3N2IA

2.25 angstrom resolution crystal structure of a thymidylate kinase (tmk) from vibrio cholerae o1 biovar eltor str. n16961 in complex with thymidine
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
208
structure length
206
Chain Sequence
MNAKFIVIEGLEGAGKSTAIQVVVETLQQNGIDHITRTREPGGTLLAEKLRALVKEEHPGEELQDITELLLVYAARVQLVENVIKPALARGEWVVGDRHDMSSQAYQGGGRQIAPSTMQSLKQTALGDFKPDLTLYLDIDPKLGLERARGELDRIEKMDISFFERARERYLELANSDDSVVMIDAAQSIEQVTADIRRALQDWLSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 2.25 Angstrom resolution crystal structure of a thymidylate kinase (tmk) from Vibrio cholerae O1 biovar eltor str. N16961 in complex with thymidine
rcsb
source organism Vibrio cholerae o1 biovar eltor
molecule tags Transferase
molecule keywords Thymidylate kinase
total genus 83
structure length 206
sequence length 208
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2010-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3n2iA00
3SBDA 1NSFA 1TADA 3TVDA 2XZOA 2XXAA 2AFIE 2C95A 2ZE5A 1Z28A 1Q22A 4DLZA 4LCBA 4TTRA 5LB4A 3W6NA 5J4VA 4DT1B 5KHOC 3A1UA 2BHRA 3F3YA 2XNSA 3BFXA 4US2R 4FMDB 4F7WA 2FFQA 3K9GA 4QNRA 1E2DA 2G88A 4WVFA 2NPFA 3CF2A 4M1KA 5JI2E 5EJEA 4MYCA 3AV0B 3V4FA 5DI3A 5FFMA 4WBSA 3TRFA 2QY9A 4HLDA 4OQFA 2YWFA 2RH5A 3PEVA 4WIAA 1XJQA 2XEXA 2CEAA 3M4YA 2JEOA 5DN6D 1KI3A 5AUQA 1ZUNB 2QP9X 5FPKA 2IK8A 3U3KA 5KSYA 4LPKA 3THWB 1CS4C 2FSHA 2QMUA 3B1VA 4EAQA 2WWGA 4DCSA 1KI8A 1JR6A 1L2TA 3Q85A 1Z0JA 3RHFA 2GCOB 1G18A 3DPUA 4HAVA 1UKVY 4HATA 4ARZA 1N6NA 2VHJA 4XTCS 1OH5A 4UNNA 2GBLC 4WOPA 4BEJA 3HR8A 5DSZA 1SVLA 2F1RA 1JXOA 4RJLA 3SDZA 4G5RA 3HWSA 4M8NE 1NMXA 5F2EA 2J0UA 4PPNA 1LB1B 2C99A 3FKSD 4M22A 5AUNB 2ZVPX 3O8CA 1T91A 2GAAA 2ZE7A 4JBWA 4YLGA 1TEVA 1W0KA 3H4MA 2VLIA 4DEXA 5CITA 2BEKA 4PC1A 1NI3A 4HB0A 1W49A 2GJ8A 1W7AA 5HCNA 5FOWA 4D80A 1IN6A 3PXGA 4IFBA 1AKYA 1VYVA 4PHHA 1NIJA 1CR4A 2G0TA 1TF2A 4IVQA 1EFHA 2GZHA 5AK0A 1ODFA 2OCYC 3BFKA 1X6VA 4PO1A 4Q5IA 3H2YA 3T1OA 1IQPA 1Q21A 1NG1A 3X1YA 2VQSA 3WHLA 1E9RA 1TUIA 1ZRHA 2QTVB 1P72A 3QEOA 3KXKA 1NVWQ 3LLMA 2FGKA 3P27A 3NVAA 1DEKA 2ZITA 4JVMA 4TTPA 3ZYCA 5BYJA 1SZPA 2HJGA 4TMWA 1KO7A 1OIWA 1NJGA 3EARA 4IDQA 4A36A 1OLOA 2OO7A 4IDNA 5HZHA 2ATVA 2QE7D 5D3MA 3LD9A 5E4FA 3LDAA 3H84A 4C0JA 4HZUA 3OIUA 2AKAB 3NBZC 2O8FB 4EJSA 1N6OA 3IDQA 4KVAA 2FNAA 3LH5A 4UJ3A 2VH5R 3L8YA 3VX3A 4Q66C 3MSXA 1IY0A 3ADKA 3HU1A 2K5UA 1Z07A 4DT1A 3AF3A 1LF5A 1KSJA 1DG1G 5EE9A 4KI0A 3B1XA 3ADBA 2V8OA 2VHQA 5AJZA 4IOJA 3VX4A 1E94E 1N5LA 4CZ2A 1M8PA 1NVVR 4DCVA 4NYJR 2CL7X 3KQNA 1ESMA 3WHKA 3SJCA 3KQHA 4NZYA 1WCV1 4ZCIA 2YOGA 3GLHB 5J4YA 4CEHB 5EP1A 2CDNA 2P2LA 1ANKA 2PCLA 1DAKA 1G5RA 1XMIA 4QHSA 1OE0A 1Z5ZA 1VTKA 2BBWA 4X8HA 1NBME 2OUKA 1J7KA 1IONA 2ZR7A 4MGKR 4WA7A 3K8YA 421PA 4ZCMA 3TMKA 3RS7A 1D2EA 3KKNA 5GJWC 4KBGA 4NDZA 1JB1A 1UEIA 2A3RA 1E9AA 4O3MA 5ANRB 3Q8XB 2A5YB 3A4NA 2QUZA 4LYHA 4MKHA 2O0JA 2JGNA 1NKTA 1IY2A 5HZKA 3BK7A 3WNCA 4IOMA 4BWYA 1ZM7A 5IHPA 5F98A 4II7A 1MKYA 3T06B 1SXJA 4LSGA 3UXMA 1OFUX 3C16C 3VAAA 2O8BA 4LX0A 1VHTA 4FXPA 4BFYA 3RSLA 2O8CB 5F3WB 2ZSAA 1QG2A 3FHTA 4GFDA 1HE8B 1J70A 1CTQA 2P6NA 1G3UA 3CZPA 3SS8A 2AL7A 2IUUA 3K0SA 1Z0DA 1G7TA 2PZGA 3BC1A 3NTUA 2B92A 3X1ZA 3PITA 4OHWA 2YKGA 4TMZA 2FSIA 3CH4B 4A6XA 3MUFA 8OHMA 5KUTA 1WBBA 4OQMA 2GCNA 3LVQE 1OXTA 1ZM9A 2OBNA 3WMGA 2QEQA 2GK6A 3QXJA 5P21A 3B1YA 4HB3A 4TN1A 2C77A 2IYWA 2KSQA 1CR2A 3EG5A 2WPDA 1W4CA 4OL0A 4C3ZA 4DJTA 4DLWA 1KJWA 4P0TA 3EWAA 3GQBA 2RKOA 2GZDA 2AR7A 2IHBA 1KTVA 2ZRJA 1UFQA 1W47A 2GESA 4LYAA 1ZW6A 3SI7A 2ZRHA 1CP2A 5EE5B 5C1BA 4MYUA 2IYQA 1VMAA 5K8UA 1EFCA 2ZREA 2EFCB 1IAQA 3RVBA 4LYFA 4YQFA 3S1AB 2P5TB 5G53C 2PX3A 2GA8A 1KMHB 4GZMA 4BLRA 3A4MA 2VYFA 1NKSA 1KYIA 5EUQB 3MJHA 2ODBA 1KIMA 4TMXA 3CRQA 5J4HA 1ZC3A 4Q1AA 2P67A 4N3NA 4QC2A 4YMSA 2GBLA 2ZE8A 4Z8YA 1KJZA 4HYYA 5EXTA 3EXAA 1J2JA 4BZQA 2G77B 3IHWA 2J0VA 2EYQA 3V9PA 3THWA 4Q03A 1E0JA 1T0JB 3A1WA 3K0AA 3WP0A 1ZU4A 1GVNB 2A5GA 2ZSFA 4NL4H 3FKQA 2ZETA 3FFBA 4D4LA 4WZAE 2CCGA 1G6HA 3P4XA 4IDPA 4DSUA 1KNXA 2DWPA 4M9QA 4P4TA 2YV5A 5G40A 4KVGA 3PUYA 4YXWA 3IIKA 1ZJ6A 5FPTA 3VR2A 4D82A 3P32A 1W1WA 2YZ2A 3T1QA 1VDZA 1U0LA 4MGYR 4QJ5A 4CIDA 4JLAA 1F2UB 3AVPA 1EESA 2EFDB 3BWDD 1NL3A 3FMFA 2WKRA 2XTMA 1E2GA 4DLSA 4DLXA 1S96A 4MUAA 3ZDQA 2C9CA 2FJUA 3TAUA 3VTKA 1YKSA 4JLMA 4JL6A 1W44A 4TMTA 2ZYTX 1G9XA 4MRNA 1IHUA 4NYMR 4K8OA 4ACBA 4A2WA 1FPMA 1SULA 1PUIA 2PL3A 2NO0A 3UIEA 1EG7A 2YWEA 1J8YF 3SYNA 1MABB 2Q9CA 2O52A 4D81A 1RZ3A 2TMKA 5BN4A 3QENA 1GSIA 5AJVB 4JVSB 3I32A 2HLDD 1KI1A 2DR3A 2OXRA 5FBVB 4MRVA 1ZNWA 3GLGA 3TGPA 4NU0A 1JJ7A 2A5JA 3B9QA 4Q21A 2V6JA 2IWRA 3AP1A 4ESHA 5JFGA 2KE5A 2ZI3A 3Q3JB 1CEEA 1KI9A 1HUQA 3K70B 4PHFA 3NIBA 2V7QA 3AGQA 4KFUA 4O2LA 1OKKA 3CLVA 1U99A 1AGRA 1NMZA 5IT5A 2WKQA 2BDTA 2BMDA 4OQXA 2YWGA 1RC8A 1H8HD 3JVUA 3WBJA 3AM1A 4C7OA 1U8AA 2ZRGA 4TLCA 2ZYVX 4UXIA 3K53A 1EFTA 2FSGA 1YQTA 2FE4A 2RGNA 4QXAA 3LA6A 3CRRA 3PEWA 1GL7A 3R9XA 1T5IA 2BCGY 1NY5A 4QG7A 5IK2A 1UDXA 1SVOA 3B2EA 4OJKA 2ZRAA 3HYTA 2LCFA 1KHTA 3HP1A 1Z8FA 3ZVMA 3FHCB 4UXHA 2AK3A 2G83A 5EP3A 4PZLA 1S9DA 3SEAA 3RS2A 2XXAB 3WMEA 3OAAA 5KSPA 4OI0A 1U8ZA 1US8B 2GXUA 1U8YA 5GVSA 4L5BA 2JA1A 1TX4B 3RAPR 1P2VA 3THYB 1UF9A 4RZ3A 3BBPA 1XXHE 2CCKA 4L8GA 4LK2A 4I1OA 2F1JA 2O0HA 3EC2A 5H68A 3TR5A 3KJEA 1VYUA 2ZUCA 3FMPB 2MSCB 1Q1BA 2MMCA 1O87A 2N1BA 4DSNA 4QBIA 3EZ6A 4PHGA 5L3QA 2WWIA 3K70C 3K0CC 1J99A 2C98A 1N5IA 3U4QA 1N6LA 1E4VA 3CPEA 1QHYA 5JCPA 3GPLA 4M1MA 5AR1A 2NO7A 5JSZB 5GJBA 4QBHA 5C46F 2NMVA 1HA3A 4RD0A 5HR5A 1OKKD 4AD8A 3WMFA 1HQYE 3BAFA 3SQWA 1U0JA 3B9PA 5DI9A 4Q4JB 3UK6A 2ORIA 3UWOA 5JCZA 3D3QA 3NHBA 4G5GA 4N1AA 3FDIA 1E2IA 2FPKA 3DZ8A 4BECA 5JRZA 1D2MA 2PBRA 2PLRA 3K0CA 4M1TA 3UATA 1W0JA 2A78A 4DIEA 3U4QB 1XPOA 3U6KA 2CE2X 3NC0C 2AWOA 2VPPA 4US0R 4WAUA 5L3SB 2WIAA 4PPQA 1E2QA 2RHDA 5J40A 1AN0A 4OHXA 1BO6A 4KHZA 2CHVA 2YINC 1G64A 5JZVA 4V03A 1F2UA 5KOYA 1TTTA 4JBXA 5K8IA 2V55B 4N0EA 3OZXA 1KAOA 4ZDIA 3CRMA 5GVRA 2V54A 3EZ7A 4G1UC 2WHXA 3R20A 4ACAA 5FR1A 1DAIA 1V5WA 5L3VA 3AB3A 5DH9A 2B8WA 2A5DA 5JECA 1PJRA 1JAHA 4X8MA 2GDJA 2REXB 3U3MA 4CGZA 5TY0A 3TQFA 4JVLA 4MKFA 1JEEA 4QBGB 3W6OA 2I4IA 1XPRA 3SZRA 2AFHE 4WZBE 5B30A 1X8LA 4IDOA 1TEXA 2XAUA 4JLNA 3K09C 2VSFA 3WYFA 1Z08A 4DLRA 5JMTA 1N5JA 4OHYA 3SE0A 4PO8A 1E4YA 3V00A 1KK2A 1E1QA 5KU1A 1MV5A 2QG6A 1Q12A 3NXSA 3SHFA 2H17A 1G7RA 5SZIA 5K8TA 3EW9A 3IO3A 4XWOA 4NCNA 4Q02A 2ZYWX 4AIIA 1XBTA 2WKPA 121PA 4GOJA 1OFHA 1A1VA 2WJIA 3EIHA 1BH2A 5JBQA 1AS2A 4FINA 3QI2A 1M7GA 4B3XA 5CB6A 1P9RA 3RC3A 2R2AA 2REOA 2ZJ8A 3AVWA 3AP3A 1SXJC 4B71A 4HB2A 4W9MC 1YR7A 1ZINA 2O0KA 4MH0R 3IIMA 2ONJA 1SGWA 5AWFC 3LO5A 3U3JA 4BZPA 4LHXA 5A0FA 1GKIA 2QNRA 2QAJA 1IN7A 4C4PA 5B58C 3KJHA 4P32A 3C14C 1G3MA 1I2MA 1XCMA 2R44A 1QRAA 5GADl 3CWQA 4EQ6A 4D26A 4A9AA 4JKIA 4OHVA 3BRWD 1Q0UA 1W4BA 3ZZ0A 2GKSA 2ZPTX 3AVTA 4AG5A 3ZVNA 2IBMA 3PUZA 4KITB 2FH5B 1CU1A 4H1UA 3KTAA 5H1YA 1R0WA 2JIZA 3OFND 4QJ4A 3DZDA 2WJYA 2J0QA 1P2SA 2KBFA 4HSEA 4A8JA 1RJ9A 1JQLB 2PH1A 2ATXA 4DDWA 3A1SA 3AF0A 5CK4A 2WWHA 2E1RA 4F92B 1OYWA 1G3RA 3OE7A 4LI0A 1RPZA 4GI7A 2ZRIA 3WXMA 4NYMQ 1YRAA 1YRBA 1JR3A 3RRYA 3NDBB 2ZAMA 3MLEA 2QPTA 4D0NA 3DKPA 5KPJA 4BE7B 1FTSA 1Z0AA 3RS0A 3G82C 3QPVA 1CJUC 2XB2A 3OF5A 1XEFA 3OEHA 4FMDF 5TARA 4BFSA 2BV3A 1K6MA 2VRWA 3AF4A 1G20E 2CVFA 1G4UR 1NMYA 1P2TA 1TF5A 4QM7A 2ZJOA 1UBGA 1WMSA 2CJWB 5HKKD 1BS1A 3GJ3A 4IW3B 4MYTA 3RC8A 3BB4A 4LC0A 2ZE6A 5L3SA 4DDVA 1XZPA 1LTQA 3O8BA 5JWHA 1Q1EA 1Y3AA 2QP4A 1WXQA 2ODWA 1QZXA 1KDTA 3AUXA 1NLYA 2ZVQX 3KKMA 3BH0A 3A6PC 4V0ME 1P9WA 3IHLA 3C41J 5CM9C 1XU4A 3NEYA 4NP6A 5M04A 3EX7C 1F5NA 4KBFA 4NCIA 1XJ0A 5HE9A 3D7MA 3TNFA 3K0FB 4Z51A 4IEEA 3P26A 2HYIC 1KO1A 1WB9A 1DAEA 4DDUA 4PHTA 2BJWA 3ZH9B 1II8B 5JJLA 2RGDA 2FX3A 2J0UB 5AJXA 3CKLA 1FMJA 1VG0B 3KXIA 2BM0A 3CONA 4Q9KA 3S1AA 1E99A 5FPSA 2ZJZA 2IYRA 2W00A 3JVVA 2IXFA 5EXSA 1P9NA 3TUZC 1U90A 2DFLA 2UZ3A 4OHZA 2O8CA 1U98A 4KFRA 1OHHA 2CK3A 1TUEA 4FCVA 2QBYB 2C8VA 3PUXA 2EFGA 1Z0IA 3Q5EA 4MKIA 2FFHA 2I3BA 4DZZA 1YE8A 2C9YA 3FE2A 1EWQA 2XNDD 4U00A 1RFLA 3DMDA 3VNUA 4R2HA 2VTKA 1W36C 4HAYA 3NBXX 1KZ7B 1XP8A 1WE2A 4URVR 1SHKA 1M2OB 2ZRDA 1CRPA 3KX2A 3THXA 4KU4A 1GL9B 3TSZA 1KJYA 2BWJA 1EX6A 5DN6A 3SJZA 1NNEA 2IYTA 2ZRLA 3CO5A 4EQ6B 1G8FA 4LWZA 2REBA 2HDNB 2CLDX 2IL1A 4BLSA 2YVUA 2JLVA 5J4KA 5FL3A 1PLJA 3T5GA 4NYJQ 4URXR 3NDPA 1YVDA 1W5TA 2OXCA 1S1CA 4DEYA 4GOKA 3SFVA 1PZNA 2V9PA 2QSYA 4Q01A 2IXGA 1BKDR 1Q20A 3QKSB 4RD4A 3T12A 2C78A 3VR5A 3HJNA 4ZO4A 4V0LA 4RY2A 1NLFA 4LJ9A 5FOXA 2J3EA 1JBKA 2XJ4A 3MCAA 2R6AA 1N6RA 2C03A 4A15A 5SZHB 1FUUA 1T3HA 4PQYA 2VP0A 3RWOA 1G8GA 4A0RA 3RANA 4LHZA 1A2BA 4Q1BA 2F43B 4W5JA 1KKMA 4F4JA 1Z47A 1EK0A 4HLCA 2QP3A 3QJYA 1E96A 2YOHA 1DO0A 3ZS8A 4DB2A 1NVUQ 1IXZA 1SKQA 3EPKA 3T5DA 1KGDA 2GAOA 4EPVA 4Q47A 4TL9A 3LNCA 1XNJA 2QI9C 4QM6A 1YJ5A 3GFTA 1W48A 2JLUA 4RZUA 3KQUA 4UJ5A 1Z63A 2L0XA 4JBYA 1VKJA 1IY1A 2ZUBA 3M1IA 2F43A 4QNMA 4MA4A 4XSGA 4B3FX 1P3JA 2W58A 4KV9A 4IOKA 4LV6A 1OH7A 1KKLA 1E9BA 5EZ6B 3REGA 3BH6A 3IKJA 2IS2A 1MOZA 1IN5A 1NF3A 5EE0A 4Z1MD 3G0HA 4X8OA 2CK3D 4EPTA 3U7FB 2WOOA 4ITRC 1YU9A 2QMOA 3TIFA 1ZNXA 3QKUA 3WRYC 4C0LA 2R6DA 1HURA 4MITA 3AVYA 2QRNA 3WYGA 2QROA 1YHNA 3VU9B 1P62B 2F1HA 1K8RA 2ASEA 4GMDA 2CE7A 1VCMA 4Q4HB 2WIBA 4P3YA 5D3QA 4EDHA 2GEVA 1ESNA 1P60A 5FR2A 1JJVA 2GJSA 3VNVA 4P4SA 3OESA 521PA 1G8HA 3RSOA 1XJCA 3FPAA 4IXNA 2NGRA 4ERNA 2N46A 1UBFA 3PFIA 4CEHA 1BYUA 4EIWA 4LOAA 1OV4A 2VL7A 2J87A 4UNSA 5AJWA 5CB8A 1FZQA 1GWNA 4C0QC 3AEZA 3B85A 5J4LA 3QG1A 4I4LA 2OLJA 2GVDC 3EIQA 5FUWA 1AIPA 4URUR 1AZSC 1XMSA 2E9SA 3BFVA 3QKSA 1N5KA 1OW3B 3CB4A 2HT6A 4HUQB 4MGIR 3QNUA 4RKFA 4TLEA 2YWHA 2GJAA 4JLPA 3RWMB 1Z29A 5BQ5A 1L7VC 5L3QB 3CX8A 1K5DA 2G0NA 1RRPA 3EZ2A 4FD2A 4RZXA 4EJSC 2OLKA 4US1R 4KCGA 2AWNA 2MMGA 5FTKA 4GP7A 4RD3A 4XD7D 1HH4A 2G1KA 4JL5A 4RD1A 4BASA 2WICA 4V0KA 1II9A 4MDEA 1SXJD 1PV4A 1Q57A 4TYWA 1YZUA 4O2RA 2A5FA 4BQSA 2CLSA 4QHYA 3TVTA 1RVDA 5BWMA 3MFYA 1XF9A 2EFEB 3MWJA 3WRXC 2GCPA 1OF1A 3GJ8A 1X1RA 1XEWY 1XCPA 2FPMA 1MRNA 2GNOA 2ZJYA 3IPXA 1KOFA 2WBLC 2JCSA 4GT1A 4XVUA 2IHYA 2X2FA 2LKDA 4LJ4A 1OXSC 2ZS7A 4IVPA 4J0QA 1E9EA 4BRUA 1II0A 5L8VA 2GTPA 1M6NA 3V4RA 2XSZD 3TJZA 2HF9A 2PT5A 2IS1A 4HAXA 3AVXA 2QE7A 4B32A 4V02A 2OG2A 5E7MA 1VG1A 1WF3A 2R62A 4Q7KA 2J41A 1L4UA 1U9IA 1J90A 2UKDA 1KSFX 1ZUHA 4F4IA 1DOAA 2O8EB 3FTQA 1US8A 3NC1C 1X1SA 1BOFA 1OH8A 1QHIA 2JASA 1AKEA 1G6OA 1GP2A 2ZJ2A 2C2HA 3BB3A 4Z1MA 1RRFA 2J7PA 2FZLA 1OJLA 4CW7A 1DELA 2MSEB 2WWYA 1NVVQ 1LVGA 4QJ3A 1KY2A 4C2UA 4YONB 1QF9A 3AKEA 4ZKEA 4K46A 5FI0B 1MABA 4DDTA 4U5XA 2MSDB 1YZNA 1H8HA 1QHNA 3K9HA 2WWWA 3FFAA 1ZU5A 3CF0A 4L9SA 3R8FA 1G5TA 5E7JA 2GILA 3A8TA 2NO6A 4WXPA 5B64A 2NZJA 2JLYA 1Z06A 1IM2A 3I73A 3E1SA 3QQ5A 5HPYB 3ZQJA 3OE7D 4Q4HA 3R7WB 2PJZA 3IGFA 4TQUS 2DFKB 5B57C 4B43A 4LJAA 2QTHA 1M7BA 3MGCA 3LY5A 4Q48A 4UKDA 4EJSB 2V3CC 2G9NA 1TF7A 1HTWA 4M4SA 3K70D 3U7HB 2JAQA 3MMPA 5CLLA 5EXXA 3RRZA 1M34E 1XMVA 3QXCA 4DXAA 4NCKA 1EXMA 1SVKA 2QRZA 2QTFA 3DKVA 4ZDKA 1N0UA 1Z6YA 2QZ4A 2BOVA 4M2LA 4A0HA 4B73A 4FMCB 4ESVA 2C04A 2JDID 2AD1A 2YC4C 2ZRFA 4GDFA 2PMKA 2F1IA 2PJRA 3KB2A 3WY9A 4FCWA 3ZQ6A 4EPRA 4B75A 5H8WA 2D2EA 2WAXA 2ZRNA 4DLTA 4A8JB 4MQBA 3SN6A 3W34A 2KB0A 4AKIA 2GEUA 2KWIA 2H8KA 3QKTA 1FQKA 1H8ED 1T9HA 5AUOB 2G1JA 3NG1A 3X1XA 3BOSA 1AA9A 5KPDA 1HE1C 4JZKA 4M1OA 3SR0A 1VIYA 4QKQA 2F7SA 1ZM3A 3W8RA 1ZIOA 5BXQC 3A37A 2JJ2D 1JNYA 2R9VA 3PR1A 2QA5A 4LBWA 2O8DB 2NTYC 1KZGB 2FSFA 3CH5A 4CEIB 4URZR 1IJFA 2OCAA 2CLCX 4NONA 5HTKA 2IS4A 1RRGA 2CVHA 2EU8A 2XB4A 3I1FA 4ILEA 4P31A 1G3IA 2JJ1A 2O5VA 4JKYA 5KDLA 1E79D 3D31A 3ICEA 1L4YA 3UMFA 3QBTA 5K8LA 3VQTA 1AZTA 3KKQA 3UANA 1UKEA 2V1UA 4HAZA 4C7OB 1FUKA 2X1VA 1U0HC 4LJ7A 2OV2A 3OIYA 1XZQA 1S9HA 3PEYA 3SOPA 3NH9A 1IOZA 5F9HA 2WSMA 1B0UA 1C4OA 1XX6A 2GHIA 3QF4A 2YHSA 3KKOA 1NSTA 2FDCA 3QXXA 1HQCA 1VCOA 5EP4A 4QL3A 1E3MA 4NPHA 2SHKA 4DC9A 4IXMA 2JDIA 3TW4A 1JECA 3K0FA 3AVOA 3LRPA 1VHLA 3QOFA 2IT1A 5KSOA 2RB4A 1WRBA 2QENA 3DDCA 1DVRA 4E03A 1N6IA 3UMSA 3QKRA 5KDOA 4HAWA 1TQ2A 1G21E 1GRRA 1UM8A 1ZCBA 5SZJA 4M9SA 3U7GA 1D2NA 5FPHA 1R0ZA 2QAGA 2QMHA 3N70A 2WV9A 5JWRA 1MO4A 3WNBA 4DVGA 1CBUA 1E0SA 2B7BA 3IBYA 4BFUA 2UVQA 1HYQA 2H57A 3K1JA 3F0TA 4LYJA 1KDOA 2GXAA 2QQEA 3ZD7A 2J1LA 2RGXA 5LD2C 2ZQ5A 2ZIAA 2QL6A 5A5GA 1G17A 2ZUDA 4QBFA 5DO9A 1LF0A 2XZLA 1KI7A 1E79A 4H9GA 4OI4A 2EW1A 4G3XA 4XVQA 2Q21A 4A82A 1HY3A 2VO1A 4OKSA 5FUVA 4EPXA 2B6HA 3BERA 4ZI3A 1IBRA 1COWA 3CM0A 2B8TA 1GIAA 1NN1A 4C0AC 1P2UA 1ELOA 1FX0A 1YZGA 2X19A 4DUGA 4I1VA 4B48A 3SU8A 2N42A 5KNBA 1SQ5A 1Z2AA 2NIPA 2OESA 3AKDA 3E5HA 4YMWA 4KO8A 5FL7A 4PR0A 2AK2A 3GJ7A 5C4MA 3U60B 3F5FA 1C9KA 1ZBDA 2HUPA 3IQXA 4MYHA 3TUIC 3GJ4A 1XTIA 4QHTA 5KO2A 2H16A 2ZI7A 3TSOA 4ZIRB 4TL8A 1G16A 1SXJB 4ZKDA 1R5BA 3LWNA 1PUJA 2JIZD 3FOZA 3GLIE 2KBEA 1FNNA 1KK3A 3OFNA 2DPXA 3GD7A 4QGGA 4B2PA 3AKCA 3PG5A 1E9SA 4BFTA 2RHMA 2OHFA 3UMRA 4FWTA 1OXXK 2F9MA 2XX3A 2ZS8A 3OEED 3GLFB 3C15C 3CZQA 4HDCA 1BMFD 1TU3A 4G5SA 2PZEA 1P61B 1SHZA 3FMIA 3I92A 4Q7LA 3U7EB 4BGDA 1E6CA 3KQLA 4RCZA 2HYDA 1OYYA 2QPOA 1PVOA 3AUYA 5DGXA 4B35A 3U61B 3LX8A 4R98A 3LLUA 5FBQB 3Q72A 4TZ6A 2PX0A 4G01B 2FV8A 1EFRD 3KKPA 4LV5B 5FBRB 4A1FA 3W3AA 3H0KA 3C4JA 2QU8A 1WDTA 1HEIA 2W2XA 1N25A 1XD8A 1XWIA 3PENA 3ZVRA 5HE8A 5FOTA 1JPJA 2A9KA 1S8FA 2WJGA 3N2IA 4LC1A 4DHEA 2ORWA 6Q21A 4PSVA 1ZUIA 4PZYA 4BEBA 4ABYA 3NBYC 1KI2A 3GJ0A 3AF2A 3UWKA 4HEJA 5A4JA 1K5GA 1VG8A 1S1MA 4HDOB 4JSTA 1XEXA 1E2JA 1E1QD 5JHGB 1OPXA 1N3BA 2BC9A 1F2TA 4I81A 3TK1A 1W5SA 5IRCD 1KO4A 2EFHB 4GBMA 3TBKA 4FW9A 1ZMXA 5HCIA 1LNZA 2OFOA 2VHTA 5DYIA 4IOLA 1D9ZA 1M1YE 4IFEA 4TMVA 4URYR 4C2TA 3ZZUA 1BIFA 1F60A 3RS5A 2QQ0A 4OBEA 1AQYA 2ZSBA 5JSZA 3LBNA 4HAUA 4DIDA 1GRQA 4AY2A 2BMJA 1VPLA 2CL6X 3R9IA 3AF1A 2XGJA 4PAQA 1XTRA 4TT3A 2ANBA 3OEEA 2BBSA 2H7VA 2ZJAA 1XD9A 4P4SB 4M0LA 1TQ6A 5DI3B 2ZS9A 2CL0X 2OZEA 2ZANA 1O3YA 3LFUA 4OYHA 2A2ZA 3NWJA 2ZU0C 5F9FA 1GZSA 1ZIPA 2EYUA 3DOEA 4A4DA 1N0VC 4DUGD 4AG6A 1R5NA 1JXMA 1G7SA 1W46A 2WMNB 3BE4A 1UAAA 5FL7D 4R9UC 2IYZA 2V7QD 3K0AB 3X1WA 1G3QA 4W5WA 3DM5A 4JJZA 3ZIAD 1XD2A 2J7KA 1G7CA 2XJ9A 3A1TA 4BLPA 1R4AA 2XOKA 3EC1A 2WJJA 3FWYA 2CCJA 1NIPA 4D25A 4JS0A 3CX6A 2XZPA 3DHWC 4G0NA 2WMOB 2J46A 2W6JA 4Q1CA 2Z83A 3IEVA 5DNYB 1QVAA 3GJXC 1XD2B 2Q9BA 2V4ZA 4XIGS 3ZZTA 3A4LA 4NH0A 1Z0FA 1E98A 3OAAD 1CF4A 4YXWD 3CRW1 3CW2A 3ICQB 4Q9JA 4PFSA 3U3RA 5J5CA 4ZV4A 1EFRA 3WBKA 4AWXA 2J9RA 1T8TA 2OAQ1 2ZI5A 1NVXQ 1ZD9A 2VP5A 3VR6A 5FUYA 4UNRA 2WTUA 1E2MA 3X2SA 5C4GB 1UDWA 3BIFA 1S4QA 4YC7A 4AYWA 3GLIA 5DE3A 4PX9A 4A2QA 5EZ5A 5FOSA 2XITA 1FMLA 3R9WA 3EA5A 4PANA 4CVNA 2YJTD 1Z2CA 4LBVA 3EPLA 1TL7C 3U2QA 3GLHE 3I5YA 2BMEA 3KZ1E 1AS0A 1OFTA 1NY6A 5EE3A 1E2LA 2GEDA 5FUXA 4GRAA 1G5PA 2W0MA 4PQRA 5H70A 1E32A 3ZIAA 2W2VA 2EVWX 1KDRA 1F6BA 1UBCA 4TYQA 1GNPA 2GWHA 2RGAA 2IUSA 3FKSA 3L0IB 4C0HA 2F3RA 3QUSA 2F6RA 2ERXA 2BJVA 2J0SA 2RGBA 2O8EA 4DCUA 1W0JD 3DMNA 4U02A 4P33A 1FW6A 4Q9IA 5IF9A 1DADA 3QXSA 4NTZA 5FH9A 3PUVA 4LV8B 3BB1A 1GUAA 1N6PA 2B21A 4H1VA 4XTRA 2HJVA 1H8EA 1NN5A 1QHHA 2ZR9A 2ZYUX 1C1YA 2FOLA 2PMDA 3IQWA 4BLOA 3IIJA 4B76A 1OH6A 1CJVC 1GILA 4HZUB 3KJGA 3X1DA 2WSSD 3KFVA 4EFNA 4JL8A 4CEJA 1SVSA 3ND9A 2GJ9A 4HLUC 2FA9A 2EWWA 4KJZA 5JLJA 3GMTA 1CXZA 4OQLA 1E0KA 4GMXA 4B74A 4IKEA 3E70C 4LBZA 1WP9A 2CXXA 2W0SA 1Q3TA 1YZLA 3G5UA 4WXRA 4Q9HA 2JJ1D 5IK2D 1GNQA 1DAFA 2CHGA 1GKUB 2R6GA 2FN4A 3I62A 1EWRA 1E9DA 3WNDA 1WQ1R 1ZAKA 3CPHA 2PLFA 1OIXA 2VF8A 3CNOA 4XOIA 1AK2A 2NPIA 2X8AA 4L16A 5CIQA 4AC9A 3U44A 1B23P 1JR3E 1ZNYA 2WWFA 3GEHA 1Q3HA 3CRVA 1U81A 2C5LA 221PA 4PPGA 1L8QA 1E2FA 4B3CA 1N2CE 1OB5A 1UBEA 3O8RA 1VIAA 1VCNA 3RLFA 1CKEA 3ZS9A 2DYKA 3Q7PA 3DEFA 2W6JD 2H5EA 4GNKA 1CR0A 1LFDB 1F48A 3KUCA 4PAOA 1KY3A 2QM7A 2WWXA 3VFDA 3ZVLA 5TB5A 4PSAA 3TE6A 4TMKA 5JJIA 2BVNA 2RGEA 2KI5A 3SQXA 4BFWA 4DB4A 5DHFA 1N6KA 5TXGA 1I4TD 1R7RA 4G5QA 1LS1A 4XJXA 4EFLA 1IJEA 1E2KA 1VCIA 1IXSB 2BKEA 4JIMA 3GLFE 2DY1A 4JT2A 4Y0AA 1Q1QA 2C96A 3U6BA 4RVCA 1R6BX 5FOUA 5G41A 3I8XA 1MT0A 4Q1EA 4MUBA 3SHWA 1VYTA 3ASZA 4EPYA 3GLIB 2LKCA 4JYCA 4M1SA 2W2TA 3EIEA 3GLHA 1JEDA 3LX5A 5SZKB 2NO1A 1A7JA 4TYNA 3D6TB 4ZI2A 3THOA 2D2FA 3LXXA 5CDFE 2J45A 2FZ4A 4TL6A 3WYAA 4Z54A 3VU9A 2OSBA 1TAGA 1RKBA 2Y8EA 1OXVA 2AX4A 4AYXA 4AK9A 4UQOA 2Q6TA 5CYPA 4ZCLA 1FFHA 2ZRPA 2GK7A 3LQQA 2V6IA 4U7DA 1D9XA 3QXHA 5CJPA 1FTNA 5TMPA 2BKUA 5FBLB 4PAMA 5B2ZA 4OK6A 1EX7A 5E7IA 3C7KA 5TVKA 1LV7A 1XEWX 4KFSA 1RIFA 5CYOA 2ZXUA 5FTNA 1FL9A 1JAIA 1UJ2A 4BFZA 1QDEA 2ZM5A 2X77A 1EGAA 1GL6A 1PLLA 3PVSA 3QBVA 1NBMD 3VHXA 4PPFA 3SJAA 1P75A 3LV8A 3CR8A 4S35A 5DISB 1RE0A 2GRJA 2CBZA 3P20A 5DHAA 4A6PA 1IN4A 3QPWA 3A1VA 1T8UA 4TLAA 2WZQA 3SFZA 5KNCA 4EUNA 4IJMA 3FVQA 3C5HA 3SC3A 4M1YA 3EASA 1AS3A 3K0EA 4UXJA 4ZDWA 3B8HA 3LBIA 4IRUB 1P6XA 5G3ZA 1Z0KA 1SKYB 2AD5A 2D7CA 1FX0B 3KL4A 4NYIQ 2UZIR 3A36A 3R7WA 5C2JB 3ZD6A 3I72A 1AQUA 2FEMA 4PC7A 3CUEF 1DBSA 3UPUA 1ZD1A 2BEJA 1CJTC 4Y0VA 1YR8A 2O8FA 3I4LA 4XVRA 4V0MA 3TW8B 2I1QA 1UKYA 1SKYE 1CJKC 1FNMA 4DCTA 2R6FA 4JSYA 3GFPA 4NCHA 4LHWA 4PO9A 4M9XA 1W0KD 3PQCA 1Z6GA 1JALA 5AUPB 3SBEA 2GVZC 3EPJA 2ZSEA 4JLKA 2JLSA 2W6ID 3P1JA 5JJKA 4W5HA 4K81B 5DIFA 1DAGA 5JEEA 2BIFA 4UNPA 2IYXA 2PZFA 3HU3A 5J47A 1DARA 3ZJYA 3TQCA 1QVRA 5BN3A 4OQNA 3W5IA 4I1UA 3SYKA 3GCGA 4L9WA 4S2EA 4HLQB 4A92A 4Q1DA 2XNDA 621PA 3FHOA 4AKEA 1II8A 4F93B 1A4RA 3IILA 2F55A 2IUTA 4A0FA 1ZM4A 2XSZA 5DLQC 4URWR 4E5UA 2NO9A 4Q00A 4WZ6A 1R0YA 1DE0A 1Y63A 1ZVQA 2ANCA 4E07A 1E0AA 1S3SA 4C9BA 2WJVA 1G1MA 2R8RA 3GLGB 2ZEJA 3KUDA 5JS8A 2Z0MA 1DPFA 4RCYA 2O8BB 1XPUA 1QHHB 2FU5C 2VHCA 1XCGB 4QOSA 1MO5A 1AJEA 1W2GA 3AVQA 5BYKA 1EFUA 5EXPA 3CPJB 1TPZA 2IWHA 1QHGA 1GFIA 1SVIA 5HKKA 2J59A 3D8BA 2OT3B 3N2EA 2OCBA 5UKDA 2WPDD 5EP2A 2YNMA 4F4CA 3KFXA 2GCOA 1Q1ZA 3L0SA 1Z6TA 3IUYA 4XWKA 2P5SA 4Q4AA 3B78A 1S0UA 1JPNA 3FB4A 4B6FA 2PT7A 5JI3E 1MO3A 2FEOA 3LQRA 4B2LA 5KNDA 3T35A 3ND8A 5JRJA 4TQ9A 1TMKA 3U5ZB 3LVRE 2WOJA 3RNLA 2ZRMA 4JLBA 4WW0A 1G19A 2JLQA 3ADCA 2HF8A 2A7QA 3HR7A 4X8LA 4LPSA 3HU2A 4NCJA 4Q4LA 4ZDJA 3R8CA 4D4KA 1WA5A 4Q18A 4JLOA 5LB2A 3RABA 1KMHA 4JJKA 4LHVA 3HPQA 4GPTA 4JYBA 3HPRA 3MAAC 2OILA 4L15A 3C8UA 1IXRC 3WP1B 2ZRKA 1KO8A 1TQ4A 2BBOA 1SXJE 2GF9A 3K9LA 3AGPA 1OHHD 1PLKA 4D0LB 1DAHA 4OI1A 2IEZA 1NN0A 3B60A 3TH5A 1P4SA 1Z3IX 2H1LA 3A58B 3TKLA 1W36B 4QFMA 4YDHB 5LDDC 4Q1FA 3T1TA 3W90A 4FI3C 1T3SA 3J81k 4C30A 4LHYA 2DB3A 4NYIR 2DFNA 3QVUA 4M21A 1DO2A 2W6IA 5C18A 4FIDA 4DLUA 2QGZA 4RZ2A 2RGCA 4B33A 5LD2B 4AI6A 3KTAB 4LRWA 2DFTA 4BRWA 4C0KA 3I5XA 3U44B 2HXYA 2QGNA 4BLQA 1Z6AA 4NE2A 4NMMA 5JEDA 2IF0A 2DHRA 4B44A 1R10A 2LWIA 1XTSA 4POAA 4ARZB 3QPUA 1DAMA 1VG9B 2VSXA 2B7CA 3ASYA 2ONKA 4HI0E 1P5ZB 3MWLA 4PZZA 1FQJA 1GITA 4B3GA 3NBFA 2QORA 3E2IA 1G4AE 4D4JA 4BPBA 2ZJ5A 1LY1A 4JLJA 1DG3A 3BGWA 3GLGE 2FF7A 2DWOA 2X2EA 3KDSE 3RRMA 1DS6A 2QAGB 4KSCA 3GLFA 1ZYUA 2VBCA 2WM9B 5LPNA 3VMFA 1A82A 4CDGA 1XXHA 4DRZA 3K09A 1YR9A 2VP9A 4QGFA 3THXB 3BD9A 1OB2A 3SNHA 2ORVA 4TTQA 4FN5A 3RYTC 2HCJB 3THYA 1FP7A 2Q0HA 3QY0A 5CIWA 3ADDA 2Q9AA 2AXNA 3EWSA 4B3DA 4YDSA 3L8ZA 3NHAA 4IVRA 2OFWA 3B82A 3LXRA 4G5OA 1T5LA 2HV8A 1MO6A 2VP2A 3CIOA 3VKWA 2I1VB 3RDPA 1ETUA 4XSHA 4AURA 2FMXA 2FFAA 1XTQA 4LJYA 5FTJA 4Q4AB 2ZU6A 1XMJA 1W2HA 2J5XA 3MWYW 4KFTA 3UKDA 3BJIC 1OXUA 1SVWA 1XXHB 4OK5A 1YZQA 1R8SA 1I4LD 1GKYA 4ASUA 4F91B 4UNQA 4F38A 4YMVA 4L4UA 2GZAA 3F8TA 4YMUA 3QEJA 3QE0A 1XEXB 2VIIA 1E2NA 4E22A 2Z6VA 2IYUA 4OK3A 1XFAA 4LJ8A 3HDTA 2R65A 2OBMA 4TYYA 5FPYA 4JMPA 3UG7A 3I3SR 2NG1A 2P0EA 4TLDA 2GJKA 2D74A 4HLUA 1FOEB 3AVUA 2D4HA 2PCJA 4PTLA 3L82B 2IW3A 3L0OA 1CR1A 5BW8A 1WBDA 3O47A 2AN9A 1GM5A 3GEIA 1U2RA 3MD0A 3O8DA 4CYMA 1NP6A 3EAQA 4W7SA 4BZXA 1R2QA 4IHQA 4LZZA 4Q19A 4CEJB 3JZAA 4M9ZA 1NN3A 1AGPA 1FP6A 3I61A 4GL2A 1X8KA 1MH1A 1GNRA 2W83A 3GJ5A 4LJ5A 4Q7MB 2OCPA 3CNLA 3PUWA 1RRCA 1CJMA 3CNNA 2ZRBA 4ON9A 2IS6A 3B5JA 4PSKA 3W3ZB 4HB4A 3FGNA 1J8MF 4GSYA 4RD2A 5G3YA 2D06A 4TWZA 3N5CA 3K9NA 4HUQA 4R71A 5JHHB 2F3TA 2QAGC 1UPTA 2E87A 3NEJA 1MRSA 2G3YA 1XTKA 1ZC4A 4JVNA 2CHQA 2IYLD 1Z22A 1DTSA 2VA8A 3T34A 1CLUA 1LW7A 1CULC 1RW4A 1X3SA 3FMOB 2JJ8A 3VR4A 4V0OA 1W4AA 2KJQA 4D0GA 1MR3F 2VF7A 1BYIA 2P6UA 4JLDA 3U3OA 3AH8A 1X8JA 2V1XA 2VP4A 5FI1B 4TLBA 4EFMA 3Q5DA 5AJYA 5CJ2A 4O25A 1JI0A 1QHSA 2OBLA 4NBSA 4FWIB 1W4RA 1S3GA 3TSWA 2FG5A 3DL0A 4Q4JA 2QN6A 2RGGA 4C0SA 4GP6A 4LDJA 5LBIA 4CF7A 4CT5A 1GG2A 4GZLA 4RSGA 1VECA 4B47A 3BORA 3MG9A 2JLZA 2ERYA 4MDFA 5CLQA 2ZI6A 5D3MB 5GJCA 2QM8A 4LBYA 4TSFD 1CRQA 4AKHA 1F2TB 2ODEA 2EWVA 2ZTSA 1QG4A 1E2PA 3AP2A 4D6PA 1SVMA 2OFXA 1N0WA 1YZTA 1KI4A 2PEZA 3C5CA 4Q9LA 2IX3A 2IEYA 3I8SA 4N0DA 4BUJA 4R7ZA 3W6PA 2ZI4A 3NH6A 3FYHA 4NKRA 4V0NA 4ASUD 4DCNA 1D6JA 3P4YA 1YR6A 1UEJA 3CBQA 3AVVA 2NQ2C 4BLTA 1Z6XA 2VEDA 5IDVA 4A0GA 1W36D 1X86B 4KYIB 2D3WA 3GP8A 4MKGA 3NKVA 4B2IA 2OM2A 1GAJA 2A30A 1IN8A 2F9LA 2VHUA 2Z5FA 3B6EA 3GJ6A 1KO5A 4JLVA 2QPAA 4KSBA 4RFVA 2QBYA 1CIPA 4ZIRA 1KK0A 1G8YA 5JS7A 3IO5A 4Q7JB 1XTJA 5ELXA 2AHOA 1V43A 1KI6B 4DLVA 3IPYA 2OE2A 2XTNA 4DKXA 2WSSA 3IEUA 4RD6A 3VKHA 1E69A 3EA0A 3T61A 1NG9A 1M74A 2Z4SA 1NRJB 2C9OA 2WVJA 3CX7A 2FWRA 2Q3HA 2Z43A 1E2HA 1N6HA 2IF2A 1I2DA 4D4MA 2GF0A 2IYYA 2IC5A 3B1ZA 3TUJC 1YZKA 1UADA 5EUMA 2IXEA 4CT4B 1Q44A 4EKDA 3GFOA 4PXAA 1E9CA 1UKZA 2QSZA 2HLDA 4KXFB 3KXLA 4XWAA 2OEPA 5FTMA 1KSHA 1Z83A 1F3OA 4Z8XA 2CNWD 1T3LA 1GRNA 2DCUA 3QF7A 4LY6A 2IYSA 1ONBA 4MRRA 4HUTA 3TLXA 1KNQA 2CMKA 2G6BA 4I1SA 2RAPA 2EQBA 1RJ9B 4JT4A 3CF6R 2BCJQ 1XRJA 1I4DD 2ZROA 2P65A 4AKGA 3EZ9A 4A8JC 4PQFA 3H86A 2FPLA 3LW7A 2HT1A 4B3BA 1JR3D 4DWJA 1P7CA 1QBKC 3BXZA 4LUCA 4D2IA 4R2IA 1KI6A 3OIVA 1U9IC 2ZR0A 4GOXA 4QGHA 5TDHA 1KAGA 2Q3FA 3OEHD 1TNDA 3QKRB 3PJRA 5GJVC 1R8QA 1TU4A 2PEYA 1S2MA 4IEIA 2DWQA 2R6CA 4TQAA 3ZLJA 4TZ0A 1XDBA 1G291 4MRPA 4XH9B 1D5CA 1E1RA 1HT1E 2JJ2A 3B1WA 4PC6A 3MJRA 3OHMA 3PV0A 2GXQA 4TSFA 1OT3A 1RYFA 1ZCAA 1KDPA 2IA5A 1LS6A 3LW8A 2BBTA 3QF4B 1KK1A 2ECKA 4RFSB 5BN5A 4NHOA 2AKYA 4TT3D 4HDQB 1XB2A 1U94A 3PCRB 4DBLC 2WAYA 4BFXA 1ZP6A 2HXSA 4LJ6A 4ZPXA 3UG6A 3BS4A 1E2EA 4KLNA 4EPWA 4M1WA 5FTLA 2YC2C 2H18A 3T15A 3ZGXA 3QIAA 1RYHA 4PC3A 2BMFA 3KJIA 2QT1A 3SYLA 4KLZA 1AM4D 3QG5A 1T4GA 2CNWA 3DOFA 1P73A 1TQDA 1E9FA 2BM1A 1A2KC 4FCTA 4KYUA 4TL7A 3KQKA 4M53A 3QVVA 1M7HA 3B7GA 2NZ8A 4XD7A 4CEIA 1ZNZA 2Z4RA 3DO6A 3ECCA 1R5OA 3CWZA 1ZM2A 4E09A 1JQJC 1QHXA 3L0PA 3Q9LA 4QGAA 1KSGA 5CM8B 3JZMA 4KODA 2D7DA 2GXSA 3Q7QA 2NOAA 3M0EA 2P3SA 1ZD8A 1NBMA 5KTYA 3DVLA 1HV8A 5EE1A 2DBYA 4P4UA 3EPHA 1R0XA 3MWKA 1KMQA 3W9YA 5E95A 2XTZA 2ZAOA 4OI2A 4TYPA 2YYZA 4FMCF 2P6RA 2YOFA 3RS4A 2JLRA 1G8PA 3KB1A 3OIWA 3REFA 1E1RD 3VR3A 2HEIA 4AYTA 2AXPA 5FBWB 5DYGA 4O0MA 2FFBA 2FGJA 4FMBB 3H1TA 4PC2A 3VR1A 3L2OB 5FOVA 4I99A 3QSYA 2ZRCA 4DLYA 3W8NA 3MRSA 4KAXA 3PIRA 1OFIA 1GTVA 721PA 3LBHA 5TV2A 2D62A 3IBGA 3LAWA 3VHLB 1T6NA 1T0HB 1OIVA 2VSOA 1COWD 4C0BA 1NJFA 2J7PD 2JATA 2QT0A 4LGMA 4B34A 4HZIA 3M6AA 2CJWA 3W5JA 1G41A 3PEUA 2IYVA 4CRWB 1H65A 3HYRA 2RCNA 3RRNA 4A2PA 4OJQA 2Q3MA 4IDHA 3RS3A 4DSTA 4BFVA 2JLWA 1GOTA 1HT2E 3ETLA 3AKYA 3DM9B 4RKEA 1A5TA 3SJBA 3EZFA 4RFSA 2VP6A 3GEEA 3ONWA 5JWOA 3AQ4A 1NLZA 3CR7A 2OAP1 2JLXA 5KDDA 5KYKA 4QRHA 1GDDA 4MRSA 2WJHA 1OSNA 821PA 4MGZR 2GETA 2H92A 2ZSDA 3BH7A 4DSOA 2RMKA 5CK5A 2ODNA 3VKGA 2O8DA 1BMFA 5E3HA 5KSZA 3TR0A 4B6EA 3TAHA 2HCBA 3B13B 3L43A 2XOKD 5L3RA 3T1VA 5CDFA 2QMEA 5EQTA 2ZJBA 4YMTA 2ZI9A 2RGNC 1D8TA
chains in the Genus database with same CATH superfamily
3TVDA 4PICA 1UPCA 4H7PA 4JY7A 5AVWA 1UT6A 3V7WA 1PR2A 1Y8RB 2C95A 3ZKWA 4CQMD 1RWNA 3EXIA 3W6NA 4UHBA 4AIRA 1EUYA 1Q0PA 1F51E 1G2OA 2Y6UA 1XQ6A 3MPUA 4FE3A 4Y6SA 4A1OA 4A8TA 5CB4F 4YUWA 1XQVA 4CMEA 7REQB 2HO5A 2XNSA 3F3YA 5JAUA 4MARA 4U0JA 4US2R 3IB3A 1W94A 4OXIA 4FMDB 3T8YA 4DR7B 2FFQA 4Z86A 1E2DA 1C81A 3A2NA 4K26A 4NQRA 1EGVB 1U2DA 3L46A 3ZC3A 3P94A 4R8KA 5JI2E 4MYCA 1YS6A 3AV0B 5DI3A 1MNAA 5FFMA 2I67A 1H4QA 4JJ7A 1AXRA 3RSFA 5AM1A 3JWJA 2A84A 5EQDA 5H7XA 2B4KA 2YMQA 2YWFA 5HCUA 2ZWMA 2ZB7A 4FDMA 5FHRA 3L8MA 4D57A 3RBZA 4WIAA 3WLOA 2XEXA 1F4LA 1IATA 4OQ4A 2JEOA 3HFRA 4RK6A 3EBOA 2ALJA 4ZCSA 4KYVA 2WSYB 4UD2A 3TF5A 2FEKA 1BJRE 2OTCA 2QP9X 5AW5A 2ZT6A 2QVLA 1I51A 2HQBA 3DMTA 1CS4C 2FSHA 4DLNA 4EAQA 1RYBA 4AZSA 2V5VA 4UPVA 3IMEA 3B1JA 3IKTA 1ZGJA 1Z12A 3MK31 1VIDA 5E3JA 3QVTA 1CLEA 3GROA 2ZYHA 4I6GA 5L40A 1OH5A 2B1JA 3PB3A 2P9EA 5ICFA 1FW6A 3EHDA 4CG0A 4BQEA 4D0RA 1RHJA 3HB9A 3HXOA 2WA2A 4ZQHA 1PKXA 3SDZA 3HWSA 3TM5A 1NMXA 3V34A 4BVHA 1C2YA 1D1SA 3CO0S 3VOBA 2OVBA 1FDTA 3N75A 4G0MA 1TEVA 2WMDA 2LW7A 2X7HA 3GRKA 5FJJA 5J9FA 5I7UA 3T7IA 3BZWA 4DFDA 4J29A 2NQ8A 2RDMA 2YXBA 2QD3A 4EY4A 3EIFA 3OPYB 2PUGA 1HDYA 1TVCA 1O0BA 4JI2B 2I9PA 5IJ0B 1WCIA 4JI5B 4MYSA 3H9EO 1UPUA 4RU1A 1OT5A 2Y76A 5KQPA 1IN6A 2AOXA 3PWTA 4FYYA 3I6ZA 4IFBA 4MAMA 3SNKA 1AKYA 2H51A 4PHHA 1M1NB 4ZJZA 5IKEA 2G0TA 1L3IA 2Z5LA 2I76A 2IKQA 1ZH6A 5FNVA 3O5AA 4LF9B 1UBRS 3BFKA 4U7FA 2PL1A 1AXGA 2FWMX 4Q5IA 5ED0A 1IQPA 2JF0A 2ZJ7A 3VH4A 2WHRA 1F0YA 1GPUA 1VJ0A 3Q8WA 2EC5A 2VQSA 4CM6A 2NU6A 3KXKA 2XKKA 3P27A 2FGKA 1DEKA 1U0OC 1IK4A 1NYTA 3OTHA 4C88A 4AZTA 1J56A 2H48A 4GKJB 3NANA 1TMOA 2HJGA 3F1LA 4LNHA 2AJDA 1LDMA 4R9RA 3U1TA 3VSDA 4AMVA 5GIOE 2UYYA 4X41A 2R1TB 2I78A 2VUTA 4A36A 1WW3A 3D8NA 4AI6A 2ATVA 4QQKA 3ANMA 2XUJA 2QE7D 5KREA 1EHIA 4GLBA 1K6IA 5E4FA 4CMIA 1AF4A 1RI4A 3H84A 4KQJA 1ILEA 2JPDA 2VJOA 3V2HA 3Q4GA 4GZ6A 4XJVA 4F5DA 3DBLA 3PFCA 4F6RB 2O8FB 1N6OA 1U3CA 4DSAA 4RUKA 1TZBA 1L9KA 3U26A 1TCCA 1B15A 4IIJB 4S12A 1K92A 4X1IA 2WT8A 5EG5A 2EP5A 1I1QB 2OWDA 2R4UA 1SBQA 1JMVA 3MSXA 3VX3A 5KWEA 4G9GA 1H1TA 3HU1A 3LKDA 2K5UA 2IOQA 2OR3A 3PFBA 1T5OA 2H65A 3AF3A 4LGYA 3L1UA 4X95A 3FCSB 3F4LA 3IVGA 3M6MD 3JPWA 5BW8A 3ACBA 2BZ0A 5LQAA 2P6OA 3N6RA 1GAXA 1I6KA 2VHQA 4U6QA 1E94E 3GELA 1N5LA 3CPSA 1BMDA 1TYZA 2JI6A 3KQNA 1ESMA 3WHKA 3KQHA 4JH0A 3FOWA 5J4YA 4CEHB 4Q7QA 3DXXA 1Y6ZA 1RI3A 3WB2A 4OM8A 5D51S 2W8ZA 1DAKA 1G5RA 4QHSA 4EMBA 4MPDA 3K92A 1OE0A 3Q8MA 4N5DA 2IHJA 3TECE 1VTKA 5I4IA 3D2AA 5CVVA 3D2CA 1IONA 4K7JA 4KTTE 4S1OA 1BDHA 4ZQCB 1SB9A 4YQYA 1F2VA 4KNWA 3TMKA 5EKDA 4P5DA 4U2EA 1ZGGA 3BIWA 3JSXA 4O3MA 1JB1A 1UEIA 3I4FA 4O8ZA 3M49A 1M34B 3NAMA 2R96A 4ZHQF 3N1UA 3FTNA 2JZCA 4GX5A 1MXFA 3JARB 2XRFA 4LVCA 4H6XA 2JGNA 4MKHA 1NKTA 3SE7A 3SWWA 3TBFA 3BK7A 3JD0A 3NHLA 4QX6A 3OJOA 3WNCA 5IHPA 2COUA 1MKYA 1A9RA 2H7CA 2XUDA 2GNPA 4HQ6A 4MWZA 4S3MA 3RK0A 1OFUX 1JVBA 4N9QA 4LX0A 1EFVA 1YF3A 2O8CB 3KZCA 5JISA 1YR3A 4HTAA 3OQJA 2PWYA 3DMYA 3W7BA 1CTQA 5HGJA 4F60A 4ZO6A 2WU8A 4RVGA 3IMGA 1R0KA 4QXRA 3SS8A 4LCEA 1O58A 5AW9A 1I4WA 3K0SA 2ZQYA 2PZGA 4I9GA 5HFJA 3E7DA 2O23A 1GT6A 1P1HA 3S70A 3F74A 3R5JA 4UULA 3UK0A 5K01A 5AQ1A 2B92A 3JYPA 3X1ZA 4RANA 3RJMA 1ADGA 4OHWA 4ZYLA 4EITA 1DIRA 2FSIA 3H5IA 4BFLA 4JLSA 1DJOA 3PFNA 3MUFA 3I2GA 4AAYA 5AD1A 2Y99A 1ECJA 2HBQA 5ISMA 1WPXA 1SXPA 3IUBA 1O0CA 3EGXA 4LXHA 1WD5A 1R4NB 1H2XA 1MB0A 1GU0A 1OXTA 5CD9A 2RAUA 1DBIA 3AF5A 1G8MA 2GK6A 2R60A 2YUIA 1JAZA 2MHCA 3BJZA 3PVCA 4TN1A 2FWBA 3FGZA 4XB6B 2IYWA 3FI9A 3HQ4O 4COKA 1YVUA 1CR2A 1UKAA 2WPDA 3AOEA 3EG5A 1PWEA 3PD1A 3QW4B 3PR2B 1KJWA 1R12A 2RKOA 1UODA 2AR7A 5ER9A 1ZK0A 3NRCA 3ESBA 3M9LA 2LBPA 4M0FA 4BN5A 1C3EA 4LYAA 2EV9A 5EE5B 1J33A 5C1BA 3GF4A 4QJBA 1AO0A 4IR7A 4L8VA 3HKBB 1VMAA 5K8UA 1EFCA 2OHIA 1HTTA 5TS3A 4WLOA 3RVBA 1LPNA 4YQFA 4GBED 3S1AB 2PX3A 1IAVA 2P75A 3H99A 1A9OA 4GZMA 3DNPA 4YROA 3WQSB 2QX7A 3OIFA 1NKSA 1NUAA 3Q3HA 5EUQB 8MHTA 2DR0A 1Q2XA 4BBZA 1L4MA 3HYCA 3MJHA 3GQBB 3R7FA 4N5LA 5BWCA 1ZC3A 3KCNA 3KR9A 1U5BA 3GAFA 5JG7A 1ZHFA 3IMFA 5AQEA 1T0PA 1KJZA 4FVTA 4GBGA 4ROTA 3TTUA 4AU1A 4H0FA 1UP6A 3KB6A 2ZAYA 3HVJA 3U7RA 4NVRA 4D96A 3THWA 1FB5A 1QH8B 1JAYA 4LZOA 4QXOA 1ML4A 1T0JB 3A1WA 3JQDA 3K0AA 3GFBA 4AVYA 1OZGA 1JB9A 4EARA 3BMQA 4URFA 5IDXA 5JAPA 2P9YA 2OQRA 2V74B 2ZSFA 4PFKA 3IHTA 3FPGA 4XVCA 3A6JA 2BFFA 1ZDMA 4B4WA 4U2DA 4W6QA 1FQWA 4M0KA 1Q84A 1A04A 4FYMA 4Y9TA 3AI3A 3MILA 5CCEA 1G6HA 2CNLA 2D1FA 2HQSA 2ODTX 3M4XA 5D3ZA 4DSUA 4DWWA 3KWLA 1EE1A 4KVGA 1QIHA 1VA5A 1MJGA 3PUYA 4LVOA 4L6AA 4K2HA 2WDZA 1T6XA 3P32A 1P1KA 1SXHA 4H7FA 2PIDA 1VDZA 1EZ4A 1U0LA 1QPGA 4MQFB 5BT9A 3T1QA 2L69A 3VNQA 1C8BA 3BSSA 3N5KA 2O5EA 2OV3A 4I1RA 5ALWA 3SIRA 1EESA 4D6YA 4L6CA 4DCCA 3RIYA 2XTMA 1E2GA 3O83A 1ZD4A 5AK6A 3W1EA 3NV7A 3ZDQA 1JWLA 2C9CA 1UMBA 4J2HA 2XVYA 2Z2ZA 4QYIA 5C52B 3E3AA 4LAFA 3CTPA 4CKEA 3KKEA 3DLPX 1EAMA 3O8NA 5IP5A 2BN4A 1IHUA 2QVXX 5DRTA 1R4NA 4QOJA 1RQXA 2YWJA 1FPMA 4BQNA 3HSKA 2MSLA 1DQSA 3NHJA 4AQ7A 3UIEA 2IZOA 4YYZA 1MABB 2Q9CA 3LDFA 2Q4EA 4D81A 3EG9B 4DYVA 2TMKA 3RIHA 2HK6A 4YJ3A 5AJVB 4ZI7B 2JJMA 1CVIA 1KI1A 2OXRA 1ULBA 3BQMB 4DMUB 3TGPA 4NU0A 1L7AA 1YBVA 2O4UX 1YKGA 3GJYA 4HVTA 2X3YA 2V6JA 2IWRA 4OLFA 1FFXB 3CEJA 1FJHA 1FU8A 5KNLA 3NHMA 5HK9A 3Q3JB 1TA9A 2HAEA 1KI9A 3JVDA 2W8BA 4UAJA 4CCYA 3QUAA 1YFLA 2V7QA 3AGQA 5ALYA 3T3MB 1T4BA 1IB6A 1OKKA 1YC5A 5C8XA 1VJ1A 1U99A 1SQ6A 1TM5E 4F86A 1MORA 2JAWA 2WKQA 1OYVA 2J5KA 3JVUA 3VO8A 2FPOA 4PLYA 4OXNA 4W8GA 3TTSA 4ARSA 4UEWA 4J0GA 2QL9A 4UXIA 2VNJA 2JNWA 1SQFA 3BGOS 4D42A 2QVGA 3CRRA 3PEWA 2PS3A 3RODA 3R9XA 1T5IA 3IP9A 2OZKA 4U9UA 4KREA 4RPGA 4V0QA 3KHTA 1W8IA 3BQNB 4GBJA 5IK2A 2DLCX 2M1ZA 4YP6A 4QPCA 1T6ZA 1A4IA 1Q95A 4OY3A 3N28A 2PL5A 2AK3A 3ZY6A 4LXUA 5ULLA 3PIIA 4MV3A 2XXAB 4E32A 5AOCA 1WJGA 2ODAA 3WMEA 4UU8A 3OAAA 4JC8A 2ZWVA 2GXUA 3O3CA 3DEZA 4OCZA 4QXMA 2JFZA 1TX4B 5IJ9B 5J63A 4RZ3A 2G25A 3T7DA 1B8NA 3SF0A 2ETVA 4I1OA 1I13A 1ORRA 3DZBA 1L1QA 3Q40A 2O0HA 3EC2A 3WK8A 2ZCVA 3HJHA 1QC5B 1PX0A 3IBSA 4Q3DA 4D46A 4KR7A 1ZMBA 4HCJA 1R3UA 1R5JA 4GIBA 4I4NA 4QBIA 4PHGA 3RT1A 5H4GA 3ROQA 1QGYA 2E89A 4BUCA 4AJ4A 1KJ9A 1DQZA 5BNFA 1N6LA 4ZYZA 3CPEA 5JCPA 3I05A 3IPAA 5AR1A 2WTMA 4HDMA 4ENVA 5GJBA 1R88A 3PLNA 3SVTA 2PDAA 1OPRA 5IWAB 2NMVA 3ODPA 4B7ZA 1XZBA 5I4CA 2CY0A 2NZYA 1ABEA 3WMFA 1O95A 1FRQA 3ICPA 1R8JA 3D7NA 3B9PA 3UK6A 5AW7A 2ORIA 2D7JA 1VFNA 3WJ7A 2Z8XA 4NG5A 1U0FA 4G5GA 2OZVA 1F17A 3L8CA 4N1AA 3FDIA 4GWLA 4K9NA 2G1UA 3IT2A 4CTKA 3S8YA 2PLRA 1T2CA 1UBSB 4Z4GA 4HQNA 4PGFA 1BH6A 1KIAA 1TKAA 3U6KA 5LCXA 1H4TA 3NC0C 2AWOA 1AHIA 5L3SB 2WIAA 3ETHA 4L8YA 1OWPA 2ZP1A 4OHBA 3V80A 2GK4A 1HEYA 1AN0A 4OHXA 1X0XA 3KXDA 1CY0A 3K15A 1JHUA 2CHVA 1DFIA 1LPSA 2XUOA 1L0BA 4GS5A 4LDPA 2GJ4A 3JAWB 1SUFA 1HFKA 2B4RO 3FNHA 1KAOA 3VZRA 4ZDIA 3G0CA 3HA5A 3EZ7A 1SU7A 1WX1A 1UK9A 3LHFA 4IMJB 2WHXA 3R20A 1NATA 1V5WA 1VYHA 2GLUA 3P9KA 4KO4S 2B8WA 4CIYA 4ETIA 5JECA 5JFTA 2HF2A 3R0ZA 2TS1A 1E8NA 4KAAA 4QOFA 1ORDA 5HZMA 3TQFA 4JVLA 4MKFA 1JEAA 5EEGA 5KBYA 2I4IA 3CVWA 4B7XA 3Q8KA 4EL0A 3AUTA 2FK8A 1TEXA 3HEMA 3M34A 4TSRA 4YWHA 2OGZA 1USIA 4MGHA 1NPTO 4FUTA 4QYMA 5HP4A 3PQ8A 5AXAA 5JMTA 1YFZA 5IMSA 1YI0A 1DKUA 3COYA 4LY9A 3DWEX 4ZEVA 1XZMA 1PJCA 1KK2A 1E1QA 1Y6RA 3C3YA 3A9RA 1MV5A 2QG6A 3ETNA 4HWSA 2Q1SA 2WNHA 3RUFA 3TW0A 5EJ8A 5HWSA 1ZJ5A 1UOOA 2DPGA 4XWOA 2DXIA 5WRFA 2PH7A 5F3RA 3DYIA 3FYCA 2WKPA 1I5EA 1TYDE 1YB5A 3DLCA 1X87A 1DJPA 4G84A 2GYUA 1K6JA 2EZUA 3A1DA 2W2LA 4IPTA 4RGBA 5JBQA 1FFAA 3FUTA 4X1OA 2VJCA 3VC3A 4PZPA 3QI2A 2AQKA 5DBIA 3L1JA 1M7GA 3WADA 4HDRB 4CLHA 2VXYA 1P9RA 3DCJA 4HDNA 5CH8A 2DTDA 4KN8A 1JW9B 3CR3C 1EGQA 1JN0A 3AY0A 1NQAO 1YR7A 5JYBA 4XQ0A 3J7AC 3IIMA 3TAXA 2BGJA 4COOA 4D98A 3T7JA 4HPWA 3U3JA 1HORA 1P1RA 5A0FA 1MO2A 3VNAA 4BP3A 2DEUA 2BSAA 4A91A 3PRJA 1X1EA 2WUWE 3DT6A 4O2BF 2DP4E 1SC4A 4ZZ1A 3C7AA 2B36A 1G3MA 4PZ9A 4BEWA 3P2OA 3ZW8A 1A2QA 3IAS6 1QHEA 3BEDA 4D26A 4QDKA 1M54A 4JKIA 2FCAA 1EVQA 3ROKA 1N2BA 1Q0UA 1W4BA 4CF3A 2Q27A 3BD8A 5FWXA 1DRUA 4E12A 2CWDA 1GQQA 2QMYA 4YUYA 4M6WB 3PUZA 1ODLA 2GPTA 2QW8A 1EJ2A 2Y1LA 3EXG2 3SXUB 4DV0B 1V7ZA 2ORED 3E7XA 3KWFA 1K7EB 1BFUA 1C9DB 2ACVA 2HA2A 4EZEA 3OFND 3DZDA 1I32A 3QX3A 5TGTA 3OHSX 4TX1A 2G06A 1INLA 1P2SA 2KBFA 3FMGA 4HSEA 4KIWA 4A8JA 2PH1A 4DXDA 1P4RA 4JGBA 5D1HA 1PU2A 3UTCA 2E1RA 4F92B 3WC4A 4UNIA 1KERA 2NTEA 2IEIA 3M6IA 3BDIA 3HY4A 4ND5A 5DNVA 3IL2A 4GI7A 3ZY3A 1ZKMA 3ZLTA 3HXKA 5AW3A 1X3LA 1HKHA 1YRBA 3ISTA 1G38A 2ZAMA 3MLEA 4Z49A 2O9JA 3GLVA 3KSBC 2NQTA 3OZVA 2YIMA 1JIIA 2QRVA 3A3OA 3G82C 4FBMA 5CA0F 3JD2A 1P33A 3OU6A 4ITUA 5TARA 2BV3A 4PONA 1K6MA 5BUZA 4NF2A 1L7RA 2CVFA 3RTAA 1BE8A 1QJ4A 3ZHBA 1P1BA 1U2DC 1WMEA 4QTUB 3IQHX 1E1NA 1WMSA 4B5LA 2AQHA 1VP3A 3K30A 2WDPA 5FPQA 4NZMA 2AG8A 5HM6A 5B58T 3DB1A 4Y6RA 1VLJA 2I55A 4FDAA 3BMCB 2ZE6A 2OHVA 4FFBA 4LC0A 4YB8A 1JXQA 1T4CB 2LV8A 1ADYA 3A2MA 3AERB 3FRJA 4ADSG 1EIZA 3FCAA 4PG4A 1GM5A 2VYCA 4DLPA 2GKGA 1QZXA 3RUPA 1H93A 2ZVQX 3G9XA 1E4EA 1PR0A 4RM3A 4V0ME 4YREA 2H29A 3WJ2A 2I66A 2PO5A 5TQ0B 3WKAA 5M04A 2OYSA 3JWEA 1F5NA 3E9EA 2VZEA 4KBFA 3DOUA 2O2ZA 3TNFA 3ZZ1A 1YGPA 4OXXA 1R6TA 2XMSA 2I7VA 4WQMA 2HYIC 1G2IA 3DE5X 3OSUA 4LS3A 1EUCA 4YRBA 1WB9A 5DXAA 2O8VA 4DDUA 1CHDA 4LF6B 1EWVA 4JGIA 5B7PA 3ZH9B 4D5EA 1II8B 1MW8X 5JJLA 4M83A 1CD5A 1GUDA 2UYGA 1OAKA 3DFMA 1WZIA 3KXIA 1N57A 2ZB8A 4UM5A 1RTKA 2VJNA 2OK7A 2BM0A 3KSAC 3CONA 1NRWA 1Y0BA 3EXFB 3ECAA 4K1XA 4QUAA 4R4JA 4Q9KA 1QM5A 3ZY2A 5JYEA 3JVVA 2IXFA 1PQ4A 3AC0A 4OUKX 1PG0A 1BGXT 2DFLA 4OHZA 4QU9A 3A0RB 5CFRA 2FW0A 4ENQA 2CK3A 3NU1A 4RWZA 3ZHOA 4ND4A 2GM4A 3GFSA 1JXAA 3EIXA 2QBYB 1LZLA 4I5DA 2EFGA 2Q3DA 4MKIA 4XB2A 2FRDC 4ATNA 2E85A 2CZGA 1YE8A 3CCBA 2C9YA 4QYSA 4E5SA 3AG6A 3PDHA 4P4NA 2XNDD 4W8HA 1RFLA 4ZOLA 4LXXA 2PT9A 4PZAA 2FSPA 1E7WA 1W36C 3D6HA 3HDJA 1USVA 5BPHA 4URVR 2B61A 2NXCA 1C30A 1M2OB 1IPHA 4XDZA 1GZVA 4YCMA 1ZIYA 3KX2A 4WESB 1WULS 2P91A 1AUQA 4KU4A 1GL9B 3OPVA 4LRSB 3THXA 1EQ2A 4WRRA 4OLJA 3L0BA 5CT5A 3T7CA 3EVNA 1FRZA 4M9UA 3UMGA 2Y93A 2AKEA 2II6A 2YW9A 5DN6A 4K9OA 2GBPA 4TKMA 1K6EA 4MS4B 3UWMA 2WYVA 4A6DA 2WFLA 3CO5A 3TLYA 1ZXXA 2I3DA 4MQMA 2REBA 2R8OA 5GV8A 1VCHA 3ADOA 3K6RA 4CCAA 4A3SA 1RMQA 4F2PA 5J4KA 5FL3A 4EELA 5K03A 5ALEA 4IUCS 2VZ9A 2R47A 4URXR 3NDPA 1XE3A 2OXCA 4ZVKA 1S1CA 3ZWOA 3V7FA 1R4ZA 1V8BA 3L7DA 3O0DA 3WV4A 1OWLA 1MDFA 3QIVA 4Z4CA 5LWHA 3MGKA 2XNJA 2VPXA 3WLLA 2H00A 4AJ9A 2C78A 3HJNA 4PYJA 4Z53A 4H17A 4XPZA 4FB5A 3RGGA 1PJQA 3LC1O 5FOXA 3GFQA 1FXSA 4R1LA 1M83A 4WXEA 1ESCA 1C3LA 3DMHA 5H81A 1K0UA 3DW3X 1FUUA 1T3HA 1ZN7A 4MV9A 3EQ6A 3Q7EA 4YRTA 5GM1A 4LHZA 2IBTA 2F43B 1KKMA 1R8YA 3CB2A 1Z47A 2ILVA 1Q92A 1NVGA 2ON6A 3QJYA 4ZT5A 3W1WA 2FQYA 2I03A 2YOHA 7ABPA 1P5HA 2C57A 4QTYA 3W5CA 5HTOA 2BUAA 2C4VA 5FWYB 3NAZA 1K0FA 3H7IA 3ZS8A 1UBJS 5JD6A 1RYDA 3UWSA 2E49A 4MUJA 2VCYA 5JTTA 4EPVA 4Q47A 1X14A 4YO8A 3AIIA 1YJ5A 2UUOA 4BP8A 3JQ6A 5DTJA 1REQA 3EZGA 3BJMA 4FLFA 1W4LA 1DZIA 1WDKA 4HNVA 2L0XA 1L4LA 1BX1A 2JGDB 3GGDA 4BO8A 4EUSA 4Q24A 4B3FX 4L74A 4XYGA 2GAFA 1NI5A 1RHQA 5PNTA 3HGMA 3WOHA 1P1CA 5EZ6B 3BH6A 3ZE8A 5L7TA 1QONA 4X65B 1LWOA 3WB0A 5CVJA 1FXUA 1O2DA 2EJTA 3HA2A 3ZBQA 4BVBA 3V7UA 4ZXPA 4WH0A 3DV0B 1O0SA 3L5KA 3OCYA 1TXGA 3GNQA 2UUPA 5K8JB 3NM5A 3DQPA 1OXKB 1DBPA 3GRAA 1E7SA 2A92A 3LGSA 1IHPA 3QKUA 4C0LA 2UDPA 1JQEA 4KMRA 2AJBA 3A2LA 1JJFA 2QUKA 3OPYI 1H05A 1P62B 4CFYA 1K8RA 2ASEA 3F6PA 5CLFA 5JZOA 3R5FA 4U2BA 3P96A 1Y4AE 2BFBB 4WT7A 1EPUA 3U62A 4P3YA 5K0BA 1H2ZA 1BRMA 3G17A 3P0FA 5DTRA 4BC1A 1K88A 4ZAFA 4YAKA 2BEUB 2GJSA 3VNVA 4QUDA 2VCHA 3IQIX 1E5VA 2QI9F 1ESEA 3L40A 3GG9A 3OESA 2QUIA 4G5FA 1ETHA 3VSBA 1G8HA 3RW9A 3UCEA 4D8YA 4DGQA 4ZI7F 5AW4A 1XJCA 5JR3A 2ZBPA 3P2MA 4U3JA 3X1MA 4YGXB 3JWHA 2NSJA 1BYUA 3OQHA 4LOAA 2OCIA 5EZYF 4Q93A 2OZLA 5AJWA 1FZQA 1GWNA 3O9MA 5JXJA 3W5BA 2UYOA 3QG1A 1JBQA 8AT1A 2XHZA 2P4QA 1XMSA 3BFVA 2FRVA 1N5KA 1QFYA 3CB4A 2HT6A 4MGIR 4RKFA 4V3BA 3V8VA 3HCBA 2YWHA 3E9CA 1L5VA 1XDDA 2VDLB 3HWX1 5BQ5A 2A4MA 4UBLA 5IYZF 1WM1A 4YJ3B 4UUNA 4ZI7A 2C1ZA 2PZKA 3G85A 2WP8J 4XX1A 5FTKA 4NU5A 4BNIA 1NJ6A 4GP7A 3TFOA 1SHTX 2AMFA 3MAJA 1XKQA 1FVHA 4JL5A 4QXQA 3U9SA 4RD1A 4BRSA 2Q07A 1II9A 3QOWA 1PIWA 5AJHA 4RULA 4Y2HA 3JQRA 4B87A 5CT8A 5IX8A 2A5FA 3FPSA 1ZSNA 2HH9A 2I3AA 3G2NA 5HQJA 4CIXA 4G8BA 3MFYA 2DSTA 3ELWA 3DUFA 3EOZA 1X1RA 4WZBB 2GNOA 2ZJYA 2JHAA 3IPXA 3L7LA 3BMNB 1KOFA 1O1YA 4GGOA 4GT1A 5ALXA 3UGKA 1Y6FA 1TKRA 4AS1A 1ZVVA 4LJ4A 4NARA 2P68A 1P2BA 4IVPA 4J0QA 1E9EA 4I55A 1II0A 3N0XA 4LZLA 2Q62A 5KTTA 5L8VA 3BGVA 3ESRA 2VRBA 3V4RA 4EFDA 3PDIB 2OENG 2HF9A 1WUIS 2PT5A 2ZTUA 4CM4A 1T1EA 2WB4A 2RBEA 1MT3A 1MA3A 2QE7A 3RAJA 4V02A 4N5NA 1DC7A 3EH1A 2Z30A 3D9QX 3R75A 1T2DA 1WF3A 5ITZA 1DIGA 1GZ4A 2WC1A 3ROMA 5BURA 4YI3A 3CMCO 5BN3B 1U9IA 2VDKB 4FQ5A 1KSFX 1NP7A 1PNQA 2WJ6A 2SKDA 3IJEB 1CFJA 5ERGB 1X1SA 1BOFA 3KOOA 3HMKA 1QHIA 4BKOA 1NVBA 1JHRA 1G6OA 1XROA 1XRNA 2ZJ2A 3LOQA 3OKPA 3R5SA 4HFRA 1RS0A 4Z1MA 2W5UA 2J7PA 4ZDKA 1OJLA 2MSEB 2AOTA 3LCUA 4E08A 4E2WA 1MEOA 4PZDA 3C1TA 1PGQA 2D00A 4LZJA 4YONB 4ZKEA 2HSEA 4MUIA 2Z9CA 1NXXA 4RF2A 5FI0B 2IGTA 4BZZA 1RXYA 1R8XA 1HDZA 1TCUA 4KDCA 1KETA 1GCAA 2O2EA 3K9HA 2O1SA 4MINA 3FFAA 4ONEA 1DOZA 2Y77A 3PWKA 4L9SA 4BO2A 5JZMA 3K6SA 3R8FA 1NU6A 2LXNA 1KZ9A 2NO6A 3AJAA 3ORHA 4HXGA 3DV9A 1W75A 3I73A 5DCLA 4EMSA 3RPEA 3R7WB 4MW1A 2IH4A 1UXGA 1FFDA 3BFPA 4LJAA 1DC4A 1JWBB 1QOPB 5IAOA 2QTHA 1M7BA 2X6TA 4OFZA 3LY5A 4Y1RB 3IVRA 3W2FA 3OT1B 1TF7A 4HXFB 2JAQA 3MMPA 3PFKA 3WYNA 4DXAA 1XMVA 2GUGA 3KPVA 4NCKA 1EXMA 2QRZA 3UHPA 1KPIA 1N0UA 2DMRA 2BOVA 1G9SA 5EKTA 4A0HA 4MDEA 1VKNA 2YC4C 1QIDA 3QLEA 3EUFA 4OPMA 3NV9A 2BZGA 4TV9B 4EKNB 1WETA 1FLDA 2EAUA 3FWHA 5K6TA 2ZRNA 2HSGA 5BN5B 4ZO7A 3NWPA 3O82A 3OCWA 2KB0A 2DG2A 2GEUA 3VR2D 5EQJB 3GVIA 3NALA 4YIHA 5J2TA 1FQKA 1H8ED 1T9HA 2VN8A 1JHYA 2QW0X 6NULA 1HL3A 1LLCA 2RHCA 3U13A 3BOSA 3WB1A 2BH9A 2HTEA 9LDBA 5MN5A 2BEVA 4MOWA 4IDFA 4M1OA 1E7QA 3I9NA 1U7UA 1E18A 4YRIA 1ZM3A 3I42A 3OH8A 4BS9A 5ADUS 2L2QA 5F73A 3WGVA 1DKNA 1FDRA 2AJ8A 2R9VA 3UT5B 3DDUA 1BS9A 3PNLA 1GA4A 5ALMA 4HMOA 4NONA 3PC4A 2ZAIA 4P31A 4RA9A 3RIMA 5F52A 4CQMB 2O5VA 3CX4A 2RHHA 4JKYA 3D31A 4LWOA 4UCFA 3FNFA 4RPCA 5KDLA 4CLRA 3F2IA 4PQGA 4J1QA 1OCEA 5T4BA 1FFSA 4BTEA 7ADHA 2GBCA 5JYCA 4DIMA 4P2BA 3VQTA 1PFUA 2VDUE 1ENPA 4PZEA 4RGQA 2BGLA 5EZSA 1UKEA 5IBPA 5TQ2A 4MJ7A 2TSYB 1BJKA 2HTFA 2OV2A 3OIYA 1S9HA 2BGRA 3PEYA 2AMYA 4C43A 1NUTA 2BM8A 1IOZA 3NH9A 5DF1A 2HA4A 5IVKA 3ZV3A 2GHIA 1AK1A 5CEEA 3C6ZA 2FDCA 3QXXA 1TIBA 2VXBA 1M2FA 5LC1A 4U9HS 4TTSA 2A9JA 4V0RA 3IVCA 1JECA 2QD4A 3K0FA 3LRPA 3BIJA 4FYPA 4J0JA 1VHLA 3M1LA 1UKBA 3ZWYA 3QOFA 1QGDA 2IT1A 1L7PA 3IVMA 2OOSA 5A06A 3KVYA 2VAWA 1DBWA 2QENA 4WK0B 1ORWA 3GH1A 4IAOA 3AR4A 4JQYA 4AZ0A 4TRRA 2XDQA 2C54A 4YRFA 2I6SA 3JS5A 1R0SA 2ZJ3A 3QKRA 1GN9A 3STTA 4UM9B 4TM8A 1KR5A 2VDVE 1YZ3A 3DLIA 4J2OA 2QMHA 5CHYA 1ODSA 2PBFA 1BHJA 2WV9A 2E1PA 3FFXA 3HDHA 2J6CA 2XBLA 4RJIA 4HP8A 2AJCA 2CBGA 2ZB2A 2FPUA 3GCWA 3ACDA 3ORQA 3W2IA 1PV2A 2UVQA 1HYQA 3WFIA 5DV9A 3OQVA 1WZNA 3ZTTA 3CF4A 3O3OB 4YLGA 4O08A 2UZ0A 1QFMA 2ZIAA 4LECA 5A5GA 5LQCA 1AUOA 5CPBA 3SKXA 4NMWA 2WFZA 2J9XB 3HN7A 5K99A 3WKDA 2XZLA 1POWA 4OI4A 5JZ9A 1A27A 4E7PA 4XVQA 5HMLA 3HLKA 2XBMA 3V3TA 5JMOA 3UYLA 4K9PA 3O8QB 3CW8X 4WSOA 5FUVA 2B6HA 3IXLA 2DTEA 1FYVA 4ZI3A 1IBRA 1COWA 1KC1A 1PEDA 3CM0A 4IFTA 2BFPA 2B8TA 1Q2UA 3BSFA 3L1VA 3AQIA 4HS9A 4QPNA 1NN1A 1N2JA 1UC9A 3AJ8A 3ES9A 3KHKA 3MTGA 1FX0A 5F12A 4Z4IA 3GEDA 4DUGA 4OLHA 5BY2A 1TK9A 1Z5VA 3SYNA 1SQ5A 4F3KA 1Y37A 4YJ2A 4IHKA 5CH3A 3L7OA 1X0VA 2AK2A 2JFNA 4PFQA 3GJ7A 2CLHB 4PS0A 4BNGA 1C9KA 3IQXA 4RA9B 3JQAA 3G8DA 2H16A 3OCXA 3I1IA 2ZI7A 4MJ3A 3TSOA 1QIGA 3DNMA 4F71A 4TL8A 3MJDA 1JDSA 2DOKA 4ZKDA 3ZQKA 2E6UX 1A5BB 3L6RA 4J07A 4B9AA 1NF9A 4RZIA 3LWNA 4D3FA 2JIZD 1Z13A 3SXPA 4E88A 2KBEA 1KK3A 1RBYA 3PDWA 4YFVA 1AK9A 3JQBA 1VB5A 1QZUA 4OEHA 3GD7A 4PG8A 2KHZA 5HKOA 2YQZA 2AG5A 3FM9A 3PG5A 3QE2A 4WKNA 2OHFA 1X7XA 2R6JA 3UPTA 3OEED 1XI2A 2OHHA 4D3SA 1BS2A 1KIFA 3UFBA 2W42A 4MDYA 2QN7A 1OY1A 2NYRA 4RCZA 5FF9A 5LQSA 3DCNA 1HFEL 1XN4A 3AUYA 5DGXA 3HDGA 2OXTA 2OPHA 4B35A 1JT2A 3LX8A 5KVQA 3SG0A 3FTCA 1PKEA 4UBOA 4OSOA 3LLUA 5CH5A 3SKYA 3Q72A 1GPLA 2C3OA 3SYTA 1XFDA 4IL5A 2GFIA 2X9VA 3C3WA 1DX9A 2PUDA 3C4JA 2WQ7A 2DQSA 1WDTA 1HEIA 4G1CA 3TRIA 4I1YA 4C0WA 1XD8A 1YONA 3PENA 1V8ZA 2Q3JA 1A7KA 3FCCA 1PFQA 4W7HA 5AVUA 5JDIA 4RTOA 4MS3A 1K8QA 2A9KA 2BHSA 2WJGA 3G2JA 4QATA 3FTFA 3CX3A 1YC2A 1SWVA 1Q0SA 4LC1A 3OEYA 3AW9A 1R0RE 4PSVA 6Q21A 1KH3A 4PQEA 4ABYA 1N78A 1XOIA 2OK8A 4LBZA 4TWAA 4KTVE 3UWKA 4D1YA 3EZNA 3P0IA 2C3YA 5BMVF 4CQNA 4HDOB 2JZNA 4CM8A 3NBAA 3IRVA 4RF3A 4RXUA 4BWGA 5JHGB 4OO3A 3K4QA 5E6UA 1A4UA 4DF3A 3T5BA 2BC9A 2A57A 2PBLA 2CDAA 1P0CA 2PAAA 4BC0A 2UZ1A 2EFHB 3K71B 5IRCD 4GR9A 5IJ0A 1ZMXA 3GL9A 2VHTA 1HTBA 1JLMA 2X42A 2O3TA 4K9RA 1M1YE 4CKYA 1M2JA 4M60A 2PKQO 4FLMA 3LS2A 4B79A 2VK1A 1F60A 4FZVA 1JLRA 2QQ0A 1X2EA 2F1KA 3UWDA 5JSZA 2Q3BA 2GHRA 5CVDA 4L75A 1X7ZA 1Y1QA 2Q46A 4PIPA 1HT0A 1OLSA 4JN6B 4TXHA 3ZUPA 4NIMA 2XGJA 1IQRA 2XI4A 1T0BA 4TT3A 3IE1A 3MD9A 4IV8A 1UC4B 2NU6B 2C4UA 2QRUA 3V8BA 1THGA 1XD9A 1TQ6A 1UOEA 2ZFUA 4QBTA 3ZWNA 4HDRA 5EMJA 2ACKA 2B1QA 2CL0X 2OZEA 3QHQA 4JAVC 3SICE 2ZU0C 2VJMA 4JFAA 1B6GA 5CFLA 2X0KA 5JNLA 3DOEA 4QLOA 3TZHA 3ZGNA 5EA2A 5EKUA 1AKUA 1JZTA 1R5NA 1NONA 4GE3A 4HN9A 3SVZA 1NV9A 2WMNB 1PBNA 1I01A 1WBJB 4ZOBA 5K45A 5EJAA 3IOMA 3UMYA 4ILKA 2QY6A 1N2HA 3CJQA 2FUCA 1PEYA 3IDSA 4R9UC 2IYZA 2V7QD 3X1WA 4EF4A 4W5WA 3R6GA 4B83A 1ULAA 4KW7A 1C9MA 4M99A 1I8TA 3W04A 3QEBZ 3IJPA 3ZIAD 1XD2A 3GMDA 1HR0B 1NF2A 5B5SA 3II6X 1HG1A 2J0EA 4P83A 1QMGA 3A1TA 3C6MA 4NBNA 3EC1A 2GBGA 2XOKA 2WJJA 4IWYA 3FWYA 1YRLA 5EWJA 4BAUA 1FS6A 5F35A 1OBFO 1ZNQO 1MNQA 3GLKA 1I6MA 1ZXBA 1JFLA 4IQGA 3HADA 1P3DA 2WVHA 4FOOA 3L49A 1EEXB 1SQGA 4F9EA 5AIBA 3GN2A 2HPAA 4M0PA 3I6MA 3KQMA 4G5YA 3G9TA 2Z83A 3A7DA 3E3OA