2OPBA

Structure of k57a hpnmt with inhibitor 3-fluoromethyl-7-thiomorpholinosulfonamide-thiq and adohcy
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
257
structure length
257
Chain Sequence
ASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWALRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Enzyme Adaptation to Inhibitor Binding: A Cryptic Binding Site in Phenylethanolamine N-Methyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Phenylethanolamine N-methyltransferase
total genus 90
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.1.1.28: Phenylethanolamine N-methyltransferase.
pdb deposition date 2007-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2opbA00
1QANA 2PGXA 3PT9A 4GF5A 4RYLA 4AUKA 3EGVA 3DLCA 3UJAA 2PT9A 4LWOA 5DM2A 2Z6UA 2JH8A 2P8JA 2AOTA 4CTJA 3PFHA 3K0BA 2QYOA 3JWJA 4FGZA 1FP1D 2PSSA 4OA5A 3KQWA 3UBTA 1UWVA 4QVKA 2UYQA 1F38A 1ZGJA 1QYRA 1IM8A 2NYUA 5LR6A 3MHTA 3KPWA 5P8WA 4P58A 3TKAA 4CKBA 1YZ3A 1NW5A 1AQJA 1VIDA 3OZSA 2IH2A 2OB2A 4P7JA 5K0JA 3M33A 2ZZNA 2N47A 5K0BA 2P7HA 3IYLW 2EJTA 4M36A 4GOLD 4QQNA 2I6GA 3G89A 4RVFA 4Y30A 2PX8A 5EZSA 2BM8A 2YXDA 2PLWA 4EQZA 2AOTB 1RJFA 3H2BA 5EQJB 3HCDA 3THSA 4YV1A 2AOUB 4C06A 1JG4A 4YV0A 4JXJA 4EMSA 4QDKA 2C7OA 3TPZA 3FPFA 3HNRA 4PIMA 4QPNA 2PBFA 3CKKA 3KQQA 5CIYA 1D2GA 2PX5A 1SUSA 5CUQA 3CGGA 2XYRA 2YR0A 5EIFA 2FPOA 3I9FA 4F86A 2XYVA 5D1HA 1JSZA 4PINA 3EVFA 3KPVA 5CVDA 2PV0A 1M0EA 4ER7A 1HNNA 2E5WA 1IY9A 3NDIA 2OZVA 1XXLA 3PB3A 4EVIA 4XUEA 2G70A 3KPYA 1L3CA 5EG5A 5E1MA 1M6EX 3L8DA 1X19A 2IH4A 4IV8A 2O57A 3BWMA 1JQ3A 3GO4A 1V39A 2BZGA 3R24A 2O05A 4OBWA 4ER0A 1WG8A 3C6MA 4QTTB 1O9GA 3QOXA 3O7WA 3R0QA 3M4XA 5E1DA 4BLUA 3P9NA 1NW6A 4RVHA 3M6UA 5T6BA 2P3LA 4GC9A 5LQRA 1B42A 1ZG3A 2P7IA 4DA4A 2EFJA 4RTNA 3B5IA 1N7IA 2CWWA 3CJRA 4GQBA 4ER5A 2XVAA 2IBSA 5EMLA 1KR5A 4L7VA 3FUWA 4GOMD 3RIEA 4HC4A 1KP9A 5DRYA 3AY0A 3DOUA 3EVZA 4GBED 1KYWA 4KRGA 5HFJA 2QM3A 3E23A 3SSOA 3UA4A 4RTQA 5ICEA 3WSTA 4LWPA 3PFGA 4C05A 4CWAA 4QVGA 4F84A 4YMHA 1ZQ9A 3GRUA 1ORIA 4HTFB 4DQ0A 5LQNA 4RTOA 4WVLA 5DSTA 5E8RA 5FQOA 3HVJA 4RV9A 2Z6AA 3GCZA 4AZSA 4ZTBA 1INLA 3A7DA 5CCBA 1MHTA 3LPMA 3LDFA 1NW7A 2UYCA 2NXEA 2O07A 4XUDA 1SKMA 3LL7A 5HZMA 2UZ4A 2IBTA 2EJUA 3MCTA 5GIPE 2VS1A 3ELDA 1DUSA 3BUSA 5F2NA 1YF3A 3PX3A 4O29A 5E9JA 5IH3A 3LECA 3O4FA 4PIPA 3ORHA 5ICGA 4CXMA 2OKCA 3BKWA 3BT7A 4V0QA 3GNLA 1YFLA 3KQOA 3TKYA 1I4WA 8MHTA 4FT2A 3G5TA 3THRA 2HNKA 3KQTA 5DT2A 4C07A 5JR3A 4KWCA 2OBFA 3QV2A 1SVUA 2P3QA 2FRXA 4CKEA 4MHTA 3BGDA 5HEKA 4YUWA 2Q41A 2IDJA 4CTKA 5CVVA 5LQUA 3MAGA 1SQGA 3GGDA 3G8AA 4RVDA 5K0NA 2ZIGA 3KR9A 1WS6A 4RSRA 5CVUA 5IKMA 3EEYA 3HVIA 1JSXA 4E70A 3CCFA 1JTEA 3A4TA 3PLAE 10MHA 3CC8A 5GIOE 4R6WA 4E33A 1VPTA 1EQAA 2FK8A 3GRRA 3BWYA 2AOXA 5EPEA 5T64A 4MQ4A 5EC8A 2C7PA 4BLVA 3FTDA 3MTIA 4BP1A 1RJDA 3JWHA 4C08A 5LQAA 3BGIA 2K4MA 1NE2A 4X1OA 5DSXA 1L3BA 2VDUE 5BW4A 4RTJA 3DLIA 5E2BA 3FTFA 3I64A 3O31A 5BXYA 2BR5A 3LKZA 5BP7A 3ID6C 1Y8CA 2JH9A 3NVKI 3TR6A 3E7PA 4OA8A 2BR3A 4AZVA 1P91A 3EEOA 3NMUF 4PWYA 2AOWA 3DXYA 2P35A 5HILA 4YUYA 1F3LA 4LECA 5GM2A 3HCFA 3PVCA 1JQDA 2AS0A 4PYNA 2PJDA 3LCUA 2ADMA 3UJ8A 4RVGA 3BZBA 2ZULA 3ELWA 3MQ2A 5FWAA 2C7QA 1KPHA 5GM1A 2FK7A 2ZZMA 1ZKDA 4PYOA 3R6TA 1RJEA 2H1RA 3KPJA 5T67A 1L3IA 2P40A 1R18A 4KVZA 3OZTA 3UA3A 4QPPA 4FP9A 2O06A 3FYDA 2QE6A 4E32A 2B2CA 2YQZA 2AZTA 1WXWA 1P39A 3SSNA 1PRYA 3KQVA 5K0EA 4RTSA 3P2KA 2B25A 5E8JA 2PY6A 4Z2YA 4OX9Y 4DZRA 3G2MA 3UWPA 4QQKA 5CM2Z 4P7GA 4POOA 1N2XA 5K0FA 5EMKA 1UFKA 3SVZA 3B3FA 5HIMA 2NXCA 5FTWA 2LD4A 1NT2A 1XJ5A 3UJ6A 5K0LA 3G2OA 2AVDA 2OY0A 1KIAA 4R05A 5DTMA 4RTLA 3PTAA 2DULA 3DH0A 2B78A 2R3SA 3P9IA 3R9XB 4A6EA 4FR0A 2PKWA 4IV0A 4MIKA 4HGZA 5FA5A 5JUWA 5FUBA 4E2XA 1NV8A 1OR8A 1ZHFA 2IGTA 2NNWB 4GUAA 5KYGA 5DRTA 2VDVE 3EVGA 3EVCA 2CL5A 1NW8A 4YUZA 3UZUA 3B3JA 3RODA 4PNEA 1DL5A 1X1CA 3KR1A 2P3OA 5F2OA 2ZTHA 3TOSA 2IDKA 5C0OE 2ZCJA 1R8XA 2ZLBA 1FJXA 3GJYA 2WA2A 2R6ZA 3EMBA 4FT4A 2PXAA 3M6VA 3C3YA 4Y2HA 1X1BA 4R8RA 1UIRA 3AXTA 3B89A 3SX0A 3KR0A 2WK1A 3JWGA 4KDRA 3SSMA 1D2CA 1R8YA 3DULA 2G8NA 3FPGA 1XDSA 2AVNA 7MHTA 4FS8A 3LDGA 1FPQA 1VE3A 1WZNA 3UFBA 4KDCA 5DM0A 5HIJA 4AZWA 1XCJA 3FTCA 4GC5A 2QY6A 2JHCA 3MTEA 3TRKA 3GRYA 3B3GA 4A6DA 2JG3A 5ICCA 5FHQA 2H00A 1R6AA 3OCJA 3K6RA 3FZGA 5DX8A 2OO3A 5E2AA 3C6KA 4E31A 4X63A 3HCCA 4PYQA 4C04A 3OFKA 2OPBA 4E2ZA 5EIWA 2B9EA 1QAQA 3KQPA 3TFWA 5K03A 5LSAA 2PVCA 2FYTA 1RI3A 4M7RA 2EG5A 5DXJA 3KPUA 4RX1A 1I1NA 3AJDA 5ERGB 2ORED 5ICFA 3C3PA 5DTRA 3SM3A 1VQ1A 3FRHA 2VDWA 1AF7A 5F2KA 5FWDA 5G02A 3NJRA 1KPGA 1QZZA 1NKVA 2ZFUA 5E1BA 2CKDA 3A7EA 2IPXA 2ZBRA 1ORHA 1XDZA 3DP7A 1R00A 2AN5A 2OB1A 1BOOA 2ZBQA 5CD1A 2CMGA 1NBHA 5EEGA 4AX8A 3UJ9A 3FPHA 2GLUA 2IP2A 1BC5A 4PYJA 1P1CA 1SG9A 1G8SA 2AR0A 5DM1A 4UOEA 3A27A 3OE4A 4EKIA 3FUUA 3VC2A 2O0LA 1KPIA 4X60A 4PONA 5KQRA 2PX4A 3OU6A 3B7PA 3KU1A 2NP7A 4DKJA 4PCLA 1SQFA 1D2HA 3CJQA 3LSTA 2AOVA 4RTMA 2GA9A 1IXKA 4AZTA 3AWIA 3Q87B 3ELYA 2EX4A 2GAFA 3EVAA 3SGLA 1EIZA 2IFTA 4MWZA 5K09A 3ELUA 3DMGA 1EG2A 2QRVB 5B1SA 2Y1WA 4QDJA 1XDUA 3FPJA 2NP6A 2ZVJA 4QTUB 2XBMA 1O9HA 3HM2A 4B17A 3P8ZA 4C4AA 5E9WA 5GP1A 4PYMA 4V0RA 1G8AA 1TW2A 4FZVA 4GOOD 3ER8A 1JG1A 3NWEA 3BWCA 1RJGA 5HIKA 5LQJA 3GDHA 3EGIA 4PGHA 3EPPA 2G72A 2Y1XA 1PJZA 4X41A 1FBNA 5C1IA 3I5UA 3OE5A 3QOWA 1DCTA 4XUCA 2PWYA 5U4XA 3IV6A 5LQCA 4PCAA 3UJBA 5E9QA 1JTFA 5DPMA 2GS9A 2QRVA 3ERCA 1VL5A 2UYOA 3GIWA 3TMAA 1M6YA 5GWXA 4P7KA 2KW5A 3IHTA 2FCAA 4KW7A 5KQSA 3PS9A 4OBXA 4GEKA 4HRAA 1N7JA 3V8VA 5K01A 1YZHA 2ZIEA 3VYWA 1NW3A 4KIGA 2HTEA 5M5BA 4FSXA 5FCDA 3I53A 4HGYA 5K0CA 3P2EA 3GU3A 3ER9A 1KXZA 2ONZA 3M70A 3T7RA 2ZWAA 1X1DA 3HA7A 4MTLA 4DMGA 5DTQA 5DX1A 2ESRA 3GWZA 3SMQA 2HR1A 5K0GA 1H1DA 2GPYA 1EAMA 5GINE 4BY9E 3HVKA 1O54A 4X61A 4EK9A 3E05A 3EVDA 4P7FA 3HCBA 3FUTA 4FSDA 3DUWA 3DMFA 1L9KA 1YUBA 3KR2A 3G5LA 2OYRA 2VP3A 4IKPA 2F8LA 5HIIA 3P9KA 4E2YA 5C9ZA 1G55A 3T0IA 3G2QA 4C03A 3NW9A 3LDUA 1Z3CA 5EZQA 2CMHA 2BM9A 2XVMA 3LKDA 5FADA 2PX2A 4HTFA 3RW9A 3TQSA 3UJDA 4YV2A 1JG2A 2V74B 5E1OA 1YFJA 3MB5A 1I9GA 4KIFA 3FTEA 1X1AA 1U2ZA 5H02A 3ANXA 5CCXA 5KVAA 3KKZA 3NWBA 2ZZKA 3UJ7A 3F4KA 4ISCA 3VC1A 4NECA 4YUVA 3SXJA 5DWQA 2YXLA 3HCAA 2IIPA 4WXHA 2UYHA 1BKYA 3A25A 3MCZA 1VBFA 4OQEA 2OXTA 4DM3A 3V97A 3DXXA 1XTPA 3P97A 4R6XA 3PX2A 1SUIA 3ME5A 2GB4A 1HMYA 5MHTA 5EGSA 1JQEA 2HMYB 5EVJA 3LBYA 3AXSA 1TW3A 2ZIFA 3FYCA 1JR4A 1T43A 3NTVA 1VP9A 1G38A 4E30A 3MERA 1G6Q1 4PGGA 4ER6A 5DM4A 1VLMA 2AN3A 3LX6A 4M38A 5CVJA 2NXJA 3HP7A 3UJCA 3DXZA 1XCLA 2P41A 4E2WA 1P1BA 4BP3A 2I62A 2PXXA 3R3HA 4R8SA 3REOA 3S68A 2PT6A 4HH4A 4DCMA 2ZW9A 4PYLA 3LCVB 1NV9A 4DCGA 1WY7A 5CVEA 3TLJA 4RTRA 3HEMA 2B3TA 1R74A 3GRVA 4OQDA 2G1PA 1QAMA 4RTPA 2YX1A 4G56A 1BHJA 2IH5A 5EHGA 3X0DA 2HWKA 2AOUA 3FPEA 3TM5A 3BGVA 5DX0A 3DTNA 4YUXA 1ZGAA 2PXCA 1XVAA 2BH2A 9MHTA 3M6WA 1FP2A 2NXNA 1G60A 3CBGA 5FA8A 2JHPA 3FUVA 3GXOA 1QAOA 3HCEA 3EVBA 1Q0SA 3DMHA 4F85A 3FUXA 1WXXA 3OU2A 2JJQA 1RI4A 3U81A 2VZ9A 3I58A 2YTZA 3LGAA 1EJ0A 5FHRA 4PYIA 3BKXA 3HTXA 2HV9A 2JHAA 2YXEA 3A26A 4HG2A 2GH1A 5EOVA 2XYQA 3T7TA 5GOZA 3EGEA 3NVMB 2AN4A 3TM4A 2A14A 4CKCA 4RTKA 1NBIA 3KQYA 3VSEA 3EVEA 5EKXA 2I7CA 3D2LA 3HA5A 1KHHA 4XCXA 5BW5A 3M6XA 3KQMA 5K05A 2ERCA 1AQIA 2H11A 3Q7EA 4BLWA 3SR4A 4M37A 5K8VA 1Q0TA 4EKGA 4DF3A 3MGGA 1TPYA 5DXAA 1RI2A 3HVHA 3OU7A 5EEHA 5FQNA 2Z6QA 2G71A 2WA1A 3BXOA 5D1NA 2DPMA 1EJ6A 3HA3A 3BWBA 4U7PB 4IWNA 1L1EA 3LCCA 3P71T 3T7SA 3IEIA 3KHKA 4K6MA 4ER3A 5KS2A 2BR4A 1AV6A 1YB2A 3FRIA 1RI1A 3OFJA 3GRZA 3OPNA 4GOND 1RI5A 4RWZA 4PYKA 4U7TB 2PWPA 3P9CA 4HSGA 5DLYA 3OZRA 2ZBPA 1JG3A 3P2IA 5EMJA 3NDJA 5HOQA 4H0NA 2ZWVA 3CJTA 4ATNA 3LBFA 2YUIA 5EKUA 1MJFA 3C0KA 5LQKA 2YVLA 2ONYA 3E8SA 3G88A 3G2PA 1KYZA 3G8BA 2FHPA 3KQSA 2P1DA 2V7EA 2ZSUA 5EHIA 4LG1A 2C7RA 3LHDA 5EMMA 1VP3A 3EMDA 3G7UA 5FULA 2I9KA 3DR5A 3JWIA 4YMGA 3CVOA
chains in the Genus database with same CATH superfamily
1UFQA 3PQCA 4JC5A 4RNDB 2C98A 5EUQB 1NVTA 3RIMA 5JJCA 2PT9A 1JZTA 4WN3A 2VQFB 1LF5A 3F6CA 1KJZA 2ISCA 3MCUA 2YH2A 4MKZA 2HMUA 3FCYA 1TA9A 1JI0A 1NP6A 5M7EA 2O8BB 2NX2A 3T7DA 3CZ4A 1RRGA 3H19A 2GD1O 1E7RA 3GLIB 2CE2X 4EUHA 3FFWA 3MHTA 3PXGA 1UOPA 1CVRA 2V7TA 1ECBA 1O2DA 3T3DA 3NCHA 3QV1A 5MN5A 1T29A 1VDMA 4WA7A 5G0TA 3KTFA 4ARAA 5B1YA 4Q9DA 1DAKA 1BIFA 5HE8A 1JHRA 2PPLA 4TRRA 2XDQA 3RU2A 1Q11A 2G9NA 2BFEB 3T5TA 4D97A 3H5LA 1GA6A 2GK4A 3L3BA 4RPLA 3BIFA 1BCSA 2HIHA 3IDQA 1JG4A 4FLFA 2W58A 3WK8A 1B4DA 4WMLA 4RS4A 3UAVA 4CKYA 4QPNA 1KKMA 4M76B 4KV7A 2PG3A 1RHJA 3SJ7A 1E2LA 1IN6A 2Q2NA 2BEWA 2I8CA 1TQ6A 1TKCA 5J2UA 3CM0A 4Q9LA 5AJTA 2XYVA 1YL6A 2O9JA 1IIRA 2C54A 1U9JA 4PFKA 4Y2XA 1X1SA 4BHTA 4CHTA 4D1YA 1C8VB 2ZPAA 1X0XA 4PYRA 4KN5A 1Y3BE 3GA5A 4XUEA 1OH6A 1XNRB 3EGDB 2FA9A 2QM8A 3IAAA 3PQFA 4RMJA 3B78A 4JCCA 4TS3A 1Q7CA 4S35A 4AP9A 5KWVA 1I4EB 4OP3A 2GCPA 2O57A 3OQIB 1UBEA 2A0UA 4V0KA 2QMOA 3PFWO 1UMDA 3PJDA 1EDBA 4C89A 2V0GA 3H8SA 2GZ2A 3EODA 3CF6R 3HMKA 1DZ3A 5EL0A 1O9GA 2QE7A 5ENVA 4AMZA 4C9BA 1FU4A 3EGXA 1BJRE 3AFMA 1XR3A 4S2EA 1NW6A 3MD9A 1CF2O 4RVHA 5LZ8A 4LW8A 3H9EO 3EY9A 3GFVA 4NBNA 4PVCA 3WGMA 1YJBA 3ZGZA 3W2EA 5IEJA 4UCFA 1S01A 2DPLA 3I2JA 4NV0A 1GV0A 3L1VA 1I36A 1P60A 4TKUA 1EXWA 1KOLA 4R9UC 1IDOA 3CX4A 3O92A 4KRGA 4ADSG 4EUKA 1YR3A 1A9ZA 1QGUA 2R47A 5CIWA 5A03A 3UJNA 4EEXA 2HF7A 1GCOA 1ZGBA 4OGKA 4R2HA 3DW1X 3H6KA 3WK9A 4RIHA 4CWAA 5JHGB 2IYSA 1XPOA 4G0UA 1SB8A 3ABOB 1EDEA 3UK2A 4D3SA 1DCFA 1YS6A 1X7YB 4RPKA 4FKZA 5KC9A 2FWJA 3F3YA 4I1VA 4ZTBA 1EZZA 3SAJA 5BT8A 3TKLA 3BBPA 1M6HA 3KUUA 1NXPA 2X4IA 3PIIA 5AUQA 4AJNA 2X41A 4M9RA 3T38A 2Q4BA 3X2FA 1SKMA 1S2MA 3E9QA 4AQ7A 2BGJA 3PPVA 4E5SA 5DI9A 4PX3A 2YJ4A 1IXZA 1ST2A 5BWNA 1R6DA 1QGUB 4EVRA 3LBIA 2Q5CA 4FMBB 5ECDA 4V0QA 3GC6A 4CXMA 4JYAB 3PRHA 2J7PA 2ZRMA 3U19A 1UXHA 3H1EA 1CEQA 2AG8A 3N8HA 5KQGA 1RKVA 4LCEA 1AA6A 1Q0ZA 1DIGA 2FW6A 3BGDA 5A3SA 2DKOA 4WGFA 5JCOA 2JFPA 4GI7A 2A9VA 5IBCA 1SUDA 3ZLBA 3BH6A 3OJOA 2A33A 1X74A 5IKMA 1CJUC 4KYUA 1G9XA 5F77A 4K6OA 1O08A 4KDEA 3U16A 2Q5LA 2RKOA 1UUFA 3E82A 3IEKA 1AD2A 1XKLA 3PIRA 2CF5A 2Q0SA 4NY1A 4CF6A 3MN1A 4O33A 1JNYA 1F1BA 1II8B 5DW0A 4X93A 1QDLB 3W8NA 1RJDA 2VXBA 4BNUA 2Z8ZA 3E3AA 3WRWA 4X1OA 5TMBA 3SQXA 5A0VA 1I2ZA 3SSAA 1A4UA 1SBNE 1Z28A 5A5FA 2GD6A 5FFNA 2AJLI 5INTA 1WBBA 1GNRA 2VJDA 4IDEA 1NFFA 3B6JA 1DQRA 3LKZA 3RGWS 3FYHA 2HO5A 3TR6A 2CVHA 1NYQA 3HZHA 1TADA 1D2NA 2UUPA 5IARA 2I4MA 1RXIA 4N3NA 4P38A 1PO7A 3D3WB 4G5SA 3JALA 3F67A 1JEQA 3WKAA 2WHYA 4ALKA 3M5WA 4LECA 1CS0A 3DAHA 3EXHA 4NJOA 2HCTA 3A32A 3QEOA 1E0AA 1EX1A 3HO8A 4YAOA 3T94A 3IT1A 1V8BA 2BFCB 4R81A 3UUEA 4DS3A 3OTOB 2IVZA 1ABFA 4OI0A 1XTRA 2V65A 1EK2A 4OPMA 3R6TA 5DHSA 2CGEA 2H1RA 4XASA 2X1LA 1V9SA 2WIDA 4RGQA 3SN6A 4DCUA 3CZCA 2O06A 2YWXA 2H2IA 2WYOA 2H7XA 4XRGA 4QJBA 1PF7E 4PVDA 2B5WA 5BO5A 3I1YA 3SG0A 1YC2A 3IVGA 3WXBA 5EE0A 1IUOA 2WTBA 2SCUA 2SKCA 3P0EA 4DZRA 5F1OA 3PC6A 1Z4NA 1H9BA 1QTIA 2IYFA 3DBVO 3NBUA 4YJ2F 4F9EA 4HT3B 8LDHA 2QPTA 4NBLA 4ZICA 1JIUA 5A4FS 3H04A 3MINB 4NU6A 2UVPA 1PP4A 4FFOA 1JQBA 4DSOA 1NN0A 1QMGA 2DULA 3BHMA 4FYJA 3OQNA 4WXYB 4DCPA 2Y2VA 3QQ5A 4Y2VA 4HGZA 1ULBA 3DCNA 5ITSA 1X42A 4YRLA 1EE2A 1J1ZA 2QJTA 2EBHX 1D8AA 2HRZA 5DNYB 4HBZA 2X2PA 5KYNA 1DADA 2G07A 3ZDXB 2ERYA 4M83A 1E8DA 1H65A 2C88A 3BERA 4S1TA 4U7JA 1BGXT 3FNEA 5GONF 3KZMA 4TKVB 3LUBA 3TLKA 1XL1A 5KI6A 3ETCA 1CTQA 4NV3A 4RY8A 2AYXA 4M2LA 1M72A 1T0BA 3ZWQA 2XNKA 3V1UA 3QVSA 5B1HA 13PKA 1DQZA 2H4YA 3CE6A 1NVKA 4PX2A 5AQEA 2ZR0A 3TNYA 1EFKA 2P79A 5SZKB 3FPKA 4P2GA 4H3SA 5H83A 3HE3A 3AR5A 4ME6A 4OYLA 4WKGA 4S12A 1V9LA 4W1SA 2QPLA 3TX2A 2VTKA 2W9XA 3N2GA 3ZW8A 2RCNA 5ICCA 4IEEA 1USKA 1Z2NX 5BR8B 1BE1A 2C29D 3JD0A 2IHKA 2MSEB 2JVKA 1XKTA 1HZJA 3UH1A 3SLGA 4HDKB 2AA3A 5H4GA 5TT1A 2CBGA 2WKPA 1PSDA 1ECLA 3CKMA 2H57A 4UAUA 2GBIA 3DQQA 4N54A 3KOMA 4BIMA 4EHFA 4YJFA 3JQ9C 3KTAA 2J3JA 2R8RA 5FLXA 2I7VA 2HSGA 2Y9PB 2CMKA 4HLQB 4R51A 2FSIA 4K88A 5ERGB 1KZ4A 3V7WA 2CVFA 4BQRA 1UM9B 5KNCD 3TGPA 1YCGA 2DHRA 1CE8B 2HT6A 5F78A 3RWBA 1RAEA 4OB8A 3KBOA 2FGJA 1OXMA 2P90A 1U8CB 1RE0A 2FEPA 4F3KA 4I1SA 5AVJA 1E0KA 4LJ8A 1MC1A 3FM9A 2C4WA 3EW7A 1UPCA 2FG6C 3VV3A 2OFWA 3NS7A 1DAHA 3NHBA 1GAWA 3RASA 4P4NA 4UM8B 1CIPA 1SUWA 3C8MA 3HS3A 2G0AA 2BFFA 1BS9A 4S2UA 4JQOA 4WNIA 4X7PA 4A0HA 1NL3A 3WTCA 1GGVA 4Q1CA 2GKGA 4ALIA 4CN9A 1T9DA 2EF1A 1SD1A 2Z1NA 3LPNA 3LRTA 4FYYA 1BRTA 4TPKA 3WL8A 3UMMA 3PC8C 5F7ZA 1N1DA 3M6AA 3Q87B 4R16A 2Q3LA 4MWZA 1P1RA 1QR2A 4IG9A 3VTKA 1EWVA 1TJ3A 4ZYYA 1U7ZA 5B1SA 1ICIA 4ZARA 4A9AA 3AI3A 2F55A 4KI7A 3WIVA 4N82A 4CQMB 1PL8A 2R25B 4TYWA 1F51E 1HYHA 4PZAA 4OX9B 1T4GA 1DNPA 1MPXA 2WE7A 3KP1A 4XVRA 4L6AA 1KQOA 1DKMA 1TUBB 5HQJA 4E07A 5HIKA 1V2GA 3BE5A 4LKOA 1J2EA 1ZUWA 3QFFA 4UAGA 2W98A 5BSVA 4WV3A 5LQCA 1QB8A 4G5RA 2ECQA 4INJA 1NI3A 1EJ2A 3LRXA 3Q5GA 3U5TA 2J30A 2YXBA 3LDAA 4J91A 4MKIA 4AIRA 1SCUA 1N7JA 3RFXA 3VYWA 2QTVA 3CBQA 1ZVVA 4DOMA 2WTAA 4UM5A 3DQPA 3QTLA 2JAUA 5JOQA 9LDBA 1KC3A 1EVJA 2Y67A 2Z95A 1RXCA 2X8JA 3EK2A 2ZWAA 3QFSA 4JSTA 5EWLB 5IYZB 3O84A 4H7HA 1XZMA 4U6NA 5JMWA 1ULTA 2ZRCA 3QUQA 1HE1C 2I65A 2OSVA 1R6BX 3RFVA 2H1SA 1FA9A 4PRYA 4X61A 1JJAA 1Z12A 3WMXA 3M9LA 5CFRA 3ZHZA 4US2R 3FMIA 3H4VA 3LP6A 3ETJA 3LBHA 4DC9A 3HO6A 4YRIA 5DNAA 1FRQA 3MYYA 2CEKA 3DL4A 4ZT4A 1G8FA 3TAUA 1EUYA 1L9KA 1YUBA 4O4IB 1KH1A 1I24A 4UMEA 1U02A 3A6FA 3G5LA 2C1EA 4X6UA 3MUEA 4MYDA 4HQ0A 2QLFA 1K8YB 3O38A 4XPIB 4GLOA 5C9ZA 2OCBA 2E5FA 3HXPA 3UH0A 1OKKD 1R16A 3ZY4A 2XVMA 1GZDA 3F2IA 5CITA 5FWXA 1YIDA 2V74B 1P1FA 4LXGA 2G7MC 4B9AA 2YY5A 4JOBA 1Q17A 1ECJA 2LGJA 4YO7A 2DYKA 5LUBA 2EGUA 4CV3A 5D00A 4AK9A 3ZWVA 3ZC3A 3VC1A 4XWTA 3TIGA 2P91A 3O6VA 4QO7A 2GZAA 1JSCA 4KQMA 4ILEA 3CIOA 4BS9A 5JBQA 2CXHA 2DY0A 1HG0A 4R9RA 3RC7A 1RTTA 3QLTA 4F6LA 1QM5A 5DZSA 3P97A 3NAZA 1TTTA 4RNCA 2DLDA 2PRIA 4UE6A 3OT1B 5H3CA 3RYFA 4F93B 3P20A 4MVCA 4V0ME 3PHJA 2HAEA 4FIZA 3WB0A 3RJTA 2FPPB 3FYCA 1E62A 2GKSA 2K6GA 1MNAA 1XZ8A 2EGHA 1P1JA 5AFSA 1G59A 3F3KA 3GGPA 2UVDA 3LX6A 1VI2A 3DDCA 4NWIA 4TTQA 2YXNA 3MEQA 1EX7A 1UF9A 2R6JA 2CLMB 3NOXA 3T7KA 5JSQA 2VLIA 1MH9A 1B73A 2PXXA 3SS8A 4WXMA 3DVRX 3RT1A 2PT6A 4BEVA 4DCMA 1JJIA 2VXYA 3H7IA 1DTSA 1WY7A 5ALJA 3KEOA 1RAAA 2XQIA 4Q1DA 2Z4TA 4OQDA 3M7IA 2J4FA 2ZOSA 1NU8A 3QVGB 2O5EA 3HQ4O 4DHWA 1SCUB 5JCPA 2BZSA 2YICA 3X1XA 3E2MA 4M49A 1ZGAA 5DIFA 1XVAA 1XRSB 1VG1A 2XUIA 1I7NA 5CTAA 1KYTA 3RSLA 4N5NA 2R65A 2VPQA 1TA0A 3GFPA 1P19A 4X1YB 3B3QA 4FEEA 4UPDA 5AVUA 2WTMA 4TRJA 2O50A 5C7LO 5L3RA 2XCRB 2MMGA 3OZBA 4HAVA 3UK6A 3QEMB 3GQBA 2FZGA 1JX6A 2BI7A 3AV3A 2GO7A 4HNRA 1YZGA 3DZHA 3RJ9A 3KT6A 5SZHB 3QOYA 3GG9A 2PBLA 4KYIB 4OHZA 3T7TA 1FQWA 1VBKA 4RFSA 4BL5A 1UZNA 4J7AA 3OTQA 3TD2A 5EWMA 2YBDA 2HIMA 3IPAA 1BKDR 1E4EB 3D7NA 4X1YA 2RD2A 1ZJWA 2PIDA 2NQTA 4GU5A 5KOHA 4XYBA 4QLOA 1EFPA 1ADJA 3H2JA 2YMQA 1BWRA 2TRSB 1K75A 3EZ2A 3DE3X 1PJ2A 5B53A 3GJTA 2IOQA 2WC1A 2QTNA 3HA3A 3V3KA 1QLJA 3KHKA 4A0GA 1M2VB 4GOND 1GKIA 3GRZA 4N7BA 1DAIA 2VSFA 5ED4A 3INYA 1JG3A 2UV8A 2DCUA 1P45A 1U81A 2E9SA 2H9IA 2PQ2A 2XSZD 3DO6A 3JATB 3LBFA 4G0YA 4DARA 4DMRA 1EX6A 1MDBA 1Y7IA 2J0UB 2W2TA 4K5QA 4RYDA 3W2TA 1CY7A 4J0QA 2JK0A 1KFCB 4K9SA 2FHPA 1SK9A 1CZUA 3LHDA 2YV5A 4IDAA 1XMQB 1N1MA 3TQTA 3WWOA 2Z9CA 2RHGB 1I3KA 2O3UA 2PGXA 1E6MA 3TUZC 4EG1A 3IP8A 5HJ7A 1T3LA 3D1VA 4JT9A 5BYBA 2IP4A 3LQRA 3RT9A 3AJ9A 4MR9A 2W4QA 4NCXA 1O6FA 4IIEA 2DWCA 2IXEA 3PC8A 4MKRA 3KQWA 2YC4C 1KSJA 4O2AF 4XWOA 1ORVA 2BKXA 4CEIA 1HL7A 2UYQA 1Y9EA 3KPWA 3PZRA 3G8YA 3FAKA 3GJQA 4DIBA 4M22A 2ZE6A 4L72A 3ZD7A 1MX5A 1XU7A 2IWRA 1PJBA 1XZCA 4HMQA 4WSOA 1P0MA 2REQB 1XRQA 1KTVA 2ZR8A 4XX1A 4B40A 2WDPA 5BNZA 1L5HA 2JZNA 2AB0A 4NH4A 3CNQS 2PLNA 4IQ4A 4ZC1A 2IHUA 3JZMA 1HFWA 4DRYA 1HRDA 4EHHA 2XX3A 4YRAA 4TUYF 1WV0A 2W6PA 4JIGA 1P29A 3TS1A 2QX8A 4CQMD 1L4EA 5L40A 4WGGA 1FMJA 5J2TA 1AKEA 3OHSX 5DBOA 3VXKA 3GBSA 1XTSA 1OWPA 3K20A 5TVGA 5CBPB 1DT3A 2HYDA 5IDXA 2ZJ4A 2NYVA 1W30A 2JGMA 5SZJA 1QHHB 2J7KA 3DT9A 1YR9A 3AETA 3VU9A 5KOJB 3NYRA 5BRJA 5DW3A 2ZQYA 3E48A 3LXUX 3IQIX 1JAYA 2H1OA 2D0DA 1V8PA 4IGFA 1J24A 3L6BA 5EINA 1O6ZA 5C80A 4K9QA 2NO1A 1IM5A 3G7SA 4JS0A 4ZI7B 4AMVA 4IXTA 5CHYA 1M6EX 2QLJA 5B6JA 5GZ1A 2HJVA 2Z9DA 4IV8A 1Y98A 3G8CA 3GO4A 5AKYA 1V96A 4HAUA 3FTNA 1WBDA 1G7RA 1QBKC 4QTTB 4F9FA 1YQWA 4XRRA 2FOXA 3RUCA 1LLUA 5LBTA 2HTFA 5T6BA 5I48A 2KPOA 4XYEA 2XOKD 2HD4A 2YFQA 4YHHB 5LU8A 4N39A 2DH5A 3ND8A 1K4KA 4NZYA 3ZWDA 2WSYB 5AOVA 3N76A 2Q46A 1KR5A 2CLOB 3FUWA 3PQDA 3KYDA 1T4DA 4J49A 1IC6A 4TMTA 3L8YA 2CLDX 2AKAB 1MF7A 2VBIA 4U02A 4WAUA 5HFJA 2JLRA 1UJ2A 2YCBA 3TD6A 2PAAA 3IQGX 3VNUA 2ACEA 2OGUA 1XZDA 4L57A 3T5MA 1NZDA 1D6JA 1PFKA 3V1KA 3VZPA 4AD8A 5EZ5A 1E6EA 1W6UA 1NVXQ 5G4KB 5I7RA 4N76A 2UZAA 4DV5B 5TMPA 1L5MA 2YNMA 3SKYA 5JJIA 3AHCA 3EISA 5P21A 1P0CA 3KLMX 3U3RA 3LC7O 1Z0SA 4G85A 4AJJA 5BVHB 4Q12A 4MYTA 3HWSA 3MCTA 4JX9A 1MJNA 4WLEA 2JGJA 4RLHA 1VHWA 2DF8A 2OKCA 3NM4A 4CT0A 5L45A 2DSTA 4WOPA 3E5MA 1FRFS 1YIOA 3DDUA 5DNVA 3IALA 3CZ5A 1R8QA 1PVVA 1XNGA 2Z5FA 2Y99A 4DCSA 1SVUA 5ALTA 1PKEA 4LFCB 1KDZA 5EUCA 3U4GA 4URUR 2OQRA 4HQLA 3DCIA 1I9CA 2HCBA 4MI1A 4RJKA 3V1MA 2J6CA 4JLKA 2ZIGA 1Q7BA 2VUSA 1FSZA 1SUCA 3IUMA 3TIFA 4D9NA 5AW4A 5HWSA 4PRZA 4BLQA 4F38A 4H1TA 5FOQA 3AB3A 3CC8A 1SO8A 1K6XA 5HVNA 1E7QA 3V4LA 4O4JA 3KDSE 1QNFA 2BCGY 3OJ0A 1K7YA 4JHXA 4ESEA 1GUBA 4PHGA 1TB4A 4G8BA 1YS4A 4L6CA 3VAZA 2OK8A 4ABTA 3C87A 1JFLA 1XU4A 2C8KA 2H48A 2B20A 4P5EA 4A27A 4DMHA 1UDBA 1OI7A 3PYMA 2NV0A 4E7OA 1NAIA 4TXHA 3FTFA 2Q2VA 3IJEB 2SHKA 2UZ1A 3ZWOA 3N70A 1CR1A 3OIVA 4MEAA 1CUVA 3NVKI 1D9XA 4QHTA 1X9IA 1KO7A 2BR3A 4EG7A 2I54A 4MUIA 4BCBA 4KXMA 1QGYA 2WPDD 4ZK6A 5I8PA 1P91A 2FPSA 2BGWA 1TYAE 3U4IA 2B2XA 1KDYA 1ABEA 3GMIA 1VLJA 1WOYA 5ER6A 5A4JA 5JVDF 1ZBDA 2PS9A 3K1TA 1P0FA 3VA7A 5HILA 2PKXA 3HCFA 1BDJA 1R6TA 4JI5B 3UC9A 1YCFA 4FMCF 2IZZA 2O14A 3LCUA 4OHVA 2AHRA 4UTVA 1H66A 1UAYA 3NJ8A 4R8KA 1UOQA 3UKDA 2FK7A 1NC1A 3RARA 5KKNB 4JKIA 1I2MA 2V7VA 3B9PA 3PVSA 4BLPA 2JJMA 2YWJA 4TL7A 4EHNA 3KJEA 4PLWA 1PZHA 4DEVA 2B2CA 3V1YA 2J1LA 2FMTA 1P39A 2QUKA 2ZETA 3GN2A 2X3FA 4O4HB 3PJEA 2Q7DA 1YT5A 3D1JA 1NIPA 1ZZGA 3QKTA 3CF0A 3DNPA 3P4XA 4IYRA 1EWKA 1H22A 2DBVO 2XNHA 2R48A 1EFAA 3KJXA 1A7AA 1COZA 3WB1A 1Z4QA 3HXTA 1CJVC 2JEZA 3ZXUB 2ZRHA 1XJ5A 3OFSA 3MWYW 1CLUA 4UTXA 1IUNA 3OPMA 1C2YA 1RVDA 5EWJB 4LSWA 2O4CA 3PTAA 1PYOA 1VHLA 1ZVKA 4UMDA 4U6SA 5AK5A 2YQ5A 3AUJB 2B61A 2XUJA 3KOUA 3F9CA 3D4BA 2BHNA 3GNSA 3E18A 5IDWA 2FSVA 2Q1TA 1BH2A 3F47A 4K9OA 3OOJA 3N2YA 3BCHA 2ZJ1A 2ZJAA 3IULA 3KR1A 3ML1A 5HNKA 3FHCB 3LQ4A 1RRCA 1O0BA 4F11A 3R20A 1J5XA 2XT0A 2Y71A 2VZLA 1EVLA 2J9FB 3QEJA 2WJZB 3EMBA 3MELA 3VC7A 4AP5A 4ROTA 1SBTA 1YQ9A 2WK1A 3Q8KA 5THQA 3X1JA 5A1TA 1OFVA 4RELA 2GF9A 1RAHA 4UHKA 3P9YA 5HKOA 4LF8B 1NM5A 2W6CX 3K1YA 1VYTA 3IUQA 4AS3A 1H93A 1WZNA 1QPZA 3B53X 5AI6A 4BGUA 1O96A 2OWEA 4PSCA 2B4RO 2H6EA 1V47A 2FMHA 2BJHA 3NORA 1YA6A 2OG1A 2YRWA 4C76A 4XPZA 1U8XX 4KNYA 4W5HA 4KE6A 4WLUA 3EUFA 5DX8A 1T0IA 2ATXA 4JL6A 3TNJA 1AS0A 2Z0MA 3MD0A 1JR3E 1IWPB 3EXHC 3KOZA 1QIEA 3BS4A 1QAQA 5GADl 4URYR 2COKA 4F5DA 1YVDA 3NC4A 2AEMA 2HJWA 4LRXA 3EIEA 4L3WA 3H6GA 2J4DA 3G2JA 2H3EA 1XIVA 1PZXA 4US0R 4FYHA 1IQ0A 3EMKA 1QZZA 2X0JA 4MUHA 1N2JA 4AWXA 3FKQA 1XDZA 2RH9B 1YJCA 2WG2A 3L6CA 4O2BB 4C2AA 1O7JA 4CTMA 2IEZA 5IUJC 2JGEA 5EEGA 2Z08A 4WZAE 4JYCA 4FGSA 1EWTA 2P65A 4O1IA 4BVBA 4I1UA 1YRWA 1MENA 4B3MB 2FPWA 4ZZIA 2Y27A 1Q92A 3AVWA 2UZ1B 2CNLA 2GBLA 4TV9F 2NYRA 4MOWA 3UMGA 2VXCA 1Z17A 2MSLA 2RHRA 2VP2A 2IITA 3ET5A 3QNUA 3E9RA 3QUBA 4IJMA 2W70A 3ZBTA 4D98A 3K2BA 3DBRB 1I32A 2VSOA 1E4VA 4MRNA 5FI3A 3X44A 3CGWA 5EIEA 4RTMA 4YN3A 3GN1A 1P2VA 1FYDA 1LRLA 2X8BA 1DEAA 3AR9A 1Q20A 4XVUA 5K09A 4NOJA 4G26A 1BOFA 4QBGB 5FLKA 4CM1A 1O9HA 2II6A 4W5OA 1FMLA 1DJOA 1A1VA 3DV2A 2XCIA 3JARA 4YVFA 5E9WA 2DT5A 2O54A 1ATIA 1CZHA 1JILA 4QQ8A 1EM6A 3RHTA 3UUFA 3ZKWB 1NBAA 1M2GA 2GZSA 2B4AA 2DQKA 2QX9A 3AVPA 4KO4S 2Y1XA 2FN4A 4IVRA 5TQ0B 4DUPA 5D84A 4RW0A 3IUJA 2NLOA 3IE2A 4DLYA 1QP7A 1DJNA 1N9GB 1R5OA 2AXEA 2QPAA 4PC3A 4CT5A 5GAJA 5B12A 1NW4A 3MSCA 3NTQA 1Z47A 2WMDA 1XZJA 2W2LA 2V1XA 6LDHA 2Q49A 4JC0A 3T52A 4WN9A 4Y6RA 4FXOA 4ZHSA 4X3CA 1KU6A 3AL2A 4LOJA 2G1AA 3DG9A 3OLVA 1DQSA 2WUEA 1KZ1A 3I53A 1JDPA 1HEUA 3A70A 3OECA 4HGYA 3T8YA 4CDMA 1DDOA 1A2QA 3OFND 3DJYA 1FNDA 3ADOA 3HU1A 4I5FA 2G77B 2FW1A 1QCCA 1FU8A 4MRRA 1PGNA 4BNXA 5G40A 2F3SA 4MW7A 2OD2A 4ZP1A 1E9BA 1I1OA 4M4SA 5DGCA 4BJ6A 5EJEA 1FXSA 1XD2B 2GTHA 3C7TA 2YOHA 5HF8A 1GG2A 4LS3A 1LDEA 4FCWA 5KU1A 1DIRA 3BXGA 1YR1A 1FSPA 4Z5XA 2OLEA 2Y0CA 4W5RA 4UULA 3N2IA 3O82A 1KJ8A 1JLLB 1S5PA 4CF5A 4AJ9A 2MYPA 3NVDA 3ONEA 4WBXC 3OC6A 4ARIA 1MLDA 4GW3A 2VYVA 3V8NA 4IWXA 5H3LA 3DZGA 1F5SA 4OKNA 4G3XA 4PX5A 1QVWA 1VM6A 1I1HA 4RJIA 1GTZA 3GCWA 3JRWA 1CZOA 4MVJM 5EZQA 3OCXA 4ZALA 3KEQA 1ZI9A 2JFYA 4TYQA 3G59A 2PEZA 3U7IA 4F3CA 4YV2A 3GH1A 4URXR 1N2EA 1KMMA 1X1AA 2G88A 1M5TA 1U7HA 2ZJ5A 3C8DA 1VCNA 4TX1A 3ROMA 3I0ZA 3N0VA 4C22A 1CR2A 3JVDA 4XSHA 3SHWA 3QE3A 4D25A 1QYWA 1YD7A 2X23A 5ULLA 4J43A 2K5UA 2G5GX 3OEYA 2GWRA 1BWQA 4OSOA 5JS7A 1FRZA 3P96A 1Z26A 3HCAA 4UPVA 1A9PA 3VYUB 3IQXA 5LQMA 1P7PA 4UW9A 1JBEA 1YHZA 2RGRA 3I9LA 1HNZB 1W5TA 3DKPA 4D9IA 3H18A 1XEWX 1XRPA 2AI3A 5F1PA 2RBGA 5E2IA 5ALIA 3U5ZB 4BCDA 2Z98A 4OP1A 4U5XA 5C4MA 3R7BA 2BLNA 4HOYA 3GFRA 4A5SA 1RLMA 2YIDA 4D6XA 5I45A 1EXNA 1YDWA 4DAOA 2I6FA 3PNOA 5E3HA 4Y18A 3MYRA 3RUFA 3ZHTA 3CEJA 3I39X 1N2HA 3GW8A 5IFKA 3OE1A 1KMQA 4D6PA 3MERA 5AR1A 3GUYA 3FSGD 1GL6A 3GZ4A 1PHPA 1ZIPA 2DTEA 3PUKA 4YFYA 1E8NA 2OAQ1 3NI2A 1XCLA 4QA9A 5C4GB 4E2WA 3DB2A 1NU6A 4NS1A 1G5FA 3T1TA 4L76A 3FWKA 1F0YA 4HH4A 1FNSA 5IMSA 1OPRA 2XMPA 2X9LA 4NXMB 2PUHA 1IXSB 4BYGA 5JNVA 2VP4A 1BVHA 3HCPA 1YJXA 3PGKA 3ICVA 2QTGA 2ZUBA 3O93A 3OZGA 1BN7A 1VJ0A 5DYIA 4X62B 5JNLA 1L4HA 1Y9AA 1JFTA 1G60A 3CBGA 5FA8A 5I3CA 4YXFA 1WZIA 4LRWA 4R7ZA 2C57A 1N0VC 3F8SA 1Q0SA 3LPAA 4CGYA 4BNGA 1CUJA 4PGAA 3NGXA 4EFNA 2QLTA 2SNIE 3V1NA 2B34A 1J2JA 2OM2A 2XVYA 4ALLA 5K9ZA 1GN8A 3RUAA 1KWGA 4PHCA 1SUAA 2ODQA 5COQA 3MGKA 5MF6A 2BFBA 5EQFA 2QUHA 1VG8A 3WLIA 3I34X 2ZBGA 1CZNA 5FXMA 1PFYA 3RAPR 1K66A 2YZMA 4BZWA 4ZI7A 5J58A 4MYCA 4TTRA 3LDHA 3P4UA 4LRSB 4MH0R 2Y1LA 1GAEO 5IANA 3ROKA 1NBIA 3AEYA 2DR2A 1BEZA 3B60A 3VSEA 1GYPA 4XCXA 1KHHA 4C7BA 1WDKA 3TLAA 3IO5A 1P0QA 3EF3A 1YQDA 2YV4A 3EZXA 4UHDA 4DJEC 4DF3A 3U80A 3VC3A 4ZMRA 2UYGA 2PS3A 3OWOA 1GGKA 5ITWA 1BXGA 3Q98A 4Q7MB 3AZPA 1YWGO 2YZKA 4YBRA 1ZITA 4MEJA 4PX9A 3IKJA 1VHTA 2I67A 3LY5A 2R5FA 1T4BA 2Y92A 3OPNA 4UASA 4XR4A 1T1IA 3ZCPA 3PI6A 2PWPA 4HUQA 4YUAA 3VPBA 3S7ZA 5AIBA 1D0SA 1O95D 1SXJC 4ATNA 1D2EA 4L8LA 3G1UA 4TMWA 1QG4A 3GXBA 4C3VA 3HUFA 3KFXA 4TT8A 3TL2A 2IUYA 1T9HA 4C7KA 4QX6A 1GCUA 5E4FA 4IH4A 3CX3A 5K5EA 3WMRA 4EBFA 1OLUB 4BASA 4Z51A 3CKYA 2WI8A 1GEGA 2R7LA 1JRLA 5FULA 2EFCB 1K98A 2V4UA 2I4NA 2O5CA 1VJ1A 1AS2A 1SBIA 2XW6A 1BD4A 3H2HA 1FCJA 3EGVA 5T57A 1CUDA 4MX8A 2J85A 4A92A 3QU7A 3KZKA 3DEIA 3HNPA 3KZ1E 4LNHA 3AFNA 3WHKA 3QPWA 4H6XA 1ORTA 4X1IB 2CJYA 3RVRA 4YAGA 3UBTA 5J1SB 3SY8A 3L9WA 2GM9A 2XGGA 1YZVA 4TM7A 1J4AA 2GFQA 3ASYA 4W82A 1S3SA 2MWMA 4N0PA 2PL9A 5HK9A 2GSWA 4OJMX 3W77A 2O2ZA 3I76A 7MDHA 1U31A 2HREA 2P9BA 5K0BA 4HQRA 4FB4A 1QCDA 5JMOA 5AW6A 5KTMA 3SKVA 1AURA 1O58A 1FTWA 1E2GA 1HLFA 3AFIA 3HB9A 5FTJA 1RDFA 2PLWA 3DCYA 3SE0A 3L8MA 5FT9A 4DDVA 1G2PA 4P7BA 3VR1A 2HIAA 1H2XA 3K71B 4KH1A 1T91A 2O4UX 3EH1A 3KB1A 4OQ4A 3FFTA 4ESOA 8ATCA 1R2QA 3BZWA 2ZYWX 1J8MF 3OJCA 4OFBA 3C8HA 4YTEA 3RUEA 1CETA 1QNLA 2ORWA 1AMUA 1E9VA 2G0NA 5AKEA 2PTGA 4HXGA 1DBRA 1KAOA 1NNLA 5C53B 1AB6A 2R8BA 2J0SA 3DFZA 1P4GA 1B26A 3ORQA 4XCVA 1HWYA 3TSZA 1A04A 2Q3FA 1YUNA 3N39C 1UMKA 2OSBA 4HH1A 5D1HA 3HXMA 4R2MA 3RV4A 1BROA 5JAOA 4JN6B 2LIVA 2G36A 5PNTA 1OE0A 1J20A 1TYBE 1ADGA 1YHYA 4BLRA 2XB6A 2GNOA 2CK3A 5F12A 4RHFA 3GFQA 3DTVA 1YZLA 3MRVA 3BWMA 4R2LA 4CIBA 1VL2A 5DFAA 2TMDA 3PICA 4R98A 1V45E 5F21A 4AS1A 5KKCA 2X14A 3HXQA 5EJIA 3OD5A 1WW3A 3PNMA 3L7NA 3P9NA 1AKRA 2D8AA 2F17A 2ZIXB 3R0VA 4CLXA 3RF6A 3LUCA 4GC9A 5ILQA 3MF4A 4RIEA 3UMYA 5KZMB 1P3Y1 1RNLA 3H2ZA 4Q9IA 2E48A 1D6MA 4UE2A 3W8EA 3E70C 3STHA 2R6R1 3KO8A 3N8GA 4GBED 1OLSB 1Y89A 2BE7A 5DMXA 4GKKB 1LCIA 2WIFA 2WE8A 1F6DA 1C9YA 2FW7A 1YDFA 3VPCA 5K99A 5BYJA 2A0WA 2DM6A 5CFLA 2Y1GA 1SCDA 1FDIA 4GLFA 5IBRA 4DPLA 4RTOA 5L7TA 1UINA 3SR3A 3SOZA 1DDGA 3MTBA 2REXB 2Q0QA 3DEYX 3O3NB 4Z7JA 1PFVA 4AIIA 4MGZR 4WL0A 4Y2TA 1NW7A 1PQYA 2WMOB 4KZPA 5THKA 1M10A 2I6UA 4GYYA 4KE8A 1KFKB 2VP6A 2CY0A 1E2HA 2DG2A 3VDQA 3FMPB 3UJHA 2IBTA 2QTTA 4XGNA 2CN1A 3AEXA 3PX3A 1VE6A 3FJOA 2F8SA 4RHTA 5EKSA 5EIHA 3TUJC 2D1RA 4RORA 4MS3B 4G36A 5JS6A 1J5EB 1Z8FA 1XZNA 1F2UA 3PFKA 4MVJG 4B4DA 3TQIA 1E2QA 1R37A 2FHSA 2W71A 4EUFA 1MZPA 1BVUA 4ZPJA 2ZSDA 3E35A 5D5HA 1VXRA 3CSDA 2DBQA 5JZMA 1MJHA 4K9DA 3HA2A 4OAPA 1OQAA 1UFVA 2PJZA 1JXMA 3FY4A 3FB1A 3KR9A 4J76A 4MVWA 4OI4A 4V0LA 5CVUA 4CM8B 3HKDA 3ED1A 1JEEA 1XDDA 4E70A 4NR0A 2JFUA 1ZGZA 5CB4A 3S2SA 2H2WA 2XDYA 1NBMD 4NX2A 3S1LA 1EQAA 2XMBA 4ANFA 5IN4A 3PWZA 1G63A 5EPEA 3C3KA 4OQFA 1T35A 2EKLA 4L5AA 5JD4A 1DPGA 3EQZA 4MW2A 4R9VA 2VH1A 5DI3A 2D7CA 4GGOA 4FQ8A 1ONPA 4ZZ1A 2UXDB 3UICA 3OLYA 3GBPA 1E4OA 3OIWA 1OYYA 3SYLA 4E7PA 1S2OA 4HQNA 3H5IA 3EHDA 3O31A 4P5PA 4ODIA 3IP9A 4NCJA 3HKEA 5H70A 1OFUX 3CHYA 3L8CA 1V3TA 3E7PA 1ZHHA 2VHZA 4I55A 4MWBA 3QEMA 1YAJA 1XQ9A 3ILYA 2XMCA 4ARUA 3U6KA 1YQXA 1J09A 5CDUA 4TT3D 2VRCD 4HLCA 2P35A 4QU9A 1B16A 3EF0A 1WD7A 3QK7A 3D5QA 1DX4A 4N7JA 4ZVKA 4J4TA 5SYAA 4C29A 4QKQA 4LHXA 2UYYA 4A23A 4G41A 3IIEA 4ZAGA 1Y8RA 2A1IA 4P1ZA 2HZ7A 1XK7A 2IDZA 3BXFA 3LIIA 2RAUA 3O95A 1QQBA 4HNAA 4P36A 1ADYA 1R18A 3NO4A 2PUWA 3CR7A 4MB0A 4BV9A 2HJGA 4A2WA 1VHDA 4L1KA 2FJPA 3WR5A 1D7OA 1PWYE 2VDJA 2DQYA 1PJCA 3FNBA 4URZR 5AI0A 4ZCIA 3QX3A 3RAJA 4QQKA 4TWBA 5CM2Z 4P7GA 4BRZA 4JWTA 3PR1A 3RSHA 2FWAA 1GZ3A 1FS6A 1T5LA 2VN8A 3AKDA 2PKEA 221PA 3GZNA 4S0ZA 3WV5A 4N12A 2A9PA 2RHOA 3KVRA 2J09A 5JXIA 4ITUA 4LJ6A 4D5EA 1IHOA 4KAXA 1DC6A 5IKXA 2WU1A 4Z0TA 4F5EA 2O2IA 3EYWA 3IAUA 1DEOA 3L7OA 5CW2A 5FA5A 1N6RA 4W6ZA 3IDOA 1K5PA 2YCLA 1OR8A 5J47A 1NJ8A 4I50B 1E1NA 2HA6A 3WNDA 3P27A 2H08A 1WHTA 2XAAA 2H5IA 1ETUA 1AT1A 3EVCA 4GSYA 1T9GR 4K6HA 1Z13A 3UMJA 4L6IA 1F3OA 1I51A 3ZJTA 1F0NA 1HG1A 1N6PA 2OENG 3M2PA 3OLCX 2XTNA 1A8QA 1SHLA 3MJSA 2QN3A 4BMDA 4NICA 1BCRA 4MI9A 4TLMB 4G2NA 5EZYB 1QO9A 5DE3A 1SN7A 3PCTA 1NE7A 421PA 4FFPA 1THTA 4FNMA 4G63A 4RPGA 3KR0A 3M9XA 1ZD4A 1IRIA 1KJIA 3CF4G 1Z82A 3JWGA 4MITA 4ARZB 5KCMA 2BVNA 3GLSA 3MOSA 5GJCA 1FS4A 2BEVA 3RC2A 4ZQEA 2GRUA 1P75A 1VE3A 3DEKA 4MQEA 3SHOA 4KDCA 2BTQB 4G24A 4MLCA 4NXNB 1WHSA 2QUZA 4LVNA 4IZHA 2AK3A 2IY8A 1J8VA 3GPDG 3QLVA 1NX6A 2W2KA 3B3GA 4U39A 4QOIA 3D8BA 3MJRA 5H16A 3D2CA 2O6HA 5FJJA 2H00A 3V55A 3VPGA 1HBJA 2O1XA 4Q3KA 1EGAA 1YRBA 3A6KA 2PH5A 5AJVB 2VP9A 5EGNA 2GVDC 3T95A 4GKVA 2O8DA 2N42A 1GDDA 4IPTA 4Z4HA 1IDN1 3Q8WA 1NQXA 5JYCA 4J9VA 1P7VA 1DCMA 4E2ZA 3W8FA 4QSHA 3J81A 1ZOPA 4NOLA 5BMVF 1K6EA 4EJ0A 3TG8A 4OLBA 4NBUA 1E9EA 2ECOA 1DXOA 2OD9A 2OHXA 4LYHA 2PSDA 4CNQA 1KZYC 4PSAA 5CEEA 1CZKA 5DTRA 2IUEA 4ZI5A 2AI2A 2VDWA 3JQ6A 1N5RA 4PTZA 1LK7A 4J7XA 1D6NA 3ZK7A 1UAAA 1GG9A 2ZIAA 3FJYA 1YJAA 3LPDA 3MB8A 5FV7A 3TL3A 5ETJA 2QQEA 1GYRA 1NSYA 1BOOA 3GJ7A 2IE8A 1GFSA 2Q6TA 4FONA 1EK5A 4TWIA 2RI0A 3N6XA 4YCBA 4IZIA 4EPRA 3FPHA 3ISTA 3U7EB 1TL7C 3BFJA 1MXFA 2VNKA 1I1QB 3VSAA 1NW9B 1T0PA 3F5DA 3M3DA 6PFKA 1CYEA 1J25A 3DBHB 1N0IA 1T3ZA 4X60A 4PONA 2B36A 2QP4A 4RVCA 1E0JA 5BNTA 1KDPA 1VKHA 3KLOA 3L7MA 1UJNA 5FTMA 5A3JA 3GT0A 4U2DA 3C1AA 3PUHA 2PNJA 1B15A 1ZGHA 2QLBA 4ND7A 1F5NA 2H4WA 1CQIA 1QFMA 1YJ5A 2AFVA 5BVGB 3L7BA 3STTA 1DAPA 2JHFA 3DE6X 4WDRA 3RIYA 2FSVC 4BKQA 4Z49A 4YRSA 3FA2A 2O7VA 1WXFA 1OTXA 2B92A 1DBQA 3DVAB 2QRVB 5C8XA 4U0KA 1VKJA 3NOVA 4QDJA 3BZUA 1OA0A 1Z37A 3D4NA 4BN5A 1U3FA 1I6KA 1PLLA 2VNIA 2XKBA 3DMYA 4XIJA 2GEKA 2WSLA 5AHKA 3L6RA 3D6JA 1GOTA 1DEKA 2EL9A 5BVHA 3K05A 4GOOD 4HXYA 5EXDA 3AJAA 1CUYA 3O47A 2XUFA 1WCIA 5ARCA 1NURA 3W5IA 1BXRA 1Y1KE 4H4EA 2I91A 1XTKA 2H52A 5DYTA 1FBNA 1SEVA 4DWVA 3EGOA 4YJGB 3PXCX 1ZR4A 2ZTUA 1E2JA 1BHO1 2W2VA 3PNVA 1GDTA 2CYAA 1KDRA 1VLQA 3S2FA 2GS9A 4PGMA 4QASA 4O2RA 5GWXA 3W7BA 2NAPA 1E5TA 5HP4A 3I9OA 1OTYA 4AMUA 2GAIA 3S3TA 4MQBA 1FMTA 1IN7A 4AKGA 2JIRA 5AK4A 3WLFA 4C5CA 1AMNA 4ZV4A 4Y3UA 1QPBA 3R9WA 3P2EA 3BK1A 3Q11A 3ER9A 3U9LA 3TSYA 2ONZA 2Q7XA 4Q15A 1Q6YA 3IO3A 1R0YA 1TLLA 2BSAA 2VYNA 3PFCA 1UQTA 4ZQBA 3ROPA 3U39A 1DC8A 1KY4A 2BZ0A 2AN9A 4I55F 4K9KA 5DTQA 3RRZA 5AUNB 2FU5C 1UMBB 2PGJA 4M1ZA 3AEUB 4JBWA 1E2FA 5JAPA 3AJRA 121PA 3FCXA 4MWOA 3GLKA 4H7FA 2QVZX 3TIVA 2OXEA 5AUOB 4EK9A 4ZDWA 4WFKA 4BUJA 2AD5A 3V9AA 3BEDA 5HXAA 2WNSA 1D0IA 3E5NA 4O2BA 1THGA 1XWIA 2ZT6A 4QNNA 3DMFA 2FUG6 3ABRB 4LBYA 4UM7A 2V54A 4D92A 3ZJ4A 1H6AA 4CMEC 2GHRA 3F2VA 4MRAA 3ZY2A 1SU7A 2CXQA 3T9BA 4E2YA 3BD6A 2CVOA 2QMHA 1I6MA 1Z18A 2VNJA 4E22A 2Y2UA 3NTXA 1Y8ZA 1SXJE 4RENA 3R9IA 1CUGA 4Y2GA 4RZSA 2QYSA 3O1LA 2X9QA 2YW9A 1U0LA 1NVGA 1M2OA 1Q1BA 1ZXLA 1WX1A 2RB5A 5E1OA 4YP6A 5TSDA 1DJMA 2WIGA 4KPFC 1R4AA 2VAVA 1W73A 5LOVB 2W6OA 3A8TA 3M5DA 4CM9A 2GFIA 1KEUA 4M1MA 1ACMA 4RIGA 1EXMA 4Y2QA 5C5EA 2LW7A 4JUDX 1Y1PA 3ZX5A 4ZIRB 1BKYA 1PNRA 1GUAA 3IUYA 3MS2A 2OXTA 3OE7D 3T3PB 4GYJA 1N7HA 2IEIA 3DXXA 4OL0A 4RGBA 3ZBPA 2I5PO 1DO0A 1M9NA 5ALKA 4US1R 2CLEB 3FD8A 3JAWB 3FSGA 1NDHA 4CIAA 5BN4A 4JP8A 1SXQA 1U0OC 4X8MA 3O8CA 4EG6A 1NBEA 3K73O 3S70A 4FYWA 4J07A 1SG6A 5KVQA 4PO3X 4QGAA 2VSXA 1C0LA 4BVHA 4ENTA 4LF4B 4NYMQ 3X1WA 4YJ3A 1HT3A 9ATCA 4CMJA 1YASA 1ODLA 4BO9A 1SR8A 1G9TA 2CBXA 3LCVB 3A1FA 2FR0A 2IYRA 5CK5A 2WG1A 4EA7A 1RM5A 2P2GA 5LXTF 2IUFA 1N25A 3QQPA 3CF2A 4HEA1 2G4LA 3RO7A 4DMUB 4PZDA 1UC5B 1YNSA 1NHGA 1S7GA 2PXCA 4JB2A 2Z6VA 1NVMB 2VHJA 3ZBQA 3ZXXA 4ENRA 2HT1A 1CP2A 1GG8A 2JDIA 5EAIA 1F06A 1LJLA 1NA5A 5C8DA 4FFLA 1CFJA 3KC2A 5FO1A 5KQLA 2Z5GA 4UHJA 1AQLA 4LXYA 4MKFA 5KOHB 4MUYA 3VVCA 3ZU6A 4ZCMA 4BNHA 1JAZA 2YYYA 5LKRA 4HG2A 1R6UA 4H31A 1LY1A 4AKIA 1R0ZA 3GLVA 4G9GA 3UB4A 3NHPA 2A9OA 5F7JA 1QLHA 2PL3A 2Q6IA 3L7LA 1ZU4A 1XJWA 3KQYA 1YE3A 1N7GA 3D2LA 5AOAA 1Q14A 4LSMA 2W4IA 2NYAA 3CA8A 3C7CB 3MS4A 1NXOA 4QJIA 3V1LA 1BNCA 4YJ3B 1SVWA 3A04A 4FHGA 2IZ0A 1USGA 1L4BA 4A0SA 6ABPA 4DNPA 2I87A 4ARCA 3EYAA 3AF6A 3I23A 1SH7A 3KFLA 5KS2A 2V5VA 1F2UB 2BR4A 2A35A 2XZLA 2NTEA 5GTDA 2NU7A 4GR9A 5L6LB 3DOOA 2IF0A 1Z7YA 2Z9BA 3WLRA 4I0WB 4MP6A 5CX4A 3CJTA 2B8JA 4QDTA 4FSHA 1U9ZA 1OSNA 4U5QA 4AC9A 2HBRA 3BXPA 3K7EA 3WK6A 4XQ9A 3D8NA 3PLRA 2BHTA 3FCUB 2B94A 2AJCA 2Z09A 4NU8X 5CGZA 5HCNA 3T5AA 1MQAA 1B8NA 4MEBA 2CUZA 4R1MA 4RADA 1L8AA 2C4NA 3D0OA 4LJRA 3Q7QA 1I33A 4GZLA 4IVQA 2BBSA 1A7UA 2OCKA 3DVSX 1KO4A 2CL7X 3PUXA 4KMOA 1H6CA 1PSWA 1SPBS 3UJAA 4II7A 1Z63A 4JXZA 1ZGGA 1MVNA 1HNWB 1RPTA 3WTBA 4YONB 4I99A 4YNBA 1EBFA 2IYZA 5CFQA 3HWWA 2O3TA 3DZ8A 2NN3C 2VDPB 2Y05A 2NQ8A 1FW8A 4K9RA 3TO5A 1NF9A 2VPTA 3H1PA 4NV1A 4JENA 1Q3KA 4UVHA 3KXIA 3ZD9A 1P4HA 1MTZA 4BFZA 2PX0A 3SCZA 4E13A 4G5YA 3T7EA 3TJRA 2GBLC 3VYSB 1A0OA 4ZZ0A 5L4LA 3K9FC 3PBKA 4DCJA 4PLGA 1L4GA 4NONA 5L95A 3TLXA 4M89A 3TINA 1RPAA 4I19A 3NBXX 4Y30A 1DXYA 3G89A 1ZNZA 3TRHA 4YMVA 4IDCA 3LWNA 4EQZA 3TECE 3GL9A 2WILA 1KVTA 2J46A 4PZLA 4RMIA 1VI6A 4Z9BA 3UAYA 4V3CA 3G23A 3ITNA 5EP2A 2YJ5A 4LJYA 1UZAA 1DE0A 1FP6A 4XM0A 1SOMA 2RH5A 4DSUA 2NXWA 3AB7A 4BWGA 3ONNA 1EINA 1PSZA 2YRXA 3I2IA 1U9CA 4UUBA 4BQEA 5KSYA 3BTOA 2VQ6A 1QKKA 1QDEA 4ML3A 5DI3B 2VRWA 4DAEA 3OM9A 1E63A 2Q0XA 4KYTA 4QUHA 4ZV7A 5AD1A 2BGRA 4U7WA 5AVKA 3QFHA 4G0WA 1KAGA 1WQ3A 3ANSA 4J9UE 2E5WA 4KB5A 2EX1A 4YREA 4B7XA 1V48A 3SJAA 4M9SA 2WU4A 4IILA 2XKAA 3ZKAA 4ENWA 3BK7A 4PBSA 4XX0A 4Y2RA 1Z0ZA 1T0HB 1RD4A 1SJ9A 1E92A 3MWEB 3Q88A 4JASB 2HSJA 2EWMA 1A5ZA 1T2DA 1TT5A 2WG0A 5G3ZA 4M0LA 5EJ9A 4CTNA 4P3OA 3NYIA 3O7WA 3P9QA 5E4JA 4QWMA 3TQHA 4YPVA 2Z2YA 1X7YA 5AVWA 1XBTA 3NR2A 2B69A 1IU9A 1NDQA 2APJA 4V0SA 1ILEA 4KV9A 1Z5OA 4GPEA 4MP3A 3KZCA 1KAEA 2ZUUA 1V4NA 1JN0A 2IHJA 3OX2A 4OYRA 2I1WA 3A3PA 2NTNA 3R3YA 3F7MA 4Q03A 1SAYA 4UAJA 1RXWA 1CIJA 2FPUA 2H1FA 3UK0A 3SSOA 1RHQA 2LPMA 1ZQ1A 3HJRA 4RLFA 1R3UA 3NBKA 3ZCRA 5A7FA 4LWPA 1H2AS 3ILXA 1XMXA 2BM0A 2C9MA 4FD3A 4JUBA 3EDCA 5DSTA 5FPPA 3WNZA 4EJMA 2D5LA 5K3BA 1UH5A 3QX7A 3LPLA 1C80A 1U28A 3FVWA 3U3MA 3UMRA 2H54A 3G8DA 1BKSB 3DGEC 2WF9A 2GF0A 2YFKA 4QSMA 4ZCRA 4RC9A 2O8FA 5JAQA 3N0TA 5EERA 2FZWA 1SHKA 2P27A 1B3RA 3ENKA 4DHEA 5ICGA 4GNRA 1QV6A 7GPBA 1HURA 3BKWA 1I7SB 4FI3C 1J56A 4LE2A 3EE6A 2BHRA 5BPHA 3BYZA 3THRA 2O2JA 2WUVA 2HNKA 2HQ1A 1DJPA 3AUUA 5TJHA 4DV3B 3B5JA 5IK2A 5DHTA 3DT6A 3WHLA 4RDXA 1FDUA 3A0UA 2JBAB 2OORC 1EDDA 3O74A 1MZVA 1VSTA 1GZ6A 2ABWA 5D3ZA 5LN1A 3AF3A 4FXPA 4LUCA 3FDXA 3AI2A 2EG9A 2CUKA 2SBTA 4K6CA 2J7PD 4RQUA 4ZJUA 2C7BA 4M8SA 3HR7A 4W9RA 1RP7A 2YC2C 3CINA 5JLAA 4CM6A 4B3GA 4YCCA 1RWNA 2WT9A 1VA5A 4UE3S 4XDYA 5H9VA 5I6DA 2B5OA 3BWYA 3ZWBA 4NNOA 1AGRA 1SC6A 2BIFA 4U63A 4F3NA 3EWIA 1LRKA 1CW2B 5JD6A 1D6SA 1FEZA 5IAOA 2HMWA 2PSJA 3EMVA 2WYHA 1GARA 3ZDAA 4LC0A 4CKXA 5JY6A 4C78A 4JQCA 4L15A 2GVZC 1PIWA 1C3LA 2I78A 2HWUA 1KMHA 3C6BA 3LBAA 4EW2A 3IVMA 3FHTA 4EDHA 2VK8A 4AJHA 3SP1A 1LS6A 1MO6A 2X15A 4MB6A 4UCXA 3OQVA 1GFIA 3Q3EA 2QIOA 4XXHA 2CHVA 1NTOA 1PGPA 4TVSA 1KQFA 4HDKA 1OXVA 1TDJA 4BNYA 1X2BA 2XRYA 3R3UA 4BNLA 2YYAA 4P4SB 1YS2X 2D3TA 4PYNA 2AS0A 1U1CA 3JZAA 5HIAA 3BRWA 2H2FA 1Y81A 4BFCA 3W2GA 3BZBA 2ZULA 4D6YA 2EC5A 3NT2A 4JLPA 5FEMA 3NBMA 2GEBA 3BRCA 1JQKA 5LNK1 1RJEA 1Z4JA 4YT2A 5FPKA 4IS2A 1P0PA 2W2XA 4W9NC 1FZQA 5E3JA 2BBTA 1FJHA 5FPTA 4ZV9A 4IIJA 3FNQA 4NULA 1N3LA 3SBXA 2CMFA 3VI3B 4HK4A 2XMRA 4WCVA 2BFMA 2C5AA 2P5YA 1CDEA 3KQVA 4HN2A 4BOYA 1M1YB 1NFRA 2C9OA 2HA5A 2HUPA 2B25A 3OAAD 5LB2A 4Z2YA 1U3CA 2ZIWB 2N1BA 2AW5A 2NSDA 1USWA 3SOPA 2XOEA 2N0SA 1SXIA 2G8LA 2NXCA 4WQMA 2P9CA 4O4IA 2LD4A 3NTUA 3O2JA 3GUZA 3I45A 3TLMA 3WV4A 4A16A 4J0DA 1PVOA 4BBAA 3S5JA 3FTQA 3IBTA 1LX6A 4LYGA 2CFCA 5FUVA 3LW7A 2ZSJA 5B4VA 1RLJA 1B1AA 2PKWA 2ZDHA 4UHCA 4X1KB 4Z1MD 1NV8A 1J5PA 2NNWB 1CY6A 3FKJA 3Q40A 1WY5A 1U8EA 4XJSA 3E7WA 5HUHA 3TW0A 5K0EA 4HYQA 5D51S 4DR5B 2CL5A 2B6NA 3QXXA 4CCAA 4WK0B 5SV2A 1FDVA 1U8FO 2HN9A 2JI9A 3B1WA 3IEUA 4O2LA 4D81A 1N34B 3F46A 2P3OA 2A5YB 4UBLA 2D2EA 5C0OE 1AF4A 1XZKA 4FT4A 4UM9D 5TRTA 2BFNA 3C3YA 1L6IA 2YIVX 1Q1ZA 2Z3VA 1IPEA 4S1PA 4PIVA 3K8ZA 4Q93A 5H82A 4MVJH 3REFA 1MC5A 2B83A 2OFPA 3TTYA 5DGTA 4F4HA 1V5IA 3S8MA 2EZTA 4OI1A 1FMFA 3EW9A 2HJRA 3HUDA 3RYFB 5KQPA 1WTAA 3LLSA 4HLUC 1PTJA 3G2KA 1PJSA 1P0IA 1T9BA 1VCOA 5JI2E 1YJQA 5EE5B 3IBCA 5GONB 3B1JA 2G67A 4ZJPA 3FZGA 1MX1A 16PKA 4V3BA 1XMIA 2XB8A 4TZKA 1A3CA 3HB4X 3COJA 4A5OA 1Y4DE 3C98A 3Q9SA 1PZMA 2BM1A 5ALDA 4DJAA 3WGUA 2JIZD 4M7PA 1QIFA 3CLKA 1ZR2A 4A8JB 1PDOA 2H06A 2X13A 5T8KA 2SKDA 3C3PA 5ADVA 3RTGA 1WNFA 2O3SA 4XYLA 4B3FX 5TMEA 4JROA 4U2BA 4GO1A 5E1BA 4C4OA 1PWZA 1PTKA 2C4KA 2YV1A 4EFDA 3ZVNA 1RAIA 3U56A 1TKBA 1XSEA 2FMFA 3GD7A 4RPJA 1QG6A 3EHEA 4G84A 3ZGYA 3UJ9A 2NPFA 4DIMA 2WZCA 3P9RA 4IDNA 4GI3A 4DDKA 2O8VA 1ESZA 1ZM2A 1G8SA 2ZYHA 1UKZA 4F04A 3DE1X 4B4WA 1A2OA 1WW8A 2FZLA 4IM7A 1FFGA 3NX4A 2BMVA 2D0PB 2MR6A 2IXDA 3KUKA 4DZZA 5JRJA 2R6CA 4E5KA 4KXYA 3KOXA 2R8ZA 1M67A 3B36A 3HH8A 1CE8A 4MQFB 5I7AA 3C3BA 3DWEX 1DBVO 1JDBC 4DKJA 3N0RA 4PCLA 4DW8A 1WMDA 1QH1A 3LSTA 4GLJA 3H9JA 2QLMA 3G1TA 1KI9A 2OBBA 1NQVA 4OQNA 5L3SB 5I8ZA 1IXKA 1TEHA 3F6RA 4YLYA 2NV6A 1WL8A 3EVAA 1ENPA 2EFGA 4G0ZA 3IDZA 2ZANA 1K6MA 4CMEA 3O03A 4KGZA 5DYYA 4GXNA 2GZ1A 2ET6A 1E6LA 4QU5A 4A1FA 4X20A 5FTNA 1QVZA 2HZBA 2R6GA 1RP1A 2V03A 2YVKA 3F6YA 5FLEX 1Y9JA 2W8BB 3SX2A 2LV8A 2P2DA 3QHAA 4B6EA 2CC2A 1EHIA 1Z34A 1VPEA 1BA2A 1WVIA 3I5UA 1CG6A 1EJBA 3MLAA 4Q3BA 4EG8A 3FHOA 4XTRA 5L3VA 1UBTS 4OK6A 1IY8A 4EFKA 4EPYA 1D9ZA 2HHAA 2O2XA 4WERA 2E1PA 3K2EA 2UYOA 4CMAA 5IJXA 4HN4B 1HPLA 4UMVA 3HGTA 1QE5A 1VE7A 1KEZA 1HDRA 2E6UX 1Z56C 2IKSA 3OTWA 4G8JA 4IDHA 1E18A 4TMYA 5DU2A 2I3AA 4JJAA 4L4SA 5FCDA 3TPFA 3FR8A 3R7SA 3KJQA 4NARA 2J9ZB 1HSZA 4IJ5A 4Q18A 1J90A 3L82B 4UKDA 4BO4A 3VR4H 1L7EA 4M0MA 4RSHA 2ESRA 1MD9A 1YR8A 2K87A 2N3ZA 2HR1A 4IIYA 2Y1DA 3UV7A 2JAWA 4BY9E 1MOSA 3GK3A 3LQ1A 3WRYA 1VFPA 1XVVA 5IWAB 4B4KA 1MX9A 1XVTA 3D64A 1E7SA 3RVQA 1UT5A 3E0QA 3MPOA 2G04A 2O8EA 3D6NB 1QQ7A 2LDBA 1WKCA 3UAWA 3VVMA 1RABA 3GUCA 5JS8A 5F76A 4PG7A 4QYIB 2C99A 2AJTA 4YCAA 2RGCA 1G8GA 2QB5A 3AJEA 5E6UB 2MJLA 4QUKA 4TTPA 2R6AA 3T0IA 2P75A 2JGKA 1BVYF 2H2DA 1Z3CA 2QZJA 2ZWOA 5ECWA 3ZHSA 2HK6A 3BCUA 3QKIA 4DG9A 1EFHA 3AEQB 4O2AB 1JR6A 1P1KA 5BN4B 4P4UA 3AVXA 3NWBA 4B85A 1V9CA 5BV2P 4QECA 1LU9A 2EKDA 3DOCA 3V4OA 4B46A 1JMKC 2XYPA 3IT0A 3GHYA 1Z6QA 2UYHA 3PPXA 3QRWA 4Q7LA 1SVSA 3I8XA 4UZFA 3VNVA 3NQ41 1A9XB 3PYLA 2PZKA 3AUFA 4WLFA 4LX8A 1ZD5A 2EFEB 3UENA 3M6IA 4LNUB 1DXQA 1U4OA 5JCJD 4M8IA 1NXTA 2I8LA 2JCGA 1H5NA 4G89A 3ZGLA 2IEBA 1Q7EA 1JMYA 2I22A 4NJEB 1L9XA 4UTPA 2VBFA 1L6RA 4HUJA 4I3GA 2BMEA 1X7ZB 2WUDA 3NT4A 5C1DA 4RIIA 3LC2O 3ROTA 1H3FA 3F6BX 3L6EA 3LFTA 2XMQA 5CVJA 3G2LA 3FZEA 4YT5A 4ZVUA 4EECA 2HIGA 2VDRB 2WT8A 4LHZA 2O8DB 1ZVJA 4CG1A 1WDWB 2ZKIA 4E5YA 1W8DA 4JOQA 3PG5A 4DQVA 1T1EA 1A9XA 2WZQA 2ZW9A 4Q01A 4TRMA 4D8UA 4DVGA 3GLIA 4ZI7F 3ETLA 3FB4A 1DHRA 4EI7A 4YI5A 3TXAA 1NVAA 4QYWA 4ITVA 4P81A 5EE3A 2B7CA 3E5HA 4C6TB 4Q7EA 4DREA 3HEBA 1J0BA 3X0DA 1IL0A 1ZIXA 1NBWB 5DX0A 1YS9A 3P9PA 4GWGA 1PQPA 2OZEA 4IGKA 4DLUA 1BCRB 4FR2A 4RMGA 1ZSNA 5WRFA 4EW3A 3TRFA 3TPCA 2DX7A 3I6ZA 3QELA 5E6RA 4INOA 1N0UA 2X22A 3HV2A 1OKKA 3Q12A 4JXKA 5CDSA 2C2YA 4IRMA 1QTNA 2IZ7A 3OU2A 1WUYA 3ZCUA 1N5MA 2JJQA 1QB7A 3L7YA 3Q85A 3RIGA 4F3YA 2G4CA 3OUZA 1JSLA 4TXMA 1BXZA 1OZGA 1H2WA 2JHAA 4P53A 1TTPB 2YXEA 2RHLA 4Q02A 3C5CA 4KK4A 3KDAA 4Y9SA 5LZ9A 1UWKA 2HX1A 5K6AC 5T4FA 1JKMA 1Z0FA 2A14A 4U0JA 1E2BA 1T9KA 2KLHA 3DBRA 4QXQA 3ZCVA 3OZAA 3FKSA 3M6XA 3LC1O 3PPWA 1JQJC 1X80A 4Y1GA 5HX7A 4MIOA 1LV7A 2NV2B 4BKUA 3L8HA 4IDFA 1TCUA 3TLGA 4WOKA 1WIWA 2IYNA 2XB4A 1NLUA 1ZRHA 2P2ZA 3CNHA 3BXOA 2WA1A 1M6WA 3OU7A 2DPMA 4OHRA 3UV3A 4E32A 2XECA 4TYNA 4K6MA 1EGQA 2QTRA 5CDYA 1U2DA 1HL3A 1YMQA 3TLZA 1YV9A 3ED5A 2X3UA 1E89A 4M9XA 3WYFA 4C6TA 1JWLA 3P2IA 3O8OA 2CB9A 4MRMA 1A88A 5JECA 3O2QB 2RHWA 4F4JA 4WFQA 4EL5A 4H15A 2JFWA 3HB1A 1DT5A 2NUAA 3H75A 3E8SA 4G37A 4KEAA 3TCNA 4BMSA 3H42B 4DGSA 1C4XA 3DFUA 1U0SY 2V7EA 5EHIA 2QVGA 4TLAA 4FMDF 1LTQA 5ENZA 3COWA 2KM1A 1Y37A 1TTHA 4RD3A 1X3SA 3PT9A 3FIUA 2WAOA 3BFVA 2UVQA 4M0DA 4EELA 1ZONA 1OHHA 4M1WA 3B82A 4Q66C 5KTKA 2PD6A 3UWOA 1JAHA 4Y2PA 1UM8A 1X70A 1FP1D 2QBYA 5EZYF 5T4BA 4WJLA 1QX3A 3BJRA 5HUQA 5B64A 1F38A 1TM4E 2YYZA 1RC1A 1UAGA 1VE9A 4HAIA 3UXHA 2XA1A 1UBMS 2JIZA 2VK2A 1OGJA 4ZO4A 4LDNA 5A5DA 1E9CA 1W94A 4FW9A 3B2NA 4YMUA 1QO0D 3AZQA 2HLDA 3PKJA 3COSA 3MJVA 3R5XA 3CH7A 3AKZA 2ZE5A 4MR9B 2FPGA 5HKLA 1GUYA 1AK9A 4FOOA 4JLWA 2C3MA 1W0KD 3WZMA 3DD1A 3X2EA 3CRVA 4FCCA 4NTZA 3V4FA 2W2MA 1V1RA 4TRNA 4GMGA 4IZ6A 3QWHA 1MHPA 3KQQA 5F9FA 4U2EA 2M6RA 1XCMA 3DUFB 1QK5A 3D3JA 4FGKA 3QI7A 2F00A 2F90A 5BSUA 2GN6A 3A9WA 4DV2B 3KLBA 2IT1A 5ALXA 3AF2A 3DOFA 5LQDA 5KNCA 1UWCA 3GAZA 1CUIA 3CUWA 4GD3Q 3W2FA 2EFYA 2D5CA 1ESDA 4AWBA 1BFKA 1D4AA 4CFYA 5DO9A 4DUGA 1FFHA 2YDXA 4FYMA 4ZDJA 4C20A 1TLTA 4NHEA 4WK2B 2COEA 4ENUA 4L0MA 4RMNA 2I4RA 2LCQA 3OEEA 3PXAA 1MG0A 4FFMA 3V42A 2Y93A 1ZAYA 2W2LD 3JALB 4Q34A 4ZQIA 3EZNA 2J87A 1NSFA 4LI0A 1RBQA 2GK6A 1IQUA 4JUAA 1WUHS 1T8RA 2JPDA 4QTXA 3FPCA 1FFEA 1LDNA 3KKOA 4DSZA 4N41A 3HP4A 3T7IA 3F5SA 2XD9A 3CLVA 4J1TC 1Z5ZA 3ZHQA 1JKJA 5B4UA 3VR3A 1SU8A 5DISB 4YMWA 2EFJA 2EDCA 3C6ZA 3CMMA 4JJZA 4PLPA 4Q9HA 3RRBA 1UXGA 4EX7A 1S4QA 2PD4A 1KFEB 2NZ2A 1M0WA 3QP9A 1I2CA 2FG7C 3T3EA 3L02A 1YVPA 3U40A 3VJMA 1EIWA 3AY0A 3EVZA 1UMCB 4K05A 4PQYA 3O8RA 5ICEA 1V6SA 2ID8A 1A9RA 4QDUA 3TX6A 5AKGA 2FEKA 2XBUA 4J7UA 5TXGA 1M5RA 1L4KA 1MN6A 1Q0QA 4OQQA 5LQNA 3HCNA 2H59A 2XA2A 3HVJA 5E8RA 3SFTA 4YCNA 4TV9A 4QDXA 4ZVPA 5FUXA 5E38A 3F8WA 3UT5A 4EJSB 3HO1A 3BB4A 3NNDA 4D8YA 1JEYB 3LPMA 4UAVA 1Z36A 5I9LA 2DKNA 2GBPA 3HDTA 1L7VC 4UUNA 1CXZA 2IYVA 4UFNA 1D1QA 2BEJA 2DBYA 3JW8A 3RVKA 3LL7A 2HYIC 3LUAA 1OZHA 3A4VA 1IIBA 3I9NA 1YOVA 4U3JA 4EB8A 1RQGA 5F2NA 4TMKA 3RPEA 3F98A 4B2PA 4ERXA 4KTTE 3BRQA 3VR5A 3GNLA 4O25A 2ODTX 3BD9A 4WCFA 1SCJA 4FT2A 4AVYA 5JLJA 3TGLA 3MBKA 2WSIA 3TJZA 3IMEA 4IFBA 1DEHA 1PZGA 3ISJA 2ZI9A 2J9XB 2Q50A 3DZFA 3OPYA 4AQDA 4CTKA 2X6QA 1J8DA 3MAGA 3EXFA 5FBKA 3TJMA 1AIPA 1JWBB 4RVDA 2CW5A 3CX8A 2A5FA 2I0FA 3PXEA 1NM5C 3RJMA 3SC6A 4ASUD 3S2EA 1LX7A 2JS7A 1SKYE 1VG0B 2A1UB 4LDJA 3DKRA 4JYMA 3VR2D 3EA0A 4PC7A 2CMDA 2JIMA 5JAIA 2QR5A 3L0IB 2YMLA 3PPIA 4GPBA 5AMXA 5H8WA 2BE9A 2JVIA 2BF4A 1X2EA 2KI5A 1V16B 1IPHA 4MJLA 3W1VA 1XNJA 2W43A 3M0EA 4HXEB 4Y0VA 4RU1A 1NF2A 4KHZA 4Q0MA 3EPHA 2DKFA 1R8JA 3A6JA 4PAQA 5EYPA 3PHBE 4HDQB 2OMKA 1Z4PX 4XIIA 3UAOA 4JJIA 3I3OA 4BMVA 2JH9A 3G5UA 4N3BA 1Z2OX 3QU9A 4OA8A 3RSOA 3T1YB 1F9AA 1UJ6A 1KJQA 3HYLA 5JJBA 2IIQA 2KX7A 4U9IS 1OVMA 5E0OA 5IJ9B 1OX6A 1VMIA 4D02A 2ZATA 5EP1A 4JGBA 3KUXA 8ADHA 2XXAA 5SZIA 2AOWA 1DSSG 2AG5A 2AW3A 4KSBA 5EJ2A 5ALYA 2GHTA 2W7TA 3NNNA 3ZUPA 1VMDA 2C2MA 3D31A 4DSTA 2TMKA 1VHJA 2XGMA 4PSUA 2G25A 1JEJA 4OUDA 3FJ1A 3W6OA 2ADOA 2CNWD 1N9KA 2J3QA 3EFBA 1GY8A 1U94A 4XJTA 3GUUA 1XZPA 4PSKA 4NK4A 1H8HD 3KYDB 4BNDB 4DRZA 2DJIA 4E0BA 4ZYUA 5AVSA 4Z0NA 2WWFA 1G3RA 4X45A 2FLWA 2ZUCA 1DGQA