3PVCA 2NXNA 1VLMA 2HV9A 2ERCA 3KPJA 3M6XA 4KIGA 1F3LA 3HA7A 4ATNA 4YUYA 5GOZA 3PLAE 4BLVA 2AR0A 4E2WA 1N7JA 3MB5A 1OR8A 4PGHA 5CVVA 4FGZA 3G7UA 1VPTA 4RVDA 2AN5A 5JR3A 4IV8A 1JG3A 3UBTA 3EVBA 2ZCJA 3TFWA 1DUSA 1FJXA 3HP7A 2BZGA 3DUWA 2AOVA 2YQZA 1XDSA 4ISCA 1NW8A 5B1SA 4CKBA 2UYOA 4OQEA 5DPMA 2OXTA 3M4XA 2JG3A 4RVHA 1ZQ9A 2XBMA 3FRHA 2P3OA 2YTZA 1KPHA 4U7PB 4RTOA 2OB1A 2UZ4A 3NDIA 1KYWA 4IV0A 2JHCA 4XUEA 5EIFA 5CCBA 5DSXA 3M70A 4RYLA 1M6EX 2VDVE 4JXJA 1X1BA 5LQRA 3FZGA 2ONYA 4G56A 1U2ZA 3AY0A 5C1IA 2ZIEA 2I6GA 3FRIA 3M6UA 4M7RA 5LQCA 4P7FA 1O54A 2K4MA 4KWCA 4R6XA 5D1HA 3VC1A 5LR6A 5M5BA 2I9KA 3HVJA 1QYRA 1G38A 5E1BA 3KQSA 5JUWA 4KDRA 1RJGA 2YXLA 2BH2A 2NP7A 3G8BA 5GINE 3HVHA 3T7SA 3GRYA 3LX6A 4Y30A 5DLYA 3OFJA 5DM0A 3JWHA 1SQGA 2VZ9A 3O7WA 3ELYA 4QQNA 5FWDA 5K0JA 1L3IA 1YF3A 5EMLA 3GJYA 5E8RA 1D2CA 2IH4A 3HM2A 1O9GA 3OU7A 5LQKA 2OPBA 3CC8A 2HR1A 4PYKA 2ZZMA 3G2PA 4P7KA 1YZ3A 4PCLA 1P91A 2O05A 1TPYA 2FK8A 2EG5A 1XDZA 4ER5A 3G2OA 5EC8A 3TPZA 2XVMA 3FYDA 4GBED 4LG1A 2R6ZA 4PYQA 4BP3A 5E1DA 5H02A 4C04A 4DKJA 5DTQA 2GPYA 5E1MA 2IGTA 3CJRA 4YUZA 4DCGA 4E2XA 3DXZA 2P3QA 3ERCA 3BWMA 1YFLA 4CKCA 5DWQA 4HTFA 1QAQA 4O29A 2PVCA 2VDWA 5K0FA 4PIPA 1WZNA 4MTLA 1KR5A 1XCLA 3HCCA 4QTUB 5U4XA 4POOA 4C05A 2C7OA 1QAMA 3VSEA 9MHTA 3QOXA 2O0LA 5K0NA 3I58A 1EJ6A 2ZW9A 3P97A 2NXCA 1R74A 3BZBA 4B17A 3D2LA 2PX8A 3C3PA 3UJDA 3GU3A 2P41A 2AVDA 3FPFA 3TM4A 2CKDA 5GM1A 3O4FA 4HGYA 3SGLA 2P7HA 1IXKA 2ZTHA 4V0RA 1INLA 3C6MA 2B3TA 2CWWA 2GAFA 3ELUA 1N7IA 2UYQA 1HNNA 4Z2YA 3X0DA 2AOUA 3P2EA 3FTCA 5CIYA 2FK7A 3DXYA 5DSTA 2G8NA 4C07A 2H00A 4PGGA 3LCVB 5EIWA 1KYZA 2ZBQA 1RI5A 4GUAA 3UA3A 4WXHA 1N2XA 1R18A 2FYTA 1JQDA 3KKZA 2G71A 2NXJA 3NJRA 2AZTA 3G88A 5FA8A 3REOA 5BW5A 3EVCA 2Y1WA 5T64A 1QZZA 2V74B 2YX1A 2H11A 1RI3A 2CMGA 3I5UA 5T6BA 2C7QA 2ZIFA 2O07A 1JQ3A 3CVOA 4FSDA 1WS6A 3G5TA 3P9KA 5FHRA 4YUVA 1ZHFA 3RODA 2PX2A 1I4WA 1R00A 4HC4A 5EQJB 10MHA 5DRTA 1G8AA 1AF7A 3ER9A 2PX4A 3I64A 3LDUA 3OCJA 2HWKA 1L1EA 3A7DA 2AVNA 2I7CA 2OB2A 1JSZA 1RI4A 4PWYA 3SVZA 5ICEA 4GOND 5GM2A 3P2KA 2ZLBA 2BR3A 3CBGA 3OPNA 5EHGA 3U81A 1RI2A 3EVAA 3LECA 2PKWA 3LGAA 3PT9A 2GB4A 1I9GA 2PXXA 4BP1A 4AZVA 1BKYA 3EVDA 3UJ8A 4DCMA 2B9EA 1SG9A 5LQAA 3JWGA 3AWIA 4E31A 3F4KA 2XYQA 3HCFA 5K0BA 5MHTA 2R3SA 4X63A 3TMAA 2GA9A 4DQ0A 1WG8A 5HFJA 3UJCA 2BM9A 5DM1A 2PWYA 3LKDA 2FRXA 2QYOA 3NWEA 4FSXA 5GIPE 1X1CA 2EX4A 2XYVA 1XVAA 3GNLA 3CJTA 3FUVA 3LDFA 1EAMA 2YVLA 3LKZA 4FT2A 5CVUA 5HILA 3OZSA 2H1RA 2ONZA 3UFBA 4ZTBA 1P1BA 2JH9A 2WK1A 5GIOE 1BHJA 3G89A 4DA4A 5K0LA 3OE5A 4EMSA 4X41A 3MERA 1XXLA 4ER7A 5GWXA 4C4AA 4YV0A 4PYOA 4EKGA 1QAOA 2JHPA 3G8AA 5CVEA 3UZUA 3KR9A 3OZRA 4DM3A 1NT2A 1VIDA 4M38A 4MQ4A 3MAGA 5C0OE 1XTPA 2IH2A 3I9FA 3M6WA 4DF3A 5K0EA 5F2OA 3JWJA 2QY6A 1X19A 3SXJA 1BOOA 5DX8A 2YXEA 5F2KA 3OZTA 4RV9A 1NBHA 3A26A 4FR0A 1EQAA 1Y8CA 4PYNA 4X60A 5EKXA 3DMHA 5EMMA 5G02A 1UWVA 1ORIA 3KQMA 3FPHA 1VP9A 3DLCA 4MWZA 4FP9A 1DL5A 3FPJA 4OBXA 4RSRA 2YXDA 1EG2A 4KIFA 2GLUA 3EGVA 3PFGA 4QPPA 5BXYA 3LPMA 5EVJA 4OA8A 3UJAA 4U7TB 3H2BA 3TRKA 4MHTA 3DOUA 2OO3A 5HIMA 1L3CA 4M36A 1KIAA 2P35A 4AZWA 1XCJA 2PX5A 5EEGA 1Q0TA 5DXAA 3M33A 5EGSA 1JSXA 4QVKA 3L8DA 1JTFA 3MTEA 5HZMA 3GRZA 1ZG3A 5C9ZA 2QE6A 3BGDA 2WA2A 3HVIA 4P58A 1Q0SA 5D1NA 3HCDA 4V0QA 3FUUA 1F38A 3ANXA 3MHTA 2PT9A 1M6YA 2OZVA 3EMBA 4LECA 3DMFA 3SX0A 4FT4A 1SUSA 4HRAA 4AX8A 3ID6C 2G70A 4KVZA 1KXZA 5EMKA 3K0BA 3EEYA 2A14A 2HTEA 3BT7A
chains in the Genus database with same CATH superfamily
2A33A 4P6VF 2ZRKA 5DBIA 3K70D 2CD9A 3O0TA 5KVAA 4NFYA 1Y6FA 3T1VA 1KVTA 3HEBA 1FFSA 3EDQA 4KAXA 4ML3A 5EJGA 1NW7A 2CDAA 2IDMA 3QWAA 1T8TA 5I7FA 4KNYA 3OQOA 2PGIA 2R00C 3OA2A 1CNFA 1TC2A 3F6RA 3U40A 4WZAE 3AT1A 3O3NB 3KR2A 4GXNA 5EKTA 3BFVA 4XJXA 4IIFA 3TCXB 4IFEA 3FWKA 3EH1A 4CKBB 4F3NA 4N5IX 4GOKA 4QATA 1P2SA 1KMCA 2M9MA 4FJ1A 3K9LA 4NZMA 3CB2A 2I4LA 1XTKA 5IP5A 1ABBA 3IT2A 2XB2A 1DLIA 1OFIA 4F6RA 1Z8NA 1M2WA 2JJQA 4B3FX 2JGDB 4A0QA 3AUAA 3WGGA 1YB5A 4DLVA 1YB4A 3DLBA 3KZCA 1AQIA 2J9ZB 4Q9DA 3SR3A 3TZHA 5A3VA 3G0GA 1HTWA 2DBZA 4D9NA 1NW6A 2UYCA 1USGA 1QIMA 2J46A 3IODA 1VHJA 3O21A 4ITUA 4Y0NA 3U1TA 1MIHA 4K03A 3PA8A 1JUDA 3VU1A 3CPHA 3MWLA 4NBSA 4U9HS 1RBMA 4U63A 5JO0A 5JMWA 2G7MC 2R87A 1JFRA 3LKBA 4KK3A 4CI0B 3RBVA 2PBLA 3DLIA 4R8MA 3BMCA 3VR4H 4BAUA 1MU0A 4LQ4A 1WMAA 2VRNA 3BQMB 4KXMA 2H7CA 3KOUA 2CUTA 1DDOA 4BTLA 4OHYA 1PEYA 4LMBA 3NASA 3PZRA 4JI3B 3T5TA 4C0WA 2VI5A 3OWXA 4L72A 4FB4A 2PDAA 2C78A 5BRAA 1GR0A 3HSKA 3WQBA 1N3LA 2P1ZA 1HEUA 1C29B 4L6IA 4C9BA 5BVGA 3ZHUA 2OP1A 3BRQA 5F9FA 4ZOAA 2BUCA 2FZLA 2IXFA 1VP3A 1IBMB 1FX1A 2R4UA 2YWBA 3PFNA 1V1RA 2NU9A 1EGHA 3SQDA 2HA5A 4B7CA 3GUUA 3LT2A 3WBJA 1LF0A 3RFTA 2P77A 4I5FA 4JJAA 4MQFA 5FBVB 2OFXA 1L5HA 5LQUA 1VCMA 3FROA 4FMDF 3I37X 3NGLA 3RKSA 3V00A 3NAQA 1TYEB 4RS4A 5JMTA 3SQWA 4PZCA 4PNEA 1EJ2A 4LOLA 1L5OA 2ATVA 3O26A 4D98A 5K6AA 4PLFA 3ITEA 1ZR2A 2YY5A 5KJFA 3B12A 1M34A 5FADA 4ZMSA 1NDQA 2AOUB 4E70A 3GLIA 4ZO4A 4A5OA 1AGXA 5M29A 1U3UA 1HYGA 5IARA 4PO8A 4S2UA 2YJ6A 3E7XA 3O4VA 2QUIA 4ZO8A 1JFFA 3T5BA 3H2HA 4I9UA 5EPEA 2W6QA 3A9SA 4URYR 1FDWA 1L4MA 4U2GA 5ENDA 5K03A 2OCYC 4ZANA 1GQFA 4DPKA 3EG9B 1MC5A 3LBIA 2XZTA 2Z6UA 3R40A 1GL9B 3CR3C 1R5JA 3MWYW 4U7GA 2HFJA 3SS8A 1OZ0A 3H5NA 1JPNA 2QR2A 4KXUA 4D9IA 4J2HA 1LX7A 3BWYA 3DXFA 1V3UA 6GPBA 5CYFA 2I4RA 4BGUA 5EHIA 5H5JA 3V1LA 4YT4A 4X84A 4DADA 3EUWA 3PNSA 2YWHA 4IF6A 3C8HA 4EQ6B 5B36A 5LZ7A 1KRXA 3E8XA 3STXA 5I8WA 3TZ6A 3F5DA 2FNAA 2YFYA 1J7JA 3QLEA 1VE3A 3UXEA 4E33A 2QUHA 4R4JA 1PN3A 4DQDA 2NU7A 1UP4A 4YCCA 5I51A 4YB8A 4GKJB 3BA6A 4LOAA 1OYYA 4P7JA 2V5UA 2REQB 1EIWA 2BUBA 5SICE 3SHQA 1OLUA 3BILA 1FSZA 1TAGA 2W2KA 4QXQA 1QP7A 4FFWA 4Q6WA 5TQVA 1Y3CE 1YS6A 5DN6A 1OAKA 3SKYA 3UPTA 4Q7MB 5B2ZA 3NR2A 3A4TA 3VHXA 4J16C 5LNK6 1E66A 2I7XA 2GXQA 5G0UA 3AHHA 1V5EA 4MIKA 2HRDA 2JBHA 3IUQA 4AJJA 4E51A 4UBOA 3CRW1 2PTHA 2Z5FA 3RU9A 4QD3A 3RYFA 3V6LA 2VDQB 1GTG1 1VHLA 1WB5A 4F2HA 2HIHA 4YHBA 3H1TA 3KJZA 4E5UA 3ZWCA 4D8YA 2YC2C 4LA4A 4YPFA 4ARVA 3U60B 3ADDA 4NS4A 4LJKA 4ZCRA 3K9HA 3FA2A 5C1BA 3GWGA 4UEQA 2WKPA 4O4HF 2I5PO 2G1AA 3LUKA 4R01A 4DJ5X 3T0GA 4IGFA 1U8AA 1O3YA 2FY8A 3DDHA 4UZSA 4KPGA 1MT3A 3CUTA 2EXXA 4QEZA 1VG9B 2QRQA 3NHKA 5JBNA 3MTGA 2D8AA 1B6SA 3DLAA 3FYCA 3CRZA 1HETA 3R24A 4KN8A 4UU8A 1RBQA 4UDYX 4YJKA 2EJBA 1C0PA 1R27A 3GMTA 2HLNA 3L3BA 3GLTA 5BYJA 3RSSA 2BV3A 2PT6A 3SDSA 3UG7A 2FOLA 4HYQA 1J2YA 1ICEA 3K8OE 3O03A 1RAFA 1DBQA 1QHHA 1XTUA 2G5TA 2QA5A 2ATEA 2BCGY 5EJAA 1VPEA 3KT6A 4EATA 5JQGF 5JJKA 1UIRA 2PR7A 1BRMA 2OECA 3PXUA 1Z6PA 3PHIA 4CTJA 4UNQA 3W1VA 2NP6A 3LMKA 3TNFA 5TRTA 3R23A 1MJGA 3VJRA 2PAFA 4M9CA 3UJNA 2JAPA 1YE8A 2OZEA 1TW2A 2NU6B 3BGWA 3DYVA 2QRPA 4J0IA 2P9BA 3ROEA 4RTMA 1NN0A 4B0OA 3L6CA 3VYVA 1T36B 2LRHA 3ZDFA 5A05A 5U1PA 1Q19A 2RHWA 5AR1A 4D9CA 2J9RA 4GSKA 3PHHA 4UCFA 4ZXFA 2VQ6A 3JVUA 1QK5A 4JMPA 3ENQA 2Z08A 1L7PA 1UFRA 1NRIA 2VOEA 3T38A 1QHIA 1JRLA 1SHUX 1U94A 3EVNA 1TI7A 3U4QA 1JDJA 4UVHA 1OAAA 1OZGA 1YB1A 2PLAA 2WWFA 3CRMA 4IMJB 4JVOA 4QC2A 2WHEA 2E89A 1IDOA 4DBZA 1M8FA 2XF8A 2QPLA 2VF7A 3ZQUA 4G09A 4RZHA 2DLCX 2VH5R 4YLEA 4LJ9A 3LBFA 1F14A 1E77A 1UBLS 3QG5A 1HFWA 1KRHA 4TLMB 2P91A 4ZHSA 1SOVA 1VPVA 3OPMA 5ALHA 5I9MA 4BMVA 1HL3A 2BVNA 4C5BA 1A2QA 1QE3A 1OYWA 3TR5A 4G4SP 3JZIA 3R75A 1YFJA 1ZNYA 1WSBA 1W35A 2BFCA 2AYYA 1VPDA 3A27A 1SHKA 3HYNA 2O9JA 1Z9BA 3TSAA 5I9NA 1VLMA 1YASA 2BGLA 2CL0X 3HXMA 2NSDA 3QMMA 3N8IA 4KIGA 1DMSA 2F90A 3PG5A 4OUDA 1IUNA 1OR8A 4JBXA 4PGHA 5LUAA 1QGUA 2H4JA 2IYNA 4ND1A 3GJZA 1TQ2A 4TRMA 4BNTA 4LW8A 3O8OA 2ZE6A 3MWGA 2RKOA 3GAZA 1EYZA 3CLVA 2OD7A 3LX5A 4F3KA 1UXIA 2V7WA 1HURA 4M1TA 1U7XA 2IZ0A 4TYYA 4RA6A 4C88A 1N1EA 4YX9A 2LP4Y 4DLZA 1B00A 3FHTA 3W06A 4KCGA 2IX3A 4G2TA 4M8KA 3ZI0A 2DE0X 2PVPA 4TTIA 5L9AA 2O19A 3GVHA 3M70A 2UZ0A 1S2GA 4HNQA 3RS5A 1M72A 2B4KA 1JZQA 1J8DA 1FPMA 1J09A 1TQHA 4RMGA 4RPHA 2G28A 5IDWA 1TMKA 2W2PA 1L5KA 5KKAA 2NU8A 4OATA 1ZUD1 1HWYA 2ZIEA 3WR5A 2WE7A 3IIIA 5LQCA 1D9XA 4B3GA 4NH4A 1F06A 1F0KA 1XD2A 1F17A 3KTOA 3Q6NA 1E1NA 1LS6A 4AS1A 3PQDA 3WDKA 4ALLA 2C4TA 5GINE 2QU8A 4PC2A 4YXFA 1FLVA 4C5AA 3ROGA 2VZ9A 4B2PA 3OPYB 1GT91 1XLVA 4BNIA 3SBOA 3DMNA 3UY4A 2FP4B 2HR1A 1RWBA 4P7KA 4WRRA 5KYYB 1TPYA 2O05A 3LX4A 2OILA 4MI9A 5E6UB 1J33A 4LNUB 5F7ZA 4BMXA 3ETLA 4I50B 5DOVA 3S2GA 1P3JA 5HF5A 1Q11A 4P8RA 3CJRA 2BGIA 2DUUA 1ILWA 1PW5A 2B8JA 4HATA 3E84A 2JGLA 2C7BA 2JATA 4Q12A 5ELMA 3HYRA 1RVV1 3OJXA 4GNRA 4PPFA 1L1RA 1D4AA 3F5QA 2I4OA 2JLXA 4CZ2A 3JVVA 3S3TA 4XCVA 1II8A 2NX2A 4P22A 1J97A 3U9TA 1J7KA 4OHMA 4R8VA 2CNKA 4U6SA 4UHHA 3MWEA 4PLVA 2NXCA 1VGVA 1Z12A 3IXLA 2CC2A 3AJRA 4J3FA 2YIVX 3FZYA 2DTEA 4B31A 4DIKA 4DUYB 1FMTA 5A3JA 4FYVA 4YO8A 2YWFA 4NX2A 1TYZA 5JATA 2LCFA 4DE5A 5JYDA 3LA6A 3MYYA 4OOEA 1U3WA 3DXYA 4WCFA 1C7JA 4GOXA 4OJNA 1D4ZA 2IPAB 1P60A 2XDQA 1X1EA 5CXXA 2GEDA 4E22A 4BBAA 1A88A 3K1ZA 4YRNA 3QNWA 1HX7A 4YQEA 4K81B 3BOSA 3P0EA 3ZJUA 4PRKA 2ID7A 3IDOA 3MLEA 4WPGA 3PQCA 4FWTA 5BPHA 2IT1A 1ZHFA 3MCWA 1IIRA 2YZ7A 4LZZA 3BMNB 3TX2A 1VKHA 3SZUA 1IEVA 1NVTA 4R9NA 1OY1A 2H92A 1AO0A 3NV9A 1U4NA 3R5XA 4D0RA 1G4HA 3QEBZ 1X42A 2JFNA 3EMVA 3NONA 4YJ3B 4M1MA 5FWXA 3UWDA 4L1KA 1H5UA 1MIOB 1ULAA 1FCJA 3AO0B 4D9KA 1S3FA 5C53B 3U81A 2JAOA 3KL4A 2I2CA 4M0PA 4RMNA 1ATZA 2C96A 4JEMA 5H83A 4Y2PA 3WBBA 2QP3A 4UTXA 4AZVA 2AN9A 4GLLA 4X7MA 1KQ3A 3FFXA 1SG9A 1XWIA 2GEUA 1C7ZA 3ZV3A 3HUDA 4DJTA 1Z5WA 3A1DA 1JDSA 5AI8A 3R0ZA 3PGKA 4OIFA 4Z4HA 5JEDA 2RGYA 1I2DA 1Z08A 2GNOA 1SD1A 4TYQA 2WYHA 4LGYA 4WBSA 3SEZA 1QXSA 4RZSA 3ZHRA 3A1EA 3C45A 1ZONA 1P2GA 2EX4A 5G0VA 4LN1A 1F8FA 5JSQA 2QLBA 5EVCA 1DPGA 3QJGA 1YHNA 4EO4A 3ZPXA 3E0XA 1SXQA 3LTEA 5BN4B 4ZVOA 1C30B 3MJ4A 2GTHA 2JH9A 5ALZA 4X8LA 1FU4A 3UKJA 1GGNA 4FNOA 3EWIA 2DERA 1FXUA 1J4AA 2R96A 1P8JA 3KDAA 4B4VA 1T8PA 3IO3A 4G1FA 4MW1A 4G26A 4TSRA 4RD3A 5ANRB 3IIKA 1ZBDA 3KR9A 3KBBA 3UZUA 4J2TA 2X6RA 4C4PA 3PLNA 4DM3A 5KX5F 2V7GA 1JLLB 1NLUA 1Z15A 2NTEA 3KBOA 3OPQA 3EZFA 3I39X 3OEYA 4X91A 4TYNA 4QUGA 1REQA 2P68A 5CYGA 2EC5A 2BGKA 3I2IA 1L8XA 1BQ4A 1FTQA 1FRFS 1TCCA 2J9GA 4M2LA 3HL4A 3A26A 2IUUA 3Q85A 2BBWA 5EMMA 3SCZA 4TRJA 2HPZA 3DT9A 4BB0A 1NIPA 4ETMA 5J1SB 1GP2A 2ODAA 4NONA 5AHKA 1KO7A 1KAMA 1W0JD 2VFAA 4ABTA 1NPYA 2APJA 2OMKA 3C7CB 1XL1A 4Y9DA 4CLDA 1YQ9A 3RKUA 2YRFA 2PUFA 1DOZA 1S0UA 3KD2A 2QPOA 5IBPA 5LZ8A 2YHIB 4YLGA 1XR3A 3OQPA 3QF4B 1SCNE 3VYUB 1WDTA 2DRIA 1H6DA 1WDKA 2OXCA 1ULZA 3D54D 3V2GA 4BX8A 3AY6A 4CIXA 5K4HA 1QB7A 1RZRA 4HPWA 2AFHE 3F4BA 5A1JA 1C7EA 3D3NA 4NYJQ 4UMDA 5I7VA 3B3QA 4IWYA 3I9MA 4DGSA 3SEQA 4MH0R 2C57A 1JU4A 1YMQA 5B7PA 4UM9D 4X8MA 5D3KA 4V0QA 2R11A 4LKOA 2A9VA 2EFGA 2QD1A 3W8EA 3O75A 3HJFA 4DIFA 4YP5A 4GKVA 3G0CA 3DMFA 2PLFA 2BM0A 1Z0ZA 2XCUA 5LOVB 3J7AC 4NDZA 4OHXA 4GBJA 4ZK6A 3NTRA 4JI1B 3A3PA 3AONB 2W5UA 3Q11A 2ZJ0A 3FYUA 5CDTA 3RV4A 3DYIA 1ULHA 2Q4EA 3Q9LA 4CWAA 2D2XA 1SGWA 2YUIA 4JYMA 4OY3A 3WLEA 1FFAA 3H1FA 4D4MA 2O5EA 2WDZA 5KTRA 3O9VA 4NNOA 3UA4A 3MN1A 2UAGA 2B4RO 4ZD6A 2JFQA 5F7JA 3CISA 4DLXA 2Z6AA 4B3MB 2ZJFA 2FPPB 3MW8A 2X5OA 4HQ0A 5ISMA 2QRVB 2GYWA 1F0NA 4G0UA 1Z07A 3N75A 2DR3A 2F8LA 3AF3A 1FYVA 1GU0A 4FZJA 6REQB 1N2EA 2JLQA 2GA8A 1R0SA 1ADGA 2Q9UA 3GH1A 1I1OA 2PJDA 4ZOCA 2RIPA 2H1VA 1RLOA 2E5FA 3JARA 1Y98A 4DLUA 2IPNA 2FTKE 1IWBB 3BHMA 2A57A 4WESA 1PVDA 3E22B 1UWLA 3JRNA 4LJ8A 4W7HA 1E2PA 2C5GA 3BIOA 3EGXA 1WV1A 4Z9FA 4LTMA 5ALXA 2CEAA 3RAPR 3OLQA 3V4PB 4D45A 1M5RA 2JIOA 4H0NA 4EZBA 3RASA 3L7DA 2BFFB 1JDBC 3IRVA 4ZU3A 1Y8ZA 1L7QA 2PFKA 2CY0A 4QYIA 5E2AA 1QKJA 1JIJA 1Y5LA 3DGFC 3F3YA 4IFBA 4IG9A 4PCAA 2AOTB 1JJBA 5A2GA 4OD0A 3OZCA 1JA1A 2P62A 4CM6A 4EYOA 3RU7A 2JFYA 3GUZA 3TM5A 4UNSA 1NVBA 2C84A 4BV9A 2G07A 4MCIA 2L18A 2V0NA 1FY2A 5JJCA 2YJZA 13PKA 1Y3DE 4QPCA 3GGDA 3F9CA 4MVJA 4S3MA 5F7OA 2ZBDA 4GOOD 3LFTA 5K8TA 3HKCA 2NWQA 5FT9A 4PTLA 4R8RA 4DIEA 1BMDA 1NVAA 5KQSA 2B34A 2BFDA 1PFYA 1ZRHA 2JGEA 2Z9DA 4XM1A 4XFDA 1F0YA 4XTCS 1UBGA 2X40A 4CF5A 3BB3A 1SVIA 2OQRA 2DR0A 3PRKE 5CURA 3HR7A 5IXSA 3I53A 3NVMB 2VDKB 1KZ1A 3DDZX 1E0JA 5CA0A 2EKDA 1ZXLA 4XARA 4DLSA 1ST2A 1EVQA 1OJLA 1YDGA 3NAMA 1J00A 4OB8A 2FZ5A 4WXYB 4YALA 1KL7A 5FEMA 2CZGA 3KDSE 5A4AA 3ZDCA 3HXPA 4QVIA 5H70A 4GS5A 1KYTA 4RYDA 4ZHQA 1FNDA 2JEZA 2A4KA 3H6GA 3I6QA 3LQ1A 5EEHA 3I9LA 3NBYC 3NYQA 1WP9A 3OIGA 2JI6A 4PLCA 1N8NA 3N39C 2ZS8A 3TQOA 5AUOB 3UT6A 1P2BA 4JK3A 3TLGB 3U7IA 4ETWA 1TQ6A 3AX6A 1QKIA 3LX8A 3K0SA 1H9CA 4LOKA 4EG6A 6CHYA 4JQYA 1N0VC 2A1IA 2OUIA 3WKAA 2PGDA 2B1JA 1UJ2A 3W8DA 3SDZA 1NMXA 4PQFA 5AKEA 3E81A 4BB5A 2PZBA 1E60A 2ZRFA 2YV1A 2H07A 4FXPA 1A2KC 1ISPA 1KVUA 1XEWY 5I8PA 3PC8A 3E1GA 3OIFA 3D59A 3ESBA 1RRVA 2JAQA 4HGQA 4XI9A 3A25A 3ECSA 1CVIA 3HVKA 3UOGA 1L8OA 4LF6B 3LL4A 3TAXA 3VOTA 3GRVA 2IDKA 3O93A 3ZBQA 1PQWA 1W5AA 1YC5A 4G5FA 1NBME 1PEAA 1OI7A 3DL2A 2DFPA 4KOEC 4Q4JB 3R3ZA 4UPEA 3U13A 4ZI2A 3E15A 1ICIA 1LH0A 3Q7RA 3QF7A 2JEOA 2VDUE 3JW8A 5C32A 2OCXA 1QG6A 5KSOA 5DKFA 4I1UA 4CMIA 3WMRA 3CLSD 1SWVA 3BBLA 4HH4A 5DVZA 5EE5B 3EVTA 3WNZA 1XKXA 3JZDA 2QNRA 2FF5A 1BFUA 1JG2A 3CZCA 3S0JA 1A8UA 4KVFA 2C5FA 5TSDA 1OAOA 1RXEA 1HYEA 2XY4A 2HBRA 1EEHA 3KV1A 3O1JC 4RLHA 1GDDA 4X9XA 5KYKA 2WPDA 1G8SA 3MINB 4JITA 3FF1A 5JFTA 1VJTA 4PRLA 3A0UA 4QDKA 3MUFA 4O1HA 5L40A 2YUTA 3HI6A 4GM0A 4QO8A 2VJMA 4RY2A 3TNDA 4B8WA 4YP0A 2L82A 1N5KA 4F85A 1WXQA 4P08A 2G06A 1BVHA 2XCQA 2YWXA 3L5OA 3Q10A 1LQUA 4FQ8A 1L1FA 2G8LA 4S1TA 4I19A 5IJ0B 1X8XA 4RKYA 3MWKA 3RFUA 4FI3F 2EF1A 3H6KA 7YASA 4C2BA 2QD5A 3M5DA 1T8UA 4DIMA 3CF4G 3TQSA 4RV5A 2PKEA 3MMSA 1H4QA 1ML3A 1PD0A 2Y1XA 3N07A 4Z3DA 4G1EB 4IYJA 2B20A 4J0EA 1T6BY 1DX6A 4ZYUA 1UC8A 3WC4A 4R5MA 3UPDA 1YRHA 1RXCA 2FMKA 3SJCA 3EMKA 4OA5A 1ANKA 2W2NA 4KUHA 1YRLA 1OLSA 3VYWA 4EA8A 1VIVA 4TUYA 1OVGA 1Z2AA 3A2NA 4BN4A 2AI1A 5KCZA 1JQEA 1Y34E 1G6OA 3DLTA 4DPMA 3V8NA 2VUTA 2XA1A 3LK7A 5JJ5A 1PNTA 3X1KA 2B4TO 5H68A 2DWQA 3UN1A 1PHPA 4EVIA 3B6EA 5A3SA 1JG4A 1ZDMA 5JS7A 4JB2A 1N6KA 2GK6A 3C7KA 4XB1A 2DUWA 1ZWLA 2WF6A 1R7RA 3FHLA 3A6PC 1Y4DE 2AV6A 4CTNA 3HI4A 3EHDA 3RC3A 3L06A 4DLNA 1J5EB 2Z83A 5FPYA 4H1UA 4A8JB 3GLUA 1HZZA 2WTXA 3O4IA 4OGKA 1OLXB 1QTNA 4BKOA 4F3YA 2GETA 4JI8B 1MO2A 5LFAA 3BN3A 3LOQA 1Z3IX 3ZXXA 5IJZA 3UFXB 3ND9A 2ENWA 1DXOA 4IW3B 3EVZA 2W2LD 1G17A 2HRQA 1KWGA 2H29A 4I3FA 3VPSA 2CF6A 1KJIA 1O5OA 3NWBA 3X1XA 3TOSA 1XNHA 4UVEA 3DMRA 4XH9B 4BLOA 1N2CE 3C5VA 1SJ9A 1JQBA 4ZC1A 3TLJA 4QU0A 4ZARA 4CL8A 1MAAA 2HA3A 4DVGA 2KW5A 2EJTA 2NSHA 2ZYDA 1V95A 1EFAA 1EWKA 1SVKA 4X1IB 4Y6QA 2M32A 5HTKA 3TLYA 5L7TA 2I54A 1L9KA 4DLBA 3P4XA 1QDUA 1EJBA 3G7NA 5EINA 4PN7A 1SG6A 3H84A 4TMTA 1WSWA 1P7PA 4JR1A 3RT9A 3ZCXA 3ZHSA 1P1RA 2FGKA 3VTKA 4NCNA 2OLKA 1CB0A 4MVJH 1IEWA 2G08A 4D5GA 1L4HA 3GNSA 2JIPA 1QRDA 1A9ZA 3LSYA 1X1DA 1YJ5A 2HBQA 3PHGA 5EJ2A 4L8WB 5FTNA 3G79A 1QC5B 5IH3A 4G5GA 3RYHA 4HWOA 3RBAA 3FDZA 3NTUA 4EGSA 5K01A 1I5EA 3DCIA 4IQ4A 4LXUA 5GV8A 4AS2A 2JBAA 2RC5A 1YVEI 3P9QA 1FFEA 1AV7A 4G2NA 1TMOA 2MU1A 4M1OA 4EZEA 1G60A 1J6UA 4FFMA 3I73A 3ILVA 4ND4A 3ZGYA 4CTKA 6PFKA 3NH9A 4RKWA 4NL4H 1NL3A 1I4LD 3BEDA 1QQ5A 1YZTA 2C3PA 5D5HA 2OHJA 5L51A 4WEOA 2ERCA 2FWMX 4HB0A 5CYOA 3WL3A 3H2IA 4JLKA 3WGQA 1IB0A 5C35A 1CUIA 2GUGA 5EZYB 3HXLA 4RVOA 2Q0SA 3B1FA 4FEGA 3GX1A 3V1KA 2Y1KA 3LLMA 4A0HA 4KE7A 5F4BA 4IV8A 4F1KA 3GH3A 1V2GA 4MRNA 3AF0A 1RQRA 4LHEA 5ESWA 3RUAA 2J3JA 1S9HA 2J07A 3TIFA 2Z1MA 3M3HA 1LWOA 2PZKA 2YWEA 2GGSA 2HPHA 5LUBA 3WLNA 3SY8A 4BIIA 1OXMA 4L85A 3ZWXA 3MYRA 4Q15A 4Z4EA 1YIDA 4IV0A 1J0DA 3TK1A 4HZGA 2Q1UA 1U2GA 2W7TA 4QO7A 3EGCA 5KYUB 1XDGA 3EY9A 2BSQA 5JZVA 4FN5A 2HLDD 3BTOA 5CNKA 1KJJA 3BIFA 4I4TF 1ESNA 1PBTA 4X85A 1PJ4A 2Q2OA 3D4OA 3HDGA 3KB6A 1E1YA 4YC7A 1NG9A 3WYBA 3D8UA 3FVTA 5TGZA 4KDRA 1L4LA 1WKCA 2D5LA 2P2CA 3WWYA 1SKUA 3EFOA 3LBHA 3NRJA 3R6LA 4U2EA 4P3NA 1SIUA 4Y1RA 1W87A 5DNCA 1E98A 3DBLB 1JILA 3OU7A 1EFTA 1VTKA 5KKCA 4E3ZA 2WJYA 1N7GA 2ZZMA 5AUNB 3RJ5A 2FUNB 4G3XA 2XQKA 1P91A 3ESXA 5DYGA 1TOAA 4B47A 4OVKA 1LPMA 4AUMA 1JKXA 5DHUA 2P0AA 4TRNA 3FAZA 3RIHA 1YRYE 3ZXYA 1FFWA 2DX7A 1W7AA 4N4AA 2OCGA 2A9JA 2YNMA 1SU8A 4L08A 3EZNA 1YI0A 4E2XA 4XAQA 3DO6A 3M4ZA 5ALTA 5DCYA 4CKCA 6AT1A 1E2LA 1F2TA 2BY4A 2VDWA 2OOKA 4FCCA 5ALNA 3U09A 1S02A 4HADA 1GU7A 5C8YA 1QWOA 2XYHA 1HG1A 2N0SA 4QKQA 4YRBA 1RRMA 2OR3A 5J59A 2O0LA 1C9NA 3HSYA 1ACLA 1OGJA 2QTGA 3P97A 3TL6A 4B17A 1UOPA 2BT4A 5IG2A 2Z8XA 3J81A 3WLJA 1CB7A 1L4EA 3IBFA 3PWTA 2C61A 1FDOA 3QSYA 2J41A 4FNGA 2K2WA 4G9BA 4JP1A 3IP8A 2UZAA 1GRNA 1IK6A 2B3TA 2K7FA 1RSZA 3G17A 4PVDA 1CQPA 3QQ5A 4D5EA 2FVXA 1OH6A 1SIBE 5HX7A 1K88A 1PYGA 4URFA 1WEKA 4BGEA 4NJMA 1NURA 2JW5A 3H5WA 4NF2A 2P11A 1N4AA 3T3NA 2Z2KA 4HH3C 2QBYB 2E4WA 1V3VA 2PZMA 2KHZA 4FCVA 2C9YA 1A98A 1T2CA 4CMJA 1TTTA 4TV9A 1JQDA 1V16A 3UAVA 4DCCA 4DG8A 4LCEA 3R7BA 5ES4B 2GYVA 3EVCA 4QEKA 5T64A 8OHMA 4QYSA 2Y71A 5AW7A 3HB9A 3OC0A 2XZLA 1JA9A 3OJWA 3TF5A 2F62A 4RELA 4K9LA 5I4BA 4EF6A 1ZM4A 2W6ZA 5KUTA 1BTOA 3JTMA 1Y37A 2AMYA 3UK2A 3JS5A 2FPKA 1IFXA 2WU8A 3O4HA 2I7TA 3CW2A 2WFMA 4AC9A 4EB8A 1FB5A 2PX4A 4BWYA 4CV3A 1IATA 4BJHB 2P5SA 3VPGA 3QFTA 5MGNA 1OMOA 1CR1A 2G9VA 4NPCA 4G8CA 3C3XA 1EG7A 2CZQA 1YFKA 1SB8A 1AKRA 1Y8QB 2H3EA 4MA5A 3EVAA 3EBPA 3NC0C 5JVDF 5EE3A 5C1OA 2R7AA 1Z38A 2PX3A 3HU2A 4NQRA 4QEDA 1BXRA 1DCMA 1R0XA 4X6YA 2CT8A 1KDVA 1JB1A 3H2KA 3KRTA 4WKCA 1KH2A 1G5QA 3LT4A 3H05A 4E31A 3I32A 1H2EA 4TXHA 2ZTMA 5B6PA 3GT4A 4ZT6A 2N46A 3AINA 4OFZA 3B6JA 4F3TA 3LJKA 2JCBA 3R41A 1YZFA 4AY2A 2A5FA 1NULA 3OOYA 3HEAA 1W1IA 2CNOA 4N40A 3SJZA 4ZCTA 1TFRA 2NPOA 4WZZA 1GZ6A 3TZLA 3ABIA 2J5KA 4FTWA 4V0MA 2EDCA 2VHTA 5EESA 2X3FA 1LDMA 2Y1OA 4TKZA 1EFPA 1M1ZA 1TXGA 1XAGA 3EA4A 5EE0A 3RVPA 4DLPA 2ZSHA 3D6VA 1O6ZA 1OIXA 2DKFA 3NHMA 3OE5A 4OK5A 4ARCA 1U8YA 3ZXSA 5IM4A 2ZB8A 1U0GA 4PYOA 1KJ9A 3WI7A 3QV1A 4ME6A 1RPTA 3ITNA 2W6JD 5I8ZA 2J08A 2QG4A 5DHTA 1F8UA 2ZT7A 4C78A 1OILA 2F43B 1OD6A 3BMQB 5MFZA 2AE1A 1YCDA 1P7CA 1Q92A 2VP0A 3C4QA 3QFCA 4CV0A 4E12A 1Z74A 3PR3A 4TS4A 1YDMA 4HV4A 4CDNA 4S0XA 4MV6A 4LPKA 4DFDA 4ZTZB 1DFHA 3W5UA 2QU7A 3GUYA 2W6MA 4CU5A 2FFBA 1VP9A 2OG2A 4ILEA 1FP4A 2HSEA 1EVIA 3DLCA 1DL5A 1T35A 4FP9A 4OBXA 1J0CA 1QONA 2YXDA 1J8YF 5I7EA 1I13A 3PFGA 1SO8A 4Y2QA 2ES4A 4EW2A 2PN1A 1D2EA 2ZI6A 5UKDA 3ZWOA 3HRIA 2OO3A 4YCAA 4MHTA 3E0QA 2JVJA 3NHSA 5AK4A 1QPBA 3LLCA 3OURA 5B4UA 3WICA 4LXYA 4QHTA 2F1KA 3ACBA 3SR0A 1JSXA 3L7LA 2FPWA 1L4UA 5DLDA 5A62A 3ZCUA 5C9ZA 1Z5NA 2VCEA 4PSUA 2LIPA 1Y5IA 1Z37A 4YCJA 2WIAA 2UVDA 3LYLA 3HCDA 1AQ6A 2BPOA 1R37A 2RHMA 3MGKA 1FTYA 3N2YA 4GNKA 4BFYA 1TZCA 4C30A 2JLAA 4N76A 3PDIA 2XUKA 3ANXA 4RFSA 2H54A 3N86A 4NVRA 3QBJA 3HVRA 2Q3JA 4G5YA 1RPZA 2QMEA 4UXJA 1G20A 1QK3A 3PGMA 1DAKA 2CLSA 1HFJA 1DQZA 1JKJB 1SKQA 3A28A 3QP9A 1J07A 3M5CA 2RDMA 2DFNA 4HDSA 3MJEA 1QIFA 1XA4A 3UXMA 3OUUA 5EIHA 3CZPA 4HAUA 5HEKA 5HGJA 4JYAB 2PGNA 2O7RA 3P0JA 2G1KA 2OWEA 3BXZA 2VRWA 1RRFA 1UFQA 3H5TA 1TKBA 1PWZA 3LF1A 1O97C 1HH4A 1PR4A 2PKCA 3KJGA 4UVDA 5T41A 2LZ0A 4KU4A 1CE8A 3W6UA 3AMVA 3WWEA 1N0IA 2ZB2A 3ZNQA 3AEQA 5TS2A 4EVSA 4ZMBA 5CDFE 5DNWA 4I55F 2QG6A 3HCWA 3WLSA 4J6FA 4XJSA 1XNQB 3I23A 5KWVA 1H3EA 4DIDA 4NI5A 1VL5A 1KHHA 4P84A 4ZQEA 5I7HA 2E4AA 4GP7A 4EVRA 1LI4A 1QO0A 1R0BA 2ZKLA 4PAMA 4YVFA 1JKFA 5BN3B 1HNZB 4RMJA 3THXB 1M54A 4AG3A 4C21A 2UDPA 2YKGA 4LZJA 3QVTA 5AH0A 1DXYA 2FRVA 1M74A 1YUMA 4I1PA 2OK7A 4GLBA 1RZVA 1PIWA 3DDCA 3S29A 4XM2A 5JASA 1TB4A 2Z98A 3BF8A 2Q0XA 4RMIA 4O08A 2GD2A 1KZ6A 1VKOA 3D2AA 1YK1A 3LFHA 4PZPA 1O5TA 4H59A 1ZVMA 1QF7A 1SBTA 5FR1A 3GJ4A 3DDWA 2V7EA 1GOTA 3F6SA 4N5NA 2YFKA 3N2NA 4TX1A 4II3A 3K7EA 3UV6A 1U28A 2PMCA 5K6AC 4LE1A 2IWHA 1AM4D 4WCDA 3ZW8A 3GUHA 1AQJA 3RFFA 5HW0A 3JQFC 3HADA 3LI2A 3KEMA 3SYNA 4YUXA 1P80A 5NULA 3EOBI 3HO6A 3RSOA 4NPAA 4ZEWA 2PWBA 5EWMB 1XRSB 1EB9A 1IHYA 1A3CA 1FTNA 1I30A 1P6QA 2PANA 1KPIA 3G13A 2JI9A 4BZXA 2XR1A 1KAGA 2C2OA 3NHWA 2A86A 2VJLA 4PV7A 1ZN8A 1WR8A 3EOAI 4EHDA 3NPMA 2WSYB 1DKMA 4Z51A 1EUZA 2HI0A 5TS3A 2NUAB 1QANA 1RMQA 4KIUA 4Z9AA 5BMVF 5CMLA 3SSOA 3E70C 3PI6A 2E49A 3E03A 3RWBA 1O6FA 1RRCA 2CXXA 2BTOA 2WMOB 1GPKA 4LXHA 4MWTA 4ZT3A 3SLGA 3LCUA 3HUEA 5CFQA 1R88A 2FR1A 4NCBA 4GI2A 1EFLA 2XNJA 1YC2A 1U7DA 2FPIA 3R5HA 4GOJA 4UD2A 5GAJA 2QP4A 1DCFA 3U39A 5ALSA 2GJAA 1KVRA 1VXOA 4QXAA 5LP6F 1C14A 4GMGA 2JCGA 1QQ7A 2WTNA 3RHTA 5IZ4A 1CUAA 4ZRNA 4Z9YA 1ZJ4A 1BN7A 5BOSB 4RADA 1UJ4A 1Q1BA 3KKPA 2AHOA 2KYRA 3KZOA 3P52A 5EY5B 1KJQA 5F77A 3RVDA 1E2GA 4BKPA 1M33A 4IHQA 1Q7TA 1YZLA 2X41A 1GZSA 3AOEA 3LGSA 4J0FA 4M21A 3K2BA 4NHEA 3IEKA 3ROMA 2QTWB 3T7EA 5HUJA 1ZEMA 1P4RA 3QA9A 4Z7QB 1NVMB 1M3SA 1ZD5A 3EQ9A 3WSWA 4LWOA 1E2DA 2AN3A 2OM2A 2A9OA 4JLPA 4N01A 3W04A 4LY9A 5JV5A 1QV6A 4LK3A 1K9SA 5DHRA 2HWWA 2VXOA 2XYRA 1XEXB 1Z47A 3WWPA 2G82A 2PGXA 4KQ9A 3VR1A 4NFLA 2C9CA 2PBFA 3N7TA 1K7SN 3UEOA 4H7EA 3OTHA 2JGAA 5FHQA 2ZP1A 5TMEA 1US8B 5BWMA 4L51A 4EY4A 1UM8A 3GLFA 2LUOA 1IG3A 5JS8A 2VRCD 1Q57A 1STOA 1TD1A 3KR1A 1PKEA 1T13A 3FF4A 1E3LA 1RHMA 5LNK1 3ZCSA 5HK9A 1QYWA 4GKAA 2DETA 1VMEA 3CSDA 4WK4B 4N6NA 4JI2B 4IR7A 4DT1B 1Y7LA 2K7ZA 4B5KA 4IWNA 4ZT5A 1K98A 3IUMA 4WKOA 2I7DA 3NRCA 4UOQA 2VTEA 3WOVA 2DB3A 4MWEA 4W5QA 1WXGA 2FZVA 5K20A 1YZGA 4A91A 3ZI4A 1DG9A 5TJ9A 1JLMA 3ODPA 1DJOA 4G0XA 3G6KA 2CVQA 4DV0B 4I8IA 3C6ZA 5CFPA 3EPJA 2WJWA 3GCXA 3QUTA 3RSCA 1R8JA 4KP7A 3PC6A 3EVEA 1CIPA 3DFIA 4J9VA 2QS9A 3TOZA 4RTKA 2IGBA 3M3DA 3MJCA 4JVMA 3GLGA 3I3OA 2DLDA 4C0JA 1YO6A 4Z99A 1W29A 1L4KA 4C2UA 2WPNA 5ECYA 3EDRA 1WUIS 4RVFA 4QUAA 1RBZA 2IYPA 1RWPA 2VVTA 1OX5A 3PIDA 4Y2HA 5CNMA 5ALOA 5KJ6A 4KR3A 3N6VA 5JD5A 1TAQA 1N33B 2BR4A 3SSNA 1IYZA 2ACEA 1Y42X 1SOWA 4MB2A 5CITA 3CEPB 3VSDA 3ZK8A 3HFJA 1W93A 1D5WA 5CX1B 4Z3OA 2EGGA 3D8SA 2HNKA 3UC9A 1LSSA 2QM8A 3K2IA 4O4IB 2LCQA 2H4HA 4GGOA 3BREA 3IJRA 5CIWA 4QUIA 4D44A 1MLDA 2ZGVA 5KCMA 1CFJA 4HP8A 5I9LA 2AJTA 2B78A 3KQNA 4HDOB 4FS8A 1N57A 2Z4TA 3ESCA 1E0AA 3E53A 4UM5A 5B1YA 2Z2YA 1BDJA 1NU8A 4DZRA 1E89A 3R3XA 3CNEA 2FZ4A 3C3CA 3ISVA 4K6FA 5C18A 4KXNA 4R9SA 4V2IA 4UFPA 4PYIA 1RYMA 1FVOA 2H5EA 1G2IA 1BYIA 3AL2A 3MJRA 4MINA 2WAMA 4MCJA 1A2OA 5K3FB 3I01M 3WLTA 2C5BA 4D0SA 4AZ3A 5K09A 1K3UB 1CF9A 5CH3A 5REQA 1Q12A 4WL0A 3FRJA 1D8AA 3OHSX 1U2EA 5JOQA 4US0R 1JEYB 3DT8A 3WQQA 3AESA 1JL3A 1NSFA 2CXRA 3DTNA 3GEIA 3UHJA 3IKVA 1HO3A 2FRDA 2CB9A 4HX2A 4MRMB 2B25A 2V7TA 3KG2A 3R7SA 4CKWB 1W59A 3PQ7A 4CF3A 5C34B 3MFQA 3H3JA 4D3DA 3C3JA 3CMCO 2B8TA 4EUEA 5JJIA 2CJYA 4ED9A 1RAIA 4AMBA 2JLRA 5EE1A 4XSVA 1W76A 2YJ4A 3DEZA 1TK2A 3NBAA 5KWIA 2HSGA 2HU8A 3HGMA 4WXEA 1HOXA 3PWKA 3U5TA 2Y99A 3WSVA 3ZU3A 3HP4A 2QRLA 3OX2A 3PVCA 1C3LA 3BL5A 3EZXA 4PSCA 3RUHA 3SJ7A 4KO2S 3Q8MA 2OAQ1 3VYRB 1XTZA 5HM6A 1Y9EA 3HA7A 3K8YA 3EK2A 3TSZA 4HFRA 4F21A 5KPJA 4KTVE 1UZMA 1DV2A 1IJFA 3DMTA 2Q2VA 2VF2A 2ZIVB 3DEAA 1FNBA 1CULC 5JR3A 4XFKA 4WLFA 5ENZA 4WOKA 2B35A 3DUWA 2OCKA 1P3DA 3FWNA 1QZ3A 3H04A 2B8WA 4FKBA 4ARAA 3OF3A 1FNSA 3KKLA 1SUCA 2XUIA 2X2PA 3SXUA 2QW1A 2YV2A 1ZQ9A 3FMIA 1QWSA 3FRHA 3NTOA 5AP9A 5EXXA 4GMXA 2VXYA 2AF3C 1CEEA 1R0CA 3WWZA 2JHCA 2XCLA 4N5DA 3VHLB 5J40A 5CFZA 1ESEA 1R8QA 2QAGB 1CJUC 4JXJA 3X1DA 4V1CI 1FYFA 1YVUA 3C3EA 4G97A 3JD1A 4MR9A 3RS9A 1QF6A 2XNKA 1M67A 2YZKA 3AY0A 3VMFA 5KIAA 3C8ZA 5DNYB 4G0WA 3SMVA 2YOFA 4M7RA 2CXHA 4MI1A 1K0UA 4O2BB 3TW6A 3AP1A 2BONA 2OE2A 3D3KA 4F4FA 1PX2A 3HVHA 1GAEO 3EG5A 1R4ZA 1XYYA 3OUZA 3VO9A 2QRJA 3D4NA 1CLUA 1EHCA 1G3UA 4PS1A 3SIPA 1BE0A 1NVKA 3HL0A 3GJYA 3NUZA 3RHFA 1XTBA 2HX1A 3SM9A 1ZA2A 2JLYA 3EEFA 3FSRA 4N0QA 3W5SA 1CIJA 1DRWA 3MBOA 4NBKA 1E7RA 2JAXA 1I7DA 5B4TA 4Q4HB 4WCFC 3DAHA 3HJNA 4XLZA 2F8SA 1FUEA 2JIZA 1Z7YA 4UAGA 3ANTA 3C85A 3CUVA 1P0CA 4HUTA 4O2AB 3MMPA 3S1AB 4LG1A 4CLOA 4BP3A 5FNVB 1QJ4A 4KB5A 5ILQA 4CGZA 2CHQA 2IUEA 5L4LA 1S6YA 3OA0A 5A4DA 2AMLA 4YMIA 5TT0A 1YFLA 4MULA 3TW4A 3QUAA 1Z0AA 4E1BA 5FTLA 1N5OX 1KK0A 2P79A 4MQEB 3KJFA 4IIDA 2C94A 3QEMB 1PFVA 3H6HA 4OBEA 2F00A 3AF5A 1CF2O 4Q3KA 1M66A 4G0ZA 5TGDA 2WB2A 3MS7A 5I3ZA 5BUQA 4HQKA 1L0BA 3QBVA 2A0XA 2GCPA 3UK7A 1GUZA 4P4UA 3KUXA 4BOYA 1DIOB 1GPBA 1Z0KA 4X6LA 3GP8A 2AW5A 2FLVA 2R1VB 4FGUA 2CKDA 5BOVA 3W4JA 4A8TA 3PCTA 1IE3A 3GFTA 1IXKA 4ZT4A 2IS2A 3UGKA 4FDAA 1F6BA 3NLLA 1P1IA 4IOMA 5BWOA 4B2LA 4WLEA 3FTCA 3G0BA 4FX2A 4GIBA 4N0DA 3SNKA 3SSAA 1AKYA 5HKLA 4AJKA 4D79A 1FIUA 5JS6A 2JKYA 4PSDA 1UK8A 3PVSA 4IKEA 4RGYA 4YJHB 3VR6D 3AVUA 2QN9A 4XEUA 4CEIA 3UENA 2G71A 3ZYCA 5BW5A 1PD1A 1Y8RA 4BUZA 1A8PA 2Y1WA 4D3SA 3AV0B 2R0QC 4WKGA 1L7VC 5GZ3A 4Q3EA 4J2OA 3GEBA 5I5EA 3NWJA 1WXIA 2O8VA 3RODA 2KM1A 2W2XA 1RXUA 3QFFA 4GM1A 5B3KA 1GO2A 2BGNA 1VSTA 1JV2B 2HA7A 3G3EA 1SXPA 4NFSA 4V02A 1DKPA 2IW3A 2TYSB 2JHFA 4WHMA 4HMOA 1Y1LA 1VGRA 3CFYA 3H1GA 2EKBA 2Y9PB 4EVQA 4E4TA 1XZJA 1TM1E 4PWZA 4U4AA 3CGWA 3PUKA 2HREA 3BXFA 4NV3A 3JQPA 2QT1A 2W0SA 4HFJA 2E6KA 4Y1GA 2W8ZA 1L5RA 4JL5A 1IOLA 2ZREA 4LVUA 4YA6A 3UT5B 4C4ZA 1SVNA 1T6ZA 4M9QA 4EB6B 2UVQA 3LZ6A 1JQJC 1UP6A 4DMHA 2O2IA 2C5EA 1LPSA 4P2GA 3LCMA 5EJ7A 3P26A 1C1YA 4QAJA 1VRWA 3AIMA 1WDLA 1P6XA 3TB6A 4FFOA 1MGOA 2FW9A 1G41A 3PQ8A 4PHFA 4RK0A 1CZOA 3MOGA 1A9QA 3QEAZ 1TZJA 3O95A 1E3QA 4P35A 2QYOA 1WM1A 3HWWA 3PC2A 1GNPA 4GZ5A 4ZGGA 3JATA 3W5DA 4AYXA 4CM8A 2PCJA 3FAKA 4KFTA 5HILA 3E2MA 3OZSA 4RL4A 2WD9A 5F33A 4ZYVA 3Q2KA 1JW9B 1HI9A 2ONZA 4L4SA 4AQDA 3AVWA 3THYB 4XA8A 2OCBA 4HN9A 2OBXA 5FP0A 4X41A 3UF0A 1RYFA 4CBVA 2B69A 4UULA 1RRKA 4G4SO 4FZRA 5AXAA 2VP4A 4GT1A 4YRZA 2JHPA 1I1HA 3IVRA 5CLIA 2HFKA 3OZRA 3CX6A 3FB4A 4BLPA 4DLTA 1V96A 3CH7A 1V8ZA 3M6WA 1EE1A 1X8KA 1GYPA 3SF8B 1R3UA 2VYFA 1OW3B 4QBTA 4EFLA 1Z62A 1KOJA 4FYHA 3D5EA 3FYUC 1V35A 3G6WA 4B87A 2BL4A 3GPLA 2YN0A 1UWVA 3DE5X 4MW9A 5K7SA 1UBHS 2GCOB 5LMZA 4I1YA 1EM6A 1H5QA 1ZW1A 3OY7A 4RLQA 4QPPA 5BXYA 1DRKA 3WIEA 3WMWA 2IU4A 2IZ5A 3EQ8A 3QPDA 4BFUA 2OYCA 2ORWA 2V1UA 1L5MA 3RJ9A 2CLCX 3S2YA 1L3CA 3GLHB 3IVAA 4M36A 4S0ZA 3FG9A 3TTVA 2W43A 1JEAA 4YRJA 4KR7A 4P38A 3W34A 2I6XA 1NVWQ 1CBUA 4BNWA 3OE7D 3WLOA 5K0TA 4REQA 2J6CA 2HBZA 5K45A 3HFRA 4PLHA 4AKHA 4ZRDA 4ZYWA 2H4WA 3DNPA 3HN7A 5KVVA 4P98A 3H8VA 3WIBA 2B4QA 3TTUA 2VUSA 4YNBA 3TLXA 5JRDS 1G5PA 3GQBB 4I1OA 1A8IA 3OM8A 1WTCA 4Y2VA 1ITZA 3EMBA 4PG7A 4B09A 3DWFA 4AX8A 2AEJA 5TPZD 2KQUA 4JLMA 1Z28A 2BFPA 1NU6A 3EEYA 1E4EB 1QYCA 3C3MA 4YCBA 1R8SA 1NQWA 5HJ2A 3UMVA 2OCDA 4QPJC 1AHIA 4BWFB 4YRIA 3QYJA 3OTQA 1NXWA 3CNOA 4G5QA 3E5NA 4BFVA 4FGJA 3KYDA 2B83A 2I87A 2PCLA 3VPAA 1HE8B 1U9ZA 2N42A 5FOSA 4A92A 1Y3AA 4RORA 5EXEA 3ZHQA 3GJ7A 1Z34A 2RGXA 5CVDA 2Z8YA 4U5XA 5A02A 1PGPA 2YVKA 1IZ8A 3RWMB 4GECA 1KSFX 4MS3A 4FMDB 5U9CA 2GBLA 2KX7A 2XVZA 4RY0A 3IV9A 3UPUA 1B0UA 3A4YA 3W6NA 2X9GA 3QU9A 5CGQB 2AFIA 1PAUA 3K1AA 3MXTA 3EUAA 4X61A 1M2VA 3II6X 2KLBA 3LT1A 4QG3A 2G9ZA 1NJ1A 1RHUA 5JJBA 2HZ7A 4RSGA 1U8TA 1CVRA 1RXSA 2JRLA 3G68A 2EG9A 4GE0A 3P5SA 4JGIA 3LDAA 1AOXA 2AQKA 3ZJYA 4QX6A 3QMVA 4TV8F 1OX4A 3B1YA 1N9KA 1JLSA 1F8XA 1NW4A 1EWTA 3JQ8A 3QELA 4QODA 5C5CA 5DM4A 3DV9A 1CDZA 3DVSX 3V80A 1JHZA 1E0DA 4RDXA 1U99A 4YP6A 5I4CA 3S55A 2D3TA 1WOYA 1WQ1R 1XF9A 3PD0A 1D1TA 4S04A 1BROA 5FLKA 5DT9A 2RBEA 2BFAA 2G88A 2JB9A 2HWUA 3I30X 3KQPA 3OMLA 3P2JA 1EDBA 3LW8A 2XH8A 2NSLA 3TN7A 5EJ4A 1J56A 5LBUA 2QSZA 4EG3A 2C8VA 3CW8X 4EHAA 3WGOA 1JR3E 3I8XA 2J59A 4KJXA 1P5HA 1SFRA 4TZTA 3H1AA 1EDEA 1IHDA 1KAEA 1YI1A 3OFNA 1ATIA 2YV3A 5GP1A 3L7AA 5KSYA 5KS2A 1VMIA 1CZUA 1O6BA 3FHCB 1HSOA 3FDJA 4ZO7A 1KA9H 2HKIA 2R5FA 3IMCA 2EX1A 2Z5LA 1PZNA 1M7HA 3FYTA 2W2VA 2B1RA 2JA1A 1WXEA 4JYCA 1N2HA 3LQYA 3H2YA 4BUJA 4DCPA 1G6KA 4I6GA 2FW0A 1LBEA 4IV5A 4J1TA 4L95C 4JLDA 2I2AA 3C5HA 1XVUA 5K3OA 4AF8A 1NSTA 2JANA 1QRAA 2Q50A 4TTQA 1DO0A 5B1HA 4Y6GB 5C80A 1OAOC 2PKXA 3GCZA 1QTQA 221PA 3IR7A 4KGZA 1BD3A 3C5WP 5AJTA 3GLSA 3GN2A 1WMDA 2VYQA 4FEEA 2WTBA 3T1NA 5H0IA 3G9QA 4R0NA 4K6HA 4DMLA 5KBYA 5LM3A 1D2RA 2JJ1A 4AURA 3B13B 3GJQA 4IWXA 1P72A 3ELDA 4LBZA 2DR2A 1XLUA 4KDCA 1PI3A 4ZC8A 2XYGA 4O4HB 1GJRA 2WM8A 2FPOA 2YWRA 3LT5A 1V5FA 2PGLA 2VYCA 3WL8A 1Y9JA 2WY2D 5IC5A 1QCDA 1Q0ZA 3GFBA 3L0PA 2VIIA 4IOLA 3QX8A 5I7RA 1T9CA 3EF3A 3ENVA 1T3LA 5EHQA 1FMFA 4J29A 1THZA 1V3QE 2QVXX 2H9AA 4K3VA 4RPLA 4DHWA 3M6VA 4Y2TA 1ISHA 1XMQB 1ZUNB 2NZJA 4PONA 3KCQA 2IZ7A 3RG2A 4TMFA 4KPYA 2Q3FA 4LY6A 2B5OA 2FN9A 3VR2A 4R1MA 2OEPA 1YXMA 1PJ8A 2GSWA 1G1MA 1RTKA 1U7HA 3FH0A 4QL3A 5FOTA 5JQGB 4DV1B 1E69A 2R1ZA 1B14A 3L18A 5SZHB 2BBTA 1QGYA 2OFPA 3OZFA 1W47A 3JQ6A 4HSEA 2XODA 2ZUTA 5JU6A 4ND6A 2JGDA 2WB4A 2ZJ6A 3HXTA 1SKMA 2IYTA 4KQGA 4C6TA 4BWGA 2ZJ5A 3I1JA 1U7PA 4ZAYA 4K87A 4HUJA 2Y68A 2LGJA 2QTCA 2GD1O 1V48A 1P2FA 1SA0B 3HMQA 5ITSA 3R7FA 4DR3B 3NHLA 2R8ZA 1M1XB 1T1IA 2O7QA 2J5XA 3EEIA 5IT9A 1Z2OX 2BDEA 2G9NA 1XWFA 2HMVA 2ZJOA 2HCBA 3PPIA 4I7EA 2IIPA 4RZ3A 2VZLA 4RDHA 3ZYZA 2X14A 3OD1A 1A27A 3LUHA 4G8BA 1R66A 2CNLA 2EARA 3CZRA 4RE6A 4U7FA 3I04A 1GUYA 1UL1X 4QJ4A 3HJRA 2GN8A 3TLBA 4DIBA 2CUKA 3GWZA 4J0GA 3RIEA 3KP1A 1DC8A 4MUGA 2GT1A 2Q5EA 1EDZA 3M6AA 5F35A 2ZIUB 5HKKA 2PSHA 3CMMA 2RGDA 3NRBA 4GSYA 5CU7A 3ASVA 2HA2A 2O4UX 3FKQA 1DXHA 5ECDA 1KK1A 1YULA 4QDUA 2VHWA 2A8YA 2HCFA 2R8EA 4ZEXA 2Q8QA 2HF2A 3DBRB 3DS8A 3Q3CA 3T7DA 3MRTA 2ETXA 4TXNA 4YV2A 2EKQA 2FR8C 2OD2A 1W581 2PLRA 2PO7A 3VYSB 5DN6D 1MDBA 1MW9X 1X14A 3OQ1A 3IOBA 3OJLA 1EGQA 1GN8A 2R2GA 3MCZA 2EFJA 3GZ4A 5U4QA 2BP7B 1F1JA 2J3KA 1B23P 1BE8A 5GJVC 4I9FA 5CVJA 4N39A 2PPLA 5HIAA 4HVCA 5HUHA 3D6UA 1ZU4A 1ENPA 2ZAIA 4HDNB 1MXHA 2OL4A 4QGAA 2RCYA 4IJQA 4ZU6X 5AM2A 2PD4A 3PR2B 2EZ8A 3AKDA 4YCLA 3O8BA 5DNUA 4TKVB 5F23A 1GVNB 3JQEA 3PEYA 1Z0DA 1K68A 2ZSIA 2QW8A 2BKXA 4KW7A 1E99A 5C3UA 1QFYA 2UU9B 1WW2A 1X7HA 3W3ZB 3QE2A 2QKYA 1AQNA 4Y2GA 2UUCB 2DQZA 3B5IA 3P71T 4XX0B 1AD2A 4IMPA 1RBYA 1EFRD 1Z8DA 3AFMA 3I52A 3OPVA 3I12A 2QN8A 3EG9A 1T9BA 3MNFA 4OJTA 4ZV9A 3D6JA 2HA0A 1FS5A 4C4OA 2AHRA 2CJFA 3OZIA 2FETA 2RHHA 4BNDB 1JR6A 1IPFA 4YCDA 4JX9A 1ZZEA 1AK2A 1F48A 1XIVA 3CVUA 2ONCA 3R3HA 1NRXA 2ETVA 3KQHA 1JAYA 2PXAA 4C14A 3NYRA 4PX2A 3AEYA 5C4MA 4HTFB 3L05A 2DP4E 4TMXA 2HA6A 4TLCA 5LP6C 4EQ6A 1XI2A 3AUYA 2AQIA 4UTZA 5E0KB 4LC0A 4LPSA 3PUIA 1G21B 1XQWA 4N6GA 1IBCA 4MHOA 2BN4A 1TNDA 4KBYA 4MIEA 2XUPA 3QPVA 4K8RB 1U2GC 2X6QA 1FLAA 2REQA 2YZNA 4FR5A 1VKZA 4CV1A 1VIMA 3SX2A 1IK4A 1O7JA 3S81A 3EOZA 2XPCA 5GONF 3NEAA 5HCNA 2HDWA 1G4UR 1W49A 1ISIA 3ED5A 4RVCA 5IN4A 2XT0A 5FPQA 1WHTB 4AUNA 3E8SA 3H4TA 1SHZA 4IUYA 4PR0A 2ORYA 2VBGA 2JLSA 3HNOA 4QLBA 1BEUB 3IBTA 1YIAA 4BMDA 2FFRA 3AF4A 2Z8ZA 3OQ6A 1IAQA 4LTDA 4HNTA 1BH6A 4URUR 1MP0A 1Q77A 5EIAA 1X0VA 1AURA 3L46A 1MORA 4GU5A 4IVPA 3L8EA 5JG7A 3UHPA 4BO6A 3QWFA 4V03A 1JG3A 3R74A 2QI9C 4ITRC 5T4BA 3OQMA 1EBUA 4XWWA 3CCCA 1ZH8A 1JVSA 3QPAA 5B3LA 3A4IA 3TIVA 4AWXA 1YA6A 4UDXX 1I2CA 2LDXA 4CDRA 2NVOA 5IUJC 1J2RA 1QCYA 3UMGA 2XGJA 3M1AA 4A73A 3O0DA 3QXSA 4RTOA 2DQKA 3DMDA 3L7IA 2IS6A 4HZUB 1KYWA 1AQUA 2YNMC 5EIFA 3ZIAA 2PV7A 4PF1A 1IWPB 1FK8A 5KAMA 1M75A 2FMUA 3IO5A 3TJMA 4QXPA 1IQ0A 4KG7A 3DE3X 4MKHA 3BFJA 4D97A 3GCDA 3P9YA 3EEQA 3OFSA 4UVIA 3B48A 2HNAA 3MGCA 4L5CA 3BF7A 1ETHA 1ADFA 1A9TA 1VBMA 2VT6A 1MMFB 2ZWPA 3FPLA 4IQFA 5F2EA 1GPDG 1E18A 1GZUA 1V3TA 1VE1A 1ZC4A 3G9XA 3HVJA 5B1IA 2NPFA 3IB3A 4EJSA 3RC1A 5HBGA 1KNXA 1LK5A 1MNQA 4Y30A 5DXFA 4R0MA 1CUXA 2EU8A 3DWGA 3OIWA 3MELA 1NRJB 2VNAA 3LPDA 1MQ9A 3QBTA 5IHXA 5EIBC 3K0AB 5J43A 2IH4A 1V1RB 2OHIA 3W9UA 3PWZA 2ZANA 4CL3A 1Z68A 2H1WA 1MENA 4KYIB 5DK4A 3SHTA 4DWJA 1L7MA 4XQGA 5CPBA 4D9JA 3UV7A 5G3ZA 1VCNA 2E2WA 5LQMA 1VZ2A 2REOA 2YRXA 1PZFA 1LSUA 3LQQA 4LYAA 4ZVQA 2ILVA 3FJ1A 2GPYA 1XLTA 2QLMA 4GLJA 4RM2A 1CU1A 1KAOA 5BYKA 3BWMA 1XD8A 3LUJA 3PPYA 3EDMA 1ZGHA 3H2SA 2RG1A 1V11B 1IY8A 2AYXA 2YWDA 4IIBA 4LRYA 1GZ3A 4GI3A 3PPXA 2H0AA 4ZOEA 2UUAB 4UE2A 5EERA 3N2ZB 4B85A 5ABPA 1E8DA 4E6PA 2A59A 2C7OA 2R1UA 4MRAA 3PXCX 5FOXA 1E6KA 2PJRA 2BTEA 9MHTA 5KREA 4QJ3A 5C8VA 1E3WB 2QT9A 3DE1X 5L7WA 3AV3A 4QUKA 1R50A 1P45A 4IJ5A 3EC2A 5FO0A 3OMWA 1ZWKA 2Z57A 2O5CA 1RJWA 3ZWKA 2Q5HA 2ZWIA 4ZCSA 1Z7GA 2J6BA 1RAAA 2RAFA 3PTZA 1HDIA 4MYTA 1YVDA 3OF2A 1XF1A 2ZUFA 3IEXA 3K3PA 1HZJA 3VR3A 1ISRA 1E1LA 5KX5B 2AG5A 4C07A 3UGJA 3HWRA 3LCVB 2NYRA 3O6VA 3QVLA 4BU0A 1ZAYA 3IB6A 4XYEA 1BQ3A 4EYKA 4ZAGA 5BO5A 1BDIA 1OREA 4JB8A 3QRWA 5CLJA 3G88A 3U4DA 2CV1A 2QEQA 4IIGA 1BQEA 2YYYA 3B78A 3T9DA 3GVIA 1G21E 3D7LA 1P74A 1EP1B 2C07A 2Y93A 1C5KA 2MSCB 3ZE6A 4LHZA 2QQ5A 3B82A 3N6XA 4IHJA 3H5VA 1U8UA 1T9ZA 1FVHA 3GP5A 3VH4A 1UZAA 2EWMA 1CRLA 5HXAA 3SVZA 3TD6A 4DHEA 1ENOA 2JDID 1LBTA 2GD6A 4LZAA 1OC2A 1XTRA 3Q3VA 4OMFG 1SU6A 5EHGA 2PHZA 1P5RA 2WG1A 3F7NA 3QTBA 4LMAA 1ORWA 2IUSA 2NVBA 2R85A 4AMGA 4EG1A 3ZLVA 3UB4A 1EXDA 2COEA 3QU4A 1DVRA 4QXOA 1BAPA 1CW2B 3EVDA 2B9EA 3UMYA 1L9XA 1QH1B 3A6ZA 3OPYA 5EJFA 1DEHA 2VDOB 4F4JA 4OYHA 3TCNA 3W5IA 2X4LA 2QSJA 1KK3A 4XYBA 1XJ0A 1YZUA 3UJCA 3G23A 2DCMA 2Z4RA 1CUGA 3F96A 3NWEA 2WLSA 3QLUA 2C83A 5ALWA 1NXVA 2IUTA 3QX9A 2GM5A 3H9EO 4JODA 3CJTA 5DGHA 5KYYA 2Y66A 5E6UA 1ZSYA 3HDYA 4LNUA 1LV7A 5LKAA 2CSXA 4FMBB 1JAZA 1P1BA 1Y1SA 1XJWA 1KAHA 3LA8A 4ALMA 4W5HA 1JPJA 1DEOA 3FFBA 3FMFA 4MRVA 4X3PA 1QQ6A 5F5LA 1KFCB 4C6SA 1RQ7A 2VSQA 1OH5A 2XXAA 1MO3A 3K09A 1VL1A 2FSIA 4M60A 4JN6B 3T6KA 2BKUA 4C4AA 4EKGA 2PBZA 4N65A 3MJVA 2IYVA 1CUVA 4OLFA 4X90A 2X13A 4IJVA 4YRKA 1S2MA 1U8XX 2IYYA 5DMHA 1NT4A 1U7OA 3P45A 4Q7KA 4BLSA 4BO7A 2QMHA 2CVOA 2IWRA 4C89A 2PH5A 4C6RA 1EFUA 3ZWBA 1ZN9A 2JFXA 4BQOA 1J5XA 1TD9A 4NYIQ 4PYRA 4BKQA 4M49A 3FPHA 1VCIA 2NOAA 1H3NA 4MWZA 3V9AA 3TEMA 3LO5A 5C4IA 4G5SA 3KUCA 2ZBEA 3JVIA 2PR2A 3P9RA 1Q7BA 4MQ6A 4OA8A 4ZOLF 5JE8A 2BBOA 4L16A 4Y6PA 3MCAA 4MITA 4MLPA 4E13A 1XL0A 2XIJA 3NKLA 4Q16A 3B52X 3M89A 3IE2A 5EEGA 3N7AA 5CK5A 2B5VA 5ALVA 1L7OA 1JJAA 2WFZA 2DPXA 3L8DA 3I76A 4YAGA 1FDSA 4LJ6A 5AVYA 1A82A 1W96A 3KKNA 3HVIA 2WZQA 2QTMA 2L69A 3CR7A 2H16A 3M0EA 2FWJA 3NCTA 4BQRA 4P86A 1G2PA 2XQJA 4JMLA 1W8DA 3RS2A 4EKNB 4IGKA 4E5MA 5J3JA 1DJNA 1W5FA 2PMBA 3BMNA 3I45A 3WX0A 1H42A 1NKTA 1WPXA 1Q3TA 2CK3D 4O3FA 4QECA 3STVA 1OBVA 1OBHA 3KEOA 2O8NA 2MOKA 4YJ3A 4W5RA 4CW7A 2JKVA 2VQ3A 1I4TD 2OZPA 3JQAB 1KS9A 1F7VA 1MIOA 2GMWA 3U3XA 4L8LA 1LZKA 3B1WA 2JCXA 2OY0A 3N8GA 5EXTA 2HCTA 3ZWAA 3OQNA 1VL6A 1AA9A 2ZWMA 3NORA 521PA 3VPBA 4YHHB 1EX7A 1GG9A 4D4GA 3LWNA 1U28C 1I1NA 1MQSA 2AN4A 3LVRE 2PZFA 4IVNA 1PZGA 1HE3A 1DSSG 1O94D 4IXNA 3VUEA 2GDZA 2GN0A 1QIJA 1NF9A 1SQ5A 3MT9A 4HUQB 4IIXA 3O8OB 3VZDA 2ZULA 3JYHA 1O5IA 2D7CA 1BFKA 1SVMA 1WD7A 1PYOA 4QDZA 2XCSB 3PNKA 1JPUA 3C8MA 4LCBA 1ORDA 4HNVA 3A3YA 2NGRA 4HFMA 2W8BA 5DTMA 1EFVA 3OO0A 3ITKA 5ES3A 3P7MA 4XCXA 1T10A 1DAOA 2NO1A 3P1JA 1ODIA 1AKMA 4Y2RA 1SXJB 4NY1A 3HLKA 2XUDA 5H9VA 3CKLA 3I1YA 5BN4A 1C30A 2C2YA 2R7LA 1EINA 1FVFA 1LPPA 2RHTA 3V34A 5AI4A 1LVHA 2QVLA 4M88A 1O95A 1FP1D 4ZZ2A 3NYWA 2XGSA 2H7XA 4ZV4A 1G5FA 1DJLA 1Z4IA 3A0RB 3IP3A 3HBMA 3T1HB 1XD2B 3RU3A 4DV5B 3HEMA 1PT9A 1YT5A 1NY5A 1SBYA 2RGWA 2XE8A 4MV7A 1SM4A 1KJZA 2G1JA 1DIAA 4JVNA 2XUZA 4IX1A 1E1QD 2H1SA 3DNMA 1UFKA 1ZGAA 5INTA 2CLKB 3WYNA 1ECFA 1Y6QA 1U0HC 2ACWA 1QHNA 1PVOA 3Q9UA 5J5CA 1WF6A 4FPXA 1PWXA 4INPA 1QF9A 1YJAA 4M0CA 4RHCA 3ELBA 4X7RA 4MDFA 1NQOA 3AOEC 5HIKA 2HU2A 2YHIA 3JAWB 3ZGLA 1NBMA 3WGLA 3L92A 2BKLA 1CUWA 3HJAA 1U6JA 1ZN7A 1P39A 3CUSA 1KJYA 2NNLD 4EHHA 3EF1A 4HWPA 2X1VA 5JZMA 1P77A 3KLPX 2IH5A 3DLPX 1QG2A 4I5GA 3CRRA 4ER6A 3V5NA 5HOEA 3L7CA 2BUAA 4TVSA 4ZQIA 2UZ3A 5JCZA 1E0SA 2AUTA 1II8B 1L3BA 3KZKA 5FBRB 2PMEA 2OHHA 1Y82A 3IQXA 3HKEB 3MWEB 3R6DA 4H4EA 1KC3A 3H42B 4XUDA 5LOVA 4RJLA 3DL0A 2NZUG 5KI6A 4YP9A 4JT9A 1EPUA 1BJTA 4C4XA 4QAQA 3CLSC 3ZD8A 1T3ZA 4MYCA 1HMYA 3NBMA 2LKDA 4D3ZA 3LZCA 4X20A 4R9UC 4E2YA 2CCKA 1WNFA 2J1LA 2JGRA 2WYOA 4J6EA 4LRUA 1GPUA 2HO5A 3FWZA 4QOFA 1MQ8B 1AUQA 3N87A 4L0QA 5TT1A 4EUKA 4JV5B 3PYXA 1TW3A 2PGJA 3WSTA 3GDWA 1DC7A 5THQA 3WAKA 4DDKA 4EJFA 2FPPA 3OEED 4QXRA 2QRVA 3REQA 4INJA 3W9SA 5DF1A 4YMVA 1OOEA 3WWCA 2I8CA 4A1FA 1W85B 6REQA 1XZLA 1FF9A 1AV6A 1O77A 1HMPA 2Q3CA 1G291 3ONNA 1N5MA 3QM1A 1ODTC 3B6MA 3BGVA 4BNUA 5EKUA 1R6BX 3N58A 3E22A 4ZDKA 1UT5A 3GMIA 1TZ2A 5FBKA 3RUFA 1P2TA 4C29A 4RZXA 1NR7A 2OBFA 4ALIA 1HEIA 1X80B 3GIDA 1EUCB 3IMGA 3LHIA 5KYTA 2FCRA 3JQ9A 4BO4A 1Z18A 4IH4A 2N47A 4B7UA 2AOTA 3QVMA 3MGBA 1TEHA 4FQ5A 2Z8YM 2HO4A 3AVOA 1M8GA 4BN5A 4YAUA 4UFNA 2X19A 5DDIP 4CLEA 1KMHB 1ZKDA 1YKSA 5TVKA 4D3FA 2IY9A 3CF6R 3M1LA 1Q1GA 2HMYB 2V3VA 1D2HA 1CR2A 2XAAA 3KKOA 3UO8B 1ZRSA 3OZ7A 1MC1A 3HBLA 4PX5A 4UTRA 2WABA 4NIMA 2BZ0A 4YACA 3EE6A 5EAIA 3DFUA 1CDDA 1P5JA 4MICA 1KH1A 1XCBA 1FQJA 1T0PA 1UR5A 2WU1A 1C3OA 3HH8A 4DLYA 3WGMA 1N25A 1V39A 2WZBA 3DZJA 1IL0A 2E3JA 3TLCA 5KC9A 1B0PA 5CDSA 1JG1A 2P0EA 5T4EA 3AETB 4LWPA 3FTDA 5JCOA 3WIVA 1UMKA 1VYTA 2I4IA 1E2FA 3HB0A 5A5VA 5KDLA 1HOTA 1UBMS 4OOFA 1UPBA 1B74A 3NTLA 2RBGA 4EAAA 4BGDA 3N59A 4A5SA 1C8BA 1FJ2A 3LRXA 1EVJA 4NNJA 1WBJB 5EZ6B 1R1DA 2Q45A 4QTZA 3TLGA 4K9OA 4BB6A 4P4NA 4AS3A 4DRXB 5FFNA 1LCIA 4DKXA 2HEIA 1QIGA 1Z0JA 2JH8A 4LTNA 1REQB 4DTIA 5ADHA 2XEDA 2H5IA 2WICA 3CNBA 2H4XA 4A2CA 1T25A