5LL6P

Structure of the 40s abce1 post-splitting complex in ribosome recycling and translation initiation
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
206
structure length
206
Chain Sequence
SLPATFDLTPEDAQLLLAANTHLGARNVQVHQEPYVFNARPDGVHVINVGKTWEKLVLAARIIAAIPNPEDVVAISSRTFGQRAVLKFAAHTGATPIAGRFTPGSFTNYITRSFKEPRLVIVTDPRSDAQAIKEASYVNIPVIALTDLDSPSEFVDVAIPCNNRGKHSIGLIWYLLAREVLRLRGALVDRTQPWSIMPDLYFYRDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the 40S-ABCE1 post-splitting complex in ribosome recycling and translation initiation.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 18S ribosomal RNA
total genus 44
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2016-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00318 Ribosomal_S2 Ribosomal protein S2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 5ll6P01
4DR4B 2PUVA 1NUHA 1VI6A 3HBAA 3TBFA 1C7RA 1B0ZA 2E5FA 4JI1B 5A2QA 4IVNA 1N36B 1JIQA 2YVAA 4DR5B 1N34B 2VF5X 4JI7B 1U0EA 1T10A 4LF5B 1XMOB 2ZJ3A 2J6HA 3J81A 1GZDA 4DV4B 2UXCB 2CXTA 3ODPA 4M0DA 4AMVA 3JAMA 4LF7B 3I0ZA 2POCA 4DV0B 1HM5A 1VIVA 4DR3B 4LZJA 4GKKB 4LF6B 3C3JA 3Q88A 1MOQA 4LF9B 4B3SB 2X3YA 1HNZB 4DR7B 3FKJA 3KNZA 3FF1A 4NXMB 2HHHB 4DUYB 1XMQB 3J80A 3FXAA 1U0FA 1J5EB 2I2WA 2CVPA 4TOIA 3M5PA 1HR0B 2V4MA 1IBKB 1HOXA 4EM6A 1IATA 1VI5A 1X9HA 1X9IA 4DUZB 3SHOA 4YHHB 3CVJA 2UUCB 2UUBB 1Q50A 2CXUA 4LF8B 4OX9B 1JLHA 1XNRB 1HNWB 4U6NA 4B3MB 3EUAA 4JI4B 5BY2A 4S1WA 4LFBB 4LFAB 2CB0A 1GZVA 4X62B 1G98A 1WIWA 3BCHA 2CXSA 5BR8B 3QKIA 1JEOA 4B3TB 2A3NA 1X94A 4JI5B 1XNQB 4JI3B 4JI0B 1DQRA 1MORA 3G68A 4B3RB 2DECA 4JI2B 2CXPA 1M3SA 2XHZA 3PR3A 4DV5B 2ZJ4A 1TK9A 3UJHA 2UXDB 3TRJA 4DV7B 4DV3B 1ZZGA 2CXQA 1KOJA 2O2CA 1J5XA 2PUWA 2VQFB 4LFCB 2PGIA 5IT9A 2I22A 3Q7IA 5IWAB 4KHPB 5I01A 4YY3B 4DR6B 1N32B 4DR1B 5LMUB 4NXNB 1VIMA 1IRIA 2CXOA 4X65B 2UU9B 1MOSA 4X64B 3JX9A 4JV5B 5FLXA 1FJGB 3ETNA 4K0KB 2O2DA 1X92A 4X66B 3OOJA 4LF4B 2AMLA 5LL6P 4DV1B 4S12A 3LJKA 2VF4X 5LMNB 3T1HB 4JI8B 3J7AC 1N33B 2UXBB 1N8TA 4DR2B 4GKJB 2Q8NA 2PUTA 1IBLB 2ZM6B 1TZBA 2WU8A 4JI6B 4JYAB 4AQYB 1I94B 2DF8A 2XBLA 3IFSA 3BJZA 3NBUA 2E5LB 3T1YB 1U0GA 1JXAA 2CXNA 3FJ1A 2UUAB 1XTBA 1TZCA 1C7QA 1HNXB 4DV2B 2F4VB 1NRIA 3OTOB 2CXRA 3HJBA 4DV6B 1IBMB 2VQEB
chains in the Genus database with same CATH superfamily
3BF8A 1CP2A 2FEPA 3AHIA 5K6AA 4GWKA 4MRSA 5DHAA 2G6BA 3PRJA 4UC0A 5I6DA 5LYJB 5EJFA 3VRHA 3PDJA 1RT9A 4OUKX 1P8JA 4G4JA 3KV3O 3VZRA 3W2EA 2HOQA 1J4AA 4BFYA 2XMPA 5CDTA 1O0CA 4OHBA 3B9BA 1SZPA 4RY9A 4M0DA 5J2UB 3AFGA 2WQZA 3EA4A 5F4ZA 1HE4A 5TQVA 4FWTA 4LF9B 2IY9A 1B14A 3CC8A 2JF0A 4GI1A 3T1VA 4C14A 1KMHA 2O1SA 2PWZA 3DL4A 4HPWA 3DFKA 4OAQA 3BJMA 3EULA 3G9UA 1F2TA 4K6HA 5JOQA 1YONA 1DKPA 1Y89A 4A15A 3T1NA 2Z2JA 3QF7A 4G07A 4AZ3A 3CLTD 1CUBA 2PVSA 3KQSA 4LS3A 3KLNA 4N3AA 2BKXA 2DAPA 2BGGA 4DCOA 1IY2A 4O2AF 1X9HA 1U63A 2ZKIA 1NI4A 4TV8A 3BKWA 5K99A 4ZXPA 3L5OA 3IVXA 3CBGA 2IYYA 5L3QB 2XMGA 3VV3A 2ZWAA 4QYIB 1SIUA 3MF4A 4BNIA 1VSUA 4MQ4A 2QP4A 1JG6A 2RBKA 3JYNA 4IICA 4ARAA 2B1IA 4C2TA 1ATZA 1N2XA 1TI7A 1NRWA 4MVCA 2D5LA 3BA1A 2GD2A 4JYBA 1PHPA 1M73E 1XVTA 3L7YA 3IH5A 2XRYA 3NFYA 2AMJA 3N3BC 2CDNA 3PXBA 1NHWA 1P74A 1TYDE 3TIXB 4YT8A 1JHPA 3DTVD 4MUKA 2QSUA 3R3YA 1XMPA 2AUTA 4HVAA 4QUHA 4D8UA 4F9GA 5A4AA 1BCSA 3U4HA 1TJ5A 1B00A 1SXJE 1NOJA 2I2BA 4KXLA 1WKCA 4P5DA 1KNQA 2NACA 2LXNA 2QUAA 4ZIRB 2NTJA 1MHPA 3UT0A 1HF3A 1P4GA 3S40A 2C7GA 2P9YA 4C2UA 1OYOA 4J76A 4LEIA 1NI4B 4I5GA 3FPHA 3LDGA 3LGAA 4JB3A 4MWOA 1SQFA 3GZNA 5B7GA 1NYTA 3OFKA 1B1AA 1DAGA 2FG5A 3CH4B 2QX9A 2VAMA 2P9FA 1DWPA 3HP4A 4JLBA 4NOLA 2ORVA 3WOHA 1MA3A 3C24A 3T9AA 6ADHA 2NV6A 4KFSA 2QYHA 1R6UA 5AOAA 7MHTA 3DHVA 3D8NA 3NOOA 1RZVA 1UJMA 2CVZA 5CW2A 3TCKA 1J39A 1L7BA 2AHRA 3GYBA 4ETNA 5IW8A 1PRYA 4F92B 1IYZA 1VDMA 1YU6A 2VF4X 2A1UA 5IKOA 3D4NA 3CV3A 7REQA 1R4NA 1W75A 1YZLA 5E1OA 2G63A 3GEBA 3GD5A 5EP3A 2JARA 3I8SA 2VK4A 1XWWA 5EY5B 1PJ4A 1J7KA 4TMYA 2M6LA 5CITA 1KYQA 3ED1A 1HO3A 2GPWA 5JNVA 4F4FA 2RGNA 3ISJA 3IMKA 4GPD1 2OKGA 3QPAA 1XRPA 5JJ5A 4PLWA 5IXYA 4XGIA 1B2LA 2M32A 2ZVDA 3WWPA 2X23A 5DTQA 1DJQA 3S44A 5BSHA 5LP6B 4WESA 5EJ5A 2FPIA 2PUVA 1JMYA 2QTLA 4D4KA 4IIYA 1QIIA 5FOWA 4BB9A 4RV9A 4YXFA 5G3YA 1ZONA 2YJZA 1O8BA 2QAGC 4OVKA 3G1WA 2GVZC 4FQ5A 3FZQA 4ZI3A 2NT4A 2R4TA 1NM5A 1QDEA 3THSA 1O0BA 3HY3A 5KVAA 1V3UA 2CNKA 3VR0A 1OGYA 1GU7A 2OLEA 3ZZ1A 4R0NA 4RK5A 1NBWB 2POCA 4GE3A 3TXYA 4RNDB 1CF4A 5LXTA 1JU4A 1NIJA 1QNLA 4PYMA 5EL0A 3HTXA 2VP4A 1AZWA 1JA9A 2HJ9A 3GK3A 4L6AA 1N2JA 2JGLA 3NYIA 4DQXA 4C21A 3AQIA 4DTIA 3OQIB 2JPDA 2OOKA 1Z9BA 2QTVB 3WGJA 2I7CA 1L7PA 4AJKA 1R74A 4RPKA 4JMPA 1PJQA 5K0TA 4M1SA 5B1YA 1KY5A 5JAPA 4V02A 2NO0A 3X1XA 1UWKA 4AYXA 1L7NA 4BGDA 4W7IA 3U7JA 1H8HD 2A5GA 2VNAA 2GEDA 4IILA 4V0MA 3SLRA 4OOFA 3WYDA 3HN7A 2CUKA 3B8HA 3LT5A 4TL8A 1JG1A 3UMVA 3NLLA 2B82A 4HDQB 5EQJB 2JA2A 2QRKA 5C34B 2Q1UA 2HCBA 3N7UA 4WZBA 1D6NA 1XNQB 3HMQA 2VH5R 1QK4A 1T6YA 6REQA 1M75A 1EFRA 1PJSA 2EERA 2KS6A 2YJGA 4O3FA 5MN4A 1UFVA 4RHUA 2YJ3A 3NB0A 2QZSA 3M34A 2WVHA 2VTKA 4MYDA 3GQBA 3CW2A 3HDHA 2ZUVA 1HXHA 4LGYA 1T5HX 4D42A 4F8JA 1B2RA 3WYFA 4ND1A 4MI6A 2P90A 3VHXB 3DL0A 4X60A 1MU0A 3FYHA 2UU9B 3AHHA 2W37A 2PGIA 3BWYA 4HNTA 1R9NA 2SECE 3VPXA 2COUA 5KYYB 1ULUA 3GWZA 2G1UA 4TSKA 1SD1A 1OI3A 4BRZA 4E15A 2D2EA 1JHZA 1IRIA 2E1PA 2RCNA 3TOXA 4XWKA 3TNDA 3DE2X 1CFZA 4LKRA 4TWJA 3ZDYB 3M81A 1XWIA 1ZZEA 1Z6PA 3GLFA 2R8EA 1K3UB 2VYFA 4G97A 1ODIA 2JFUA 2MTBA 3GFVA 4KIWA 1FP4B 2JGNA 3AJAA 1GADO 4Q02A 9GPBA 3O8LA 2GCIA 1U7XA 4TM8A 2PKRA 4ZO4A 3ED5A 1F60A 1UZUA 4GT1A 2V97A 4PZEA 5DMXA 3RFXA 1YJCA 1UJ4A 3I23A 2XCQA 3NBZC 4Q7KA 2BKUA 2C4UA 3I8OA 1DBWA 1J6UA 5C1PA 4JYAB 1SU6A 1I6WA 2XITA 2HUPA 5JWHA 1C0KA 1IQUA 1IOVA 3U37A 4YR9A 3D9QX 1OPRA 5KNDH 5HF6A 1OAOC 3NTQA 5CMLA 2P5UA 3FJYA 4OHRA 3RRJA 1MH9A 1VE9A 3GVHA 3KEGA 2AE1A 4X44A 1C30A 4NYMR 4UCWA 2P2GA 2IOFK 3P1JA 1UBUS 4EEXA 1PGOA 4UTNA 3ZDBA 1DJPA 1CDOA 1R4NB 2GVDC 2BGIA 1FUYB 5GVRA 1G6Q1 2ORWA 2D2FA 4RHTA 4XPIB 1EAMA 2AVDA 2ZVQX 3WGMA 4DTCA 4FR0A 1N5LA 3SR4A 2QG6A 4CEJA 4QVIA 3NOQA 1VJ5A 4DV4B 1I30A 1RU3A 5FOSA 4EG1A 4XQGA 4KQCA 3E2PA 5K4AA 2X5OA 1PFYA 3ND6A 4RXTA 4XX1A 3ASUA 4IGIA 2ZBPA 4ND3A 3K6RA 1L7QA 2BYTA 2WV7A 1YS4A 1KOFA 1ENOA 2GD1O 3HI6A 4I46A 3UFXB 4ERXA 1L8LA 4BBPA 3QUSA 1KE2A 1T9CA 1PKXA 2QYSA 2XUGA 2LW7A 3Q41A 4OQMA 4TL9A 3RUAA 2GKSA 2QX4A 3T6KA 3SZGA 5JI3E 5H7XA 1T0UA 1C9NA 1CR2A 2OXCA 3ILVA 2AOTB 3CLHA 1TVKB 4ASUD 3KUUA 2YINC 3OY2A 4HNAB 1PZEA 2HIAA 1WSWA 5M04A 3NGLA 1BCSB 3A9RA 5H81A 4V0NA 1QHEA 3BIJA 4G5RA 2Q0SA 3WNDA 3TFOA 3DPIA 4B3MB 4L08A 3DOJA 4ND4A 1H94A 4G36A 1E1RD 2D13A 4H7PA 5CDGA 1ILEA 3FVTA 3H5TA 4RJLA 3F4BA 4CTKA 2I87A 3WYCA 1U6IA 3FPAA 3T5DA 3RO7A 1R8JA 4P9NA 2WICA 4GVPA 4OHXA 3CXRA 4I1IA 4G1VA 5TMBA 1F17A 1ADYA 3WDLA 2VUSA 3ZDQA 3TMAA 2Z5LA 2LUOA 2QTGA 1CUYA 4EUFA 5L3QA 4OHUA 5IKXA 5FBLB 2EJWA 4Q7JB 4RS3A 5EMHA 3VGPA 5KUTA 1NVKA 1Q14A 3IO5A 3R7BA 1HE3A 2AFIA 2V7EA 5H8WA 2WJZB 3W4KA 4PHHA 1DKMA 2AYZA 4R2MA 5EJMA 5LLSA 4DBZA 2G9QA 4Y7CA 1IHPA 4ZOQI 4YAUA 1CY4A 2YQ4A 2A9QA 1SCDA 5HRUA 4GYJA 5DP2A 4HH3C 1U9JA 5AK5A 2RHOA 3W8DA 1PQWA 2QR3A 1PG0A 2VPIA 3MWEA 1JE1A 4WXRA 2D1YA 4NNPA 4EJFA 3L4KA 3ZI7A 2IUFA 4ZYVA 1HDCA 2C5HA 3C7AA 1EFPB 1EINA 4OFXA 4W5HA 1SVMA 1RHQA 2JGAA 5I7AA 3ZE0B 4KMOA 3A1NA 4O4JB 4O59O 2EIXA 1V16A 4P7JA 2HXSA 1DADA 2IVFA 2R97A 1LSUA 1LS1A 3OG9A 4GM1A 1N92A 3CTPA 4TUYA 1EXWA 3LJKA 4HSEA 3T7JA 3U7GA 5JD3A 5JNTA 1XEFA 1TLTA 2PUTA 1AS3A 4FDVA 4U1RA 4JI6B 4ETWA 1C0IA 3A6JA 3I1YA 1F2DA 3MRXA 3J81k 3KWMA 4DG5A 4P93A 1S2MA 1U0GA 3MMPA 2YVKA 1Z0JA 4INPA 1K9VF 2X5XA 3FSJX 4ON9A 2WINI 1OASA 2P67A 2LPMA 4IKOA 2EWWA 1SBNE 4CL8A 1CE8B 3I1JA 4G5SA 4BNTA 4FZRA 2RHGB 2VTEA 4KFUA 3HO6A 4XVHA 3VU0A 1UJ6A 3JAWB 5L7YA 1GRNA 3Q9LA 2LCQA 4QXAA 4TV9F 2WFMA 4BNLA 4RKYA 4PSUA 2XV1A 1G8JA 1XJCA 2JHAA 2WABA 3DVSX 521PA 1T3HA 3B1KA 1N36B 2Q5IA 2FMIA 2G72A 1XJ0A 1XV5A 2XR1A 3PC2A 2VSYA 5ER6A 1WBJB 3WDSA 4AY4A 4F4JA 1GPYA 4QAJA 2WJGA 2R65A 1LV7A 3EQ9A 4WXMA 1FA9A 1OI7A 3L8HA 3U31A 4QOJA 5KWSA 2QBYB 1P45A 4ZOLA 4K9DA 4XLLA 3KKMA 3HU2A 4KLCA 4EI9A 2X3YA 3H7IA 4WMLA 3PCRB 4HO1X 5IBPA 3T0GA 1QYIA 2IYTA 3E1SA 1RRMA 4FYWA 3TTVA 4DQLA 1A9XA 2Y1FA 4MK4A 1DWOA 3LYAA 4JL8A 4MB6A 5JBQA 1V11B 2YVUA 1B8PA 3GBPA 4OB6A 4GL2A 2JKVA 1MQSA 4FHCA 2DFPA 1FRQA 4AJLA 1TKAA 3GXOA 1TQ4A 4YWJA 5BXYA 4YMLA 3WLFA 4RE5A 2LTAA 3WIEA 1STOA 3LHKA 2BHSA 2HR1A 1G17A 2AL7A 2JANA 3LW7A 5CJJA 4BFLA 5SY4A 3SZOA 1KJYA 1BAPA 2CB0A 3SHWA 3WQHA 1FLDA 1ZU5A 5C1BA 1UBLS 2CXSA 3BCHA 1QF6A 3U3DA 1JFRA 1MCZA 2V9CA 5KDLA 3CUSA 4RKQA 1LKZA 3CZ5A 2RC5A 5FUBA 1S2DA 4DLRA 3QPBA 1PR5A 5C51B 3AI7A 3RT9A 2V65A 4DIFA 1MJGM 2IXFA 5EUBA 1MORA 3GDOA 3L6RA 4G81A 1ODKA 4B3RB 1O6GA 1TYBE 4WJZA 3V8MA 4I4NA 1WW2A 2V1UA 3UAWA 2GAJA 2OK8A 2ZB4A 3F4LA 3IX7A 3UJHA 2DHEA 2IZOA 4LWPA 1XVUA 1ZL0A 3KQPA 2ZPAA 4C5AA 1JHQA 3DLBA 4RUKA 2P0YA 3ETCA 4PAWA 4MV3A 3OPYA 1B4DA 4LRQA 4C4TA 5BQ3A 3G0HA 1XZIA 3SC2B 3QKRA 1A2OA 2TRSB 3TLJA 1XNHA 3RS8A 1G16A 4OHCA 1QRRA 3SBOA 4NDZA 4MPTA 2FKAA 2NYUA 4RXUA 2EATA 3PQFA 1UFOA 2X40A 1A98A 2J59A 2ZLBA 3KOWA 4V0QA 5AHXA 4KQIA 5TX7A 2XEDA 2P3OA 3AYZB 3PXDA 4A0QA 4XX0A 1H2AS 4W1QA 1XEXB 2JATA 3JQ7A 3RKSA 3SG0A 5ENZA 4L4RA 3MTJA 4HX5A 1BX1A 2NT3A 2V7WA 2BISA 13PKA 3KCQA 1VKNA 3QKSA 4HXYA 1YR3A 4P7GA 1KQNA 4AJ2A 4AWAA 2FV8A 1JHMA 3FCAA 4JVLA 3S8YA 4MV1A 5JASA 4LE2A 3SHFA 2WEKA 3BGDA 3AWDA 4DLUA 3U80A 1SCNE 3N2IA 4KNVA 3G88A 2QD4A 3H1EA 1ZI6A 3ZU4A 1KPGA 1OZAA 4ZAWA 3UAYA 1VMDA 3X43A 2ZIVB 4PXYA 1H1DA 1R4AA 1HNXB 2PGAA 4IIHA 4U4AA 3HY4A 4AMZA 2X22A 1CHDA 3NM5A 3QBJA 3I9V6 2WTEA 4HPJB 4KYUA 4LOIA 5AJZA 3MIIA 4YJ2A 6PFKA 5ALEA 3E53A 2B36A 1LBHA 2YN4A 2C54A 3GRYA 5AOCA 4I1UA 2A7QA 5GOTA 4DR5B 4IIDA 3RYCB 4NCHA 2ZOSA 3H5RA 2PXXA 4II2A 3S68A 2QTZA 2QE6A 1K89A 2DG2A 3E5NA 4FQ7A 1RI2A 4EW6A 4I50B 4B3BA 2VH2A 3IPYA 4GRDA 5TLSA 3QWBA 1XQ6A 3ZU2A 5H4GA 3DKVA 2BGTA 5JC8A 4MUBA 1U0BB 1HDZA 5DYWA 3DWEX 1CERA 1DDIA 1ZM9A 2Q21A 4ZAVA 1XCBA 4I4IA 5BORA 2R4QA 1DPGA 3W90A 2V59A 3CWCA 1G8MA 3OZTA 4MXDA 2EFEB 1ZH8A 3KYDA 3WK8A 5JAHA 3I04M 2C8VA 3OP4A 2ZTSA 4GUDA 4W1RA 3LQKA 5AW7A 3QHQA 1JFFA 4XM2A 4ANFA 4EMBA 3BMQA 3H1BA 4WE3A 3FMGA 1U4OA 3H16A 1W0JD 1R1DA 1S4MA 2GTPA 1J8QA 2R79A 3C43A 4UARA 1SG6A 3T1TA 4D79A 1RC8A 2O2HA 4D9CA 3VR3A 1UAAA 3C5VA 5DVZA 3U3JA 1NXSA 2E0IA 2QP3A 4M46A 1BS1A 1D7OA 1DAFA 4MUAA 1QAQA 3ZCVA 4AJPA 2AA3A 4I66A 4ZI7B 3W3AD 1IMOA 1KSHA 6GPBA 1NW6A 2XAUA 1JPJA 5A3VA 1KR2A 1H65A 2GH1A 1MQAA 1M76A 4WNAA 1ZXXA 4KC0A 4OU4A 4RHEA 5CR9A 5E9JA 1NN0A 2IH5A 1NXQA 2O3UA 1LK7A 2MU1A 2V55B 2QLMA 3GRVA 2HMSA 2R11A 4M8LA 1XQWA 3R9XA 3DOOA 1JH8A 3DAOA 2PZGA 2WU3A 4BX9A 4CCYA 5JXHA 1OILA 1Q2XA 1IUNA 1SO8A 4HGRA 4FFSA 5B37A 2XA2A 4B4UA 1ULBA 1XTQA 3FI9A 3RR2A 2UVPA 3OLCX 2Y1LA 5EKUA 1OB2A 1HYEA 4KLNA 4PC6A 1M2VA 4JR1A 2O14A 3RIXA 1JDUA 3ZCTA 1GITA 5B12A 5AW1A 3LD9A 4M1EA 1D0VA 2ZRDA 1GPJA 1UOPA 2NU7B 2QP9X 4DG8A 5M2QA 4XWWA 1KZYC 4BJ1A 4EHNA 5JSZB 3R6GA 1CZOA 4LYJA 4NE9A 1P2GA 3M6VA 4GXQA 4YP6A 5C1IA 5TPWB 1QIJA 2IW1A 4M4SA 4JODA 2GN2A 4OHMA 3TW8B 3O4IA 1TZ2A 1GZHB 1X1CA 3EGCA 3IUYA 1T1RA 4PYLA 5DYYA 3PQ2A 3VZSA 3DNPA 2IEZA 1JLKA 5AUNB 5K8CA 4NS4A 3HBLA 4NG5A 5EZYB 4I4TA 1EEXB 2CD9A 2X4LA 2O2GA 3DMHA 3NBMA 1IEXA 3LWNA 4H31A 5F98A 1IC6A 3NHKA 4PBRA 4UXJA 3L7CA 1TT5B 5CK5A 3S2FA 5GINE 1D09A 2X8JA 1BE8A 1V8BA 4R2HA 4CETA 4FHZA 3TG8A 3CNNA 1BHQ1 3UW1A 1KK1A 1XMIA 4AK9A 1ZAKA 2GHQA 1WTAA 2GYVA 4JT9A 4DQ0A 1RWMA 4BFUA 2O7VA 3U5ZB 2C2GA 4LRTB 4OP3A 1JQBA 1PSWA 1VRVA 2FZEA 2I0FA 2Y92A 3L02A 3M9LA 3UT6A 4C01A 5JQWA 3KHSA 2J8ZA 1Y1SA 1MA0A 3ON5A 1Y6GA 4LISA 3HJBA 3BJRA 2W6ZA 2NVBA 2XH8A 3EAQA 3NBXX 3G59A 1W581 5BOSB 1MHTA 2JGFA 1F7VA 3DLTA 4K9LA 4OHWA 1XTVA 1P6QA 2CBGA 1GARA 1XCJA 2J3EA 2RAFA 4OKNA 3WGTA 4KITB 1QLJA 1PWZA 1ZYUA 3RHFA 1YHNA 2BP7B 3IUJA 4GD3Q 4JP5A 5HM8A 2PFKA 3QWFA 4YA6A 4LF7B 1T5OA 1DV1A 3U17A 3NXKA 1E9FA 1KO5A 3AGQA 4WUTA 1CCWA 3KUKA 1D0IA 2NPOA 5GZ6A 4TZ0A 3PYLA 2R0QC 3C3JA 3EG5A 3GGCA 3L6CA 1BEZA 1L7AA 3AVYA 2Z83A 2OT3B 1WHSA 1UH5A 3PSHA 4Q16A 4QELA 3SQXA 4DL9A 1I1OA 1WXEA 4XSVA 4GZ6A 2R44A 3ANSA 1IM2A 1VBFA 3JZAA 1Q7GA 2IKSA 3I9KA 3TJMA 5D1NA 1Z0FA 3N8KA 3IQEA 5LB4A 3DDHA 2ZBFA 3NEJA 3QXGA 2FWRA 4ROSA 3AU9A 4DOMA 4K9KA 2XTNA 4UFPA 2XBMA 2WWRA 2YYZA 4FHFA 4PPNA 4TRNA 1JR3D 2C78A 2JIRA 4HRVA 1EK1A 1QFSA 2HNBA 3OQ1A 4B4WA 3FUCA 3QX3A 1FZTA 1V7PC 3GAMA 4KO1S 3GP5A 3VC3A 1XDUA 2WWHA 1W93A 5BNIA 3P2IA 3R8XA 4ZEMA 2BMVA 4P34A 2XOEA 1P80A 1UEJA 4MYRA 4DA0A 3LYLA 2WF6A 2HJHA 2R85A 3R1IA 4G1BA 1RC0A 4HBZA 5EZSA 4D82A 4FEGA 3GP3A 4XLZA 4WVLA 3ZX5A 5EXXA 4EJMA 5IJZA 4ME6A 2IHJA 3QMVA 1COWA 4CQMD 4KUHA 1N5DA 2Q46A 2PMEA 3ABRB 4BZQA 1O1YA 1CHNA 1EG2A 1UAGA 4URHA 4L1KA 4INAA 4FXOA 3ZBUA 3A10A 2IYNA 2YIDA 3KAQA 1SXJC 3VKFA 5D6OA 3SYRA 3UF0A 1GKUB 1T8PA 4MVJD 4KQXA 5CLLA 3FFXA 3KQOA 3UWKA 5DBOA 1ENPA 1QVWA 4V1CI 5HA5A 3BHJA 1FP1D 5M3BA 4DCPA 4K1XA 3A4YA 2NTYC 3OUUA 2BMAA 4OP2A 4XTCS 3R7WB 3V42A 3RFVA 4YYZA 3EY9A 3LK6A 3SDSA 3QVMA 3WGLA 4I4TF 4EUNA 3ICEA 2CLMB 2C2KA 4L3WA 5CLQA 4BTVA 4WOKA 1B3RA 5TQ2B 5EFZA 3S7TA 3G8AA 1N77A 5J2UF 2IOQA 5DF1A 1TVEA 3A1CA 1X7YA 4QM6A 4B0PA 4Y30A 3FUTA 3FCOA 3BB4A 4L9WA 5GM1A 1P7VA 1NZJA 3FFAA 3QJYA 1S9HA 3E9CA 1P5HA 3MQFA 1M2KA 5ALWA 1XALA 1E5TA 3D7KA 1BS9A 1TM3E 4AKTA 3R0XA 1JAYA 2Z30A 4QBGB 1W85B 2ZJ1A 5JW6A 5H5JA 1QKIA 2OWDA 1GQOA 4FJ0A 2G5CA 3T9BA 2C2ZA 4B85A 5HVNA 4ZQEA 4NAHA 1NMYA 5HE8A 2Q2OA 1I3CA 3D6AA 4QFMA 1JYFA 5H4HA 2R68A 5EJEA 1CV2A 1T2AA 2G09A 3A4VA 2Y77A 1U2PA 1TADA 1Q83A 2OCLA 2REQA 3UPDA 2CUNA 1A2KC 1DJOA 2G25A 3PXAA 3C4JA 3L8YA 5IDQA 5JY6A 3WZMA 2OBMA 2F55A 5KYUB 2Q6VA 2PFSA 2J3KA 3BMNB 1CR6A 2WM9B 3IVRA 2A2ZA 3QTTA 1P9RA 3L1JA 3UENA 2FWPA 4KPGA 4ZVPA 1SVNA 2QNBA 3VR5H 1ZUIA 1NHGA 4F1JA 3D4PA 4QDUA 4ZI7F 2UAGA 4KQMA 1SEVA 5ECYA 1MVOA 3WGQA 4G1MB 1TA0A 1M66A 4QNMA 2O1XA 1UQTA 2QMEA 3A28A 2ZULA 1YS9A 1UBJS 1MH1A 4PFQA 2IW3A 3DEJA 4X97A 2HAEA 3U0BA 2RKBA 1HYHA 4DMFA 3H2ZA 2I8AA 3ANYB 3LVQE 5HFAA 3KT0A 2IP2A 1U8TA 2Q9AA 3DTTA 4IJMA 3PNPA 1IN5A 5CHEA 3RJ9A 5I3CA 3H99A 4RVGA 3T95A 1OFUA 1PNQA 4A8JB 3TUZC 1ZWLA 1HTTA 4IVQA 3MCVA 4CM1A 2J7PA 1DOZA 5JJIA 4GMHA 4GWLA 3B3JA 2P6MA 5LDHA 4B4OA 1OAKA 3S2GA 2R6JA 2BR3A 3B48A 1M34E 1OLSB 4BN0A 3WADA 2BVNA 4X1OA 2JAHA 2W98A 3NV9A 3TUIC 3IRUA 4L8YA 2ZEJA 4YJFB 1CF2O 1PQUA 3NIBA 1E0KA 2EFDB 1RWOA 1PT8A 4B4VA 5CLIA 2UV8A 5MF6A 1W5TA 3HWSA 3K35A 4Q0MA 3W3AH 1F20A 1ODCA 2NU8A 4KAJA 3QWAA 4RJ2A 5J4KA 1IN6A 1N0WA 2EJBA 3C16C 1EH5A 4ISBA 3WWDA 1JEYB 4BRSA 1X0XA 5JT1A 3FTFA 3H8SA 4G1EB 5AM3A 4HDKB 5JD5A 3VNRA 4GLBA 3UXYA 2Z9DA 1SXJD 1II0A 2GA8A 2GEJA 2GBPA 1PS8A 3L0DA 1DT5A 4BV3A 3HFJA 5B3JC 5IHPA 1ISPA 1DBSA 1U94A 3IGFA 1ZGHA 4P4TA 3ZWNA 3U5TA 3TIFA 3CNHA 3ILXA 1MPTA 3RUFA 2YV2A 4J0GA 4PGAA 1CEYA 2JZNA 3Q5DA 4RFSA 2W2KA 3TTXA 1H2HA 2IXDA 5G4LA 2ENWA 3VDMA 3MMZA 3T5GA 4IMIB 1F5SA 3L6OO 3MJFA 5DNUA 1TEVA 1N2GA 2WRZA 1L8AA 3P94A 4Z0NA 4JV5B 1S7CA 4HH4A 4YHBA 1DFIA 1O89A 5HDBB 1Z6ZA 1PR0A 3FB4A 2E4WA 2PL1A 4GL4A 4XCQA 2QPOA 3I64A 2NW6A 4BLPA 4LY9A 1M1NB 4F93B 2DFVA 2PGNA 2QS9A 3R2JA 4V3CA 3GD7A 4Q3KA 4E03A 1NT2A 3OCVA 4IOLA 4JDUA 3RFFA 4B40A 3NUQA 4FYYA 4XIJA 1KF0A 1FUIA 1A8HA 2QEQA 3A6PC 1ZK0A 4GBED 4OI1A 3UAXA 3FPSA 4CQLB 3DDNA 3QI7A 1E6UA 2VHXA 2VRBA 3DE1X 3IUNA 1H42A 4JLKA 4OBXA 3ZLBA 4UU0A 3ZCQA 2DCUA 3RWMB 2QZJA 4RSRA 4E21A 4EPVA 3B3GA 5FQNA 3QEJA 1CY1A 1TM5E 2MYNA 3VMFA 1DMSA 2GPBA 4K87A 1Z6TA 3TI9A 5C18A 1ZUD1 5KQMA 1JDVA 1A96A 2VDRB 3WGZA 2KHZA 2OV6A 3WISA 4QJIA 4Q9HA 2C31A 3PUKA 4GGOA 1GUYA 1WPRA 3RBVA 3HN2A 3EHDA 3F6BX 1DQZA 1CLUA 3GFRA 4UHKA 3IELA 1GTMA 2E2WA 2ETVA 3COYA 4TQAA 3LHFA 1M6WA 4FSDA 5BN5B 3B89A 1U4SA 1TTHA 2X0KA 4FYHA 4MYSA 5L3RA 3WKAA 4D3YA 5BVHB 5EIAA 4J94A 4EG3A 4LF5B 3HJGA 1KZ1A 3F73A 3KYJB 4DEXA 4P4NA 3J81A 2OBXA 3HEMA 2PRIA 2TYSB 1H3EA 3U44A 2O8VA 1U9ZA 1YAHA 3TSYA 3UKDA 1KIFA 2LV8A 2ZTUA 1B0PA 2C4NA 2OK7A 3ORFA 3PFNA 4EZEA 4Y6GB 3R0QA 4KZPA 5BOVA 1KTIA 1UJ2A 1I8TA 2AXNA 3BK7A 3I32A 3JQAA 4CLRB 1FJXA 3A1UA 5DHQA 5F3WB 5H9VA 1I9GA 3L4BA 4TMKA 2ZB8A 2FW8A 4FDUA 2XTAA 4JQCA 5JS1A 1N7JA 2NO9A 3X2SA 3HNOA 3MA0A 1VE6A 1RXYA 2VOJA 4LY0A 1HTWA 2OGZA 2R62A 4PXAA 4EG8A 1QGAA 1RPAA 3O4JA 4LSMA 5G3ZA 3X2EA 1AQYA 2F67A 4AKEA 5CEJA 5MGNA 3K9NA 2IS1A 2BH2A 1TA9A 2W9XA 3VKUA 5A7HA 4F9TA 4I8XA 4FIZA 4E1BA 4ZOBA 5LSAA 4WKOA 4FTWA 3OQVA 2PSDA 4R84A 5EYPA 2BKEA 4MKFA 2OV4A 3DBRB 4YRRA 4O4HB 5A9TA 5CYGA 4LXHA 2PX3A 5C7OO 3ZGLA 1BA3A 1YV9A 4EVRA 2X9LA 4DDTA 1U7DA 1L3CA 2GXAA 3C3KA 1JMVA 2I76A 4WKPA 4Z9FA 1G9SA 3I3OA 4ZCQA 5F7ZA 3IEIA 5AUQA 4B44A 4BMXA 5IN5A 1IAQA 5DXAA 4NZ9A 4IQFA 4QWWA 3LC7O 3NZEA 1G5QA 1C3XA 1VPTA 1XMVA 2BGKA 3GLUA 4GX2A 3HCAA 1CYDA 2W42A 1BH2A 1TE2A 4BCBA 4LJ6A 5IKPA 1TF5A 3ZHVA 2Y05A 2ZBDA 4RF2A 2AZXA 4DRXA 3ZWMA 1TO2E 5JNRA 3A2KA 2HWWA 1TUIA 5K0LA 1DEHA 1Z29A 3NDPA 2OZEA 3UJPA 1GNTA 4CHTA 4CIAA 3LCVB 2H1SA 3HS3A 3HWX1 1D0SA 2L42A 3LUFA 4L5IA 4O25A 4U0JA 5TVKA 1RI3A 4M0MA 3ADCA 1EVEA 3E18A 1X38A 1MABA 3GGPA 4JY7A 2FZVA 3QFTA 4KH0A 4QDKA 2BLLA 5BYBA 3WO1A 5JI2E 4MWGA 1FMCA 1N6HA 4F04A 1WETA 2WG1A 4IH1A 4PYRA 3SZRA 2EU8A 1HEIA 4ODIA 4JT2A 2G7MC 2IYUA 2G80A 3DBOB 4CF4A 4TVBA 4I5FA 1TQ8A 1N0UA 3JASA 4AMYA 3KSAC 2GN4A 5CW1A 4FWIB 3MCWA 4E11A 1NPDA 4H0CA 4LYEA 1PYDA 1UPFA 2WVAA 2VP2A 2YMQA 3NONA 1DV2A 4DRXB 1KI8A 4DJFC 2Z3WA 4TXNA 5LYYA 5FA8A 1OT3A 1VBKA 3NALA 4UPVA 5HGJA 1QTQA 4HY3A 4ZQFA 2PX4A 2CBXA 2O1WA 2C94A 2YV5A 1SVKA 2ZP1A 3VAYA 1A7AA 3RAGA 1Q57A 2FLVA 2FPWA 5LDGA 2BHRA 4S1PA 4WJKB 4BXOA 1JHYA 4ZPXA 1R16A 3AFHA 4OHFA 5FBVB 5JAIA 4BV2A 1LTHR 4MWCA 2FUG1 3LO5A 4GMKA 3R20A 2FTKE 2PKQO 3IIEA 1KQFA 4JJ4A 3JVIA 1TCAA 5GP1A 3CSUA 5HUJA 4WT7A 1NVEA 3D6NB 1VSQA 2I6GA 1C14A 2N47A 2XE6A 5BN4A 5LQJA 5JANA 1Y82A 3W6PA 2AYYA 3C8DA 2OLKA 2OO5C 3GLVA 2C5SA 3LWBA 2QX7A 3LO8A 3VR5D 1DOAA 3EFEA 3P9YA 2WUEA 4YMSA 4F4UA 3IB3A 4M1ZA 1BJTA 3AUJB 3M6IA 1DQYA 1XQ1A 3P97A 1X7DA 4JBWA 5CM9C 4Y3UA 4X3PA 5BW4A 1OD6A 1NQAO 1AVTA 1RE0A 3F9CA 3UC9A 4MUJA 3KBOA 2AKAB 1UC4B 2NYVA 3FMPB 2C92A 3LDFA 4WADA 1OIVA 1I6MA 1A72A 2HQ1A 2QYTA 3O84A 2WP0A 1Y33E 5KNCD 3RUEA 1V41E 3EVAA 2E4YA 1BOFA 1KK0A 4Q4AB 4BQRA 2HW8A 1SH7A 4EPWA 5LBTA 3O5AA 3B70A 3BA6A 4HRXA 1SMKA 3LU1A 4LXQA 3CLTC 2P0EA 4EFDA 2G88A 4GF5A 1ZVKA 2Q1YA 3DDZX 4BP1A 4URUR 4J7XA 3ZJVA 4MICA 3DEHA 4KODA 1J49A 4EO4A 3EVGA 1J90A 1JIUA 2HQOA 4NNJA 1V35A 4RDIA 2RE8A 1DVRA 1IQ0A 1CU1A 1ZI8A 3IESA 3FROA 3KVOA 2CFRA 3ROMA 4N5IX 4HADA 2FPKA 2XT6A 4CLXA 2JRLA 1UKBA 1G59A 2B7LA 5JH7A 4DR6B 1SK9A 3C8MA 1NN5A 5ALFA 4OLFA 2HI0A 1PE0A 2ZUEA 2WW8A 1Q1EA 1UPBA 1WTCA 4PU0A 4YC7A 5DNAA 1CUVA 1NBOA 3KLBA 1RTTA 3CX4A 4ND2A 5BSWA 4DADA 4FMBB 1VSTA 4P54A 4B5KA 4EOGA 1XDBA 3GCGA 3GCZA 3I53A 4DYVA 3G1TA 2WUDA 2JASA 3QFFA 1N9KA 3AEYA 2X8WA 4GOMD 1ZGBA 4DNFA 3ZVMA 4KLAA 2H54A 4EG4A 2B4AA 4RANA 5JVDB 2V1XA 4D9FA 2WIAA 4RVCA 5BMVF 1GR0A 2P65A 4CN8A 2RBGA 2WZDA 2RH5A 1LJLA 1SA0A 1LNQA 2EEPA 1EFKA 4RWZA 5C8VA 3KKNA 1VLJA 4I1YA 1OQAA 3Q12A 4U2BA 2XDQA 4GOJA 5FA6A 5I48A 3ZI0A 3CIOA 1SHKA 4X6YA 2I67A 4V3BA 5EOVA 1ZK1A 1UM8A 2PD6A 2IKQA 4ITVA 1T29A 2F3SA 2J31A 5BT9A 4OL0A 3MGCA 4PX2A 1QBGA 3SPXA 1MR3F 2BLNA 3BOSA 1XTIA 4JBGA 1E79A 2HREA 4KIJA 1CLEA 3W78A 3I2FA 3ZZUA 4GGMX 2J6IA 4Q47A 2W93A 1FS5A 5E1BA 2A0XA 4X92A 2CGEA 2IJGX 1U0OC 1VCOA 4A16A 3JWGA 1SKQA 4CG0A 2JFXA 1V5GA 4NFLA 3NWPA 4Z1OA 4MW2A 2YV1A 1N6NA 3QVVA 1EWVA 1YK1A 1Z2AA 1SKYB 4GKKB 4C78A 3JWEA 2BDUA 3TOVA 3DZJA 2H7CA 3LF2A 2OAP1 2ZIGA 4EMSA 1E0SA 2H1RA 4RNCA 2IZ1A 2EX0A 5SZJA 2Q5EA 2Y6VA 3F74A 2JLZA 2WM8A 2HJSA 2EJVA 4B87A 2ATIA 3NKVA 5I9TA 2AX3A 1L6IA 4WLFA 4I9HA 2XI4A 3UWDA 1T8SA 1Z5UA 3NNDA 5D01A 3W5DA 4L0MA 4B80A 4NOMA 1PR9A 1ABFA 1UADA 3BERA 4K40A 1P29A 2Z43A 4NYMQ 3U9TA 3THRA 4HS9A 2PZ8A 4R1UA 4NY1A 1W36C 1BVHA 3LXUX 5AHKA 1NXXA 2IPAB 4HNQA 1D7AA 4CKBB 1JLHA 2DPXA 3T9FA 2RB5A 4BWYA 2PXCA 3EPLA 4XLTA 3NHMA 4D9GA 5KOJA 3DVAB 2XQVA 1XA4A 5E9WA 4D57A 4HUQB 3CZ4A 4FCTA 4B8YA 5LQMA 3F78A 1CQPA 1PEYA 5DIFA 5KYUA 2WBLC 3QYJA 3OCXA 3D3KA 3LH5A 3E1GA 1IM5A 3QHAA 1OW3B 5ERYA 1NV8A 1TCCA 3PUIA 4LSWA 1ID8A 1Q21A 4PVCA 1XZQA 3FRHA 1B8UA 4TQGA 4ZV4A 3T3PB 1VXOA 2Y0PA 2WP8J 2K6GA 3GAZA 1DAOA 1E7MA 4BQOA 3LTNC 2FSVA 1F0NA 2BELA 2IV3A 4C43A 2CXQA 3ZKWB 4ARZB 1MO4A 2WAMA 1E9EA 4X94A 1HFWA 3DGEC 1VQ1A 4K7JA 1UJCA 2R25B 3PNSA 5IX8A 4UTPA 1C9DB 3E8MA 2AD5A 1LPNA 4A8TA 4UBLA 1ONNA 4TXHA 4GECA 1UP4A 4QTUB 3JX9A 4ZJUA 1F6DA 1QX3A 4G9EA 2I2XB 3IQFA 3P7MA 1N3LA 3IKTA 3IPXA 4H4DA 4AL4A 5AUPB 5B1IA 1RI4A 4GI5A 3UW3A 2P8JA 4KSCA 5ALUA 5AXDA 2JIPA 3A6FA 2IF2A 3HWRA 2P41A 3MT0A 3AEUB 4PYOA 4FILA 4HNSA 2OV2A 1RZRD 1UJNA 1W8DA 4UASA 8GPBA 2RG1A 3R7WA 1IWPB 1E60A 3H1GA 5DPMA 3RQSA 5LQUA 4ZMSA 4R1OA 1TAUA 4HLDA 2LKCA 4CL3A 2W6JA 4KOAA 1IJEA 4D41A 4OQQA 2YY7A 2G8NA 4N4AA 1Z7GA 2BFDB 1KMNA 1RWKA 2ZJZA 3IAS1 4LQLA 4D1YA 5JIBA 5B1HA 1RI1A 3RS5A 3FDZA 2KBFA 1RMTA 2JHGA 2OXIA 2FDRA 3PPYA 2K87A 4RDXA 1NNI1 3GA0A 5THQA 3BDIA 4NX2A 3JQBA 2HC9A 4U5QA 3RT1A 3S0JA 3ZIDA 4Z49A 1ITZA 4KKXB 3THYA 1FSSA 4IZ6A 3H5VA 3P9XA 2O2EA 2Q3HA 3HWWA 2HT6A 3CCCA 4IYRA 2C1EA 1T9BA 1ILWA 1U0LA 2RAUA 2GPYA 3ZV5A 4BBJA 1I32A 2B35A 2BEWB 4Q37A 4HX2A 3SZLA 1T10A 4M54A 1O5TA 3U49A 4CT5A 5GY7A 3DFUA 5K8IA 5KSZA 1P6XA 2GX6A 2ZJ8A 4NU5A 3RIMA 2Z8ZA 2C9DA 2GI4A 2EF1A 4XYMA 4AF7A 4HYYA 1N2IA 4ZD6A 4EG0A 2OR3A 2VWPA 2R7MA 3MGBA 2CNLA 3MJVA 4LC0A 1U7WA 3STHA 5KI6A 1FS6A 3T3EA 5GIOE 2E4AA 1ZR2A 1YFJA 5KCMA 1FFWA 3D5EA 2RKWA 4JXJA 2AH5A 1VKJA 2WMYA 3QMMA 3DCIA 3EPRA 3WOVA 5KSWB 1XRSB 3VVBA 3LP6A 2WU0A 3GFOA 3ZY3A 1UBSB 2EG5A 4EPRA 1AUXA 1JR2A 3HM9A 1TKBA 5K4HA 4CL0A 1E2DA 3SWWA 1CUEA 2A84A 2PZJA 5EXTA 3L5KA 3ZCRA 2DBZA 5IYZA 3SD7A 2H7XA 2PNFA 1NP6A 3C6KA 2DUMA 5F5XA 3KTAA 2JBWA 2YHSA 4W8HA 1JGTA 3VPBA 2ZT6A 4B6JA 2ZU6A 3RSHA 4Y2QA 4ZYZA 4L75A 2JW5A 1V1RA 4O4HF 5FTWA 1GTSA 1S5PA 3EBLA 2PS0A 2VYCA 5JUWA 3Q8WA 3GDFA 4I55B 4CLEA 1OBVA 3K1YA 1IK4A 4AMGA 4C1NA 1EK2A 3EQ6A 4S2UA 3WJ1A 1QGZA 1U8AA 4DIOA 1SGWA 4HH1A 5JTTA 4I55F 2IELA 5EXEA 1D2CA 4BMSA 4BB5A 2NO1A 4M1MA 4C7XA 1NONA 4LF6B 3G0IA 4F46A 3HFSA 1VL2A 3HV2A 2QUIA 1F8UA 4RL6A 5TC4A 2QUHA 1QYDA 3KXDA 2DKNA 4WNIA 1T3GA 4PCVA 2IYOA 3ZE7A 5TGDA 3OFJA 4OFBA 2IZ6A 5IAEA 2YXNA 3ZE2B 4BQPA 4JLUA 3HJAA 5BV2P 1PAUA 4I3GA 5HGXA 3CF4A 2CWDA 4MWEA 5EA2A 1SEPA 5DH9A 3INTA 3ZLVA 5HZHA 1DL5A 4U8HA 5ILGA 1JSCA 2YIVX 3U3ZA 2QV7A 5JZMA 5LKAA 1WEHA 2W6PA 1I7QB 4ZCSA 1QZTA 1RCTE 1W87A 1C4WA 3OCJA 4HDMB 4MMXB 3L8GA 4LHXA 4D8YA 3AF6A 2HLNA 1QFJA 2COKA 2D2IA 3JALA 2G36A 4I6EA 3T9EA 3VO2A 2RDMA 3CJTA 3VNAA 1LVHA 1G8SA 4HDNA 3TM5A 2WJVA 1TU4A 3L41A 3PLAE 1TGYA 5I47A 4BGUA 1W4AA 1J9GA 1K1EA 4NABA 1MT3A 3NV7A 3VU8A 2H4WA 2RAVA 3IVAA 3LNCA 4TXMA 5IP5A 1ZJJA 1DRVA 1T5LA 3QX7A 3HBNA 1YR9A 1C41A 2C7RA 4OUDB 5JMOA 2F4VB 4AWBA 4AJHA 5JDIA 1K8XB 1RAEA 1SNYA 2CXHA 1Z22A 2OVBA 3G5TA 3V32A 4G0VA 1ZMOA 2J48A 4O8CA 1JG3A 4IJ5A 4LVCA 5EC8A 1KOGA 1X87A 2FMKA 3E7FA 5CFZA 2VYNA 3TPCA 4AF6A 1QP4A 2WYWA 1TMKA 1M6VB 4G8BA 1BDJA 1KFEB 2HCTA 3AERB 1YT5A 3EVNA 1U0EA 3MJRA 4IHKA 4L16A 1NVFA 1YOBA 3C48A 4RCYA 1I1QB 1IG0A 1F4PA 3WGHA 1ECGA 1KI1A 3LX5A 2PZKA 4FDAA 4DJAA 2O3SA 1WXFA 2WSYB 2VK2A 1N5JA 2WNHA 1KU6A 3AB7A 3EXG1 3K1AA 3GBSA 4CLHA 4HEHA 4IOMA 4LZNA 4XJTA 5ARCA 2EYUA 2PMWB 4QBTA 3QQPA 4EO7A 4YDSA 5CFOA 2GK3A 3W5VA 1OV6A 4M9XA 1CZKA 1CZUA 1GEEA 1JFFB 2B7CA 2GZMA 4L8FA 5AW4A 3R5HA 2JCSA 1Z0KA 1C1DA 5EUQB 3RVPA 2Z56A 3S5UA 4ER5A 5HBGA 1Z13A 2BMWA 4H2DA 4KSYA 3AKDA 3KUCA 3VC1A 4JC4A 5C8XA 1WB9A 1CEQA 4RMJA 3I73A 4YMWA 3RDPA 3RYFB 4LWOA 4RZUA 3SEQA 3WV5A 5GJCA 5FT9A 1DRUA 2Q6LA 4OATA 3TQFA 4YAOA 4Q12A 4IDNA 1P2SA 2BRUA 5I3ZA 4PYQA 1TVMA 2PJZA 2W2LA 2UUBB 1C4KA 1A8UA 1ZU4A 2RHBA 4GX0A 3G85A 1IUKA 1BRMA 1UPXA 3NT2A 3CS3A 5AM2A 3NFRA 4MGEA 4Q7MB 3L2OB 3PQDA 4AUMA 3O95A 3NORA 3WV4A 3PENA 3H11A 4M8IA 3BREA 5I4BA 1G3UA 2YMLA 3GT4A 2RMKA 1V25A 2B1RA 1QE0A 4RLFA 1GNLA 1RKBA 1U0HC 3EGXA 2HU8A 5EWMB 4GFDA 3TECE 5F2KA 3CSSA 1I24A 1IB6A 1TM4E 1WHTB 2XKBA 1M3SA 2R8ZA 2YZ2A 4AY5A 1HRKA 1N57A 1XDSA 2PK3A 3CZQA 1DKNA 3OKAA 1OBHA 4DXDA 5BR4A 2G1KA 4BOYA 1L7EA 1GQFA 3HBFA 3ZXUB 2Y1OA 2V4UA 1JILA 1RAAA 5LUBA 3MWJA 2MSDB 2WUVA 4IQ0A 3CVWA 2DU8A 1LX7A 3FDIA 3O9VA 4ER3A 5KIAA 2OG1A 4HWPA 4XR4A 5LP6C 2QLBA 4E4RA 4LCEA 4BP9A 2FN8A 3R7NA 3B85A 2R1ZA 2XZLA 2RB4A 3T3MB 2YS6A 2GJAA 3M2PA 2ZB2A 5DNVA 2ZBVA 2PGOA 3HZOA 3BE4A 1IPEA 1K7SN 3PFFA 1ZGCA 3AJEA 4IIFA 3UA3A 4BNYA 4EVIA 4Q1DA 1X7XA 3M3PA 4MULA 4J1SA 4UBOA 1UKYA 3GUHA 4MHTA 4Y0NA 2VJYA 1T3LA 2VZ0A 2B8JA 1RLOA 3GUUA 3WLLA 3HZRA 3IR7A 4F5YA 4MDEA 4OK3A 5IBRA 3C3DA 1TDJA 2PQ2A 1W96A 4HFMA 4V03A 5LOVB 2DXIA 2ATXA 2I1QA 5BNTA 3EN0A 4KRXA 2P9TA 4KVGA 1FDTA 1JEEA 2J7KA 1LTQA 3KKQA 4KAXA 1IPHA 3VSEA 4LZAA 3EWSA 5K0CA 4XYBA 5DX1A 3EC2A 4YIKA 3W2HA 3ERCA 1JEJA 1UEIA 3IBCA 4FCCA 5GONF 3WJ2A 3CO0S 1FX0A 2Z2ZA 1ZHFA 1ZIXA 3EGXB 5FP0A 1GV1A 4S0XA 2JGKA 3I05A 3I62A 1P5FA 2PQMA 3PQEA 4EQZA 1HOTA 3Q87B 5U4XA 4BUJA 1JQJC 4RC9A 2FFQA 3R9KA 4LYHA 2BM0A 1IHOA 2PIDA 4YRGA 3TIIA 2P4SA 1RVV1 5J40A 1JECA 1T9HA 2VDKB 2X1MA 3DTNA 2W48A 4JAVC 1NVVR 4C0SA 4BX8A 2VCHA 3O74A 1F6WA 2IXGA 1KDTA 1DFHA 1YZTA 3INYA 2A92A 1WVIA 1IY8A 1PTJC 1WF3A 2WSIA 2LVBA 1E20A 2EV9A 1CPYA 2XUDA 3AL3A 1I3KA 3FTNA 1UXHA 1PZNA 3I4CA 3PA8A 1Z07A 4PZ9A 5B4VA 2G9VA 3RYIA 5KO2A 2PVPA 4GEKA 3ABIA 1I33A 2P2YA 4DCGA 1WABA 1W19A 4JD5A 2OO3A 3FDXA 3N75A 4ZKEA 4ZCMA 4INJA 1ISSA 1J99A 2HRQA 1HM5A 4IIJF 3PE3A 1SHTX 3QXHA 2JJMA 4MQEA 5DTJA 5JQGB 4HAVA 2Z5FA 2QY9A 1UEXC 1FNCA 1SHZA 3QV2A 3K73O 5ICCA 4RIGA 5K09A 5DSZA 2J0EA 3FKJA 1HC7A 1UPCA 4EARA 2PSEA 1AKRA 2HJVA 5C8DA 3UATA 5CFRA 4ZGWA 3IB6A 4KYIB 2XQKA 4PG8A 1NWCA 5KNCH 1XPJA 4WN9B 3TNYA 3WLNA 1EGVB 4I14A 2FF5A 1BZYA 2QBYA 2YV3A 1KZHA 3V4PB 1NKVA 5I9BA 1NNUA 3DP7A 3C1UA 4B73A 4TTRA 2Q3MA 4P8RA 1LSSA 4XWTA 3RUIA 4BVHA 1E89A 1P4RA 2BV3A 1I3OA 4MCIA 5HEKA 3AUYA 3SS9X 2ZJ2A 3DCYA 4XYLA 4A23A 3AR4A 5A62A 4UU8A 1Q3KA 1R0BA 3G5LA 4L50A 1TQDA 2CZGA 3DE4X 5IM5A 3JZMA 4J4HA 2VXOA 1NVDA 3ESYA 4N9QA 5KDDA 4BIMA 4JU8A 4L9RA 4MVJG 4DCJA 3TL2A 2DECA 3WLEA 1KTVA 5EPOA 4Z2AA 1MG0A 3Q2IA 4YCMA 1F12A 3GIWA 1JQLB 1ZKMA 1AXGA 1VIDA 3A05A 3DB2A 3PGA1 2G06A 1RKQA 3HCWA 1VPLA 2RHRA 3OIVA 1MZVA 1GZ3A 1K8ZB 1Z68A 2EQ5A 3DZIA 4GLJA 1H2RS 2CW5A 4LJ9A 2IC5A 1CZRA 3GJSA 3JYLA 1JS1X 2PKQP 4QRIA 4PYNA 3B1FA 1BD4A 5I9LA 3GLIE 4U2GA 2CXOA 2JH9A 1YB5A 4LYAA 2Y71A 1CRZA 4RK4A 3R7FA 5IZCC 3A6LA 1V16B 2GUGA 1GKIA 2XUQA 4IAOA 4J0HA 2ZRGA 4MIYA 2WJ3A 5F1YA 2P40A 3AV3A 3VR4H 1N1MA 1Y80A 1ONPA 1AHHA 5HJ7A 1CIJA 3Q3VA 4Y9SA 2V7QA 4ZICA 5JR3A 1BIFA 1GGHA 4JT8A 3BMOA 4P08A 2VA8A 4R2WA 1P4JA 5JQGF 2G04A 1QXSA 4U9IS 5L7TA 5ECDA 4WK4B 1LUAA 3TDKA 1AMOA 2A59A 4I1VA 5JZ9A 1SXIA 2ZQYA 5AJYA 2IUTA 2AQHA 3N5CA 2IZ5A 5KTTA 4Y6QA 2QMHA 2GZ3A 3IV9A 2IHNA 3ZWXA 1XK6A 2NQ2C 4NOKA 4WGFA 1K7YA 2GF2A 5HYVA 4MIOA 3OC0A 2BGNA 3A3YA 3CIFA 3NHSA 3V1YA 5J4LA 5FADA 2YOHA 4BLSA 1U3DA 3ZW8A 3SXUB 3PQ3A 1T0PA 2IYZA 2EHJA 3LCRA 4MAAA 5CB8A 4B7XA 3M89A 1S8FA 4LZPA 5TDHA 3ZH2A 3T3GA 1DELA 5EWJA 3KR9A 3Q6NA 5GM2A 4WXPA 3PFCA 1NVUQ 3R7AA 1Z4LA 2B0CA 2F7SA 2HTEA 4IIJA 4XD7A 3VNUA 2WWWA 3BD7A 2ODAA 1UBGA 2VHWA 4B3CA 1PLJA 1H2YA 2ACVA 3AUXA 5CM2Z 3CE9A 4RD6A 2ZBQA 4FSHA 4JP2A 4QO7A 1KMMA 5H70A 2XAAA 3JQGB 4XYEA 1PL7A 4ZHQA 5J43A 4CCWA 1MEEA 2WFLB 2HHJA 3LTEA 4FT2A 1ZNXA 3IQWA 1J0AA 3TZHA 3WYNA 3IDAA 3ZBTA 2XZPA 4ZEOA 1JLLB 4QOSA 3KJHA 4WOJA 3VDNB 3G9QA 5J2TA 1AK2A 5CA1B 3V4ZA 3AY0A 4PYIA 1WSAA 5EE5B 4PPGA 1ZD9A 2W8BB 1JNYA 3KEOA 4PZYA 4RY2A 4XB1A 4POOA 1O96A 1QDUA 5A7FA 3N7TA 4UAVA 1YL5A 3PP8A 2O19A 5B58T 1XZAA 2QMZA 1KK2A 4P5EA 5K8VA 2FETA 4Y2UA 3N2KB 4E0BA 3N28A 1T5TA 3HCOA 2VTBA 2C7OA 3A4NA 5A4IS 4BQFA 2ONCA 3D81A 1OXVA 2M6RA 2WSSD 4B71A 1ZN9A 5ADUS 3FUXA 4IXWA 3PNVA 3R74A 2H1WA 2HMUA 1OWMA 1HBJA 3E7DA 3OEEA 1U3WA 5ETJA 1K86A 2W6JD 4B35A 3ABOB 4Q7QA 1R5NA 2BFDA 2OVFA 1RYFA 4QGAA 4LCBA 1ADJA 2CVFA 1JFVA 3RFTA 4RTKA 1L4HA 1NXTA 2I6SA 4HFNA 2X9GA 1BVUA 3G9ZA 2OY0A 2OWEA 3OUZA 2RK6A 4Q3NA 3DJYA 3A1DA 1KJQA 2O05A 2D1RA 4H7JA 3AEUA 1W2GA 2OCDA 3AHJA 3WWZA 1ZGAA 2IHVA 4N54A 1TK2A 2I22A 4Q00A 1VYHA 3H9BA 1WZ2A 3D8TA 4MRMA 3AM1A 4DF3A 1SXJB 1K7CA 1UM9B 3X1DA 2R9VA 3DZFA 3ANTA 3QVUA 1BVRA 2Y0BA 3I3SR 3OZAA 4HI0E 1HZJA 2Q62A 3G2LA 2P6UA 3MT9A 1RRCA 3H2SA 4W4TA 3ZWPA 2VHQA 3RS0A 4BJHB 2OLJA 5HX7A 1VL1A 1L2TA 4IXMA 3EASA 4IJWA 3O90A 3EAGA 1KO4A 1QNFA 1WZEA 3KQVA 1H5NA 1M7GA 4EGCB 2VRNA 4PGHA 4HWRA 4QQFA 2L0XA 4X20B 5E4TA 4ARZA 6LDHA 2JD1A 3CEPB 2V6GA 5EGNA 1DC8A 1ABBA 1QH8A 3DLCA 2F48A 1J1IA 4WEQA 5G02A 2LBPA 1W1WA 4HHEA 5TS2A 5JC1A 1TPZA 2O0LA 1FLNA 3E9NA 4HB0A 1DKLA 3CPJB 4MPPA 4M99A 5K3BA 1ZQ1A 2QSJA 2QN3A 1C8KA 2FFRA 5FB3A 3RK4A 3BJZA 4A6PA 4BKUA 5A5FA 4KQKA 3KJNA 1U0JA 3HXLA 3FCXA 2A0KA 2E18A 2CXNA 3K5PA 1VMAA 4LE0A 3RBZA 3NBKA 4RBNA 4ARCA 1PKEA 2YNMA 4WK0B 4NAVA 1NN3A 1XZ8A 4NCNA 4UCXA 3F9IA 1OXKB 2ZSBA 3BWVA 2GJ4A 3Q8KA 3WGNA 1ODJA 3EBOA 1S89A 4QKQA 3WQRA 3OY7A 4LWQA 5EMJA 2X8LA 3PIRA 5IUJC 1H5UA 2QNRA 1JNXX 5F1KA 4A8JC 3OBIA 1W5SA 2CZCA 1VLZA 3LQFA 4KMRA 1DXQA 2I7DA 4LDZA 2PT9A 1N3IA 2G1AA 2VZLA 3BD9A 3BXFA 3FE2A 4Y9UA 2IA5A 1MAHA 5EIHA 1UK8A 2B8WA 2MYUA 1GL9B 1CNEA 2FW6A 3WB0A 2D0PB 3HYCA 5K6TA 3THWA 2AN3A 4AX8A 2P4EA 4GDFA 1WXIA 2HA6A 3FOWA 1E2LA 3TZLA 3DA8A 4X3CA 4O4LF 3TLAA 2FFHA 4TKVA 3GZ4A 1PFQA 3MB8A 2PS9A 1EGHA 1V6SA 4ZTUB 3KR2A 1SKYE 1UDWA 1PJ8A 1VIYA 3DMDA 1DX9A 2XA9A 3HKEA 4NZZA 4YQYA 5EIEA 3KNZA 2VT7A 4X63A 2PT7A 1XWFA 1H4QA 4NNOA 1Y5IA 5JNUA 3L49A 2FA9A 3OQIA 1VKOA 3R76A 2Q3EA 3RSGA 3KQQA 4FZ3A 3L93A 4HN2A 5C52B 3BT7A 1VXRA 1KOLA 2YZMA 2ZI6A 3HXQA 1HDRA 3ITKA 3FOZA 3T7CA 4EP1A 1G41A 1B6TA 5COQA 4B7CA 1U2QA 4ZEWA 3K31A 4MS4B 3ROFA 4CEHA 1VG9B 3CX8A 4DVJA 1JFTA 3LUJA 4GZ5A 4U6NA 5KPJA 1DG1G 1CS4C 3V1NA 1DBRA 2FI1A 4IO1A 4J7UA 1NQOA 2HSJA 3K0AA 1EM8A 2A1TR 2B6HA 1C2TA 1EWKA 2BEKA 1KHTA 1RRPA 3K96A 1KJ9A 3NATA 3SVZA 3EYWA 1EUCA 5JS2A 5E7IA 1R12A 1SA0B 3KTOA 1ODSA 3EA5A 2OYCA 2GXSA 2XF8A 1PDOA 2ZUDA 1YQDA 2UXDB 3W3ZB 1KMCA 4R9SA 2IXTA 5D3KA 2C4VA 3GLRA 1NG9A 1UZMA 1QFZA 3DMFA 3IOEA 1ND5A 1MO3A 2FN7A 1X86B 2H1IA 4G0YA 3RJZA 1C1YA 2D1SA 1OXMA 2A5FA 1D3AA 1USWA 2W2VA 1H23A 1I5EA 2PG3A 1JZTA 2V6BA 3FHJA 1K66A 2R8RA 4XKJA 3V2UA 3VH1A 4LW8A 1XX6A 2DHRA 3DZCA 4M1KA 5DLPA 3A11A 1FNMA 4YLGA 2VNJA 4Y2TA 5IK2A 3U26A 2IUUA 4OA8A 3NTVA 4WZAE 3WYEA 2HRDA 4R1SA 1WRBA 2BN4A 3JQAD 1RP7A 3K94A 4L2IB 2OQ2A 2VWHA 2XGJA 1MIOA 1SC3A 3W5SA 2QN7A 1CXZA 3OZ7A 2NO6A 2XLCA 4H1HA 2PQ0A 2P2SA 3JRXA 3GZNB 4Z8XA 3JATB 4AMUA 1OF1A 2FSFA 3ZYCA 4OGWA 3ZLTA 1I5RA 2H92A 3FR7A 1TZBA 4G0PA 3W9BA 4HWGA 4G84A 5KDOA 1N9GB 4UM7A 4MUIA 4JJKA 3CQ9A 3LOUA 3C6MA 3M7IA 1SB8A 1U11A 1C3VA 2CCJA 1GYPA 4QARA 3RSCA 2BF4A 1JV2B 4X6LA 4EB6A 5B7PA 4N82A 2Z4SA 3K6KA 2I4RA 2DVMA 3AFNA 1E58A 1Q92A 5D3ZA 4L6CA 3I0MA 3KB2A 1R37A 4R9UC 1WXHA 2Q5JA 1SAYA 2Y93A 3KVYA 3QWHA 3I39X 4N18A 2IPNA 4DSTA 1PWYE 2A7XA 5CXXA 1JHVA 1JPUA 3OESA 4EYEA 2QLTA 3ECCA 2F1RA 2D3WA 2WTUA 5EHNA 4D8XA 1WD7A 1THZA 3ELDA 3URMA 1JL3A 2HA5A 5LPNA 1VZ3A 3B2EA 4RVDA 4BMDA 1KPHA 5DJ5A 1R6DA 1ZX1A 1K5DA 1E2NA 3JAMA 5KNBA 1WW8A 4BJ3A 4EY6A 3G0GA 1LK5A 1E3SA 3BRQA 2Q49A 5TR9A 4OBEA 3R40A 1IZYA 1M8PA 4EG5A 5KWIA 5BV7A 2I7XA 3R3HA 3KUXA 4S04A 3WLKX 3NAMA 4L2IA 1HMYA 4O0MA 621PA 1IXYA 5BN3B 4OXIA 4LI3X 4RPIA 1Z0DA 2PDAA 3K0FA 1E61A 2GSDA 3N2EA 3S5JA 1IXKA 2UZ1A 1GPUA 4JOQA 3ISVA 1JG7A 1EWRA 1XRNA 4G26A 1OZGA 4OXQA 2QGNA 2X5NA 4S24A 4EHDA 3A9TA 2X1HA 1FNSA 3LVFO 4I5DA 4UW9A 1RWQA 2JVJA 2O6LA 3I28A 5FWXA 3VVLA 4BTLA 1FMFA 5LLTA 4OL9A 3X1YA 1XRMA 3KU4A 2W7TA 3EUFA 2VUUA 1N25A 4M49A 4F71A 4H3VA 3V2GA 4BL5A 4ZJYA 1I7DA 1H0HA 3ABQB 2B78A 3P19A 2ZE8A 1VL5A 1JU3A 3EF0A 4L4SA 3L7OA 3AUAA 4B31A 4ZP1A 5JS7A 3TZ6A 2H7VA 1E5LA 3EDRA 4D9NA 1J25A 1GNRA 1DTSA 3RS4A 4G0UA 1W34A 4JEIA 2C5AA 4NCXA 4LTMA 3SIPA 3KL2A 1IJKA 4XE5A 2NWQA 3OJCA 3N0XA 3BE5A 1RWXA 1GGJA 3GEHA 3ZNNA 2R8BA 1CQIA 2NZ8A 4IDCA 3ROKA 2WF9A 4U2KA 1GQ2A 1TK9A 5AK6A 3W5HA 1M1YB 2X5JO 3T7RA 3B3FA 5MDHA 4FFLA 1P1KA 1VE3A 4KKVA 1S3SA 5CB4F 1YE3A 4BLUA 3AEZA 1KOJA 1GGFA 4BE9A 3GVXA 3L0BA 4NEGA 1M8KA 1U0SY 1MKYA 5JCXA 2PGLA 3ZDAA 2RH4A 3EDQA 3IAS6 4C6RA 3OLYA 1P44A 1SVLA 4KUGA 1J1UA 5SYAA 1XIVA 3EUWA 3GLKA 3JCZA 3ZDEA 4XJXA 4HFJA 1II8B 2XNCA 3PHBE 1THGA 1ST3A 4R1QA 4UCQA 3T5PA 1L3BA 2HMVA 2FGKA 5D5HA 3NGMA 3TRKA 3JSAA 1JBQA 1XYGA 3EIQA 1K5GA 3DT6A 5DLDA 3ZWVA 4BMZA 5K3DA 2QRUA 4DHWA 3IQXA 3UUWA 3CM0A 3PUHA 2ZETA 2PGDA 4QJ5A 5A4JA 1T8WA 1Q77A 2ZXUA 2BCEA 1KXZA 3ILHA 5COAA 3WL8A 1N33B 1CFJA 4B2IA 1KJZA 1S01A 1UP6A 3KT8A 4PQRA 2WWIA 4H6XA 1YASA 4EHHA 3G8BA 5IDWA 5AI8A 5AKIA 4DJDC 2BDEA 4DLYA 3FNEA 3TGPA 2F1JA 4ATNA 1KI9A 3NBUA 5B36A 1I2DA 3EIWA 3GLGE 3QX8A 4EUEA 2IE8A 4FU0A 3V8BA 4BO3A 1ZJ5A 3R5TA 3S3TA 1UCFA 1U7PA 2BEUB 3EQZA 3EY4A 4X8HA 2J85A 2E82A 1PYOA 3UK0A 1W4LA 3FSRA 1MRSA 3FZNA 1AQLA 4O4HA 1KGSA 2BFMA 2FW7A 1R6XA 3OJWA 5IU6A 3AR5A 3RAEC 3OUTA 1VA4A 4ZGBA 4ND5A 4CU5A 1ZXLA 3LG2A 1PR3A 2Z98A 1KEZA 4BO5A 5CBPB 3C7DB 2H08A 3NW9A 1C1HA 4JLMA 3ML1A 1QH0A 2BR5A 4FN5A 1N34B 5TGTA 1RP1A 4PTZA 3WVNA 2ZJ3A 4OYHA 2IGBA 1IY9A 1EK6A 2NXWA 1WZUA 2QRHA 1OIWA 3EHEA 2FFJA 3M1AA 4BKMA 5ADWA 3MERA 2CF5A 1FRNA 1QGED 2OFWA 3CKLA 1PLLA 3G5MA 3JZFA 5FI1B 3VYVA 5IPFA 1AKEA 4OI2A 4ZYXA 2SNIE 2B30A 1ZMRA 2KB0A 3CW8X 3QVTA 4CEIB 3ENQA 2X1VA 2ECKA 3NHYA 5FPPA 1GKYA 3SIRA 1OWOA 4HB4A 1IB0A 2FW9A 5DBFA 1E2KA 4EM6A 3Q2OA 3RK0A 3VO8A 1SG9A 3VZQA 5K8UA 3U60B 1E5DA 3PGLA 3AY7A 1PLKA 5BRNA 4OX9B 4UHHA 4JJZA 4E5PA 5HTOA 1BKYA 4HCJA 5FR1A 3WFZA 4H59A 3RG2A 2BTQA 1HPLA 3BC1A 3UOWA 2WTNA 3ITNA 5E0OA 1JJFA 3BRCA 2ZVPX 3PLNA 3ELUA 1DJLA 2AR9A 1J8VA 3I0NA 5T4FA 3RADC 1SBHA 1J1ZA 2AEMA 2WM3A 4JUAA 5G1NA 3LBYA 1E96A 3U16A 3WIOA 5DHRA 4DPLA 3AIMA 5CB4A 1BW9A 3AP3A 3O8OB 3IMGA 2X2EA 1YQGA 2QN6A 1DBIA 4FGJA 5C4GB 3VPGA 2BC9A 1DIRA 1EVQA 5KYXA 3DLPX 3F3SA 3OC6A 5AVZA 5CLFA 3ZU6A 4K05A 4ZANA 1BQ4A 1V5EA 3IP5A 1JF8A 1DJNA 1PUIA 3HDGA 3N53A 3PS9A 4OF4A 4PFSA 4PZZA 3DXZA 2NM0A 4PHTA 4TT3D 4LFCB 4A91A 4CM7A 2VP6A 3EF3A 5HFJA 1NIPA 4MW6A 4GI3A 2D7DA 4PHFA 2JAWA 2NSJA 2WHXA 3EARA 1H9BA 4NEQA 3KYBA 3ZYZA 1QUFA 2MHCA 3SHQA 3ONNA 9ATCA 4UDOA 2HWYA 3GJ5A 4HMOA 5AI9A 1GTG1 4LXTA 1VMIA 1BEUB 3FPLA 4LC1A 4IFIA 5GQSA 5L51A 4H7DA 1NA5A 1OH5A 1PFKA 1OE0A 1GPBA 2I99A 3B1ZA 3OOJA 5BVGA 3SICE 4JBLA 2RCYA 3N6VA 2C77A 4FKZA 4ZHQB 3RCBA 2GXQA 3NVMB 1RXIA 3OO1A 1H3NA 3SS8A 3FMOB 4MV9A 4UEWA 5EN4A 3OCYA 3T4PA 4QGSA 4MO9A 1NQ5A 4B6PA 2DF8A 4JNKA 1VJGA 3CFYA 3Q3CA 1S4QA 1EFHA 1JTEA 4RVSA 3PDIA 4WNCA 4U7DA 1HE1C 4KVZA 1F2VA 4MR7B 1QO0D 4URVR 1PNTA 3IIMA 5M7EA 1RKUA 5JU6A 1TJPB 1L4UA 3OTOB 3HA2A 2OOSA 3QY9A 3IT3A 1Q16A 4RA9A 3DHWC 3O2SB 1GSHA 3S81A 4AZVA 4JL5A 2AFVA 1FY2A 2WC1A 2WI8A 3EF1A 1NVWQ 2OYSA 3E22A 3F4KA 4NLLA 4FJ2A 4Y67A 1JLRA 1TNDA 4ENRA 3O2JA 2WF7A 2FWBA 1P1FA 3WLQA 4BLWA 4TLAA 1YFZA 1RRGA 3R23A 4IFEA 4XGRA 5FFFA 1JYEA 1K8RA 3V80A 1U2DC 2GN8A 1QP7A 3OT1B 3KO8A 2W4IA 1BFUA 1R0XA 3C5EA 3IDSA 5KJEA 1YIAA 1EFVA 4DCSA 4U8GA 5CVCA 3P45A 4B34A 4ENPA 4TVKA 2QG4A 4RLSA 3RYTC 4PLPA 2YXEA 4BP8A 1MJGA 1KVTA 5KREA 4EI7A 3N8DA 3R3SA 4OG2A 5AI5A 2B3TA 1Z6QA 3ACDA 3G6WA 2EKDA 4FINA 4BMVA 3M5PA 2X2PA 4MZDA 4LG1A 1NF3A 3CHYA 3ZJ5A 2VHVA 2FNAA 1UMDB 3HCPA 3FPKA 1QYWA 1TYZA 2JJQA 2O3JA 4NOJA 4TS4A 4KNYA 1F0KA 3MLAA 2JL1A 1SOMA 4FLFA 1R0RE 1U1IA 1IL0A 2XDWA 1SN7A 4E7OA 5I51A 2CMFA 2RBEA 2Z95A 2REQB 1RBMA 4M8NE 3Q8MA 2AXEA 5JDCA 3AUKA 2H29A 1GSAA 1NJ6A 3B6EA 3G49A 3H05A 3HV0A 4G0WA 5GONA 2IWHA 3IDOA 1S8OA 1UC5B 1CTQA 3SZ3A 2H9YA 2A30A 3ZU3A 4A8HA 1XU4A 4XIIA 4N3CA 3G3EA 3PG5A 1DG3A 3AHEA 3W05A 2Q3LA 1YJQA 1SCJA 4OBWA 5E7JA 1ZOSA 1PWHA 2XWQA 2VDWA 1E3TA 1VHQA 3GMSA 4HEJA 1UKVY 5JZBA 4G41A 2FXVA 3JARB 3L1HA 1QYRA 4FGWA 5K3AA 2H18A 2HRZA 2I71A 4K2AA 3TRIA 5I8PA 1MC4A 4QQ8A 4L57A 2GRJA 4KGVA 4RD1A 3KL4A 5HCIA 4DA7A 5AI0A 1V95A 3BFPA 3KR1A 4GVLA 3RJ5A 1K6IA 1HT3A 2YZGA 3GLGA 1L4KA 3T7EA 2DR0A 5I01A 1O97C 4WDRA 2P1ZA 5IJAA 3PUXA 3C8ZA 4IDOA 2FZKA 2A5DA 4IIVA 4C0AC 1U3VA 4PNHA 5AKGA 1MB9A 1WXDA 4WN9A 8ABPA 2I6XA 1P1IA 4B09A 3N39C 1QFMA 4HJXA 3HO1A 3O47A 3R5KA 1OH7A 5LVAA 4X66B 1RXVA 2YJTD 4D0LB 1A5AB 4I2NA 4J0QA 1O3YA 3NWJA 4KL8S 5LL6P 4OMFG 1D2GA 1XAIA 2Q1WA 2PXAA 1QWSA 2VSXA 4LI0A 1M1XB 3AW8A 4RD0A 1NL3A 3HB1A 3ETLA 4O2AA 2WMNB 3IAUA 4RF3A 4LXUA 4AN0A 5L53A 5CTJA 3AEXA 1GD1O 4PHCA 1VHLA 3IFSA 1TM2A 3BWDD 3PL1A 4L78A 2ZFUA 5BQPA 3RTDA 1E92A 4TKUA 4UXHA 3LPCA 1YE8A 5EKXA 2FR0A 4Z3DA 3AI1A 1AHNA 3CLSC 1W4RA 2I4NA 3QU9A 2CXRA 3GGOA 4XM0A 4F2WA 2LKDA 3I76A 3PPXA 1GNVA 3DPSA 5TARA 3W7VA 2SCUA 5EIWA 1VI6A 2EQBA 3AVQA 4RWEA 1U2ZA 3O73A 4L76A 3AFMA 1ONSA 5TB5A 2NZ2A 5HIJA 3SJAA 3Q9UA 4PLHA 4QJ3A 1U5CA 3Q7SA 1U2GC 1GFSA 2J4CA 3M3DA 2ERYA 4MARA 1U6JA 2XVYA 3G02A 4NJEA 4Y1RA 5DX8A 2PEZA 4CODB 1K6XA 2UVQA 1MO2A 3W2GA 1X7WA 3BBLA 3G0OA 4Q4CA 2HSEA 2PMKA 3AY3A 2DR3A 2ZRLA 2PSSA 4O2BF 3C3BA 2WWXA 5J59A 2R7LA 4QRHA 3KZ1E 5TE9A 1E0AA 4BC0A 5EEGA 4EABA 3D7LA 3EIHA 1A1SA 2G4LA 1XN4A 2EDAA 2YC2C 4JP1A 1M2JA 2IHZA 2FHPA 2EZ8A 5K45A 3T3NA 3D7NA 2O52A 1Y5LA 2CV0A 5L3VA 3LQQA 4Y98A 1H2XA 3TDNA 1SKAA 4Y18A 1VMKA 1SCAA 1G4UR 1A97A 2UUCB 1CY2A 2D0DA 2HMTA 1TUGA 2MR5A 1SVUA 1W30A 2QJOA 3WRXA 1XCMA 3KC2A 5BOSA 1GN8A 1P8AA 3HRIA 4GXRA 4WDQA 4WFJA 2X8AA 3T61A 3LOQA 2WUWE 2FU5C 2IT1A 1R6BX 4EGSA 1GJRA 3HY6A 1XMXA 1AKWA 1GPNA 1E7QA 3W77A 3SBDA 4EL0A 4XOUA 1KWKA 2A3NA 1RBZA 2P5TB 1K6JA 3CLUC 5DLEA 1IXZA 1P1RA 4FQ8A 4MW4A 5LMCA 2I4LA 4MLPA 4PLYA 4I1PA 2GCNA 1OX5A 5TT0A 2GD6A 3NHWA 2I66A 2WPNA 3PQ6A 1MOZA 5JXGA 2ZWIA 3F7TA 3OH8A 2ZUFA 2F8SA 4M9QA 2NP7A 2G76A 5AKXA 4NQRA 3QPUA 1QQ6A 4RDCA 3U7EB 2FZGA 4QBHA 2VPQA 5EIXA 5DNDA 1VJTA 2VDOB 2XGMA 2P2ZA 2X41A 4IDDA 5T8KC 1PZHA 1P2DA 4F11A 1GHTA 1QFYA 3AR6A 3CY6A 1IBSA 4TTTS 3PJRA 1USIA 4GQIA 3CF6R 3V8QA 1ZM7A 3FUUA 2WD8A 4EKGA 5CJPA 3T41A 3TW8A 1N3YA 3D54D 5KQLA 4AT1A 4BO6A 1P9NA 1MTOA 1Y1LA 4G5QA 2C4KA 3UJDA 1C1DB 4FYMA 2CF6A 4N5DA 5FLYA 4CXMA 4YQEA 3PXGA 1VB5A 1TK3A 3W06A 3O75A 3D3NA 5KBYA 1E1LA 4O2BB 1M2VB 3CKKA 5J2TF 4L9AA 1O6ZA 1MO5A 3TQCA 4G09A 2AOUB 3S28A 2UXBB 5E1MA 4R0VA 3R5JA 1TZJA 2I9KA 4GOND 4UULA 1BU8A 2FMHA 3H1AA 1HE5A 3R9XB 2BZ0A 1O6BA 3AERA 2Q4OA 4IHJB 1X1SA 1KP2A 4FB4A 3JVUA 1RYZA 3CEHA 4INZA 3N05A 4IQ8A 1U0RA 4M2LA 3R75A 4IFTA 5JAMA 3GVPA 4PBTA 2SKEA 1NBMD 3C5WP 1NG1A 2I5PO 4NDAA 4W1SA 5AFSA 1DG9A 2IP1A 1HFJA 4ERNA 2ZSJA 1WCWA 4ZCIA 3W5JA 2F3UA 3GT0A 3VR1A 3WL4A 5T67A 2QTMA 2AWNA 4ZT7A 4D3ZA 2ZE7A 5IFKA 4N9WA 2BM9A 4LZOA 1P5JA 2YCLA 1SBZA 4URWR 5BUCA 5FUYA 5GGXA 1MXFA 2J3JA 1P3DA 4O2BA 3BMQB 3Q3EA 5JYEA 2QTAA 5CURA 4A73A 4KQFA 3ZV7A 1HLFA 1JVSA 1O95A 2R5WA 3LIIA 4HQNA 5TS3A 4XGQA 2JCGA 3O3MB 4GPTA 2WJIA 1NW3A 3N6XA 3KYCB 1VPWA 2AD1A 2X3FA 5DHFA 5EHQA 4HDMA 4UUAA 3V7FA 3WK5A 4AXBA 2GQ0A 3DGFC 3NIWA 1KYZA 2GPNA 3DR5A 4MA5A 4RIFA 4MKXA 2AWOA 5PNTA 4E5YA 1UANA 1RWWA 3MTEA 3IDFA 1C0LA 2WF5A 5IAJA 2CCGA 4UM9D 4YJKA 4DDUA 4QUGA 3PJEA 3HCCA 3W7AA 1NW7A 4I0WB 3UK7A 1JIIA 1RTKA 2FRDA 1P3Y1 2PKXA 3LAWA 4WXEA 1G3MA 1SG0A 3ZS8A 1DZ3A 4E5NA 4X71A 4PTLA 4RAQA 2WLSA 2ZSAA 4LVUA 2V74B 1QPBA 4F2HA 3M2TA 1NQXA 2CFOA 4E1AA 1YL7A 2YHIB 1O4WA 1LLCA 1OIXA 1OGIA 4NC9A 4D3SA 5AVWA 1V96A 1BU5A 2YVLA 1WUYA 3A04A 4OXRA 4GP9A 4QEZA 4YFYA 2OV3A 1G21E 4ZCRA 4Q3BA 2WIJA 5FFNA 3FNIA 3WICA 2EFGA 2G6TA 4JWKA 1M2FA 3NHRA 4IPTA 4CDRA 4LXYA 4P98A 4PQGA 3VO9A 4EVSA 2YDYA 3CPSA 4UMFA 1KIAA 3SI7A 3DFZA 3WGKA 4ZT4A 4U3JB 2GJ9A 2W4QA 1CUFA 2W2MA 2YOFA 1N9ZA 2VAWA 1XDWA 2HZBA 3LYHA 3PTAA 2QM8A 3C2QA 5FDFA 3TTSA 4FJ1A 3UHFA 4HN9A 3L01A 4EYSA 3HYSA 4YEDA 1ZS9A 1G19A 1X7WB 3E05A 4CGYA 2C7QA 4MQ6A 1KAQA 4Y6OA 5SV2A 5ADVA 1TYEB 2VYVA 1EDEA 3N86A 2G82A 2WWFA 2AMLA 2IHBA 1F7UA 1DKRA 3B6MA 4GYKA 1P2UA 1PNRA 1E1CA 2QGZA 4UTVA 3REGA 2Q7XA 5ELLA 2YJNA 2IDZA 3BXEA 3ORSA 3FCYA 2Y3IA 1YB1A 3G79A 1W47A 1LTKA 2P9EA 2ZJBA 1U7OA 4PGMA 4U7FA 4G5OA 3C3XA 2EP8A 5EZ6B 4PPQA 2GEKA 3P2YA 2XA1A 3ETDA 4PO3X 2PMCA 3SJ7A 1LS6A 1R8YA 3EXHA 4WGGA 1E2HA 3VOAA 2EZ4A 1MC8A 4JLWA 3B52X 4ENUA 2Z09A 5IVPA 1S7GA 4UDXX 2EG9A 2XYVA 4R9NA 5J4VA 8OHMA 3THYB 1P2TA 3T7AA 4CKWB 4F38A 4IJKA 4O2AB 2PT6A 3BORA 2VJNA 4HQLA 2I65A 2C59A 1ICEA 4RD3A 3G5AA 4MYTA 4YBRA 3VKHA 1XQ9A 4PAOA 2BZ1A 4DAEA 4DLVA 1T43A 4KTVE 4QYWA 2HCJB 1P7PA 4P3XA 1AM4D 1SY7A 3ZCUA 3ZY2A 4M1YA 4YMGA 3TGLA 3VHQA 3IEVA 2Z8YM 1V11A 3I0ZA 4J0KA 1FNNA 3SHVA 2GPAA 2BMJA 3H2JA 3QX9A 1GZUA 4Q9IA 4HSGA 5AR1A 2Y67A 3L07A 2AG0A 1SBTA 3FFTA 4W5OA 2HMYB 1IE3A 3JW8A 3P9RA 4I5EA 1AGXA 1BQ3A 1ZD4A 2FX5A 4PO1A 5G0SA 1OPXA 3UFBA 5KC9A 4YUAA 4QSHA 2Y99A 3NRBA 5IAGA 2F9LA 1I7PA 4K9PA 3J80A 4B3GA 1RQGA 2G9RA 1FDUA 1PQ4A 1EWQA 3WDMA 3PC4A 4RU1A 3BHNA 2BFFA 3COJA 5JEDA 2PX5A 4W6QA 1K92A 1W35A 5CT4A 4A7PA 3O3CA 4EHKA 4GZ3A 1TZMA 3HN6A 2PKWA 4WVFA 3MBIA 5E6RB 2YXDA 3FWPA 4J6EA 4FZVA 1W25A 3NAZA 5GTDA 4JS0A 2ISQA 4QIHA 5K8LA 1GZVA 2I4TA 1DEAA 1QR2A 3JSXA 2VJBA 5AQEA 2A33A 5FOUA 3WLAA 3SU8A 4ZMRA 1BKDR 4K0RA 2QORA 4RVFA 2XCTB 2X86A 1WPXA 1E3EA 4L22A 3VOSA 4MKGA 2GZAA 2Q5HA 3OZXA 1B8VA 4BMYA 5K5EA 1ZIOA 2PUFA 2GN0A 1RQLA 2O2IA 3M70A 2AG8A 3G68A 3GNTA 1HT1E 3TYXA 3WLHA 1P1BA 2VDQB 2Q28A 4H27A 4IP0A 2RAPA 2QPAA 3CX7A 3OQBA 4JKOA 3RC2A 4KR0A 4PC3A 4M9SA 1RXWA 3G7NA 3PT5A 4NZMA 4I9GA 2BR4A 3R3VA 5J3JA 4HXGA 4HUQA 3QITA 3R9WA 2PYIA 3DVAA 3C98A 3BXOA 5EMKA 2RARA 1X13A 4FB5A 1G6HA 1PGQA 2QRQA 3FX2A 1ZCJA 2Q2QA 4MWZA 1E98A 3M83A 3F2IA 2O0JA 3RSSA 3L4SO 1KYW