5LL6P

Structure of the 40s abce1 post-splitting complex in ribosome recycling and translation initiation
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
206
structure length
206
Chain Sequence
SLPATFDLTPEDAQLLLAANTHLGARNVQVHQEPYVFNARPDGVHVINVGKTWEKLVLAARIIAAIPNPEDVVAISSRTFGQRAVLKFAAHTGATPIAGRFTPGSFTNYITRSFKEPRLVIVTDPRSDAQAIKEASYVNIPVIALTDLDSPSEFVDVAIPCNNRGKHSIGLIWYLLAREVLRLRGALVDRTQPWSIMPDLYFYRDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 18S ribosomal RNA
publication title Structure of the 40S-ABCE1 post-splitting complex in ribosome recycling and translation initiation.
pubmed doi rcsb
total genus 44
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2016-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00318 Ribosomal_S2 Ribosomal protein S2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 5ll6P01
3ODPA 2UXDB 1XMOB 5A2QA 3J80A 3PR3A 4JV5B 1TZCA 4X62B 1N36B 4LF6B 5LMNB 4S1WA 3JAMA 1TK9A 2ZM6B 4GKJB 3TBFA 2A3NA 1MOQA 1KOJA 1U0GA 1MOSA 2DF8A 1IRIA 1HNZB 4S12A 2CVPA 1M3SA 2PUTA 2UXBB 1T10A 4DV5B 3LJKA 1JXAA 3KNZA 2E5FA 1FJGB 4DR6B 4M0DA 3QKIA 4X64B 2Q8NA 4DV1B 3C3JA 3M5PA 2J6HA 1HM5A 3JX9A 2CXOA 3FXAA 4NXNB 3SHOA 1IBMB 1U0FA 4JI3B 2POCA 1I94B 2VF4X 4JI1B 4OX9B 2AMLA 2YVAA 1Q50A 1IBLB 1NUHA 2ZJ4A 4YHHB 2O2CA 3OTOB 3OOJA 4LF9B 2X3YA 2UUBB 4B3MB 4GKKB 3FKJA 1GZDA 2UUAB 2DECA 4TOIA 2UXCB 1IBKB 1ZZGA 1N34B 2CXUA 4JI4B 2PUWA 1X9HA 2CXQA 4JYAB 2F4VB 1X94A 4JI7B 4LF7B 4DV6B 1U0EA 4U6NA 2CXPA 4DUYB 4JI5B 4X65B 2CXSA 2CXTA 3FJ1A 3IFSA 4DV3B 5FLXA 1VIVA 2VF5X 4DR4B 1J5XA 1J5EB 1XTBA 4DR1B 3TRJA 3T1HB 4LZJA 3J7AC 2CXRA 2CB0A 3FF1A 4YY3B 4DV2B 3Q7IA 1HR0B 4B3SB 3T1YB 3ETNA 2XBLA 1X9IA 4EM6A 1DQRA 2E5LB 1TZBA 4JI6B 5LL6P 4DR7B 1WIWA 3EUAA 4LF4B 4LFAB 4LFBB 4DUZB 4DV4B 4AQYB 5BY2A 4DV0B 4JI8B 1G98A 1IATA 1VI6A 2I22A 4AMVA 3HJBA 2I2WA 5BR8B 2CXNA 5IT9A 1B0ZA 1XNRB 5I01A 1GZVA 3HBAA 5IWAB 2PGIA 3BJZA 3Q88A 1HNXB 2VQEB 4LFCB 4LF8B 4DV7B 3J81A 1HNWB 2UU9B 1JIQA 1VIMA 4KHPB 1N32B 4DR2B 5LMUB 1NRIA 3BCHA 4JI0B 2ZJ3A 2V4MA 2PUVA 2O2DA 1MORA 2WU8A 3CVJA 3I0ZA 3NBUA 4B3RB 1C7QA 4K0KB 4DR3B 1C7RA 4NXMB 1HOXA 3UJHA 2HHHB 1JLHA 2XHZA 4LF5B 4JI2B 1XMQB 1X92A 1JEOA 4X66B 4DR5B 1N33B 3G68A 2VQFB 4IVNA 2UUCB 1XNQB 1VI5A 1N8TA 4B3TB
chains in the Genus database with same CATH superfamily
2IYXA 3D3JA 3I9NA 4N39A 2NPOA 3SN6A 4FKZA 4AJ4A 3K70D 1F3OA 1QORA 1ISIA 3SYLA 4WOJA 3DC2A 4Q4HB 1T35A 4I3HA 4IGFA 5A3SA 5AI5A 3WNCA 5LQJA 1EP2B 2CMKA 3CB4A 3KB8A 4OAQA 3GIWA 4QEKA 3ZHXA 5HSGA 2RHWA 2ZSBA 5GJCA 5KNBA 3RIXA 5JVDB 2NTJA 3OJEA 3BHIA 2LNDA 1MOSA 4DEYA 1XCBA 4ZMSA 1FXWF 4G4SP 3URKA 3ZXIA 2PUGA 4JBYA 3JU3A 3L6DA 3KCNA 3WQSB 4ZVVA 4WL0A 3LBHA 3WOHA 3ASYA 4KO1S 1QQTA 4LBYA 5ULLA 1R4NB 4ON9A 3SKVA 5E38A 3X1MA 9MHTA 2J6HA 4ZAFA 1T13A 2G9QA 2YFQA 5DU2A 1DNPA 5ETJA 2DUNA 3DL4A 4P86A 2BGMA 3EASA 3KVVA 5A6SB 4QJIA 2ZRMA 4I9FA 2GYUA 4QRHA 1VYHA 4AT1A 2OHFA 3E7FA 3T4EA 3OZXA 5I9MA 2OBNA 4CUJA 1TA4A 2D1SA 1GGJA 4HWOA 1A9ZA 2DLNA 3LM8A 3U3JA 2Y0CA 1Z45A 1A4RA 4NEHB 4Y9SA 4KREA 4KNYA 8MHTA 1ZRNA 1CR4A 3KR2A 5AJHA 4D8TA 5JOQA 1QQBA 4CMJA 2PJUA 3DVQX 4NZZA 3HA5A 3SMQA 4UASA 2ZRLA 3NETA 4KWIA 3S99A 4EG6A 4UMFA 4GRDA 4CLHA 1T9BA 4K9QA 2J3JA 3GEBA 2E2WA 1R6TA 2VYQA 4Y2QA 4YEDA 5IJ0B 3KPJA 4NJEA 1A5ZA 1QZ3A 1TJ5A 2EZUA 3G02A 4FR2A 1Z47A 2VPYA 2JH9A 3LL4A 4MCHA 3VJRA 4IX1A 5DN6D 2P1ZA 4RH0A 5FHQA 4B3HA 2V7QA 3AW9A 5H0IA 3DZBA 4D9JA 1PCXA 3DTVB 2FH5B 2RGNC 3GRCA 4G0NA 1COZA 1P4JA 4AG5A 5L4SA 1JDTA 4RBNA 1I1QB 2CD9A 4AW9A 5ICMA 3I9V1 1ORWA 3TTXA 3BL5A 3T5GA 4DCMA 1L7XA 2CHFA 4XDZA 3W78A 1HKUA 4MV0A 1SUCA 2CB0A 3SLGA 4I1OA 4HAZA 1OU0A 2QG9A 4FKBA 3I3OA 2Y93A 3ABQB 3FI0A 1VSQA 3P9QA 4PS0A 5TMDA 3CJQA 1ZH6A 2A9KA 5EPOA 2VJYA 3GA5A 4LGYA 2PQ6A 1CQXA 3GCWA 4MZDA 3DP9A 3QPAA 4LBZA 4R5MA 2WP8J 4LOAA 1QGYA 2PMCA 1WD5A 3IHLA 3O4HA 3AXSA 2W6JD 2WSBA 3ZHZA 4YMVA 1RHRA 2QSZA 5ELMA 3ZKAA 4B4DA 1YFKA 1RXSA 2LIPA 3M6LA 4PQYA 3NHFA 4WDQA 4BFVA 4EI7A 2X1HA 3S2GA 7REQA 3I62A 4KMSA 4P4SB 4ANFA 3RVRA 2PV0A 1KEVA 4XR9A 3FOFC 3Q7QA 3ROXA 1S2LA 1THTA 3OPVA 4EYEA 4CEIA 1QZXA 1NDUA 2WHPB 4BZWA 2PG3A 3NASA 1VYTA 1DV1A 3QVKA 3U81A 2CLFB 2YUIA 3IKVA 3JWIA 5D86A 4ZIRB 4IYRA 4ARIA 1PBTA 2FN3A 3MFQA 3VOSA 3C70A 1JW9B 1XC7A 3I53A 2JGLA 1Q0QA 3N1UA 3FNGA 3QKSB 4UATA 4Q9KA 2CEKA 4BNZA 4GBED 4I08A 4UTXA 4RO0A 5KNCH 3GDWA 1U0OC 1KIAA 2AJCA 4NCIA 5TQ0A 1EWQA 5FNVF 1URPA 3Q7PA 4PIVA 1PJLA 3E3MA 4LQDA 3F73A 2I91A 1U0GA 1H5QA 3ILXA 3QVSA 2HMWA 3TLAA 3UGTA 2E4ZA 4XQ9A 4B82A 4ESHA 1E2GA 2H29A 5BT9A 2X19A 3ENVA 5ARCA 5F5XA 4ZPJA 3SIRA 1SCBA 1X1SA 2D0OB 2JJ2D 1IVYA 2YZ2A 3G0DA 4CKEB 1YIDA 1S1CA 4I6EA 2PXCA 5TS2A 1NDQA 2XY4A 3QUBA 3W3AD 5HZGA 1WD7A 4DUGA 5KOYA 4EBBA 5GM1A 2NZJA 3F97A 4UHDA 2I6XA 2QL5A 3T3MB 3U3XA 1JR6A 1RRCA 2MSDB 5JYBA 4HRVA 1CFJA 3OTIA 3HL4A 4M7OA 4E3WA 4B3MB 1UDCA 3NO4A 2V3WA 1YRWA 1DXHA 4H4CA 1OIXA 2ZXFA 1QV7A 2BFCB 2REXB 1PQWA 4TROA 1FRNA 2YJZA 3QXHA 4MICA 2XAUA 3AV3A 5MFZA 1S89A 3M6VA 1OXMA 4Q4AA 5B1SA 3VDNB 2QAGA 3UMJA 3AI1A 1NY6A 4GT1A 4CG3A 3N3AC 4F38A 4ZZ0A 2IRWA 3LKBA 3TMAA 3UMCA 5DK6A 5E9WA 1RC0A 4W7SA 3VDRA 1HT3A 2ZRAA 1VIDA 4RF2A 4EKIA 3GJRA 4LYEA 3SC6A 5B2FA 1GFSA 1UBFA 4X20A 2CDRA 1E6LA 2GZRA 5TPZD 1QH9A 5E6SA 4D02A 1P2TA 2G5TA 3E7DA 1G55A 2P0AA 2R3SA 4GMGA 2R0QC 2W2KA 3HY4A 1G3QA 4EYQA 3SZOA 2IW3A 5LQDA 1T0PA 2VSOA 2FF5A 2ETVA 4WA7A 1F5NA 1G9TA 1M73E 2P0YA 3OECA 4MPDA 2OA0A 4E70A 2YDYA 4WJZA 2IXAA 4AVYA 1KU6A 2JFWA 4W1QA 3X1JA 4CI9A 2GBFA 2JHGA 4LGMA 1K27A 5FBWB 3ROQA 5BWMA 2Q4BA 1IHPA 1NVMB 3OBIA 5K0JA 4DV4B 5IMBA 2ESRA 1VDZA 5ALGA 3GG9A 1D5CA 1KMMA 1S2OA 1RWMA 2PT9A 1U9JA 4C87A 4DDWA 3N2KB 3HN7A 1TU3A 1XR3A 1XSEA 4J4HA 1W4AA 2Q5LA 1PJSA 3GOHA 3BFPA 1NVVQ 3WIEA 5TVGA 1U6JA 4DSOA 2OAP1 3MSCA 1NFFA 2B4KA 2FWBA 2Z6VA 3VYSB 2YWRA 3MGBA 4O2BB 2GWHA 3PITA 4FNAA 3TRIA 3AVOA 4UPDA 5DO9A 4MX8A 1KKUA 5AXCA 2II6A 1UZUA 2QAIA 4WY2A 4XDYA 1JP7A 3UB4A 3EQ7A 2A33A 1E2DA 4G4SO 3HMQA 4CQMA 4TKMA 1VBKA 1HSOA 2QY6A 3IVXA 4QTYA 2PUVA 3NBUA 3ZBPA 1Z82A 4KQGA 4ZV7A 1UT6A 2B9VA 4R3WA 2PKRA 2VWPA 3MBOA 3W5BA 4CCSA 1TM7E 2DAPA 3M2TA 3AKEA 2GCOA 3RUAA 2X0EA 2FMFA 3LXXA 1MP0A 5EIEA 4Z51A 3HDHA 1QYIA 4FBLA 1EJ0A 2O05A 3D7SA 3STHA 3U3MA 4DR5B 4MEBA 1T5SA 1E2MA 5IJZA 1E1KA 1F51E 3CGWA 1LF0A 3F47A 3L0OA 4FTWA 1AKWA 2X58A 1U8XX 2R5NA 3BH7A 4B84A 2GHTA 1UAAA 3DLCA 6Q21A 3D7KA 1L1FA 1F4PA 1UXHA 2ZSDA 4E14A 4Q4LA 1P80A 3SQNA 1VRCA 4IVQA 2J41A 3PHCA 4WD3A 1UQTA 3HP4A 2Z2XA 5CU7A 4DXAA 4PN7A 5IEJA 1T2DA 4CT5A 2WYOA 1W94A 4XM2A 3VBEA 1Y7IA 3OCCA 4NP6A 5EVJA 4N48A 3QVOA 3IGFA 3VX3A 5HIMA 2E4VA 5NULA 1MJHA 2JAUA 4X90A 4EI9A 1IBMB 1IN5A 2Z08A 1G8JA 2W2TA 2CUNA 5DNCA 4MI6A 4XQEA 1XN4A 4U7DA 4DPMA 4ZGGA 3RHFA 1UDXA 3KJFA 3RTCA 1GGMA 1AKQA 4BX9A 2VT6A 5KJ1A 4J1TA 1CUYA 2V7XA 3V3TA 3ZIDA 1HL3A 2K4MA 3BFKA 2C04A 3BJMA 4JUBA 4RFSB 1C0KA 1HWYA 4AUMA 3HM9A 4KXMA 1R00A 1V5WA 1ES9A 2WUGA 3IE0A 1G59A 2EV9A 4LZPA 2NNWB 1MJGM 3BMNB 1S8OA 4YT8A 3QY9A 3JZAA 3PUYA 5HQJA 3W1WA 3WR5A 1AO0A 4JYZA 3KG2A 5JYCA 2FQXA 6YASA 1BQ4A 2A3RA 3L92A 4BVAA 5JCXA 3FPFA 3MJSA 1DO8A 3HB9A 1IB6A 5FLEX 1UC8A 3B9QA 1HZZA 3N7UA 2FZ4A 5CA0A 2WIKA 1J5XA 4E07A 5C51B 4ZTUB 1XROA 1IJFA 3VC2A 3IQIX 5BSGA 1ZC4A 4EYSA 3BTOA 5K45A 5E9AA 1KNXA 1N7HA 1Z6YA 1I3KA 2Q3LA 3E58A 1XNGA 4GOXA 1KEEA 1CK4A 3P9XA 2BFPA 3GLFE 1XTSA 3I1YA 3R75A 2G7MC 2RKBA 4EW1A 2G4VA 4H59A 3AU8A 1VCHA 1L7NA 2E4AA 2VDUE 1EDEA 1RPTA 2Y1GA 3MB8A 5AKJA 1KFCB 1RXEA 1IJKA 1ATZA 2CFIA 4FC6A 3SQOA 2C8KA 2IEZA 2OAGA 2R1UA 4L4SA 2N1MA 3R7DA 1U63A 3LF2A 4QYXA 4Q9AA 5BSKA 1VJDA 2Q3MA 3AGQA 3LPMA 5A71A 4FFLA 4XXHA 5DYYA 2Q1UA 1SUAA 1ODJA 5FUMA 3RSCA 1VKHA 1PQ4A 4YRGA 4YR9A 1LTHR 2GXSA 3FCYA 4D82A 1P0MA 3KZMA 3E3AA 4ZV9A 1E0KA 2B9EA 5BSEA 4EAQA 1PHPA 5AVRA 4BCCA 3EGDA 1JQ5A 1ZN2A 3OE5A 5DI3A 2FB9A 4IYJA 4O4IF 1JLHA 2NAFA 5DNEA 2G36A 4L0CA 2O8DA 1D03A 3L01A 3R8CA 2WJJA 4MUEA 3VMFA 3HPQA 4Q7QA 1L3IA 3AVUA 3DVAA 3G2NA 3SVTA 1G3IA 1LGYA 3W6UA 3DQPA 4FYWA 3IQWA 4YRBA 4GOLD 2O4UX 3F3SA 1IL0A 1G8GA 2WE7A 4RZ3A 4EW2A 4IDNA 2P6NA 5D6NA 5LLSA 4HXFB 3R9KA 3PI7A 4XW2A 4B7AA 3DE7X 3OPYA 3QTLA 3I5UA 1N5IA 1FS5A 1P1RA 2AZMA 4E5DA 1TDJA 3PA8A 1GQFA 1L4UA 4CKZA 1TJPB 5J40A 3RT9A 1F9EA 1ESDA 4HFMA 4FE3A 3WLRA 2FJUA 1EGAA 1WXGA 1YK1A 3G89A 5FLKA 3CE9A 2BCJQ 4N3NA 4ALMA 3QEJA 4CV1A 1W59A 3M5PA 4UHEA 1RC8A 3I32A 2PUFA 1ZZEA 3OTWA 5JAHA 2REOA 1UPUA 3BFXA 1EWYA 3GLHB 3ZGZA 3SYTA 5AW8A 4L3VA 2IV7A 3LUHA 3Q3CA 3PWZA 1R16A 4U3JB 3QSYA 4Q16A 2YV4A 3FJOA 2OV1A 3M89A 4RJLA 1BKSB 3C3PA 5IDWA 1YU9A 4UU8A 2OILA 5CURA 4IIUA 1RPAA 3AEQA 1JLSA 4RIEA 4MR7B 4ESEA 1YRBA 3IE2A 1KDZA 2ZGVA 1NZFA 5IKPA 4HATA 2O8VA 3QXCA 3AWDA 3QFTA 2M6KA 2GT1A 1XLTC 3FETA 3T1VA 4HEHA 5EQFA 1VRWA 3COZA 4ID3A 5CVJA 1M1YE 3WKDA 5K2MA 3MINB 4KITB 3GVIA 1E96A 4WI1A 3S2FA 2JFUA 1M2EA 3OEWA 1UEIA 2Q6IA 2DTDA 3MF4A 2EP8A 4AJEA 2JL1A 1XCGB 3AO0B 1JSRA 5EP2A 1OX4A 4KG7A 2BGGA 4BVGA 3KB2A 2LBPA 3I30X 4Q7JB 3OQHA 1H2FA 3RV3A 2HNBA 3RPEA 4F7DA 3VPAA 2I99A 5JE8A 1QMGA 4ARZA 3JAKA 4AS1A 2CEAA 3MILA 5JANA 2E89A 3EC7A 1GLNA 2OZKA 1BD3A 1U7PA 1RU3A 1H8HA 4IIFA 5CVEA 2O3JA 2ES4A 3IR6A 1E7WA 2G9VA 3DB2A 1WSBA 2WJYA 4QXAA 4HPWA 4RE5A 1PJBA 1FMFA 4FMDB 1X7ZB 1C80A 2V59A 4IW3B 5ELXA 1KP2A 1Z28A 1RQ2A 3LX8A 1RAAA 3ZHTA 3L1VA 1LLUA 1Z0ZA 2DBQA 2ISCA 2Q2NA 4D25A 1F6WA 3ER8A 3IP1A 5FL3A 3RROA 2H63A 3PP8A 2V5AA 4N7JA 4NQRA 4AURA 3HHPA 4C4SA 2PMBA 3AUYA 3FA2A 4UU7A 4EFKA 5KCZA 3LUDA 2VKTA 1Q6YA 2EJVA 3A3YA 2P6PA 4M8IA 4MI3A 2AG6A 3FUCA 4GEGA 3RKRA 3WGIA 3CFYA 4KVAA 1X7XA 2JLUA 2O6LA 4NCXA 4US0R 5HDBB 1ESZA 2QZ4A 3CC8A 4FFBA 2PSDA 4Y2SA 3ZHCA 4MVJF 3AERA 5DBEX 1Y81A 4XCXA 4HDKA 3VR4A 2PH3A 1BFUA 4QFBA 3GWGA 1YWGO 3EOZA 1J8VA 3N39C 2J0QA 4PSAA 4S2UA 4WXYB 4BB0A 3COPA 3UPUA 5E1OA 5B1YA 3K0HA 2AV6A 2O7QA 4PRLA 3MMSA 3E27A 1YBFA 3QKWA 1ZIOA 2IOFA 4BNJA 1UM9A 1XNJA 3HWSA 3N5CA 4KPGA 4WGGA 2B35A 1MEEA 1NF2A 4X0EA 1DFGA 8GPBA 3FGOA 1AUVA 2HQ1A 2IHZA 3JZFA 4IQGA 4REMA 4TL8A 1EJ2A 3BD6A 3WLQA 2HQOA 1XRQA 3NT2A 2WMYA 3LIIA 5E9QA 5EKTA 4EY3A 5TIIA 1N36B 5FPSA 4ZVQA 1PD1A 3S1SA 1VTKA 3QJYA 1XELA 2BFWA 3ORRA 1J9GA 4GSKA 3EXEA 1PWYE 1E1CB 2EL9A 3RRZA 3V4ZA 4M1MA 5IP5A 4LKRA 4GPTA 1HGXA 3IE1A 2DBRA 4KR6A 5GONF 5HFAA 3T94A 1MQAA 3ESXA 2GH1A 3KNZA 3KDPA 3OZCA 5FWYB 3DQZA 2PZKA 4RXUA 3R8XA 5HS4A 1E77A 2ZBDA 1Y3BE 5B37A 4D5GA 4JVOA 3QMVA 4W5NA 2YC4C 1OTYA 3HRHA 3ZJTA 1DX6A 4NXNB 1UKZA 4IWYA 1BO6A 3SNKA 1WDKA 2ZJOA 5F9FA 1Q0LA 4HVLA 3ILSA 4BLVA 1JKIA 1QKKA 1IZ0A 8LDHA 5GZ1A 3NOOA 3NOXA 4PY2A 2I66A 2EIHA 2OMEA 1P9NA 4KAAA 1NVVR 3OMWA 2UVPB 4ZEVA 2DWCA 4F3YA 4ENUA 5GTDA 2OC9A 4HI0E 1RE1A 4UFNA 3B1XA 5JDCC 1EIWA 4WKGA 3K1AB 1I33A 4WOKA 5KTYA 3GD5A 1ARZA 2GR9A 2ZWIA 2Z43A 4S0XA 2WM3A 2DY1A 4C0XA 2QW0X 2CW5A 2QX8A 3DDNA 2Z8XA 4YUVA 2YVUA 5CCEA 1RYFA 3LP6A 3F6YA 2LV8A 1F14A 1NXSA 3TW0A 1L1QA 3TRFA 4GO1A 1P39A 3QU2A 4JLWA 4DV6B 1RCFA 3U7GA 2HFKA 4CG2A 3BXGA 1B8UA 5FOXA 4G6ZA 1ZN8A 5B57C 5K3FA 1Z9BA 3ETCA 4PC3A 2XB9A 4QDOA 5ER9A 4DARA 3ZY2A 5FLXA 4KFCA 3OX3A 2QT1A 4BY9E 2C0QA 1FW8A 2W6QA 3HYNA 2FUG6 4PYQA 4HZGA 4YJKA 3RFFA 4F4DA 3OIUA 2EGUA 4H6PA 1UINA 4RPJA 2QRGA 4X44A 1O87A 4I99A 1Q0RA 1GZ7A 1P61B 4PPYA 2FA9A 2ID4A 3T06B 3VNBA 1XEWY 1XXHB 3TL6A 1R8SA 2FQQA 1GV0A 1XKQA 1E9RA 3EQ9A 3PFWO 1PWZA 2J45A 4LK2A 5TV2A 3PDCA 5AFSA 3AG5A 4K40A 2JGRA 2X8BA 1LDGA 1ORDA 2IHJA 5ALVA 1GUZA 2XYVA 3EARA 3T15A 2NXWA 3BEOA 4P93A 3HFRA 4KQ2A 1DCKA 1KMHB 1L0BA 3LHKA 2EGGA 3A05A 2CLLB 2VQEB 1JLKA 3WYCA 2H1CA 4I5GA 3A9WA 1YVEI 3PC8A 3PL1A 3QXGA 4LZWA 3UA3A 3GLIA 3GMTA 4HBGA 4P92A 1HTTA 5F33A 3TSAA 1ORTA 1P2BA 3I45A 4HNUA 3ANYB 1W9HA 1UMBB 1AHNA 1NVWQ 4HQ6A 4O63O 4U9HS 1W4CA 4EQZA 4CL2A 2BEVA 2VZ0A 3I8SA 4FVTA 2RK3A 3N2NA 4DT1A 5M29A 2TS1A 1Y3CE 1Q11A 2WIJA 2WMOB 1DTWB 3BRSA 3EH2A 5IZ4A 3UWPA 1TYDE 3DYVA 4RM3A 3KVYA 4A5OA 3MJTA 1C9EA 1SOWA 2NXEA 4Q3LA 5I9TA 4RTJA 4TMVA 1HRKA 4EY7A 4H7EA 2UUCB 1KOGA 2GKOA 2RG1A 3MERA 1T0JB 1XL1A 2PSEA 3QVJA 5JH7F 1NF8A 3ZZMA 5MHTA 4BYGA 1DGQA 3O4RA 2RJNA 2VNSA 1Z4QA 1DS6A 3GRAA 2ADOA 4FT2A 4J91A 4NC9A 4NOMA 4Q7MB 2JAWA 3NTRA 5IBPA 4PQFA 3V2HA 1CP3A 1EESA 1WXWA 3BRWD 3LC7O 4HGYA 1C7IA 2O9JA 4P5DA 4RPHA 5E7QA 3SF8A 3JWJA 4A6PA 1VLZA 3C6BA 1C1HA 5TMEA 4CM1A 3KV1A 1IONA 1MGPA 5ICFA 2V65A 1SXPA 2FZVA 2ZI4A 3QI2A 4IOKA 4Z4FA 1RBMA 4EG5A 3OC6A 4QODA 3RRJA 3JZIA 3VR5A 3LTNC 1M0SA 1WEHA 4ZRNA 3R1IA 5TEVA 3CX3A 3THYB 3OZWA 3K2QA 4XR4A 4UU0A 4Z9AA 4E2FA 3F5QA 4R1TA 2O59A 4ENWA 3KZ1E 1T9DA 2CYCA 5E7MA 3UWSA 3UMVA 5HF6A 3VHXA 3PNLA 1U28C 1KO7A 3RADC 3BA1A 2YJTD 3WQBA 4Q7EA 3PKIA 4CODB 5JRJA 1IZYA 2YWEA 5REQA 4BO9A 1VLVA 4X1YB 4A6DA 5L4NA 2Q3FA 2VTBA 1CDEA 4CUKA 5DCLA 2UXCB 3GQBB 3VC3A 2WUFA 3FOEC 1GUDA 5IS2A 3H42B 4RQUA 4ERXA 4UD6A 4OOEA 5AO9A 2VZLA 4ESOA 5FTNA 3NATA 1WDTA 1XDWA 4DCVA 1KORA 5BWOA 1NNSA 1W19A 2UVDA 1T6YA 4QOHA 3TQTA 1EFLA 3TNYA 5B4UA 2GD0A 4KGZA 4ZYUA 3W4JA 3IAS1 2JIRA 2JVKA 3O8DA 4KFUA 3S1LA 1SPXA 4JLPA 3V8EA 2O8BB 4PQRA 3L0PA 5D8DA 1V37A 1Q19A 4K9NA 2I78A 4OHRA 4N8SA 2GFIA 2P1RA 4HEJA 3GLSA 4OL9A 1DQRA 1BWSA 2CWDA 1LH0A 2DQKA 2F8LA 3IJPA 4IUCS 1FTNA 4O5OA 4A2QA 4F5EA 3D6VA 5SYMA 2W2VA 4OUKX 2MMGA 1G4HA 1RAFA 1G98A 2ADFA 5M5BA 3T7AA 4ZCPA 4UAUA 3JQ6A 1BE0A 3HV0A 2GPAA 1PZXA 3HNOA 1YS1X 4GNKA 2ZBPA 3LLCA 5F2EA 2XUOA 4DBVO 2VDQB 3CZPA 1YU6A 4EITA 1ISMA 1TAGA 3CEHA 4HAIA 1MO3A 3O8NA 4GR9A 3BK7A 2V8BA 1DAIA 3OFVA 1HRDA 2GK4A 4G2NA 5FTMA 1LBSA 2XQKA 5C18A 1IJBA 1NFRA 1HMYA 1LPAB 2Z4RA 2G9UA 1CUVA 4DV7B 1GTSA 1SU8A 2B2CA 3KL4A 3LSTA 1M6YA 3P52A 3F78A 3QVLA 1KSGA 1KZHA 5JSZB 4X1IB 5H9VA 1YL5A 3U3DA 1XK6A 5KTPA 2DCUA 4UQPA 1KK1A 1YACA 2WM2A 3AI2A 3C45A 3EXFA 3GCDA 4KIJA 5L6MB 1EUYA 2XUFA 2B4AA 2O19A 1HDRA 4C2BA 3H05A 3D8SA 3IEUA 2QNBA 2NNLD 2PN1A 1V16B 4G56A 1VP9A 4F4JA 2UAGA 4EEZA 2J07A 2MT9A 4DF3A 2PMEA 1N8TA 4S35A 3Q8MA 1PP4A 3AHEA 4RGBA 2LGJA 5C8YB 4I5IA 2FWNA 4XWKA 1U7OA 1PLKA 4JOQA 4PZ0A 2V0GA 1YHZA 3OP4A 1FDVA 1KBZA 2J30A 5JEEA 3WGHA 2RFLA 3UJDA 2EF1A 2CF5A 4AF6A 3B12A 1I7DA 3GCXA 3KC2A 1NT4A 1H0KA 3JQ7A 1S4QA 1OHHD 2BBSA 2CVZA 2QUIA 3ELWA 3JY6A 3OM8A 3U37A 3O8QB 2OCAA 5A1TA 3VO9A 3EZ7A 5BSFA 3FFAA 3PXXA 3D5TA 1TVKB 4A8TA 3GJYA 1P75A 1I8TA 1LPPA 2F3TA 4R1UA 1OH7A 2OBFA 1OXKB 2P9BA 2FPSA 2IZ5A 4W4TA 4QO8A 2VZEA 3FWZA 1RNLA 5H82A 3R3YA 4FYKA 1I3MA 4MMXB 3HXTA 4IILA 4E2XA 4JI3B 4J7CA 1KBOA 3NHAA 5BSRA 1C3LA 3G9UA 3F6SA 1G63A 4CMKA 2ZR7A 4P2GA 2WWYA 4KQEA 3RV4A 5DGTA 2H1HA 1PNQA 2V7WA 2O2CA 1U7WA 3L8ZA 3SEZA 4BNKA 4DSZA 4U9IS 2XB6A 4HB0A 4YUWA 5K99A 5C53B 4LF9B 1ENYA 1PEAA 2X0RA 3SZMA 4MQFB 2R7KA 4HDRA 2P6MA 3FAKA 1CVLA 3SVLA 5F2KA 4LDRA 1JKJA 2A9FA 2QUZA 3Q7EA 2OPBA 3ZE9A 3H04A 4Y2TA 3SFZA 4IS2A 2IPAB 1L5ZA 2GCIA 1YC5A 4D8XA 2ZXEA 5EY5B 5TB5A 2ZXUA 1U6IA 4RVOA 3QLEA 4KV9A 1KYQA 2RI1A 4PGGA 3TLBA 3RTEA 3NX4A 1BNCA 5MFPA 2HCBA 5BN5A 5ED4A 3WSWA 3TVDA 1DTSA 3IHWA 4O4JA 5KPJA 2VJQA 3IJEB 2B99A 3FHCB 3D4NA 1N2CA 1KJZA 2IY8A 4L57A 5JSKA 2FMXA 4DZRA 1GUAA 3ASZA 1CY2A 2D7CA 4G85A 5KQGA 1Q1GA 2RD2A 4ND1A 4GEKA 2FSVA 4P7KA 4PF1A 4GLJA 1Q44A 4OHOA 3UFXB 3DMPA 2V74B 2HA0A 3VJLA 4QHTA 4RVNA 4TQ9A 3ZDDA 3KXIA 3P5SA 4WK6A 1ZRMA 5K3BA 1TECE 4FC7A 1YJ8A 3CVYA 5GJBA 2DCMA 3BZWA 4O2AF 2P7HA 5HF8A 2LCFA 4B2IA 3VH1A 1P7VA 1JXOA 2GPJA 2X1VA 2Z57A 3AWIA 4YDRA 3W2EA 4G23A 4Y1RB 2A94A 3WXBA 3QEOA 1XAIA 3ZQKA 2PGIA 2OR3A 1GZHB 3MT7A 3RYFB 4DEXA 2HSWA 3TEJA 1U5AA 2XE4A 4OHYA 1TLFA 3ANNA 3KAPA 3R9IA 1E6KA 1VFNA 2Q8QA 2Y1OA 1QNLA 2ZRJA 3EZNA 3P26A 4PFSA 3RHZA 1E9CA 1PR2A 1JKMA 5E1DA 1HO3A 3QVWA 1QRSA 1CQIB 5DYTA 4Q3EA 1C9JA 3LL7A 3KOXA 3R0QA 1HETA 1W75A 4PLPA 2FFHA 2I6SA 4YQEA 3TTYA 4ZARA 1JL3A 3PC6A 3AFGA 4F86A 3BWYA 2I71A 3TLMA 5ARDA 4URHA 1R6UA 3BK1A 1PT5A 2Q3EA 1S9DA 1DJPA 1I3NA 4NECA 1YR7A 5LBTA 3EVAA 1DSSG 5KWSA 3IV9A 4K6FA 4DJAA 3DDOA 3BHMA 1U2GA 2AGVA 1YVUA 4CM9A 3NGXA 4PG5A 4KQHA 4EX6A 4MB0A 1E3MA 5CBPA 4EUNA 4TX1A 4YPFA 1UR5A 1KARA 2P4SA 4IF6A 4KLZA 4KSCA 3KVNA 1FCJA 1GKIA 5DXAA 4NOKA 1G6HA 4CF4A 1PWXA 1TUEA 4MVYA 4TXNA 1PYOA 2IDZA 1P5RA 2W48A 4WA8A 1F8GA 4QEZA 3BDAA 1G20E 2QD4A 3LVBA 3MCTA 4JLOA 1QFYA 1N9ZA 1KPGA 2P9JA 5FKJA 4ECAA 2BYTA 2CDCA 3BF8A 3UJHA 3D8UA 1RHQA 3C6KA 3CRW1 2EERA 4N01A 2R1VA 1NJ1A 1NBME 2FSIA 4EY8A 1TT5A 1UODA 3DBRB 4X91A 1ZNZA 5LBIA 1D2RA 3WYAA 3GZJA 1AF7A 4HEA6 1MW8X 3H9EO 2VS1A 2ZE5A 1BMFA 2FZWA 1V45E 2P3LA 1U0TA 4KN9S 4QTZA 4KGDA 4ZVMA 2XR1A 1JHDA 3AH8A 4H7FA 5COBA 4ZOQI 5THXA 3FCSB 2FN9A 2CVFA 4IUBS 3ZWDA 4FEGA 1KZ4A 1HI9A 1Q2XA 3TDKA 2NYUA 5C3MA 4Y9TA 1YB4A 5HK8A 3OZSA 5EAIA 4R0NA 4E5PA 3ELBA 2B20A 3H7IA 3CUYA 4LC1A 1TAQA 3EWNA 4DQ0A 2PCJA 5BT8A 4JK3A 5LC1A 4L8YA 1QUEA 2Q5CA 4PG7A 3T99A 2B8TA 5B7GA 1WDWB 3R74A 3TOSA 4TMWA 1E2JA 1OYWA 1I0ZA 4RF5A 2CXXA 3HVKA 3M9WA 4XX0B 2GX6A 2ZAGA 1YDMA 4LBWA 1G8AA 1ZJZA 3FOBA 4OHMA 4TZKA 4ZCLA 3NTXA 3T7CA 1MX5A 4L5YA 3RU7A 3A26A 1GZSA 3M2PA 4FS3A 4N65A 821PA 4I55A 4OCZA 5ADWA 3EXHB 1E64A 1QG6A 5JO9A 2YWGA 3ZWAA 5C5IA 3OZRA 4NBTA 2IZ6A 2P6UA 3LNTA 1NPYA 1NF3A 1Q0SA 1XCJA 2V55B 3LT5A 4C6RA 1NGSA 3VR6H 1JHUA 2C88A 2A59A 2R8OA 2VSYA 1OWPA 4MULA 3LVQE 1QOZA 4COOA 1JDPA 5M3BA 3K0AB 4E31A 3RFTA 2VUTA 4XRGA 1UOQA 2ZWOA 3OJWA 1D2AA 3CB2A 2PCLA 1A9RA 1UJ5A 4QL3A 3CV3A 4HTFA 1D2EA 4OJQA 3JVUA 4YONB 2ZIVB 2VDWB 2QTVB 1NM5A 3ANXA 4NBNA 5IT0A 3GL9A 1XAHA 1YQXA 4Q19A 5IABA 1RI2A 1DC5A 3HG7A 4MIOA 6AT1A 3N75A 3TLYA 1BDBA 4R51A 5BUQA 1PN3A 1O95C 2H48A 3HR8A 3ONEA 3PUXA 1QRDA 3WRVA 4LF5B 4R68A 1JEJA 1XPRA 3A9TA 5E1BA 1ULUA 2B82A 2O0LA 2RK6A 5EEHA 4KBGA 1CHDA 2KX7A 5UKDA 1NJ6A 3DZJA 2YFKA 4XLTA 2QJTA 2VK1A 3IVAA 3SXUA 1OI4A 4RK7A 2YV1A 1EM6A 1EXNA 1PZFA 2R97A 1IUPA 5FUYA 2JCYA 3R7LA 2FMTA 3J80A 4Q00A 2WD7A 5DSXA 4HTAA 2EOAA 3AVWA 1EBFA 3REQB 1EVJA 3GGCA 1V26A 3EXHC 4RK6A 1F2DA 3PUKA 1R18A 1H0HA 4JODA 4PAQA 4DDMA 2QZPA 4EL0A 4YRMA 4J0JA 2E4YA 4K6CA 1XJWA 1SC6A 3OP1A 4NK5A 3A2NA 3BQ9A 1GLVA 3FIJA 1OPRA 4HDNB 2NXCA 4JT9A 4LJ4A 1QU2A 3PXBA 1P2GA 3LJKA 1JILA 5D3ZA 3UM9A 2E5FA 4AJ1A 4WN3A 5DASA 4KWTA 4LNUA 2IE8A 3OHSX 5CT6A 3R0JA 5ESRA 2FR1A 3BJIC 5GM2A 4HS9A 3DF7A 1HYBA 1DVRA 1TD9A 3IP7A 1UBGA 3HADA 2Y0PA 4EW3A 3C7DB 4FCCA 3HEBA 3HKCA 1N5DA 1U7DA 1HQKA 4CM4A 4XEUA 3S55A 4OYLA 1UP4A 3WLPA 1VPEA 4W5TA 1ZAYA 4Q3NA 5CJPA 3AGPA 4ALIA 2HJWA 5BOSB 1JLMA 1JB9A 1KI6A 3CVWA 3LKVA 1PR6A 1WF3A 1Y6RA 4RTLA 2C5AA 3MJFA 4BVHA 3S7TA 2NQTA 1QBKC 2LDXA 4O4HA 2IGBA 4FD2A 5LXTF 2Z6QA 3VHQA 4QE3A 2OCKA 3VYUB 1NBOA 2OY0A 1BD4A 16PKA 5FPTA 5ICCA 1SBIA 2HCJB 2JIZA 4IS3A 1V4NA 1XWWA 4FDAA 1O1YA 2G4LA 2HIGA 3TKLA 4IIYA 4OLFA 3ZHUA 1C0LA 3I2IA 2G8NA 3D3KA 4FOLA 3JASB 4KYIB 1YDGA 2WVJA 2XTNA 3IHTA 4LRQA 1XPOA 1EGVB 4KXUA 1XKTA 5JC1A 3H17A 2XYQA 4PO1A 4X3CA 1J20A 3KEOA 3SJCA 1Y34E 4NCAA 3F2VA 3SJZA 1UBEA 5FWNA 2DG2A 1OBHA 2BGTA 5FBKA 5U9CA 2VKQA 2PPLA 2G1JA 2HMSA 2QLNA 3BK2A 2UUOA 3PUZA 3IUMA 2COKA 2XD9A 1Z5WA 1HA3A 4NJMB 4U9UA 3UPDA 5DZSA 3RSGA 3QLUC 1M2KA 2VT2A 3ZEAA 4I66A 1M5UA 1R8YA 4LJKA 3STVA 5C1IA 5H3LA 3ZDCA 4W5JA 2UZIR 1VBNA 3DO5A 1PV1A 2YS6A 1C2YA 3AEKB 3LBYA 4ED9A 4FONA 3RYHA 4QUDA 3L3BA 1GPUA 2SCUB 3I2JA 1SU6A 3E81A 1G5FA 5FLYA 4E5KA 1NRIA 3EMVA 5EZ5A 3K0FA 4EGFA 2B21A 2FEAA 4CQMD 1OROA 2ZT7A 3T6KA 1N2BA 3FG9A 3GCGA 2ORYA 3LRXA 3P4XA 4XJVA 1XTKA 1Y3HA 4P3KA 1PS0A 5KVAA 1D9ZA 3S8MA 4MKXA 4MYSA 2H7XA 1YZ3A 3KSUA 3BAFA 4G8JA 1YFZA 2FZEA 4C3VA 3T3DA 2Z98A 3SZGA 1PFQA 4C0QC 4HQKA 4DDTA 4QDJA 4PHFA 1REQA 3M3PA 1U1FA 1VI5A 1YRLA 2DT5A 5DB4A 5F73A 3LPCA 1BTOA 2ZRNA 2BY4A 1WMBA 4FI3C 4FGSA 4M4SA 3W4KA 1NBEA 3X2SA 4GM1A 1E5DA 1SCAA 4MW6A 4UVHA 5BNTA 1HG0A 4YMIA 2X0JA 4TSRA 3B9BA 4N54A 4IVRA 3E1SA 4KXLA 1ZA2A 2JW5A 4DUPA 1IY8A 2OUKA 2I8AA 4IJVA 1BAPA 1HF3A 2WP0A 1N5JA 3OA0A 4YJ3F 1MC1A 4DWOA 5LR6A 3ZXXA 4KUHA 5AJYA 3QWAA 2IS2A 1Y7TA 2C7RA 2JLBA 1DC6A 1B43A 1JQJC 4YCLA 2I6FA 3FIUA 3QKRA 4IFTA 3EQ2A 2IEAA 2P2GA 2GBIA 4PHGA 5GMOA 2J46A 4AXBA 1JBQA 1LV7A 3RUHA 1SCQA 3IL2A 1QO0D 5A03A 2C5HA 4QKQA 1Q15A 2ZTLA 3ICEA 2C2WA 4X63A 2J3EA 4BQOA 3MQ4A 2H2AA 2A5LA 3LDUA 1EJ6A 4RA6B 1ND6A 4TMTA 1EFUA 1BRTA 1BX0A 1KNQA 2J4CA 1L5HA 1ESEA 4AY4A 5F76A 2HNKA 5CB4F 1KAHA 5KNCA 5L53A 4LZAA 4IO0A 1PL8A 4GOND 3ESCA 3K8OE 5IJ9B 1M76A 3R7NA 2V4UA 4LTMA 2ZU6A 3HCNA 3N2GA 4EB3A 1BDMA 3TW6A 3WIUA 1K08A 4DA4A 1QVVA 4G1BA 4OV6B 5TY0A 3RVMA 3D3NA 3LQQA 1RM0A 2JG3A 1EH5A 4D4KA 3DFZA 2D74A 3D7NA 1ZIYA 3FFWA 4N40A 5LU8A 2VO1A 4FBGA 1QHGA 5HG0A 3ZU2A 1ZL2A 3B8EA 2I55A 1E9DA 4JLJA 3GMSA 4O2BF 2XUKA 3QG1A 1USKA 2QTHA 3ILHA 2C4TA 3MCVA 4J2OA 1ZKMA 1IY9A 1GPMA 2ZI6A 5KSYA 1H3FA 4GVPA 3TR0A 1WHSB 3FNQA 3L5KA 3OD1A 4P4UA 2C0PA 3EZ9A 2BUCA 1FE8A 3JWHA 2AH5A 1RAIA 3D6HA 4YJFB 4G0YA 5KJEA 1JYFA 2COUA 2OD9A 3KEMA 3OSZA 4WKPA 5BR8B 5D7NA 3W6OA 3E03A 1HT2E 4G8DA 4XVUA 4CRWB 5LM3A 3ROPA 4ZYYA 1NI3A 3FVWA 1QIJA 2VBIA 3K5HA 1ELOA 4MA5A 1RAGA 1FNCA 4MJ7A 2IXEA 2FGJA 3FMPB 1HNWB 3EPPA 3VNRA 4UUPA 2AQHA 4FJ1A 2W00A 3WLHA 5U4QA 1ECCA 3PQCA 3JARA 5KDLA 1INLA 3EDRA 4NXMB 4KIUA 2H1VA 1YS9A 2QQ5A 1S3GA 4M3NA 2XZPA 5AVVA 4URZR 4L5IA 5K6AC 5I9IA 5KKNB 3UGJA 5HIAA 1UJMA 3IMEA 3LT0A 4KXWA 4WLVA 2NN3C 3IEPA 3VHLB 4AJHA 4ZOLA 4P35A 3DA8A 3GD7A 1AB6A 3KJXA 3QWIA 2ZAYA 2NSDA 3ZWMA 4NDNE 5BWCA 3IERA 1ZJ5A 4I81A 5CCDA 3II6X 3NTUA 1B74A 4UVGA 4LYFA 4V03A 2W4MA 1KTIA 3DYBA 3LECA 1G41A 3ABIA 2BGJA 3MM4A 2QM7A 3P0HA 2ONJA 3MJDA 1QDEA 1XYVA 3W05A 5KMGB 4D4GA 3LS2A 2QXUA 2A1TR 4Z7QB 3IEVA 2NO6A 3TD2A 5CDTA 3SYMA 1JHRA 4RD3A 4ESVA 2TECE 4JC5A 3QX7A 4XB2A 2A2ZA 4HAUA 2RBEA 2GRJA 4WKBA 5L51A 1IHYA 1U9CA 2JJ1A 1W6RA 4CKCA 4PSKA 2C2YA 4NJEB 3DE6X 4ZHQA 1LS6A 3D4PA 4DV1B 1K0UA 4LYHA 2J0EA 1RQNA 5IKOA 5BXQC 3RDPA 4HK4A 1FUEA 3RSQA 1IHXA 3SHOA 4RPGA 4TVBA 3SOPA 4OX9B 3P9CA 2CL0X 2FVXA 4UBLA 4OATA 4YCSA 3FBGA 5D00A 4URFA 5K1ZA 1BH6A 4O4LA 5HRCA 4MUBA 2P91A 1LQUA 2JKYA 3LXUX 4IHJF 2CK3D 2ZU0C 5G4LA 5KBYA 3HN2A 3K1JA 4KV7A 5H5JA 1N0UA 1YF3A 3EN0A 1DG9A 1ZZGA 4QU0A 4AI6A 1RM3A 4F97A 4HVAA 3ERCA 3GOQA 3PF8A 4WKNA 1CJCA 3IURA 2H0QA 3C7TA 3KU4A 5CTAA 1FLDA 2B98A 4B32A 1T6ZA 4OQDA 3HB5X 5IJWA 2K2WA 3WAJA 1QG4A 2K7ZA 2H8GA 1MVOA 1LBTA 3I5XA 3HGQA 4P5EA 3I6IA 3R5TA 3WTCA 3OQMA 3QIAA 3H2KA 3QVUA 2RHGB 1GU7A 3TLCA 2YN4A 3OZBA 1NJ2A 3N0TA 1PJTA 5KC9A 3KE8A 1JLLA 3NHUA 2VYFA 4RY2A 1XD9A 2GM3A 2QG4A 2XEDA 3GGPA 4XGRA 3OWOA 1MXFA 4GR4A 4IH4A 5JARA 3DOJA 3L1KA 1WO8A 3MWKA 3NHBA 2FQWA 2C31A 2ZITA 3QF4A 4LHVA 4ZN6A 2OO3A 5IVHA 1UUFA 3FWPA 3NVAA 1DIHA 1E7MA 1PR5A 3A1TA 1GSHA 3KPUA 3NHMA 5LU9A 4B35A 5CDUA 1ZD8A 3EXAA 2L0XA 3R3SA 1QMPA 3GRRA 1TIPA 2QLJA 4FHEA 5JPIA 3GAZA 421PA 5DGDA 1CS4C 1GEGA 3ZC3A 4GSLA 2NZWA 1EX6A 1GCOA 2JGJA 3GLFA 1J9EA 4TKVA 3V1LA 5KU7A 4YMSA 1NI4A 1H93A 4TLDA 3PFIA 3SDZA 4B44A 3U2QA 1TM2A 2HZ7A 2O4CA 5TQ0B 1H65A 3WDLA 1RHJA 3SR3A 4ALLA 1FLAA 3W79A 1XJ5A 4URXR 4XM1A 5F3WB 2XSZA 1MOPA 3TZLA 4BRZA 4LRTB 3RIEA 4PG8A 1K7XB 3G8DA 4TTAA 3VR4D 3JQGB 5HOEA 4QT4A 3Q85A 3F9IA 1G42A 3RQSA 4FW9A 5CTJA 4QEDA 3UENA 3T41A 3FB1A 1WG8A 1O5OA 2MYNA 1KL7A 1TM3E 1VPDA 2C03A 2G04A 3MK31 4OD0A 1DKMA 3OCYA 3ZI4A 2QI9F 3S8EA 4GWGA 1RTKA 4Q9DA 5CM9C 1VC2A 3HYTA 3UW3A 1RWVA 5C4GB 2RH5A 3PNKA 3H9QA 1MQ8B 2WHEA 1Q14A 3JD1A 3V80A 1LI5A 3W6NA 5JQGF 5F4ZA 1I51A 3MAGA 2JBHA 2DE0X 1H6AA 4EHFA 2B8JA 2Z5GA 4YXWD 1M9NA 3SD7A 3H97A 5CFMA 3ACDA 4ND7A 2CZCA 4I4TF 1MBZA 4Q4AB 3ZWPA 1QP8A 5A05A 2QAGB 4HMOA 3I2KA 3I01A 1ZOSA 3PD7A 5LQMA 1V9SA 5K2OA 4AZTA 5DISB 2G5GX 4JBLA 4BGDA 5K0FA 1YJBA 1AKMA 4P2BA 4CF6A 4HNHA 2DKOA 4CF5A 3T52A 1P4HA 5AK3A 2CNKA 4Q6WA 4UDYX 5DSTA 5K09A 2GZ2A 1QF7A 4GYYA 2GVDC 2W2KB 2WT8A 3TKAA 1OYOA 4F5WA 4MHTA 5KC8A 1K2WA 5KNLA 3W90A 1GZDA 2E18A 5CCXA 5LKRA 4OKNA 1DIBA 1GTZA 3C98A 3C3MA 1DAEA 5DHUA 4DG9A 4KAXA 2VFAA 3KFVA 1LBQA 4L95C 4EA9A 5LJLA 3O94A 5DLYA 3DV2A 2KM1A 2AHRA 2QSUA 3KBOA 3E1GA 1SZDA 2QZSA 1IB0A 1W8DA 4LG1A 3REGA 3RUFA 1CDZA 3A6GA 2EFGA 1C3JA 5K8IA 1O6CA 2RGUA 2C4KA 1E3JA 1B16A 1CYDA 2XTAA 1WUHS 3INRA 3OHPA 1SFRA 1L7DA 2HO5A 3O2QB 3L6EA 5AK0A 4BEWA 2DT8A 2D3WA 2P3SA 4JHLA 2C29D 1NBHA 1QUFA 1LVGA 4ZQIA 1JHPA 2DWPA 2MWMA 2QAGC 2JFPA 3OT1A 5T6MA 4CQMB 3B52X 3GGDA 1NOKA 3WL3A 4DBZA 3ST7A 4Y6SA 3OM0A 3U7RA 4CIBA 3OD5A 3WA7A 3MMXA 1SB8A 2YH2A 3UOAB 5TLSA 1EDZA 2Y1LA 1TLLA 3G2JA 2GCOB 1W85B 4RTQA 2UYCA 1ZAKA 3P9NA 5FWXB 3RCBA 1ISFA 1CUHA 1KP9A 4D4JA 4M46A 2IPLA 3MD9A 1DIGA 2YTZA 2A84A 1WP9A 5DYNA 5FBHA 3CWZA 5AKYA 1E89A 4GWKA 1ODTC 1JAIA 4HNSA 4R1LA 3R9WA 3N2YA 1H4VB 2OK7A 1QIKA 3T4XA 4L74A 3J81A 1L7PA 2E6KA 1W44A 4PG6A 4N41A 3PHGA 1AS0A 2W90A 1RQGA 2QVZX 4IV5A 4RZSA 1F60A 5I9SA 5IYZF 4HDSA 2ZSEA 3FGNA 3L7DA 5HEKA 4WVLA 1U0HC 3FYDA 1NW4A 1AB5A 2Z9CA 3JTMA 4R9VA 4V0RA 5LZ7A 3AEYA 3OQNA 3GUYA 1HT1E 2PSHA 1R5BA 3GBVA 3WQHA 2XE6A 1KI8A 2FZLA 5I7RA 5JMOA 3RGWS 4YP9A 4KMRA 4JNCA 1KWKA 3CG0A 3ILYA 1R6DA 2QGZA 4DR7B 3RM3A 1WKBA 3CA8A 4D8UA 5JSHA 3GWZA 3ULKA 1ZRSA 2G9NA 4LYAA 1KJQA 2F1IA 3ONVA 4C1NA 2BFFA 1R9MA 2H1RA 1E62A 2JFGA 2AWOA 3NNDA 5EXPA 1Q7TA 4IFBA 4LXGA 3H1TA 1MC5A 1DWOA 1PSZA 1TIKA 2NQ8A 3OOSA 1RT9A 5AVSA 4PS1A 3QY0A 5DNWA 1HNZB 4MR8A 1FSSA 1LUAA 2YUTA 1OI7A 4UMVA 1Q7BA 1IG0A 3VU0A 3PQ3A 2P30A 3GP8A 2I9KA 1UMKA 3P0FA 4OJNA 1SC3A 2MSKA 1NC1A 4YJHA 4JY7A 3SDBA 4DBLC 4DLTA 3HSYA 5K3OA 1BWRA 3NEYA 4ABTA 2FPIA 1P4AA 2HJHA 1G9SA 1OJLA 5EN4A 4EAAA 2AN3A 2BELA 5M2QA 2YZKA 2SICE 1MAUA 4HVCA 4AYXA 2JC3A 2ECQA 2A0XA 2XYRA 3D2CA 4RSMA 4OMCA 3H5TA 2BV3A 3E9NA 4PAWA 3WKAA 4F1JA 1G17A 5G0SA 1U2DA 4GQBA 1KU0A 4U0KA 1KEEB 5KU1A 2Y27A 1J49A 1Y80A 2B94A 2EFEB 4QUGA 5F5LA 4NEGA 4F2WA 2ZPAA 1HYGA 1V5FA 2V6GA 3HZZA 4CGYA 2OFWA 4QUKA 1AMNA 3DCJA 2YASA 3UF0A 1SVSA 5CPFA 3VU9A 3EA5A 3VI4B 1FFWA 1Z2PX 1H85A 1GG5A 1KVTA 2OHHA 3HDQA 5KQPA 1Y42X 2CNWA 1ETUA 2B7LA 1FTQA 2JVJA 4HG2A 1BMTA 1L4EA 1OASA 1JHVA 2CL5A 2EVWX 3DZCA 2PTHA 4KPUA 4R54A 4DB2A 1E2FA 3TJZA 3I76A 3PHBE 1MTOA 3TUJC 4N03A 4URVR 1LEHA 1YGYA 3PHLA 2AQIA 4IZOA 2DERA 3VKVA 3ADDA 3PSAA 2VJMB 3Q9NA 1E1QD 3THRA 4BO1A 4NICA 3BL6A 4CR8A 2L17A 1US8A 3EGDB 4Q21A 3D1LA 5DI3B 4KXNA 1LSUA 2P65A 3IMGA 5M34A 1YB1A 4QJ4A 1R5NA 1V7CA 4TVOA 4V2UA 4Z0NA 3ZGXA 1YVRA 3A8TA 4M86A 1H2WA 3DMGA 3DVAB 2ZUDA 3L6BA 4ND8A 1EUZA 1D1PA 5CLFA 2WJHA 4B79A 1WCWA 2G0NA 4ROSA 5LOVF 2AXQA 1BVRA 2OTCA 2X9NA 3DONA 3K15A 4JBHA 5BOSA 2AJLI 2IXFA 1XGKA 3IOEA 3R3JA 4Q7LA 1NW3A 3SIXA 2AC4A 4ARUA 3KJQA 3DMRA 4UPEA 1F0PA 2XUQA 5LMUB 2YYZA 3OPYB 4MW7A 3AR3A 3LHIA 1W5BA 1J7KA 3IQGX 2W6IA 1C4WA 4R41A 4BZQA 3D1JA 3M7IA 1FFXA 2OP0A 4EUEA 3L02A 1P5FA 4JN6B 4X61A 1HUQA 3DQQA 1VE5A 1NBIA 3K9FC 1XMQB 3TGLA 4UXJA 1FVOA 3C85A 3QW2A 1ZK4A 4IOJA 1GYQA 3DV0B 3CPJB 1OLXA 2OLKA 4MCJA 1KETA 3PK0A 4URUR 1ZH4A 2C2MA 1IOWA 5E9JA 3ZZTA 3C97A 4L3WA 1VHJA 3CCCA 5AVZA 1CRLA 4U6SA 2CFOA 1DZIA 3FM9A 4JLNA 2I1VB 4YJ2F 1LDNA 3OE4A 1JJ7A 4S1WA 4UKDA 3AEQB 2HV9A 1F8UA 3TZCA 5HR5A 5L3SA 4E46A 2A3NA 4HXGA 1GU0A 3S29A 3F3KA 4UZEA 3BXXA 2CVPA 2I8LA 2C9BA 4BFXA 2VF7A 2VPWA 1PFKA 1JYEA 4KQXA 5EE1A 4EP1A 1U3DA 3KRTA 3DPIA 4EA6A 1YDWA 4G63A 4F21A 1LPOA 3C3JA 2CBGA 3MUFA 2AOXA 3I73A 1WNTA 3E9RA 1FNDA 3DFMA 3HKBA 4PSVA 4RCZA 2OZLA 1OX4B 4RS4A 4E1BA 4M8LA 2JAHA 3LU1A 3UQZA 1L5LA 1T8TA 1M7HA 1Q20A 4WLFA 1UWCA 2FPXA 4FUQA 1J2TA 3AQ4A 4ARZB 3X1KA 3G8YA 4N5HX 3JAKB 4MVJG 4IDBA 5BQPA 5EUQB 1GAQA 3ICCA 1A9QA 2GJSA 4QULA 4RXMA 3GLTA 1QVZA 2IK8A 3O8RA 3FUXA 4S1TA 2DP4E 2V9ZA 3VR3A 3DDCA 1GUBA 4BTVA 1U98A 2DGDA 2HYDA 4MNTA 2ON6A 2ZUVA 5IBQA 4D6PA 3JD0A 5JMPA 4D9BA 3IT0A 1FYDA 4DIMA 1PL6A 3T3IA 3A11A 1HQDA 1D4ZA 3DFUA 1KSFX 5KKCA 2REQA 3LRPA 2Q5EA 3RSLA 1GAXA 2ARKA 1ZY2A 5IMSA 3OMXA 1FVXA 3C4QA 3PSHA 1QANA 1Y1KE 2TMYA 4C7MA 1JPVA 1ZWLA 2DPHA 2DTEA 4OGLA 4GL4A 3RUIA 1OKKD 4FX5A 3FOZA 1QGAA 3J7AC 3K4HA 1M6NA 1AXRA 1NQOA 1MABA 3PEFA 1N75A 4HNTA 2ZTHA 1X7XB 3TBHA 1K86A 3SQDA 3NBAA 4FFBB 2IH2A 3AERB 3WY9A 4DSNA 1L8OA 1FP4A 2HBZA 4HDKB 4I1UA 3FTPA 2O2GA 3CRQA 5D3MA 4ZQGA 2ZRIA 3VUFA 4Q01A 3IQFA 2FHPA 3H3JA 3RNOA 3WZ2A 3FHJA 4DCSA 4INZA 5HMMA 3WKCA 2O7VA 5DOVA 3FBTA 4MAAA 1XDGA 3ABOB 4R2IA 2LRHA 2WHXA 2C84A 3CURA 3D6NB 4G09A 1OWOA 1XF9A 5CVVA 3GG2A 1NV8A 1C9DB 1ZW6A 4NCHA 3WAGA 1LTQA 5TE9A 3CLSC 4TRJA 1SBCA 4CCWA 2ODTX 5EPUA 4BZXA 3NBXX 3ROTA 3VGPA 4YUZA 4IICA 2QRZA 1CY4A 1P1KA 1WBDA 4ZK6A 2R96A 1W5AA 4G24A 5J5VA 5KVVA 1UXJA 3DBOB 1ESNA 1XD2A 2I67A 1F12A 3T3PB 5G0VA 1CG6A 4QUHA 2AQ8A 1XZPA 2B1RA 3OPMA 1ECBA 3VZQA 3KIPA 3WJ1A 3VX4A 1E3QA 1IEXA 4G3XA 2R8ZA 3QNMA 4OYYA 3HXQA 2LVBA 8AT1A 2N0SA 1CUBA 3QBTA 2NLOA 5JAPA 2UXDB 1GNQA 2IH4A 1VLHA 2R65A 2PU7A 3U44A 1ZESA 2NXJA 3KWFA 4QDUA 1VHWA 3NDBB 4DREA 2QT9A 4DB4A 4MO2A 2F4NA 4I6JA 3ZV5A 4UCXA 4JWTA 4WINA 4BV9A 4DMMA 1E5VA 1GR1A 4M0CA 2ADMA 3Q8WA 4MVWA 3FX2A 4LSWA 3DS8A 5BNWA 1PHRA 4H0FA 2GD2A 3A6ZA 4BU0A 3X0DA 2ODQA 3L8YA 1WRBA 2IZ1A 4ZI7F 1OZFA 4YRAA 2OVFA 3KDSE 4QSHA 4YQZA 1ZYUA 2J9GA 2QJOA 1DO0A 1G66A 1YZGA 1X86B 2XRFA 1X6VA 5DXFA 5K3FB 2A14A 4E6PA 2XDYA 3DL2A 1XK7A 1SEPA 2G1KA 1XMPA 3O9VA 4H3KB 1XVTA 3ZLVA 1USVA 3Q7TA 1XU9A 4MR9A 721PA 1FQJA 4R8KA 3KR9A 4PONA 4FINA 5C5DA 4RS3A 4FT4A 2OLEA 2X0NA 3AF5A 1UBKS 1EHIA 1CCWA 1A2BA 3I8XA 3LLVA 1BMFD 3TLGA 4M1EA 1EVZA 4XD7D 3V4LA 3K1TA 5KTOA 2VP9A 3QE0A 4RNCA 3NUQA 5LWQA 5KOJA 3KQVA 4H1WA 2FCRA 4U7JA 4OBBA 2XHEA 1K68A 5FCDA 5FL7A 3TLZA 3BDIA 3U16A 1TD1A 1I2ZA 4MYUA 3DBLA 3E4DA 3HACA 4CNQA 5KREA 3A0UA 5JS8A 3TSZA 3EGOA 2JI7A 2PD3A 3B48A 3L05A 4HNAB 4XYMA 3A6JA 2VJNA 3ZH9B 5GADl 1G1AA 1QV6A 2PT7A 2A35A 3BL8A 3I9FA 3NTVA 4F6LA 3D54D 1EXWA 4U7PB 2XTMA 4WOCA 3DEJA 3F8SA 4LXIA 1MJGA 2CJWB 4FOTA 2H06A 5JSUA 2ZUSA 2WQ7A 3FOWA 1H4TA 1IPFA 1SQGA 1I4DD 1QTRA 1TC2A 2XLBA 3F71A 3LXRA 4WUTA 4DT1B 2ZZNA 1J23A 1RBQA 1QYCA 1UL1X 1BSVA 1ULTA 2P2DA 2JHFA 2QVXX 4AX8A 3ER9A 2R7LA 1W0KA 4TM8A 3TPCA 1Y5MA 4LOIA 4B83A 2P5TB 4E03A 3UIEA 2Z5FA 1JDZA 4CU5A 2XNJA 5I01A 5L45A 4AU1A 4D1YA 3C3XA 3DLTA 1O0CA 2VOEA 3UCEA 3QV1A 4A91A 2GHIA 1E3EA 3DOFA 1EKXA 3KR1A 2QXYA 5KQRA 2P6RA 2Y4NA 2GS9A 2IEIA 2YHIA 3NV9A 1G7CA 5JZ9A 3STUA 2C5EA 4DLXA 4N12A 4GUAA 1VJ0A 4WNCA 3N59A 1YT5A 2ZVQX 5JRZA 2W2LA 4AG6A 3SF8B 2JI4A 3WGYA 2VUHB 1XA4A 4ZRDA 3BMCA 3NVDA 4LA4A 4NATA 4ONEA 1KDTA 3SX4A 2WU1A 3UFBA 3CVOA 2Q5JA 5HJEA 4RMGA 4RHEA 5G4KB 1PT7A 4AKIA 3C1UA 4JIMA 3FUWA 5H02A 2Q1SA 1BW9B 1OWMA 2XT9A 4MGEA 3WO1A 2M1ZA 3OF2A 3A4YA 2CBXA 3PC8C 5SICE 3S1AA 3SC2A 3KS9A 3SX0A 4RYLA 1PG5A 4BNGA 4W9NA 1A4XA 3U3RA 3QBEA 2J9ZB 3PC7A 3VNSA 2ET6A 2XUZA 2DPGA 3KQWA 4Y9DA 3VHXB 2HK9A 4PC6A 4H16A 1T4CA 3KP1A 3L7KA 4OFWA 1KAQA 2ZIXA 5REQB 2GEUA 4BJHB 4MRSA 3WIOA 3KO8A 2VTBB 4EX7A 1WA5A 2DVMA 2V1XA 4Q4CA 4YV7A 4YCMA 1ODFA 1XD8A 1I0LA 1VKOA 3SE0A 1J2RA 2ZJZA 1V3UA 1CFZA 3HNPA 2QN1A 4TVSA 1C9KA 2GZMA 1Z4LA 1I9CA 4GBMA 4Q3BA 4K81B 3V4OA 3MQFA 3VAYA 2FFQA 1J2JA 2PR7A 4S04A 5JEDA 3IP9A 4IJKA 4M1YA 4YNBA 1VL0A 5C32A 5DNDA 3A6EA 3U7EB 2I6TA 5IC4A 1E7SA 4H1UA 3IYLW 1XTJA 3GXOA 3TE6A 1BXRA 2VEDA 3VZCA 4H7HA 4J03A 1YZYA 3AR4A 3IKJA 4NZYA 1AV6A 3FPSA 4JJFA 1SOUA 1TC1A 1WQ4A 2P9QA 4JEMA 5G1PA 3SLRA 5HKOA 5DHQA 4Q12A 1BMQA 4OBWA 4W1PA 3GPCA 2BMFA 3C3BA 3FKSD 4BOYA 4EL5A 2NU7A 2PRKA 4P1ZA 1H69A 2G70A 2IEBA 1VKNA 4A92A 1NBMA 3CS3A 1SKUA 1QHNA 3EMDA 4HQ0A 4JGBA 4MVJE 3FYUA 4RL6A 5LD2B 2I1QA 3T7TA 1OI2A 4OAOA 1KQOA 2WUEA 3KTAB 1Y7HA 3PGMA 4AYTA 2BDUA 1W87A 4BP8A 5JSFA 1PEDA 2GFQA 2JIZD 3CBGA 5KVSA 3ZE1B 3VR2A 4EO4A 3BWEA 4BUCA 1JXMA 3AP2A 4C5BA 4EBFA 4DR4B 4YRSA 2PIDA 5TT1A 5AW3A 1ODKA 1GCUA 2VK2A 3UJ8A 3U3KA 3M6UA 5A9RA 2WB2A 4LCBA 5I8WA 4L6CA 1GVHA 4RLQA 3ZCPA 1OMOA 1WCIA 3WK9A 3GRYA 1NT2A 1PNRA 5CK5A 4F9EA 3HVJA 4OXYA 3ZUGA 5BNIA 1I80A 3IX7A 4XAQA 4M0FA 4JT2A 4Q18A 4WBSA 3UYLA 2Q9BA 2A5YB 3DLAA 2O8EA 3ZY3A 3ZCQA 1RXCA 2QRHA 2WM8A 3OZIA 5J63A 2YHSA 3ZPXA 4DCGA 3ZWNA 3EOBI 5LBUA 1Q7RA 4BXOA 3PNOA 4BLRA 2CNOA 4KH1A 3FNHA 1I2MA 4N9WA 4PANA 2QD5A 3C39A 2Q4RA 4JEIA 1OREA 4BQEA 4F2HA 1C0EA 4RZ2A 1NASA 1U7XA 4WOBA 4F71A 2V6IA 1U2PA 3THXB 1A9SA 2NZXA 5F7ZA 5CA1F 2RGYA 3N2LA 2JKVA 3ZGNA 2DOKA 4B6FA 4NG4A 4B7XA 4LOKA 3BJRA 5LD2C 3B78A 1EWRA 3N2IA 1FNSA 2ZIZA 3JQ7B 4J4BA 3GMIA 4FYVA 4QQNA 1OFIA 2NU9B 2H5EA 2P69A 4HL6A 4HC4A 4IDGA 4LWZA 3TXXA 3BCRA 3WK7A 1TW3A 1K89A 4V2IA 4YJGA 3E9ZA 3WWOA 3IXLA 2NZ8A 3H65A 4I4NA 5CX4A 4D4HA 5KHLB 2IBSA 2ZBEA 3U7QA 2ECOA 1K7CA 4U7WA 4BVKA 3RUCA 4UD2A 5K0GA 2XBMA 4BNDA 1GL7A 4RFLA 3MT9A 4F11A 4HF7A 2XWPA 2BFAA 4JVSB 4K6MA 5C80A 1CUJA 3VR6A 1VSTA 4IPTA 4CCYA 3D1VA 4Y6LA 3GLVA 4U7TB 4EVIA 2GBLC 3OTHA 5EZ6B 1SOAA 3VKFA 1YAJA 4Q4DA 3W9YA 4KNWA 4GE3A 4WSOA 2ZBRA 1UDBA 1KVRA 1ISGA 1DC8A 2ACKA 4HDRB 4C01A 1V5GA 5C1PA 1SUWA 3SBOA 3EEYA 1T6BY 4F4IA 3K94A 1DBPA 5E0KB 1Z36A 4J9VA 2CJPA 3UMSA 4COKA 3EVTA 2HO4A 1JFSA 1PVVA 1K9VF 5BN5B 2C99A 3PDHA 2RHDA 1MU0A 2FPWA 3LYAA 4XRRA 3DOUA 1T3SA 1T5DX 3EJWA 4O4JB 2O8CA 3IELA 3U09A 3Q2KA 4UZFA 5LLDA 4Z4GA 4OQPA 2F48A 2DPMA 5LA6B 1N2CB 4C4TA 3ZTWA 2YRWA 1U3CA 4GPIB 4BQPA 2FAXA 1Z13A 5D85A 4DCUA 4Y2XA 3AI7A 3R6GA 4K1XA 1Z4OA 5F1KA 3ESRA 3VUEA 1GLGA 1YKFA 1Y3DE 4PINA 4C0BA 2DH6A 2JZCA 5K03A 4NYMQ 1YA4A 3DWGA 1ZSVA 1ACJA 4JX8A 4KX5A 4UE3S 4JJIA 5DYWA 2AZTA 3R3HA 2R9VA 1W0CA 4JS0A 4Y2YA 4OSOA 2BDEA 3V8BA 2QLMA 5EUCA 4E0BA 1U9YA 2WWWA 3RO7A 4TL7A 4XVQA 1BYUA 1PG0A 4FEYA 4G25A 4WCFA 1AUPA 4HS4A 5FTWA 2R751 5CXXA 3WYBA 2CVOA 2O3SA 3LCUA 4NWIA 2H6EA 4DR1B 3BICA 3LYUA 2Q9CA 4RVCA 3KJIA 1T9HA 3D43A 5KS2A 2X5KO 4RTSA 1XDZA 3M70A 3IVMA 4B8ZA 3A14A 1N8KA 5ALPA 4BTEA 3A58B 4C29A 4YP7A 1WZEA 1WF6A 1NAIA 3DOIA 2XCUA 3DNPA 3SXJA 4KR9A 4BX8A 3U4QA 2VRCD 2NO0A 1COWA 2X0IA 1JSZA 2BONA 5T7BA 1WV1A 1KOLA 2J3QA 2IE0A 3HB7A 5KTRA 4PLHA 4UNRA 3UEOA 4R2XA 3RHTA 3KYIB 1P1FA 3DW1X 1GQ2A 2XXBA 2D8MA 1LXCA 3IDZA 3NHWA 1WOYA 2PQ2A 1NMXA 4ZCQA 4BMPB 3ZR4B 2P5SA 1WXHA 2H2WA 2FSVC 3LWNA 1Z2EA 2PE5A 2WPDA 1ZK2A 1GY8A 3FR7A 2Z3ZA 2VJCA 1IEQA 1F6BA 2QDKA 1K6IA 4CDNA 4KHPB 1HL7A 3GH1A 4YRFA 2HU7A 3GLKA 4FYHA 3HABA 3NKVA 1PFVA 5IDQA 2MSNA 4BZPA 3AINA 2NTNA 4YT2A 5CBPB 2AFVA 2X6QA 3D3EA 4NAUA 5B64A 3MB5A 1CUXA 1T24A 4IIJA 4OGWA 2E49A 4Q03A 2Q4TA 3QVGA 3VTKA 4H3SA 1QGUA 3OLWA 4BASA 1ZH8A 4E08A 2I65A 3H8SA 1SD5A 2O5EA 3TSYA 1Y33E 1RQRA 1P4SA 2ACVA 4DM7A 1NDHA 2VQFB 3JYNA 4M0EA 3IODA 2R7MA 2I8CA 3G13A 2I5PO 3STXA 1JDUA 3A3KA 4DOMA 3TFQA 4TMKA 1MMFB 4NYIQ 2R62A 2R1VB 1RYBA 4NL4H 5AHKA 1EZZA 1YH3A 1K3TA 1P3DA 1FXSA 3F7MA 3KVOA 4OOFA 4P3PA 621PA 3WLFA 2RGNA 3TIXB 3LY5A 4D97A 2HLHA 2NSYA 5E2IA 1N0HA 4YVFA 3TFOA 5EYPB 3UJPA 4MWEA 5D01A 1XZMA 4NZOA 2BEUA 1GAJA 3B3JA 3DAGA 5C35A 3DXZA 3JZMA 1K7YA 4BLUA 3AU9A 3EA4A 3T8YA 2XVXA 1SMKA 1P9OA 2ZAOA 3GNQA 4POOA 1TT7A 2PK3A 4HNRA 1QDUA 3OEEA 1AZTA 1U2GC 3NRBA 2XNDA 1QPZA 2P9YA 5ADVA 2IGTA 2VF4X 3IQZA 4CM7A 5BR4A 5FR2A 2W6CX 4U5QA 1PR4A 1WUKS 2A5DA 3ID6C 4BWFB 2JAQA 2BJHA 3LCJA 3N3BC 4KHZA 3SY8A 5AM2A 3FKJA 3P71T 2CT8A 1ZPDA 1L7BA 3T5DA 4TOIA 1VBFA 4FKMA 5K3EA 4GYKA 4PZAA 2NTYC 1YTLA 3P1JA 4D46A 1ZC3A 5GQSA 4I55B 2IU0A 1R2QA 1K0FA 1P2FA 5IK2D 2EW1A 3DWIA 4ITUA 4G37A 1DAGA 1Q3HA 2GK3A 1CUCA 3WJAA 4H7IA 3ETLA 2CYAA 4C78A 2OCXA 3LYHA 1JT9A 1O94A 1RBZA 2O8FA 4WDRA 4XM0A 1LC0A 3L04A 4DAOA 4HTFB 1EVKA 3WQRA 3MUOA 3MBIA 4PBTA 4R7ZA 2RHRA 4HWPA 1H1TA 4IINA 1GIAA 2XBLA 4JEUA 4L51A 5AH0A 3WGQA 1WP4A 2Y8EA 2ACWA 3EUAA 4M8SA 3GLRA 1ZBDA 3ZLJA 1JQDA 2GXUA 2QGFA 4BMNA 2WTUA 4AKTA 3AHIA 1AKNA 3A1NA 2AVNA 2EKZA 3DTNA 4LF8B 1G8SA 1SRQA 3KWLA 4Y0AA 1XF1A 5HOQA 3RF7A 2ZTSA 2FDCA 1E92A 1Z56C 5KYGA 3ZWCA 4O1MA 4YASA 1E2IA 4KXYA 1NUSA 3CX4A 4OLJA 4K26A 4G0XA 4MRMA 3MJHA 5D51S 3SXUB 2OCGA 1WZUA 3RFCA 3CLTD 1RYNA 2RHCA 2RHLA 1AS2A 1KBQA 1OC4A 4EJSA 2MYUA 2XT0A 4LFCB 4CGZA 4R2KA 5ALDA 1QFZA 3TQCA 2FFBA 4D81A 3BT7A 3R24A 2Q1XA 2FEKA 1I6LA 3Q87B 1DC4A 3B1WA 1LJLA 2JDID 3VNVA 4TQAA 2WHPA 2EBWA 4CLXA 1VA4A 1M0EA 4Q48A 3TZQA 2W6PA 3LPLA 2ZSUA 3QP9A 1QHFA 1T5IA 4TYNA 1X92A 4KWEA 4W6QA 5KYYA 4QNMA 2I3GA 3PNYA 4LNUB 5PGMA 2HSZA 1ZI8A 3SJAA 5JMTA 1EHCA 1HE3A 1JPNA 1VLLA 2J9RA 4MQEA 1Z6ZA 3QKSA 1Z8DA 2KQUA 2IZOA 2YZNA 1NM5C 2ZS7A 5EIHA 2EFYA 3WWDA 3W06A 3AIIA 4DLZA 1CPYA 3HKCB 3TSOA 4CM4B 4FNGA 4DLUA 1NF9A 1ORHA 3AF4A 5AHXA 3R7FA 4CQNA 3AEXA 4FYPA 1YMVA 4L9AA 3TL2A 1JFFA 4MVJI 4RV9A 1W0JA 1KI6B 4OVKA 3IBSA 1G7SA 3SIPA 3O8OA 2Q0QA 5L7TA 4FGUA 4HOYA 5HE8A 3D8RA 2DF8A 1BJTA 2QE6A 3MRVA 4UBNA 4Z99A 1X3SA 4O1HA 5LLTA 3H9GA 3FWKA 2GA9A 4Y0NA 2HSJA 5KKAA 2O06A 2OORA 1BJRE 2QE7D 3AJAA 5AUOB 3ADBA 4LMAA 4XYEA 4O4HB 3D0OA 3EGCA 4C22A 1MX9A 3O9ZA 4P7JA 3DAPA 4D3ZA 2W6OA 2CV2A 5E3IA 3PNBA 4M36A 2YV5A 1GFWA 1Y82A 1AZLA 1U0RA 4JQSA 4TXMA 1G19A 2MR6A 4E33A 3WTBA 5DCYA 3STTA 2RHBA 3I4FA 3RS3A 3LLSA 2B34A 5U1PA 4RHTA 3ASUA 4A9AA 1HE4A 1YVDA 1O4WA 5ECWA 5EZYB 2ZI3A 2AYYA 2OBBA 2V3CC 2BFCA 1ZGHA 5EGSA 4M37A 4XFKA 1OSNA 4D0NA 4F3CA 5HUJA 1ZM7A 1IU9A 4CU2A 1FEZA 3KPWA 2NO5A 3WNQA 4RXTA 5F7OA 1ORRA 2P4HX 1JE1A 3WRXA 2RAFA 4IDEA 3UPTA 1HYHA 5CXSA 4BVLA 3AF6A 2ZANA 2R6R1 1UXOA 2HMAA 4Q1VA 2A6PA 3SIWA 1H2AS 4LS3A 4DSTA 3T0IA 1N6LA 1LBIA 4P81A 3HDJA 3ADKA 2B37A 3A1CA 1VE7A 3FLEA 4FMCF 4M9UA 4NYJQ 3RYHB 5CXUA 2YJNA 4HLCA 4QPJC 2WJWA 2NSJA 4ZU3A 13PKA 1HKHA 1KMIY 1RWPA 2F64A 2ZPTX 3QMPA 5AVXA 1KIMA 1ABEA 1PU2A 1VMEA 2YWXA 4JU9A 4HYQA 3TBKA 4QPZA 3W5VA 2P4QA 2QPAA 3AM3A 5DRTA 2YJ5A 5E95A 3KZKA 1O9HA 4BP9A 3A6HA 1K63A 3ZOZA 4DV0B 4CQJA 4R2HA 2NSLA 4FLEA 3DKPA 3O93A 5TNXA 2DHRA 1EUCA 2OM6A 3PEUA 1P29A 3AMVA 2BTEA 2ONCA 4H4EA 5LP6F 1REQB 4TS9A 1W1IA 2AE2A 4KK3A 3H11A 5EMJA 5K0CA 2MU1A 1DX4A 4MS4A 2N3ZA 5DNVA 4ISBA 4XWWA 4WKOA 4IH9A 1TA0A 1ZGBA 1XEWX 4BO5A 5ALYA 3BE4A 2WINI 4EKGA 5K3AA 4NONA 1ZM3A 2Q5HA 4KXXA 1C30A 3O1JC 4X9XA 5IAJA 4X7RA 5JBQA 4ZTZB 3JQDA 1C7QA 4CIYA 5CDHA 3MAJA 4UTNA 2G67A 4EG1A 5JNWA 1S3SA 2X6RA 1KY3A 3IMFA 2RGRA 1E6EA 1MDFA 2RH9B 1AHIA 1MB0A 2VOJA 3CEPB 3N8KA 5CNKA 2MCFA 4P0PB 2CC2A 4LJLA 4YAUA 1H3EA 3AR7A 2EZTA 2EJUA 2HXYA 3QKRB 4MW0A 5DHFA 3FPKA 4Q1AA 1TGVA 1XMOB 5DIFA 1WXQA 4RVGA 4U8GA 3ODGA 4EFDA 2OMKA 1NW7A 4ZT6A 2ZWAA 1P81A 4ZANA 1FFCA 4AMZA 4QIHA 1MO2A 4EHLA 2CUTA 5HFJA 2QJWA 1L5HB 1IBCA 2REBA 1KR5A 3D9QX 4NCJA 1XYGA 1RMYA 1MOQA 4KVGA 3UKDA 5KNDH 2OWDA 1Y8QA 4FDVA 4DLAA 2IPOA 3IQHX 3PT9A 8ABPA 5A4KA 5BSUA 3A6KA 1PGJA 1BKYA 1DJNA 4HGQA 4KI7A 3HJRA 3WI7A 4P31A 2I7VA 1ZKDA 2XVYA 5ALQA 3FTEA 3RYIB 2W93A 3N2GB 2WFZA 3T9EA 3I0MA 4NMXB 3LKZA 2P6OA 2VPIA 5K8CA 2CLSA 1YO6A 4M98A 4DCTA 5K8TA 2ECFA 1GQYA 2H31A 2HU8A 5CEEA 1U2EA 2EFJA 4QD3A 3PR1A 4DCOA 3GLGE 1ECLA 2JAXA 4RFSA 2RHJA 2WJIA 5DWVA 3ZG6A 4D8VA 2ZYUX 4DY6A 5JRDS 2HWYA 2VNIA 3A7DA 3L18A 4XZ3A 1IM5A 1Y3AA 4RKYA 2WOJA 2Y1CA 5TT0A 3EAFA 2QR2A 3LIPA 3G7NA 2CZGA 4CIWA 2F67A 1II8A 2YQZA 4B8YA 2YICA 3DFIA 3NC1C 4TTSA 4LRSB 2QPOA 4L8FA 4O8CA 1EK6A 3FHLA 4PM4A 4JI5B 1AA6A 1YTUA 3PZRA 3OURA 5EJGA 1B73A 2ZSHA 3N6XA 4BS9A 1AQNA 5FV7A 1UANA 1QPBA 3Q2IA 2YOFA 1O96A 2JFHA 3GROA 2VQ6A 3QE4A 4QOIA 1T3LA 3R2JA 4EHHA 2ODAA 4I8IA 5CFLA 5EMHA 4IJUA 5D3KA 5EMLA 4CEHA 2AMVA 3R5FA 1J0EA 5LPNA 5DM60 4TL6A 1ZIXA 1QIMA 2VCEA 3JARB 1OZGA 5HQTA 2XZLA 1V5EA 4BEBA 4AD8A 1RYEA 3K92A 2GLXA 5CNMA 5HKBA 3QX9A 4JT8A 4KQFA 4XB6B 3AW8A 4ZCSA 1PZMA 3IVGA 4ZOLB 3L4KA 1YUMA 4IXNA 5AQEA 3IBYA 3EFOA 2YDXA 1FSFA 3CGGA 3E3NA 4ZVLA 2WY2D 1PTJC 4C6TA 2OBYA 4NF2A 2KB0A 4OHPA 3EISA 5LDDC 4DAEA 5KWVA 3DXXA 2OFFA 3TQFA 1BIFA 2X0DA 3I39X 4B43A 3Q7RA 3ED5A 1L9XA 2O2IA 3ZGVA 1FXWA 2E87A 4EPYA 1EFTA 2PL3A 1QS0A 3FGPA 3V1MA 4E12A 5KJFA 4O02B 1N3BA 1E3DA 3OCJA 4TSKA 4PLWA 3RUDA 2BBWA 3FTFA 1OV6A 3LPAA 4MRPA 2WTBA 1GITA 2ZFUA 3QPVA 4OLBA 1NWHA 3SWWA 4FBMA 3LDFA 3RT7A 1HSZA 1JQEA 3HV2A 4M9SA 3JQCA 4RJTA 1NSTA 4CKCB 1A7JA 1E6WA 2RCYA 4BYMA 2X8WA 1NSYA 5LYJF 4BKUA 4ZHQB 3M33A 5JY6A 1DXYA 3UHPA 1XLTA 4FFPA 3SR4A 5FX2A 1ACLA 3QOWA 3WWYA 4G9GA 4HDMB 5AVUA 2DUUA 3BQNB 2MSEB 2OHOA 4FHZA 2XKBA 3HP1A 4ZI2A 5CVUA 5T8KC 1ZK0A 4K6HA 4BJ5A 5I7HA 4RABA 4CLDA 3FMOB 1J56A 2XIJA 1TK9A 4O4LB 5CA0F 5K0EA 4MA4A 4OQYA 4DQVA 1OD6A 1G8MA 1Y63A 4Z9BA 3X2EA 5LNK1 4Y98A 3VC7A 3CISA 1XQ9A 4PLTA 3BWXA 2LKDA 3O1LA 2IT1A 1WXEA 3D0KA 2QMHA 4KTTE 4LDJA 4RY9A 5FI5A 1H05A 3RVPA 1EXMA 2I6GA 3LUGA 1R4AA 2JIMA 4KDRA 1LVHA 4LJ9A 4WV3A 1T2UA 5DHRA 3UHJA 2QUJA 4QZVA 4KPEC 3CG4A 3KZXA 4W5WA 3B70A 4Q66C 1X0XA 4U3JA 4AUKA 3MS4A 2GSWA 4JLKA 5DLEA 1W49A 1R6XA 4L5AA 1AK9A 2RJOA 3UAWA 1ZIPA 3JR7A 1Z5PA 1UWVA 3KOZA 3RVNA 3W1VA 1JLLB 2HLPA 2GO7A 2QNIA 4HB2A 4O33A 2O2ZA 5JYEA 4D7AA 3ZVMA 2W2MA 2IYPA 5CVCA 1GNLA 2XMPA 5G0WA 5C1DA 1NQ5A 1U80A 5MN5A 4K86A 4N3AA 2EKDA 2XQGA 3QF4B 4TYPA 1KQPA 2KBEA 2F8TA 3VR3D 2IS1A 2YVQA 5AWFC 4F5ZA 3I3SR 2YMMA 4E13A 5KPDA 1BGWA 3EXIB 3TTSA 1AG9A 2Y0DA 2P9HA 3EG5A 1Z26A 3EIFA 1D4AA 2ODWA 3CUEF 2H2GA 3TUZC 3IFSA 4KP7A 4ZCMA 5JNVA 4X1OA 2VNAA 2RHOA 4Z1MD 2WRZA 3G0OA 2EJBA 2Y0BA 4INPA 3RVJA 3X1ZA 4A2WA 4DNOA 4TKVB 2QTZA 3GLFB 5IN4A 3TRKA 1NI4B 2XBUA 1JA0A 4NSNA 1RRVA 2RI6A 4MWTA 5IM4F 3PFFA 4UNPA 5HWSA 4OLAA 1F06A 2Y1DA 1UPBA 3AHFA 2QL9A 1DHTA 4JUDX 2ZBUA 1NE2A 4BB5A 5JWRA 3DP7A 2YW9A 2A92A 4FQ8A 4UHKA 4XI9A 1QVAA 1M2VA 3PPVA 1KAGA 4QOFA 1PX0A 1UP7A 2IIVA 3F5FA 3EWSA 3T7RA 4LV5B 3KQNA 4D9IA 1NNUA 1OVMA 4IDPA 5EG5A 1Z6PA 2ZJBA 3RREA 2ONZA 3H2HA 1PG2A 4AO6A 2PQMA 2AW5A 5JAQA 2AFHE 2GTPA 3FZEA 3GEDA 1X0VA 1KHTA 3FW1A 1HNXB 2D0IA 5FNVA 3TQHA 1W47A 5A04A 5BV2P 2WG2A 4FYXA 4M8NE 4NBVA 4C76A 3AYZB 3U17A 2C8VA 1WVMA 1OF1A 2PEYA 2PGJA 2GTHA 2I2AA 4OGFA 1L8LA 3LOQA 5AW6A 1ZJJA 3IAUA 2H4HA 1UBHS 4GFDA 4DR3B 2DR0A 3BVPA 3AL2A 4GW3A 3PD1A 5JCPA 1R9NA 3EPLA 5TARA 4DLWA 5L4LA 4MP8A 2FWIA 3JV7A 4UNNA 4CDMA 1A72A 1T2FA 5A9SA 5J3JA 3Q5EA 4UEKA 2AX3A 2C9MA 5HF5A 2P9CA 2HV8A 4GXRA 1VJCA 5ESXA 4AJ2A 3HB4X 3PR3A 1VKJA 3AUAA 4J49A 5KHAA 3T35A 2A0YA 1XVIA 3GAFA 3IAXA 3IVCA 4MQBA 1AN0A 2QUAA 1E1CA 1TF7A