5LL6P

Structure of the 40s abce1 post-splitting complex in ribosome recycling and translation initiation
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
206
structure length
206
Chain Sequence
SLPATFDLTPEDAQLLLAANTHLGARNVQVHQEPYVFNARPDGVHVINVGKTWEKLVLAARIIAAIPNPEDVVAISSRTFGQRAVLKFAAHTGATPIAGRFTPGSFTNYITRSFKEPRLVIVTDPRSDAQAIKEASYVNIPVIALTDLDSPSEFVDVAIPCNNRGKHSIGLIWYLLAREVLRLRGALVDRTQPWSIMPDLYFYRDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S ribosomal RNA
publication title Structure of the 40S-ABCE1 post-splitting complex in ribosome recycling and translation initiation.
pubmed doi rcsb
molecule tags Ribosome
total genus 44
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2016-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00318 Ribosomal_S2 Ribosomal protein S2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 5ll6P01
2PUTA 3SHOA 2ZM6B 1VIVA 3T1HB 1NRIA 1U0FA 2CXOA 4S12A 4X64B 1JEOA 4LF4B 2PUWA 3Q88A 1VIMA 3FF1A 3FXAA 1ZZGA 3C3JA 4B3MB 5LMNB 1N8TA 1IBMB 4B3RB 1IATA 1M3SA 3ODPA 4JI7B 2CXTA 3CVJA 1T10A 2PGIA 3IFSA 3KNZA 5A2QA 3BJZA 5IWAB 3OTOB 1XNQB 2CXQA 2CXPA 1C7RA 2O2CA 5I01A 4TOIA 1DQRA 1JIQA 4LFBB 4DR6B 2I2WA 2CXRA 4U6NA 5LMUB 1NUHA 1IBKB 3NBUA 3PR3A 2V4MA 4NXMB 4IVNA 1N32B 3HJBA 3J80A 2X3YA 4LFCB 4DUZB 1HR0B 2Q8NA 1X92A 1FJGB 1TZCA 1B0ZA 3JX9A 4X65B 4LF7B 5FLXA 1X94A 2HHHB 1TK9A 4DUYB 2DECA 4AMVA 1HOXA 2VQEB 4DV6B 4GKKB 1VI6A 3BCHA 2CXUA 2CB0A 4DV1B 4JV5B 4YY3B 4JI4B 3Q7IA 4JYAB 2AMLA 3FKJA 3TBFA 4DV2B 2WU8A 5BY2A 4AQYB 4LF6B 2XHZA 4JI1B 3HBAA 2ZJ3A 4DV5B 1HNWB 2ZJ4A 4LZJA 4S1WA 1XMOB 1HNXB 2UXCB 1HM5A 3J7AC 3FJ1A 2F4VB 2VQFB 4B3SB 1X9IA 4JI6B 1GZDA 1J5EB 4X66B 2VF4X 3I0ZA 4LFAB 4DR7B 4DV0B 2J6HA 1IBLB 4OX9B 5LL6P 2E5FA 1MOQA 2CXSA 3EUAA 4DV7B 4NXNB 1WIWA 5BR8B 2DF8A 4DR3B 1XNRB 3UJHA 1XMQB 2UUBB 4M0DA 4K0KB 4JI2B 2E5LB 4JI5B 4EM6A 4DR4B 3T1YB 1JLHA 5IT9A 4X62B 2O2DA 1C7QA 3G68A 4YHHB 1MOSA 3QKIA 1G98A 4JI3B 2CXNA 2VF5X 3J81A 4LF5B 1XTBA 3TRJA 4DV4B 2UXBB 1IRIA 4GKJB 4KHPB 2I22A 4DR2B 4DR5B 4JI8B 2UUAB 1X9HA 1HNZB 1TZBA 1GZVA 3JAMA 2UUCB 3LJKA 4DV3B 1U0GA 4JI0B 3M5PA 2XBLA 3ETNA 1N34B 1U0EA 2UXDB 1N33B 2A3NA 2YVAA 1MORA 1J5XA 1N36B 1JXAA 2CVPA 1Q50A 3OOJA 4DR1B 2POCA 4LF9B 4B3TB 1VI5A 1KOJA 2PUVA 1I94B 4LF8B 2UU9B
chains in the Genus database with same CATH superfamily
1L4NA 2AC4A 3RBAA 2PU5A 1Z4NA 1YA4A 3Q7PA 2OG2A 3MYRA 3KEGA 3Q7RA 3DZJA 3FF1A 3P9YA 5TEWA 2FEKA 2QRKA 5ALJA 1Q2XA 2Q7XA 5E4YA 1L7DA 2A33A 1QS0B 2ZWVA 3ASUA 1P5RA 1QYCA 3GGOA 1L5ZA 4MS1A 4K6HA 4XUCA 3U6BA 2JHAA 2CD7A 2YJNA 5K0FA 2AG8A 2KBEA 2WJ4A 4LMAA 2Y68A 3QA9A 1G2IA 2Z2YA 3QF7A 2DUJA 4LYFA 4YR9A 2QVCA 4PO1A 5DNDA 4LBWA 1RKUA 3ROFA 4BB6A 3IUJA 4DA9A 2CXRA 2OB1A 3A8TA 1N2EA 3CF6R 5BSUA 3JQGB 5JALA 4KPYA 3BERA 2OCAA 3VHLB 5GVSA 4QATA 2Y4NA 1ZY2A 2O54A 2C03A 3OLXA 2OCPA 1DEAA 3BA1A 4FD3A 1L7RA 4UMEA 4I9HA 3RM3A 1U2GA 3QP9A 1RXIA 4K9OA 3ZQUA 1M1XB 2ZTLA 3P45A 2WSSA 2ZZNA 2ZKIA 2HSZA 3QVTA 1RAGA 3QEJA 1W2HA 3E9EA 5A4KA 3HY3A 3C87A 2DG2A 1N7IA 1ORIA 5KJEA 2PLFA 5EXEA 3DSRA 1M7GA 1SU4A 3I76A 2B0CA 4AUEA 2XE8A 1E2JA 2EX4A 1ZC4A 2F3SA 5DRTA 3SZOA 4L5BA 1KZ1A 3DEYX 2CMFA 4JP8A 3Q3VA 1KEKA 2Z9CA 4YP7A 2CLCX 1F6BA 1YA8A 1QIHA 1J1ZA 2VJLA 3EZLA 3J7AC 1GZ4A 3ZE2B 2BEVA 2WPDA 1SCBA 1YS1X 1C7EA 4QBTA 4EZBA 1DAKA 3ANSA 1STOA 2BISA 2ZTVA 3L43A 4B31A 1SCUA 1RYYA 1NZDA 3GGJA 3K9NA 1W73A 3CH7A 5G3YA 1CRPA 4JT9A 1BDBA 4US2R 3G0OA 2JLZA 2PRKA 2PGLA 2E5FA 4HO1X 5KVQA 4MI3A 2ATXA 3ND5A 3QBJA 4XCVA 1ADJA 3NC4A 1V9CA 3RTAA 5JWOA 3DV9A 4BGVA 5FDFA 1F8FA 3TIXB 5C5DA 3BXZA 4FHEA 2BWJA 1L5SA 1FDSA 2X4IA 3H2SA 4JODA 1CS4C 4OJTA 4AJHA 4WIAA 1QYVA 1W88A 2QOEA 5FNVB 3PHCA 2AEJA 1WOYA 4KXMA 4PLZA 2Q1YA 1NN3A 3FRJA 1PZXA 2GESA 4LCEA 4EELA 3J81A 2VQ3A 1E9CA 3PGMA 5LFAA 3C6XA 1CV2A 3KLNA 1NP6A 5REQB 4HG2A 3GGDA 3TIIA 2B7CA 1XG5A 4JR1A 1UJBA 4C7KA 3LBHA 4QXMA 4JZKA 3H99A 2ZRDA 4RGVA 1SKYE 3D0OA 4RJ2A 5EPUA 4GO1A 3TO5A 2LUOA 1U7PA 2EKZA 2FEOA 4MDYA 1X7XB 3JQ9A 4DLYA 5C7IO 4DT1B 1D5WA 2C42A 5FXMA 3OX4A 1C9NA 3ONEA 1YTLA 1B74A 4UEQA 3IOYA 1IEWA 2WJ3A 2P11A 4DIKA 3HN6A 1VMAA 2HMYB 3EIEA 4J0EA 4AY4A 1JKIA 3JQRA 2OHOA 1CJCA 2L19A 3O2SB 1AG9A 1R0WA 1NV8A 2O9JA 3INRA 5T8KA 1JA1A 1U0JA 1ZMBA 1OX4B 4BQIA 1EXVA 4WESA 1E2IA 4ND1A 1T1SA 3B5JA 2QRVB 1AVTA 3LUJA 4RJIA 1MH1A 2AEEA 3WLAA 1T2VA 4DDMA 2IV7A 4G1FA 2WSLA 4NBTA 4FDVA 4DMCA 3WYFA 1JGTA 2XF2A 4FS3A 4RY8A 3SIRA 1IZZA 1C80A 3WZ2A 3N2NA 4QYSA 4GMDA 2WUVA 3HUTA 5F76A 4CIDA 3SF8B 1E9AA 3PXBA 3CJQA 2O23A 3EOBI 5EJIA 5KHOC 3ZLUA 4FOSA 2JIZA 2R47A 3MEQA 4PYKA 4BFZA 2GEFA 5MGBA 4I2VA 3HNRA 2DTDA 5CFZA 1IQRA 3L1IA 5C31A 2CUTA 4YB8A 3WGHA 1DTWA 2JAHA 5F3WB 1XQYA 4I1YA 4Q1CA 4AMZA 1KEPA 2QL6A 3CKMA 3HUUA 4RU1A 4Z0TA 4ESOA 3GDWA 3LPAA 3U37A 1KARA 4PHTA 4A4DA 5JC1A 1VE3A 1RVDA 2JK0A 5DYWA 1RBQA 2X3FA 3HVHA 5F35A 3H5AA 4C7JA 4V0QA 2HO4A 2CV2A 2O8DA 2VLBA 1DC8A 3JR3A 3KKLA 5JG7A 3PLAE 3EIXA 3EPKA 2Q5OA 2HSDA 1JJIA 1BH2A 1R0CA 2VK4A 2H1OA 1I30A 3H04A 4C0WA 1I7SB 1E3WA 1N0IA 2YRXA 2AMLA 5FLKA 5JD5A 3KDAA 2GT1A 4GM1A 3AEKA 4ETMA 1TF5A 2IZ5A 3PQFA 3VH1A 2DX7A 1NE7A 2F1HA 3K2IA 2JI6A 2JGAA 1P0PA 3B82A 3I92A 1A2OA 3OPQA 4FR5A 4Z9BA 2Z6QA 4XDGA 1USWA 1ZS9A 3KQUA 1OXMA 4CGZA 1SVSA 3VU9A 3C3EA 4R84A 3E81A 2DXIA 2OXEA 4K9MA 1ZOPA 1OILA 2EP8A 4KE8A 4KN8A 1TPZA 4GMFA 3CX4A 3TDKA 2YN0A 4IYJA 4PGMA 1KDOA 3BMOA 5I45A 2QJWA 1JLLB 1HKUA 3O4RA 3EAGA 1GAJA 1RAEA 3CBGA 3ZBUA 1RWBA 4XWGA 4E6PA 5C1DA 1HE5A 2G5CA 1Q0HA 1M8KA 2PZFA 3HR8A 5I47A 3KOOA 3DAPA 1LQ2A 1IJFA 1LNQA 2WIDA 4L4YA 3SKVA 4E7OA 2HMVA 1XXHB 1S5PA 2HPVA 4H3VA 2J3DA 1VA4A 2NU6A 4R2LA 2VYQA 4MVWA 4IDDA 4HDRA 2CK3A 4OQFA 2WVGA 3UK0A 4ARZA 3IJRA 4M2LA 3VUFA 2KWIA 1M0SA 3FVTA 4FFBB 4KQ6A 4URZR 2CNLA 2G9NA 1BDIA 2H08A 3B8HA 3INGA 4IGIA 4HLQB 3K0KA 1A1VA 3NTUA 4PC2A 3MIZA 1DLJA 1YS7A 4QUBA 1KI7A 2OCYC 1ZSNA 2PTGA 2CHUA 2WTAA 1B6RA 3JPYA 1TU0A 4LV8B 5FTMA 3KSZO 1UP4A 3WSWA 1Z56C 1RJDA 4D9EA 2O8NA 4IY1A 2AOUB 4ZT7A 4V0RA 1H6DA 2PNFA 3HDQA 4FM9A 2R7LA 1V8DA 5NLLA 2HSJA 5LKAA 3BYZA 1VLMA 5ITZA 3FCAA 3G1WA 3IB3A 4BZWA 4DDHA 1Z2OX 3G9QA 3NTRA 2YVLA 2LZ0A 2XF8A 3P9KA 3CINA 3QY9A 3TLMA 5BUQA 5JQGF 4HNUA 3F8TA 4QHSA 3SJUA 2RCYA 4C9BA 2A5DA 1A95A 3NDRA 5D2CA 2QTNA 3NJRA 1VHLA 5IBRA 2AL7A 3F5MA 1X7WA 4XAQA 1C2TA 3EWSA 3K16A 4I50F 3V1TC 5JS7A 1KZYC 5KSWB 2NZVG 5LZ4A 5ALZA 4L4ZA 3IL2A 2H07A 3GRPA 2WWRA 1LV8A 1URPA 1F8YA 1Z25A 1UDWA 2HJ9A 2QMZA 3HJCA 1KEWA 1V5IA 4GYJA 4JN6B 4ZVKA 4OI1A 4BKRA 2QRHA 1NUAA 4UBLA 3G2MA 3JV7A 1SBZA 3PK0A 2NVUA 4KKVA 1U8YA 1JF8A 4XIGS 4R9UC 1MB2A 3LF2A 3V4ZA 1WULS 5EXXA 2WTMA 3W90A 3LK7A 1FTYA 3RTGA 2OV3A 1E1RA 2P6UA 2ZRIA 5EERA 3A0UA 3BXFA 4PC3A 2B7LA 4BFWA 4DM4A 2ZUDA 5LUAA 2XJ4A 4NCXA 2PUCA 3L8ZA 2QJFA 2ARKA 3TLGB 1ILWA 1V4VA 1DC3A 2BTQB 1TVCA 4PLCA 3PUZA 1X80B 4FFWA 2CY0A 1F4VA 1JHXA 3TZBA 3EIQA 3BAFA 1CUUA 2JIPA 2RC6A 3BJMA 4UXHA 5TNXA 3B6IA 1JDZA 3BIJA 3AHGA 3IT3A 4NOKA 4QX6A 2L82A 2GVNA 1JQEA 2AMJA 2P0EA 1U4SA 3PDHA 4C7MA 7MHTA 1ZZEA 2JGFA 5EHGA 1Q0PA 1E9DA 1QZTA 1O8BA 5HXAA 3Q3IA 3ZI7A 3QG1A 1RLOA 2N0SA 4MKIA 1JYEA 5GM2A 1Z62A 3O84A 4IO1A 1U0HC 1KZ4A 1GA4A 1JDTA 3BWEA 4L4UA 3KAQA 4OJNA 4PLVA 5CPBA 1VCIA 4LHZA 3O4JA 3RTEA 3HM2A 4PBSA 2XTNA 5TQVA 1RI4A 3O1HB 2COKA 4QGBA 3WDLA 5K3FB 1DVRA 3VKGA 2BP7B 2W2KA 2C5SA 4IF6A 3TKAA 7REQA 3QE4A 4D3ZA 5T57A 2PSSA 3N9IA 3PGA1 4FZJA 4QRIA 5EOVA 4EARA 3E23A 5JISA 2OGWA 3AQ4A 1CE8B 1VZ2A 3EZ9A 2Z5GA 4CKWB 1DCTA 1YDWA 5D3MA 1PDWA 1SKBA 3C7KA 3IELA 1A9YA 1C50A 2BFMA 1XLTA 3DFUA 3WS7A 3ZDAA 3Q98A 4R1UA 1KK2A 3AKCA 5JSUA 3HG7A 3R6DA 1IXSB 1I7NA 4MRPA 2YHAA 4WOPA 3BDIA 2PANA 1KE1A 1ODIA 4UHBA 3VKHA 3RG2A 1DWQA 2V6MA 3ZXUB 4FX2A 2VS1A 3QEBZ 3A7EA 4LE2A 4CR8A 2DFPA 3IXQA 3HR7A 3ENKA 3WWZA 3HBMA 3FLAA 2KPOA 4HXYA 2AMVA 3CR7A 3MS4A 5J59A 3CVXA 3VGPA 4BNVA 4NBLA 2Y9PB 3KYDB 3SJCA 1AKNA 3GNTA 4MJ7A 3RFXA 5BNFA 2UZ4A 1U1CA 3QW4B 1UMDA 1YU6A 1LBQA 2WD7A 1MBZA 1AGNA 4Y1RB 4H60A 2AUMA 2R97A 2COEA 4DY4A 3GDHA 2Q1XA 4OQZA 1G3QA 3A4NA 2HSGA 1I6MA 1RIFA 4IXWA 4KTVE 3Q7TA 3S1AB 1I2CA 1CW2B 1RBYA 2B8NA 3AF1A 4KQJA 5CD9A 2WWWA 4TKUB 4AO8A 1EDBA 4RTNA 4KDEA 4D92A 5A3JA 3MUOA 1GCOA 1KMMA 1PBNA 4HZUA 4QICA 1CJVC 4IIUA 2ZJFA 1CT9A 1SOUA 2DFTA 1ODCA 1D5CA 1CPYA 3QENA 1GAQA 4R8LA 4E15A 5KYXA 4HDKA 2PJDA 4GPIB 3K6RA 4PFKA 3JYHA 4X97A 2OBFA 4ECEA 1R8QA 1XTIA 4XOIA 1POWA 1U7ZA 3QKSA 4BCBA 2CDBA 2J3JA 2R4TA 1JHMA 2WSSD 4LDNA 1AN0A 1W93A 1V7QA 3GCDA 1GLGA 1UK9A 3MCTA 1BXGB 1BKYA 1GV1A 1E1YA 1U99A 1R10A 1VRWA 2R3SA 4QGAA 3EQ8A 1Z0SA 4QREA 1HDCA 5G4LA 4IV8A 2RHCA 3AV3A 1DWOA 1UPUA 1XB2A 2I29A 3F49S 3F7MA 3WKCA 2VCYA 2MYNA 1VYHA 4Q4HA 1HFKA 3DF7A 3VHXB 3VX4A 1Y81A 4LFCB 4WKBA 2Y0PA 3CNEA 3I53A 5E8JA 5H3HA 1M1NA 2C92A 4ESEA 1GRVA 1QG6A 1C8KA 1VPLA 2QTMA 3LPCA 3LQFA 3JYLA 1YUNA 3TLCA 1I4TD 4UHHA 4X9XA 2F3RA 4CFYA 3JAKB 2WB4A 4RADA 5LZ2A 2PPVA 3FFBA 3WYEA 1MOPA 1BHO1 3CJTA 3G0BA 3BAZA 2D74A 4EI9A 3K70D 4IDPA 1QQBA 5F9HA 4MX8A 3CF4G 1MVLA 1P1RA 2XY4A 2HU8A 4X6YA 2IL1A 4NF2A 2HCTA 4HDNA 5FBZA 4ZVNA 2GM4A 1NYLA 3Q0TA 2QGNA 1AQ6A 4FP9A 2I4IA 3AESB 4RSMA 3TTXA 4C04A 5B6PA 2WF8A 1LS1A 3M1LA 3ZIUA 2RG1A 3LVFO 3ZLVA 1DX4A 4ZPJA 1ZWLA 1DOHA 3BICA 3NMUF 1ZINA 4JYCA 4DYHA 1AMOA 2Z1DA 3BSWA 3W3ZB 3I0ZA 4HMOA 4EJSC 5KJ1A 2WM2A 4ZOLF 4L0CA 1CVIA 4GI5A 4A2PA 5JS2A 4BNUA 2OLKA 3GMSA 3EUAA 2F9FA 3DZCA 1E61A 2F1JA 3IDQA 4AJLA 3PUXA 4IXNA 1J70A 3FWZA 1VJGA 4LXYA 1DELA 4KQCA 4EECA 3FYSA 4XWAA 1XNRB 2P1ZA 4LGVA 4YRSA 1JQKA 4P4GA 4XGIA 5KEIA 4WOKA 2P2SA 1OBHA 3RS4A 3C6MA 5A3QA 4MUYA 1ECLA 1VL6A 3HJAA 1GKLA 1I6WA 3GLUA 2FPRA 3I2KA 2JIOA 3L7CA 4XWTA 3SP1A 4X62B 1XNGA 4DIUA 2KE5A 2QD4A 4MUJA 4QTZA 3V7YA 3LP8A 2AN3A 4QEKA 2V6GA 3ZDFA 1B6TA 5H70A 1PN3A 3KT0A 1P0MA 1ZKDA 1DOZA 1ZWKA 5FJIA 1YS2X 5DWDA 4L7VA 1T4DA 5MGNA 3VPSA 1W5SA 4PNZA 5HSGA 1E6LA 4EVSA 3W77A 1H0SA 1T3GA 1YT5A 2JZOA 1ZK1A 2QS9A 4AJIA 4CN9A 1WS6A 4QGHA 4Y9DA 3MFYA 1QQAA 3IJ5A 5CX1A 4OSPA 3ZE6A 5AIBA 4B3GA 2HMUA 1E6MA 2FZWA 1UFRA 1QIMA 1IUPA 1ZW1A 2J4CA 3PNYA 3U4MA 4PM4A 3PQ4A 4PPGA 5I7WA 1OXTA 1ML3A 2O2EA 3WYBA 4GPTA 3LK6A 3AEUB 3ZI0A 2JIZD 3AFIA 2JCSA 4MV3A 3L1HA 4YPVA 5LDHA 3LYLA 2YNMD 1WRBA 1NRIA 2G5GX 1VKJA 2HNBA 1AOXA 4Y2QA 1KBQA 3R9WA 1G8PA 1MG0A 5DM60 1XNHA 5FP0A 3EAQA 2XMRA 1IN4A 4QYWA 4D5GA 1EUDB 2IVZA 2WG0A 3E15A 3Q4GA 2N1MA 4NYJR 5EEGA 3SY8A 3U44A 2UKDA 1L7BA 1TQDA 1UXGA 2J3EA 3WHIA 1FS5A 2G40A 4CLXA 2XWPA 1U0NA 2X6QA 3JD0A 2C5BA 4HNGA 2B8TA 2FHPA 3A3PA 4I4CA 2P77A 3CVJA 4IHJA 4R7ZA 2MYPA 3MLEA 9ATCA 3ZKWA 2ZBFA 3SN6A 4ZVUA 4PSKA 3ZHUA 4DNFA 1JIXA 1RACA 3BK7A 1WVMA 1HTBA 2O59A 3LOQA 3OVMA 4ZVTA 3AF5A 2AD5A 1V39A 2BKLA 4EB0A 2EHJA 4MWSA 2X9GA 4YDSA 4EA7A 4H77A 3KKMA 1N6OA 2O2XA 1CIJA 4PAQA 3W7VA 2Q8PA 2WG2A 2N1BA 2DHQA 4Q3BA 1Y8RB 1PP4A 1EK6A 5AKYA 1OYOA 1UK8A 2WTNA 3NWEA 4MPJA 5DHPA 4MMYB 5F1KA 4A8JC 3KHKA 4NQZA 5DMXA 2PH5A 1XNJA 3IILA 4E32A 5EUQB 4I4NA 4RH1A 3NBFA 2W2MA 3H4MA 3LDAA 2WNSA 4BUJA 1X8LA 4C20A 4KLNA 4TMTA 3DPIA 1JLSA 3LWNA 2A9PA 3O83A 3PEEA 4KWCA 1L8LA 4E2ZA 4G8JA 2B34A 1HRDA 4Y6GB 2HGZA 5JECA 3DMTC 1VC2A 5DX8A 2RHRA 4B40A 4ZOLA 5IX8A 1DHRA 1MMFB 4GOXA 1CU1A 1M54A 3MGCA 2FRDC 2ZYHA 4A27A 1DOAA 1GSAA 1QHFA 4N49A 5K51A 4ERXA 2DKFA 3MSCA 4JK3A 1QMGA 2R7NA 4G5OA 4DV0B 4S1PA 3HN2A 1ORWA 3K9QO 3L93A 1DC4A 4M9UA 4RD3A 3R8XA 4LQLA 4AIRA 2GEJA 2HEIA 3C5EA 3AB3A 3L4EA 4KXXA 2R6ZA 2WPNA 1UBTS 1Z36A 1RQ2A 1OVGA 3A3OA 2OLJA 3CLUD 3PIDA 1Z4KA 4J1QA 4WSOA 1O96A 2CFSA 3GN2A 3IIKA 2CYCA 4E22A 2HF9A 3RV4A 4CF5A 5JJCA 4DA6A 2C4KA 1PR9A 2FDRA 5AI6A 5TF4A 5PNTA 1G98A 1UXKA 2ASVA 3EVNA 4HXEB 3IOEA 1DWPA 4A15A 1N7HA 5JW6A 1N5IA 3K0CC 4GKJB 2TS1A 3H1BA 3WIOA 4DWVA 3LLCA 3NPAA 4H3KB 3CN7A 1ZONA 1YRLA 3V33A 4XUGB 4F2DA 1OWLA 4MUEA 3I4LA 4KXYA 2HH9A 3R8FA 3F5QA 2FGJA 3ZLTA 4AMYA 3H05A 4DSOA 2BFCA 1VMIA 3M6WA 3CG0A 2QX4A 4MTLA 4RA9A 1YS9A 2O4CA 4LY6A 5L40A 1WTCA 2BKXA 3L8FA 1VGVA 3AW8A 4D4LA 4F45A 1OBCA 1BVRA 3EAFA 1FFGA 5A5FA 2V6FA 5FTKA 4LOHA 1WU7A 1NF9A 3MUEA 4XRGA 1C30A 4QULA 1YQXA 2GTIA 2V6BA 1M5UA 5A9RA 1KEUA 3ROKA 2R2GA 1I1NA 4E14A 1KAEA 2C8VA 4AY5A 3EGDB 5KNLA 5HTOA 1UJ5A 1JTVA 2MSWA 1Y98A 2UUOA 5DBIA 2BMDA 1KPGA 4QFBA 3WIDA 1T5LA 2ZRJA 3KWMA 4IG4A 2BKAA 4EDHA 3A0RB 3SFVA 3F5FA 3SX0A 2C3PA 5FAXA 2HWUA 1D2GA 5H16A 3RF7A 5BVHB 1Y1RA 1N7JA 3KUKA 4YDRA 3SU8A 4ESVA 2I1WA 1EX6A 1EGAA 5CFQA 1TADA 2EIHA 2P4QA 3H2KA 4ND7A 4MRAA 1YCDA 4ZCQA 3NKLA 2CHFA 3RE1A 5CNIA 4WBNF 4DCSA 2C2MA 3HI6A 4F85A 1BS2A 2D2VA 5AHOA 2YC2C 3ZU3A 1VG9B 4MW4A 3BMCA 4JKOA 3UAOA 2RB4A 3OCJA 1C3LA 4QM7A 1GSHA 1H0KA 1WAMA 1WNTA 4GM4A 3V32A 1PJBA 4DUZB 1AC5A 4XRRA 4GR5A 1YR1A 1X77A 3JX9A 5HYVA 3T61A 2IPOA 4GBMA 3UFBA 4ZWNA 1ZR4A 3RB8A 4O2AA 3A70A 1ZIPA 1HG0A 1YE3A 1V6SA 2MJLA 4FC6A 4KVFA 1KHHA 3OY2A 4GPBA 3AR9A 2RHTA 1WD7A 2CXUA 4BPRA 3QXHA 5JDIC 2VDVE 3BDAA 3D8TA 5C3MA 1T8YA 4X3OA 5DIZA 1RJ9A 4RQUA 5DEOA 1EFDN 2GEBA 2Q07A 2WAOA 4TWZA 4XSGA 4AZ0A 5KYYB 1HDXA 1U9IA 3GFFA 3FPSA 1XEWY 1XDSA 4N40A 2C1EA 5D01A 2O05A 2OXRA 2PUHA 3H1AA 1XEAA 1NE2A 2GJ8A 3ZDZB 5A7FA 4Z3KA 2R1VA 1JMKC 1YBAA 3GCWA 4JT4A 1CNMA 1ZGBA 1LDEA 3QNMA 5TS2A 5JASA 1W7AA 4L15A 4ZVPA 1NBMA 2G67A 3H75A 4QDZA 3NONA 4ZC8A 1AXRA 3MGBA 2GMWA 1ZIOA 1NQ5A 1YB2A 2HADA 1H5QA 521PA 1H2EA 4ZAWA 5HKAA 1FFXB 3PDJA 4LY0A 3HDGA 4IDAA 3ROZA 4AG6A 2B9VA 3U3MA 3ZDRA 1KEVA 2MU1A 2V7BA 2IHYA 4JA0A 4MQMA 3KZKA 1B73A 1U2ZA 3DW3X 1SUFA 1K7FB 2WIGA 3QVGB 4GE3A 4GX5A 4YRRA 3U4AA 3VR4H 3V34A 1DKQA 3K15A 1VKZA 3QELA 3UMVA 1H1LB 3EXIA 4RIFA 2I99A 2VP6A 3BZUA 3V7FA 4CRWB 4JGGA 3DAYA 3HDYA 1OB2A 4Y6RA 3H4TA 3DMFA 1C1DA 4L2IA 5CCDA 1UIMA 3QWHA 1PQWA 3ISJA 3OM8A 4LRXA 1YBFA 4Y6SA 4GXNA 4F84A 2X23A 1FLVA 1XUOA 3UG7A 2R1TB 1R6DA 2AR7A 3W05A 3AF4A 3K6SA 4LECA 3D2LA 3WLOA 3JTMA 3R09A 3CKLA 4HH1A 1ETUA 2EQAA 4EGCB 1P1BA 3NIWA 4X84A 2WE8A 1R00A 1W48A 3DBRB 3NEAA 2PEZA 3DBLA 3HWSA 2G6BA 4V0ME 4NJEB 4C4SA 1EX1A 2FK7A 2WWVD 4F5WA 4R16A 1Y7HA 3DV0A 4H35A 3UVEA 1UWLA 2REQA 2IK8A 3I2FA 4QODA 3W78A 2JH9A 5HS6A 5C4GB 4JQZA 4YMTA 5EJ8A 5IXJA 2N75A 3FZGA 3V4FA 2PXHA 3N86A 5BRJA 2ZM6B 1AUPA 4EPRA 6Q21A 2CHQA 5JWRA 3NHMA 2OGZA 5B12A 2O5EA 4HP8A 4ZU1X 2HJSA 3IVGA 1XHLA 5KDOA 3NRCA 2A1UB 2YQZA 1FP7A 3DTVD 1JJFA 4DMLA 3TW8B 1E7RA 1V7ZA 4IIJB 1BS9A 4WBNA 1E6WA 3DULA 1BSVA 3QTBA 1ZMXA 2QD1A 4IAOA 2EGUA 5BXYA 3RYFB 1QVAA 3M9WA 2QJOA 2R6HA 2W71A 1ODSA 1JIQA 2Y05A 5CHEA 5DF1A 5GGXA 2GBIA 2I2CA 3WHKA 4Z4EA 1XRPA 4LRWA 5A6SA 3WRYC 1ZJ6A 2IY7A 4ARSA 2DPGA 2OGSA 3IHWA 4JLWA 5JV5A 3H2HA 5DTMA 2EZ4A 3AY3A 1UC4B 1L4GA 2IUSA 4XVHA 3OLZA 5CGZA 4KR3A 4A9AA 2PSEA 3QVJA 2ZIUB 1U3WA 4II3A 4RV4A 3EJWA 1BMQA 2BAGA 5I9LA 3AEQB 3UZUA 3RT9A 2DUWA 2JLAA 4CM4A 3K1YA 1QPGA 4N41A 1SIOA 4YP9A 3UAVA 1OGIA 1TVKB 4EGQA 4Q9KA 1R27A 2D2XA 4L08A 4Q18A 4C01A 1AF4A 1CRQA 4PXYA 1T2NA 2AB0A 1Y4DE 3B38A 4N3AA 2VBGA 2DLDA 3EVGA 4CM1A 4J07A 3IQZA 1PR6A 5C4MA 3QUCA 2JGRA 2QIPA 2DPLA 4TKZA 1CIVA 3P5BA 4P4SB 2YV2A 3OSUA 4O8CA 4RVNA 4TMZA 1ZHFA 5MDHA 4Z0PA 4IUBS 4JVLA 4CMKA 1A9XA 2FMHA 3LH5A 4HWSA 1OSNA 4TS4A 5LD2B 3UMFA 2DFKB 1FTSA 1ODLA 2R7MA 1D4AA 5EAIA 1JALA 1JG2A 3AF2A 3QUAA 3W5SA 4BMOB 1ADFA 1QBKC 4R1NA 3FWNA 5BV8A 3GROA 1RM0A 4DG9A 2V58A 5F2NA 1TYAE 4U63A 5HUJA 4IVPA 1II8A 3NM4A 4X63A 2QW0X 2H2AA 1TFUA 1U4NA 1OLXB 1GL9B 221PA 2W4QA 4UM9B 5C7LO 1NSYA 3MINA 3IALA 3T7CA 1G9TA 1Z68A 4J1NA 4Q9NA 3SICE 4OHVA 5BUZA 3HM9A 1HLDA 2HK7A 4E03A 1QWSA 4Q05A 3TZKA 2DBYA 3HTXA 1P6QA 2WWIA 3ND6A 4X54A 1VMEA 3HDTA 3LQKA 3RFVA 5KJCA 4LNHA 4P38A 3OQOA 3GXOA 3GRCA 1WM1A 3MOIA 4HQOA 1U3VA 1FNSA 5IH3A 2ZR8A 3TLXA 3VPCA 5FH9A 4NOJA 1X9HA 1J56A 1TZBA 3QSGA 4MLCA 2PQMA 3DEFA 2HWYA 3IMEA 1UPAA 3PRJA 3WV4A 5ELXA 4DTCA 3K0EA 2NXJA 3ZQKA 1U0GA 2OC9A 3EBOA 3GRKA 3JYOA 3RIMA 5CBPA 3SR3A 4KU4A 3WHLA 1NM5A 1WMAA 2RKBA 2QD5A 3ZNPA 3AXTA 4C6TB 1ZCAA 2FPGB 4TLEA 4TWJA 4BMYA 3HJGA 1LZLA 1ZM2A 621PA 1ZM7A 1D2RA 3VYVA 4B4KA 2ONYA 3I83A 3UWOA 4F2GA 5BSVA 5EIFA 1Q0TA 4A92A 3SXUB 3G9UA 5FD8A 5FEUA 4C43A 5L9AA 2GETA 3OCXA 4NH4A 3TPCA 3UO8B 4DEYA 3HO8A 2QYSA 3FDIA 2H5LA 3H9EO 4Q4AB 1T1GA 4YRLA 1EFRD 3DT8A 3M6LA 1BHSA 5AOAA 1SKYB 1OZAA 2JIMA 3DLHA 1DTEA 3OQHA 3E9RA 4XQ9A 4B87A 4UBMA 4ZO9A 5M34A 3T12A 1UODA 3TCNA 4UTRA 3EYAA 3V8RA 3ZHBA 2EZTA 3RC9A 5BWLA 1GHTA 2AOTB 2P30A 1VLVA 3HCAA 2CXTA 4MRVA 4AJKA 2YXDA 1AK1A 1E2FA 1Z2PX 1P5FA 4Q7LA 5JS8A 1B4DA 5MFPA 3QJGA 4TV8B 3ESBA 2REXB 1SY7A 4YFYA 2EF0A 3ZJ5A 3EQ2A 1ZUNA 2QB5A 4BN5A 1T1RA 1ZVVA 1RLMA 1BEEA 2Y6VA 3L5OA 1QIGA 2FWIA 3M7IA 3JYNA 4G1CA 5SV2A 4X8MA 3OZUA 3NHWA 5THKA 3JD4A 4PR0A 4ZT2A 2E9SA 2GAIA 2OP1A 3IX7A 1RC8A 2HDHA 3M6FA 3QYAA 2FUCA 5DZSA 5BSHA 4UNRA 2GZDA 1GZ6A 1C7IA 3RYHA 1A8UA 1YZNA 2YZ7A 5FKJA 1I6LA 1YU9A 5FPYA 1GLNA 4KPEC 4JBXA 4KIFA 4IZIA 1NQVA 2I4OA 2WWFA 2EKDA 4AKIA 1RRKA 4CCYB 3N74A 4H1UA 2V3VA 1F4LA 1O4WA 1JDPA 2I7TA 3N7UA 4MR8B 4Q01A 2IBSA 5JT1A 4A5OA 4KL8S 3W6PA 4ALNA 1GNVA 2BW0A 4GLBA 4KXLA 3WQRA 4DMMA 5MF6A 5A4JA 4CTKA 3RI3A 3VYWA 2OQ2A 4OXXA 5IG2A 1WUHS 1O2DA 4RQTA 4RLFA 2VAMA 3DOCA 1I01A 1P4HA 2Q4BA 2XQGA 1MU0A 2JA2A 4FN4A 3HQ4O 1WUIS 9LDBA 1D1SA 3DEKA 3EJ6A 1QWOA 1TC1A 1SCDA 3ORRA 1FDWA 1FYXA 1ZJ4A 4O5OA 3DFKA 1SQ5A 1UEIA 5DNEA 3VSAA 4QKQA 5KTNA 4WA8A 4FB5A 4BY9E 5CVDA 1O87A 1O95C 2YY7A 3L8EA 3G17A 1M2OA 2LDXA 3A28A 2J7PD 3ID6C 4KPFC 2F17A 2X13A 1NTOA 1MGPA 2VDJA 1GGVA 4TQ9A 3RU7A 2PKXA 3SZGA 3K4HA 2NV2B 3C6QA 4F46A 1OI4A 2XXBA 5HBRA 1M1YB 3NORA 4YASA 1DCMA 5FQOA 5HVNA 5AM1A 3HNOA 4KR9A 3BGOS 1TZKA 1VGQA 4H18A 2QVGA 4WXRA 2PUJA 3Q0IA 3T94A 1XPRA 3K20A 3NTLA 3R0JA 4OP1A 1QYIA 4MA5A 5H5JA 4AQDA 2Y1DA 3L1VA 3CZPA 4E94A 4QUJA 2PS0A 3GR6A 3IEVA 1YUMA 1G38A 3IKLA 4U00A 3O31A 1ESZA 1RYHA 5BV0A 3HYSA 3W1EA 1PGQA 2X15A 3H5RA 2PX3A 2LW7A 3EEYA 4P35A 1UKVY 4ZTBA 2TSYB 1Q1AA 2RCNA 4EJ2A 2BJVA 2XGMA 3L06A 4RHUA 3RANA 2PL1A 3NHYA 4MUGA 2Q5HA 3SLGA 4N82A 3F0TA 1FVFA 3NHAA 5K4GA 1CKEA 2ZUCA 5TT1A 1C4OA 3DDNA 1DKLA 1X0XA 5EMJA 1E1CA 3E5HA 3OC6A 2Y8EA 4O4JF 3HI4A 1W85B 1XZDA 4BX9A 1VHJA 2XUAA 3UJCA 1HQKA 1WDMA 1G1AA 2VWGA 5DNWA 1K7CA 1N1MA 2PAAA 3OF2A 5JY1A 2IYSA 1XZHA 1BD4A 2J9FB 4GXRA 3CLRC 3VUEA 3SBOA 1JKXA 3IE0A 4DDTA 5AFSA 2ST1A 1CDOA 1FTQA 1QJ4A 3MCWA 3HXQA 4OQMA 1PWYE 3O47A 2PGJA 2BGNA 2DTEA 1NU6A 4C3VA 3S27A 2FSIA 2UZ1B 2YWGA 3PFGA 4LWPA 5KINB 1W9MA 3BM5A 4ZI2A 3Q5GA 4FFSA 5BN3A 2DPYA 5CU7A 2ZT6A 1RMQA 2HU7A 4CIXA 1MB4A 1JHOA 1YI1A 1FLDA 1XDGA 2W6IA 1TD1A 4LY3A 5KPDA 1NLMA 4B0OA 5LDDC 1F6DA 5C80A 1B41A 3GZTB 4U0JA 2X7JA 1NBMD 1KAHA 4MJ3A 1B8PA 1RDFA 2AN4A 4IOKA 1VCNA 5FI5A 2OA0A 3ZGZA 2IIVA 3WR5A 1A9PA 2WFAA 3FB1A 4RTMA 1RT9A 2NU9B 1L4YA 5AO9A 2O48X 2VT6A 4WQMA 3FOZA 3GWGA 4HAOA 3G0HA 1XA0A 2C8JA 2G0AA 3DVLA 1NHWA 4M0LA 1CIPA 1H9AA 1P80A 2UZ0A 4CR7A 1PZNA 4OKSA 3VU3A 4ZZ3A 2NSJA 3RTDA 1W36C 1ACMA 3VPFA 2QT9A 2VTDA 2C4UA 1NLZA 2CLMB 4LHXA 4IJVA 2RAFA 2ZSKA 4HYQA 3Q87B 1CYEA 2J3IA 5TQJA 1T4MA 1BYUA 3OIVA 1JEYB 2I5PO 1PT8A 1LPAB 4II7A 3OIDA 4NVRA 2ZXUA 1LCIA 5JPIA 3U7GA 4ALIA 4FZ3A 1X1AA 4OFZA 2XUIA 4H7PA 4F3KA 4EHBA 4PGHA 1B23P 3BWDD 4DUGA 1LRLA 1OXSC 1GZ5A 3HY6A 2IOFK 5BPFA 3UXHA 1TJNA 4QXOA 2O5RA 1NUQA 3L02A 4R8MA 4RJJA 4DPLA 3FYUC 3HCOA 3Q8LA 2CC2A 2WJWA 3DA8A 3ROEA 4BU0A 4S04A 4S1NA 1PNOA 2J0EA 3RU9A 1T9AA 3D4BA 1ISJA 3VTKA 1M8FA 2QMEA 1QH0A 1WWKA 4DV4B 3CUYA 3GGSA 2M1ZA 2ZE7A 3IEKA 3TBKA 5J1SB 2QHXA 3AKDA 3KVNA 2YFKA 4YRKA 4DR5B 1ORDA 4FNAA 3AOEC 5CFNA 1SUCA 5H8WA 3NJ8A 2FB9A 2A0YA 4TRMA 3ANNA 1LBTA 4BGIA 4F97A 5C8YF 1U28C 2FY8A 5KMGA 2E2WA 2JLBA 1GSIA 2GZRA 2Q6LA 4QVKA 2B99A 3ORHA 3BXEA 4UW9A 5K8TA 1WB9A 5DGIA 5P8WA 3N7TA 4DSUA 3DKVA 1ZRHA 2Z09A 4GI7A 2X0FA 2H1VA 4NOMA 2QN3A 1P75A 2R8BA 3JALB 3EXG1 5TPWB 2Q41A 3SG0A 1U7WA 5JD6A 1OH5A 1XCGB 3DVSX 3ECCA 5JTTA 2QTAA 4RHTA 4RVCA 1C7FA 1X7GA 4US1R 4IZHA 4O4JA 1O6GA 1QLJA 4URYR 4Y2YA 1NFQA 1OI3A 1P33A 2GHRA 4MV1A 2GLXA 1OH8A 1OIVA 3O8QB 2C2GA 5FPKA 3UC5A 1J1IA 3A9RA 4CKXA 4GYKA 1Z22A 4HOYA 3EOAI 3Q8MA 3NP9A 4IGFA 2NQ8A 4O63O 4ZV9A 1PFWA 1QRRA 2J6CA 2XNHA 1R4MA 3MNFA 2I1LA 4IDGA 3ZWQA 4UZSA 2JZNA 1D2NA 1BHJA 2YFYA 4REOA 3ZW8A 4ZGWA 3PQ6A 1EP9A 4EHJA 3OTOB 2PSFA 1IM8A 1JI0A 2CXPA 3AFGA 3T9DA 3C4QA 1WKVA 3H2BA 1X13A 3L7BA 4UHFA 3QWBA 5HWSA 4P92A 3SPXA 3A7DA 4QVIA 1OZ0A 4BBAA 4FDMA 1PZMA 1Z7WA 3EBPA 4GBJA 4LOAA 4E33A 4QQFA 4BS9A 2CEAA 3BD6A 4ZJPA 4IINA 1PK9A 3RSQA 4EJ0A 1WCIB 1XMVA 2JFVA 3ADOA 4K86A 1HYQA 2I6TA 3VU1A 1JG6A 2J0QA 1JTEA 3OZAA 2IT1A 2W93A 3KB8A 5EESA 2R6R1 3ZE1B 3G2HA 2FQWA 4UOEA 1GUYA 3RPEA 1EZ1A 1WHSB 3E5RA 4J3NA 1C9JA 3DAFA 4UDOA 2NZYA 1ESNA 1DIOB 2J9RA 2WTXA 2YXEA 3GUHA 5EIOA 3STYA 1N0WA 3PA6A 5EMMA 4B71A 2PKQP 1F3LA 2PO5A 3N2EA 1P4JA 2EXXA 3PQ8A 2PEYA 1JHZA 2OOSA 5BUCA 1PR0A 2IHKA 1LDMA 4RY9A 4I99A 5DGCA 4D0GA 5JAZA 3FPEA 16PKA 4KN5A 2CUNA 4JIGA 3F2VA 3AM1A 1QE3A 2EBHX 5KX5A 1HNXB 3AYZB 1EGHA 1TTQB 2PMKA 4QWWA 4WLOA 1QIEA 1UM9B 1JSLA 3KE8A 3DMRA 3MPUA 3RD5A 1M73E 2PX6A 1WABA 2Y67A 5LQSA 3ZK7A 1Z2CA 2BFFB 4XWWA 2QK4A 3LQ1A 3O1IC 1XALA 7AT1A 3TZEA 3QG5A 4TXHA 2E0IA 3QVWA 2IEBA 2J6HA 4I4TF 4OQYA 5EJ6A 3T15A 3W2HA 4L8FA 2VF2A 3V97A 1JG3A 3K3PA 4O33A 3KS9A 4YPFA 3FSRA 1ZR2A 3T1NA 1UBFA 4R1LA 2Y66A 1Y4UA 2XIJA 3QPCA 4H59A 5DI9A 5DXJA 1R6XA 4CW7A 2QN1A 4DPMA 3I9V6 1C3JA 4INJA 1GTJ1 4WRRA 3DCJA 4Y9UA 3TNLA 4AU1A 1G8MA 1ZX1A 2JRLA 4PTZA 1ZUIA 3SBEA 3QVMA 4BVFA 1E0DA 3IUBA 2YJGA 4YLEA 2VHQA 5IUJC 1LPOA 1MEJA 3G8YA 1NUTA 4BHTA 4Z0HO 2ZE6A 4RULA 4PHFA 4DVGA 1CUVA 1PYGA 4LQDA 4U2BA 3LUGA 4MYCA 3KAPA 5ABPA 2QTLA 4MWDA 3RNOA 2HJWA 1YJCA 2QP9X 5SY6A 1LZKA 2C7RA 4WH0A 1TO6A 1XRJA 3QXGA 1NBIA 4JYPA 3G9TA 5JNTA 1EUQA 3K32A 3KXKA 3FVWA 3PE6A 3PE4A 4N5HX 3N70A 2XRYA 1LQTA 3DPSA 3PFWO 2PQ0A 4HJRA 4DJJA 3JWPA 1E6CA 2FPLA 2V5AA 3H2IA 1VSQA 2NTJA 2JB9A 2GERA 2XH8A 2XWQA 1GR0A 3P9SA 5EIAA 3ZU2A 1H6AA 1VFPA 3MMZA 1NXSA 2HU5A 2P27A 2HA3A 3MA0A 4KX3A 5L4NA 5AW3A 4IGAA 1KDYA 4AKTA 3K6JA 2XDQB 4JBNA 4DGQA 3GLIB 4R3NA 3MQ4A 3QEMB 1QBGA 5CTJA 5E38A 1MP0A 2HTFA 4ZODA 2XB9A 4HTFA 2NUAA 2XI4A 3Q88A 2HBQA 4JY7A 1XR3A 5G0WA 5CYPA 1QFSA 2QT1A 1XV5A 2EQ5A 3SLRA 2H2WA 2AFRA 4LYDA 1Q3KA 1M2WA 3CJRA 2G71A 2ZJ1A 3CCCA 4JA2A 4OB8A 3W5VA 1CEYA 1H8ED 2EGGA 1OASA 5I48A 3L4JA 3OCYA 2BF4A 1Y9DA 4I4LA 1L5VA 1AXGA 3W6OA 2FW8A 4YV2A 5AUPB 5JZOA 5F5NA 4RK1A 3NANA 4RH3A 5BW6B 5A03A 4Z7NB 3FTFA 2D1FA 4YRTA 4FKMA 3CNOA 5DBGA 4EABA 4I5EA 1EG7A 3E6AA 2PRZA 3JWIA 1QUEA 4LJ8A 1T8PA 2YWCA 4YRAA 3WAGA 3T3IA 5CW2A 2OAEA 3IHKA 4Z99A 3ZIDA 1VZ3A 1KIMA 5KVVA 4YUAA 3GQBA 3GZNA 1X94A 1K5PA 2BEWB 4XOUA 1IHUA 4RVOA 1ZM3A 1G3RA 4C0HA 1TC2A 2WFZA 3L82B 4ZC1A 2P5SA 4MPPA 4JL6A 1U7UA 2P9QA 3NJ4A 5BOVA 1FY2A 3T95A 1PV4A 4RPHA 1UL1X 4MUFA 2KI5A 2R6JA 1DIBA 3EDCA 4K8RB 3UHOA 1U9JA 5CYGA 3BE5A 3SYTA 1PJ3A 2FPUA 4XIFA 2FQ1A 2R85A 3NVDA 2P9CA 4B80A 5BW8A 1OIWA 4A5SA 2NUPA 3K9CA 4WZAB 2D4HA 4KVAA 4OGGA 2RK6A 2PDAA 3GVPA 5TGZA 1BD3A 2ABWA 2EP5A 2HREA 4GQAA 4GWGA 4OTZA 2CJFA 3FZNA 3L7KA 5CIWA 4G41A 1FJHA 1TMOA 4K6MA 4ZARA 2AXQA 4B45A 1V5GA 3EIHA 3AR5A 3TXXA 5K4HA 5COBA 3GCGA 3RLIA 4DCJA 2WWYA 2Y1WA 3BMNB 2FPIA 3MVEA 1QAMA 4J7CA 1Y1PA 4W7HA 1APBA 4PG6A 1YB4A 3H17A 4TV9B 4QOHA 1CUFA 2JAPA 4WFIA 1HY3A 3UOGA 4DWWA 1RKQA 3LQRA 4Q7QA 1JAIA 2GFIA 5E2IA 1Q1ZA 3F6CA 3MF4A 3TMYA 1WP9A 3ZGLA 5JU6A 1QF6A 4HGYA 4QU0A 3T3DA 2Z3WA 4CKCB 1NVEA 2NSHA 1RWWA 1R4NB 1TOAA 3WWCA 2Y2VA 4QPZA 4MS4B 4NP6A 1C4XA 1TU3A 3GJ5A 5HJ2A 4AJOA 1GKUB 4DG8A 2Z6AA 4YHHB 1DIRA 1R64A 1SD2A 3EZGA 4J16A 3RC8A 5SZIA 4LXUA 1NP3A 2QRNA 1FJXA 1WLSA 1X1SA 1WL8A 2Q1TA 1PSZA 2Y1LA 3OFNA 4K8OA 1OXKB 4FEGA 1I7DA 1M2FA 3DOUA 5FBWB 4XIIA 1VL2A 1ZK3A 5JARA 3Q3EA 1QV9A 3URMA 1BAPA 3ZQ4A 1GT91 1U1FA 3LDFA 3P2JA 3WKAA 2IDJA 3HL0A 4A0FA 4YRZA 1TLTA 3DL0A 4I2NA 4L9SA 4W5WA 4GWKA 1GCIA 2XXAB 2H5IA 4EKIA 1ECGA 1LX7A 3DR3A 4MKXA 2P2CA 3IIIA 1VLLA 3O38A 3PC8A 4UAVA 1AV7A 1VI5A 1SKAA 2X8AA 2CUZA 4U2FA 2W4MA 4NDZA 3FNQA 1U0OC 2R751 4B76A 3UBMA 4RIEA 3LSTA 3K9GA 3B3GA 3U62A 3PPVA 4D8UA 2OBMA 1XLWA 3LV8A 4RHEA 1AQJA 2R2AA 4G5FA 3BGVA 2ZUEA 1FJ2A 1XBTA 4H7FA 3ADCA 4DIOA 3GUZA 13PKA 2B98A 3R5JA 3VVMA 2BDEA 1OWNA 3VOBA 1DBRA 3ENZA 4R1TA 2JEYA 3TZHA 4EMTA 2QTVA 3WL5A 4YP1A 2GK4A 2R87A 4YS6A 1EGQA 1T5IA 3BJZA 2CVOA 3PC3A 3PUVA 1GZHB 4N1AA 4NBNA 4GMXA 5ETJA 3KOWA 1XTTA 3ZCXA 1U3DA 1JLKA 3L6BA 4HWGA 5EVCA 3WB0A 1W4BA 2ASEA 5EIEA 3V8NA 4XJVA 1XZEA 2CN1A 2EZ8A 1AIPA 2XA1A 2WSIA 4P84A 5KAMA 3UYKA 2E6KA 3DJFA 2W98A 4NXMB 4DIBA 1RWPA 5ADUS 2GQ0A 2J30A 3OAAA 4DDKA 3S81A 1WSWA 2DCMA 4JVSB 4RD2A 4O4IF 1ZJYA 3AU8A 3ENNA 1HE1C 1GV0A 2CLEB 2VCHA 3CU5A 5TE9A 3GFQA 3H2JA 4EY4A 4CKZA 1R15A 2ORVA 4ER0A 4Z5XA 4NRDA 3WQSB 2FF7A 2GF0A 3G8DA 1AV6A 3H9CA 1MO6A 3QF4A 4K6GA 1Y8CA 3PLNA 3G2LA 1GTMA 3AWIA 1IQPA 3TX6A 1BDMA 2O2SA 2VP5A 1XTZA 4KZKA 3R3UA 1NVAA 5F7ZA 3U4GA 4AJ2A 5AM5A 4C3UA 1SCJA 4EBFA 3IJPA 2BM9A 3FA2A 2BRUA 3E2IA 4DUGD 1YDMA 3VNAA 2GEKA 1N4DA 2F3QA 2WUFA 5ENDA 3VVCA 3FDZA 3C8MA 1FXWA 2OLEA 4PINA 2Q3LA 4PN3A 3S8EA 1TF7A 5JAOA 3DG9A 4QQNA 2DVMA 3EFOA 3THSA 5GADl 1RKVA 5HFNA 1CHDA 2FVYA 1FP4B 3LUBA 5F2KA 3WMGA 4RL4A 1Y1QA 5LYJB 1EXDA 1IOVA 4G24A 3U2QA 1TZ2A 4GI3A 4EAQA 1U0RA 2P2NA 2PSJA 4YJ3F 8ATCA 2PX4A 3UNXA 4BGDA 1SM4A 3OFKA 3T3GA 5KUTA 2YS6A 1BO6A 3HKEB 1D6JA 4PLPA 2CL0X 3N5CA 1BQ4A 1L5LA 3C16C 2JASA 3GNSA 3LC1O 3MUNA 2P9EA 2RIPA 3ONVA 3DZIA 3T1YB 4BL5A 2XBMA 1SVLA 3OJEA 4BNHA 2W00A 1AKQA 3VNVA 1NMXA 2R5WA 3PWTA 4CEHB 2QAGC 1QO9A 1Q6ZA 5KYWB 4C03A 2A9VA 3VI4B 3WL7A 2JFQA 2PRSA 3EPPA 4FI3F 2QZSA 1QRSA 3U61B 2JAQA 1X7HA 3LT4A 3WFIA 2VQDA 1RZ3A 2GO1A 1IK4A 3RYTC 2Y1GA 4A6EA 1T5TA 3S2UA 2OOKA 4A0RA 4ED9A 4FFRA 2JAOA 1W25A 3WLRA 4GF5A 2UZAA 2O19A 4HS4A 4BB0A 4PC6A 5CJJA 5CA1F 3TXAA 3ZDCA 2QR5A 4W82A 5DSZA 2I91A 5E7IA 2OCGA 1EA5A 5J47A 2ZUVA 4DBZA 1U2PA 1GQQA 3OT1B 1LDGA 5G3ZA 4D3XA 1KJJA 5ES4B 5GIPE 3ZV7A 1QDEA 1MEOA 1K66A 4E2FA 5A2GA 1KRXA 2XTZA 3N75A 3RRZA 3CLVA 2D62A 4F2HA 1NOIA 1J0AA 2A86A 1EXNA 2C88A 3G5AA 3IMGA 1KHTA 4GE0A 1KJ9A 5EJ7A 1R8YA 2B21A 3JQ8A 2DY0A 3SSNA 1ELOA 1TE2A 5SICE 2HA0A 4H08A 4OUDA 5AVTA 3DMYA 1JMYA 4RH0A 4WCFB 2B6NA 1UWKA 2QLFA 5KO2A 3R8CA 3IPYA 3G2KA 1T10A 3IBSA 4IDBA 4OFBA 4DQVA 3DGFC 3SJBA 2LIPA 3CISA 3KU1A 4IGEA 4I55F 2R0QC 1E7SA 2R96A 2WJYA 5DFAA 4DXDA 4A8PA 1FF9A 3COSA 5JEEA 4ZALA 2CXHA 4M53A 4YAEA 1PL8A 4TM8A 1LY1A 3I23A 4W9MC 3F1LA 4LOJA 1DTSA 2ETXA 3IRVA 4K28A 5D1NA 2ZI5A 3ZV5A 3PJDA 4PVDA 2C7OA 1X92A 3MN1A 3PXDA 3JQAA 1TL7C 2X41A 1XQXA 1O4VA 1SQFA 1SCKA 4XXHA 3WQHA 3JVDA 2QLNA 4V1CA 3HL4A 3F3MA 5IDVA 4M3NA 2BC9A 4CTNA 1LK5A 1P7YA 1VHDA 3WQQA 4A16A 2PBLA 4EG6A 4WZBA 4N18A 3UHPA 3LFHA 3PQDA 2JHPA 1W35A 3BXGA 3F8SA 4HRYA 4BECA 2ZJ6A 1S0UA 2GAJA 2HRQA 3STXA 3ROQA 4LBVA 3ROXA 3WLNA 3LL7A 1ZK4A 3OHMA 4LSWA 3VRHA 2F00A 2XQIA 4B3DA 3VJLA 1D1TA 1REQA 1Z8NA 1T36B 1UEXC 1F12A 4CG2A 2L2QA 2Z2ZA 3MTAA 2C7PA 1AY0A 4D0RA 4QRDA 2GN4A 1R6VA 1M34B 3FTDA 2GWRA 2Q3MA 4B5LA 4BNMA 1NNI1 4D8TA 4ZYLA 1NW4A 2MOKA 5HE8A 3WK9A 1W4ZA 4PLTA 2DP4E 5LQDA 1MTZA 4PIMA 2AOWA 2WNHA 1KGDA 5KBYA 1FRZA 4RF4A 5ED0A 4BMXA 2GH1A 4GEGA 4TRNA 3VYUB 1XZQA 2DBRA 4LJ5A 5C81A 4YP0A 2GCNA 2V7VA 4PSUA 5TSDA 1ORHA 2GJ9A 3RS0A 4CIBA 2OR3A 5HIMA 4B85A 1XN4A 1V1MA 2OZKA 3IPCA 3JQBC 1JLHA 1G5HA 3LGSA 4MVJF 4BFXA 3DUWA 1GNLA 3QY0A 1OHHD 4MAMA 4TLBA 1Z83A 4BAUA 2ENUA 3U7FB 2FPWA 4Z49A 4WFJA 4B3BA 3AWDA 1XVUA 4F72A 1HSOA 2EX0A 3A3KA 4KMSA 3ZXIA 4DR2B 2JGDA 4F7WA 3H8SA 4M22A 2CSXA 2P5YA 1BXRB 1J06A 2PMBA 3IA7A 5A04A 3R0QA 1JYSA 2EKPA 3R5XA 4F5EA 5CA1A 3JAMA 2NTYC 2VXCA 4PHGA 3UK6A 1I13A 2P9YA 2WHRA 1KSJA 3CRNA 3D6VA 1M6HA 2JKVA 1BOOA 4PSCA 4TLMB 3VNUA 2PCJA 4FCCA 5H4HA 3AF3A 1RI5A 3BTOA 4DLUA 4U9IS 3DONA 1Y1LA 3OQ1A 4IMJB 9MHTA 5J2UB 3ZDQA 3N2IA 4YAIA 3T7SA 1R0BA 1GPYA 2H1LA 4PICA 3BCRA 3K35A 2V7QD 4ZEXA 3THRA 1W75A 2Z8ZA 2FCAA 4BVGA 1GUDA 4L6AA 3R7WA 3H9UA 1PFGA 2WHQA 3LS2A 3MS7A 2O2GA 1CC1S 2CL7X 4XGQA 5T3YA 3PS9A 5IBQA 4E5KA 1BFKA 5BP7A 1KI9A 2BELA 3D7MA 4DGSA 3IA2A 2GEUA 1M2JA 4NABA 1NT2A 3MZ0A 4HB4A 5EJGA 4I55A 1M2VB 3NCTA 2AFIA 4TTTS 1PR2A 3WL4A 2QL5A 1P7PA 5DBOA 3NEYA 2OKCA 3HKCB 1B0UA 3STWA 4IUDS 1NR5A 4OU5A 5FPQA 1HMYA 3ESYA 5E7JA 5TGDA 1AHPA 4KAXA 4JB3A 3QUBA 1WW3A 2XKKA 5E4JA 1P4GA 4ZEWA 2GJAA 1JQJC 2XSZA 3BE4A 5LKRA 1FU8A 2PUGA 3ITDA 3L9XA 4OAQA 5L3SA 2FKNA 3WVNA 1ZUWA 4WWHA 4AN0A 2UVPA 1DWUA 4ZIRA 1YONA 4II2A 2C4TA 2RHMA 3N8IA 1T9DA 1KJWA 2TMYA 3OQIA 3EK2A 3U7JA 2HB6A 4M46A 4RTRA 1FVOA 1KI6A 3B2EA 2WYHA 2ZSUA 2IF0A 5L4SA 4OP2A 1W1UA 5LA6B 2IS4A 2NAFA 2XA2A 1RRGA 3HN7A 3O4VA 4DMGA 3X2FA 4E2YA 4BO7A 3SMQA 2H63A 3UTDA 3H19A 2FQYA 3GVCA 5IYZB 5K0SA 4F04A 1U2EA 3AL2A 3I9NA 4ETWA 1VECA 3A4MA 3B1YA 3HLTA 3R3XA 4YACA 2VZ0A 1T43A 1YC5A 2C96A 5IC5A 1QVRA 3DC2A 3PWKA 1G5RA 3R6TA 4JQCA 1EGMB 3K0BA 5BYJA 5LZ5A 4BFTA 2OMKA 4C0XA 1E0JA 1JRLA 4D4JA 4J0GA 1XK7A 4ER6A 5LNK6 3IAAA 3AUUA 3LF1A 4H27A 3RVRA 1T6ZA 1QG4A 1HO3A 4PCAA 2CW5A 3TMKA 4NK4A 2J9ZB 2VDOB 4FJ2A 5AW9A 3RSZA 3B7GA 1O5IA 1CR0A 1I9CA 1PG5A 3A3NA 3DQZA 4ZT3A 1R37A 4DV7B 1W5EA 2Z83A 3DDUA 4RQAA 2LKDA 1OX6A 2W0SA 4WZZA 3TTSA 4QUEA 4XX1A 3SBDA 5K8VA 2Y1EA 4HDQB 2B0JA 4NZ9A 3QITA 4L5JA 5HDBB 5TQ0A 3U3XA 5EXSA 3E1SA 1SZPA 1GUFA 1ZU4A 5J4LA 1GO2A 1DT3A 1OPXA 3UB4A 2AS0A 2YFQA 3IBCA 2PSHA 4D3SA 1XTQA 1GN8A 2B3DA 3BMQB 3GLQA 2R8YA 2HIGA 3EPRA 5FL3A 2R8ZA 4PTLA 1DEHA 1E64A 1RQRA 1UPXA 3RNLA 1A98A 2CXXA 3T3MB 4BQSA 2BSAA 2V4UA 2VOEA 1NBME 4ZCMA 1K86A 3RT7A 3I12A 3IVMA 3QJ5A 2DQKA 3UAZA 2YN2A 4H1HA 2RGAA 3O92A 4H7JA 4L6CA 4YJHA 5IVDA 4HNVA 3U7QA 5K03A 1F17A 2D0PB 3WTCA 4QDJA 5IJ0A 2BGGA 3K70C 4BB9A 3UT5B 4DCTA 3R0ZA 1ZD9A 3B52X 2ZSDA 3S4YA 1V16A 3BFJA 4LJYA 2F2TA 4UNSA 1AHNA 1XZAA 4JUBA 4OP3A 3ZCRA 3PPWA 1N92A 4IXTA 3I2YX 5EIBD 2BFWA 1L4BA 1SULA 1KOJA 2A9FA 2P4EA 2ZRAA 5LBTA 1C1XA 2GZAA 1ZVJA 3RAJA 3RR2A 4FT4A 4WINA 1E2BA 3KYJB 3IXLA 2GGSA 2ZW9A 5FWYA 1UBOS 1THZA 1AMUA 1CFZA 3G8BA 2WOOA 3QE2A 4ZVVA 4UJ3A 3VZBA 2NT4A 4YCSA 3F8WA 3T5TA 1D0VA 3A4LA 3OJOA 3OAAD 4OREX 1PJRA 1H1TA 1QTRA 3HCFA 1FFHA 3UMBA 1RWXA 4ZYWA 3TGLA 3BC1A 4ME6A 4EF4A 4HNQA 1JEQB 3TG2A 4HC4A 4BNXA 4HQLA 4QNNA 3KYBA 1QGUB 3KZ1E 4HJXA 4MJXA 3T4PA 1ND5A 1DSSG 2C8KA 3N0XA 1R9NA 2OB2A 4NS4A 3JQ9C 4OQXA 5KJFA 1IY8A 4FUTA 4ZMBA 4A0QA 3QVLA 3ZVLA 2JFOA 2AR9A 2WU3A 3K31A 4XJSA 3F5SA 1LDNA 1F20A 1RCUA 3IBTA 1SVOA 4FSDA 5BOSA 1L7AA 2YWXA 5ULLA 1NDUA 4HN9A 3FZYA 4H0FA 3ZCTA 1QFYA 5M5BA 4PG4A 1MAWA 2R00C 3H13A 5JLAA 2YVKA 5AICA 3B1KA 1YV9A 4Q9AA 3UUEA 5L7WA 4N3GA 5T8KC 2R8EA 1RC1A 4HR7A 1YZ3A 1ZRNA 2O2JA 2VI5A 2VWHA 3LU1A 4G84A 4UE2A 5E1MA 3V4VB 1V9LA 3VC2A 2VYFA 2C98A 1BQEA 5AW2A 2C3YA 4LV6A 2WZQA 4G8BA 4O5AA 3B1FA 1GPBA 5GJBA 1IWBB 3FIUA 3PD0A 4OK3A 3FNGA 4U0KA 3LI2A 4D6XA 1QYDA 3KR9A 2Q1SA 1QKIA 1NXQA 1EVQA 2IYOA 4AF8A 5AVQA 2XHZA 2J41A 4BDSA 4PNHA 2BSXA 4EYEA 4RMIA 2ZK7A 1K9VF 3EHEA 2IPXA 1KZ7B 3G1TA 1R0SA 3QRWA 3G2OA 5KWEA 3P9RA 2YNMC 1UH5A 3IIEA 3JVUA 1N2CE 1EWRA 1O03A 2VP0A 3HY4A 1TQ2A 4N0QA 4X5OA 3T7DA 1UWVA 2ZBVA 5CURA 5CM9C 3KEFA 3UXYA 1HFWA 3LQ2A 3VDRA 4JGIA 4MS1B 3PB3A 3R7FA 2JBAA 3RAPR 1DO2A 1JUDA 4M8KA 4DT1A 4W9NC 1HDRA 1EVIA 2C4WA 1ISRA 1MABA 5K3AA 1FNNA 2X4LA 3WSVA 1BKDR 1FNMA 1NUPA 1RR6A 2ZRGA 3D1JA 2VHVA 3EFHA 3VSEA 3N8NA 4LC0A 4PLWA 2D7JA 3RIGA 3WGUA 4Y2HA 1G6HA 1Z12A 3DNFA 2M9MA 1LTKA 1TEXA 3RJ5A 3S5JA 4R2JA 1DKNA 1GTRA 1CYDA 2XZPA 4ZOEA 3EIFA 3PX7A 1T3ZA 5HUQA 1LPNA 2JFFA 1SC3A 2Z9BA 2AQHA 3EQZA 3FGOA 2IEGA 3K73O 3PVZA 4LSMA 4RUKA 4TXLA 4YVFA 5C7OO 2RHJA 4B33A 4MCIA 2M98A 4TUYB 1UBGA 4HFJA 5DX1A 1Z88A 3QXSA 4CG1A 1LKZA 2QKYA 3QW2A 2PRJA 2A4MA 3O95A 4MK4A 3IAEA 5BR1A 1J5XA 3A6EA 4KSYA 3B7WA 3T35A 1ZRMA 5HUHA 1QYRA 2QWXA 1ONPA 2QM3A 1L0BA 3F3YA 3MHPA 2BZ0A 3PUWA 5CNJA 1Y7TA 5BUSA 5JNWA 3EPHA 1HYGA 2BIFA 4X6XA 2W48A 3O82A 4DCGA 4DJFC 4M7OA 5ITVA 4MKHA 1PT6A 5B1HA 2NO4A 4WXEA 3VC3A 5KQPA 2R6CA 4Z1MA 4K03A 3O2NA 2C2ZA 4PU0A 5JR3A 1FC0A 1CR2A 4IVRA 5DHFA 1XTPA 3N58A 2ZRHA 4PYOA 3LPDA 2PH3A 3B1VA 4PPNA 2IGBA 4W5HA 2CNKA 1XD2A 2IYEA 3OE7D 3W4KA 4OHPA 1KYVA 2BUBA 2XUKA 1SJ9A 3UUGA 4D9KA 1THTA 4WI1A 3CLUC 1VG8A 4YYZA 1AGYA 1RE0A 5GV8A 1TB4A 3G0GA 4LDAA 2WD9A 3N8HA 1OU0A 3RSOA 3VR6A 3T9AA 3P2EA 4BAGA 2ZJAA 3DWGA 5KTOA 4ZT5A 3RUDA 2B8EA 1AHIA 1DRVA 2HNKA 3JWGA 4ZANA 5FTNA 4CKBA 2PWAA 4KQEA 1JILA 4RNCA 2XVZA 3LXUX 4Z3OA 2FWMX 4Z8YA 4IUCS 1XMSA 1VYVA 2RSLA 3O6VA 3O3CA 4J7XA 3VH3A 4ARUA 4FYPA 4BLVA 1RXYA 2XITA 4BX8A 2G07A 1CZUA 4OVKA 3ZE7A 2HU2A 3WLKX 2I2XB 3FPLA 4HT3B 1GG8A 4N03A 2CVHA 4ZD6A 4B32A 2GAFA 3N0RA 4GP7A 4B48A 4WKOA 5FNZA 3OE5A 3TBFA 3EA0A 2DJIA 3C4VA 3W6UA 1L4KA 3IERA 3ZJYA 4BVBA 3PITA 1FFYA 4AZ3B 1HNWB 5AJZA 2IXBA 4K6KA 2R8PA 4K1XA 5CXSA 4CGYA 4BO8A 1SIWA 4WESB 1HQDA 2C07A 4UEJA 4YQZA 2VHCA 3HXKA 3RBVA 1ISIA 4A73A 4V02A 2BGTA 3F78A 2XADA 3NUGA 3P4UA 3FOWA 2EV9A 4E5DA 3OM1A 3L04A 1ND6A 3AJ8A 1ULUA 3G1UA 3ZN2A 2CXSA 4EY5A 4F8JA 3GPDG 4Q1VA 1NAHA 4XVCA 2HXGA 3AR7A 2FMTA 2Y0CA 3FE2A 2JJQA 3GA5A 3VTZA 3U9TA 1I5RA 2OQIA 3QU7A 4UCXA 3LY9A 4PCUA 4AWXA 3EGXA 2GASA 4JI2B 1IZ8A 2V0NA 2ADFA 5K0BA 1L8QA 1PJAA 4GRIA 1NW7A 2E4XA 4OXKA 5TVGA 1YFJA 4FSXA 1DTWB 5KQLA 1KP2A 1ZOSA 5IZ4A 1QH9A 1MF7A 2FFHA 1Q21A 1H5UA 2E4VA 1OJ7A 2JIRA 1I14A 1IHDA 1S3IA 3BCSA 3H8VA 1UK7A 2WRZA 3BWYA 4LY9A 4O1IA 4R69A 1BRTA 2GLUA 3G13A 4MH0R 1KVRA 3K0AB 2VZ9A 2GAAA 3WG9A 1ATIA 1E2KA 4LDQA 2O8DB 3GARA 2VSNA 3L0PA 3HA3A 2AN5A 3QEOA 3KZVA 4OI4A 1T13A 1FMCA 1LJUA 1U9CA 3MB8A 4AB1A 5JCOA 2AT1A 2UUPA 3LT5A 3EZNA 3OQ6A 3ZU6A 4YCBA 2RC5A 3RUFA 3AHHA 1UQRA 5PGMA 3ZGOA 3ZHTA 4DJDC 5CTAA 4A0GA 3A58B 2DWQA 1K4YA 3G6KA 2QXUA 3W6ZA 1GLVA 1QH8A 2X42A 3BRSA 3B13B 2EBFX 5B58T 4C7BA 3MTEA 2UZ3A 1VRVA 3AP3A 3O26A 4K81B 4LC9A 3VU9B 1KH2A 4JC8A 4ON9A 2VR1A 3KKPA 5D3KA 4BV2A 2GN2A 2IXTA 4U1RA 5KSZA 1ICEA 1Z29A 1ZNXA 1Z35A 3QBDA 1TKRA 4DA7A 4NJMA 3BMOB 3FPCA 4E4RA 3OLVA 3W2EA 4F86A 4F3TA 3QEAZ 4MITA 2GN8A 3FUVA 1PL6A 1XCBA 1D07A 1CDEA 2XAAA 1JWBB 4D5EA 2WJZB 4LPKA 1JQ3A 4N6OA 4X1KA 3H0CA 5AH0A 5J9FA 1ISPA 3OZEA 1XRLA 3VDXA 5K0EA 1AZWA 1MX3A 3LHKA 1KK1A 1QRTA 4EHFA 1D9XA 4ENRA 4YCMA 2X4DA 3NBAA 2FEPA 1DAGA 1IM2A 2JIDA 2NU6B 4JJ6A 1I32A 1GUBA 2P9TA 5IKMA 1NR7A 3QMMA 1BJRE 1Q3TA 3G9XA 2VSOA 2X0RA 3HJUA 3OQVA 3LA8A 5F78A 2OXIA 1KQ3A 1SURA 2BMAA 2FJ0A 4X7MA 1ZL2A 3PP8A 4UD2A 2HMWA 1HOTA 4QT0A 1WUTA 1WXEA 2JFHA 2GXSA 2XYRA 4QAJA 1V3TA 1A8IA 4LOIA 1SUEA 4FYHA 1XT6A 1U8AA 4G5GA 5A4MS 4X65B 5K2MA 4P5PA 1PGOA 1KFKB 4LJAA 5G0SA 3G2PA 1I1OA 1ZGGA 1MENA 2I3ZA 2YJ5A 3T99A 2QTBA 3B1JA 1MC5A 4N65A 1YL6A 4W8HA 3H0EA 3UJDA 2XNJA 2XUGA 2ZVJA 4C4RA 2WDPA 2HFJA 5JJKA 4JOSA 5JMWA 4O3MA 2W6MA 3UK2A 4EO7A 4KDCA 3U17A 5IT4A 3ONDA 3CSDA 1X7ZA 5FF9A 4E46A 3K8QA 5EP4A 3AUKA 1I7PA 1NN1A 2QLMA 3DDOA 1RYDA 3F47A 4KWTA 4LK2A 4FZRA 5ES3A 4ZVQA 1YVEI 3RVMA 1VBMA 1ZH6A 2AKEA 2NZJA 3AEXA 5E2BA 5JDCC 3N8DA 1Z0IA 5AHWA 5IDYA 1K7SN 2OKGA 4YO8A 5FORA 1DXHA 3IQXA 4JI6B 1JHVA 4L8VA 1ADCA 4A26A 4BB5A 5BT8A 4ATNA 1R1DA 3ROMA 4AN1A 2OWDA 3IOCA 3LE8A 1SCNE 4OX9B 2ZZMA 4PLYA 2QQFA 1KY2A 5FQNA 3PEFA 2XW6A 2VDLB 3O9MA 2NVUB 4B7CA 4EOGA 3SGLA 3NKVA 1F5NA 3BE6A 3TNFA 2Z5VA 1ABFA 4RGYA 1ZNYA 4TYQA 1VLHA 1Y3HA 1QB7A 2CVZA 2PZLA 1GNPA 1PU2A 1TJ5A 3GNLA 3KJFA 1ZCFA 3NHUA 5KQSA 1AE1A 3I3OA 2HWKA 1GRRA 3BF7A 4DUPA 4ZGBA 1ZN9A 1QRUA 4J1TC 4YMSA 3RRJA 2F90A 1NIPA 2P78A 4L07A 2IHZA 2VJYA 3G59A 2ZWAA 3DL7A 3GBSA 3GJ7A 1Z0KA 5CLGA 1V11B 4KPGA 5BSWA 1HNZB 4K46A 2GD2A 2NU8A 4COOA 2HCFA 4KNWA 1BHQ1 3R3JA 3ZK8A 2CCKA 3N2LA 4URFA 4XD2A 5F64A 3ETNA 3TVYA 3R3SA 1XCPA 1L4UA 5D3QA 1S2IA 1TQHA 5FPSA 4ZU6X 3T3EA 5HQ3B 3GOHA 3I4CA 4CF6A 4PPQA 3NVAA 3BUSA 4ISCA 5CIYA 4KR6A 5HFJA 3IV7A 3PYMA 3WK6A 3T7RA 2YBDA 2O8CB 4H9GA 3I42A 4O0MA 1R12A 5L95A 3DQPA 2C2KA 4ZKDA 3ZZ0A 1XSEA 1WCV1 3OM9A 3W3AA 4NYIQ 4OGKA 1KDRA 1IJBA 4PAWA 1LX6A 2B1JA 4TKLA 4BUZA 1KYWA 2W2KB 4N47A 3I0NA 1IHOA 1MH9A 1GPAA 3T54A 2IU4A 2ANCA 4K2HA 4L8LA 2JA1A 2JHCA 1W6RA 3ELDA 3UTCA 1RXCA 1N8TA 2CB9A 3G0CA 3N3AC 4O2BF 1MB3A 2ZJ7A 3FDXA 3TTWA 2CL6X 1DC6A 3NYIA 1QDLB 3UV6A 1W8IA 4Y1GA 1TEZA 2CNDA 2D7DA 2JJ1A 4B1FA 4G5YA 2OAP1 4ENTA 4C0AC 1ZVKA 1SHTX 2I2BA 3INTA 2A88A 4RM2A 2PBFA 4FN5A 3QV2A 3RSFA 1ZGHA 2ZFUA 3RVJA 3VA7A 4I5IA 4F12A 3EQ9A 3RUIA 4Q4LA 2EAUA 4NJOA 4J0HA 4A2WA 4GSKA 5A9SB 5BV1A 5KNBA 4H31A 4MV4A 4UOZA 4RPKA 4PLHA 4WJLA 1UAGA 1R8XA 1Z0AA 2HMAA 4J2OA 1J8DA 1NI4B 4GZ6A 1CBUA 5BQ3A 2P2LA 5C5IA 4MEBA 1WV1A 3CH6A 2IBTA 3HZOA 5C1IA 4HCJA 1XZPA 2FE1A 3ZCVA 2RGRA 2H51A 2PL9A 1NBEA 1IXKA 1UMDB 3GJRA 3MT0A 3MUFA 1AGRA 3NNNA 1FDRA 4MR9A 5LLTA 4OLAA 4HH0A 4QBIA 3JVIA 3OCUA 3RBZA 2I78A 1U1IA 4ND5A 5FIUA 4M7RA 3KTAA 1RW4A 1ODTC 2HXYA 2PY6A 3GPIA 2AMYA 2IY9A 1MTOA 4I50B 4ZEOA 3T7AA 5CB4F 2GFHA 4TYYA 1Y7LA 4N5LA 2DSTA 2WM3A 1M6YA 2YQ5A 1QPZA 4G0YA 3JD3A 3PF9A 4B46A 4HZUB 4GLLA 4KIUA 2R4UA 1LSUA 2UYYA 4AXXA 1RKBA 4U8GA 4EA6A 1H3EA 3KT6A 4ZN6A 1G2PA 4QHYA 5K99A 4XUEA 1J5EB 2WJJA 4UFNA 1UOPA 3DFMA 5FBLB 1TMYA 1VL0A 2JD1A 2ZE8A 3DUFA 3JWEA 3QKSB 4GIBA 2ADMA 5KTTA 1NJSA 1GQOA 2APJA 4CQJA 2OILA 1VBFA 1Z7GA 4M0UA 3D4OA 3O8BA 5F12A 2JFBA 4RKFA 3ZHXA 1EM8A 4OHOA 1CZOA 2RAPA 2WJPA 1PUJA 3L6RA 2HA7A 2ZBDA 1ZXBA 2VBCA 1YJ8A 4G97A 4W1QA 1GGHA 1Q7GA 1SUIA 1PVOA 3VPBA 2CXNA 1IU9A 2O57A 1M1NB 3B78A 3U49A 1WZCA 8GPBA 1SPBS 2NZUG 1XJ5A 3ZBQA 3LW7A 4JJIA 1VG1A 3U3OA 3NBQA 2YMQA 1J20A 3KSDO 1OFUX 4G4SP 2PL3A 3V00A 4M7PA 2AKAB 2B1IA 4B3CA 2C54A 1ST2A 2J31A 3K09A 3P97A 1K8YB 1VL8A 4OFXA 4ND8B 3I01M 3TUJC 3FBWA 3NLLA 3WBFA 2PZKA 4C4OA 5K5EA 3QX3A 1O8CA 3A1VA 3DMTA 3QX8A 2Y1FA 1UAYA 3KCQA 1EUCB 4CMAA 2AHRA 2H0AA 2HO5A 1J1UA 4MW6A 1M74A 2NTNA 3CM0A 5KQMA 4UU0A 2UU9B 3ESQA 4OIMA 3VR6D 3MJEA 2R86A 2QRMA 3WRXC 3ETCA 3FCUB 1GZSA 3KB6A 4W99A 4CT5A 2DPXA 4X1YA 4O2BA 4EZEA 1DB3A 2H1WA 3SJ7A 2MCFA 3UHJA 5B1YA 2XCSB 2ODAA 4QUIA 3ZDEA 4KRXA 2A0WA 3MBOA 4QU9A 4BBJA 2HW8A 2FN7A 5EFOA 4TYPA 3VR3A 3E4CA 3ZE8A 5DEIA 2LD4A 1IZ7A 1Y3CE 3EZXA 4I6EA 1I3MA 1YVPA 3VAAA 1HTWA 2QNBA 2L69A 2QU8A 2W6ZA 5C1PA 3SOPA 5AM3A 4DZZA 2J5KA 3AVVA 4CODB 1L4EA 3OC0A 5BV7A 3QKTA 3L4BC 4KNVA 4EYOA 2OZVA 1V9SA 1LK0A 2PZBA 4BU1A 2AD1A 3FLMA 4GVLA 2I3GA 3W2FA 1F4PA 1R6TA 3K0CA 2V9PA 2ALJA 1WETA 3ERCA 5TPZD 3UN1A 4BGUA 1ZH2A 3BRWA 3ZWXA 3C8ZA 3DP7A 4QEZA 1SPXA 1KF0A 1JSZA 3BKWA 2VUSA 4XR9A 3VR6H 2P7IA 1IAVA 4DABA 4EQ6A 1EBUA 4MR7A 2EL7A 1FCJA 4KR0A 4O4LF 1EG2A 4CXMA 3PHGA 3S3TA 4RWEA 4E21A 1UZNA 2EG9A 1NJ2A 2IUYA 3PXXA 5CB4A 2WQ6A 3GPCA 2WWGA 3GK3A 4Q3CA 3CVYA 3AUSA 3QUTA 2HN9A 3WQBA 2Z4RA 1X87A 3LY7A 4MQEB 3TK1A 1ZG3A 2R8XA 5U9CA 5DLQC 1UZAA 4M21A 5AHKA 3VAZA 3EXFB 4BX3A 4D43A 1NLUA 1P4SA 4JROA 1L7VC 1L9KA 3HZRA 10MHA 2HF7A 1CULC 1R7RA 5JRDS 4FBLA 3GHYA 3MWEB 4AY3A 1MC1A 2ADOA 1VHWA 4CL0A 1RAIA 1N2JA 1TUIA 2XODA 1DFGA 1AB6A 2XYGA 3AERA 4ZAFA 5F5LA 2GYUA 1X1QA 4CMJA 3TSCA 2VAWA 1ZNQO 1RHQA 2DC1A 3PX3A 4QEDA 1NW9B 2IE0A 3SIWA 3L0YA 4F06A 2O8EA 3D54D 3EX7C 3NR2A 3L0CA 2O0MA 1QCYA 4UVGA 4HEA1 2D1SA 3RKRA 3PCTA 4ZOAA 2FFQA 2QQ5A 2X9QA 2K2QB 2QVZX 3E5MA 5FADA 1XP8A 3AF6A 1YVRA 3SSAA 1RS0A 2H2HA 4L4SA 4HMPA 8OHMA 3DDCA 5DLEA 2I1VB 3OH8A 4UAGA 2A30A 1YCHA 3SFTA 3ZQJA 3BDVA 3CEPB 5F9MA 3DBHA 4UE3S 3CZ9A 4KMMA 3PNLA 4RO0A 3JCZA 3HVJA 4C5BA 3V6MA 1HG1A 1U9IC 3VR2D 4MVJI 1MX9A 1JR2A 3ONNA 4GZ5A 4RX1A 3IKMB 2I22A 2YWBA 4RK7A 1UEJA 4AKEA 2G76A 5CM8B 4D79A 5JDIA 3FGNA 5IKXA 3LBIA 1LI4A 3LQQA 2I3BA 5DGHA 3KQTA 1L4LA 2DU8A 2Q2WA 1Q2UA 4BXOB 3NWJA 3ZV3A 4ALLA 5JJLA 2NV0A 3HSYA 4UUPA 1X8XA 2HDOA 1H3FA 1OXUA 1Q50A 2RHHA 4RVDA 1E63A 2QE7A 4MLPA 5E6UB 1U8FO 2QI9C 1NKVA 2VTKA 1BEZA 1PZHA 3E4DA 2OG1A 1VMDA 4W1SA 3TECE 1U0LA 3KQMA 3R6WA 4CQMA 1TJ4A 2WZBA 1RU3A 1NF2A 2PN1A 4EI8A 2VXYA 1X1RA 2FWBA 3CVOA 2E55A 4ECAA 4BNZA 1HPLA 2V7UA 4NCBA 2GPBA 4YRBA 5FOQA 1OAAA 3C74A 4HYEA 2CHVA 3WLEA 2LWIA 2YHIA 4F6CA 1Z45A 1O96B 5IVHA 4GDMA 5AR1A 1XCOA 4EBBA 1CUBA 3RK4A 3SS9X 1BMTA 3P0JA 1M8PA 2F55A 1RJWA 4XZ3A 1IZ0A 4ZV7A 5IC4A 2PMDA 4Y7DA 2ATEA 4FR0A 5TARA 1MO4A 4YT5A 5ILQA 5IARA 1F7UA 2QG9A 2ERYA 4O4LA 1KMNA 1KU0A 2SCUB 4GS5A 2BBOA 4RC9A 4LIPD 5JS6A 1T4GA 1UIRA 1KH3A 2V7PA 2A5JA 1IDN1 2W2XA 2EP7A 4ID3A 3SX2A 2H6EA 3FMOB 3CZ4A 1IFXA 2BFCB 4Q12A 3VPDA 1JAZA 5A0TA 1Z8FA 2LR0A 3KB2A 3KQSA 4MIYA 4RA9B 4BJ5A 2JH3A 4QQRA 2JBHA 1Z82A 2ZDGA 3LCRA 4HQKA 4QNMA 4DCCA 1HWYA 1NW8A 1DQPA 4L9AA 3IKTA 4YH1A 4CL2A 1C30B 3BGWA 4A10A 1Q7BA 3FTEA 1JDJA 1RZVA 2QTCA 4GI2A 4MW5A 4CBVA 2E85A 5SYAA 4JJEA 2IHUA 3KDPA 1XTKA 3Q7EA 4I1VA 4LRSB 5H3CA 1BH6A 1TM3E 5DU2A 2OUIA 1TM5E 4OOEA 1KO1A 3SOZA 4F4JA 2DR2A 5F23A 1V1RB 3LT0A 4JVOA 4AK9A 1FMFA 4UUOA 3FCYA 1LBSA 2HA4A 3UAYA 4RCYA 4WXYB 1RHMA 4RZQA 4XQEA 5FTWA 4EW6A 2VUTA 1J2UA 3D1VA 3IAUA 4Y2JA 4B4OA 2F8LA 1HYBA 3JPWA 2DMRA 4CWAA 1NJ1A 2Y4OA 5E0KB 2CE2X 1MLDA 1KC1A 3DFZA 2B69A 3E3LA 4TXNA 4ZO8A 1RWKA 1TM7E 1V41E 2H1RA 2Q0HA 5E8RA 3WRYA 4C4AA 4KFTA 2XWJI 3ZI4A 3V55A 4H6PA 1AS3A 1EYZA 4Q3OA 2B30A 5K3DA 3NIFB 5HS4A 3DOEA 4Q37A 3C3XA 4E09A 3BRCA 3W9SA 3WMXA 2F62A 1OGYA 2GTHA 4QWMA 1ZN7A 4F6LA 4EY3A 3WB9A 3AETA 4MQLA 2CKDA 3LBFA 2V03A 3IOBA 1DJMA 4OSOA 1WP4A 4EYGA 4WZ6A 3GO4A 1TD9A 3G82C 5DTEA 1QLWA 4UXJA 3WZLA 3D02A 4XLTA 5I7UA 2I54A 4OHUA 3KFLA 3M89A 4QGSA 2JVJA 3N28A 3Q85A 3I39X 1WZIA 4BNTA 3FKSA 4XFJA 1FYEA 1OH7A 4K88A 1KIFA 4R8SA 1MOZA 1ODJA 4AZ0B 2D2IA 2R8RA 821PA 1D0IA 3E53A 3HU1A 4QBKA 5AK5A 4O2LA 1TIPA 4CN8A 3NT2A 3OBBA 4B7ZA 4ZDKA 4EGAA 1I94B 3N39C 1F60A 1E2DA 1M2EA 2VSXA 4JQSA 3KJHA 5A4DA 3JARB 3P9XA 1YNOA 3C6BA 5JPCA 2P6NA 4TX1A 1SBQA 2LGJA 5KNBD 1Q84A 2QZ4A 1DXOA 1EP1B 1VDMA 4M49A 3GZ4A 4CKYA 2VNSA 3GT3A 4Y9TA 1GRNA 3O4FA 4CL8A 3HO1A 1PHPA 3BD9A 2IYXA 4XX0B 1MR3F 2X22A 3R7LA 2CCGA 3ODPA 4BFVA 2A9QA 3DDHA 1H85A 5KHAA 5BQFA 1J2JA 5HQTA 1EWTA 5EKXA 1A2QA 4Q3DA