5LL6P

Structure of the 40s abce1 post-splitting complex in ribosome recycling and translation initiation
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
206
structure length
206
Chain Sequence
b'SLPATFDLTPEDAQLLLAANTHLGARNVQVHQEPYVFNARPDGVHVINVGKTWEKLVLAARIIAAIPNPEDVVAISSRTFGQRAVLKFAAHTGATPIAGRFTPGSFTNYITRSFKEPRLVIVTDPRSDAQAIKEASYVNIPVIALTDLDSPSEFVDVAIPCNNRGKHSIGLIWYLLAREVLRLRGALVDRTQPWSIMPDLYFYRDP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S ribosomal RNA
publication title Structure of the 40S-ABCE1 post-splitting complex in ribosome recycling and translation initiation.
pubmed doi rcsb
molecule tags Ribosome
total genus 44
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2016-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00318 Ribosomal_S2 Ribosomal protein S2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 5ll6P01
1IBLB 4S12A 4LF7B 1X92A 5LMNB 2I22A 1NUHA 2A3NA 3ETNA 2CXOA 4B3MB 1TK9A 2O2CA 3J81A 3OTOB 4GKKB 5IT9A 1C7QA 2XBLA 2E5LB 4JI3B 2CXNA 2CXTA 3M5PA 1T10A 1IBMB 4LFBB 4DR3B 2UXBB 3IFSA 4EM6A 3FKJA 4LF4B 4TOIA 5BY2A 4B3SB 2CXQA 3JAMA 2AMLA 3HJBA 4DR2B 1HNZB 4DR1B 3EUAA 1U0GA 4S1WA 4DR5B 1VIVA 4JI0B 1JLHA 1NRIA 1HNWB 2CXUA 4B3RB 4JI6B 3UJHA 2WU8A 3T1HB 1XMOB 4LFAB 1J5XA 2V4MA 2DF8A 2I2WA 1XTBA 1VI5A 1U0FA 1X94A 1C7RA 1IATA 5I01A 4X66B 3HBAA 4X65B 2UXCB 4DV0B 2UXDB 4DV5B 4B3TB 4LF8B 2ZJ4A 3CVJA 4X62B 2VQEB 3I0ZA 3LJKA 3TRJA 1I94B 4LF6B 1N8TA 2PUWA 2F4VB 1XNQB 1ZZGA 4GKJB 1XNRB 1IRIA 1VI6A 4JI5B 4AQYB 4DR7B 1GZDA 4JI2B 1G98A 1N34B 3KNZA 3FJ1A 1HM5A 1N36B 5IWAB 1IBKB 1HR0B 4JI1B 2CXPA 1FJGB 3Q7IA 4KHPB 2ZM6B 1X9IA 4DV3B 4OX9B 1JXAA 5LMUB 1M3SA 1KOJA 1VIMA 1N32B 3T1YB 3BCHA 4DV2B 3C3JA 3SHOA 3NBUA 3BJZA 4X64B 1JIQA 2CB0A 2PUTA 4M0DA 2ZJ3A 4LFCB 4K0KB 4DUZB 1WIWA 2HHHB 5LL6P 4LZJA 1MOQA 3TBFA 2X3YA 2UU9B 4JI7B 4DR4B 1GZVA 3G68A 4LF5B 2Q8NA 1TZBA 1N33B 4YY3B 2E5FA 3FXAA 2VF4X 2DECA 3PR3A 2UUCB 1Q50A 4YHHB 4NXMB 4JV5B 2VF5X 4JYAB 2CVPA 5FLXA 2UUAB 2YVAA 3FF1A 4DV1B 1MORA 2O2DA 3Q88A 4LF9B 2CXSA 4DR6B 2PUVA 4DV6B 1MOSA 1U0EA 3OOJA 1HOXA 1J5EB 3J7AC 2UUBB 5A2QA 4AMVA 1XMQB 4JI4B 2CXRA 2XHZA 2PGIA 1X9HA 3QKIA 1HNXB 1B0ZA 1DQRA 1JEOA 4DV7B 1TZCA 2POCA 4IVNA 5BR8B 4JI8B 3ODPA 2J6HA 4U6NA 4DUYB 4DV4B 4NXNB 3JX9A 2VQFB 3J80A
chains in the Genus database with same CATH superfamily
4CEJB 1D4OA 4RHFA 5EVJA 1WF3A 3BXGA 4MX8A 2I9PA 3TQQA 4D46A 2IH5A 3L82B 4UEKA 2FWAA 4PX3A 1BN7A 5DFAA 2KB0A 3WNCA 5E7QA 4HAYA 4CMCA 4Y2VA 4HAVA 5M34A 5DXAA 5AI4A 3TE6A 1Q44A 5LLSA 2VP9A 2NVWA 1ZC4A 1T36A 3SVZA 3LQ4A 4FI3F 4IYJA 3ZD9A 5I48A 1OHHD 4FGJA 3FAKA 2XRZA 3VR6H 2XMBA 1I5OA 1Z8HA 1OWLA 3CZMA 3EZXA 4OHCA 1BYIA 4PCLA 4PPNA 3T99A 5ECYA 3QHQA 4XPZA 4DY4A 1TRKA 1Y6ZA 3WJ2A 4HWSA 3D59A 3SLGA 4WK6A 4CG1A 2ZJ1A 3NHRA 1NJGA 4RQAA 3WTCA 3GAFA 1PJLA 3JVIA 3NC4A 1T24A 4NOJA 5CMLA 1GRNA 4HDNB 3GAMA 3ZDCA 4MIEA 4PQRA 1JTVA 2UVQA 9ABPA 3THXB 3UMRA 1N6OA 3PRJA 4Y2TA 1UFQA 3QE9Y 2XRYA 2AR7A 3WVNA 3SWWA 4F1WA 4MAMA 2LVBA 1SHLA 3G79A 2FZ5A 4UU1A 4A6DA 4MO2A 4E03A 5KYTA 1YF3A 2FR0A 3GBVA 1HWYA 3NYRA 4UBNA 3T7EA 1KPGA 3S27A 4UNSA 4WVLA 1FYVA 4TLMB 1KY3A 2PGAA 3T3DA 5CFOA 5JS6A 2GF9A 4B40A 5JT1A 3N9IA 2PUFA 3ROGA 2ZZNA 1YJAA 1R0YA 2AB0A 3U9SA 3UVEA 4HNAB 3VSEA 4ARZA 4WADA 5TY0A 3MJEA 4UM5A 3RLFA 3L6DA 1TYCA 2HSWA 2N75A 4LVUA 1WVMA 1RJEA 5G0UA 4JI1B 4ZHQF 1HDGO 5B7GA 4YJ2A 2YC2C 3EBLA 1L9XA 4A03A 3KR9A 5KPDA 2PJRA 4ZQHA 2Z4SA 1TA9A 1QJCA 2AG0A 4AY6A 3BGSA 3AILA 2CK3A 4HNQA 4II3A 1EDZA 1R6UA 4JL5A 2AN3A 4MS3A 4W6ZA 4X8OA 2Q7DA 1G20E 2GZ2A 4NBRA 3QKUA 1HA3A 2HBZA 1YDGA 3EVZA 3N2GA 5T7BA 5GINE 2Q49A 3GAAA 5GONA 1WKVA 1KOFA 2D54A 1C0IA 2F59A 2JGRA 5JY1A 4L6AA 5L95A 1L6IA 2HTEA 2RGWA 3H2ZA 3A70A 1E18A 1ESCA 3IBSA 4X7PA 1XD2B 4D2IA 4JYAB 3T95A 1XVTA 4YROA 3F6PA 1JFTA 1EK1A 1F4VA 2JLBA 4FW9A 1NX6A 1U0OC 2IHBA 2XKAA 3INYA 4JC8A 3B9RA 2PX0A 3E61A 3ONDA 2FW9A 2H65A 1U7TA 3NZEA 5K3AA 2EHDA 2W6CX 4E4YA 1SXHA 4IRUB 1RQPA 1V6CA 5KWVA 2OBXA 1HT3A 4RBNA 2YVQA 3FN4A 1RXVA 1GKYA 3GP5A 5I5EA 2YCBA 3ICCA 3GLHE 1N0IA 2B37A 3AC0A 3I9V1 2NU6A 4LDAA 4N54A 4X84A 1I30A 2W2LA 4C30A 1XEXA 1HRDA 4J3FA 3ANNA 1H6BA 2NO0A 3IIJA 3TTYA 1JPUA 2XADA 2XVAA 1Z6QA 3LQYA 4YJ3B 1LLCA 4LPKA 3GUYA 2J08A 3BUSA 2A3RA 2HA3A 5A62A 1N5KA 2IYLD 1TK9A 2IYVA 4KODA 2VTBA 3EX7C 4YNBA 1EH5A 3C24A 3DT6A 4YB8A 1I5EA 4RDXA 4GX0A 2PEZA 1LX6A 3HJGA 4HGOA 1NR7A 1PU2A 3VZQA 3ECCA 3CNHA 1Z56C 1XRPA 3IEIA 3DEZA 5FWXB 1XGKA 2GCPA 2J3JA 5JNVA 2PS3A 1TECE 4CM6A 4PYMA 1XELA 2WG2A 1J25A 4RNCA 4TMYA 4TVKA 1TZJA 3L6UA 3CF4A 2FPUA 1YIOA 3I2HA 2WB4A 3ROPA 5AK0A 3TG2A 3LW8A 1JJ7A 1NNUA 4ZMSA 2DJIA 5C46F 4N7JA 5FOWA 1KNQA 4JUBA 3R0IA 2IPNA 1K8XB 4QXOA 5TE9A 3ROQA 4U39A 4DCTA 1VJ1A 1FF9A 5HJ7A 4Q9NA 2PU7A 3LDAA 2Y0EA 4M0LA 3RSLA 1HYHA 1H1LB 1ZH8A 2C2WA 2DAPA 3E3AA 3MB8A 4Q3KA 4US1R 1JMVA 2C3PA 3AV3A 4Z0PA 4E32A 1KMMA 5IAKA 4H1VA 3VNSA 3L77A 3LI2A 4Y18A 1DEOA 1MAAA 3DFZA 4LY0A 4MRVA 4ZD6A 1G9XA 1CY1A 1GN9A 2DR3A 2PV7A 1LDBA 4ALMA 1E2LA 4P7GA 2VPPA 2C83A 4NZZA 3I3SR 9LDTA 1PGJA 1E3MA 4IFBA 1FNNA 3G2MA 1CS4C 1V45E 2QR5A 1WPGA 2VK4A 1EKXA 2GPWA 3G5UA 4BO5A 4BAZA 4E14A 3L79A 3QKRA 4ON9A 4I1PA 5I4KA 1U6KA 1G9TA 9MHTA 2G80A 1P0FA 3HL4A 1I6MA 3MJHA 1AHNA 4R16A 4Y0AA 4O4HB 4FEYA 1VJGA 2PXXA 2ZP1A 1S2DA 3DW3X 3EBOA 4LXTA 5K0FA 2FZGA 1C3VA 4OHZA 1DO0A 2MSLA 4UXJA 1YRHA 2QY9A 4EVRA 1WIWA 2H1FA 5I7EA 5JUWA 4CEIB 2HHCA 2E37A 3OT4A 2BEVB 2EBUA 2R8BA 3HXOA 4OHRA 3NLLA 4CUZA 4K9NA 1OTYA 3EGDA 4D9CA 1HQCA 5DYYA 4XX1A 1RPTA 2HRRA 3ULKA 1GTRA 3U4CA 2GPSA 3G82C 1D1QA 5JD5A 5FF9A 3DMTA 3TKLA 1V4NA 5DO9A 4WNAB 5JNRA 4ZI3A 2O8CA 3N7TA 1N5MA 2WT9A 4P32A 1NMXA 4B84A 2P68A 2P69A 1W6RA 4J0JA 3IEPA 4QJ4A 4DHEA 4EA8A 1HE4A 4CW7A 5EWJB 1O5IA 1PYOA 4MR9A 1AG9A 3AM5A 4Y7CA 2QVGA 2VPIA 1T9AA 3ENZA 1IXYA 2R9VA 5BSFA 3Q0EA 4PHCA 3DULA 4QYMA 4LSWA 5COAA 1OKKD 2P9ZA 4KJZA 4EG0A 1QGED 4WD3A 2C1ZA 1RLJA 4MA0A 3TQHA 2QTAA 3O31A 4OU5A 4R2XA 1R4NB 4JJ7A 3VFDA 4A8HA 4KAAA 2OESA 3ZZ0A 5HIKA 13PKA 1CDEA 3BWDD 4AECA 1XUOA 5C4MA 3H6GA 3ECSA 4KQGA 1P2VA 1VRWA 3OURA 2OBYA 5T67A 3WADA 5AJXA 3FDIA 3RVKA 1W1UA 4E30A 2FWMX 2R5NA 4BVBA 4GKKB 5DCUA 2OWDA 1O5OA 2AUTA 1ECFA 2QD4A 5IC6A 5JAZA 3DL2A 2PT7A 3K31A 1APBA 4TN1A 3R5FA 1IEWA 4PGFA 4R7TA 5TRTA 5CXUA 2WM9B 3NH9A 4I6GA 4WXHA 4DR1B 1U4OA 3HU2A 4MIOA 2PZAA 3GGPA 1D4ZA 2FX5A 4PFKA 3QVJA 2GXSA 4QJBA 4KAFA 1B4DA 1TMYA 2OXRA 1YR3A 2OAQ1 1TIPA 3DHVA 1SQSA 2QV7A 3LBIA 4KTTE 4CQNA 2Y6VA 2DF8A 3RREA 1PR5A 1RXEA 1KEUA 2DLDA 4U3JB 3IP5A 2H1OA 1JLSA 3O73A 1KVTA 3TX2A 4E88A 2I2CA 2HWWA 2I3DA 3GJSA 3TZKA 1MQ9A 1FSSA 2B7CA 4D25A 1RJFA 3CVJA 3TLJA 4QUJA 5CH3A 5CA1A 1VMEA 3T3HA 3VV3A 2FFBA 2O2ZA 3H5WA 4G25A 3EZ2A 3H1EA 1KAGA 1OTXA 1J0BA 1KF0A 1BX0A 4NR0A 1FP1D 3AVWA 1IZ9A 2QGNA 2WINI 4M1ZA 5ESRA 2SECE 4Q21A 5C1DA 4WJKB 1JIXA 1N0WA 4C7OA 1SVWA 1UR5A 2OXEA 5DASA 1CQIB 1J2RA 4ZVKA 4DYDA 2O0MA 3M34A 4HZUA 5JECA 1KY5A 2BKLA 1N32B 1J90A 1KS9A 1GLVA 4D3XA 4QM7A 4CQMB 3IE1A 5F77A 4Z4GA 1SCUA 4NYIR 2WKSA 4NMXB 1LI4A 2AOXA 3LY7A 2WUEA 1MX3A 1Z73A 4KXLA 4MVJM 1L7BA 5THQA 3VC7A 4EABA 5KREA 4LW8A 2C04A 4FFNA 2XVZA 4ECAA 1FOEB 1TT5A 2CKDA 3BXEA 4IW3B 4D44A 2H9AA 1ZRSA 2I6QA 3OHSX 3R8CA 4EUSA 3PNMA 4UARA 1NZDA 1PJCA 2W2NA 4YDSA 1T91A 2H4JA 3VPFA 5EJ8A 5LZ5A 4X6YA 1UAYA 2OCIA 4L6CA 1GVNB 2MMCA 3OCYA 2O5CA 3T3NA 3LC7O 2A9KA 3F78A 4P4UA 5BSGA 3K20A 3ONVA 1MOZA 1SWWA 1OI7A 1DT5A 2RG1A 4FKMA 2VAVA 1R8XA 5EMJA 4ZDKA 3FBWA 4MS1B 3M6UA 4WI1A 3L7YA 1S96A 1KBZA 1VFNA 2WHEA 5A9TA 1A0OA 4U6SA 2YHUA 3BOSA 5MN6A 3DZKA 5KB3A 3SX0A 1DQRA 4WJZA 1B6RA 3OD5A 1KDTA 1L3CA 1UZMA 2LBPA 2X42A 1IG0A 1YACA 5E2IA 3SDZA 3DC2A 3TR5A 3ZCTA 5ABPA 2AUNA 4FFMA 1SVNA 1YE5A 2LCIA 3AIOA 4CMHA 3EPPA 2Y0PA 1YU9A 3H04A 1KH1A 2IOFA 2VH2A 3WWEA 4CMKA 1TJNA 3RUDA 2J7PA 2QLLA 2H9IA 2JBAB 1JT2A 4RKWA 4ZAVA 3OTGA 4RL4A 2QNIA 2OEPA 2YVUA 4MKZA 4QQFA 5DTIA 3ZIDA 3SEZA 3L8FA 2WU4A 3JALB 1Z0UA 3JQ6A 3N0TA 4JJEA 1KQOA 4RQUA 5H70A 3TE7A 4CZ2A 4J6EA 4DYVA 3EMKA 5FUYA 2VT2A 5JSKA 1JKXA 3DG9A 3HXMA 3KB8A 1JNXX 3K1JA 1L5VA 5F2EA 4GM4A 1GQRA 4LS3A 5HE8A 1L4KA 3VZSA 1H4SA 2X9LA 1Q6ZA 4JLSA 1N3BA 1E2GA 1VPWA 5BMVB 4AY4A 2YNMD 4XB2A 3RIYA 1DBRA 1Z22A 2OSBA 4ZYWA 2VTBB 3VZDA 4N3GA 3JQ8B 4XWWA 2BMAA 2QSYA 4EAAA 2BBOA 4URHA 5ITZB 1NUAA 3M83A 5EP4A 3T9EA 3DOCA 4OJNA 4BNDB 1G17A 2E1RA 4KO1S 1QH1B 1V1MB 2IU3A 1A9XA 3THYB 1U7DA 2WYUA 3KSMA 1XKXA 4IKPA 4JELA 5DHQA 2FRDA 6PFKA 1E98A 5DN6A 4B7UA 2UZIR 2AI3A 3UUEA 3LUDA 3WO0A 1CNEA 1DJOA 2DWCA 2JIQA 2CHQA 3IVMA 2L18A 4BFTA 1RRVA 1Z18A 4NYIQ 4WLFA 4HSGA 1LLFA 1UINA 2YUTA 3F5DA 1THTA 4Q3NA 1KI9A 4NYJR 3TFWA 4C5AA 4R84A 3O95A 3TLAA 3R3UA 4CQLB 4JGGA 4ZHQA 1WAMA 2GTPA 4B6EA 1VRCA 4WX2B 5I9LA 3FSRA 1BW9B 4I50B 3TSYA 2DG2A 2GSWA 1TCCA 2G04A 2VQSA 2VYFA 1RDFA 2Z56A 5HF9A 4YECA 4B3BA 4CR6A 4F9FA 1E0DA 1E64A 3LF2A 3RC7A 3BGIA 3ZEIA 4QUKA 1JHDA 1MP0A 2RGNC 1I1QB 4QD3A 3SC4A 2ORYA 2ZYDA 3I8OA 2FEOA 4YI5A 2PYIA 4JUDX 1C3LA 4Q12A 5CJJA 1J42A 4ZT7A 3DBRB 1H6CA 3OIGA 2V65A 1ABBA 3VNBA 4CLRB 3SZLA 3EQ6A 2OTCA 4YTEA 4AWBA 3D3QA 2ACVA 4EB0A 1T2FA 2ZI7A 3ETLA 5CH8A 1Q20A 1UJMA 10MHA 1R3UA 1YKSA 1I3LA 1J9EA 1EGMB 1F2UA 1TYEB 1W2WB 3SSNA 3IP1A 1Z08A 5F5LA 4H31A 3PICA 1JDVA 4YUXA 4NZOA 1FFXA 2FF5A 2B4RO 1VIYA 2CW5A 2NIPA 2QS9A 1Z75A 2XKJE 2NN3C 2OHFA 4X1YB 4WBXC 3VKGA 3B20A 3EODA 4C7KA 4DJEC 4ETNA 2NSYA 1Q91A 4GFDA 4DDMA 4WPGA 2OCPA 3U26A 1SHJA 1SQ6A 4CM4A 2XQJA 3VKFA 3KQSA 4RS4A 3FUVA 4WN3A 1TVKB 2E87A 1LEHA 1SC4A 3LPAA 3AUSA 3DPUA 3P27A 4ZRMA 1V7QA 4FU0A 4U7JA 3TB6A 5CAEA 3RFTA 1YKGA 5JAMA 1NJSA 1ZK0A 4WNYA 3K0CA 2I62A 3QELA 1UZAA 1QAOA 1XO1A 1WP4A 2CLCX 4ZCQA 1M83A 2H1CA 1UOQA 1HKUA 2JLYA 1Y82A 2J59A 1U3CA 1JX6A 3QVUA 1AS0A 2IUUA 4MRMB 2CJWA 4EQZA 3CEJA 3WK7A 3KR2A 1J0AA 2PFGA 2YICA 2IW1A 2ZVQX 4P7BA 5HS6A 2WJAA 2XBLA 2Q6LA 3QBJA 2C96A 3QUQA 1I3OA 2FQWA 1QHNA 3KP1A 3R5XA 1WNTA 3RDPA 4XPIA 5C9ZA 4O0LA 3MWGA 2X58A 3C3AA 4KU4A 4LSMA 2HPZA 3EJ6A 4Q1VA 4R1NA 4TOIA 1I2CA 3EW7A 3QF4A 2SNIE 1KDZA 2GZ1A 1IVYA 1TZMA 1JLHA 2B35A 3I9KA 4HDMA 4BU0A 1JG1A 1G8AA 3KZCA 4QXMA 1Y9AA 2GNPA 2IVFA 1QH9A 1EUDB 3M2TA 1M0WA 4NEGA 2I3AA 2R6AA 4BMCA 4OXXA 3NM5A 1U7PA 2QUBA 1SUIA 3G2NA 3LY8A 2JVJA 5CT4A 3QQPA 5AW8A 2K87A 3ZGYA 3A1NA 1R4AA 2OHOA 2HNAA 2HJHA 1KO7A 4XWYA 3N07A 1KA9H 3FR8A 2PZKA 4Z53A 1Y37A 2FMIA 4N9WA 3OPYA 3RS5A 4I36A 4INAA 1HE3A 4IS2A 2CVZA 1YZLA 3DXFA 5K0TA 1EVJA 1U2DC 4BV8A 2W93A 4ND2A 1FNCA 4Q48A 3D2AA 1ARZA 3LXRA 3GMDA 4A73A 1TQ4A 5L7WA 4KRFA 1C14A 1GA1A 4FIDA 3FZQA 2IH2A 1QAMA 5JIBA 1EWVA 1W5FA 2HRDA 1AGRA 4I3GA 1VYUA 4DLWA 4MAAA 1M2VB 1P3JA 3AEUB 2A30A 4MI1A 2CXPA 1AUVA 1KVQA 2JH8A 2P91A 4MGZR 4S35A 3GYBA 3AEKB 2D1QA 1KVUA 3Q7QA 4LZPA 1LGYA 3HYCA 2YN2A 4RABA 4X44A 1GOTA 2PQ0A 3P26A 1IY1A 3QOYA 3TSAA 3CPEA 3E53A 4NP6A 1Y7IA 2EATA 3L8CA 4FNAA 4IX1A 1DQPA 1I4WA 2A78A 2O2JA 3N0WA 1VJ0A 4P7KA 4BQIA 4EMBA 2RK4A 5CG1A 2FPIA 2MMGA 5HP4A 3SBXA 1XHEA 2JD0A 2Z3VA 4PPFA 2UZ3A 1UXGA 1T15A 4CEJA 4MV6A 3H42B 2DMRA 3STXA 2R6FA 3FGOA 3MS4A 3CUEF 1IQ0A 3GLQA 4FR0A 2TECE 4GICA 4IH4A 1KQFA 3QK7A 2O57A 1GU1A 3TDKA 1ZPDA 3SFZA 4D9JA 3U44B 1YOVB 4HPJB 4ECEA 5A3RA 3MWLA 3BHMA 4FOSA 2NXCA 4ZFNA 3QJGA 4MJ3A 4IGKA 4YRSA 3FOEC 1JYEA 2IGBA 4H2DA 4L9WA 4LCBA 2O0HA 2V3VA 3C2QA 3UG6A 3V33A 4ZJZA 3BGWA 4K6FA 3CX4A 4D3SA 4DJTA 5FHRA 5KX5F 5F3RA 2HHJA 4J1NA 4EI2A 4XFJA 4JI4B 1QF9A 4R41A 1M1NA 3WL6A 5HQ3B 4P3NA 5AW9A 1DJLA 3ABQB 2A2ZA 1R0BA 1LDEA 2VNAA 2Q0XA 3WBKA 1FJXA 5UKDA 5HPYB 5EAIA 5ALEA 1Y8ZA 3OJEA 1RC1A 4P93A 2M1XA 5FB3A 5K4GA 1L4HA 1AS2A 2WC1A 4GX5A 2OXCA 5LP6C 4JS0A 1TFRA 4B6QA 5ES4B 5JNWA 1WETA 1DADA 3JYOA 4IV5A 4NABA 3AO0B 2PUHA 5I7VA 4XWGA 4GR4A 1X74A 4HTFB 1OIXA 4E07A 5LYJB 1WZ2A 2EWVA 4XASA 1ISIA 1FMTA 3KU4A 1G5IA 4F4DA 1A5TA 1MUUA 4JX9A 3D0RA 4ZP1A 3W2GA 4P0PB 2VHUA 2ZTSA 4HNAA 1DB3A 1XZIA 3OM8A 4IO1A 3LY9A 4X9XA 2PO5A 2J9FB 1T1RA 5LPNA 4JP3A 3HVIA 1YGYA 4Z0TA 1OFUA 1W4AA 2VLBA 5T8KC 1U8UA 1FRNA 1Z4PX 2BOVA 2Y77A 4M1TA 4B47A 1HNWB 4EY8A 1EJ0A 2H59A 4I50F 4HP8A 4OREX 3WKCA 3OKCA 3G88A 4MVXA 1P9WA 4GQBA 1ZG3A 3UAYA 4CDMA 3TECE 1A3CA 2QV0A 3ZZUA 2WJHA 3PZRA 3PXCX 1J00A 3USZA 5KNBD 1NR5A 1MHTA 1ULBA 1BYUA 2JJQA 5I01A 2WMYA 5C2JB 4Q37A 1DG1G 2ZRHA 4N7MA 1M0TA 2JIBA 1P9NA 3BRQA 1SU6A 4Y9RA 3FTNA 4CFYA 4G3XA 2A4MA 1SQGA 4XSHA 2R1TA 3HDTA 4HI0E 2NXNA 2JFGA 2W6NA 3Q3VA 1AZLA 3TOSA 3VOBA 3IXMA 5F1KA 3OQMA 1TA4A 3RC2A 4AU1A 3HBJA 4NZ9A 4OK5A 4ZYYA 4RGYA 3C7DB 1JAHA 1NASA 1Y1KE 3TCKA 4MV3A 3LL7A 1QH8B 2PYDA 3T12A 5TS3A 4B74A 1T4GA 2EIXA 3KEGA 3PLRA 2FNAA 4NZNA 4QUAA 5H83A 2C3YA 2A1UB 4A6PA 4Y2JA 5JC8A 2YWXA 3HEBA 4F3CA 5K3BA 2HADA 3K8YA 4JA0A 3A2KA 3ORRA 1U28C 2WIDA 3KV3O 4F92B 1H2WA 3QLVC 4CRWB 1N3YA 2YH2A 1IM2A 1GPYA 1VL8A 2Y1FA 3F6SA 2BFOA 4N76A 3GRUA 4ZXFA 1Q95A 2BGRA 3HCNA 4HRYA 4KO8A 3KQYA 1VE1A 3NGXA 5E6UB 4BNLA 2VF2A 5SZKB 4X00A 3NHJA 3H16A 2P5YA 1I7PA 3FDJA 1MDFA 4PZAA 4XX0B 2AHOA 4Y9SA 1MN6A 5DWQA 2HIHA 4MO9A 3S7ZA 1L5HA 4EQ6B 4QECA 4BJHB 4BQNA 4FDVA 2YFHA 2WP8J 4P34A 1GARA 3O8QB 2GTIA 4Z4FA 3VHXB 1ZD9A 4AW9A 4F5WA 4M8KA 1YULA 5ESWA 1DMSA 2E2WA 1VZ3A 2J07A 1OWPA 3W8DA 4EVIA 2X8LA 2P5UA 1AK1A 4X6XA 2Q3BA 2Z1NA 3G0OA 1P0QA 2YW2A 1J8MF 3JZFA 4M2LA 3UATA 3GLRA 1RSZA 3U37A 5FWXA 1IBCA 1T4BA 1W4CA 4HYTA 2OVFA 3V4RA 2XUFA 2Y1EA 5J4KA 2IYFA 1I14A 3JVDA 4C3UA 1HL7A 2ZGVA 3B2QA 2ZQZA 4JH0A 4LE2A 3RTEA 3LP8A 3AHCA 2QRKA 3FNIA 3QP9A 1ANKA 5SY4A 2BTQA 3HCBA 4J0IA 3RR2A 3DMYA 4J29A 1FLVA 1G3UA 4NOMA 2YOHA 2XMGA 1QOZA 1SUPA 3QE0A 1KPIA 5SV2A 3ZXYA 5FTMA 4CTNA 4OB6A 3VYRB 1BRMA 2Y2UA 3GR6A 2FUNB 5AESA 2CNKA 4JC0A 2VHQA 4DQVA 3HKDB 1GPLA 2BJHA 2J9RA 3QKTA 1NG9A 4QPZA 1ORTA 1TA0A 3DKIA 3DZDA 1ZM7A 1O1YA 1A95A 5DYWA 1Y4AE 4DOMA 2R2GA 2YHIB 5HOEA 5ALJA 1CR4A 4YPVA 1G6OA 2XMDA 3WK8A 4AROA 5KDLA 3F9IA 3L6EA 5L4SA 2PH1A 4TWZA 4B83A 1VM6A 5FLEX 1SUDA 3I8SA 1X6VA 2GZDA 1K97A 2OMKA 3VX4A 2WNIA 3BSSA 3NPAA 1NY5A 4UVHA 1BGVA 3DZJA 5EIHA 1ZM9A 2RHOA 4D97A 1COWA 1QR2A 2NPOA 4YAEA 1F2VA 4B32A 4BS9A 1Z4OA 5LDDC 1FZTA 3RIGA 1E32A 2YINC 4EF6A 1RZRA 4R2HA 3I05A 3CGWA 1ZK1A 4HX5A 3WQHA 4EKYA 1ILEA 2B94A 3MAJA 4UZEA 4CEIA 3PLNA 3C1OA 4PZZA 1V16B 1GWNA 2BEVA 3KYDA 4HGPA 1HKHA 4IIFA 3K70C 2UVPB 1ISPA 1Z28A 2C7QA 2P6NA 3TJZA 2O0LA 2HDHA 4IDHA 1KKUA 1UCFA 5K01A 2G1PA 2D13A 4GGOA 4PRZA 1A76A 1IE3A 1PG2A 2GS9A 2H92A 2GK6A 3FZEA 1E9BA 4PWZA 4QAQA 3TNJA 4B33A 4Y2RA 3HCAA 4MPRA 4K9DA 1T8RA 4RA6A 3O6VA 3VUEA 3B9BA 5EZ5A 1X7YB 2A86A 3TIGA 3EF3A 2IP4A 1K6IA 1IK6A 5L3VA 3KOUA 4WIAA 4F2HA 1JUDA 1M54A 5FUQA 1AGXA 2WWIA 2XNJA 3MGKA 1XCPA 4PBSA 1EXVA 4B7CA 2XQGA 1KZHA 1WW3A 2GAJA 3NO4A 3TD2A 2OHJA 1Q3KA 3BDAA 3ADBA 4QVGA 3ETDA 2ZYVX 3JD4A 4HWGA 5B2EA 1EE9A 3AR3A 1PQPA 4HN2A 2OL4A 1ADCA 1CUCA 4UXIA 3VOAA 1R6TA 4N7BA 3LC1O 5B1YA 4U9UA 2H51A 5TPZD 3ZVMA 4CT0A 2VWQA 3DFIA 2HSGA 3G02A 3HJHA 1WV1A 5JYEA 3WRYC 1DKLA 1G7TA 1VPEA 3GJ8A 4MRSA 3SPXA 4O29A 1PE0A 1IPEA 2CCJA 1SBQA 1KZ9A 3GEEA 3D7LA 2FEMA 5EUQB 4AC9A 2A9VA 2CBGA 5EMNA 3BMCB 4EPRA 2ID4A 4G41A 1JAZA 1SIBE 3W4KA 4KSCA 3NEPX 1UWCA 3UAXA 2C00A 2VP4A 1YZVA 5IAGA 4BJ6A 1AGYA 4II2A 4F4FA 1RRGA 4DL9A 3TUZC 5AKGA 2JAQA 1J8QA 2KS6A 2Z4TA 2PPLA 3H6HA 3SQOA 5JYDA 1WBBA 2IHUA 2JCYA 1EX9A 1U2ZA 4KQFA 5J3JA 3KIPA 1XRJA 4B8YA 4B76A 3GVHA 4PPQA 4DNFA 1FFBA 2DR0A 3G1TA 3Q8KA 1JEYB 1IN5A 2E6UX 2IIPA 4KLNA 3L92A 4PYQA 1E2MA 5GQSA 1U2QA 4RCYA 1MW8X 1U3VA 4HQKA 4JFRA 3ZGZA 4BC0A 2QM7A 3OLXA 5TQ2B 2CHEA 2AQKA 4UEJA 4UATA 1MPXA 4J03A 3WK6A 2Y1LA 4LX0A 5NLLA 1VSQA 5G41A 4KH0A 1P1FA 1UBJS 3ADPA 4FS3A 3WYBA 2WF6A 3DD1A 1JKJB 3M6AA 3M4XA 3MXOA 3P52A 4I55B 5DE3A 4DF3A 3T1TA 4HX9A 1XA4A 5AWFC 3F2IA 3OCWA 4CEHA 3AKEA 1B14A 1V7ZA 2NP6A 4Z0NA 3CN7A 2BGJA 2ZM5A 2RH9B 4FP9A 1DMRA 4AKHA 4FEEA 3HI6A 1D4AA 1ZGAA 1KYIA 5JXGA 2EX4A 2PX5A 5FCDA 3GARA 5FI1B 5K4HA 1CQIA 4WZAA 1Q2XA 4K26A 2IL1A 1X8XA 3W5CA 2RBGA 5DDIP 2SBTA 2FX3A 3HA2A 4M1QA 4YIKA 2YV4A 1NI5A 5KOJA 1EYZA 2ZZMA 1G6KA 1E99A 3AYXB 1U9IC 2FZKA 4MAFA 4PLVA 4YP0A 3JD3A 4F46A 2FSVA 2DRIA 2PS1A 1PX0A 3BF8A 3DZ8A 4LHWA 3LX8A 3WP0A 1AK9A 2QYSA 3KJZA 1XDSA 2D1RA 3M9XA 3C7TA 4WY2A 5ED0A 5B7NA 4WINA 1HTTA 1QPBA 1UJ5A 3D4PA 4KBFA 4BWVA 2D06A 3HM9A 3CUTA 4X1IA 1R0KA 4OSPA 2MYTA 5DGCA 4E12A 1CX9B 2ZBPA 3MTJA 3A9UA 2D5AA 4UREA 3MT9A 4ZARA 1DX4A 4A2QA 1EFPB 3HCDA 1CE8B 2I8AA 1I24A 4JYMA 4YDHB 3VR4H 3H4MA 3OKPA 1OI2A 4IILA 3QLUC 3I9OA 2R2AA 2AYXA 3SNHA 4REQA 3MHTA 4QXRA 4A0HA 1PTKA 3NU1A 4AJ9A 1B6GA 421PA 3DPSA 4QFMA 4IAOA 1U9CA 3AJEA 4G9GA 4MS1A 4ZT3A 4YUVA 3CCCA 2G0AA 2PTGA 1PDOA 1DAIA 5FUVA 1HE2A 1N92A 2BFMA 3UWMA 3LD9A 3PEFA 5LIPA 3U7RA 3LWBA 2QU8A 1A7AA 2P2ZA 3C48A 4DIEA 1ZS9A 4GI2A 4WLUA 3VNQA 4K9RA 1KMIY 4JDUA 1B8OA 1N2HA 3CONA 1KK3A 4E33A 1UDAA 4ZVNA 2OM6A 4OMFG 4WBSA 3SY8A 1MC5A 3BCRA 5H3HA 1FDRA 3RWBA 2CMFA 4NNJA 3FMGA 1BVRA 5FUBA 3KKEA 2EZ4A 4J94A 4M0KA 2YR0A 1QFSA 2RH5A 2R6CA 3LZDA 1D2NA 1VL6A 3SLKA 2QYOA 3RYCB 1AF4A 2PYZA 4ZPJA 3R5SA 4PE5B 1YMUA 1EZ1A 1UJBA 3G2KA 1FFSA 3JALA 3MMZA 4G5GA 5DXFA 2I8CA 5FPKA 3QPAA 3LUKA 3PIRA 5AW5A 5JHGB 4P0TA 3CKYA 3I9JA 5A5EA 4KPEC 4RK0A 4FCVA 4DV6B 5JCZA 5KX5A 3Q5DA 4HMPA 1J2TA 4BMOB 4DLYA 3I30X 3OX2A 3LA8A 4F6CA 5EQTA 1A5AB 1JFFB 4BBJA 4J1TC 3HBFA 2CXRA 2R0QC 4WLOA 1AKYA 2CMHA 5ALNA 1TZ2A 5JLAA 2GDZA 3JQ8A 3IHWA 5EGSA 4YRIA 1ODJA 3TGPA 2CNOA 4BP9A 3O8NA 4F5YA 4BQFA 1Q0HA 1P2GA 2I6GA 3VGPA 2XQVA 2Z5LA 1K4YA 2H0RA 5IDYA 4I1UA 4BNDA 5FBRB 4D4MA 4DV4B 1T2VA 3EZ7A 1NBMD 4EOGA 1UBHS 2GA9A 3I9FA 1HV8A 3IXLA 1QH1A 2YNMC 2ZUCA 2Z2IA 3AHDA 4X41A 2F43B 1YS2X 2A9JA 5DU2A 3ER9A 4XVCA 4GKAA 2FPPA 3WLKX 2EEPA 3RSOA 3H7AA 2CNDA 2HKIA 1UKYA 3OEHA 3NGMA 4Z99A 1W6UA 3VR2A 3X1YA 3DMRA 4ZK2A 3W78A 1Q1AA 1X7XB 4HQ0A 1CF4A 4PLTA 1FTGA 5IFKA 1ZCJA 3HWX1 4MWTA 1G20A 3HU3A 4ZODA 3UUFA 4OYHA 3GDFA 3ZUPA 1YZYA 4BMVA 4B3SB 1Z2EA 2CXQA 4XLTA 4P4LA 2K7ZA 2NAPA 3B82A 4B87A 1BW9A 1Z5NA 4I50A 4DLNA 2RFLA 1EDBA 3PITA 3TTVA 5CLFA 1QHFA 1BE8A 1GFZA 4ND6A 3I53A 5FEUA 4RTQA 3OTIA 3BWVA 3GT0A 2ZJZA 4R1UA 5BVGB 1GP2A 2QTNA 3O8LA 1RKVA 3TRKA 4P81A 4Z4QA 8MHTA 1VLMA 3OJFA 4Y2GA 3RRMA 3F4KA 4MWZA 1DQSA 4X66B 2OILA 3DBRA 1DXYA 4JSTA 1D2AA 1F14A 1WHSA 1M67A 1RXCA 5G1OA 5SY9A 4LVOA 1WKCA 2H2AA 3FRIA 4Y0NA 5I7HA 3NS7A 5BSMA 5GZ3A 2B34A 3MLEA 4IG9A 1XDUA 3PVZA 1GYRA 3I2KA 2WFLA 4B7AA 5AVYA 2XEXA 2IP2A 1DDIA 5H02A 1YDHA 4DJDC 1WVGA 2C29D 2HC9A 2I4OA 4C20A 3LAWA 5CT8A 5EZSA 3DGEC 1RMTA 4ZXPA 1M2GA 1JAXA 2GEVA 3SDSA 1E3IA 3HWSA 3OC0A 3RVRA 5IXSA 1GTL1 4KHPB 1Q0QA 5ENDA 2HQ1A 4V2IA 1QOQB 1LJUA 1H23A 1TJ5A 1DKNA 2W2OA 5CITA 1OZHA 2YIJA 1LW6E 5AJUA 1WE2A 1GPBA 3DCJA 3R20A 4J9VA 4MYCA 4ZYTA 1E5VA 3IUBA 1GZ5A 1EQ2A 1QRSA 4AY3A 1GLNA 2O06A 4B0OA 2Q6OA 1ABEA 2TRSB 3MT7A 4Q3OA 5HF6A 4FJ0A 4EUFA 3TF5A 3JATB 4JYZA 4MRMA 1T34A 4KBYA 2EFDB 4UUBA 4FINA 3WNVA 3ABSB 2MINA 2FK8A 2V6MA 2JJ2A 3M4ZA 5HMLA 4YMSA 2IWHA 1H94A 2ZWVA 1L8LA 3FVRA 4PGGA 4YXWA 1AZWA 1LDMA 3QGMA 1G4AE 4JODA 4LGVA 1ACMA 1G5PA 1JAIA 1GAEO 1NKVA 3KR1A 1SKMA 3QI2A 2WWWA 1D2HA 4R69A 2A6PA 2KE5A 1EX1A 3GZ4A 4TTIA 1LFDB 1R8YA 2F3PA 3WAGA 3T52A 2CL7X 3JD0A 1N2IA 5A5DA 1IOVA 3GFQA 3OA2A 1JHOA 4G8BA 4R5MA 5ITVA 2R6DA 1DRUA 4GRAA 4JLNA 4PQEA 4V0RA 3WFZA 4GQIA 4C04A 1LCIA 2WHXA 1X1EA 5HF8A 2IY8A 4AKEA 2JFWA 4U7TB 5JPIA 3S40A 2Q3HA 1Z38A 1GCIA 5C7LO 1OWMA 4ZOLB 1CRLA 3LVFO 3OIWA 3ZZNA 5KVAA 2VDJA 3AKDA 3GLIE 2Q2NA 3VM6A 5C8DA 4HD8A 3MTQA 1CFZA 2NQ8A 1AKMA 3AETB 5CD9A 3M3DA 2BSXA 2AK2A 4QPPA 1RQLA 4UFOA 4NCIA 5TF0A 3TNDA 5KSZA 3PDHA 4IXWA 5HKOA 3K15A 3AU9A 2NQ2C 3MBKA 4ZCIA 2PMKA 1VE6A 4ZCTA 3JRNA 3QBEA 1MA3A 1ODFA 4NPHA 3L4EA 4NFYA 3AV0B 1CUGA 4HGQA 4BN4A 1JECA 4WV3A 5CLIA 3WHLA 1Z5VA 4QHSA 2GO1A 1Y6FA 3C85A 1VCOA 1Q0PA 1TVEA 4PRKA 4MUGA 3E81A 3AEKA 4L5JA 1PQYA 3U19A 2DQKA 1U90A 3GJTA 2NUBA 4U63A 2R5WA 2QVBA 1WP9A 4JJ4A 4ZQBA 3EZGA 4RNDB 3ZWDA 1A9RA 1FDSA 3A4IA 3M1YA 4RS3A 2M6SA 5TS2A 3Q5GA 1L3BA 2ZREA 3OEEA 4FYIA 1XPOA 2H9YA 4B3TB 3NGLA 1DLIA 3PS9A 2Q0QA 5ENVA 1OY1A 1V96A 1LLQA 3ER8A 5ALRA 1FPQA 2NT3A 3DUFB 1G1AA 3VC3A 4JN6B 5DX1A 1KBOA 1P1HA 5J63A 2ZBFA 3RHFA 2ZXUA 3AW9A 1O6GA 4V2UA 1YOVA 3MYRA 4H7IA 3TLXA 2XI4A 4C07A 1MDBA 2YZ2A 1M5TA 1PS9A 2O1EA 5FA8A 3OI7A 3WGYA 3I37X 3TL3A 4N82A 4FUQA 3RBAA 2RAPA 3HNPA 1D9ZA 2ZT6A 1KR5A 1E5QA 4MYRA 1BE1A 3RIHA 4ZEXA 2WIGA 3LW7A 3WQQA 4EUNA 5BWOA 5JEEA 4LOAA 3ZHRA 1N25A 3E7WA 4FX5A 3NWOA 2JLAA 1E2KA 4G1BA 1H8HD 4PC7A 1ML3A 1LF5A 4U7DA 1SVIA 4G5YA 2AEMA 4C5BA 4A91A 2FPKA 5DX0A 1X15A 4W5QA 1A9SA 5GM1A 3ROKA 6YASA 1RYZA 4ZT5A 1NNEA 3Q8WA 4KV9A 1ULZA 5GP1A 2Z5GA 3PQCA 4GMFA 4IBOA 1UDRA 3B53X 4DG5A 3EWAA 2ZRCA 4OQQA 4S24A 3NX4A 4HTFA 4GLLA 4R9SA 5JDIC 4HNVA 5BNTA 4LPSA 5DLDA 2ZWOA 2EVWX 2ZTHA 1LKZA 3TBHA 2AFHB 4WUTA 4DQLA 3KDAA 2VT7A 2ZR8A 3Q88A 2R00C 4HB4A 1G3IA 5ALKA 3NWJA 4RXUA 5FL3A 1XZHA 3TW6A 4JQOA 3VR5D 4ED9A 3OESA 5BUQA 1FTWA 1INLA 1CDOA 1SEPA 1QP7A 1PTJA 1BMTA 3KJEA 4FFBB 2XAUA 1DX9A 2QVCA 2QXUA 3L7NA 4MI3A 5G3YA 3RTBA 1T3TA 5K6AA 3L7JA 3NMUF 3R3SA 5JCXA 3TB4A 4O33A 4Q3CA 1RZUA 4TM7A 3LUPA 4ZTZB 5LA6B 2ZLBA 2DH6A 3FFBA 4NICA 4GI3A 4DUYB 1KNXA 4LJYA 2P7HA 2MYUA 3M0EA 1PFGA 1XZEA 3M3PA 3MLAA 3NKVA 2WV7A 4NZYA 5DJ5A 5C1OA 3NV9A 3MN1A 3LOUA 5JW6A 2HL6A 5JARA 1GQQA 1NVTA 2OBFA 3K4PA 4FLFA 4OFZA 1XZKA 3SYNA 2X8JB 4AURA 2CJYA 4XM0A 3ZWQA 1JIVA 2JLCA 5JROA 4D9BA 4OGKA 1AX9A 2NUAB 3TM4A 5EHZA 3CB4A 1UT5A 1VB3A 5G53C 2A1UA 3RK0A 1H0SA 4PSKA 1OAKA 5IN4A 3HYNA 3KWLA 4EY5A 5JI3E 2UYCA 1U5AA 4X54A 3LSYA 3G2QA 1WRBA 1UJNA 4XXHA 1CQJB 5BR7A 1Y1QA 3UAWA 3EG9A 4PSVA 2B2CA 3WMEA 2G09A 3NIBA 3M5WA 5E6UA 4G5HA 2W6OA 3T1QA 4UZSA 3WWPA 1GV0A 1YQGA 3K05A 3L49A 4CV1A 2VI5A 2HT1A 2GFIA 3IVXA 1SOWA 1MX1A 5M2QA 1GUZA 2XZPA 4EQ6A 1TUBB 1WKBA 1UWKA 1CUAA 2VPYA 3K6JA 1QF6A 1IUKA 4LJSA 3JWGA 2JFVA 3PUHA 4PO8A 1D3AA 1NSTA 5EI5A 3U49A 1Z4IA 3GFPA 2FN9A 3IAS6 4JAVC 4W9NA 3RODA 1MO3A 4C4RA 2QZ4A 3HPRA 4CQJA 1RHUA 2A1TR 3BE8A 1QYVA 4QDZA 3T94A 3TQSA 1VYHA 4BY9E 1KAQA 3MINB 3N74A 2Z98A 4DGSA 4O3MA 1J99A 1VCNA 2Z57A 3BMOB 3UPDA 4BLOA 5L9AA 4RMGA 2PGNA 1MIHA 3IAEA 3AT1A 2GD2A 1U3UA 2GJ8A 3IUNA 5BMOA 3MB5A 4J2OA 3KLPX 4ZHSA 2X6TA 4QBHA 1RP1A 2W48A 2CDBA 1XD8A 2GXAA 4GPEA 2G9QA 2V0GA 3BJZA 3HKCA 2HRQA 2YV2A 3NDRA 2W2TA 3R0JA 4EATA 4L51A 4XOIA 4MPPA 3MIIA 1V8FA 2FWPA 2DPYA 3GHHA 4EG8A 3FSEA 2QN3A 1ZITA 3DBVO 2J30A 3LECA 5CRIA 4MDYA 4ZOLF 4E5SA 1H5UA 1C9EA 1TTHA 4LZAA 1UBRS 5JH7B 4RW0A 3GGGA 1ACJA 5MGNA 5B53A 2ZDGA 2AXEA 3DBHA 1XIVA 1SXGA 4BU1A 2BMDA 1VMIA 3EIOA 3P2JA 3TH5A 5JD3A 2TMKA 1Q19A 4Z0HO 2ES4A 2GYUA 3CW2A 5EWLA 3GRVA 3MZ0A 4K81B 2J3LA 3UJ3X 2OENG 2YHIA 2HNKA 3O90A 2VS1A 3HYRA 3PFCA 3JR3A 3V42A 2EWWA 4EDFA 2IYXA 2AG1A 1G5QA 1QLHA 3NUQA 1ENOA 1RLMA 3PE6A 5CXXA 3PYMA 1AE1A 4C4AA 2RK6A 2D59A 3IE2A 3PTAA 2VXBA 1GYQA 1JN0A 3PNYA 2XT6A 2G1JA 2RH4A 3V7NA 4NJMA 2D5CA 3UBTA 2IPMA 3KWFA 4KN9S 2CK3D 5ALMA 2QROA 3VPBA 2G6TA 4H3KB 4Q1FA 1XVVA 4XSGA 1V16A 1XRMA 3CUKA 3WRVA 2X0KA 3EZNA 3C6XA 3D8UA 4MR8B 5AW7A 4ZI5A 3BWCA 3FYUC 4YCMA 3ZHQA 2ODBA 1P3DA 3BL5A 1EXDA 3CLUD 1IBSA 4Z8YA 1QYRA 1N6LA 1WXFA 3GD5A 4Z86A 1X77A 3AUKA 3H97A 2RKBA 3IDOA 5G02A 4XRGA 3IR6A 4Y2QA 5FAXA 3E48A 4E22A 2AFIE 2OZKA 5K8LA 1ZQ1A 5INTA 3VDRA 1NSFA 1DIGA 3DR5A 2OPHA 1X7YA 1G5HA 2IKSA 1PGPA 2ZBGA 5HRCA 1NRIA 4OHUA 5EUMA 4ZCLA 2AZDA 3QRWA 1JVNA 1AC5A 4S1PA 1DHTA 4I8IA 4EZIA 1NE7A 5JMOA 1X38A 3VKUA 2A0WA 3CC8A 3VU3A 2B1GA 4QTUB 2KLBA 3EEYA 3MWDB 1HTBA 4J9UE 3OICA 4ZOBA 5ADVA 4BTEA 4JKYA 3C1TA 5BR4A 2YXPX 3CQ9A 2REQB 5F1OA 3STYA 2JG3A 3CT6A 3ZN2A 3NATA 4B6SA 4H0FA 4Q4HB 3FWHA 2FX2A 4GPBA 1YAJA 1MNQA 1Q83A 2IYEA 4KAJA 4DIMA 4M1MA 5C8ZA 1DIRA 1NP7A 5LZ7A 1EVZA 3PZBA 4HFJA 4MUKA 3EYAA 1XNRB 1JT9A 5IPFA 2WUWE 4M1SA 4IJMA 2I99A 2IK8A 2QLBA 3LKZA 3VR4A 3VNRA 1BCRB 2HCFA 3CW9A 3II6X 1WXDA 1ZWLA 3BMCA 3OP4A 1JSXA 4XR4A 4DB4A 2RGBA 3KFVA 5KNLA 5DHTA 2HY7A 2XLCA 2BR5A 2CBXA 3GK3A 3K0AA 2FP4A 1IEXA 1ZH4A 3L2OB 3S2YA 5AVSA 2EC5A 4Z4CA 5HHTA 5K51A 5LKRA 4N8DA 3QEMB 2G9NA 3BFJA 4ASUD 1N3LA 4I2NA 5JATA 4FTWA 4MLDA 4KYTA 2GUGA 3FCYA 5I9SA 2YWEA 4KMSA 4XWAA 1MGOA 4ETWA 3ZTYA 1NOIA 5K6TA 2OBBA 4WKNA 3I9MA 1JEYA 4D9KA 2XVYA 1OA0A 3Q87B 4LDQA 3FFAA 2FZ4A 3LL4A 5CH5A 1DIAA 2QENA 4LC9A 2PANA 4CKYA 3K73O 4UBKA 2W8BA 3IGFA 4UNQA 3DEIA 3B38A 4BECA 4C7MA 5K0ZA 3S2UA 2Z58A 4DXAA 4RJKA 4XFKA 5I4BA 1SRRA 5T4BA 1OUMA 3KXKA 4H6XA 1RYYA 2NZ2A 2RHRA 1NJ8A 2JD1A 3P7MA 2V7GA 1KFCB 1HDRA 1JA0A 1M33A 2HA6A 3VGJA 5DHRA 2JI6A 3IO5A 2WJGA 3RSGA 3G8BA 1XLWA 3UPTA 3CVUA 1SB9A 1CUYA 2ODNA 1VA5A 5EERA 2NG1A 3JQ9C 3TMAA 1K98A 4XQCA 1WMSA 1JV2B 1PBTA 2O2IA 2ZB8A 2OO5C 2PO7A 3PQDA 4ND5A 3SXUB 5HWSA 5CXQA 3Q8MA 1QFXA 3DL0A 4ZEMA 5BR8B 3UYKA 5FOQA 3OFSA 1EDEA 1CQZA 1ZVQA 5FT9A 1XTPA 4KMRA 1IOLA 1W1IA 1LH0A 4UM7A 1EP9A 3TUJC 3LCJA 1DTWB 3GNLA 1KWGA 1E2FA 3ANSA 4LDZA 2B61A 3NKFA 2B7BA 1K06A 4Y6RA 4KX5A 3WWYA 2C7PA 4EA9A 3V2GA 1FDUA 1JMKC 1WM1A 1YS4A 2QYTA 4BNZA 1HDIA 3FI9A 1XJWA 3K0FB 3N6VA 1K68A 2O2SA 5DIFA 4IIHA 3FLEA 1BRTA 621PA 1FNMA 1PI3A 3EPJA 1IBMB 4QZVA 3IUJA 3UK7A 5CT9A 3BL8A 5F9HA 1RIIA 4IGAA 3KYCB 3ILYA 4P8RA 1E0SA 1GNRA 2BCGY 1P1IA 2O5RA 1SUWA 1XP5A 2N3ZA 1YK0A 2WRZA 3OVMA 2G07A 4TPKA 4X20B 4HWTA 2WZBA 2F55A 1EFVA 4RAQA 1XMOB 4G0XA 2VUTA 4LV5B 2AN5A 2ZE7A 4RMIA 4I1RA 5BQOA 3O21A 5FR1A 3H2JA 4XD7A 3Q9LA 5AKIA 4C6TB 2YIDA 1TEHA 3X1WA 5ERYA 1XKLA 2DSTA 3HL0A 3L4SO 3FLMA 1CLEA 3N2KA 2WJVA 1G42A 2O3SA 3ZLTA 4XTRA 3R74A 4YGYA 3EVEA 2X8WA 4M1WA 4BLRA 4BX3A 4D79A 3I32A 1WUHS 5JCOC 1MV5A 5KDDA 1G8SA 1R8JA 3PU6A 4X45A 3MQFA 4BLVA 4UULA 1KARA 2X4IA 3H1PA 2DFKB 3QA3E 2EBWA 3PD7A 5DTJA 3RVQA 5ITSA 1US8B 2B8TA 3B60A 3WGOA 1DKOA 5IVHA 4LXUA 4Z6KA 4BO0A 3E22A 3CR8A 1POWA 4MRAA 4IIBA 1NOKA 4G23A 3REQB 3DEHA 1Z45A 5AO9A 4L78A 1EA5A 2P9EA 2ZJYA 4ZAWA 1IM5A 4UHJA 4UBIA 3ZE6A 5LXTB 1DS6A 2CWWA 3UCEA 5F3WB 3ZG6A 1URPA 2XA1A 4KOAA 2WIKA 1I36A 2ZZKA 1P0MA 4L7QA 5AJZA 1J70A 1Z4JA 4OQNA 4A3SA 3SHOA 3OFJA 3DYBA 4XM2A 3T3IA 1QCZA 2W7TA 2ZK7A 4UDNA 5HZHA 4YAIA 3SJBA 4GXQA 2CHUA 1Z29A 1Q1GA 3PQ2A 1DWQA 1VTKA 3MAGA 4X94A 4UM8B 8LDHA 4HWKA 1PNVA 1TAHA 3QE2A 2WAYA 3KKKA 1RWBA 2F43A 3MCZA 4R68A 1AZTA 3UIEA 1S2LA 1RWPA 1UDCA 3VBCA 3TVYA 4JK3A 1PF7E 3PKZA 1GTSA 4BOYA 2P4SA 3IMFA 1PK7A 4J2TA 5CDFE 4QHTA 3EG5A 4B4WA 2GCGA 3L6RA 4QQ8A 4ANFA 1X7XA 3FFTA 5FTKA 3PGMA 1LLUA 3IR5A 3P2MA 4HWRA 1NLZA 1PJRA 4M36A 3S1AA 1FFHA 3J81k 4OQXA 2XWBF 4FQ5A 2C42A 3WMWA 1KY4A 3IB3A 3H84A 2KHZA 3FZNA 1MF7A 4K03A 1SUSA 1SD5A 4RHUA 4G8CA 3A4LA 3N8HA 1E63A 2WSMA 4YV2A 2I65A 4JP2A 1A8HA 1BU5A 1U5CA 3I2IA 2PN1A 4UVIA 4FWTA 1Y6QA 3D8HA 3PFIA 3LYHA 2II6A 3THWB 2P62A 2IYUA 2AJBA 5BVGA 1SA0B 2W2KB 3C4QA 4KH1A 2JDID 2V8OA 1IEQA 3EB9A 3JXEA 2O8BA 2VJLA 4KIJA 1NMYA 1WMEA 2LIVA 5GJVC 5LZ8A 1CY4A 4UHBA 4N48A 4ZICA 1OXVA 4QPNA 5IKXA 1C7JA 2JGKA 5FTJA 5EJ2A 2HBQA 5H4GA 4IG4A 2FR1A 1E0JA 2Y1DA 1Z33A 3IUMA 4KR0A 2MR6A 4NCBA 2C2KA 2GKGA 1ZDMA 2HF2A 2OD9A 4IIYA 3VKVA 1T4MA 2FXIA 4AO7A 2REXB 1WSBA 2GM4A 3E5HA 3KQOA 1WOYA 3CB2A 3U61B 6ABPA 1PT8A 5CDGA 4LE0A 1FX1A 3VR0A 4G09A 5CFRA 2DERA 1LQ2A 3ZU2A 2CJFA 4JYBA 1OVMA 2XDAA 1YHNA 3IOCA 4CTMA 4MB2A 3FNRA 4IDFA 1HDZA 4I5GA 4WNIA 4XKJA 2VFAA 3F9CA 4PR3A 5JCJD 2JLQA 3QFRA 4CWAA 3JQAB 3IAHA 2VPZA 4CKXA 4DIDA 1H85A 3O8OA 4JDPA 1KXJA 2I6XA 2LW7A 4ARBA 4JEMA 2BM9A 2ENUA 1GQSA 1OV4A 3HMKA 4RESA 1E5TA 2J4CA 3A27A 3C6KA 3C5HA 1M2WA 4IJVA 2QTCA 4KIGA 3QX8A 3DWGA 2J3HA 5SYNA 3RU9A 3B8HA 3PK0A 2HTFA 4AT1A 1UQTA 4I5IA 4NC9A 3O3CA 2DWQA 4IRMA 1ZAKA 2IIBA 2PM8A 3JPWA 3PHGA 1P2UA 2GBLA 3P9YA 4FIZA 2XWSA 3JATA 4B6PA 4Q66C 4UQPA 2XNDA 5KHAA 1HT2E 2X9GA 4TTQA 4BHTA 4OQMA 1SCAA 4YAFA 1IRIA 3AGQA 2MHCA 4E4TA 5B6JA 1P77A 3RS0A 4IQ4A 4H7HA 2B1IA 9GPBA 1UEXC 1FSGA 3CLTD 3X1MA 5FBKA 3SEFA 4GHWA 4DUPA 2DGDA 5T5QA 4JBGA 1HURA 2WTAA 1I3MA 3N5CA 4RSGA 2HB6A 4RTRA 1L7NA 2JAOA 3ZVRA 5A4DA 4LHZA 3VJMA 2BSAA 3Q11A 1QX3A 1II9A 2PS9A 3EVTA 3OF5A 4FXPA 4J7UA 1UDWA 3K09C 4CV2A 2CZGA 3LHSA 4ZOLA 2HA7A 2PLFA 2WPDA 5J59A 2HU8A 2IPOA 5JSQA 4XDZA 1KTVA 2CFIA 3P0HA 1Q50A 2G5GX 4J1SA 4IUYA 3VHQA 4PN7A 3KYIB 1G3QA 5JSYA 1I3CA 1V95A 1YZ3A 2VBIA 3S29A 4UUAA 1USVA 2IDKA 4E2ZA 3MSCA 4A6XA 1M2NA 5I7WA 5K0SA 4RCVA 3WLJA 2QXTA 4KNWA 4P9NA 4AXBA 2OA0A 3QXXA 3HJUA 1J0XO 2YYAA 3NVDA 5A4KA 1HOXA 1Z8DA 1E79A 3VI3B 1VLQA 5BR1A 1KP3A 1R5JA 3CNOA 4M76B 5HX7A 4GOJA 4ZN6A 5TEVA 3M5CA 4C2BA 4ZCMA 3EULA 5HBRA 4OHOA 1VE5A 5MF6A 3LHIA 5C3UA 3STVA 1FRQA 3LO8A 3WLLA 4PNEA 1A8PA 2WHQA 2V03A 2OWEA 2VNHA 4RPHA 4EYSA 1RHRA 4QYXA 5CCXA 3SCZA 3SQLA 1LRLA 3VZPA 1JVBA 3OZCA 1WNFA 1EFDN 1ZVMA 3L18A 1IRXA 2Q45A 2RKOA 1Q21A 2X0EA 2VQFB 1RKXA 3E9QA 3OJCA 1YQEA 2Z8ZA 1NVFA 3MWFA 1E62A 2HXGA 3S99A 5DKFA 1S1CA 4E5PA 3DFMA 2GBCA 4X7MA 3RSSA 2GN1A 3TL6A 1OBCA 1ZK2A 2XYVA 3D3EA 4KXNA 3RO7A 2NZWA 4U7WA 5KVQA 1B0UA 3IMGA 3GVXA 4GVLA 3GP8A 2NO6A 1WXWA 4DR3B 2CLKB 3H2YA 5THKA 2UXBB 1QO7A 4ZI7B 3EVBA 3EDYA 4DIKA 1MVOA 1YI8A 5U1PA 1RYBA 4JSYA 4OQDA 4URYR 2Y93A 5TX7A 2WF9A 5I8WA 4GBMA 1L8XA 2XSZD 1OLXA 1P4HA 4XARA 4NBNA 5LUAA 1JF8A 1JHAA 3HB1A 4RVGA 1X7HA 2AUMA 2QRVA 5TC4A 4DIBA 2IYSA 3U60B 3E8XA 2YDYA 4BNXA 1JQAA 5L6LB 2I71A 2O1WA 3UBMA 2V59A 5J47A 2E89A 4W5OA 1CQWA 5EYPB 4EYGA 1O95A 4PLYA 2XQIA 2BLLA 1ZL0A 3KB6A 4MCIA 1ZD3A 3IBFA 1VZ2A 3EC2A 1E0KA 1G7SA 1M1YE 2WWRA 5CU7A 4LF8B 1U8TA 4PFJA 1VOTA 1L4LA 1ZM2A 3EXAA 4UW9A 3ZWAA 2I1QA 2Y92A 4P08A 3CRRA 1IIRA 1CJUC 2J0VA 1QVWA 4GC9A 1R18A 2NVOA 3N8KA 4MJ7A 1T5TA 3OCXA 3WYAA 2X0RA 2AFHA 3EIQA 3BJEA 1EHIA 1NX9A 3H5VA 3D81A 3NRCA 3UFXB 4F60A 3AGPA 3I6ZA 1E9RA 2PZ8A 2HWKA 3A1SA 4GNKA 5EHNA 3V7FA 3VTAA 4I1YA 1G8HA 4Y2UA 1XPUA 1TJ3A 4UE2A 1Q1QA 4JP1A 3IQWA 1DX6A 1K3TA 2OC4A 1EB8A 2J0UA 3EVDA 1MOPA 4EGSA 4ZKDA 3FSGD 4F4CA 3FOFC 4FFBA 5LMUB 1FTSA 2Z9CA 3OFNA 3VR6D 2BKEA 4OLJA 2ISCA 4GVXA 1KI4A 4MUHA 4PGHA 3UK1A 2FUCA 4RPLA 3DKPA 4AMGA 2XPCA 4WFIA 1U63A 4C0XA 4HVTA 2CB0A 1JIQA 2PUTA 4JGIA 4KAXA 4MYUA 5IMSA 2B2XA 1D07A 1OBOA 1N6IA 4E15A 5K03A 1MOQA 1KAHA 2OGUA 4QOFA 1YA8A 1U0BB 3ZTTA 3OZEA 5E0OA 3L8EA 1IOWA 3LBFA 2H5IA 4UHCA 2ZRQA 3UCFA 4B4KA 3L5OA 2AMYA 3K1YA 3PJFA 4A8JC 7REQB 1MB9A 3W9UA 3L93A 3WYFA 5ICEA 3R0VA 3FIJA 1GSOA 4UHFA 4EBBA 2J46A 5ELLA 4E1VA 2A84A 4MUJA 3UKOA 2B3DA 1N75A 2Z9DA 2P1ZA 5FOXA 1C8VB 4HMQA 2R1ZA 4PW0A 2DTDA 2VA8A 3WIVA 4BO2A 1XXHE 4MIKA 4UEOA 5I9IA 1VP3A 3X43A 4BZQA 4FFPA 4WE3A 5HQTA 1GPH1 3SJCA 5EXEA 3WLTA 4AVYA 3HGTA 1G5TA 2H52A 1CUHA 2G9VA 4YRPA 1CQJA 5DBIA 5ITWA 3NDBB 4RFSB 2E9SA 4UOQA 4IUBS 1FE8A 3GLGA 1EINA 1X7GA 1VHTA 1YQXA 2F9MA 1WY5A 3PTLA 4OSOA 3CZPA 3GA0A 1ZINA 3R6WA 4TUYB 4BWYA 1A77A 5JYCA 4LECA 4OQFA 4TYPA 1RZ3A 2GVNA 2NU7B 1H0KA 1VE9A 3CSUA 3QWAA 5D2CA 3IO3A 4XB1A 4EYOA 4YJDA 1EX7A 3IPYA 1ODCA 4K1LA 1RKQA 3MA0A 1E5LA 2WG1A 4D81A 2YXNA 3ST7A 3CKMA 2VWPA 4JOBA 3K4HA 1DBQA 1RJGA 3DBIA 3FKSA 2Y68A 3LWDA 3DOEA 4MK4A 2AC7A 3ZKWB 3GLVA 4RSMA 5A05A 2B92A 1EUCA 1L7RA 2PKRA 3E9ZA 1DBSA 1I13A 4XB6B 5TQVA 2OXTA 3TRIA 3BIJA 4G1FA 1TLFA 2RGNA 2MIIA 1M2JA 1YBHA 3BMOA 3D3NA 5EEHA 5ICGA 2Q28A 2V7VA 1FVXA 1SGWA 2DJ5A 3G6KA 4KLRA 1XC7A 2VJAA 2FPXA 1M1UA 1QC5B 3I01A 2RJNA 1ENYA 2RI0A 2WSSD 1XA3A 3D02A 1H2RS 2JL1A 4B8WA 3CIOA 2O2HA 4DLPA 3V4SA 5JZMA 1H0HA 3H9QA 3QKWA 3U3KA 1U0NA 4BIMA 2XAAA 1WBJB 3B1ZA 2ANCA 3H7IA 3K5PA 4RTMA 2ZUVA 4M9ZA 3UYLA 5JH7A 1BU8A 3RF7A 2EP8A 3GJ4A 1UPUA 1VXRA 2AF3C 3EGXB 4GZ3A 2FFRA 4MGEA 4YH1A 2WJWA 1HYBA 4BBAA 1C7FA 1KC1A 2QZSA 4UHEA 3F6RA 1VKOA 2G4CA 2WVGA 2XT0A 4JMLA 4UMEA 3RVOA 4Z1MD 3GGJA 1CUVA 1G9SA 4U8GA 4UKDA 4BO3A 3D6HA 3AI3A 3B1YA 3HB0A 4H7FA 4HADA 2LZ0A 1KH3A 1IZ7A 2KYRA 2C58A 1SFRA 3FJ1A 2DPMA 1ZMBA 4EFNA 3K35A 4GOOD 1BC5A 5I45A 3ED5A 1S4QA 2W98A 1LWNA 4YJFB 2F8TA 1IG3A 4I81A 5IEJA 1ATZA 5LLTA 4FYXA 2P6RA 3UHOA 3A1FA 5HKLA 3N7UA 5JS7A 5CB6A 4HDRB 4F0JA 4DJ5X 2O8EB 3RTAA 5KNDA 3S8MA 1QR6A 4NE7A 4HAXA 3H9JA 4KL8S 5SY6A 2ZIZA 3V6MA 1EVIA 1RM3A 4DXHA 5KQSA 1Z36A 3OZTA 3B6KA 4CG3A 4MR8A 2CNBA 3ENKA 5B55A 1QQ7A 1RFLA 1KSFX 5ES3A 2QD5A 3BQNB 5EESA 2ZRPA 4B4DA 3TZ6A 4PSAA 5B2FA 3LPCA 2FN8A 3FNBA 5CXSA 5E9WA 2C2ZA 1XRLA 4TLAA 3BYZA 2HQOA 3N6RA 3U1TA 2PBRA 3R8FA 1W4ZA 3K9NA 5THXA 3B5EA 3ZX4A 4DQXA 5IT5A 1YDMA 1C7EA 3KOYA 1OE0A 4TN5A 4CIVA 4UBJA 5BVHB 3D0KA 4CG2A 2GEUA 8OHMA 1U0TA 5BN5A 2ZRBA 4F56A 5CFLA 3CLUC 4L9AA 2ZDQA 2PD4A 5T41A 4YRCA 4AKSA 4QVIA 4AMUA 1KORA 3U13A 4D8UA 3MIZA 2J3EA 3JQEA 2B1JA 2P41A 1WCIB 3EDQA 3Q3JB 5K0JA 1R6VA 1FJHA 3IUSA 3MWDA 1UFVA 1CUJA 3RS8A 4CN8A 1YJ8A 2VL7A 5FORA 3GLFE 5A04A 4C03A 5HJ2A 4EW1A 2VP3A 2J41A 2ST1A 3BMQB 2PRZA 4L5BA 4BQSA 4AO6A 4Q4HA 5MFPA 2I55A 1U1CA 3VDMA 1G19A 2BGTA 4QOJA 2ZAIA 1E7RA 2RHDA 5HBGA 4RWZA 3LKDA 5I7AA 3OM1A 1M0SA 4UOEA 2HDOA 1GY8A 1YNOA 4IPTA 1UANA 4G2TA 1UMBB 4YCDA 4OAPA 3BC1A 5CLHA 1L5NA 3B52X 1A4XA 3HUDA 2C9YA 2L82A 4NCKA 3JS5A 5DP2A 2XGOA 3MJRA 4UTOA 8AT1A 5HW0A 5K8TA 1YVDA 3JQFC 2C2YA 3HHPA 2W42A 1RWQA 2ZYAA 2DPGA 4DS3A 4KFCA 3QXHA 1Z5UA 3JQ7B 3MUOA 3A3OA 3F1KA 5FWAA 5BO5A 1T6ZA 4JB3A 5EJIA 1SVOA 2PMBA 1Q14A 4YP1A 4E5VA 2BRUA 3EIFA 1CB7A 2W4MA 2PT6A 4Y2HA 4JCCA 1GPWB 4JMPA 2Y9MB 1HQKA 1P5ZB 1YXMA 3MILA 3COWA 4WASA 3LFHA 4BUCA 4ZV9A 1R5OA 3MNFA 1GUYA 4PV7A 1M10A 4I7EA 3HJTA 2PH7A 3ESYA 5FWDA 4H3HB 4F6RA 1DRVA 2PGJA 4L4YA 5ULLA 3QUAA 2EFCB 3DMPA 4HKTA 4YBRA 3CISA 3DKRA 5IH7A 2AJTA 3K32A 4BFWA 3WP1B 3Q9SA 1M6YA 4ROTA 3DEYX 1Z4QA 5L40A 3BFKA 4C87A 2VKTA 2HQRA 3ZKAA 1VI6A 2C5AA 3GZJA 4LQ4A 1KQPA 4MSUA 5K3SA 1WZUA 3SDBA 2PSSA 3QV1A 1N34B 1M66A 1ZI8A 3DTVB 3SIXA 4ZOCA 2ZWPA 4YFVA 1OHHA 1S8OA 4S2UA 2HQSA 3AUUA 2JCGA 3SEAA 1WX1A 2GKSA 3U7GA 1M3SA 5LOVB 4JR2A 1VCIA 3O0TA 3RBVA 3GJ6A 4DV2B 3W6PA 3HVHA 1CWUA 3SXUA 2IYOA 2FUG6 3FX2A 3L7CA 4KKVA 1YQUA 1CK4A 5FI0B 4EDHA 4GPZA 4TUYF 1QG6A 1FUEA 4MA4A 2AQHA 2MU1A 2ZR9A 2XNSA 3FHJA 4L27A 3P9RA 4O1MA 4AXXA 5JXJA 5AVZA 1P1RA 1DTWA 2A5LA 4DREA 4JBHA 5JCPA 3I2YX 3EGVA 4ILKA 1D03A 3LQFA 1JHPA 3GJ5A 4MWEA 1L1QA 4RD4A 2XMRA 1Y5MA 1MQSA 5ERXA 4S1OA 2Y0BA 2I2DA 3WMFA 5B57C 3NOQA 3IALA 1KHTA 1MO2A 3DFFA 3KYCA 2G5TA 5F51A 1JILA 1Y1TA 1T1EA 2D1FA 5AW6A 5HM6A 4M3NA 5F4BA 5GZ6A 1NY6A 4HL6A 2CXHA 2RONA 2ONCA 5CFMA 3QKIA 1VBMA 2CNNA 1DC3A 2R65A 3TXAA 4C6TA 3LXUX 3DMTC 2I3BA 1RRPA 3VH2A 4DRXB 3LLUA 4TTPA 4PAGA 1XX6A 3OBIA 4LY6A 4MYSA 2Q2VA 3O74A 4G9BA 5PNTA 4KQ9A 4L74A 5FUWA 3WDKA 3LT5A 3ZX5A 4DDTA 3AVOA 3D7SA 5KYUB 5GJWC 2CXOA 1KY2A 2PGXA 5J4LA 1U8XX 4IDPA 1Q0RA 2ZPUA 2NZ8A 1U28A 4IM7A 3ESDA 4MKRA 4GSYA 4LTMA 2ZBQA 4DM3A 1NQVA 1RCFA 2CKMA 1Q16A 3VPGA 3NM4A 2VHXA 5BSKA 1K08A 1W8IA 1Y5RA 1F38A 1XCLA 2P8JA 3E8SA 2B4AA 3IFSA 4G8JA 3REQA 4MROA 1FJ2A 4UCXA 1ZH0A 1JG6A 3H5NA 3NV7A 3FWZA 4G6ZA 4MCAA 3WV5A 3ZBUA 1T6BY 3ZXSA 3SU8A 4LK2A 2I6TA 1R3DA 2R79A 3DT9A 4RANA 5E8JA 2FUEA 4YMWA 3QWHA 2V4MA 3PFNA 2J7KA 3CEPB 2P4QA 1VJRA 3E9RA 3CSSA 1EQAA 2NYUA 1RJDA 1C1HA 1E7QA 3CF6R 3DE2X 3WL8A 3I6BA 1UL1X 5DHAA 4UOZA 4DJAA 2ORWA 2QTVB 1OLUA 2M2IA 3PL1A 3LPLA 2ZIWB 2JAHA 5DBHX 5DWDA 1VG9B 4DEVA 2K2QB 4YJGA 4N5MA 4R0NA 3D6JA 4U6QA 4UCWA 2HA0A 3UWPA 1C9KA 1P73A 2I0FA 1LPBB 4EHKA 1RAEA 4JKOA 3I5XA 4LQCA 1CJSA 5K3FA 4J49A 1R9GA 4JOCA 1JIJA 1N0UA 3JR7A 4EVSA 1Y7PA 4CV3A 1IUNA 3QX7A 3SF8A 1U2SA 2C4UA 3TSWA 3VMMA 4BPRA 1A8IA 3GV0A 3N70A 4EKNB 2A67A 4Q9JA 2D0OB 3LPNA 3CZQA 1LPMA 1KFJB 3X3HA 3GPCA 5EMLA 1JLKA 3DF7A 2ZTVA 3EXEB 3DZIA 4HC4A 1H9CA 2XYPA 1GNPA 1CNFA 3CX6A 4TYQA 4L4RA 1DIBA 3KBBA 3KJFA 4INJA 4MITA 3PC3A 2D4HA 3LQ1A 2VOJA 4MPJA 4EEKA 4W7HA 4IX9A 1XWFA 4WSOA 1VHWA 1N1DA 3KYBA 3M70A 4CQMD 3OQOA 1Q0TA 4KVAA 4O6VA 4BCBA 3QHAA 1GZVA 2ZEJA 4RK4A 4MV8A 4WACA 1U3GA 1N7GA 3A0RB 3GPBA 1LK7A 5FNZA 3PR3A 5JBNA 4C1BA 2WD7A 4JUIA 4Z5XA 4CIWA 4ZT6A 1Q1ZA 1MJGA 3MD0A 5IJ0B 4PLCA 3HK2A 4EL5A 3A6GA 1U1IA 2FDXA 4TS4A 2B5VA 3AIKA 3F96A 4DAOA 1GPKA 1BH6A 1KYQA 3PYXA 4WHMA 2ZTLA 1OAOA 1UK6A 4P5EA 5CK4A 1X13A 5IUJC 4JYCA 2QTFA 4TMFA 3EW9A 3KG2A 2G1AA 4AKIA 3ITDA 2GSDA 1NYTA 3H9CA 3L9XA 3GPDG 3N05A 1ZJ5A 4HV4A 3PUJA 3UGQA 5KPJA 1YHZA 4UAJA 3ZU6A 2OORA 4TT8A 1U2TA 3ESXA 4BNIA 3CPJB 3QE4A 3D3KA 1G8FA 2BHNA 2LCQA 2O4CA 2QR3A 1S0UA 1ZESA 5JFGA 3GVIA 1NBOA 1D9XA 2R1VA 1ZSYA 1Z5WA 3GJYA 3OUTA 5C35A 4DA4A 1WO8A 1RHMA 2QP4A 1U5BB 1ZCBA 3J80A 3QWIA 3R44A 4H6WA 1K7FB 4U02A 2X0FA 3WYCA 2O19A 4MQEB 4TV9A 2WF7A 1YT5A 2G5CA 3HFJA 4BYMA 2WF8A 1XZPA 3HS3A 2FMTA 1BWSA 1NUHA 2JHFA 1YOBA 1H3EA 1EXNA 1TM4E 1YO6A 3CT4A 2ZYGA 5JSUA 1W85A 1T2UA 3L05A 4LTDA 3PV0A 4UPDA 3T41A 4QRHA 3JARB 1NVGA 2JCBA 4KUHA 2ZSHA 2XMCA 1PJ4A 4Z9XA 2YJ4A 1IIBA 1E5XA 1I51A 4RC9A 4NHOA 1XTQA 2ON6A 4KZPA 1BGXT 2JCSA 2G06A 2QMQA 5ICCA 3CF0A 2C4MA 3A3PA 5K0CA 4WLNA 5KIAA 4PLHA 3LLCA 3FWPA 4PQFA 2Y76A 4NJEB 2ZWIA 4OJKA 4AJNA 4DJJA 1MQAA 1DELA 4DNQA 1KC3A 2WHRA 3E7PA 2WTMA 4PINA 4QATA 4AZ0B 4DY6A 4FI3C 1OKKA 3IJPA 3EFEA 4ZQCB 4BVHA 1UMDA 4HDSB 4YO7A 3R7WB 4S05A 5IEBA 2D4AA 2VPXA 2QI9C 1GRVA 1O9BA 2CUZA 2WSYB 3BCSA 4H6PA 4C7VA 4XWKA 3A10A 1EX6A 1IHDA 3P2IA 4LC0A 2JW5A 3OLQA 1OF1A 4MVYA 4AQDA 3GN1A 2EKQA 4QDUA 4B7ZA 3O2NA 4Q7MB 4RIEA 4OHFA 5AI6A 3CWCA 3HPQA 1TNDA 3RW9A 4A1OA 5CDHA 2QTWB 3VR2D 3CRMA 4I19A 4C0QC 2X9NA 3RFFA 2X19A 2SCUB 3MTEA 4G0YA 4AMZA 3R9XB 3KETA 2KBFA 1HE5A 5AM1A 3SFVA 2BVNA 2QVYX 3PC7A 4E94A 3B9PA 4EIWA 3H9UA 3TYXA 1SPXA 4G0MA 4PONA 1GN8A 4LK3A 1VSBA 1OPXA 2VJNA 2YRWA 4M46A 4D98A 5C4IA 4BZZA 1CR0A 4Q3BA 4UTRA 1DEXA 3E2MA 2VDVE 4IS3A 3EFOB 3RVSA 3N8IA 2GD1O 3BIFA 3V9AA 5A4FS 3KXDA 2IEYA 2C5GA 4R6WA 4PX9A 3P4XA 4AIRA 3Q2KA 3O2QB 4CKZA 5JSZB 1NN1A 4GW3A 3ZJTA 2ZIGA 5KUTA 1JG7A 1CDDA 3NAGA 4HAWA 4QO7A 4AJLA 2IBSA 1NQOA 1XDWA 4BO7A 1WA5A 3PUKA 1YCGA 2R85A 4I9UA 4S3MA 4DCCA 2BSQA 1DUIA 4G2NA 1O4WA 1P1BA 3AM3A 3CLVA 3PGVA 1C2TA 4AX4A 1NZFA 1U0EA 1V39A 1U9IA 5AI9A 4UFNA 1N3IA 4EA6A 5CDUA 5LIRA 2XE6A 1E7WA 4V0LA 2GLUA 5K2OA 1SZCA 3VTKA 1H2YA 2QX4A 4YT8A 3QIVA 1SHTX 2C61A 4OL0A 3W1WA 4DRXA 1Y4ZA 4IF4A 4GMDA 4UUOA 3SR0A 1A2OA 3OQNA 3UHPA 1JEOA 2JLUA 2HV8A 3LGAA 4C06A 3WYNA 1T5OA 4W5WA 5C37A 2H1LA 3CLRD 1FIUA 3D5QA 1P81A 5E6RA 5IULC 1DQZA 1HFJA 2GYYA 3DNMA 2AE1A 2CNWA 3QU5A 3V8EA 2IF2A 1G59A 1CRZA 3CRVA 3MBIA 4GO1A 4JEIA 3QLUA 1YB2A 4LN1A 1M7BA 1UC9A 1XVAA 4IWNA 2UYYA 3QHPA 3TAHA 3MJCA 1E6KA 1NQUA 3GWZA 1ISSA 1P0PA 3LNCA 4KG7A 1BH2A 1BO6A 3EBPA 3PDUA 3ZK7A 1QZUA 2P27A 1E7MA 1E2NA 1JQBA 3NJ4A 3HTXA 2W2PA 3GZNB 2HNBA 1V37A 3SHWA 2EYQA 1GCGA 1OV6A 2HFJA 3K0CC 3P0EA 4ZJUA 5AW0A 2RCNA 5F5XA 2BMJA 2MSCB 1H5QA 2C9ZA 2P0AA 5IJ9B 1FQJA 4IJ5A 4KQCA 2GCEA 4WESB 3HWWA 4B46A 4DLRA 4EHLA 3W5SA 1TIBA 3NHFA 5BPFA 2HCJB 2VYCA 4GI7A 4JENA 1IDOA 2J9ZB 1LZLA 2PPVA 2W90A 3C6BA 3GW8A 2CDRA 1GUFA 1U8ZA 4A0GA 1YDEA 1ZSNA 2AEFA 2DWOA 3P4YA 3VZRA 4BX2A 3EGWA 1E96A 1G8PA 5IAJA 3U1VA 1O94D 3D1JA 1RVDA 2EJWA 5EIWA 4TYNA 1EVLA 3S2SA 5JTTA 1P60A 3AUXA 3DMGA 1S89A 2PIDA 2R97A 4GBJA 5CM9C 3BFVA 4YRRA 1Z7YA 5F35A 1W8DA 3E9DA 1JE0A 1DUVG 4O4LF 2G9RA 4EX7A 3PQ6A 4ZAFA 4J1TA 1NXQA 4D99A 1VJCA 5DYGA 4I6EA 2J4FA 3WOVA 1DTSA 1NW7A 2H4FA 1F0KA 2NO9A 4GRDA 3T5TA 3LP5A 1R6XA 4HDQB 4AUNA 4DXDA 4XYGA 3QYPA 3AG5A 4G56A 4RVSA 3GZTB 4FZRA 5JVDB 1UFOA 4DM4A 4XVUA 2QT0A 2IQ5A 4EA7A 4B45A 2V5AA 3IAS1 1P4JA 2YNMA 3ILHA 2IZ6A 1S6YA 2AN1A 2FPSA 5EUBA 3P0JA 2B36A 4TUYA 2NSHA 5F3DA 3M89A 2YS6A 1JTFA 1E0AA 2I3ZA 1D6MA 2PGLA 1QKIA 1X1DA 3UGTA 2WUGA 2D62A 1VJDA 4JQSA 1S5PA 3OIFA 1OBVA 3EYWA 1PFYA 1RD4A 2H07A 4KVZA 4OP1A 4Q1BA 3RAEC 4AZ3B 4GMKA 1X86B 3PQ3A 4WZZA 4I9NA 2JARA 4X3OA 1N2CB 3H19A 2SKCA 3MWYW 4PX5A 4OQLA 2NTJA 4HF7A 3MHPA 4IHQA 3ZKWA 3SVLA 4M89A 3U39A 1GNVA 1X39A 5I7OA 1XLVA 4GSKA 2MSNA 3TGWA 4DR6B 1TF2A 1XRNA 3GAZA 4LJ7A 4IMRA 4U2CA 3VKHA 3FF4A 3OSUA 4TL6A 3BTUA 5DLPA 1WUYA 4TKVB 5CIYA 2PLNA 1VGVA 4BLPA 1S2NA 4XR9A 1RQGA 5E4JA 4C22A 3H5RA 2HH9A 3ID6C 4TXLA 1SCNE 4PRYA 4ONEA 3OQBA 4DA8A 4ZZ3A 3GY0A 5HUJA 1MB3A 1G8MA 2Q27A 2PDAA 3MGAA 2NU9B 5JAPA 1NU6A 5JNTA 4OGGA 3QJ5A 1W93A 2WWVD 1C9MA 4D6XA 1BA3A 1Z0IA 2A0UA 3F9RA 3KAKA 4AX8A 4M87A 2JH9A 4AUEA 2QM3A 2DHDA 4I0WB 4TKZA 5DMHA 5DSZA 1SVSA 2RGRA 3D8RA 1K5PA 1G2IA 1HDOA 3KJNA 3KKMA 1Y42X 4DGQA 2FOXA 3CKKA 4ZAZA 5BSRA 4MVJI 2XB2A 1RXIA 3ZE7A 3OECA 1QHSA 3DDOA 4ZZ2A 1OJ7A 3PC8A 4JU9A 3RT7A 4C3OB 3JRXA 4IHJA 1YQDA 3DCNA 1C1YA 1MG5A 3AI1A 1USIA 2VDNB 2PKEA 3UHJA 1KFBB 3Q3IA 4WZ6A 1KWKA 1POXA 3TQOA 5CFQA 5EG5A 3JQCA 5JAHA 4RU1A 2ATXA 3PPYA 3A9SA 2HPVA 3LK6A 3WK4A 5KTSA 5KYNA 1E61A 1HNZB 2OZLB 2BM8A 4DDKA 2QW8A 4FGLA 4YJFA 4ZVVA 3RBZA 1KJWA 4X7BA 3KKQA 1UPCA 2BELA 2P6OA 2R751 1TIKA 2CFSA 2VJBA 3BXOA 4U1RA 4YRTA 2EU8A 1CPYA 1C80A 1JHYA 4PYKA 1QKJA 1LSOA 1WCV1 4L9RA 4BX8A 4KITB 4HDRA 4V0SA 4FGWA 5FJJA 3RVBA 4H16A 5BT8A 3AR8A 3WGNA 3UMJA 2WFZA 1PRYA 4AZWA 1DLJA 3DP9A 4Y98A 3RNLA 4RE6A 5C18A 4CIBA 4TRJA 1RBQA 1W87A 2DQSA 3ITNA 3EGCA 2VO1A 4JJKA 3VC1A 1U2PA 2V9CA 4B6OA 4DVGA 1UKZA 5J1TB 5BN4A 1B41A 3A8TA 2M6LA 4G0UA 1CJVC 1KFEB 1NMEA 3PXAA 1JJFA 5I7SA 5B6IA 3CPSA 5B7PA 5CCBA 3G0HA 4RKFA 3P71T 3GQBB 1KP2A 3PQ4A 2QLNA 3L7OA 3PHHA 4M7RA 4QDOA 2WTNA 1MW9X 1HLGA 4QU0A 4S2EA 4C4XA 2IP1A 3GDWA 4D9EA 1JJBA 2C7VA 2O7RA 4XYEA 5KCZA 3EQ9A 1GNSA 1EK5A 2EQ5A 3C3KA 1F6WA 1Q7GA 5FO1A 2RBKA 4IKOA 3SE0A 1A9OA 1WCIA 5FOSA 4IMIB 1VL0A 1XOIA 4QOEA 3HXLA 2C0CA 2OD2A 2EG5A 3DLPX 3PUYA 1AD2A 5BQ5A 1OJLA 1ND6A 1IM8A 4FFRA 3BMQA 2PD6A 3QXJA 4XJSA 5C52B 4U2GA 3TIXB 1GNQA 1NFRA 4UDYX 4M9CA 1EFLA 4DADA 3AERB 1A5ZA 2C2XA 1KAMA 4YQFA 3A1DA 4V03A 5CHEA 4P98A 1XTZA 2WZCA 3RRYA 2B8NA 3UOGA 1O6BA 1L7EA 2XUOA 3HADA 3N39C 3CEMA 3PJGA 4K9LA 2F1KA 3V2UA 1UMBA 3CZ5A 3SF0A 4B81A 2AQ8A 2R6ZA 4KWIA 4UTPA 2DLCX 3QEJA 3D8SA 1AO0A 3PRYA 3A14A 1PWEA 4HH1A 4Q7EA 5TPWB 1W35A 1GILA 1CS0B 1J2UA 4YAWA 4A9AA 3JQ7A 3ZGLA 2ZR7A 3ABRB 1CHDA 4TQUS 2IQIA 1Z5OA 4GSLA 2VK1A 3I0MA