2OPBA

Structure of k57a hpnmt with inhibitor 3-fluoromethyl-7-thiomorpholinosulfonamide-thiq and adohcy
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
257
structure length
257
Chain Sequence
ASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWALRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phenylethanolamine N-methyltransferase
publication title Enzyme Adaptation to Inhibitor Binding: A Cryptic Binding Site in Phenylethanolamine N-Methyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 90
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.1.1.28: Phenylethanolamine N-methyltransferase.
pdb deposition date 2007-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2opbA00
4M37A 4C06A 1RJGA 1EAMA 5IKMA 1TW2A 5E9WA 2Y1WA 2YXLA 3KQMA 5EVJA 5F2NA 1WG8A 4QPNA 2EJUA 4Y30A 1WS6A 1XDZA 2FK8A 3BUSA 1JR4A 3FRHA 3ID6C 2ZBQA 4X41A 4CXMA 3FPJA 3DMGA 4QVKA 2PY6A 2WA2A 3FRIA 3KPJA 5H02A 3GJYA 5C0OE 3UJCA 5CCBA 2XYQA 3B7PA 1PJZA 1X1BA 1FP2A 3B3GA 3TM5A 1O54A 4RTRA 1XDUA 4XCXA 2FPOA 3EEYA 1X19A 1VQ1A 2PXCA 3TMAA 4C04A 5ICCA 1QAQA 2FCAA 4MWZA 3HA3A 2I9KA 2G71A 2DULA 5DX1A 3EVZA 3MCZA 2PJDA 5EMJA 3VYWA 4KIGA 1B42A 3X0DA 5EGSA 5ICEA 3G5LA 4ISCA 3OU2A 2GAFA 1M6EX 2PSSA 3MAGA 1VP9A 5EPEA 1OR8A 4IV0A 4U7PB 4XUDA 3TKYA 3AY0A 3Q87B 4HTFB 3GRVA 5FHQA 3CJTA 2ORED 4GOOD 4P7JA 5EC8A 1M0EA 3JWJA 4GOMD 2OXTA 3OZSA 5FUBA 2R3SA 3OZRA 4RX1A 5KQSA 3KHKA 3V8VA 2QE6A 2P40A 3KPWA 3LKDA 2YX1A 3I9FA 3NW9A 3R24A 5GM1A 1L3CA 3M6VA 5DM1A 3RIEA 4DCMA 4GBED 4E30A 5EOVA 2IH5A 2ZZNA 3LCVB 3LKZA 3PT9A 3FUWA 2VS1A 3OU7A 4LECA 5FULA 2IBSA 2FHPA 2JHCA 4P58A 2VDVE 5EG5A 4HGZA 2PGXA 3GXOA 4YV2A 3B3JA 3THSA 2XYVA 3OCJA 2AN5A 3CJRA 2FYTA 3O7WA 1INLA 1RJDA 2GH1A 3CGGA 1EQAA 1WZNA 4LG1A 3V97A 2P3LA 3OZTA 4X61A 5DTQA 3KR9A 3JWHA 5K09A 2AOTA 1QAOA 4K6MA 4PYOA 3GWZA 2P3QA 4LWOA 5K0LA 1JG1A 2JHAA 4OX9Y 2I6GA 4PYQA 5FQNA 3CBGA 5EZSA 2H11A 4FSXA 4FP9A 2XBMA 4DQ0A 1P1CA 4ER5A 2GPYA 3G8AA 3KR2A 1ZGAA 5CM2Z 4H0NA 4RSRA 2B25A 5C1IA 5E9JA 3DLIA 1TW3A 1KXZA 3IYLW 5HIMA 3TKAA 5EMKA 1WXWA 2OKCA 3CKKA 3IHTA 5MHTA 3LDGA 3WSTA 2IIPA 1QZZA 4PGHA 1FP1D 5KS2A 5FCDA 2AOTB 3KQTA 1BKYA 3JWIA 5GM2A 5CCXA 4IKPA 3HA5A 1MHTA 2FK7A 3K0BA 2UYQA 4BP1A 2QRVA 5BP7A 1YF3A 2YUIA 2ERCA 3E8SA 2CMGA 4FR0A 4OBXA 1JG3A 3BXOA 1UWVA 1O9HA 3BZBA 4PYIA 3BWMA 3HVIA 5EEHA 3CJQA 2B9EA 4RWZA 3MCTA 5FHRA 2AS0A 4F86A 5BW4A 5FA8A 1R00A 5CVUA 3KR0A 3UA4A 4F85A 3BT7A 5EHGA 7MHTA 3GRYA 5DRTA 3C6MA 3GDHA 1SG9A 5BXYA 2Z6AA 1U2ZA 4PNEA 2IBTA 3LGAA 2ZULA 1RI4A 3DULA 1F3LA 4OBWA 5HIJA 2GS9A 3E23A 3P2KA 5HFJA 4FSDA 2HWKA 3M33A 4R6WA 4KRGA 5HEKA 2NP7A 2O06A 3P8ZA 2CWWA 3D2LA 3L8DA 2NP6A 1YZHA 3C0KA 5KYGA 4PCLA 3CC8A 2PVCA 4CTJA 2Z6UA 4BLUA 1FJXA 1L3IA 4PYJA 5K03A 1BC5A 3BWBA 2O05A 3M6UA 2JHPA 2WA1A 2C7PA 1NW8A 3A26A 4ER3A 4YUZA 2IH2A 1NBIA 4RV9A 2AZTA 5C9ZA 4BLVA 3P97A 3REOA 2P8JA 4EMSA 3EMDA 3GRRA 1NBHA 3NVMB 5KQRA 3LBFA 1VL5A 5EQJB 1QYRA 3EVEA 4FGZA 4C4AA 3A27A 5LQKA 2UYCA 2PXXA 2ZBRA 1ZQ9A 4M7RA 5D1NA 4EQZA 1VLMA 2PKWA 3MTIA 4GC5A 4E32A 2XYRA 3TR6A 5FWDA 2QY6A 1JTFA 1ZHFA 5CVJA 3ME5A 3EVGA 1YUBA 3OFJA 2BM8A 1XCLA 2ZZMA 5DM0A 3HCCA 3LECA 3PX3A 4RTLA 1Y8CA 3NDJA 5E2BA 4BLWA 5DT2A 2HNKA 2EG5A 3EGEA 3BGVA 4RVGA 1UFKA 4CWAA 3DMFA 2I7CA 3LBYA 4HTFA 2HV9A 3ER9A 4KDCA 3NMUF 3B5IA 1VIDA 4R8SA 5DX0A 4HGYA 2B78A 3KQOA 2P1DA 5EIFA 3SMQA 3TFWA 4PIMA 4YV0A 1X1AA 2OB2A 3P71T 4HC4A 3G2QA 4YMGA 2QYOA 5K0GA 4POOA 3HCEA 2HMYB 5K0BA 5EHIA 5CIYA 5D1HA 1KP9A 3B89A 4QPPA 3GCZA 4X60A 4EKGA 4PYKA 5BW5A 2PWYA 4DMGA 5LQAA 1NKVA 3KKZA 1D2GA 2GB4A 3TM4A 1XVAA 1KYZA 5K0EA 4OQDA 2NXNA 2P3OA 3GRZA 1HMYA 3HP7A 4G56A 1T43A 1NW6A 1WXXA 1ZG3A 4AUKA 1XJ5A 3EMBA 3H2BA 2O57A 5DSTA 3SSMA 4GOLD 2DPMA 3TOSA 4CKEA 2CL5A 1P1BA 5HILA 2IH4A 4P7FA 1EJ0A 4M38A 1G55A 4RTOA 5DXJA 3C3YA 1X1CA 3G2PA 2AVNA 1BOOA 2C7OA 3S68A 3FPFA 5LR6A 5T64A 1RI5A 4DF3A 3OPNA 4F84A 4IV8A 3NJRA 2NXCA 4PONA 1FPQA 4E70A 3CCFA 3T7TA 4FT4A 4A6DA 4YUYA 2PX4A 2G1PA 3DH0A 5CVDA 4GC9A 2YVLA 5E1MA 1KR5A 4EVIA 1TPYA 2GA9A 4QQKA 2VDUE 3THRA 3VSEA 4O29A 2V74B 4R8RA 4WXHA 5JUWA 1O9GA 3A4TA 3FUXA 2BH2A 2OPBA 3PVCA 4GF5A 3BWCA 1KIAA 5GP1A 4AZVA 4OQEA 3NWEA 4B17A 4ER7A 3OU6A 3HVKA 2R6ZA 5FWAA 3UWPA 2BR4A 3TQSA 2ONZA 2WK1A 1YFLA 5DTMA 3R6TA 1NW5A 1UIRA 1G60A 3EEOA 3SSNA 3DOUA 3GRUA 4HH4A 3SVZA 2AN3A 1PRYA 5M5BA 3A25A 3NTVA 5EZQA 2OB1A 5G02A 3G7UA 4E31A 2AOUA 3LDUA 3PFHA 2ZLBA 1MJFA 2EX4A 3G2MA 1ZKDA 3GGDA 4E33A 3AJDA 4OA5A 5HIIA 4MQ4A 1N2XA 4AZSA 1QAMA 1JSXA 1NV9A 4RYLA 3R0QA 3UBTA 2Y1XA 3LSTA 2UYHA 2HR1A 3QV2A 3SX0A 2AOVA 1ZGJA 1I1NA 2QM3A 4RTQA 8MHTA 2YXEA 4Y2HA 1N7IA 5F2OA 1KPGA 1V39A 2PT9A 3BKWA 3I64A 3KQPA 10MHA 4KW7A 3FYDA 5T6BA 3AXTA 1D2HA 2AOUB 2EJTA 5EKXA 4MIKA 4E2WA 3DLCA 3P9IA 5EEGA 4DA4A 5JR3A 4IWNA 2PWPA 3HA7A 3C3PA 1P91A 3DXZA 1VBFA 2A14A 1XCJA 3FUUA 3MERA 5DSXA 1R6AA 3T0IA 3HCFA 4QVGA 2PLWA 3SM3A 1AF7A 3NWBA 4KDRA 4E2XA 3UJAA 1KHHA 3SSOA 1RJFA 3EVFA 1AQIA 1R8YA 5K05A 2ZIGA 3DUWA 2KW5A 3KU1A 4V0QA 3MQ2A 3P9CA 4FS8A 2XVAA 5K01A 3KQYA 2IGTA 4RTPA 4YUVA 5K0CA 3RODA 3BGDA 1KYWA 3HVJA 2BM9A 3SR4A 1SQGA 4QDJA 4CKBA 3FTDA 2VDWA 3KPYA 3HNRA 3LPMA 5EMMA 5LQUA 2JH8A 5DM4A 5IH3A 3B3FA 3I58A 4WVLA 5EKUA 4FT2A 3FPGA 3UJ9A 1Z3CA 9MHTA 1XTPA 3LCCA 5DXAA 1JQEA 2F8LA 1D2CA 2IP2A 3M70A 3M6XA 3UZUA 4DKJA 1G8SA 3LX6A 3FPEA 4HG2A 1DUSA 4RTNA 2B3TA 3G5TA 3HM2A 2EFJA 3QOWA 3VC2A 5EIWA 1JQDA 2OO3A 1G6Q1 3GNLA 2I62A 4PWYA 1L9KA 5ICGA 3A7EA 1VP3A 2AVDA 4X1OA 4L7VA 1XXLA 3NVKI 3G89A 2PBFA 4RTJA 4KIFA 4KWCA 4ATNA 4DCGA 3BGIA 1VE3A 2YTZA 3FYCA 2ZSUA 2V7EA 2OBFA 4NECA 2LD4A 2AOXA 3HVHA 3KPVA 2NXEA 3RW9A 4PINA 4AZTA 5EMLA 5K0FA 2K4MA 3P9NA 4KVZA 3GIWA 3KQWA 1Q0TA 4RVHA 1Q0SA 3GO4A 4BP3A 2JJQA 3E05A 5DX8A 2ZIFA 3O4FA 4PYLA 5HOQA 3KQVA 2O07A 4DZRA 3P9KA 2O0LA 5E9QA 3KPUA 4HRAA 3EVAA 4GUAA 3EGVA 4QDKA 1HNNA 1NW3A 1WY7A 3LHDA 3DXYA 2NYUA 3O31A 4OA8A 4QTUB 1I4WA 3UFBA 1NT2A 4RTSA 3HCAA 3QOXA 5GWXA 1R8XA 5CVVA 1G38A 2JH9A 4AX8A 4JXJA 2UZ4A 4R6XA 1P39A 3FTEA 1H1DA 1IXKA 3UJ6A 1G8AA 2B2CA 3EPPA 3EVBA 3M6WA 3HCDA 4RVFA 3MHTA 3FTCA 1QANA 5DRYA 5E8JA 1SVUA 5E1BA 3EVCA 2CMHA 4GEKA 4C07A 1SUIA 5P8WA 3ER8A 2PX8A 5K8VA 1ORHA 3OE5A 5E8RA 1VPTA 1L1EA 2VZ9A 4XUCA 2NXJA 5DTRA 4ZTBA 1I9GA 2XVMA 2ZIEA 4FZVA 2AOWA 4GQBA 2IFTA 3A7DA 3ELDA 3I53A 5E2AA 2IDJA 3PS9A 3G8BA 2P7IA 3IEIA 5GIOE 4AZWA 3FUVA 5CVEA 5ICFA 1X1DA 5E1DA 4PIPA 2G8NA 1RJEA 1RI1A 2FRXA 5DM2A 3F4KA 3G2OA 1DL5A 5LQCA 3P2EA 1AQJA 3CVOA 5KVAA 2AN4A 4MTLA 1SQFA 2BZGA 1FBNA 4RTMA 3G88A 5T67A 3DXXA 4CTKA 2JG3A 3ELWA 3LL7A 2ZZKA 3OFKA 2NNWB 2VP3A 3FPHA 1SKMA 5FQOA 3C6KA 4YMHA 3UJDA 5ERGB 2ONYA 2PX2A 3UA3A 2Z6QA 1JQ3A 4PYNA 4GOND 1L3BA 4P7KA 1EG2A 3DMHA 5LQJA 5FTWA 3ANXA 1IY9A 5K0JA 3NDIA 1YB2A 3I5UA 2YXDA 1IM8A 1ORIA 3ORHA 4P7GA 1N7JA 5CUQA 2UYOA 4Z2YA 2P7HA 4YUXA 1DCTA 3T7SA 3UJ7A 1EIZA 3KQSA 5LQNA 2YR0A 2PXAA 4RVDA 3KR1A 5GOZA 3PB3A 3HEMA 5FA5A 1YZ3A 2C7RA 3R9XB 5B1SA 2H1RA 3KQQA 3PTAA 1XDSA 3BKXA 1KPHA 4X63A 4C08A 1JSZA 4QTTB 3MTEA 2H00A 5HZMA 3BWYA 5K0NA 5LQRA 4BY9E 2E5WA 3OE4A 3SXJA 3LCUA 1JG4A 2PT6A 3DR5A 3PLAE 3VC1A 2ZCJA 1R18A 2G70A 3P2IA 2ZW9A 3ELUA 3E7PA 4LWPA 3ELYA 2ZWVA 3PX2A 4ER0A 3K6RA 5LSAA 5E1OA 5DWQA 4HSGA 2GLUA 4PCAA 5U4XA 3UJ8A 3MB5A 2N47A 3HCBA 1NE2A 4E2ZA 2OYRA 4E2YA 3DTNA 3U81A 2ZVJA 1JTEA 3FZGA 2PX5A 3EGIA 2BR5A 2ZTHA 3UJBA 3GU3A 5F2KA 4CKCA 2IDKA 2ESRA 4EKIA 3MGGA 1R74A 2HTEA 3AXSA 4R05A 3TLJA 5HIKA 3T7RA 4PYMA 4YV1A 2CKDA 2QRVB 1F38A 4PGGA 4XUEA 4EK9A 1YFJA 4MHTA 4UOEA 3JWGA 2OZVA 1M6YA 3PFGA 4V0RA 4YUWA 3R3HA 3HTXA 3AWIA 4U7TB 1AV6A 5GINE 1NV8A 1EJ6A 3DP7A 2ZFUA 3FUTA 1KPIA 2G72A 1SUSA 1NW7A 1RI3A 4ER6A 2BR3A 5CD1A 3EVDA 3ERCA 3FTFA 2OY0A 2Q41A 2ZBPA 3Q7EA 5DLYA 1BHJA 2C7QA 2IPXA 3IV6A 2ZWAA 3TPZA 3TRKA 3M4XA 4RTKA 1RI2A 3LDFA 5DPMA 2P41A 4M36A 4C03A 2ADMA 3SGLA 5GIPE 4QQNA 2P35A 2PV0A 4C05A 2AR0A 4A6EA 1JG2A 5FADA 4DM3A 2YQZA
chains in the Genus database with same CATH superfamily
4PBTA 4QOEA 1MNQA 3K5IA 1IQRA 3U3JA 1ZH0A 4KN9S 4S1PA 3ZHYA 2DWCA 5F2NA 3I5XA 1AHHA 3MWGA 4FNMA 2HHCA 1BA2A 1ZZGA 2VQ3A 5D00A 4CM3A 1NX6A 1X2EA 3V3KA 3V2UA 1PK7A 4PZCA 3KOWA 4RA9B 3T0GA 4I0WB 1A2OA 4O08A 2PK3A 3DE3X 1WDMA 2JFZA 3MRVA 1RWPA 3NEAA 5DCYA 4F3NA 3K6SB 1DEAA 3CRW1 4E5PA 4FDTA 4ZGGA 2ZYGA 4C04A 4QELA 4MWZA 1CEQA 1YUMA 5FA6A 1SC3A 3OZUA 1TO6A 1QO0A 1U0NA 1QGUA 1Z36A 1MT3A 1NI4B 1Q16A 1YZUA 4WLEA 3VR4H 4W5OA 1SWWA 2JNWA 3NYQA 5ITVA 1ID1A 4EBBA 2JAHA 5JNTA 4RZSA 1CUYA 2YL2A 1PZNA 1I0IA 2BEWB 5HK8A 2HO5A 2Q3BA 3U7JA 4ARCA 2AI2A 3T8YA 4GOMD 3PJGA 3TL6A 3OMWA 2VSOA 3DUFA 3PNQA 1ST2A 1RWVA 1ZONA 2BDEA 2CXSA 3NW9A 3M6FA 3X2FA 3DT6A 5SZIA 5EHXA 3EB9A 1EDDA 3OJFA 2A9VA 4MICA 4DCMA 4OXXA 3RJ9A 3R8FA 3FMIA 2VS1A 2XCTB 1GPJA 1R3DA 1ZD4A 2Y76A 1JJVA 2VDVE 1URPA 2DOKA 4TKMA 3O93A 4N3BA 1JAXA 2SCUB 3W06A 1MC1A 4OAPA 1UOEA 3HUDA 3A31A 5A9RA 3ETEA 3FJYA 3ICOA 3PDCA 3C3EA 3VZRA 2XNJA 1D2AA 4XM1A 3VOSA 1YGYA 2V0NA 3IP3A 2UYYA 3GZJA 4X61A 4WKNA 4P33A 1CT9A 1L8LA 3JZFA 4NU8X 1RRPA 4Q5IA 5KTSA 5CNMA 5G3YA 2UZ1B 5BNWA 3E6AA 4PYOA 1J07A 2GHRA 4J0EA 4NNJA 2YDXA 3W7VA 4BUZA 2PTHA 1JQKA 3BORA 2FUKA 3G0DA 3TIVA 3EG9B 4E5SA 2EWVA 3G8AA 3AILA 3TUIC 4J07A 2ONJA 1GGNA 4OIMA 4C5CA 3T6KA 1SQ0A 2ZB2A 1TUEA 3O2JA 1EFAA 1NXWA 3MILA 1N34B 1O5OA 2OORC 4EW1A 1UF9A 3OLQA 7REQB 1IQPA 2C2BA 2QT0A 3MINA 1B4DA 1RYDA 1SOUA 1B7GO 3MC1A 3OMLA 4FMCB 3IHTA 4KLCA 5J5CA 5ULLA 3RCBA 4L07A 3SC2B 3WSWA 3ON5A 2WSBA 3NJ8A 1FSZA 3NTRA 1JRLA 1MIOA 3MD0A 3DBRA 1VG9B 3GRPA 4GE0A 4L27A 5L45A 1FMLA 4IYRA 1ULZA 2PVPA 2QRQA 1DJPA 1QKKA 3VA7A 1JFFB 1W1WA 3F7NA 4JT8A 4LNHA 4F3RA 3ACCA 5LVAA 1IOLA 2VATA 1KO8A 1AXEA 4N0QA 4EUFA 2VJDA 4EJSC 1F51E 4M9QA 3WFIA 1P4HA 3BT7A 4LV5B 1RE1A 1E98A 1DIBA 1R4AA 3PQ4A 1ODTC 1XMVA 2ZI4A 4NBSA 4NYJQ 4DCOA 1GKLA 1KFBB 1HNZB 3HPQA 1D9XA 4JC4A 4WZBB 2HV8A 2X1HA 3INGA 1XTKA 2O06A 4H18A 5CT9A 4AAYA 1W36B 1BOFA 3L0CA 4QUKA 4B5LA 1CY0A 4QLOA 3CR3C 4LXXA 3CC8A 4EYOA 1HUQA 3O1HB 4EUSA 2FWJA 4OKIA 2YJNA 1L3IA 4UHJA 2HYDA 4I9GA 1QGOA 2ZRMA 5TVKA 3Q72A 3WWYA 3U61B 2WA1A 3DL2A 3IURA 2NU9B 3FAKA 3C6ZA 1NL3A 2ZJ1A 1G5QA 2ONCA 3M8KA 4F5DA 3PRYA 3DTVA 3TBKA 4O4JB 4ZWNA 3WGNA 4RORA 2PRIA 1G8MA 2QQFA 3R9KA 2QUZA 4DE5A 4Z7JA 4IMIB 4ONEA 5AVOA 2B0JA 1AKNA 1GYPA 3E9MA 3VPBA 2HIHA 2I3GA 3L6RA 3MTIA 1F3OA 1LSSA 4RZHA 2VZ0A 2YFHA 3TUZC 1UP4A 3VHXA 2P91A 4MSUA 3ZY4A 1ZN7A 3WBKA 4DL9A 1HEIA 4OJNA 5I51A 3D7NA 1YUBA 2J0SA 4D5EA 1XMPA 2Q9AA 4K0KB 3K0HA 3N1UA 3N2GA 4B3HA 5K8TA 2HNKA 4YMWA 4WX2B 2JAWA 1P19A 2PS3A 1GA4A 2ZE7A 1E2UA 1P8JA 1Y1TA 2WT4A 3DNPA 4KDCA 3ZH2A 4KO3S 2A9RA 4IHJB 2XD9A 2WSMA 5D7BA 1E3IA 2NT4A 4TQAA 4JK3A 3BMXA 1COZA 3G2QA 4IICA 4H7PA 2GBLC 1DOZA 1UKAA 4UBJA 2LZ0A 2XW6A 3C7DB 4R4JA 5F4ZA 3V8EA 2HMYB 3WLTA 2OBXA 5T4FA 3G8YA 5D5PA 1KP9A 2TMYA 2NXWA 4G5RA 3TTYA 1UBRS 2XUOA 1GPWB 4KE6A 3GOHA 4ZTUB 4WCDA 1EFHA 2AYZA 2OV6A 3MJEA 3Q3JB 1ENZA 4YQEA 1CZHA 4JLUA 4BVJA 1DG1G 1IVYA 2X0IA 3A4MA 1QH1A 3E48A 3W5CA 1MB3A 2YYAA 1WUKS 3AUTA 1GKUB 2A0UA 1NPDA 4LRWA 4WXEA 3LUJA 3QWIA 5JMPA 1LFDB 2JGEA 5ALKA 4GX0A 1SIOA 2V6MA 4FHGA 2OA0A 4OBEA 1JDSA 2Q6LA 5IDXA 2QUKA 2BF4A 3OZIA 3E0QA 3R5JA 1X7YA 2FMTA 3GOQA 1F4LA 4MMZB 2XQKA 4CM4B 5KQLA 3G82C 1PBNA 3FN4A 3VZCA 4BX9A 4QFDA 4HD8A 3ESBA 4EG8A 3Q3HA 2XQJA 3FTPA 3L8HA 1VBNA 2FN8A 5I7SA 3S68A 2W0SA 5J23A 1Z5UA 3QFSA 2JGLA 1ZR4A 1LDNA 2YV1A 4PONA 1VKNA 3LK7A 4E7PA 1XXHA 2BISA 1VCHA 1UOQA 3E5MA 3PDIA 1J8FA 1U2GA 2A9OA 2J9FA 2PX4A 3QGMA 5G40A 5IT5A 3O82A 3QU4A 1V48A 3T3OA 4E0BA 1FPMA 5KYVA 5ALYA 4LZJA 1HZJA 1YQXA 3OFND 1NVFA 1Z2OX 3A4TA 3KCNA 5DTJA 5HFNA 1XDDA 3U48A 3KAJA 1KIAA 1JZQA 1FQKA 1WIWA 1N2CE 2CXPA 3MYRA 4B82A 4UTNA 2R6ZA 2ZSKA 2BTQA 1HQCA 3GHHA 4WLNA 2WK1A 2ADOA 2JBAA 4D02A 2QMUA 2X1VA 2J6HA 3ZW9A 1RBZA 3PFCA 5LM3A 1TQHA 2EFYA 4TLAA 4C4YA 4TV9A 1CVIA 4DMMA 2HSJA 3LFTA 4JBHA 3DC7A 1CC1S 3B38A 2EF1A 3DCIA 1BYIA 3QYAA 1V9CA 3GIDA 3OX1A 1T2DA 1Z4QA 3DFKA 4PLWA 2QBYB 4FKMA 1RNLA 2ZB8A 3CZPA 1QVVA 3L8EA 5E7MA 1T36A 1XTJA 1ZD3A 3RYFA 1JSXA 2K87A 3D02A 3P27A 4A0HA 2GLXA 3C3DA 4CIYA 4H17A 4JI7B 4RCYA 3JQ8B 3VTAA 1T9AA 3PC4A 2O5CA 3U39A 3BAFA 1BO6A 1ESZA 4AKTA 1R37A 2XECA 2QYSA 1MO6A 1NVWQ 1VPVA 2Z1MA 1RU3A 1I3CA 2BBWA 4KFUA 1SKYE 1G6HA 4Q4CA 4WOBA 1U3DA 4GP6A 3BSFA 1P5ZB 2FE4A 4CQMB 3ZDBA 1K7SN 1RLUA 1RM4A 3AT1A 1SURA 1AE1A 1RCUA 1GT6A 1U0HC 1W29A 2QWXA 3ESRA 1KKMA 3CE9A 3FUUA 1GPMA 4MUBA 1Y8QA 1RRCA 5TGDA 1ZRHA 3MSCA 1KZGB 1WP9A 2I1VB 1PX2A 3B1YA 4IDBA 2EG9A 3UJAA 1OJ7A 4HGQA 3HB9A 3U1BA 2G7MC 4AC9A 2QYHA 2KW5A 3N53A 3OICA 3A1TA 2YWEA 4X6XA 4EMUA 5ES3A 4RTJA 1CETA 3LP8A 5JH7F 1P5JA 1Q1BA 1JF8A 1FLDA 3QEAZ 1LLUA 4C3UA 1JDVA 4HV4A 3E4DA 2HLDD 3KVVA 1J22A 3RSSA 5DI3B 3TAUA 3FTDA 1X74A 621PA 4G4SP 1E1CA 1ORDA 1TA0A 1XALA 2JHGA 3P96A 3K70D 1UK6A 1CZLA 2RAUA 1C9EA 2JH8A 5B3KA 2A1UA 4S04A 3RTCA 1ADBA 1N5LA 1T8SA 2DRIA 4I6JA 1OGJA 2HK6A 5KX5B 4BBPA 4DKJA 3VZQA 3W6PA 2RJOA 2FZCA 3G3EA 4RW0A 2BBSA 5E6SB 4KRFA 2GN6A 4II3A 4LS3A 2H31A 5K5EA 4FQ8A 3P9YA 2AD5A 4QATA 4CMAA 3GVPA 2CNWD 3EXEB 5G2OA 1U8TA 1MEEA 2PQ6A 4OLBA 2H6EA 3QFHA 1VPDA 5L9AA 1BMQA 2P2DA 2CNLA 1KY2A 1Z4KA 1TJPB 3N70A 2VJLA 1YRBA 4L5YA 2V0CA 1NDQA 1OFIA 2VWQA 3I6QA 3PCXA 1ZI6A 4YAJA 2CV1A 3L0SA 3ZGLA 1BKDR 2FF7A 1VMAA 1SBZA 1Z2AA 2NXEA 1O4WA 1P2FA 3CF0A 5FFNA 4QGSA 2CV2A 1LX6A 3P9NA 5LZ5A 5FI3A 4CBVA 4LQDA 1QOQB 2XNCA 1WTCA 3BJIC 4OMDA 5A4KA 4DQLA 1Y3BE 4JLOA 1Z6XA 4QAQA 1R0ZA 1U8FO 1VE9A 2NSYA 1G4AE 3IPLA 3KAKA 4PZZA 3X1JA 2JDID 1KARA 4F93B 2OLEA 2ZRBA 1EQUA 2CDAA 5L3SA 4X20B 3AETA 1KY3A 1J8VA 2P4QA 3SJUA 1E5VA 1ZVVA 3MTDA 4KTVE 5CVVA 5FAKA 2IT1A 1XCBA 1H6AA 2O2EA 2TMGA 4GBJA 4MGEA 3ZWMA 4B3XA 2I7DA 5IABA 3FTEA 2VK4A 4G5SA 3MMSA 4NBUA 1EWKA 2P11A 3EPPA 3EVBA 3D4NA 4GNKA 1E5TA 2F8MA 1YZLA 3DW3X 3KB8A 1PSWA 3VO1A 1IZ0A 2P6UA 4A73A 1MA3A 4MQUA 4C07A 4DV0B 1GQFA 2C82A 1GP2A 4JC5A 1YE5A 1RR6A 3O8BA 1ORHA 5T3UA 5D3KA 4F2PA 5IJXA 1JEQA 4NATA 2PZ8A 3C6QA 1PD0A 2D4HA 4JGIA 4Z3KA 3A7DA 3E1GA 1DWOA 2Z5GA 3NKVA 2QTNA 4P82A 4R0MA 3EFOB 4JJGA 3KLNA 5J5AA 1AU9A 3ZLVA 3SS9X 1RPAA 3EEFA 1Y81A 2Q27A 1KP3A 2E0IA 2ZUCA 4F5ZA 4Z1MD 2VF5X 4W7SA 3G2OA 3N8GA 4B46A 3MWDB 1WZEA 3K53A 4HB3A 4XRRA 1AQJA 3UJNA 3UY4A 1ZI9A 3GQBA 3MBKA 1SQFA 3U4GA 4BLPA 2GESA 5T67A 3ZTYA 3WTCA 3JW8A 3GAFA 5IXJA 3VSDA 3HN7A 3OFKA 1BW9A 1XMIA 3D7SA 4H6VA 3VM6A 1KJQA 3HWRA 3PFBA 4L5CA 2YHBA 3RBAA 2ZE6A 4AMVA 5KTYA 4UU0A 4XLTA 2GR9A 2Q9CA 1X6VA 4DWOA 1UJNA 1U1DA 2AQKA 3G1WA 4OYYA 4YAFA 4F86A 1GRVA 1GZDA 1PG0A 4JP8A 4ZGBA 4Y2TA 4QBFA 4AMBA 1BHSA 3S8MA 2Q07A 3QEBZ 2C00A 2V96A 1C5KA 1Y4SA 1KVSA 4MV8A 4BX2A 1BA3A 1DQPA 2OCYC 2JCXA 3H5NA 4XI9A 1KPHA 1Y3CE 2X7HA 1F4VA 1KFJB 1IU9A 3DOHA 1QJ4A 3JAKA 4DG9A 5KTRA 2HCFA 4RY9A 5EJMA 3LCUA 2XKJE 2F2TA 5AI0A 1OCEA 2EW2A 1YQ9A 4MVJH 5J40A 4ZVLA 2AEFA 3WNCA 4NU0A 4D46A 4PR3A 3DDNA 1Y3FE 3C8ZA 1U2GC 1EFKA 1W4BA 1K89A 4K81B 5H16A 3UGQA 4X92A 2EL9A 1U9JA 1GZ6A 1Q6ZA 4DSZA 1I0LA 2QLBA 2PH3A 1BQEA 1FSFA 3IS3A 5I3ZA 3S1LA 3HDHA 2KMLA 3DB1A 5AVVA 4RIHA 1WAMA 4IY1A 2R6GA 1KS9A 2R5WA 3EA5A 2BM0A 4ZANA 1XZLA 2XQVA 2AI3A 3DTNA 2OYRA 1PKEA 2WSLA 1EGAA 2M6RA 3WO1A 3ZCSA 4ERXA 4F45A 4C6TB 1KMCA 2IDKA 3HFRA 1U7UA 4R1NA 4C5AA 1EFVB 4ZYYA 5AW2A 3ZDDA 3MWLA 3F1LA 5ITZB 2RK6A 4UDXX 5JATA 3IBCA 4PZYA 4EHAA 1P2UA 2QVGA 5TQ2B 5PGMA 1E0AA 5L53A 5EL0A 4Y6PA 3OH8A 1UFQA 1AJEA 3JWGA 2PUEA 2XMPA 4IQFA 4RBNA 1YDWA 3MOIA 3KK0A 1GITA 3TCXB 1E58A 2OHOA 4JI6B 1C3LA 3WMWA 1T9KA 3UWMA 3DP7A 1S8NA 4TTVA 4AKEA 2PS0A 3BOSA 4HL6A 4OB8A 5A04A 1ZGCA 3ERCA 3T3DA 1CY6A 4IQGA 2Q41A 1UKBA 2FEMA 4PC2A 2HZ7A 4EAAA 3QXSA 4F6LA 3TRKA 2OUKA 2R1TA 3B53X 5CLFA 1XYYA 2OHXA 3C7CB 2F3QA 2Z5LA 1SUBA 1ZIYA 1YI0A 5AOBA 1DBIA 1S2GA 2FN7A 3IMCA 2EZTA 4B6RA 2QROA 2BI4A 3VZDA 4A6EA 5HKOA 3DQQA 4NOJA 4HGRA 2YBEA 2YQ4A 2HL6A 3R5FA 3DMDA 2W6QA 4G81A 4DM3A 4ITVA 4NCAA 2I65A 4KQ6A 4DCSA 5CEJA 1J6UA 1I2ZA 2QDXA 3FY4A 2WWHA 2XCRB 2NZVG 2Y1WA 4MEBA 1TZMA 3KQMA 1OXBB 4JMLA 2D1SA 4IXDA 3U9TA 1C9KA 4IJMA 5IBRA 2NPIA 4NJMB 2G4LA 2C3PA 1EAYA 2YJZA 4MJ7A 2H5LA 2PY6A 1Z35A 1XV5A 3FRIA 3KPJA 5UKDA 5CA1A 3LLVA 5IUJC 2COEA 4J90A 5JMWA 3QPUA 4BVAA 5SZJA 4NPCA 1XDUA 4XCXA 3GUHA 3R77A 3DP9A 1UAYA 4RJ2A 5A2QA 3P9ZA 4IGAA 3I5MA 4JVLA 4FEAA 3PGXA 4HOYA 5KC9A 1JXQA 5KWIA 4BO4A 4QDXA 3U3OA 3X0DA 4NU5A 4YREA 5ICEA 2HSZA 1J0BA 1LSUA 2IEGA 3KSDO 1LXCA 2BCEA 1Q5PA 4W1SA 3G5MA 1U2PA 2PS9A 4R8VA 2W6OA 5EC8A 3OFVA 2XBLA 4GKKB 3I9KA 3K92A 1QYWA 2DM6A 2BWJA 5AJZA 1RZRD 2R3SA 3I92A 4A6PA 3BRWA 4CMKA 1XT6A 1JEYA 1ULAA 3LKDA 4QDTA 2ZZNA 3IBTA 4M87A 2E7ZA 1W4RA 2JJ1A 4CM1A 2DUUA 3FUWA 3OU7A 5EKDA 2EJVA 1AQNA 3RVDA 3LO5A 3AF6A 4R0VA 2R5NA 4GH5A 4XIGS 2FSVC 3WGVA 4HQLA 3I1JA 3N86A 3JXEA 3IXMA 5L8VA 1KTIA 3TZEA 2DHCA 3HBLA 4YLGA 1KBZA 2GUGA 3CJRA 3CEMA 3SBXA 5H59A 1BXKA 1WZUA 4GQAA 4D9IA 3VH4A 5J4YA 4Q6WA 1FFHA 1Z88A 1JLRA 2H4FA 4PTZA 3U9SA 3J7TA 1F7VA 5JMTA 3H6KA 4BLTA 1I3LA 5C35A 4YCLA 4K6MA 2FPGB 3UOWA 3SM9A 3D3NA 4K9SA 4URHA 4BFSA 2IZ5A 4PYQA 2JATA 5EYPB 3CBGA 4D8WA 5EJ5A 2O8EA 4JD5A 3N6RA 3G9UA 3KTDA 3CN9A 4F04A 1UM9B 1N1GA 3IL2A 3L0IB 2EQBA 3ZVMA 2YVKA 5DB4A 4JOQA 3E2IA 1JLKA 1QLHA 3IYLW 4G0NA 1SG0A 3IX7A 4NL4H 3D3WB 2C2KA 5FAXA 2JK1A 5HSGA 3OQMA 2JIBA 2JGMA 3ABIA 1YONA 4TQUS 5FOQA 1TM4E 1KZ1A 2D1RA 3H0KA 5E0OA 3J81k 1R0CA 3GEGA 3ONEA 3JWIA 1P9NA 4DSTA 4P84A 2PD6A 3OO0A 1ORRA 2ORIA 3HG7A 5BP7A 1AMNA 1GL3A 1Z4JA 2KBEA 1I2CA 4LYFA 4XAQA 1YF3A 1ISIA 1PG2A 3LD9A 3TLZA 4N5DA 4QNNA 2QMQA 3QVUA 4B31A 3FDIA 4ND8A 5B6IA 2ZYUX 5HOEA 2F6RA 4HDOB 4C0SA 2AFHE 3ZHCA 1HE4A 2F90A 3PHLA 1T3ZA 5FA8A 1A2QA 2AWOA 4WCFB 3ZV7A 3ZCQA 4KK3A 1E2FA 1Y9JA 2FV8A 3WNZA 3H1PA 2Z6AA 2C03A 4HDSB 1W0JD 2CKMA 2G9UA 3KJZA 3L8ZA 3SC4A 4ECEA 1Y48E 5GZ3A 1UPCA 1LB1B 2WYVA 2PCLA 2SBTA 4QGHA 1TZBA 4X94A 3D2LA 3E9EA 3QE2A 3HO8A 4F7DA 1TAGA 4F9TA 2UVPB 4F6CA 1MAVA 2JHPA 3AP2A 1NNI1 3A26A 4IXMA 3WIUA 4F1KA 1FJGB 1VLQA 2HK8A 1VYUA 5DASA 4BLVA 2C4MA 2MTBA 1A9QA 3I9V1 2VT3A 5CH3A 4LDAA 2L2QA 3QBVA 3ZV6A 3PG5A 4C4AA 3Q41A 4RC9A 1M7GA 3L41A 1JECA 1QCCA 2PXXA 4RA9A 4REMA 2PAAA 3N5KA 2V6JA 4RH0A 4ZAXA 2XYRA 4LWQA 1HORA 2PIDA 5HGJA 2NMVA 1AN0A 1JTFA 4B3MB 1TLFA 4GPZA 3AEKB 4NDNE 3H1BA 1H1LB 1DHTA 1C7IA 3I6IA 4P31A 2VEDA 2CFRA 3K05A 2MCFA 3O03A 4TV9F 5FORA 5K2MA 5BYAA 1EXVA 1KIFA 3WGMA 4MV7A 5DT2A 3U0BA 5LKAA 2PZAA 4FN5A 5HRAA 3H9QA 4X85A 4F2GA 4IS2A 4U2EA 1Q22A 1MJNA 2FWAA 3KQOA 4OGLA 2H1OA 4ITRC 2N1MA 3WBJA 4HCJA 5JSHA 2FG7C 1A8IA 2WYIA 3EIXA 4FFSA 4V0KA 1ETUA 4POOA 1XTIA 4KO4S 4RLQA 3K9QO 1VJDA 4FLMA 1WXGA 4BC1A 1ZCFA 4YCMA 4WINA 4LYYA 2IHKA 2HN9A 3OQBA 4HATA 4LRXA 2PWYA 4IGKA 4GLFA 3LTNC 4L9WA 1LF5A 5T4EA 4AULA 3Q7PA 1O6GA 1FTYA 5ELLA 3OTGA 3VJKA 3UMRA 4BMZA 4XD7D 4LOAA 4NYJR 4PO3X 3MUEA 4IDHA 1YVEI 1XCGB 2GK4A 1NJ1A 1GPAA 1FVOA 4K6OA 5IJ9A 3RC9A 2NPFA 3ENKA 2WIBA 5EWLB 3O1IC 2GEUA 3BGWA 3LYLA 3QSGA 1H23A 4XWGA 1XHEA 3EIQA 4GOLD 2C2OA 4F8EA 1SCAA 1Z68A 4G89A 1KEEB 4ZVVA 3UK2A 4Z3DA 2IH4A 3QMMA 5E4JA 2ZRQA 1R5NA 1C30A 1KORA 2VFAA 4QDUA 2FR0A 3EG9A 4JQOA 4KXQA 4Y1EA 1FX0B 2P30A 4R5HA 3TFQA 1M2WA 2C5GA 2CLFB 3QBTA 2ZAIA 5E6UB 1RI5A 2Q6TA 4IHQA 1CQXA 1H0HA 3ETCA 3EXAA 3UK7A 1CJMA 2SKEA 4PLTA 1A8UA 4R2XA 1BROA 1XMQB 1K7EB 3SC2A 1MW9X 3S2GA 3NX4A 1S8FA 2I7XA 3T3NA 3ROZA 4DDKA 1R27A 4U2DA 5KCZA 1YOBA 2VUUA 4BKPA 1HYEA 2AL7A 2R00A 4RH1A 4UBMA 5IMSA 1AGYA 4A0RA 4TWRA 2C9BA 3DOEA 4A8PA 4Q21A 2O3UA 2Z4TA 1DAPA 1G2PA 1IEQA 1JFFA 1YFLA 2IYQA 3NBYC 3U4MA 4RK0A 2HKIA 1JVSA 3VH2A 3WV4A 5JFGA 4RCVA 2XMDA 3ULKA 2R8PA 2RHTA 3DE4X 4FYIA 4IVQA 4OXRA 4RK6A 4EAQA 3ZJYA 3G0BA 3QI7A 4AJOA 2GZ2A 4BPRA 1HRDA 3LBIA 2GK7A 5ESXA 3RKRA 3IT2A 4D9BA 3KXPA 1HFEL 4BATA 3QVMA 1KNXA 2B30A 2QU7A 3CTPA 3RIHA 4G5QA 1VKHA 2E5LB 4ZV4A 1MXFA 4BL5A 4LQLA 4HAOA 2YWGA 2J6BA 1IFXA 1RAEA 2Z5FA 4ZQCB 1HSZA 1J20A 4MUFA 4AS3A 4RTQA 5ITWA 1B23P 1UIMA 2GZHA 3CLUD 4KO1S 2NU9A 4IVNA 4ZYVA 5KDOA 3MWEB 2YFYA 3HE3A 2FZWA 2ZU6A 3PA8A 3ZNPA 2BMWA 3CVVA 2YIDA 1J2TA 3F8WA 4O4JA 2E1PA 2B5WA 3PJDA 4D2IA 1K6EA 4LZZA 3WHLA 1QX4A 4QDZA 5IAEA 4DIEA 2Q9BA 3O7MA 4LI3X 3MXTA 4XTCS 1GCGA 3MTAA 1CP2A 2OSVA 4G01B 3ZWVA 1FDWA 2NO1A 4KDRA 5DU2A 3HJTA 3UUGA 4NMWA 2A9QA 1HGXA 2BM1A 3TLCA 1PJ4A 2WMDA 4JJEA 4F9EA 5K6AA 1E0SA 3RADC 3TB4A 2H59A 3TKLA 4AFNA 1Q19A 1G2QA 4MVJF 4G9EA 2A9PA 1Z45A 1WUYA 2IZ1A 2A1TS 1U2TA 3IBYA 5M29A 2PUWA 5A4JA 2FQWA 4TTJA 4DR4B 1VL0A 4PAMA 2O52A 3RODA 3BE4A 3GELA 3SR4A 4LUCA 5EE5B 3HXLA 4LHSA 1VMIA 3CR8A 4WERA 4U6NA 3V7WA 4LV8B 3G1TA 3EHDA 4IDEA 5DM4A 3GMIA 3OSZA 5K8JB 4E88A 4I6GA 1E32A 5EKUA 4K6CA 3F6PA 4EL0A 3R7FA 3L2OB 4B87A 3L6EA 1N6HA 3FMGA 3FZEA 5DXAA 4O63O 1WMBA 3GYBA 4DMRA 2JCBA 2WSSA 3EWAA 3QKIA 1J09A 4PG7A 5DGCA 4UEWA 5BNFA 5MGBA 1Y7HA 1RBQA 5EIWA 2OO3A 2C5FA 1BH2A 1IOVA 4J4TA 1U8AA 2FEOA 1TEZA 3R4VA 4ZZIA 2BYTA 1OAAA 4RMHA 1QYVA 2Q5QA 4OHWA 4DSAA 4MWGA 1K0FA 4BRUA 3RGGA 1YZFA 4PHTA 2VWGA 1NN3A 2PH7A 2ZKLA 4CM4A 5J4LA 2JI4A 1KAOA 1CE8B 2E3JA 1Y33E 1JHYA 2JVIA 3UHPA 4F9GA 2YMQA 1U6JA 3BMOA 3LJKA 2FDCA 1GG5A 3Q10A 1HYQA 1Q57A 2JFNA 4QU0A 1JEJA 2JIOA 1G98A 1XB2A 2VSNA 2CLOB 1QIMA 3I1FA 3R3SA 1SRQA 1CJKC 4NCIA 4KUEA 2C4HA 2FN3A 3I52A 4YJHA 4ZVUA 4NV0A 3P9KA 3PIRA 3KZNA 5A3RA 4RIFA 5C81A 2HCTA 2WIKA 4JP1A 3GPIA 4QDKA 2ZTSA 1NW3A 2ZTVA 3FFBA 4YASA 1XD9A 2D62A 3VR0A 4D1YA 2V6GA 4LKRA 4IEIA 5GWXA 4ZT5A 4AJ9A 2HU2A 1BMFA 1EMDA 3PQ8A 1NU6A 2XDQB 5JU6A 1NVBA 3VFDA 4KE7A 3IT0A 4KAAA 4N6OA 5A62A 3A3OA 3KD2A 3P45A 4HS9A 4JI5B 4ABTA 2AZXA 1OD6A 1SVUA 1DWPA 1LKZA 3WLPA 1Z0DA 4EIWA 4S2EA 4FFNA 1Q83A 3UH0A 3P7MA 1U6IA 1EM8B 3R40A 4TMKA 4FDAA 3MJFA 5TF4A 5DTRA 1SIBE 2PPLA 4IDOA 4L0QA 2WFLB 3CF2A 4TSFD 2BHRA 1MO4A 1ZSNA 4WBSA 3KBBA 2BKUA 4U00A 2QX9A 3MJVA 3RUFA 5TQ0B 1K3FA 1UXJA 3Q7QA 3MS4A 3DHNA 1VL6A 3AO0B 3HJRA 1IN7A 1V0JA 1F5NA 3EDCA 4OHMA 1IPFA 3ZDYB 3JCZA 4Y2XA 1RJEA 1T5SA 2D5IA 1EBFA 2FRXA 5DM2A 3SR3A 4TRJA 3JQ8A 1YQGA 4LVCA 4L3WA 3FDXA 3ZCRA 4KQ9A 1MU0A 4JB3A 4J0DA 4ODIA 4RGQA 2XE4A 1U4OA 2VRCD 4BO3A 2M9MA 2FR1A 1DXYA 1U9ZA 1M2FA 2AQ8A 2FW1A 2QXYA 2XDAA 3H2JA 3LL7A 5A3QA 1DUVG 2NNWB 3SXUA 5IJ0B 2ERXA 2GF9A 4I5FA 1QBKC 5K3OA 5BUZA 1C8LA 2JFWA 4PYNA 2XUAA 5ARCA 4B3JA 3KKPA 1XZ8A 5FTWA 1O8CA 2DPGA 1ZOLA 3U7QA 2YXDA 4AN0A 1XZAA 4H7DA 3FDZB 3M3HA 1W46A 4QQ8A 1MAAA 1KBOA 4CM9D 4RVDA 1UBCA 3BHNA 3QZUA 5FA5A 3WDMA 1J4AA 2VOEA 2W2PA 4L3OA 3HYLA 2XZOA 3GJXC 3WWPA 4ZOBA 1G66A 3C14C 5H70A 1HQYE 1VM6A 3VSAA 3ROFA 3IA7A 3ZC3A 5BN4B 4FVTA 1N6RA 3RAPR 4BCCA 1NXXA 2XVZA 1KQPA 3H0CA 1GR0A 2GJAA 3JD2A 1W4LA 4MUAA 4X0EA 2Q0SA 4XEUA 1VL1A 4YY3B 1OVGA 1G1AA 2BKXA 3LHKA 4XW2A 1CJBA 1QFSA 2ZAOA 2J0QA 2DE0X 3GLIA 3K1JA 1M5TA 3ILSA 3O8QB 2VPWA 1PR5A 3SJZA 2PXHA 2XUDA 4BQSA 4NU6A 4F5WA 1RAHA 3GNQA 4HPWA 5KX5A 3QU9A 1USIA 4GLLA 3K3PA 3S7ZA 1TJYA 3HKBB 5MN5A 1ZW1A 4FEYA 1MJGA 3KEQA 4NBWA 4Q0MA 1F20A 3EZXA 4MW0A 5FPHA 1WPQA 1NJSA 4W4TA 1VCIA 2V7BA 1YU9A 1XTSA 1O97C 5DKFA 5E95A 4EI7A 2GDJA 4ZK6A 2XTMA 3SK0A 2J4DA 5HIKA 3H5WA 1OV6A 3GUVA 5ALMA 4CU5A 4S05A 3QBEA 1V26A 1T8WA 4RPIA 4WGGA 4ZEXA 2YRWA 3BAZA 4RZIA 2Z2KA 4MHTA 3T5TA 4MI9A 2P78A 1AV6A 2F4NA 2WF6A 3PVZA 1EJ6A 4YHHB 5AIAA 1LF0A 4FCTA 1XVLA 2QTMA 3GT4A 3JWEA 1DQSA 3BL8A 2GCPA 1NFQA 3AB7A 3KSZO 1ZVMA 1DKLA 3IAS6 4HAIA 5F78A 2O3TA 3FTFA 2XUZA 1WE2A 1FFEA 1KZ9A 5DHPA 2E4WA 3QHQA 5E38A 3K4PA 3WNBA 3RWOA 1GA6A 3S28A 3DL0A 3HKDB 3HJBA 3GVHA 4LYGA 2WJPA 2NYRA 3GLHA 3WDKA 1NYLA 1V96A 4DIUA 4FWTA 3MTBA 4GVXA 3OPVA 4LYEA 2JVJA 2I1WA 2FSSA 3ABRB 3KSRA 1WF3A 3MMPA 3OHSX 2A1TR 1TCVA 2RSLA 2V54A 2YOGA 4M54A 2QD2A 5ALSA 2RGNC 3OAAD 3P9RA 4BV3A 1H1TA 3HKCA 4QPNA 3R6DA 1SXHA 3AOEA 5I4IA 5JSZA 1F0PA 4FD3A 1PS9A 1XDZA 3WLEA 1YS2X 2C78A 2OILA 3CLTC 1N2CB 5AW1A 2JLAA 4XD2A 3DMGA 3LUFA 4DC0A 4PAGA 4YMVA 4URFA 1NP7A 3N58A 5ALRA 3F6YA 3B7PA 5JY1A 2HRRA 2XXJA 3WOHA 1V35A 1F4PA 2B2NA 5CDFA 1L7MA 4NVRA 2EU8A 4R83A 3PITA 1BD3A 3EFOA 4WY8A 3TMAA 3V8QA 3I2HA 3VR2D 5CA0A 2G71A 3EQ2A 4RPKA 1WXHA 1QYIA 2GBCA 1N5KA 2PJDA 5BOVA 2HRCA 5SICE 1QC5B 4X1IB 3T94A 1GZHB 2CXHA 3NLLA 3QWBA 1Q3KA 2IUYA 4OG2A 1J39A 4UE6A 4JBGA 4P4GA 2FQ1A 2YWFA 2D54A 1GNLA 2GBFA 1H2AS 4F12A 4IV0A 2XCQA 3JD3A 2D2IA 3JWJA 3P9SA 2PEYA 3QLEA 3I8XA 5FUBA 3R75A 4URVR 3OZRA 4W9MC 5C1DA 4ZA2A 5DEOA 4N5MA 2FPPA 3I9FA 3TGWA 1SKYB 4Q1VA 4E30A 1SC1A 1M9NA 3HLYA 5DM1A 5FOWA 4DSNA 5BVGB 2Q0QA 1WW3A 2H4WA 1NUQA 4AQDA 5SYNA 4FGKA 3ONWA 3C97A 5JS8A 1RP1A 1VL2A 1CF2O 1NNUA 2O7VA 2Z9DA 1EFUA 3HR4A 4EB8A 5M34A 4AQYB 1L1RA 3D9QX 1L4UA 4RE6A 4EHKA 3UUEA 2IHUA 1PJTA 4Q7EA 2ZVQX 1EEHA 2AN5A 3ZY6A 1JKFA 1DSSG 1XPJA 2P4UA 1TMYA 1AF4A 2X77A 4L8FA 1D4ZA 1S1CA 3IAFA 5KHAA 5AVYA 2EARA 1DBQA 2W4QA 3E8XA 4RFSB 3TNYA 4P5DA 3CLVA 2AOTA 5JT1A 4CKEB 5KNDA 2WVHA 1RQLA 4Z8XA 1T2UA 3CUTA 3FDFA 4KQHA 1WCYA 2E5FA 2XCOA 1JAYA 2X19A 4W8GA 4IDDA 1JEAA 3OM1A 1EWYA 2OCDA 2QLNA 2H2HA 5DW3A 4KK4A 3PE3A 1H2YA 1KEZA 2X0FA 5JTTA 3F78A 4Q3BA 4I5EA 1PUJA 4K88A 1AKVA 4EF5A 3KJGA 5HIMA 3SJBA 1IB0A 3H2SA 1E2DA 3RVMA 3KZKA 4LJ4A 3PDUA 1FNNA 4LCJA 3AR2A 3D6JA 4LHEA 1NN0A 2I6UA 3IH5A 3ZNQA 5MHTA 2Q1WA 4WXRA 3ZK7A 2DEUA 4JQCA 1GXSB 4R31A 3HN2A 1EFVA 2CBXA 3HBNA 4I55B 1PE0A 1RQXA 2ZJAA 4GVPA 4NPHA 4D98A 5JS6A 4OSEA 1V16A 4MQ5A 3PC8A 4Y1RB 1GQRA 1Y5LA 3FLBA 2YUIA 1GAJA 3NASA 4KG7A 5GVRA 5AUNB 5JRJA 1H2FA 1JS1X 5JADA 1OFVA 1C1XB 2MSNA 3L1UA 1CZRA 2C2ZA 1BIFA 1LV7A 4H27A 2XRFA 4MVXA 1C4OA 3BEDA 1NLUA 2ERYA 3PYMA 1PS0A 1A1VA 1ONPA 2ATEA 1OX4A 1GKIA 4TLDA 2IYXA 2FUCA 2I33A 3MCWA 4IQ0A 4R84A 4CT5A 1PUIA 1NJ2A 4ND6A 5CPBA 2DLDA 3C6MA 1U2ZA 4X3CA 2Q1UA 4FQ7A 1M1UA 2FW6A 4TLEA 3FSJX 4NMXB 4Y9SA 4PX3A 1T3TA 1AM4D 3A1EA 4UU8A 2G9RA 1EXWA 1QZTA 1GPUA 2NP6A 4A4DA 3AGQA 3BD8A 3NBKA 5K3CA 3EOAI 3OFNA 4OI2A 3HZHA 1TCCA 1VGVA 1Z4OA 2ZSFA 3NBUA 4GEGA 4BLUA 1RHKA 2C1XA 2SHKA 2WF7A 1FJXA 4ARZB 2IU4A 4BKMA 4U2FA 4M0MA 1DKUA 3CV3A 4TV8B 5ELMA 4ZPJA 4FMDB 1X42A 3HABA 4A6XA 4RV9A 2QLLA 3LBNA 2JRCA 3SHOA 2A88A 4URZR 3P97A 4MO9A 2GJ4A 1A5ZA 2I6FA 3EMDA 3GRRA 1MX3A 2RH5A 1FDUA 2B1GA 2WP0A 1VL5A 3NT5A 4ZMRA 2FWPA 5KUTA 2X76A 4U39A 3DEJA 5TR9A 4EQZA 1M54A 2V9CA 1G2IA 4MUEA 2P2NA 2ZM5A 1YGPA 1D3AA 1NUHA 1DI0A 4KSYA 3KTFA 3ZH9B 1TAQA 4DPLA 4GPD1 3U19A 3DZBA 3EG5A 1ECJA 1M34B 3I04M 3DNMA 3LECA 2ZZMA 5D3ZA 1AA6A 4GG1A 4H1HA 3QF7A 1Y8CA 1QCZA 4MV0A 4EI8A 2EG5A 3A1UA 3W77A 4OIFA 3FBWA 4TUYA 1GLNA 4P81A 5LJLA 4NBNA 1NBME 1N2IA 1G8HA 3T4PA 5BYBA 3PKJA 1E7QA 2C98A 3M5PA 4EZEA 4G5HA 4YT2A 1LLFA 5JG7A 1IK6A 4OXIA 1Q17A 1G19A 4HUTA 5IDWA 4YMGA 3KQHA 4GSKA 5F1OA 1ZMTA 3SX4A 1EZ4A 5IS2A 2PMEA 1Z33A 2GHQA 2EAUA 5D1HA 1OAOC 5JYEA 1RZUA 1CEEA 1PYDA 4PWZA 4HRYA 4CLDA 1H5QA 1JHPA 4EY4A 2Q1TA 4D0RA 4YA6A 4XPIB 1KYZA 4I1YA 2H7YA 4OQDA 3O74A 1L7BA 3AERB 1Y5RA 4UPEA 1EA7A 1THTA 4DV7B 3WB0A 3GRZA 4UDYX 1EFTA 3HBJA 4HFMA 1NW6A 1YFZA 1Z6GA 2PL3A 2WB2A 2HLDA 3IIMA 3K1YA 1RHUA 2QN8A 1DFHA 1M0WA 2FPSA 2Z8ZA 5PNTA 3EZYA 3RUHA 3ZU2A 1FK8A 1CR4A 4DXAA 3BTVA 3L07A 4LGVA 3CZQA 4LY6A 4KC0A 4WKBA 5DM70 2C5SA 4EECA 1VFNA 4YCAA 4DJDC 3D4LA 1WB5A 7MDHA 4MQFB 3FOAA 4YMLA 2REXB 3OETA 1HE3A 2OSBA 4KNWA 1BOOA 4BAUA 4E2FA 1DLIA 4FD2A 3A6JA 4C7OA 1SC9A 2HUPA 2VT2A 2Y0DA 3DF7A 3JYQA 1U2DC 1WW2A 4GD3Q 4E70A 1U3WA 4LZLA 3T7TA 2PRYA 1G20E 2CNWA 1YC2A 3GRFA 2AIRA 1MG0A 1S02A 2J6CA 4WFQA 4QSHA 1NBWB 3FMFA 4KKVA 4W5HA 4DPKA 4QSMA 1A8PA 4DNOA 3HBMA 3IDOA 1EFLA 1GCIA 2R47A 1STOA 2ASVA 2PLRA 1O9GA 4WIAA 3NH9A 3R20A 5ALEA 4XWWA 2QRJA 1FSPA 1UC8A 1X3SA 2IOFA 1XQ1A 2PH5A 3FVWA 4DDHA 4FWIB 2ONZA 3EC1A 5DTMA 1K6MA 1NW5A 1ESNA 1NRXA 5FPQA 2P62A 2ZJ8A 4UUMA 1M0TA 4N7RA 1YTUA 1W85B 2AMLA 3NM5A 2AOUA 4OYRA 4ALKA 1QIFA 3VUEA 3PEUA 2JDIA 2NN3C 3AR4A 1UPUA 1V5EA 3FB1A 3HBAA 2EJBA 3MCUA 4E5UA 5JXJA 2JFUA 4OMCA 1KIMA 2CJPA 3AJDA 3W5IA 2EVWX 1FP4A 2H48A 2LCIA 5FTNA 1C8KA 4INOA 1Z7BA 3CISA 1QHIA 4ZYXA 3UBTA 4R3WA 4H7JA 4QRHA 3AF3A 3LQFA 1H9CA 2GX6A 4P32A 2QAGB 1BZYA 3MUOA 1V39A 5ALTA 1ZD1A 2VDOB 5MDHA 1BDJA 1G3UA 4HWOA 4CGZA 1N3BA 3DE2X 2ZRAA 4RF5A 2AUNA 3PZBA 4TYWA 1IEVA 2JL1A 3AEQA 1K63A 2I54A 4PZDA 2VXCA 1YT5A 2C4WA 1PQWA 3P9IA 3QY9A 1ABEA 3MNFA 3A11A 1BE1A 4Q7LA 3H1GA 1UMCB 3JQ6A 1I8TA 4J0CA 2D1TA 4R1LA 1TM1E 2PN1A 4X97A 5AK0A 2Y6UA 3IDZA 4YO8A 4HWPA 3ETNA 3T9DA 4YRMA 2Z58A 1ONOA 2OG1A 3RNOA 1JHMA 4G84A 3E15A 5JZOA 5LC1A 1FNDA 1UUFA 3NWJA 2PZBA 3EVFA 4HAWA 4F7WA 4EGJA 4E46A 1W47A 3G2HA 1MTZA 4Z1MA 3NIDB 1SC6A 4EW2A 1QM5A 4MULA 4RK4A 4V0QA 5BWLA 2ZSIA 4NS1A 2VQFB 3M1AA 2RAPA 2J08A 3DWFA 1BGWA 1POXA 4PSUA 1IULA 4OL9A 4FYXA 2E4AA 1FTQA 1CS4C 4UCWA 2X0DA 1PW5A 3IIIA 2B61A 4MS3B 2Y92A 4ZQHA 5BW6B 2BCGY 2DUMA 2VDWA 4YBRA 5IBQA 4B3SB 3QNWA 2V9ZA 3SN6A 2HPHA 2BMDA 3K9LA 2GPSA 3DLPX 1XEFA 3EAQA 4H16A 4LMPA 1MTOA 4KAFA 4N7JA 2WI8A 1A97A 4XYGA 1T3SA 4BYMA 2DLCX 3LIPA 3DBVO 4PNZA 1ZR2A 1WSBA 2Q4RA 2GF0A 3N75A 1ZD9A 3QQPA 4TXNA 3KETA 4LCEA 1I7SB 4ZJZA 4JJ7A 3BEOA 3E9RA 4I1SA 1XJQA 1MH9A 3QWAA 1Q7CA 1GG2A 3A3PA 1YCFA 4N0EA 4P34A 5EWLA 3W7AA 2VDRB 3EPJA 4RQBA 2MSCB 4HDRB 2OBMA 3ZNOA 4E5KA 5EP3A 3DDOA 3GEEA 2CHGA 4U2BA 1Z06A 4R51A 2ZUSA 5JARA 3BGIA 1AMOA 1KEEA 1MT0A 5FNZA 3TXXA 2Z83A 2FB9A 4L4YA 1GRNA 3AESB 5HF9A 2X6RA 2YASA 3FW1A 3ZIDA 4ZCMA 3GFGA 4B75A 3CH6A 4R2IA 1JPVA 2X13A 1FX0A 4JX9A 4PBSA 3RW9A 4CEHA 4IFEA 3QI2A 2YY7A 1XPRA 2O8FB 4ZC1A 1E1RD 3MJRA 1F5SA 4KR2A 3ZD9A 3WOVA 1H69A 1TI7A 2XPCA 3KQVA 2V7WA 3UMVA 1W4ZA 2P27A 3KPUA 3EA0A 1PDWA 1P2BA 1ZESA 1R4NB 2K7ZA 3EVAA 4FZJA 3HUEA 3JAWA 1LI5A 2P5YA 3IR7A 3JVVA 1B0ZA 4QQFA 2E55A 5HW0A 4U8GA 1YB7A 1ZH4A 5KX5F 2PWAA 3DGFC 1HLPA 1W9HA 3GL9A 2GZ1A 3LZ6A 3C5EA 3H1FA 4Y18A 1R50A 4MV5A 3F9RA 4M7PA 3M6WA 4Q9HA 4N3GA 4UTZA 2H2AA 4ZO9A 3VYRB 4R1MA 1WM1A 2VZLA 4X7RA 1SXJE 1PF7E 3LGXA 3ORRA 4JSTA 4NRDA 3RF7A 5IYZB 2RBEA 3ER8A 2B4YA 3KQUA 2I1LA 3KTOA 2AFHB 2GEVA 4V3CA 3WWDA 4AD8A 2ZQ5A 1NF8A 4XDGA 1QGYA 3B8HA 1WR8A 1CZUA 2IUFA 4I3HA 1TTPB 2VNJA 5L6MB 5KU7A 1V9LA 4CKYA 4CV3A 5KYYA 3ZKWB 4PO9A 2ZRGA 3T3GA 3QV1A 5LQSA 2JA1A 2RARA 4GP7A 2FFBA 3DOOA 3MWEA 4FFBB 1IXSB 2CXOA 3NTLA 4C1NA 1LRJA 1LDGA 3NUQA 4ZU1X 2WTEA 2PKCA 4KLAA 3WXMA 1HOTA 1JBEA 2NU8A 3U2QA 2C2MA 2PJZA 2QR2A 5KHLB 3STXA 2WVAA 3WP0A 1GZ3A 3GGOA 2WHXA 3UNXA 1L5QA 1UBJS 2Z3ZA 2BE7A 2NGRA 4GOND 1WHSB 4ZVRA 5TPZD 3UPTA 1DIAA 1KP2A 3T52A 3D8TA 2XHZA 1CVRA 4P7GA 1BG6A 1CP3A 2UYOA 3NV9A 4GOKA 3TCKA 1IBSA 3OLCX 3KQSA 1EGVB 3UCEA 4HDNB 3G8CA 3IP6A 4IW3B 3ESAA 3MIIA 4ZODA 1U0BB 1NJ8A 5K3DA 2KJQA 1U3VA 1Z6ZA 2EX0A 3ZDXB 5JVDA 1DRKA 4H1WA 4OF4A 4URYR 4Y9UA 2PMBA 1I80A 3N2NA 5CA0F 1RAIA 1WPXA 3MOSA 2GZAA 4EEZA 2FE1A 4M9XA 4PSDA 5CT6A 5KPDA 1U0OC 2RKWA 4BIMA 2VBGA 3PYXA 1G8KA 3B7GA 3G9QA 1YASA 3IUNA 1QV6A 3PCRB 4ZQGA 4ETNA 3ANNA 3EXIB 2OD2A 3IQIX 4BQNA 4E5NA 2DB3A 4OI1A 3D6MA 4X1KA 4BX8A 2BFFA 1XWFA 4HXEB 1AZSC 3G9XA 1PNOA 3RQSA 2FEWB 2OENG 4E2YA 3CFYA 2PMKA 3AEYA 1KK0A 3RUAA 2DFVA 3V4OA 2XYHA 2LKDA 2PX5A 2OO5C 2WWRA 3BJRA 3FZGA 4WSOA 3PEYA 3P94A 4EG5A 1CPYA 3BA1A 3ENWA 3OLVA 3TRHA 3UPUA 2EWMA 4DWJA 3KVOA 4E51A 1SKQA 2Q46A 3LHFA 5BNZA 5DHAA 1FB5A 3M9WA 4MW5A 2XQFA 3EUFA 2Y6VA 3OSUA 4GGPA 2OAQ1 2P1RA 4RY8A 2Z2ZA 1Z0IA 3MBIA 2WICA 3HTXA 1M3SA 1NV8A 1UXGA 2CW5A 1KL7A 2OFOA 3A0RB 3F8TA 4FFWA 1QYCA 4JYPA 4ENPA 1N33B 4ROSA 3OZEA 1NW7A 4GGMX 1QS0B 2H1SA 4MUGA 4ER6A 1I32A 3QVWA 4CU2A 3IRUA 2I3AA 2BMVA 2OY0A 2CUTA 5IUNC 2P65A 2IPXA 4O6VA 3TPZA 4CIWA 3DBIA 3AI7A 4MB2A 1HDZA 4D97A 2IX9A 1SVNA 2X23A 4P8RA 3ZE9A 1QK3A 1TU3A 2BHTA 1NRJB 4B40A 4IJVA 4E5YA 3K2IA 2WYUA 2AR0A 2B98A 4HSEA 4L2IA 1R6UA 3CXRA 4LGYA 1AB6A 2XDQA 1AB5A 3REGA 4DOMA 2ZS9A 1E3MA 4KN5A 3ZGOA 4QBHA 1S2NA 2RAFA 3B6ZA 4ZCLA 2ZPUA 3U3KA 3ZBQA 4MHOA 4N54A 1LC3A 1P74A 5E9WA 1ONNA 1U3UA 2NU6A 3D6AA 5DCWA 4EKYA 3USES 1NUUA 3EE6A 2J3KA 4S24A 4X6YA 4CXMA 3ZCTA 2BY4A 1X7XA 1EM8A 3H4IA 3OT1B 2HZBA 3NEPX 1YNSA 1EYZA 5CDYA 2P0YA 1W0JA 4QREA 3R0JA 5EN4A 2Q3HA 1U0GA 1RAAA 2DQZA 2QRPA 4U5XA 2QZ4A 2EJWA 1KZHA 3II6X 1IBCA 3HCNA 1EDEA 2BONA 3EEYA 2XWPA 3QKSA 3B3QA 3D4OA 5JD4A 1J1ZA 4KFRA 1Z0JA 3FYUC 5EJIA 2GN8A 1IEXA 4XKJA 3RARA 2B92A 1C7RA 3VYWA 4I50A 3QXXA 4WACA 1XF9A 2HWYA 5A5GA 2C61A 4JITA 2HCRA 1DBRA 3H4TA 1PTJC 5EPEA 4J6EA 3UJHA 3EBLA 2QDKA 3ADOA 4W1PA 4BLSA 1NG1A 1SU4A 2L17A 3DMNA 3T7EA 3VJMA 2YRFA 4FUTA 5FUXA 3ZGYA 4DJ5X 1QG0A 2PU7A 3B3AA 2BJHA 1ISSA 1SXGA 1QIGA 4MNTA 4RK5A 2O8DA 1ES9A 3E27A 1US8B 2QJOA 3LUDA 5CK4A 2ZUWA 2RIPA 2ID4A 1IIRA 2XWSA 3NKFA 1JQLB 4BWGA 4UNIA 5FFMA 3VU1A 1Q0QA 4G2TA 1KAEA 1SG6A 3FDZA 3OCXA 1BDHA 3WV5A 3RJMA 1Z2PX 1VZ3A 3MXOA 2XNHA 1GUDA 1SVSA 5DGTA 2FYTA 1W36D 1GGFA 3V1NA 1U6KA 4OK3A 4U9HS 4W8HA 2A0KA 1CTQA 3W90A 5L51A 5BN4A 2VUIB 1YVPA 2IIBA 3JWHA 5I45A 4NZNA 5DLDA 3EIEA 3IVCA 2CEAA 4G5OA 1QTQA 3I9V6 3IQWA 3IT1A 3KVRA 2PKEA 4PZ0A 5JD6A 5DBHX 5KIAA 1AHPA 1FYWA 2AMVA 5G0TA 4IDPA 5ALQA 1A04A 3B6IA 1JI0A 4TUYF 2J3JA 3DXFA 3VDNB 4DMFA 1M8PA 2B25A 1F8GA 3K1ZA 4Z4HA 1JSRA 1YOVA 2PBRA 1GCAA 2GCOB 4FJ2A 4FCVA 4J3NA 4XD7A 3FPLA 3R0VA 3DCNA 1ESCA 1UQRA 4J4HA 4U63A 3GDOA 5FBRB 4ENUA 2WZBA 4U7WA 3WSTA 2H29A 3OZVA 2QL7A 1SEVA 4DLWA 3M5DA 4FDMA 4AF6A 4CL3A 2R6JA 1V11B 4IKPA 5KNBD 3U7GA 3LQQA 4JVNA 3DWEX 2Z2JA 1ZYUA 2XUJA 5F4BA 1HL7A 2KPOA 4MOWA 4BNUA 4RHYA 1OAKA 3H2YA 1RAGA 5IAOA 3GGPA 1DBWA 2V7UA 3RIYA 3L01A 5FHRA 1UK9A 1PNQA 5K99A 1N25A 1P1RA 3L0PA 5BW4A 1KI1A 1KMNA 4XPZA 5EJ8A 2P9HA 1FFAA 1WD7A 1EUDB 1T5BA 2BF7A 3GRYA 4IG4A 4PRKA 4BKRA 4PGAA 3A4IA 3N9IA 4IPTA 2QPOA 4LQ4A 4OGFA 1KJIA 4CDNA 3QX8A 4GYKA 3GJ8A 1RI4A 3GY0A 4O2AB 5CW1A 2YY6A 4DG5A 4DV2B 1QTRA 1N0IA 3WZ2A 2OFPA 3QX3A 2OK7A 3D4IA 2ZJ4A 4NZYA 3CUYA 1TUGA 4H4CA 7ADHA 1A2BA 1JE0A 1QG6A 4DLPA 3HCPA 2I4LA 4HT3B 3IP1A 1MP0A 4FFVA 1L4LA 4KQEA 3FFWA 1M75A 3L93A 1DT3A 1BU5A 2O05A 3M6IA 4UBLA 1REQB 4YUZA 1XFAA 3JD4A 5KO2A 5J5VA 1GPYA 3GZ4A 3I6YA 4L76A 5TRTA 3I76A 3TOZA 4EMSA 4CLOB 1L5WA 4YRBA 3L7JA 2MYUA 2Y9PB 3LBFA 2DQKA 3ICPA 1QF9A 3EZ9A 3IT3A 1NR5A 4ZOEA 1QR2A 1XR3A 4FGLA 4GC5A 4PO8A 5LDDC 2UXBB 1ESEA 2FW0A 3NIFB 1VMDA 4WVFA 3I5YA 1G2OA 5CLLA 2V4ZA 2HQOA 2ID7A 5LA6F 2KSQA 1QRSA 3VTKA 2AFVA 3JSXA 4A8TA 2Q7OE 3SE7A 5CVJA 2C29D 3WKCA 3IJ5A 4OHVA 3QQ5A 2FRDC 1R0LA 3H17A 2FQYA 4QXMA 3X44A 2R6HA 4C29A 1A9SA 3OHPA 5JW6A 5JSYA 5EIBD 4HBGA 4AWBA 4LDJA 4NG5A 5TQJA 1R5OA 4HVLA 2DBVO 1PX0A 2H07A 4GMKA 4KE8A 2BHLA 4M8IA 1YDHA 5EUCA 2P2GA 3JY6A 5K0GA 1NBMD 3G6KA 5B6PA 5K0SA 2R6FA 4OCZA 3OUTA 1HDXA 1Y1RA 3HC7A 3AI3A 4MK4A 1Q1NA 1TVMA 1YB4A 1TYEB 1ZUNA 3ORYA 2Z3VA 1UBHS 1T2VA 1J2JA 3KE8A 3R41A 2FY8A 3GFOA 4MWCA 3SBEA 1SXJC 1CQJB 1DG3A 3TSYA 2QRKA 4TLCA 4CZ2A 1KZ7B 1GL7A 1RSZA 4UOZA 5IDQA 2G5PA 4RH3A 5ADUS 5CDUA 3JZAA 1T43A 1SN7A 4GOXA 1TKAA 1C14A 1T5LA 4EPVA 1UDAA 3KOXA 4CCSA 1YHYA 4EYSA 5AR1A 2A3NA 1ML3A 2J0UA 4QXQA 4Z4CA 5BN1A 1T0BA 4I1PA 3QOYA 2XODA 3BK2A 4CKEA 3WK5A 4KP7A 2IE8A 2ZE5A 3JYLA 4BVGA 1EFPA 2YXNA 3ZQUA 5LXTB 3S1SA 3LZCA 3UT6A 3UWKA 1EM6A 4FBGA 3IERA 1Y1KE 1WOMA 3CCCA 1LQ2A 4V1CI 1GTL1 4A0GA 3H5AA 5LYJB 3NAGA 3VJLA 2OC4A 2ZM6B 4P3KA 4QWMA 4P3NA 1CNEA 4OQQA 4WA7A 3ESZA 3RUPA 4NS4A 3VUFA 2Z8YM 1SCQA 4GRAA 1GXSA 5HZHA 4E08A 2I2XB 5C5EA 3FSEA 1C1DA 5SV2A 4KNYA 2MR6A 2BFPA 4RF3A 4O29A 2EKLA 4K40A 4Y1RA 2B6HA 3BMCB 4IM7A 4REQA 3BHMA 5GP1A 1TT7A 1BHQ1 2B94A 4IIYA 1IK4A 4JKYA 2BR4A 3UICA 2ZWMA 5D3QA 1X15A 3OF5A 3G13A 5HHTA 1XMJA 1QHYA 4E4TA 1TTQB 3AHEA 3E5RA 4KN8A 2BUAA 2DH6A 3CB4A 2W8BA 5I9NA 3EGCA 3FWPA 4DV5B 1KEVA 4OK5A 2AB0A 2C3UA 1XKTA 4EKEA 3L9WA 1F2VA 1QWSA 3I34X 1EFRD 1DEXA 1N2XA 3LC1O 5FI0B 1CERA 1P80A 3QV2A 2DSNA 2Y0BA 3M2PA 3FETA 9LDBA 1W76A 2NSDA 2P4EA 3KTAB 4W6QA 4BNTA 2IYRA 2WDZA 4TV8A 4MV1A 4MDYA 5HJ2A 4KPYA 2ZJBA 3FPCA 2BEUB 3BFXA 4YX9A 2C2XA 4XJVA 3U44A 2B7CA 5K2OA 4FHDA 1X9HA 1TYBE 5KDDA 5CCDA 1IAQA 1UZAA 3CRMA 4G24A 2P5SA 4X91A 3JYPA 4CIAA 1YCDA 4TSFA 3WL3A 5DSXA 4JQSA 3VBEA 3FKSD 4HWSA 5ERXA 4M1QA 3FMOB 3KUKA 3D8NA 4BGVA 4E2XA 1ZL0A 3FRJA 1P5HA 3FI0A 4IP0A 4OP3A 2HM7A 4QHTA 1AQIA 1NKTA 2JASA 2VHEA 3HGTA 2JKZA 2ZIGA 5AKLA 5A5VA 3EWSA 3UXEA 1UM8A 1PV2A 3MQ2A 5AK3A 3NTOA 5E4FA 1ZO8A 3MCVA 1RWBA 2VPZA 1Z74A 2QENA 4XX0B 4EJ0A 1A76A 2VRCA 3LT0A 4IIJA 3INRA 3SYMA 1YVUA 2W8ZA 2CHFA 4ZC8A 3OLXA 3KT0A 1SQGA 4F1JA 2NAPA 4KXYA 3AK4A 4BMPB 3ZS9A 1PWYE 2BTOA 1G7SA 2XAUA 3C6YA 5AOVA 1DGQA 2IXTA 3FSGD 2J31A 5BPFA 5IH3A 4LF7B 1R5JA 2DMRA 2F48A 2OM2A 4WVLA 4DA8A 5A3JA 1A8QA 1PSDA 1U5AA 3P9XA 4B34A 4MQLA 3NHPA 4DZZA 3M70A 3LWDA 2LV8A 4NH0A 3UB3A 1V5WA 2ZRNA 4RADA 2BZSA 4BJ3A 3PFWO 1R16A 1FUYB 3F74A 4I4NA 4U2CA 5AKZA 1J8DA 2FEXA 2IXGA 5F73A 1FW6A 5KSYA 1C4WA 4LF6B 2LRHA 3SHQA 2ZWOA 4LYJA 5J2TA 2WB4A 3DEKA 4YFVA 2DPHA 1C0IA 3EW7A 4GMFA 2POQX 1BVHA 1X8JA 4PWYA 4CKBB 3L49A 4I81A 3RS3A 5H8WA 1N4DA 3WRYC 2DWQA 4KWCA 1WXEA 2Z5VA 4DCGA 2Y1KA 3AKYA 3C43A 2ZSUA 5IKXA 1K97A 1Z0UA 2WD8A 5IF9A 4M76B 5B2FA 4Z2AA 3DD5A 5JVDF 2ACEA 4PINA 2G17A 2PMWB 4NAHA 4ZVOA 5EXPA 4C7KA 5IRCD 1CUWA 4YLYA 2JS7A 1JKMA 1WY5A 3LV8A 3QVKA 3HH8A 4DHWA 4IRXA 3O84A 3U5ZB 1FFSA 2HSEA 1V8ZA 3E53A 2R8RA 1R7RA 2XAAA 3GVCA 3LX4A 5JBQA 4P3XA 1Y42X 5EXXA 1LI7A 3U37A 2VI5A 1W34A 3TGLA 3LBAA 4LY3A 3PD0A 1LJUA 1MB4A 1IN6A 1PR0A 2DJ5A 4L5AA 4L8GA 3UQZA 4UVIA 2P9YA 4IFIA 3SHFA 4NBKA 4CM8B 3UJ6A 1SZJG 4YPOA 1U9CA 4B4OA 5JS1A 4CCWA 1EE2A 1SCKA 5CHYA 2ZUVA 4P1ZA 4UHCA 2HXGA 3P20A 1B15A 3FYHA 4U6QA 2RFLA 4IX1A 4WDRA 4YXFA 1LVHA 4ZV9A 1ZAKA 4XUCA 1P1FA 2BUBA 3TX2A 1P7CA 3E5NA 4JGGA 4RV4A 1RAFA 3TW0A 6GPBA 3Q15C 4MJLA 4Z7NB 2QL5A 5BSUA 5EMNA 4J0KA 4QWWA 4ZVKA 4DJAA 3TTUA 4M99A 3Q2KA 1SHJA 1T2CA 4J1QA 2BRUC 1OKKD 3S2FA 4HBZA 1PVDA 3WG9A 1TFRA 4ZCIA 3LXMA 1HF3A 2FF5A 2QAGA 3EEIA 2DTDA 2WWFA 3AI1A 3L6CA 3P0FA 3OAAA 3VNQA 1NW9B 4BVEA 4CFSA 4RTMA 3I2KA 2PHZA 2ZYAA 1PJAA 1OBOA 3D3KA 1KEWA 3GP3A 1GFIA 2E37A 3IP5A 1XPOA 2J9ZB 2ZDQA 3CMMA 2V98A 1W88A 3T1QA 4F4FA 4OJMX 4QJIA 4B8ZA 5L7TA 2JC3A 3M83A 1UMCA 4LFCB 1YDFA 2ONYA 3ZY3A 3O0DA 5ALIA 4DQKA 2ONKA 3M9XA 2AZDA 4P7KA 1MBZA 1EG2A 3DMHA 4FYVA 4S1WA 4FJ0A 3VR2A 4D7AA 2VSXA 3I09A 4QT4A 1V2HE 3A1CA 4D57A 4RU1A 2FZGA 1ORIA 4WPGA 4Z2YA 2CLSA 3CNHA 4B8YA 2ODNA 4AKGA 3CVWA 1XZGA 5AIBA 5JSUA 2VIIA 2Y1EA 3JQAD 4M22A 4QBGB 5ECDA 1PL8A 3HEMA 1Z7WA 4MUIA 3PE4A 1Y37A 1ELOA 2QRGA 3ASZA 4B73A 1A7AA 1CRZA 1W87A 3GA5A 4CF5A 4E1BA 4M88A 4EF6A 2WSYB 2FZ4A 2N42A 2NQTA 3IDAA 5HZMA 4TOIA 5K0NA 5LQRA 2E5WA 4UEJA 2Q2WA 3LY8A 5ALXA 3UUFA 4FI3C 3UHAA 4IZHA 1Z5GA 1QHEA 1Q20A 1F9AA 3DZHA 4I50F 4H7HA 2ZCJA 2G70A 4Z54A 2VPTA 2XT0A 3C5CA 1GEGA 3SDZA 1WUHS 1W2GA 2Q5FA 2VDQB 1LS1A 3K6RA 1XZFA 2FX2A 4KGVA 5E1OA 3T3IA 5CBPA 1YDGA 8GPBA 4B83A 2AK3A 1O6FA 3U4DA 3IP8A 2GARA 2AR9A 2XJ4A 6YASA 5GAJA 5LWHA 2H1LA 2G9QA 2BHSA 3MLEA 4QD3A 1GZ7A 4ZXFA 3TTTA 1I5EA 1TA9A 1TO2E 1XGKA 2A92A 3S99A 4PQFA 3SS7X 3LAWA 5AK4A 3I28A 1YKGA 2D8AA 4W1RA 4K2AA 4LW8A 3WNDA 4R05A 1FU8A 5TEWA 5J4HA 3RM3A 9ATCA 4U3JA 5CHEA 4JI2B 1YFJA 1DELA 3W5UA 1N0HA 1MABB 2CCJA 4I08A 2TRSB 4X90A 1V25A 1Z4LA 5IW8A 3WKEA 3AESA 3V32A 2OZVA 5EUMA 1S9HA 4WH0A 3A9TA 4YUWA 2J30A 1FDVA 1E2GA 2XNKA 4KRXA 5FD8A 5I7AA 2XHEA 4UFNA 4JS0A 4L78A 1FFBA 1GY8A 3IKMB 4KDEA 4N18A 2NZWA 3VR1A 2O8FA 3KEOA 4J2OA 1UKVY 4OGWA 3FYUB 4L1KA 2XMZA 1RI2A 3ZK9A 3JVIA 3LDFA 1ZAYA 3SR0A 3THOA 1MXHA 2GASA 4MITA 4X7MA 5DE3A 3OX4A 1O0CA 2IP1A 2XE7A 4I8DA 2GKSA 2OMKA 3ANLA 1C4XA 2QV0A 3H8JA 4YJKA 2RGCA 1G20B 4M0PA 1TMOA 4L9AA 4ABYA 1OVMA 4TKUA 1ZUIA 4HY3A 3UCXA 1SZPA 1U63A 4AJHA 5H3CA 2VP9A 1QE3A 2E6KA 4BJ6A 2GZMA 4DNPA 5JWOA 4S35A 1QQ6A 1RMQA 2WTAA 4JMPA 5AI8A 4ACBA 4GL4A 5CFLA 3IIJA 1LPNA 2FK8A 4KWHA 1JIQA 4P6VF 1JHAA 2KX7A 1N32B 4Q4LA 3FF4A 2HXSA 3GCXA 4FUQA 3WK7A 4A03A 4Q1EA 2XMQA 2XYQA 4RZ3A 5T8KC 3OZXA 4MLCA 2OVBA 4U7JA 4QNRA 5FV4A 3BCRA 4MJ3A 1FS6A 5AUOB 3F67A 4QGGA 5CDTA 3HB1A 5KKCA 4M8KA 2D5BA 3HA3A 3PUXA 3Q0TA 3R6LA 5DX1A 3EVZA 4CM9A 3RIXA 3IODA 1GUBA 1ND6A 2FOIA 4G8DA 4OUDB 1M7HA 2V97A 1IC6A 3BRCA 3M1IA 3ZKWA 3GLGA 1DQNA 1CEYA 2P77A 3I45A 1UEIA 1TEVA 1M6VB 4G5YA 5CFNA 3H4MA 1DG9A 4DV1B 1YWGO 3GNSA 1PJSA 3LXXA 1EXMA 1THMA 2CJXA 2VK1A 4D0NA 2DWPA 1MQ8B 1TYCA 2OE2A 5KQSA 3V8VA 3SC6A 3S2IA 3PNYA 4YMIA 1KK2A 5LB2A 2G25A 4UTRA 4JIMA 1T5DX 4NI5A 4RQUA 3F9IA 4ZRNA 3U3XA 5FDFA 4AQ7A 3JX9A 1D1TA 2AFRA 4K6HA 2FHPA 3H2GA 4MV4A 3NP7A 4P58A 4F8JA 6REQB 3N59A 1SXQA 3RC8A 4IL5A 1RWKA 4OI4A 5T57A 1IMOA 2R8OA 1ESMA 1IM2A 2C4KA 2NTEA 2ZI7A 1OROA 5KDLA 2O6LA 1P7WA 1UXIA 2I91A 4R98A 2H2FA 2HRDA 3CLHA 1N2OA 2ZJZA 3RTEA 5EIXA 2JLXA 2YICA 5KAPA 2WFAA 3GFTA 1HOXA 3OP4A 4X9XA 4IH4A 3C3AA 5AKYA 4BNVA 5EJEA 3KR9A 4C01A 1DQRA 4LXUA 4G4GA 1LPMA 1LVUA 5BYJA 3G0HA 4GYWA 4LWOA 2Q6OA 1LNZA 3TLYA 5FYDA 1K5PA 1YR6A 4RVSA 4EB6B 4FP9A 2D06A 5IUKC 3H3XA 3U4IA 1MVNA 4RAQA 5CM2Z 3EXIA 5EJGA 5IN4A 3K4QA 3S2ZA 2CYBA 2OAGA 3HDQA 5E9JA 4E09A 1XZDA 3TI7A 4PCUA 5J1TB 1H6BA 4WE3A 3EXG2 1DBSA 4BTVA 4Q12A 5B57C 2DQ4A 3T9BA 4BNGA 3CH5A 2ZS8A 4PGHA 2QX7A 2YNMD 3CZ5A 3TPCA 1BKYA 1E20A 1EP2B 1L6IA 4CIBA 3UMFA 4E15A 1MHTA 3K0BA 4QG3A 4UPVA 3HBFA 4RPHA 3E8SA 1Z0FA 4B0PA 3LKVA 4PSVA 4CCAA 1UZLA 1NUTA 2PRKA 2ODQA 3BD6A 3BZBA 4H59A 5IX8A 2GM4A 1GKKA 1UT8A 2HQRA 2R79A 3BWMA 3CJQA 4RWZA 3W9BA 1EE9A 2XUQA 1AQUA 4GXQA 4WW0A 1ADGA 3UA4A 3MJCA 1QS0A 1WB6A 1Q21A 4D9MA 3CMCO 1SG9A 3GDHA 3IDSA 1BXGB 3ZVNA 5IM4A 4N3CA 3URMA 3OIUA 3SCZA 3UKJA 2CB9A 2WMNB 3DULA 3WLMA 4DJFC 2IPMA 2WE7A 4MS1B 1UBOS 3P2KA 1X3LA 3BULA 3RUDA 4DLSA 5D3MB 4RMNA 4AY2A 1P81A 3N7AA 4MINA 1WLSA 2BKAA 1Y6QA 1BEZA 1QIJA 3FWNA 1UPXA 2C8VA 2WKRA 1LS6A 1IOWA 3UXHA 4PVDA 4FI3F 4M0FA 4Q93A 4PYJA 3ET4A