3N2IA

2.25 angstrom resolution crystal structure of a thymidylate kinase (tmk) from vibrio cholerae o1 biovar eltor str. n16961 in complex with thymidine
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
208
structure length
206
Chain Sequence
MNAKFIVIEGLEGAGKSTAIQVVVETLQQNGIDHITRTREPGGTLLAEKLRALVKEEHPGEELQDITELLLVYAARVQLVENVIKPALARGEWVVGDRHDMSSQAYQGGGRQIAPSTMQSLKQTALGDFKPDLTLYLDIDPKLGLERARGELDRIEKMDISFFERARERYLELANSDDSVVMIDAAQSIEQVTADIRRALQDWLSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 2.25 Angstrom resolution crystal structure of a thymidylate kinase (tmk) from Vibrio cholerae O1 biovar eltor str. N16961 in complex with thymidine
rcsb
source organism Vibrio cholerae o1 biovar eltor
molecule tags Transferase
molecule keywords Thymidylate kinase
total genus 83
structure length 206
sequence length 208
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2010-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3n2iA00
1X6VA 2KI5A 1E9RA 1NSTA 1CLUA 1ZIOA 1KDRA 2XITA 3KXKA 1IY0A 1RYHA 1ZNZA 3QBVA 1SXJA 2OFOA 3SI7A 1YR6A 1KI8A 5FOVA 1CS4C 2HXSA 2WSMA 2IS6A 2BKEA 3U60B 1XFAA 2SHKA 3NH9A 4EJSB 5HZHA 2REOA 4TYQA 2J41A 4PSKA 1SVWA 3BE4A 3W6PA 4A82A 4MGZR 4Q1AA 1K8RA 1QHHA 1MO6A 4NONA 1XEXB 3LDAA 2XTNA 4LV8B 4BRWA 2WIAA 4Q9JA 4F4CA 3KUDA 1MT0A 4RD3A 1OXVA 5AJWA 3ADKA 3QKUA 3R20A 1VHTA 1N5LA 1TUEA 1E98A 4N3NA 1XPOA 1E6CA 2ZS9A 2J45A 5AWFC 3AF2A 2QG6A 4C9BA 3AB3A 5CIWA 1G5RA 1OH6A 1KO5A 4DLRA 3ZIAA 3NHBA 3QEJA 4V0ME 4Q03A 3WHKA 2ZE7A 1E9CA 1EXMA 3MCAA 2OV2A 3DOFA 2F55A 2BV3A 3QKSB 1J8MF 3THYB 5F3WB 1LS6A 1LY1A 5JI2E 2NG1A 4BFTA 1VYUA 4MGIR 4JZKA 4YDSA 2F9LA 5CITA 5GADl 4EFLA 2IXGA 4GP7A 3AGPA 1Q20A 1MR3F 3SE0A 4EPRA 4LYAA 2FEOA 5EE3A 3OF5A 3RABA 3K70D 2HJGA 2JIZA 4M1TA 3VKWA 5FUXA 1G19A 3A4MA 1W0KD 1ZW6A 4IW3B 2HF9A 4QGHA 1SKYB 1ZCBA 3KFVA 4O25A 3RC3A 3TSWA 3VNVA 2QGZA 1ZIPA 4M8NE 1E4YA 2GF9A 3RHFA 3W8NA 3DMNA 4DLWA 4DZZA 1N5JA 1CIPA 1O87A 4GP6A 1IY1A 4TLAA 4NH0A 4US1R 3BXZA 1UAAA 4Q19A 2GXSA 3VNUA 221PA 4TT3D 2JLXA 3IBGA 1S3SA 1F5NA 4BPBA 4BGDA 3RSOA 2IF0A 3NEJA 1GL6A 1KI6A 1U0HC 1XTIA 1JPNA 2CJWB 4JVSB 1HT2E 1NBME 3DMDA 5L3SB 3L8ZA 4HDOB 3O8BA 1I2MA 1PLKA 1UKEA 1IOZA 1OH5A 1XJCA 2MSDB 2B7BA 3CNLA 4JBWA 4Q7KA 2YKGA 2Q3HA 1Z29A 4BQSA 3CWZA 5GVRA 2VH5R 4PSVA 4PXAA 4TZ6A 1HE8B 3UWOA 2RHDA 1FX0A 1KK3A 3CX7A 4A0RA 1CU1A 4M1MA 4DJTA 3GLIA 2D7CA 1TUIA 3DL0A 4URZR 1PZNA 3LXRA 5KYKA 4CT5A 2G83A 1BH2A 3TUJC 2JDID 4M9XA 2ZYWX 1GKYA 1CP2A 1G18A 3HYRA 5KDLA 1G3UA 3KQUA 3RS2A 2FDCA 2F9MA 5AK0A 4LYJA 1T5IA 4BLRA 2YINC 5M04A 3PEYA 3O47A 4HUQA 3BIFA 1E9EA 4R7ZA 2WSSD 2CXXA 2OCYC 2ZROA 1F3OA 1Q57A 3A37A 1S0UA 4B47A 2CE7A 2VO1A 3A1WA 3QE0A 1TMKA 3AVQA 3L82B 3U4QA 3KJGA 1P2UA 3FKQA 2FE4A 3CZPA 4B3GA 4KFSA 2JLSA 2DCUA 4LJ9A 3NWJA 3LVQE 1W36B 4ZO4A 1R8QA 4QRHA 2B8WA 1GSIA 2G0TA 4X8OA 3FFAA 4LPSA 1HE1C 4JLOA 4XJXA 3RDPA 2FZ4A 4QHTA 2V6JA 1N6RA 3GJ8A 1GUAA 3ONWA 1N5KA 3FGNA 2ODWA 2JAQA 1G41A 3LXXA 1ZM2A 4ZCIA 1YR9A 1DAIA 1I4LD 1X8JA 1W5SA 1GIAA 2GBLA 2MSCB 5UKDA 2PX0A 1ZUIA 2JEOA 1XCMA 4LV5B 1QG2A 5P21A 1Q12A 3V9PA 2ZSAA 1NNEA 2AK3A 2ORWA 3SJAA 4PC2A 4QNMA 3IQWA 3LBNA 3QPVA 3I92A 3CPEA 4KYUA 2WBLC 4NTZA 4URXR 2IS2A 1Z06A 4B35A 3TR0A 4B75A 3MG9A 3X1DA 3R9WA 2O5VA 2OBMA 2ZU0C 2C04A 3CF6R 2VA8A 1WF3A 4RD6A 2BMDA 4MKGA 3AF3A 2W00A 4EQ6A 2R62A 4PO9A 2CL6X 4PPGA 1AM4D 3TKLA 3FHTA 2QM8A 2ZRJA 2QGNA 4R71A 2ONJA 3SJBA 4LGMA 2YWFA 5K8LA 3EC1A 2A5JA 8OHMA 1KO4A 3CF0A 2VBCA 2ZUDA 4D81A 5CYPA 3RLFA 4OQFA 4YLGA 2XGJA 1KZ7B 1CJKC 2BMJA 4PC6A 1KY3A 1IQPA 4M1SA 3P32A 2F7SA 1GDDA 1GL9B 3LO5A 4C0KA 4A92A 3C7KA 2FSIA 2YOGA 1Z0DA 1PLJA 5EZ6B 3ZS9A 4NBSA 3RNLA 4Q18A 1R5NA 1YVDA 3KL4A 1G6OA 3D6TB 5HTKA 3IHLA 4JLPA 1RYFA 3A36A 2AL7A 4LY6A 3TE6A 1AGPA 4EJSC 3VR6A 3BH7A 5J40A 3AVYA 4OHVA 3RWOA 2ZVQX 2GCOB 4X8HA 4DB2A 3GLFE 4ILEA 5FBLB 1IY2A 1W44A 2PZFA 2WOJA 3K70B 1GRNA 4QHYA 2XZOA 1NMYA 1T0JB 3K1JA 2YNMA 4BE7B 5CB6A 1LS1A 5IF9A 3K0AA 4V0NA 3GLFA 3UWKA 1XCPA 3BB3A 4O2LA 4DT1A 3LBHA 4JVLA 3LA6A 3ZVRA 1U0LA 2KBEA 4S35A 1QDEA 3GEIA 2AFIE 1A2BA 1C9KA 3BS4A 3NBFA 2XB4A 1GNPA 3K0CC 4LI0A 3UG7A 5BN4A 4II7A 1G21E 4A1FA 4B74A 1OLOA 1A4RA 3VU9B 5GJBA 3GEEA 4TSFD 4N0EA 1LNZA 2XXAB 1N0UA 4FCVA 4Y0VA 1RPZA 4C0BA 4UXIA 1P4SA 4TTPA 4IRUB 2JJ8A 1Z8FA 2C8VA 4E22A 3OESA 4MRRA 4GDFA 3K0CA 5L3QB 2ORIA 2XEXA 3QQ5A 3KUCA 3A1SA 3AP2A 2ONKA 1YZTA 3T15A 3BORA 1TU4A 1IJFA 2OLJA 4DIDA 2ZS8A 2H16A 2V1UA 4FCTA 3ADCA 4LBZA 1FNNA 1KIMA 5KSPA 1S2MA 4PZLA 1ESMA 4GSYA 4W9MC 1E1RD 1RW4A 2J7KA 2WAYA 4HDQB 1N6KA 1RJ9A 5TV2A 3QKSA 4U5XA 2CHQA 1BMFA 5CJ2A 2VL7A 2OCPA 4A0FA 4Q00A 4R2HA 1E2QA 2FJUA 3K0EA 5EUQB 4E03A 5E4FA 1CEEA 2ZYUX 2AKYA 1VYTA 1KK2A 1D9ZA 3HR7A 4F4IA 2J7PA 3WXMA 3U3KA 2FGJA 3N2EA 1NI3A 5DH9A 3MJHA 1XMIA 3SYNA 1XD2A 3CNOA 4EUNA 4JLBA 4QC2A 1XTJA 3K09A 3CUEF 3Q9LA 4M9ZA 5HKKA 1KNQA 1EWQA 1G17A 2CHGA 1JR3A 2ANBA 1E79D 2G0NA 2QP3A 1FUKA 4C2TA 1RC8A 2X2EA 2E9SA 1US8B 1XEXA 3CX8A 4PQRA 5SZKB 3IUYA 3UMFA 2DWPA 2WAXA 1Q3TA 4Q4HB 3G5UA 3EC2A 4LX0A 2FEMA 1KSHA 2QSYA 1Z08A 4KLNA 4DBLC 4HZIA 3AF1A 4JT2A 2ZAMA 3A58B 3THXB 4DRZA 4CEHA 1T8UA 3AVPA 2QPOA 3GLIB 3GLFB 1DAHA 2ZJZA 3WBJA 3B1VA 1Z63A 4PO1A 3KQHA 1Z6YA 4BASA 3WRYC 4BEBA 1D2NA 5AUOB 1O3YA 1T0HB 3MD0A 5BYKA 4OK5A 2C5LA 1NN0A 2PJZA 3Q72A 4B48A 2QP4A 3GFTA 3RS7A 2OXCA 5GVSA 4PAOA 1KMHA 2CNWA 4DLUA 1GKIA 4JVNA 4JBYA 1K6MA 1CJTC 4GPTA 4GRAA 5BQ5A 1DAKA 3SBEA 2FNAA 3T06B 3SQXA 1ZP6A 4OHWA 5FR2A 1KMQA 2O8CB 3TH5A 4HATA 2ANCA 3VAAA 4QJ4A 3OEHA 3WBKA 1W48A 3LLMA 2I4IA 4JT4A 2G3YA 1GP2A 1HQYE 2N1BA 3FYHA 1YR8A 4JSTA 4KAXA 4UNNA 5JWOA 3KQNA 1LW7A 2RGBA 4RSGA 4M53A 3FTQA 2CCKA 3NVAA 2AR7A 4KO8A 1Z3IX 3SJZA 5JFGA 1GL7A 1R5BA 1QF9A 3F5FA 3NDPA 4AKIA 2ZETA 1W4BA 3BGWA 1ZU4A 4Q7MB 2OO7A 5C46F 2C77A 4HLDA 1XPRA 4HAYA 4XVRA 4EPTA 2G1KA 4D0GA 1XXHA 1EGAA 4HUTA 3GD7A 3J81k 4IDNA 2FU5C 1HYQA 3RSLA 3OE7D 1TQ2A 2B7CA 3JZAA 1E9BA 2O8BB 4B3DA 2VHQA 1XNJA 5TB5A 4ARZA 1T9HA 2XTZA 5IK2D 1F2TA 1HEIA 2O8DB 2WMNB 4DDVA 2ZE8A 1WA5A 4FXPA 1VCIA 2R44A 4YMTA 2HLDA 5JBQA 5HR5A 4TT3A 3GEHA 2GEVA 2P67A 4GOXA 4IDQA 4A0GA 4XOIA 4RCYA 2PCLA 3OEEA 1U98A 3A4LA 2P6UA 3FKSA 4DLSA 1E9FA 1NBMA 4FMCF 4PHHA 3T12A 1EK0A 2PT7A 1U8ZA 2L0XA 4YQFA 2MSEB 2QMOA 1T91A 2GJ9A 5D3QA 1N0WA 1R10A 2PCJA 4EPXA 4Z8YA 5FUWA 4I1SA 2ZJYA 3WNCA 1G9XA 2ZPTX 1OH7A 3AVTA 5DHAA 3UANA 4AG6A 1B23P 1Q3HA 1XU4A 3W34A 4XWAA 3VR2A 1XZPA 1EFRD 3MWKA 4RD4A 2P5SA 1HUQA 4TLDA 1RJ9B 1KDPA 3FMPB 4D4MA 2QRZA 4FINA 1R4AA 3D8BA 1LF0A 2YV5A 4CEIA 1MRSA 2Q21A 1AIPA 2P3SA 4L9WA 2ZI6A 4QGGA 3AVUA 2UZIR 1N2CE 1TU3A 2J7PD 2QENA 5E7JA 4LYFA 2VP6A 2WOOA 2IYTA 2WKRA 5HPYB 5FL7D 3RS4A 1E2KA 4N0DA 4HB0A 4ZDJA 2NGRA 5B57C 3TRFA 4PZYA 1II8B 1Z5ZA 2E1RA 3AEZA 1IHUA 1XEFA 3GLHA 3T5GA 3SU8A 4P4UA 5CDFE 3I62A 5BW8A 3PUZA 3WYGA 5JCZA 4UNQA 5GJWC 4DIEA 2JLQA 4G5RA 1XTQA 2QAJA 3BWDD 4FN5A 4RCZA 1TTTA 2V3CC 4PPNA 3HYTA 1QG4A 3B1XA 3BFVA 3TQFA 2WJGA 4WXPA 3BERA 3SR0A 3LQRA 4F91B 2DB3A 4HAVA 1U8YA 4URVR 2V7QD 3PG5A 4C0SA 2ZRCA 4B44A 1QHNA 4GFDA 3TVTA 3X2SA 4DCVA 2IUSA 5C1BA 4OJKA 4B3BA 1KI3A 2QUZA 4A2PA 1NLYA 1XEWY 2YOFA 3QVVA 2UVQA 3QSYA 4KFUA 1DARA 2IYQA 4PANA 5DN6A 1FMJA 4LSGA 3I61A 2AHOA 3QG1A 4QFMA 5FI1B 1Z0AA 1P9RA 2IXEA 3QF4B 3AP3A 2HUPA 1T4GA 3TVDA 4ABYA 1S4QA 4M1OA 3X1YA 3QPUA 4FCWA 1XEWX 5C2JB 4AURA 3PEVA 3T34A 1WCV1 3IIJA 4MGKR 2VHUA 2OXRA 4OI2A 3NBYC 3IEVA 2F3TA 3MWLA 3ZD7A 3PR1A 4A8JA 4LYHA 5E3HA 2OEPA 1VIYA 2DY1A 1SKYE 5FPKA 4ZV4A 1G4AE 1RIFA 2YC2C 2GEDA 3KKMA 1VTKA 3ZDQA 4TYPA 3EZ7A 4OL0A 2ZITA 1JXOA 2ZI5A 4A2WA 3EWAA 1MKYA 2YYZA 1E3MA 1YHNA 4MRNA 2PMKA 4OI1A 4AKGA 2AWNA 3LFUA 3Q85A 2Z4RA 1E2PA 121PA 1KGDA 2BBSA 3THWA 4FIDA 2IYXA 5G53C 2KSQA 1Q22A 4LUCA 2ZRMA 3VR5A 5DI3B 3U5ZB 2OHFA 2GZAA 4Q47A 4M1KA 2VRWA 3W90A 2J3EA 2FFBA 1OB2A 1Z2CA 1L4YA 2GJKA 4TMZA 1F6BA 4MYHA 3E5HA 3BB4A 1UKYA 4GBMA 3B13B 5B58C 1W4AA 1MOZA 1NG9A 4D4KA 1G16A 1BOFA 4IXNA 4DCSA 4ZCMA 4R9UC 3U7GA 2BEJA 2PBRA 2QMUA 3EIHA 5H70A 2QY9A 1MABB 1F2TB 4NYIQ 4KSBA 3PUVA 3I3SR 3LV8A 4QL3A 1NL3A 2W58A 4DSNA 3F3YA 5LB2A 4B73A 3GLIE 2BM0A 1XXHB 1NVVR 5BN5A 1HQCA 4QBIA 4TN1A 2J87A 621PA 3U44A 3EARA 4RKEA 2RB4A 4C0JA 3C15C 2AK2A 4FMDB 4DLVA 4AY2A 4TTQA 2PZGA 3C14C 2OZEA 4QM7A 2ZJAA 1PUJA 3DOEA 1E0SA 4RFVA 2IHBA 3PV0A 3SN6A 2BJWA 4MKFA 1F2UA 1K5DA 1CTQA 2VEDA 2EVWX 3FMOB 1G7TA 1DO2A 2HXYA 3OIWA 5E7IA 5G40A 3W9YA 3GMTA 3NHAA 2QM7A 3TUIC 3VX4A 1VG8A 4QBFA 5JS7A 3Q5EA 5FTMA 4F93B 5D3MB 2WJVA 3GCGA 3TBKA 1ANKA 1LTQA 1TAGA 3BOSA 4I1UA 2FSGA 1VG9B 3EW9A 1BKDR 1KYIA 1Z6GA 4LBWA 1ELOA 2W2TA 2ZI7A 1CJMA 4LJ5A 1ETUA 1KI6B 3HR8A 1XTRA 4DUGD 4JLAA 1R6BX 1M7BA 4WVFA 4Q9KA 3HPQA 3CRRA 3U3RA 4DDUA 1TL7C 2GESA 2W6JA 1RFLA 3Q7QA 2ZR0A 1FTNA 3CNNA 4I1OA 1ZNWA 4CEJB 3PEUA 3JVUA 3L0OA 2IWHA 4B34A 4YMUA 3ND9A 3DKPA 4JMPA 3DEFA 4G01B 1ZD8A 2QTVB 1G7CA 1KI4A 3QXSA 4KI0A 4ZKEA 1UKVY 4TMVA 4CT4B 5G3ZA 2FFQA 1DPFA 4MH0R 3THYA 1GKUB 2ATVA 4G3XA 5AJYA 2ZIAA 4OHZA 4A9AA 1II9A 1NVUQ 1JJ7A 3IPXA 2I1VB 1P6XA 4LBYA 2NO0A 4RD0A 5EE0A 5EE9A 2VIIA 2FOLA 5CK5A 2CMKA 1Q21A 1X8LA 2J0UA 4QBGB 2BBOA 3RVBA 4AWXA 2C9YA 4PC3A 4W5HA 5HE8A 1FQJA 2HT1A 3LH5A 3CR7A 3EZ2A 4P4SA 4P31A 5SZHB 1SXJC 2CVHA 4GZMA 5AUQA 3RRYA 5IRCD 1N6PA 2QROA 3B1WA 3CONA 4FD2A 4M9SA 5LPNA 1LF5A 1E2NA 5HE9A 1EX6A 4DCUA 2C98A 3QNUA 3AUYA 5EP1A 1JQLB 4LHYA 2W83A 3OIYA 5FTLA 3MRSA 4MDEA 5KSYA 3IIKA 2A78A 2GCNA 4C7OB 5J4YA 5KOYA 4HAUA 2RGAA 5C4GB 3ADBA 2E87A 2CLCX 4ZIRB 1CF4A 3K09C 3NH6A 1KJYA 1T3LA 4EDHA 5F98A 5J5CA 4UJ5A 1XCGB 1U9IA 5DGXA 1Z6XA 2FMXA 3O8DA 3B1ZA 5A5GA 3AKCA 2P65A 3H0KA 2YHSA 1OYYA 4W5WA 1FX0B 3X1WA 1E2MA 4A15A 1N6IA 5DI9A 4DSUA 2JDIA 4V0OA 1L8QA 4NYJQ 4JL6A 3W6OA 3ZJYA 3W5IA 2NO9A 2RGNC 1KI1A 5DISB 3W3ZB 4OK6A 2F6RA 1IN6A 4ZPXA 4D0LB 4JLKA 1CRPA 4IVQA 4IOJA 2IWRA 5EP3A 1U9IC 2O0JA 1ONBA 3HWSA 4PX9A 2BOVA 3EA5A 2DWQA 1YZNA 4WA7A 2W6ID 2A9KA 1G7SA 1FL9A 3X1ZA 4DWJA 4EFNA 4W7SA 2WWIA 3BB1A 3OIVA 5H1YA 3GLHB 1R8SA 3MWYW 5F2EA 1KKMA 3A1TA 2QTHA 2R6DA 4HLQB 2IYUA 2PT5A 1Z47A 1C1YA 3I72A 2FPMA 4ZI2A 2V6IA 2ZRNA 1QRAA 4Y0AA 5EP2A 2EWWA 1EG7A 1NKSA 1E96A 1E32A 2I1QA 3LW8A 3G0HA 1OE0A 4MUAA 4TLBA 3REGA 3T1OA 4CEJA 4F4JA 4BFXA 5FR1A 4GNKA 1R7RA 3NXSA 5JWHA 3WMFA 4HYYA 4RY2A 4DKXA 3EXAA 3CKLA 2WJJA 3H2YA 5HZKA 1DG3A 2XNSA 4PO8A 3AV0B 1WB9A 1FNMA 5JJKA 4NZYA 4FMDF 3AH8A 5J4LA 2RHMA 4BLQA 4BLSA 2GK7A 3IO5A 2UZ3A 3QJYA 1U8AA 2ZUBA 2HCJB 4Q4JA 5JWRA 2JLYA 3HU1A 2RGEA 3QF4A 2GEUA 5G41A 3DM5A 3BH6A 3UPUA 3LQQA 2GA8A 3GJ7A 5CM8B 5FI0B 2HV8A 4QGAA 3GPLA 2Q9AA 2VP2A 4CYMA 4OI0A 2KB0A 2WWXA 3CRVA 2IS4A 4ERNA 2QPAA 1WBBA 4A0HA 4LOAA 3SDZA 3WY9A 2BCJQ 4KBFA 5JRZA 2IS1A 1KSFX 4TQAA 1XD2B 1KAOA 1VCNA 1ZCAA 1GNRA 2YWEA 2BC9A 1PLLA 2WM9B 1G8PA 1G4UR 4QOSA 1NP6A 3RWMB 1YKSA 3PFIA 1M1YE 3BD9A 4D6PA 4OQNA 1E1RA 3O8RA 1YJ5A 2FFAA 3CRQA 3LVRE 3PEWA 2REXB 3FVQA 2QAGC 3SC3A 2HYDA 2CK3D 1QHYA 4TMXA 1S1CA 5SZIA 2J1LA 3QXCA 4H9GA 4JS0A 2R6CA 4Q1BA 3N5CA 2JLZA 1FP6A 4HDCA 4DB4A 1JXMA 2QQ0A 3NIBA 1XMVA 4JYCA 3D31A 2NZJA 2Z43A 1XXHE 2QP9X 3A4NA 3V4FA 1SXJB 2A2ZA 2R6GA 3RRNA 4GL2A 4M21A 4UQOA 2FPLA 2C96A 2ZSFA 1Z0KA 3BJIC 1IN5A 3C5HA 4FWIB 1E1QD 3I32A 3P27A 4LDJA 2OAP1 4JL5A 3K9LA 1Z0IA 2GVDC 1L2TA 3KKQA 1G7RA 1GG2A 3H1TA 4JKYA 3AVWA 1H8HD 2XSZD 1FFHA 1VKJA 2V7QA 1DELA 2JIZD 2FA9A 4KCGA 1TX4B 1KDTA 3JVVA 3GFOA 4KODA 3NG1A 3TIFA 2NO7A 3KFXA 2GAAA 2H7VA 4CRWB 2CLSA 2WKQA 3IDQA 1DOAA 1AKYA 3KQKA 1EFTA 2EFGA 5AR1A 4Z1MD 4Q7LA 3SEAA 1HH4A 3LX8A 3EPHA 2DFLA 1E0KA 1KDOA 1XRJA 3QXXA 2C9CA 1L7VC 3CPHA 3K0FB 4NMMA 4S2EA 5K8UA 4DLXA 4HAZA 1ZD1A 3E2IA 2AKAB 5FOUA 3QIAA 1E2DA 1RKBA 4LJ7A 4LPKA 4B3XA 2WWGA 2X19A 1MO3A 1KAGA 4Q4JB 1J90A 2FGKA 2PX3A 5K8TA 2QMEA 1D5CA 2YOHA 4I4LA 2IYSA 2LCFA 1E4VA 1MRNA 2Q3FA 4LHXA 4PPFA 4BEJA 1WDTA 1XJQA 1JR3E 4R2IA 4FMBB 3AVOA 3EZ9A 1RE0A 1WRBA 1UFQA 3VX3A 3I8SA 4BLTA 3CRW1 2EU8A 1OIXA 2OCBA 2F1RA 1QZXA 4ACBA 2QMHA 3ZZUA 2P6RA 3T1TA 2OBNA 4ESVA 3ASZA 3OEHD 3UKDA 1DS6A 2QZ4A 4A6XA 5L3QA 4B43A 4NPHA 1CR0A 2ASEA 4LV6A 2JATA 1ZC3A 1KO1A 2EFHB 2BEKA 3T1VA 4BZQA 1VIAA 4U02A 1NN1A 2GXAA 1CKEA 2VHJA 3ZYCA 2WJIA 5FBRB 1GAJA 1UJ2A 2D2FA 2VP5A 5BXQC 2TMKA 4DDWA 1P2TA 3SNHA 1XWIA 3TR5A 1D2MA 2QORA 4LCBA 3SYKA 3WYFA 5A4JA 4L9SA 4R98A 1YRAA 1OXSC 2PJRA 1COWD 3ECCA 4TL9A 4XIGS 3OFND 4P32A 3KB2A 3KJEA 5L3VA 1HT1E 5LB4A 3K70C 3UMRA 3L0SA 5CIQA 3LLUA 3WP0A 4JIMA 2GVZC 3C8UA 4Q1EA 5ELXA 1S96A 5IHPA 2NO6A 4HI0E 4IOMA 4Q66C 3ZQJA 1ZVQA 1XF9A 4A6PA 4HEJA 1L4UA 1W2HA 2D4HA 3CPJB 3GJ3A 1DE0A 2A5YB 1US8A 4WZAE 4C0LA 5AUNB 3UIEA 1OF1A 1Q1EA 1VHLA 2JLRA 3BFXA 1N6NA 4EFMA 2PH1A 1NBMD 4KXFB 1JJVA 3THOA 4D80A 4WAUA 1ZNXA 3ZLJA 1GOTA 1GRRA 2J59A 4OQMA 4G5GA 1N3BA 1W46A 2V8OA 2PLRA 2WVJA 2EWVA 4XD7D 2W2VA 1P7CA 1R0YA 1SVOA 1W7AA 4Z51A 2ODBA 521PA 2GAOA 3MMPA 2H5EA 2EFCB 2PEYA 2XZLA 2OG2A 2R6AA 2WTUA 4I1VA 2K5UA 1GM5A 1E94E 3SS8A 3IEUA 1XZQA 6Q21A 2OM2A 5EJEA 2J0QA 4B6EA 2CLDX 4LJAA 3P20A 1FOEB 1G3QA 1XX6A 2Z4SA 3KX2A 4URWR 5FL7A 4V0LA 1GWNA 1M8PA 2F43A 2NOAA 3TMKA 4Q21A 3I1FA 1KMHB 1OFTA 1VCMA 3CR8A 4XSGA 3TSOA 2ZRBA 1BS1A 3U7HB 1AQYA 3P4XA 4ZDIA 4U7DA 4IOKA 3T1QA 3UG6A 2WWYA 2ZRAA 2KJQA 2ZSEA 3KTAA 1XTSA 1NJGA 1W5TA 2P0EA 2WPDD 2DPXA 2AXNA 4L16A 2PL3A 1J99A 2Q0HA 5EXSA 2X1VA 3T35A 3WMEA 1UDWA 3ZH9B 4QG7A 2G88A 1M7HA 2WJHA 3MGCA 2XOKA 4NCIA 2QT0A 3QENA 4NCJA 1VCOA 1W4RA 4JLDA 5KUTA 3KJIA 4Q5IA 1G8YA 3FPAA 2ZE6A 4PTLA 4PSAA 3PITA 4GMXA 5KO2A 1BIFA 3MSXA 1SGWA 1GVNB 1FUUA 2N42A 3C4JA 4K81B 1CR2A 2BCGY 3OEED 4I99A 4JSYA 1W0JD 1BO6A 4ZDWA 4ON9A 2BM1A 3IILA 3H86A 2GF0A 1JR6A 1TF2A 1VYVA 4D25A 1DAFA 2CCJA 3B7GA 2B6HA 3NEYA 4Q9HA 1ZUNB 4RJLA 1NRJB 3SHFA 2C2HA 2GBLC 2GXQA 2QPTA 1Z2AA 1QHGA 1WP9A 3AKYA 2NZ8A 2ZVPX 2JLVA 2AWOA 3N2IA 1ZMXA 1YZUA 5AJZA 4BFZA 1WBDA 3D3QA 3CBQA 3F8TA 2LKDA 1OJLA 1XMJA 4M4SA 1X1RA 2C78A 4C30A 4TYYA 1ZC4A 2VP0A 2FFHA 2BKUA 2AD5A 2ZJOA 2ZRGA 4DUGA 3K53A 1KJZA 1G8GA 3S1AA 1G291 3BK7A 3EA0A 2WWHA 3RC8A 4URYR 4MKIA 4X8MA 3TW4A 2ZM5A 5EE5B 4DCTA 2RGGA 2RGCA 4C2UA 4XH9B 4NDZA 2OE2A 1A7JA 3U2QA 4PHFA 3IO3A 2NQ2C 5LD2C 2YC4C 1YZLA 4NCHA 1UBFA 3THWB 4OHXA 5FPTA 3E1SA 3QKRB 3OAAA 2HJVA 1FPMA 5KDDA 2QAGB 3VU9A 3QXHA 4V03A 3W3AA 1QHXA 2JGNA 3EPKA 3MWJA 2C95A 1MV5A 4GI7A 4AIIA 2O0HA 1OIWA 3TW8B 3LD9A 1NY6A 1J2JA 3FE2A 2GJ8A 2ZEJA 2BBTA 2RGDA 5KU1A 2ZJ5A 4ITRC 3TAHA 3RS3A 1OT3A 2BDTA 1UADA 3KJHA 3KTAB 4Q1CA 3OAAD 1MABA 4IDHA 3QVUA 2XAUA 4LWZA 4C4PA 3VMFA 1JAIA 3Q5DA 1XJ0A 5BWMA 2HLDD 3KKOA 1AK2A 1DAMA 1NJFA 1E2LA 2Z83A 1SULA 1M7GA 1NN3A 2IHYA 5DO9A 2V9PA 3PENA 2H57A 2QAGA 1OV4A 5L3RA 4WW0A 2ZJ8A 4B32A 2O8FB 1GZSA 2W0SA 1KK0A 1ZNYA 2WSSA 5FUYA 2AD1A 5FOSA 2AXPA 5FUVA 4KV9A 2GJAA 1WMSA 1YU9A 4IDPA 2NO1A 3WMGA 2HT6A 1D9XA 3P1JA 3B1YA 1F48A 2F1IA 4WZBE 4AYWA 4O3MA 1JEEA 1OH8A 1AS2A 1UEIA 4IOLA 2FWRA 4DSTA 4V0MA 1OFIA 2ZAOA 2A30A 1F2UB 4DDTA 3B85A 2NTYC 4JLNA 2RCNA 1W4CA 1JNYA 3BFKA 3AUXA 3H4MA 4LJ4A 4XVQA 4Q02A 1Y63A 5TY0A 1YQTA 5B2ZA 3X1XA 2GRJA 2RMKA 4IHQA 1YRBA 3IPYA 4YMWA 4UXJA 3TLXA 1G8HA 3TNFA 4CGZA 2IYLD 4C3ZA 1ZUHA 4BZPA 1P3JA 4KITB 2IF2A 1XP8A 4HUQB 1HV8A 3VKGA 3ICEA 2XNDD 1AZTA 5DHFA 1II8A 3CB4A 1E1QA 4P4TA 3P4YA 3U3JA 4E07A 3EZ6A 2X77A 2V55B 2ZRIA 4RZ2A 5TVKA 4DLZA 2ZRFA 3VTKA 2W0MA 1P62B 2ZRHA 1VDZA 3LWNA 2IX3A 3FMIA 4NYJR 4XTRA 1RZ3A 4XWKA 1IJEA 4BECA 5JMTA 1P9WA 1W47A 3ADDA 1OPXA 2EYQA 4Q4AA 1P5ZB 2XNDA 3DKVA 1EX7A 5DSZA 2FX3A 4ASUD 2ERXA 3B9QA 1OFUX 4MRSA 2DFKB 2Z6VA 3NDBB 1S9HA 1LVGA 4FWTA 3A1UA 4QGFA 3EWSA 1AS0A 1CR1A 4UKDA 4DEXA 2WWWA 2CJWA 4XD7A 2QRNA 2J5XA 1AA9A 4HSEA 4GOKA 5KSOA 5FTJA 3HU3A 3VR1A 3PUYA 3QUSA 5DN6D 1N5IA 4LC1A 2XZPA 4E09A 4MITA 1WXQA 2XJ4A 5FBQB 3FFBA 2RKOA 1EESA 1ZBDA 4YDHB 4LC0A 1DVRA 4W5JA 5HCNA 4NCKA 3ZIAD 1E2GA 3FHCB 4NE2A 4RZUA 1FZQA 1OIVA 1UDXA 3WRXC 1II0A 2OT3B 3DDCA 4DC9A 1NKTA 1GTVA 2WMOB 3A8TA 4PC7A 4LHWA 1VPLA 5KTYA 3THXA 3ND8A 2D3WA 2FF7A 2P6NA 1Z6AA 1SVKA 2FG5A 2F43B 1ZINA 2MMCA 4AKEA 3AF4A 2CHVA 5HKKD 3RS5A 1UM8A 2Z5FA 3UK6A 5FPSA 2N46A 3PCRB 1B0UA 3HU2A 4EPVA 1S1MA 2W6JD 3EIQA 2OBLA 1KOFA 4TLEA 2RH5A 1OFHA 2QU8A 4IFBA 2XX3A 1OKKA 2BMFA 5HCIA 1SVIA 4HB2A 3REFA 4EAQA 4DCNA 2DBYA 4F92B 4YC7A 4XWOA 4LJ8A 4L15A 5H68A 5JSZB 3ETLA 3UXMA 2CEAA 4HAWA 4TYWA 3F0TA 1SHKA 2RAPA 5TXGA 3L0PA 1J8YF 5JS8A 4LHVA 5J4KA 1E69A 4H1VA 3B2EA 4RD2A 2IXFA 4TSFA 4WBSA 3GJ5A 4QXAA 2ZE5A 3O8CA 4EJSA 1NSFA 4HLUC 2F3RA 5EXTA 5B64A 2QE7A 4TQ9A 1KI7A 1FQKA 1QHHB 1RRPA 2VYFA 1CULC 2RGNA 2ATXA 1G3RA 2J46A 2WICA 1ZYUA 4BFUA 2ORVA 2HF8A 3EIEA 3I4LA 5CK4A 3AKEA 5JCPA 1W1WA 3B5JA 3QKTA 3NBXX 5DYIA 4B33A 1DAEA 1Z6TA 2DFTA 1P9NA 3CH4B 3K9NA 1P61B 2G77B 2YZ2A 1T3SA 1Z0JA 5JHHB 2BHRA 3VKHA 1G64A 4HZUA 4TQUS 4CEIB 1UBGA 1FW6A 4NHOA 3VQTA 1AS3A 3FKSD 2OAQ1 4B2LA 1VMAA 2OCAA 4L8GA 2A3RA 5JECA 3TAUA 5JJIA 3BH0A 1D8TA 3C16C 2O8EB 3M1IA 4NYMR 1IONA 3SBDA 4IJMA 3T5DA 2WWFA 1OXUA 2ZS7A 3R8FA 3ICQB 2JASA 3I5YA 2DYKA 3EPJA 3QKRA 1M2OB 2OLKA 4RFSA 4FW9A 3V00A 4FI3C 3KKPA 2LWIA 2RGXA 2FSFA 1JBKA 4Q1FA 3LRPA 1NLFA 2GXUA 1N25A 3CF2A 2IYWA 4Q48A 4O2RA 4PHTA 4MUBA 1GRQA 1UF9A 2IYZA 1SVSA 5DE3A 5KPJA 5H8WA 3TJZA 1A5TA 3CZQA 2QI9C 2EFDB 3NBZC 2O0KA 1AGRA 1Z83A 1E9SA 3CWQA 1BYUA 3Q3JB 5GJCA 2O8EA 1UEJA 4QBHA 4PR0A 3B82A 4JLJA 1COWA 4KFTA 1ZU5A 4ASUA 3PIRA 1DADA 1SXJD 1SVMA 1I4DD 3PXGA 5K8IA 4B3FX 4K8OA 4M1WA 4IXMA 2IT1A 1S9DA 2ODNA 5F9HA 3R9IA 1XB2A 3HDTA 2AX4A 4DVGA 3D7MA 4LBVA 1UPTA 3W6NA 1R0WA 1EFHA 1FTSA 2IK8A 4ZDKA 3PVSA 3QY0A 5FH9A 4M22A 4KHZA 1GITA 2JA1A 1CR4A 4L4UA 5KNDA 4Z1MA 5IDVA 2XXAA 1E9DA 5EZ5A 2ZJ2A 4N1AA 2GCPA 3I8XA 4US0R 3WYAA 2YVUA 1U94A 3VHLB 1JAHA 1IN8A 1NMXA 2QNRA 1E2JA 5DNYB 4JJZA 3I5XA 3HPRA 2GJSA 4OJQA 4JJKA 4RKFA 1BMFD 3B8HA 3MUFA 1UBEA 1H65A 2ZSDA 4A8JC 5FOXA 2IL1A 1OXTA 4V0KA 3ZGXA 4BFWA 4YXWD 1A2KC 4UXHA 2QTFA 3U4QB 3H84A 1NY5A 2C9OA 1NIJA 1ZD9A 3M6AA 1N0VC 2O8BA 4MYCA 5CYOA 1VG1A 4D4JA 1OKKD 4XVUA 4MRPA 4P0TA 1V5WA 1KSJA 3BBPA 3R7WA 2O8DA 2Q9BA 2Z0MA 3N70A 5KDOA 1ZRHA 2ZQ5A 2JJ2D 4B2PA 1DBSA 2ZRPA 2KWIA 1S3GA 2CE2X 2GK6A 1TQDA 3CX6A 3A1VA 3KB1A 3T61A 3ZVLA 3CM0A 1LB1B 1JR3D 4JBXA 2QEQA 1AJEA 4AG5A 2WJYA 1W0KA 4KFRA 1KO8A 4TZ0A 1H8ED 5CM9C 4PAQA 1KZGB 1CJUC 1PJRA 1M74A 1TQ6A 5DLQC 4G5OA 4PAMA 2I3BA 3FWYA 4EIWA 3GLGA 2ZUCA 4KJZA 4OKSA 3W5JA 1JPJA 1P2SA 3B60A 4PQYA 2O52A 1GILA 4B2IA 4KSCA 2QSZA 3LAWA 4CIDA 4ZI3A 1K5GA 1OB5A 3IIMA 3QPWA 2VTKA 4OBEA 1G8FA 3ZZ0A 5DI3A 3LBIA 2ZU6A 4BLOA 4IFEA 4DEYA 2ZI4A 1UBCA 2O8FA 3AKDA 4B71A 4NP6A 4G5SA 4AKHA 2BMEA 2XJ9A 2AN9A 3MFYA 1DAGA 1R5OA 1E2HA 2GKSA 2IEYA 2ODEA 1T3HA 1Z28A 4POAA 5KNCA 4EKDA 5CDFA 5J4HA 2VSOA 3SHWA 3BC1A 1LFDB 1DEKA 2ZRDA 1IN4A 3VR3A 3U3MA 4CVNA 1NG1A 5CLLA 3AVXA 3LX5A 3K8YA 3M4YA 5E7MA 1M34E 4LJYA 4YXWA 1EFUA 3DO6A 4TYNA 3KKNA 1P75A 2PLFA 1X8KA 4UNPA 1KSGA 3LNCA 1MH1A 821PA 5EQTA 1Q1QA 3OIUA 1T6NA 5LBIA 2ZYTX 2JJ2A 4Q7JB 1E2FA 4YONB 3LY5A 1DO0A 4HLCA 1Z0FA 1G1MA 2D62A 5J47A 5L3SA 1X3SA 2QT1A 3DM9B 1U90A 1H8EA 2JJ1D 1WQ1R 2NPIA 2W2XA 4DHEA 1OHHD 2FZLA 2KBFA 3CIOA 4WIAA 1KNXA 2BBWA 2CBZA 2ZSBA 2R9VA 1ZM4A 2QN6A 3MAAC 5JEDA 1PV4A 1RRFA 3U6KA 4F7WA 1P60A 2H1LA 4A8JB 5D3MA 2BVNA 3OE7A 4C0AC 1W36C 3VFDA 2ZI9A 2LKCA 2ERYA 1SHZA 2QBYB 5CLQA 3K0AB 2WHXA 2C03A 1Z07A 5JLJA 4QJ3A 2ZRLA 4MKHA 2GNOA 4QKQA 4LRWA 4ZKDA 4TWZA 1KJWA 1J70A 1E99A 2CL0X 3SFVA 3AVVA 1XDBA 3EZFA 4WZ6A 2XOKD 1W49A 1Q0UA 1SVLA 3JZMA 2WKPA 4C7OA 1ZM3A 4NL4H 1KI9A 3FOZA 5DYGA 5BYJA 1QHIA 1QHSA 1TPZA 2R2AA 4NKRA 1TADA 2IYYA 4AYTA 3K9GA 4OK3A 3CW2A 1C4OA 1DTSA 4HAXA 1IXSB 1JALA 1SKQA 4TMTA 2IYRA 5FL3A 4URUR 1IXZA 4NCNA 4RZ3A 3QI2A 3HP1A 3M0EA 3P26A 2JLUA 3CH5A 4BFVA 4KVAA 3NKVA 4RVCA 1ZAKA 1N6OA 421PA 2ZR9A 3U61B 1W36D 4M2LA 4IVPA 4AD8A 3VR4A 4A36A 4EPWA 5JJLA 2OUKA 1W0JA 2YJTD 4MQBA 1TF7A 2JCSA 2QA5A 5EP4A 1AKEA 2R8RA 3EG5A 2VLIA 2J0SA 1IN7A 2ZXUA 2R65A 2AFHE 2GHIA 4IEEA 1IXRC 2IBMA 1QVAA 1N6HA 4HLUA 4ZCLA 2IYVA 2H8KA 2B8TA 3B78A 4FMCB 1VECA 4TLCA 1M6NA 2PZEA 1YZGA 2CVFA 4KYIB 4QHSA 2PMDA 4Q9LA 5A0FA 1I2DA 1AN0A 2BJVA 2KE5A 3IHWA 3DHWC 4OQLA 3BAFA 1TNDA 4DT1B 1V43A 1XTKA 4WOPA 2GTPA 4A2QA 3E70C 4M1YA 4YMSA 1G3MA 5CB8A 3ZVMA 3IBYA 4AI6A 3U3OA 3GJXC 5FPYA 5BN3A 2VSXA 1EFCA 2FV8A 4JLMA 1WE2A 3CO5A 4KBGA 1JI0A 4Q4HA 3PQCA 2CL7X 2J9RA 4PZZA 1G3IA 4PC1A 5TMPA 1FP7A 2D7DA 1JEDA 3SOPA 1IAQA 2XTMA 2ZRKA 4MA4A 1KHTA 1XMSA 4O0MA 3WP1B 2QE7D 2VP9A 4KVGA 4LK2A 3GLGB 2YWHA 4X8LA 3OHMA 2BIFA 1AZSC 4MRVA 1UKZA 4JYBA 4MYUA 3PUWA 5J4VA 4L5BA 2WV9A 4P33A 5F9FA 3QOFA 4C0QC 1KY2A 5AJXA 4QM6A 2GCOA 2B21A 4GT1A 3S1AB 5JRJA 4MDFA 1YE8A 2GDJA 3GQBA 2QL6A 1NVXQ 3U44B 4D2IA 2C99A 2V54A 1ODFA 2ZJBA 2HYIC 1CRQA 3L0IB 2QBYA 4DSOA 3KXLA 4Q01A 5TARA 5C18A 3C5CA 4D26A 3IGFA 4E5UA 1Y3AA 4WXRA 5GJVC 2W6IA 4QJ5A 3RRZA 3TK1A 4C0HA 2VF8A 3R7WB 4Z8XA 1F60A 1OHHA 1KK1A 4BLPA 1NVWQ 4M9QA 4P4SB 4RZXA 4QNRA 1QBKC 3I73A 1KKLA 2A5DA 4DLYA 2GILA 1IBRA 2J0UB 4DXAA 3MJRA 2A7QA 5KHOC 3EASA 4RD1A 1NLZA 5G3YA 1I4TD 3W8RA 1G6HA 2ZR7A 5CJPA 5KSZA 2CCGA 2FH5B 3AGQA 3LW7A 3EPLA 1P72A 2P5TB 2DHRA 1R0ZA 3VHXA 3FMFA 3L43A 3AF0A 1KTVA 3GLHE 1R0XA 4K46A 1RVDA 3RRMA 4AC9A 5IT5A 1Z22A 1P2VA 4B6FA 3GFPA 2H17A 2H92A 2GZDA 1T8TA 3HJNA 5IK2A 5KNBA 4BFSA 1ZJ6A 3WNBA 3AQ4A 4KLZA 4BFYA 3QF7A 4OHYA 3IKJA 4CZ2A 2P2LA 2JLWA 4M0LA 1CJVC 3DZDA 4OI4A 1Q1ZA 2F1JA 4UJ3A 4XTCS 3SZRA 4CF7A 2VHCA 3Q7PA 3MLEA 1OYWA 3ZD6A 1NIPA 4AK9A 2IUTA 1XD8A 2ZI3A 2G6BA 4TL6A 3SYLA 4BWYA 4BUJA 5B30A 1PUIA 1FMLA 4LHZA 4TMWA 3GJ6A 3KZ1E 3U6BA 2D74A 2FN4A 2FSHA 2H18A 3C41J 5AUPB 2GWHA 3SFZA 2OFXA 3WHLA 1G20E 1G5PA 2A5GA 3QG5A 2X2FA 4US2R 5FBVB 2NPFA 5JSZA 5TDHA 4HB4A 5FFMA 1EFRA 2HDNB 3B9PA 4P3YA 4TL8A 2Q9CA 1X1SA 2ZREA 1E0AA 3EAQA 3GJ4A 1GNQA 4IVRA 1CBUA 3B6EA 1HA3A 2EYUA 4KU4A 2HEIA 3KDSE 1JB1A 4XSHA 5SZJA 5JHGB 5L8VA 3GP8A 2WZQA 3PJRA 3R8CA 1HTWA 2ECKA 1RRGA 3DZ8A 4Q4LA 1IM2A 3RYTC 1D6JA 5JZVA 2VHTA 3ZVNA 3A6PC 2Q3MA 3AM1A 1OXXK 5EXPA 1U0JA 2ZYVX 2IC5A 1QVRA 1ZM7A 4GZLA 1S8FA 3TQCA 5FTKA 1HY3A 1NN5A 5EXXA 5EE1A 1NVVQ 4Q4AB 5FPHA 2NIPA 4JVMA 2GETA 2F1HA 2EFEB 4J0QA 2FPKA 1T5LA 4TL7A 1G5TA 1NF3A 1R2QA 4ZIRA 2R6FA 4NYIR 4H1UA 4CEHB 2GZHA 4IDOA 5C4MA 3ZS8A 5JI3E 4BZXA 2ZANA 4TMKA 2NMVA 1XD9A 4A4DA 2DFNA 1Q1BA 1U2RA 3TSZA 2YWGA 4D82A 1E0JA 2O8CA 3TGPA 1ZM9A 3WNDA 4EPYA 2WIBA 3PUXA 2EW1A 2XB2A 3NTUA 5FOWA 2Y8EA 2MMGA 1A82A 3V4RA 2OFWA 2REBA 3CRMA 1U81A 4HB3A 3RAPR 3R9XA 1SXJE 2BWJA 1E79A 4I81A 2D2EA 3FB4A 2HCBA 2WPDA 2X8AA 3U7EB 3OFNA 1DG1G 3NC1C 1AQUA 2VF7A 5FTNA 3SQWA 1YR7A 1RRCA 2VQSA 4IEIA 1TEVA 1TQ4A 3CLVA 4AYXA 4OQXA 3UMSA 3K9HA 2IEZA 1OW3B 2UKDA 4LJ6A 3DPUA 3RANA 2OILA 4UNRA 1D2EA 1H8HA 2XSZA 3QBTA 4MGYR 1Q44A 1CXZA 1A1VA 4CDGA 3L2OB 5FOTA 3UATA 2V1XA 5EUMA 4B3CA 4PPQA 3ASYA 5KPDA 2G1JA 2VSFA 2V4ZA 5DIFA 2B92A 2D06A 3ZQ6A 1ESNA 3QEOA 2A5FA 1OSNA 3NC0C 4ARZB 4Z54A 4F38A 1VG0B 1XBTA 4IKEA 4V02A 3RS0A 4CW7A 4YMVA 2CK3A 1N6LA 3AP1A 4GMDA 1E2IA 4NU0A 4PHGA 1GFIA 4Q1DA 4B76A 1JECA 4MYTA 4EQ6B 1MO5A 3DVLA 2G9NA 3OZXA 3K0FA 3L8YA 2EQBA 2IW3A 4DLTA 1HURA 1MO4A 4U00A 2IUUA 4UNSA 4OYHA 5LDDC 1EWRA 4G0NA 4PFSA 2CNWD 3FDIA 4NYMQ 5AJVB 721PA 3EX7C 2DWOA 1E2EA 1LV7A 1KO7A 2QQEA 1X86B 4ACAA 2DR3A 4LZZA 1J7KA 4PQFA 1NMZA 2VPPA 1BYIA 3K0SA 4Q9IA 5ANRB 4GOJA 2JJ1A 4D4LA 1SQ5A 3FHOA 2VP4A 5E95A 2Q6TA 4JKIA 3G82C 1TF5A 4G1UC 3QXJA 4BRUA 4G5QA 1TEXA 1SZPA 2OESA 5LD2B 3ZZTA 4RFSB 3GLGE 2CDNA 2IA5A 2OSBA 1YZQA 1JQJC 2ZTSA 3U7FB 1E9AA 3BRWD 2PEZA 4JL8A 4TTRA 4D0NA 1W2GA 1PVOA 1KI2A 1XPUA 1P73A 1U99A 3TUZC 4HZUB 4JLVA 3KQLA 1YZKA 3KXIA 3Q8XB 3GJ0A 3IQXA 3SJCA 4ESHA 5FBWB 2J0VA 5JEEA
chains in the Genus database with same CATH superfamily
5DLEA 4NR0A 5EJ8A 1RHQA 2XHZA 3BCUA 3QLJA 4LJSA 1KDRA 5A4IS 2XITA 4RGVA 4L27A 3QBVA 1SXJA 3F96A 2PKQP 3S99A 1XVAA 3NHRA 2IS6A 2MT9A 5KYWB 4R1NA 2BKEA 4M49A 2VP3A 4DA9A 2O2GA 4AQ7A 2DTXA 2DR0A 1IZ9A 4KK4A 4BVKA 3C0KA 3URMA 3IH5A 2BUBA 1FSGA 5TVGA 1XN4A 2REOA 5EIFA 2BCEA 1KPGA 3BE4A 1UXHA 3RT1A 4QTTB 3WL5A 3VDQA 1QHHA 4FNAA 3OBBA 1KIFA 2W70A 3DSRA 4Z9BA 2WPNA 3C5EA 4F4CA 1CJBA 3GGSA 4Q9JA 3C3MA 4K9RA 6LDHA 1CCWA 1MT0A 3ILSA 4RD3A 1WPXA 4UU0A 3QKUA 1Y3BE 2ODAA 1DEHA 3RNOA 3B5IA 2PWYA 4LNUA 4B2YA 1E98A 3CINA 5AICA 1E6CA 2ZS9A 3WC4A 2W4IA 3EIXA 5EHZA 2IDMA 3TRIA 4EW6A 3JQBA 5CJJA 5BORA 5BWNA 1F4LA 1BD4A 2ZSJA 3PD7A 3HBFA 3PFNA 4D9JA 3QVGB 4WLFA 1KO5A 3EDMA 1BOOA 5B1IA 3ZIAA 4UOZA 4MTCA 4IY1A 3W8DA 4V0ME 2SCUB 1XWWA 2AR9A 4Q03A 5EIWA 2VSYA 1E9CA 1P5FA 1TCBA 1R6DA 1EP1B 1EXMA 1W75A 3MCAA 3VSAA 2OV2A 3QKSB 5F1PA 1B8NA 1FRVA 3O2QB 2CMDA 1DNPA 4E14A 5LZ4A 2HF7A 1LS6A 1LY1A 1FK8A 4BNJA 4GRIA 1PTJC 4TVKA 2A14A 3V7UA 4XGIA 1A7UA 1IWOA 3I30X 4N82A 2PR7A 3UB2A 5CITA 2GMWA 1IZ8A 1FFSA 1RXIA 3ITNA 2VJAA 3KAPA 2YJ5A 3KE9A 1IB0A 2R5FA 5K3BA 3GBSA 5JMPA 4DWWA 4P34A 1RI4A 2VDLB 3TAXA 3PNKA 2FEOA 1YBMA 2NV0A 4GGOA 1NBOA 5DNUA 4M1TA 1UK6A 1R0LA 1MQAA 2IZ5A 3D81A 3L0ZA 2WJ3A 3OZUA 5FUXA 3ZV7A 4U0KA 5ERXA 1IIBA 4HJRA 4R3UC 1ZIPA 1IQ0A 3EGXB 4Y6SA 5TQ0A 4MS3B 1YXMA 3NIDB 4G1CA 4ZTUB 2JHAA 4FBGA 4GF5A 4TXHA 1N5JA 5LWHA 4Y6GB 4WCFA 4GP6A 5ICFA 2GD6A 3FCCA 4KEAA 1IY1A 4NVRA 4Y2VA 5JARA 3OQVA 1WV1A 3BXZA 1DUIA 1QXSA 3AW8A 4JUIA 3UA3A 1BJRE 2P3LA 1S3SA 2WT4A 3RSOA 4K1XA 4EY8A 2IDJA 1KI6A 1U0HC 1HR0B 1JPNA 3PWSA 4AVYA 1I94B 4YRAA 3WJ2A 2Y77A 4HDOB 3SZLA 1I2MA 3FOCA 2VH1A 1RQRA 2MSDB 4Q7KA 1NXTA 4KWIA 4BVBA 2YKGA 1NT2A 3T5PA 4A26A 2QVBA 5GVRA 4CQMD 2VH5R 4KR9A 4PXAA 1KTIA 5KMGA 2RHDA 4JQSA 2QUJA 1TUIA 3VR4H 3JCZA 2ZYDA 5IH7A 1P1IA 3C6ZA 3I6IA 2CLIB 3LYAA 4L7QA 2NAFA 1L3IA 2ZYWX 3LKVA 1UXGA 2XOEA 1CP2A 1G18A 3KQUA 3KEOA 3TOXA 1Y9DA 1GY8A 2F9MA 4EJ0A 3TFQA 3FH0A 3KL2A 4LYJA 4D3YA 1A69A 2YINC 3PEYA 3O47A 3P52A 3VU8A 4D4GA 2RD2A 3QVTA 1R00A 1RZVA 3B70A 5K0LA 2WSSD 2CXXA 2OCYC 3SZGA 1XCJA 3CMMA 5LA6F 1C4KA 4XR9A 3ZKAA 1S2IA 4EP1A 1HOTA 4OGKA 3O4GA 1MIHA 4PGHA 5ADHA 1NXSA 1MAHA 1TMKA 1U9JA 3IAXA 3V3KA 5GOTA 4U8HA 5JNUA 4BJHB 4LXGA 1P2UA 3VZSA 3ZJ5A 2FE4A 4B3TB 3GFSA 5GZ1A 4B3GA 1BXZA 1DKPA 1QDLB 1NRIA 2JLSA 3KVOA 5DXFA 4HNTA 2DCUA 4LJ9A 2AI1A 2JHGA 3VPXA 1W36B 5CHYA 1DU4A 3ST7A 1NA5A 4XFDA 4ZOCA 3ZCVA 1U0NA 3AILA 1DBPA 1KY5A 1QCYA 2E4YA 2PMWB 4QRHA 4DL9A 3C7AA 4QGSA 1GSIA 1MJGA 2G0TA 4X8OA 2H3HA 4BGUA 5EHQA 4CJXA 3FFAA 1BN6A 4LPSA 3DAOA 1J24A 2C7GA 2EXXA 3NMUF 4OFBA 3TBHA 4ARSA 2V6JA 1N6RA 2E4VA 3Q6MA 5HS4A 2O06A 2XA1A 4PW0A 1N5KA 2GYUA 2DSTA 3FGNA 2Z6AA 3WMXA 5JOQA 3NHWA 2ZWOA 1M2WA 1DAIA 4JP1A 1I4LD 5SY4A 3STYA 4DKJA 2XF8A 2WHRA 2MSCB 4JZYA 1PCXA 4BNZA 1DCTA 3BIWA 1C1HA 4ZMRA 4ALNA 1VFNA 1JBQA 4BMSA 4ZFNA 3O4IA 1QG2A 2HK7A 5BMVF 1NVKA 2AS0A 1P3Y1 2ZAYA 2ZR8A 3JYHA 4BO9A 2AK3A 2ORWA 4M83A 2GPWA 3ZHXA 4FLFA 4EUHA 3O21A 4KWEA 2BM8A 1Q0TA 4RGYA 4FMPA 4J0HA 1SHJA 1Z06A 2CXTA 3O1JC 4B35A 1JYEA 3QY9A 1MTOA 3MG9A 3OLZA 4LZJA 3WNZA 1XP5A 4S2UA 1OTHA 3AY7A 2C04A 1DX6A 1SBIA 2CL5A 3AB7A 3DJFA 1WF3A 4MKGA 4DPMA 2HHJA 2P0YA 5ALIA 3JD1A 4PO9A 1JKFA 4PPGA 5EIBD 5DULA 5T41A 1ENYA 1HZZC 1XTZA 3FJ1A 4LECA 2ONJA 4D8VA 3Q0IA 5JZSA 1J33A 4LGMA 3EXFA 2PT6A 1OBHA 4WDQA 2YWFA 3LRXA 1ZUWA 3FR8A 1KO4A 1L8LA 1I51A 1B7GO 1YZ3A 3OQIA 1CVRA 3WFJA 3COYA 3D5QA 4OQFA 5CYPA 1KZ7B 3UJ9A 4CIVA 2WA1A 4X7MA 2EBUA 1PYDA 2F7SA 2ZSHA 4FKMA 1C1DB 1CNFA 1GL9B 1E3TA 5FADA 3GRYA 4C0KA 5EHIA 3EGIA 1LI4A 1UZMA 4YV7A 1PLJA 3C1AA 1J23A 4J6EA 5F5XA 3S3TA 4C4OA 1LLQA 1F8FA 1R5NA 2GPAA 2JFXA 4K9DA 1YVDA 2CHEA 4NXMB 3P9YA 4QARA 4LYDA 4CI0B 1U80A 2R7NA 3NR2A 1TK9A 4JLPA 4W5OA 5M2QA 1FFYA 1TIPA 1RYFA 4LY6A 1OTXA 2ZTMA 4G24A 2H1OA 1B26A 2KQUA 3BH7A 4IIFA 4MKZA 3NTLA 2FEKA 5JPIA 4Y2TA 2K7FA 5JVDF 4MS3A 2DG2A 3CCCA 3QXGA 3GG2A 4EUKA 2ZVQX 3O8OB 4UHFA 2VDNB 3QE2A 1W44A 2PZFA 4YJGB 5G1OA 5DHRA 3GT7A 1BDIA 4HFRA 5FFFA 2RC5A 1SBHA 2YNMA 3FOAA 2ZIFA 4R7GA 2W2PA 1CQJA 1PJZA 3K0AA 4J29A 4Y2SA 1IQRA 1R12A 5AXAA 5CLFA 1ZCZA 4JVLA 3A0RB 5DFAA 3ZCSA 3ZVRA 5DX8A 1T1SA 4ZU3A 1U0LA 1A9ZA 4GX0A 3TOVA 2YXNA 2F62A 1A2BA 1C9KA 2O5RA 2VZLA 2YJ6A 1GNPA 3GEIA 4IDBA 4OQDA 3T99A 5BN4A 1JUDA 4BJ6A 4ALLA 3G5LA 4B74A 1SM4A 1A4RA 3DE6X 4ETNA 5GJBA 2ZKIA 2QTZA 4QEKA 4HGPA 1NBAA 2BLNA 2QX7A 1DZIA 2LR0A 2GJ4A 3A9SA 1N0UA 1TECE 4MB6A 1RPZA 2J9YB 1EB9A 5KTSA 5EY5B 1ZK0A 3TFOA 2MYPA 1WHSB 2D2IA 2FUG6 4E22A 2AFHB 3H5IA 3K0CA 4GDFA 3F7MA 3PPWA 5L3QB 3QQ5A 1J2EA 3A1SA 5EVJA 2G8LA 3AP2A 1CUJA 1YZTA 2JGJA 1REQB 4GC9A 4LGYA 2IEGA 5JS1A 1IJFA 3BE8A 3RAGA 2O1EA 3VTAA 3ADCA 1CYDA 3IIIA 4QZVA 4GQBA 1W88B 5IVKA 1KIMA 3WB0A 2IELA 5MDHA 2AYYA 2DQYA 5C34B 1P81A 1KQNA 2MINB 1E1RD 1GG8A 1YQGA 2OCIA 3N6RA 3WGYA 4MW7A 5JZMA 2K6GA 3RUCA 3UJBA 4U5XA 1IQUA 3PPVA 4TXLA 1GYPA 1L1EA 2NSDA 2PHZA 3P9SA 1Y42X 1QS0A 4ABTA 4R2HA 4WH0A 1C7QA 3CYFA 1T9DA 3C4QA 5A7HA 4EGQA 3MTAA 2ZYUX 4YAEA 2NZYA 4JI0B 1CEEA 1VYTA 2WVAA 3CNHA 2Z30A 1I6MA 1RRKA 5SYMA 4ZRDA 2QJWA 2J7PA 2P1DA 2RDMA 2FGJA 2ZIVB 1JLLB 2D8AA 2V3WA 3N2EA 3V4SA 2HRBA 1CUSA 3V8NA 5F1KA 3KQYA 1YKFA 4D9MA 4QJIA 1V45E 1XAIA 4PYLA 5HW0A 1XTJA 3Q9LA 3CUEF 2NTNA 4IIJB 5AM5A 1AB6A 1QGAA 3RF6A 3RKSA 4ZOQI 2G9UA 1BE8A 2QF7A 4WT7A 3ZPXA 2Q6IA 2X40A 1CF2O 2YJGA 4P5PA 1BHSA 4YRZA 2YIMA 5JTUA 2G0NA 2QP3A 1FUKA 2AMVA 3JD4A 5DTRA 5CFQA 2O48X 2E9SA 3L4BA 2QW0X 5HMMA 3GN1A 5TS3A 4BPRA 1AGXA 5SZKB 2SKEA 3T7TA 4U9IS 4KQXA 2XMBA 3QKWA 4XAQA 1RQGA 1VA4A 2FEWB 3RUEA 1U1IA 1KDVA 4XWWA 3KU1A 4DV7B 2ZBPA 3T9FA 1D2CA 1DRUA 1BVYF 2QSYA 3HDQA 4W5RA 1Y0BA 4L0CA 4IJ6A 4R8RA 2I80A 3A58B 1EZ1A 2BFFB 2JIRA 1Y5MA 3COWA 3EUFA 4HR7A 1EVEA 4RW0A 3P2IA 3GLIB 1FS6A 1EVQA 4U0JA 3GLFB 1TDJA 2ZJZA 4IYRA 5AVOA 5F51A 1Z63A 5U4XA 2YW9A 3CN7A 2JJMA 5DIZA 3T52A 4D79A 2RBKA 1WL8A 1E1NA 3EPPA 3LOQA 1XVUA 3C8MA 1H2FA 2VWPA 1P7WA 3WRYC 1KETA 3NJ4A 3OMXA 5KX5B 5LYJB 2PK3A 2C5LA 1IBCA 2H7YA 2PJZA 3Q72A 4GLFA 2XCQA 4GYWA 3D2BA 4M0DA 1PJ3A 4OF4A 1XAJA 3RS7A 4PAOA 2V5UA 1T0IA 1GKIA 1A0OA 3DZIA 4JLWA 1ORIA 1JAZA 3G0GA 2BTQB 4H3HB 4JBYA 4JVNA 1FLAA 5LP6A 4QVIA 1I2ZA 4JITA 4Y2YA 4GRAA 1YCHA 1Q6YA 2UYYA 4EY5A 5JNWA 4B4KA 2FNAA 3SQXA 1ZP6A 1FS5A 3GVIA 3PT5A 4DWOA 4KO4S 1TTPB 1RJDA 1ODJA 4HATA 4U6QA 2V96A 2ANCA 2BGNA 3CS3A 5DW0A 4L50A 3TH5A 4ZHQF 2QSUA 1EAYA 3PGXA 4JLUA 1A50B 1K06A 3BGSA 1TJ5A 2G3YA 4JT4A 4MR8B 1GKLA 3AWDA 1YR8A 2X1LA 3JWHA 3R3YA 4PAGA 4RVNA 1LW7A 3NS7A 4UNNA 4YCNA 3KQNA 3LZDA 3F7OA 1ADCA 1NKVA 2AUMA 3GXOA 3U7IA 3WB9A 4ZK2A 3KALA 5D5QA 1N2SA 1GL7A 2X4DA 3REQA 3NDPA 1PZHA 5TLSA 2DQSA 3BGWA 1AO3A 4Q7MB 1Z2OX 2OO7A 4DWVA 5C46F 4HLDA 1XDDA 4I6GA 1L7QA 1E3WA 4V3CA 5B6JA 5CBKA 3LSTA 4FHFA 2G1KA 2CLMB 2WIJA 4RVUA 3BN3A 1EGAA 1QG0A 1YMQA 3GDWA 3QWIA 4GHWA 1GFSA 1JU3A 1ZRNA 3NCTA 3RODA 4CMEC 1UBSB 5CVUA 4E5NA 3J81k 3ETGA 2FU5C 3RSLA 3OE7D 4OUDB 2D0IA 1N33B 3W4JA 4WBNA 4B3DA 1N8NA 1S2GA 1XNJA 2JJQA 1T9HA 2XTZA 2X9LA 3LKZA 5TB5A 4ARZA 2AMLA 1EE1A 3GP5A 5EUCA 2WMNB 2YQ5A 5ESWA 3B12A 4N5LA 3HKEA 3IEKA 4TT3A 4XOIA 4DDKA 4RTQA 1ZW1A 4FS8A 2VS1A 2P6UA 1QVZA 3QELB 4KZPA 4MV7A 3T12A 1EK0A 5DOZA 2O2SA 4HGRA 4EB6B 3WDLA 5BVGA 1EK6A 1FQWA 4XUEA 4BQEA 4YCLA 1YFJA 4IRXA 4LMRA 3V4ZA 1ODTC 2P7HA 3VPFA 3DHEA 1N0WA 1R10A 4XYBA 1GTG1 1Z33A 4YRPA 2C8KA 1ORHA 2RARA 2V7PA 3IV6A 1MV8A 1C3OB 5FUWA 2FPWA 1SA0B 1LX6A 2E48A 2QRVB 4QTXA 1IZZA 1I8TA 1G9XA 2ZT8A 3DWFA 5LQMA 4KMOA 5DHAA 4Z2YA 3W2GA 3HY3A 3BVPA 2WFAA 4XWAA 1M73E 3VR2A 4CF3A 3J81A 1L9KA 3WHPA 1V8BA 2P5SA 4QQRA 5CG2A 1RJ9B 1KDPA 1Y8QA 4AZSA 1N36B 4LG1A 1KEVA 1V35A 4CLEA 1HPLA 2F00A 4FINA 4NJEB 3HLKA 3TE7A 4YRFA 1J0EA 3UA4A 3A1CA 1EGQA 5CX1A 3EMDA 2P9EA 1LF0A 3N2ZB 1MRSA 1QRSA 1E62A 4L9WA 3T95A 4QGGA 3AVUA 3AL3A 1TMOA 1G21B 2UZIR 1RWPA 1MMFB 3M34A 2CBXA 2FG6C 2GGSA 2Z1MA 4Y1RB 2GHQA 4A1OA 4CPDA 4QT4A 2O2JA 4ECEA 1WZNA 4WFQA 2DBQA 3OIGA 4GSLA 4UE6A 2J5QA 2XOXA 1KVUA 4N0DA 3NFYA 5HM6A 4HB0A 4HTAA 4ER3A 2BFAA 3FVRA 1PHRA 3TRFA 1SXPA 1NYRA 4PZYA 3WLMA 5A9RA 4GPAA 1IHUA 5EKSA 1KDZA 4PRYA 3NWBA 4GXQA 2ICAA 4I6EA 4P4UA 4KX5A 1ADYA 1DI0A 2CZGA 3P5SA 3GNQA 4LOKA 3NVKI 5JCZA 3AXSA 4WESA 4DIEA 2JLQA 3D6HA 4F3CA 1TTTA 4L5IA 2XYGA 3A7EA 2GQ0A 3HYTA 3ONEA 3C6KA 3JQBC 2IDZA 2X42A 3T5AA 3TQFA 3E9CA 3VKVA 3OBIA 4BATA 3BERA 4HNQA 4BDTA 4COOA 2VUUA 4GEGA 3H6GA 4QO8A 2JVIA 2J0EA 3DC7A 5J43A 3RSGA 4ENQA 4B44A 3CF4A 1Z4NA 1RE1A 4GFDA 4DCVA 1HM5A 5SICE 5C1BA 3LTNC 4NCBA 1KI3A 1YK0A 2CXSA 3K73O 2YOFA 2XBMA 3QVVA 1FDUA 3FDJA 2UVQA 1NZFA 3QSYA 4MKRA 2WTEA 4PANA 1T4MA 5DN6A 4KIGA 3G9TA 4LSGA 3I61A 4OSPA 5FI1B 3EXFB 1Z0AA 2UU9B 2IXEA 2ZJ1A 1C4XA 3BF7A 1U2TA 3H5VA 3QF4B 3ILVA 1RHJA 4B8WA 4O2BF 2OHGA 4LSZA 4R1TA 3ET4A 5EWLB 2DCMA 2CXUA 3GRRA 1O95C 1S89A 3HVUA 3IIJA 4BZWA 3IBFA 1Y3CE 4DS3A 2WUDA 5D1NA 2OXRA 4W8OA 1EVZA 1RTTA 4OI2A 3T4XA 2F3TA 2JGRA 1UOOA 1DG9A 1PR6A 3RYFA 4LYHA 1DJPA 4MB0A 3RU9A 5HBRA 2OEPA 1VIYA 2PWAA 4J43A 1GZ3A 1M3SA 2GEDA 1G9TA 5I7OA 2H08A 3BSYA 2NZ2A 4A2WA 1SUWA 4XUDA 2PKXA 5GM2A 2QLBA 4X6UA 2EGGA 3WLHA 5C37A 2FX5A 1L7NA 1JKXA 1YHNA 4EHNA 1H3NA 4EO7A 1E3MA 1U5CA 3LFUA 1TUBB 3K0SA 3MWEA 3H5NA 2IH5A 1J2RA 1TRHA 3CH7A 1FFXA 2J07A 2R60A 3UB3A 4CFSA 1PEKE 2IYXA 3L79A 1SIOA 3NPAA 3HO6A 4OM7A 3VR5A 5DI3B 5JDCA 3UT5A 1EDDA 5IS2A 4WNAA 3JWEA 3DMYA 4W6QA 4ZXFA 4OQZA 2J3EA 1PS9A 4KP7A 5M7EA 3I37X 3Q7EA 4R9RA 4U2KA 3UJDA 4FE3A 2X5OA 2ETVA 2F4NA 3JASB 1MOZA 1L8XA 3JR7A 4K6MA 2OD9A 3ESDA 1S2LA 1B76A 1QYCA 2JRLA 4MS4A 3T3GA 3V1YA 4BB0A 5CNMA 1GQRA 1UWCA 2BEJA 4JU9A 5FI3A 1RNLA 3IMGA 1MNQA 3JQ9C 3I04A 2JNWA 3ZXIA 2WHPA 3DBLB 3FSGD 3O31A 3I9V1 4NV1A 4QUGA 4EB3A 2HU8A 1K4MA 1MJNA 2D3TA 1E64A 2WTMA 2YMLA 3PQ5A 2ACWA 1QZTA 1QMPA 5AKZA 3ZKWB 3LV8A 3LYHA 4DSNA 3OQMA 1I3MA 4JI4B 3F3YA 3I2YX 1J07A 4GPIB 4JWTA 4HDNA 5LB2A 2P1ZA 2GSWA 4OU4A 1XXHB 1M1YB 1RYMA 4DMUB 4FOOA 3JAWB 1LSSA 2B36A 2D1YA 5CNKA 3R74A 2RB4A 1M8JA 3F2IA 2F3QA 4DLVA 1JGTA 1OFGA 3PC2A 3WIEA 4B17A 4Q16A 2C4VA 3RB8A 3RVMA 4TTQA 2PZGA 3C14C 3W2HA 3S2EA 2COUA 4BNNA 3ROXA 2QAIA 3G7NA 1E0SA 2Q3EA 1N7GA 2VK2A 5DEIA 3ZE7A 2IHBA 2BJWA 1CQXA 2G25A 2JHFA 4JYZA 4QLOA 4IJVA 4AJIA 4DJAA 4EHAA 4RTNA 2YHUA 2OCLA 2YWBA 3G0IA 2H4YA 1CTQA 4LOJA 4ZYVA 1W94A 1KY4A 2DUNA 3BIJA 4J2TA 2Q5OA 5AT1A 1OWLA 4PBRA 1LBTA 3I2HA 3TUIC 1H4VB 3TSYA 4CT0A 3OO0A 4IG9A 3BQMB 4YO7A 4EH1A 5FTMA 3F1KA 1KVSA 4QYTA 3VUEA 3TBKA 3GFFA 3TB4A 3VAZA 4Z4QA 1TAGA 3LQ4A 2JBWA 4I1UA 1V1RB 1JFRA 3MYRA 1U8XX 3JALB 5ALRA 3PC3A 4NENA 1Z6GA 2G1AA 2W2TA 2WUGA 1S8NA 3BA6A 1CJMA 1L5VA 1EM8B 1ETUA 1KI6B 3HR8A 4AJEA 1EKXA 1XTRA 1GAQA 4S1NA 2X0RA 4DUGD 2IV3A 1W4ZA 4WVFA 2FRXA 3DOHA 2GN1A 1UODA 4JC0A 1LZLA 4D4IA 3ECAA 4DDUA 3U3RA 2I71A 2GESA 5I7VA 1RFLA 3VXKA 3EIFA 1V41E 2VJYA 2ZR0A 4E2ZA 4I1OA 1ZNWA 2Q3BA 3W8EA 5K0CA 3L0OA 3GVPA 3O2JA 1IUPA 4G81A 3DEFA 2PD6A 1KI4A 3A1NA 3QUAA 3QXSA 4ZKEA 3MZ0A 5LLSA 2O2ZA 3SC6A 3WIBA 5JR3A 2FFQA 3E9NA 5TPWA 4MH0R 2PJDA 1N9GB 2F2TA 5AJYA 1VE7A 4BN4A 5IT9A 2D54A 3AETB 3RU7A 2M98A 1NVUQ 1L5QA 4IH4A 4RUKA 3NB0A 4YECA 1GRVA 4KVZA 2EFJA 4X1IA 2UXCB 2DT5A 1BRTA 3T7DA 2R7LA 5CA0F 1ULHA 2J85A 4R8MA 4CQMB 2FUG1 4QBGB 4AMYA 4EHBA 1A96A 3DNFA 4AWXA 3CR7A 3EZ2A 1YB7A 4OBBA 4P31A 5T5QA 1SXJC 2CVHA 3BZUA 4FDVA 4OMCA 1EFPB 4OCZA 5AUQA 4M9SA 3B1WA 4UZFA 1T2UA 2A9FA 2DTEA 4FD2A 1DTWB 1E2NA 4C3OB 3LHFA 3KT0A 1UJBA 4FYIA 4DCUA 1C29B 4EB8A 3QNUA 1J0AA 5EP1A 1XKLA 4ZVKA 4ETIA 2HU7A 2TS1A 4X20A 3OIYA 3TIIA 2XB9A 5TEVA 1Q11A 4J4HA 1C30B 3MF4A 4MI1A 1F8GA 1Z4KA 5EN4A 5JADA 1CY2A 4MCJA 3FUXA 3RVKA 4TGLA 4HAUA 5C4GB 2HL6A 3AESA 3IMKA 2I66A 2CLCX 4KN5A 5BR7A 5ICGA 1N7IA 3ZVKA 1KJYA 3WAKA 2O14A 1WMAA 3VV2A 2EX0A 3BDAA 3PUIA 3FHJA 4CTMA 2R00C 1XCGB 2E6KA 3F6EX 1EVYA 1JQ5A 5DGXA 3J7AC 1Z6XA 2FMXA 4QQNA 3B1ZA 1DIHA 4XJTA 2YHSA 4JELA 5L7YA 1JZQA 1ULTA 2ZT7A 3X1WA 4F86A 5AXCA 1FFCA 1WJGA 2C3PA 1T2DA 3AHCA 4JL6A 3W6OA 2NO9A 4ZPJA 5DISB 3N0TA 3KSZO 3W3ZB 2QD3A 4JLKA 4I4TA 5F73A 4IVQA 3MINA 2VDWA 3FW1A 2BOVA 3BWXA 3MLAA 1YB1A 2DWQA 1R8XA 1YZNA 2GSDA 2FPIA 3BCSA 4WA7A 4X9XA 4H7HA 1WETA 1ZHOA 3OIVA 3H5OA 1IZ7A 4CQNA 1A95A 1CUVA 3LHIA 5BWBA 1T6ZA 4QRIA 3JQ6A 2R6DA 4YAGA 3JATA 4P7BA 5IC5A 2EGUA 3I72A 2OGTA 1NHGA 1AF4A 2ZRNA 5ECDA 5EP2A 4R1PA 1EA7A 3RU2A 1EG7A 3URKA 5I7EA 3FTEA 1WX1A 1FZTA 4J03A 1VIDA 1JLRA 3PUHA 4MUAA 4NU5A 1FTWA 4TWRA 4MWSA 3O4VA 3VISA 1F7UA 3KLPX 1RWWA 4BNKA 3M3HA 2VDUE 1TAHA 1R7RA 1C8KA 2YUTA 4GNKA 3LIPA 4RY2A 4FCCA 1HO3A 4RHUA 3EXAA 4AY6A 4X63A 2V6FA 3H2YA 4MROA 1J2TA 4KYVA 4WEOA 1WB9A 1FNMA 2UUCB 3E8MA 5KNCD 3AH8A 2B8JA 1KBZA 5FIUA 4GS5A 3I4CA 3ZKWA 2GK7A 3IO5A 2OZLA 2WVHA 2ZUBA 2HCJB 2ZDHA 1FYDA 3N2GB 1TJ3A 5JWRA 5JCOC 3HU1A 3KSUA 4D8UA 5B5SA 3ZDZB 5G41A 3GUHA 4RVSA 3DM5A 4BX3A 4OLJA 3BWBA 4RS3A 3II6X 1TC2A 3M83A 4PG6A 4Z0TA 1TPYA 3UPUA 5HQ3B 2B5VA 5FI0B 1KJIA 5KQRA 1NBHA 2HV8A 1L1QA 3ABOB 3L7MA 3GAZA 3COPA 3IEPA 2Q9AA 2VP2A 4R1OA 5AK4A 4EGAA 1E7YA 1ZHHA 1EJ0A 4OI0A 2KB0A 1OI2A 1T10A 2WWXA 4KK3A 4ERNA 4MUNA 3P96A 2AE1A 4PGFA 4OQEA 4E3ZA 3U4IA 4J3FA 3KSBC 2KLHA 2NVOA 3A28A 4HPWA 1MJFA 4LOAA 3UT5B 4A0HA 5JRZA 3PGVA 3FZQA 5KNDH 2N47A 4EYQA 1XD2B 3PQ8A 1ZCAA 1GNRA 1X0VA 2BC9A 2E4UA 2AT1A 2FPGB 3Q3IA 1UAGA 3WOHA 3UAXA 3FAZA 3VC7A 3DE7X 4P84A 1E5LA 3MWGA 1BAPA 4HNAB 4JU8A 4D6PA 4N01A 4W7IA 3IJ5A 2H7XA 2UXDB 2IUYA 3HY4A 1KOGA 4ZAVA 2DFDA 3FVQA 3LCVB 5IZCA 3T3DA 2HYDA 4II3A 3EVAA 4BQRA 2GYYA 3OCZA 4E5PA 1NBEA 1Q0LA 4UDOA 4NBTA 2J32A 3NHYA 3QXCA 2R6CA 3IELA 2C4MA 2JFFA 4J0GA 1P1HA 2F3UA 2JLZA 2Q6VA 3GCZA 1RZRA 2BHLA 5JAHA 4Z49A 7ADHA 3D31A 4GICA 1JPUA 1V2HE 2QP9X 4UDXX 4KQGA 3LO8A 3ZOKA 3GB9A 3SAJA 4JH0A 2R6GA 4AZVA 3MJEA 2ZSFA 3E3LA 3BJIC 2IBSA 1OGIA 1IN5A 5FKJA 2I29A 4HPXB 3MJCA 4BU1A 2H4ZA 5KOHA 3OC0A 4FYHA 1QUEA 3P27A 2FPRA 2XGGA 3NATA 1PGOA 2OAP1 1RVV1 5E6RA 3R3VA 5CA1B 5IJ9B 3NYRA 2JAOA 1BMDA 3KKLA 1L2TA 5LP6C 3H1TA 1V7CA 4DLAA 3HKDA 1FFHA 2IEBA 2V7QA 1DELA 3C6MA 1MW8X 3E7DA 3JVVA 3GFOA 3K72B 3LK7A 3TIFA 5COBA 1SK9A 2A9JA 4BKOA 1DWPA 1SHLA 2CLSA 3IDQA 4CRWB 3JX9A 1FDVA 1XELA 3RSZA 3KQKA 2C2XA 1NOKA 2QZZA 2QLMA 2XY4A 4EEXA 4Z4GA 3PXXA 1WXHA 3AEUA 4J1SA 3KOMA 4S1PA 3H2ZA 5GINE 2H2FA 3HDYA 4DMLA 1KDOA 1XRJA 3QXXA 4BP8A 1JT9A 3H9QA 3KIPA 1E2DA 1RKBA 2X19A 3BE5A 2VRCA 1DRVA 1DCKA 1QB8A 2G7MC 2VPQA 4IO0A 2PX3A 2ZIXB 1BXGB 3FLMA 3GA5A 2FVXA 2YOHA 4I4LA 2IYSA 1SIUA 1E4VA 4KRXA 3TZ6A 3M89A 4LHXA 5DASA 1WDTA 3HM9A 2OC9A 1YZFA 4FMBB 3EZ9A 4QODA 3ROFA 1JRLA 2LE0A 3I8SA 3CRW1 4YV0A 1QGYA 4F71A 2OCBA 4X3CA 4CDMA 4YRBA 3CLRC 1WUYA 2NLOA 3V4OA 4B6OA 3RFCA 2GN6A 4KXYA 2ID9A 2N75A 2JH3A 1L5RA 4RVGA 3A3YA 3DD1A 2HA6A 5L3QA 1NPTO 1FFDA 3KTDA 3L8FA 3HWX1 1ZC3A 2JATA 3AHEA 3PBKA 5JY1A 2QR3A 3D4PA 1PP4A 2ZTUA 4GKJB 2YDXA 4P80A 3UK7A 1UFOA 1VIAA 2R48A 2FWPA 2EL7A 2PBFA 3ASUA 3A05A 1F0PA 2VHJA 4G0OA 2WJIA 1GAJA 5KWEA 2ZUEA 1UJ2A 2D2FA 2B6NA 2BEUA 2VP5A 3GLUA 3UUGA 1T9AA 5I7UA 2DP4E 2VAVA 2Z3ZA 1D2MA 4LCBA 1ARZA 4EWLA 5A4JA 1A97A 2E6UX 1A7KA 4LDAA 5AVZA 2PUFA 4R98A 5TGZA 3QVWA 4ER5A 3A6LA 1QC5B 4XIGS 3KB2A 5A5FA 2AQKA 3KJEA 4IIEA 5A6SA 3GEPA 4OG2A 3BHNA 3NV7A 1O4WA 4IXTA 3UOWA 3HJHA 4UBNA 2RIRA 4G0QA 2VDVE 2GVZC 3C8UA 2LCQA 3BUSA 3VYRB 4BNFA 1D07A 1E8MA 2NO6A 2VXBA 2LW7A 4PYMA 2VPXA 1RABA 4WLVA 3ZHRA 4B9AA 2XWBF 2AQ8A 2DSNA 3EMKA 3I6ZA 4FEGA 2D6FA 1RAEA 1EQ2A 1M8KA 1V8OA 3QNWA 2I4MA 2V97A 3DZJA 2A5YB 1SHTX 1AE1A 1US8A 3G0CA 4WZAE 5DDIP 2OHXA 5AUNB 4Z6KA 3G2NA 1E3WB 3BFXA 5A9TA 1KJ8A 1NBMD 1DT5A 4DOMA 3PCXA 3EVZA 4K6KA 3THOA 1FW8A 2C4HA 5EYPB 2J59A 1YK1A 1X7HA 4QUKA 4OFZA 4F5DA 2NN3C 1COZA 3WIOA 3U3DA 5AKKA 9LDTA 4Y2PA 1HDGO 3DNPA 1DINA 1IRXA 1OYVA 3L7JA 4WEQA 4R7TA 4XD7D 5AM3A 4YV2A 1P7CA 2HIHA 2Q2QA 2GD2A 3TXYA 1W7AA 1NVFA 4L3VA 4TV8A 4FB4A 3TBFA 5BPHA 5GIOE 521PA 2H5EA 2EFCB 3KG2A 3D2CA 2BISA 3D6FA 3MBOA 4KI7A 4QU0A 4UBIA 2F4VB 5I5GA 3GNLA 4MQ4A 3PNOA 1S01A 1E94E 3OHPA 5K51A 1F1JA 1USUA 2L82A 4LDNA 5FHQA 1T29A 3RJTA 3IEUA 3V33A 4NU6A 1UC9A 3ZIDA 2HBQA 5C5IA 5CPBA 1CY8A 2XA9A 3TRKA 1A8PA 2BFCB 1FOEB 1XX6A 3PL1A 3VHQA 3PQFA 4EL5A 2HDOA 2QXUA 4H2DA 3V8QA 4V0LA 3OT1B 4BTEA 4CIWA 1M8PA 3ROQA 3TMKA 2OXTA 3AY3A 3HBJA 3ZI4A 4S1OA 5B6PA 2HO4A 2ZRBA 1BS1A 1SKAA 4O4LA 4QREA 3OOSA 3WX0A 3V1KA 4HGZA 3LT4A 1JH8A 3K5WA 4QSMA 4PFQA 4I3HA 3GH3A 5EZYB 4ZDIA 1C81A 1IATA 3ZHCA 2WWYA 1AUOA 2KJQA 5CT5A 1LPPA 3KTAA 4C06A 2WM2A 4GBGA 4CCYB 1RLIA 2D1FA 4ERXA 2WPDD 4KNYA 1M0TA 2DPXA 1YA4A 3NOQA 3QE3A 2AXNA 1ISHA 1CX9B 1A8HA 1X1DA 2V74B 4L16A 1NXPA 2PL3A 1Y6ZA 2OVFA 4DLLA 2Q3LA 3T35A 1UPFA 4ZVRA 3EIWA 1UDWA 1C50A 2ZYIA 3W9BA 5HX7A 2QNIA 4RCVA 2QM3A 2PA3A 2R97A 5KUTA 2JF0A 2QT0A 3EXIB 1VCOA 1BA2A 2B25A 4JLDA 3IAS1 1I6LA 4NE7A 1HFKA 3L7YA 4CMGA 3HKBA 5F2OA 3FPAA 2ZE6A 4R5MA 4PTLA 1ISIA 2CUNA 2WU3A 4YRTA 5KO2A 4CE6A 1D2RA 3O4RA 4UTXA 4F5ZA 3EQ9A 1SGWA 4DTCA 1FUUA 1ZSNA 4K81B 1CR2A 2BCGY 5ARCA 4YJ3A 4DQLA 1VFPA 4ZDWA 3RH0A 1V0JA 2PQ6A 3GBPA 3OOEA 5B55A 1T5DX 1G63A 1PRYA 2CN1A 2XNCA 4C1BA 5K6AA 1L7BA 2IHKA 1JR6A 1DAFA 1N8KA 1BHQ1 3AY6A 3L1VA 4KQEA 1ZUNB 4QYSA 1SELA 3I9OA 1T0UA 1IUNA 1CK4A 1SURA 2RHWA 1JWAB 3CISA 3VYTB 1Y33E 3UBTA 1PR4A 2NZ8A 2ZVPX 1Q5PA 3KOUA 3N2IA 3IJRA 5JW6A 2JLVA 2PBLA 4L4YA 3ESBA 1TKRA 3ZH2A 3SDSA 5EWLA 3VNSA 1JIQA 1OJLA 2VTDA 4M4SA 2ZUVA 4OXYA 4R16A 5EKTA 3BL6A 4X1KB 4K05A 2VP0A 4F5EA 2FFHA 1UKBA 3KAKA 3NTOA 3R6WA 2ZRGA 2SCUA 4LXHA 1LPMA 3W5SA 2YW2A 5CDSA 1KMMA 4BX0A 3BK7A 3JQFC 1SIWA 2WWHA 4B6SA 2OV6A 2WT9A 4LYGA 1WU8A 1EE2A 4MKIA 4URYR 4HDKB 2YZNA 2H1VA 1XA4A 1IWBB 5DLYA 1D0IA 5HJ2A 3VDNB 4R2MA 4DCTA 2ZM5A 4C2UA 4MR8A 1E1LA 2OE2A 1A7JA 1M2JA 4PHFA 3LGSA 3V55A 1N2HA 1GPUA 2IXTA 4V2IA 2WE7A 5JROA 3O1LA 4NENB 1JVSA 5BV1A 4JDPA 3TR6A 3C1UA 1FPMA 1HFWA 3GH1A 3VSBA 1RU3A 3LWBA 3QXHA 1BWSA 1O4VA 2JGNA 2RHGB 4S0ZA 1SRQA 2X8JB 1MV5A 1QVVA 1KL7A 1N5RA 3OQNA 4QATA 1ZICA 1O94C 2YJ4A 4HGOA 3NETA 5ALEA 1LWNA 2XMPA 4WTOA 1JZSA 2VAMA 2ZJ6A 5B4TA 3RS3A 4H1WA 4RSMA 3DXXA 1OT3A 2O3JA 5BV8A 1G8AA 2HO5A