3N2IA

2.25 angstrom resolution crystal structure of a thymidylate kinase (tmk) from vibrio cholerae o1 biovar eltor str. n16961 in complex with thymidine
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
208
structure length
206
Chain Sequence
MNAKFIVIEGLEGAGKSTAIQVVVETLQQNGIDHITRTREPGGTLLAEKLRALVKEEHPGEELQDITELLLVYAARVQLVENVIKPALARGEWVVGDRHDMSSQAYQGGGRQIAPSTMQSLKQTALGDFKPDLTLYLDIDPKLGLERARGELDRIEKMDISFFERARERYLELANSDDSVVMIDAAQSIEQVTADIRRALQDWLSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Thymidylate kinase
publication title 2.25 Angstrom resolution crystal structure of a thymidylate kinase (tmk) from Vibrio cholerae O1 biovar eltor str. N16961 in complex with thymidine
rcsb
source organism Vibrio cholerae o1 biovar eltor
total genus 83
structure length 206
sequence length 208
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2010-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3n2iA00
2GJSA 1MV5A 1W1WA 2J7PD 4B71A 4KJZA 3AVWA 4RZXA 3EARA 4MDEA 4WZBE 2J0VA 3IHWA 2H8KA 2GJ8A 2PH1A 1ZNYA 2X8AA 2CHVA 3K8YA 4JYCA 4DBLC 3P27A 3EC2A 1TU3A 2RGDA 2CL6X 3EG5A 4Q7LA 5HCIA 4A4DA 4Y0AA 5JWOA 5JWRA 4Z51A 5CJ2A 1G3QA 2GA8A 2A2ZA 2H1LA 2PT5A 2QBYB 3IPXA 5F3WB 3A1WA 2FH5B 4PHHA 2XX3A 1E2KA 1W4RA 4O2LA 4P0TA 1NKSA 4Q4AB 2OCAA 1WF3A 1LVGA 2AKYA 5JEEA 1G1MA 4M2LA 1S4QA 3AKDA 1KDOA 3R9WA 3RRNA 3TIFA 3N2IA 3OF5A 4MGZR 4DDWA 1XEFA 1XZPA 4RD3A 5EXPA 3A4MA 3GJ7A 5FPTA 2J0UA 4W5JA 4UXJA 1R4AA 2ZU6A 3T1QA 1AA9A 4Q4LA 2A5DA 1DO2A 1XTRA 4M1WA 4D4JA 4JZKA 1IONA 1T0HB 1XD2A 5FTNA 3QG1A 2ZPTX 4TT3A 4D81A 3THXA 2GILA 2UZ3A 2GNOA 2R9VA 2HLDA 2WBLC 4FCWA 5H68A 1GSIA 3Q8XB 1UEJA 3DMDA 4DCNA 3SI7A 4HUQA 4PPFA 4BQSA 1FMLA 3CPEA 4LJAA 1Q20A 1ZU5A 1TEVA 2BBSA 4NCIA 1II8B 2VP4A 1NRJB 1VCMA 3C4JA 1ZIPA 4XD7A 1TL7C 3MWJA 2B6HA 4OK3A 2ZI5A 4IW3B 3T5DA 3TSOA 3EZ2A 5HTKA 3QSYA 2WJJA 4P4SA 1AM4D 2XZOA 1Q12A 3D7MA 4LPKA 2FSGA 3FKSD 3O8BA 1XZQA 4OI0A 1XCMA 2ORIA 5EE9A 1CU1A 4AKHA 5EQTA 2QMOA 2N42A 3T1VA 1J8YF 1E2GA 4BLPA 4GZMA 1EWQA 3CX7A 1ESNA 2BDTA 1W0JD 2V9PA 2ZSEA 3SJZA 3U44B 1BKDR 1XJ0A 2C9OA 1NIJA 1QHSA 4LHYA 2ANCA 2ZAOA 4U00A 3K70B 3HR7A 3RS5A 2JLUA 2HF8A 5JJIA 2GXUA 4KODA 4RFSA 3SFZA 1SVKA 2HJVA 2ATXA 4ILEA 2Z4RA 4QC2A 2XB4A 5LBIA 4M9QA 2EFCB 3EIQA 1F2UB 2YWGA 5CDFE 3OHMA 5AJZA 1KI4A 3CRMA 1YR9A 1P73A 3UPUA 3QF4A 4US2R 2ANBA 1E2HA 2QSYA 1OLOA 1US8B 3W5IA 3P20A 3FTQA 3PCRB 4GP6A 3ICQB 1LTQA 1LFDB 3F5FA 1E98A 2GK6A 4V0NA 3ZVRA 3GLHA 3UG7A 3OESA 2BBWA 4FXPA 2IF0A 2FU5C 3QOFA 2D2EA 1ZCBA 1BIFA 4TYWA 1VIAA 1G291 4OJQA 4C0KA 5BN4A 1OFIA 4M1TA 1KO8A 3RNLA 1Y63A 2A3RA 3B6EA 2AR7A 4MYHA 5C4MA 2BMJA 4C7OB 4F92B 1G17A 3N70A 1GL6A 4G1UC 2ZSDA 2ODWA 4P3YA 2ERXA 1W36C 3WRXC 2GF9A 3K0AA 5DLQC 5M04A 1CEEA 2D4HA 4D82A 2PL3A 4JLBA 3HR8A 5FTMA 1DELA 1KK3A 1P61B 4LJ5A 3S1AA 3C5HA 1VG1A 3LWNA 1A2KC 1RRCA 1BOFA 2W6JD 3EZ9A 4C30A 4US1R 2F43A 1T0JB 1E1QA 3TNFA 3AVVA 5FL7A 1VYTA 2DYKA 1NVVQ 4W9MC 2WAYA 1R8SA 2NTYC 2G9NA 3TK1A 2FEMA 2QEQA 3U61B 1J2JA 2F55A 2R62A 4JJZA 2ZJ5A 1CR2A 1FL9A 2ZEJA 2KB0A 3D6TB 4KU4A 1LF5A 4YMWA 3CNOA 2OFOA 2GAOA 1I2DA 2Z43A 5CYOA 4QFMA 4TL7A 1OB5A 2BMEA 1ZC4A 4ZIRA 2AD1A 3W3AA 2GEDA 2DWOA 1F2TB 1X8JA 5B64A 1R7RA 3PITA 3EX7C 4LHVA 5JHGB 3KQNA 2KBEA 2PZGA 1M7HA 2PLFA 3H84A 3LBHA 1VCNA 2FFQA 3U3RA 3OFNA 4TSFD 2ZJ2A 1II9A 3T15A 1KO4A 3K0CC 2QP3A 3QQ5A 1S2MA 3K0SA 1KK2A 3A8TA 5DN6D 4DLUA 3NXSA 2GEUA 4Q18A 4XTCS 4BLTA 1NN1A 5KTYA 4W5WA 3QKUA 3I3SR 2WWXA 3ZIAA 1T8TA 4K46A 4N0EA 5CK5A 3I5XA 3X2SA 1GWNA 2LKCA 1X1SA 5GJVC 4XOIA 2W0MA 3EPJA 2YYZA 1OV4A 2QL6A 3SHFA 2RAPA 2IXEA 5BW8A 5CIQA 4D6PA 3GLFA 3RRYA 1S9HA 3IO5A 1KK0A 5BN3A 5LD2C 2XXAB 1G7CA 4B3BA 2AN9A 1R10A 3ADDA 2WSSA 4KLZA 3U3KA 2CVFA 3F8TA 3PFIA 4DIEA 3HPRA 1UF9A 3FWYA 3EAQA 3TUIC 3MFYA 4AKGA 1Z0AA 4LK2A 2AWNA 3D31A 2QN6A 5FTJA 3LRPA 3CRW1 2HT1A 1ODFA 1C4OA 2CHQA 1EX6A 3BH0A 3K0FB 1XMIA 4NCJA 3AF2A 3U7EB 4F4JA 4TLEA 1I4LD 1NVXQ 4U02A 3A6PC 4YMVA 3U3OA 4TYQA 4CEIB 1BYUA 2GJAA 1ETUA 1KI6A 1R0ZA 1Z6TA 2ASEA 3BB4A 3VU9A 2J0SA 1WBBA 2B8WA 2GCOB 3FVQA 3DM5A 1DPFA 3ZD6A 2FFAA 3AF3A 5KSYA 4NZYA 1VHTA 1CJKC 4NCKA 4D0NA 4RFVA 3MUFA 2PT7A 5FPYA 5DI3A 1OH7A 2B8TA 2O8CB 4M53A 4O3MA 1NG1A 2ODEA 4JVSB 4EFLA 4O25A 4URWR 3PQCA 1MR3F 2QP9X 1AJEA 4EQ6B 4OI4A 4IOLA 5FBQB 3W6NA 4HLDA 1XMJA 4DC9A 3BXZA 1TF2A 3CPHA 3K0CA 3PV0A 4ZCIA 1QBKC 2IYTA 2C99A 2AWOA 2RHMA 1JXMA 2VHQA 2ZREA 4Q1DA 1JR3A 3TUZC 2IS2A 4Q21A 2OE2A 4LHXA 4US0R 3M0EA 4MQBA 2TMKA 2X2FA 1R0YA 2V1XA 4ASUD 121PA 2MSDB 3A37A 4QOSA 3UATA 2QTFA 5A4JA 4CZ2A 4U5XA 4KSCA 3WRYC 2JIZA 4EFNA 3RABA 2CJWA 4RCZA 1HT2E 4X8LA 1PZNA 3AGPA 2ZRJA 2JDID 3I62A 2YV5A 2DPXA 3A1VA 3PIRA 1SGWA 4JKYA 4WW0A 3X1XA 3B1ZA 4IOJA 521PA 2D7CA 3GLIE 2PX0A 2KI5A 4YXWD 1YZUA 2BHRA 1MABA 1RE0A 3BFXA 3LFUA 3KQUA 2PZFA 1OB2A 1P62B 1CKEA 2PBRA 1CBUA 1XEWX 3AKYA 4BRWA 1KDPA 1U2RA 2XNDD 5FUYA 3MLEA 2FPLA 1E4VA 2OSBA 3KQHA 1E1RD 2BBOA 3HWSA 4WOPA 4BLRA 5D3QA 4TYPA 3K70C 4C2TA 1W4CA 2P65A 4BFTA 2V7QA 3IHLA 4JLNA 2HXSA 1QHIA 4TTPA 5L8VA 1KMHA 1OHHA 3C7KA 3TR0A 1X8LA 5DNYB 5IK2A 2AX4A 621PA 2J0UB 4DJTA 2XOKA 1R5NA 1YR8A 1COWA 1CR0A 3PEYA 1P2VA 2EVWX 3AVYA 2YNMA 3ASYA 3AB3A 1CJTC 1OIVA 1G8YA 1XD2B 2CVHA 2IBMA 1CTQA 3U6KA 1AGRA 2GDJA 2WJHA 4LWZA 3L43A 1W49A 4M9SA 2B7CA 4V02A 4HUQB 3K09C 2J45A 3M6AA 3I4LA 2W2XA 1OKKA 4MRRA 4PO8A 1AS0A 3OIYA 4BASA 1WQ1R 1KJWA 4Z8YA 4YMSA 1HTWA 1IAQA 1J70A 1KOFA 3SEAA 4BFZA 3GLGA 1G20E 2CE2X 2JJ1D 4I4LA 1IN8A 3EASA 1GL9B 3L0SA 2WICA 1ZC3A 2JLXA 4DSUA 2RKOA 5CIWA 2QM8A 1A2BA 4G5OA 1U90A 4IOMA 2VYFA 4P32A 2OUKA 1FQJA 3MMPA 4KHZA 3PXGA 1CJMA 4BRUA 8OHMA 1Z63A 1Q44A 2P5TB 3LA6A 4QHSA 1L7VC 1G3IA 1T6NA 3WYAA 2W2VA 2KWIA 2VP0A 3C5CA 4B2PA 4RFSB 1DAEA 1G8FA 1FZQA 4OBEA 3X1ZA 5FOSA 5EXSA 3L8ZA 2CE7A 3MD0A 2X77A 4PC1A 2GXAA 4G5GA 1A5TA 1JQLB 2V6JA 3SJCA 1E0JA 4BWYA 4EKDA 3U44A 1W0JA 5TDHA 2O0KA 3THYB 1IOZA 1K6MA 3DZ8A 1OE0A 2IYXA 1KDTA 2J87A 2YC4C 5C46F 3CPJB 1NVVR 3CRRA 2IS4A 2WWYA 1AQUA 4IDNA 3QPWA 1NI3A 1T8UA 1RZ3A 2WJGA 2ZJOA 4MYCA 5KOYA 4ZDIA 2BJVA 3GLHB 4AK9A 4Z54A 3PVSA 1S3SA 2H92A 1N6HA 2RGGA 3SJBA 3C16C 1F2UA 4DDUA 3GJ5A 4QBGB 5KPDA 1G5PA 5FI1B 2QI9C 3CR8A 1CXZA 4HDOB 3U6BA 4CW7A 1JR6A 1LB1B 5H70A 1W7AA 721PA 1ZCAA 4GPTA 5B2ZA 3A4NA 1XTJA 1IJEA 1E2MA 3IIJA 3H4MA 3K09A 2Q0HA 1A7JA 4OI2A 4HI0E 1F60A 4QGAA 3ZZUA 3FKQA 1W0KA 3K0AB 2FJUA 5TARA 4HYYA 1EFTA 3TKLA 5DSZA 4RKFA 1Z6AA 2BOVA 2Z6VA 3MWLA 5JRZA 3QY0A 5SZIA 4D25A 4LC1A 1EFRA 2ZI9A 3DMNA 4PZLA 3TLXA 3AV0B 4PANA 4B43A 4H1UA 2F43B 1EFHA 1N6NA 2ZM5A 3SYNA 4MGYR 1CIPA 4HZUA 3QE0A 1TUEA 4BGDA 1YZTA 5FOUA 3AP2A 4IRUB 2ZJAA 2J7KA 4FWIB 2ZVQX 1UPTA 4C4PA 2XB2A 4JLDA 4DSNA 1HE8B 2BEKA 2WOOA 2ZE7A 3DHWC 3VR2A 4NDZA 3BK7A 5FUXA 4KV9A 2V54A 4Q1FA 4XSGA 4B6EA 1F5NA 1KKMA 3RC8A 1XBTA 4EPTA 4TMKA 3KKPA 4EPWA 4MKFA 1PLKA 3I1FA 1XB2A 4DLTA 1KGDA 1FP6A 2PLRA 4URVR 4ZIRB 1M34E 2D06A 2G83A 2XJ4A 3MGCA 4JVLA 2EYUA 2R65A 2WKPA 1P2TA 3NWJA 4B32A 1SXJD 2F7SA 4DB4A 2O8BB 4BEBA 1Z08A 1E2QA 4B35A 2WPDA 4G3XA 2CL7X 2VH5R 3B1YA 3IQXA 4RVCA 4DLXA 2WOJA 1HY3A 4FMCB 3QEJA 5EXXA 3EIEA 1S1CA 1Z5ZA 5FTLA 4GNKA 4OHWA 5J40A 4PHFA 4ITRC 1XX6A 2ZSBA 4NTZA 2EFDB 4Q4JA 3TW4A 3LX5A 3SDZA 1GRRA 2AFIE 1HT1E 2DWPA 4RZ2A 3E2IA 3UK6A 1EWRA 1ZW6A 4Q1BA 3FHOA 4JBWA 2WJVA 4CYMA 2IHBA 5BYJA 2ZRMA 3ZYCA 5KO2A 3Q7QA 2YWHA 1YRBA 4QJ5A 1AGPA 4NCNA 2J59A 4QBHA 1I2MA 5HKKA 1DEKA 3GLFB 2G77B 2VLIA 3NC1C 2PCLA 3RRMA 4DVGA 1H8HD 1MO4A 2D3WA 3A1UA 2GF0A 4S2EA 2XEXA 2FX3A 1YRAA 4DCTA 1N5JA 2VP6A 5EP2A 4B3FX 1D9ZA 3KKOA 4KO8A 1KIMA 3MWKA 4ZDKA 5EP4A 2IWHA 2FGKA 5JSZA 1YR6A 5IDVA 1L2TA 3ICEA 1JECA 4II7A 1NMYA 3IPYA 1E6CA 4JT4A 1IXSB 1AN0A 1JPNA 3PENA 2I4IA 3HYRA 2CNWD 5AJYA 2ZE6A 1NVUQ 3L8YA 1G6OA 1KI6B 2WVJA 5KYKA 3VU9B 2QG6A 4AURA 4OL0A 4UNQA 3BAFA 3VFDA 1XEXB 4BFUA 4GMDA 1UBEA 2A30A 1IBRA 2RGAA 1DARA 1VTKA 2QENA 1P9RA 5BWMA 2P67A 2QGZA 1HUQA 1U98A 4KFTA 2ZRFA 4Q00A 2ZRHA 3PEUA 4GRAA 2QMHA 5JWHA 4B2LA 4BFYA 5JZVA 5KDLA 1JALA 3C41J 5IT5A 1NBMD 2PJZA 2V8OA 4TMZA 4OI1A 2MMCA 4KFSA 3ZD7A 4B48A 4HAXA 4NL4H 3LVQE 3B1XA 1TADA 4H1VA 1G4UR 4KFRA 1W47A 3P32A 4DLWA 4OK5A 3U4QB 4PZZA 3TQCA 4TLDA 3OEED 2IXGA 4A0GA 1ZD9A 4L9SA 2NO7A 2WWWA 3T35A 2EU8A 1YU9A 4MGKR 1Z07A 1SKYE 4F38A 1HQYE 2AD5A 3R7WB 1CJUC 2CJWB 2ZSFA 3SJAA 4TMTA 4V0ME 1XWIA 3NH6A 1OH5A 4TYYA 3B2EA 1FX0A 3X1WA 4PAMA 1TNDA 4ZPXA 4BE7B 1RW4A 5L3SB 5K8LA 1ZP6A 3QBVA 4R71A 1BS1A 1XPRA 4PHTA 1ANKA 2AFHE 3FHTA 1MABB 4M9XA 2W6ID 3ONWA 1UADA 2VP5A 1GRQA 5SZJA 3FYHA 4PSKA 3RRZA 4A0FA 3R20A 1E96A 1TQ4A 3E1SA 4PC3A 3JZMA 1M2OB 2NIPA 3GFOA 1T5LA 3EWAA 1WB9A 4RY2A 4B73A 1KMHB 4OKSA 4AG6A 3KTAA 3MAAC 3CNNA 3QKRA 2XSZA 2JATA 1S1MA 1IHUA 1VG8A 2ZS8A 3TAUA 3WBKA 4PXAA 4AWXA 3KJGA 5CYPA 2OHFA 3ZZTA 2G6BA 2ZI3A 1U9IC 3RWOA 1E79A 4Y0VA 1GNRA 2HV8A 1MRNA 4CIDA 2GAAA 2GJKA 4CEHA 1KI2A 2A9KA 3K53A 1W2HA 4PFSA 3NEYA 1MO3A 4IVQA 1OXSC 2BV3A 2OAQ1 5FFMA 3I8SA 3UMRA 4LSGA 1Q1ZA 2ZIAA 3GFTA 1P4SA 2IHYA 5KU1A 3GLGB 3OIVA 3MCAA 1JEEA 2C96A 3EPKA 5KSZA 2BMFA 3QG5A 1KI7A 1JI0A 1TF7A 2IYWA 1Z2AA 3K1JA 4MRVA 4RD2A 4B44A 4B75A 2OBMA 4D80A 1JJ7A 4R98A 1QF9A 1VPLA 2GHIA 2JGNA 3THOA 3RC3A 1N0WA 1XJQA 1NG9A 1NSTA 4IDOA 2RGNC 4ABYA 4LUCA 1XXHE 3Q5EA 4DSTA 2ZS9A 3GEEA 1NLYA 5K8UA 2JJ1A 4XWAA 4Q5IA 3AKCA 4I1OA 1ZM9A 5HE9A 3FB4A 5BYKA 2H7VA 3A4LA 1W4AA 2AL7A 2OBNA 2ORWA 4LV6A 1DBSA 5C18A 4NYJQ 4TTQA 4JLJA 5KNCA 1FTSA 2JJ2A 2K5UA 1OXXK 4QNRA 5CK4A 5CDFA 1JB1A 1IY1A 1U94A 4JMPA 4MGIR 2PZEA 1M8PA 4A15A 4L5BA 1IQPA 1ZMXA 3F0TA 5EE3A 5GJCA 2XZPA 2IC5A 2C95A 2ZRGA 3WHKA 1I4DD 3DOEA 3P26A 4DZZA 2Q9BA 1FUUA 1A1VA 5FI0B 3THYA 3KL4A 3U7GA 1Z29A 2EQBA 1T3HA 2IEYA 2QZ4A 1OJLA 1O3YA 4OK6A 5EE0A 1WBDA 1CF4A 2ZYTX 1U9IA 5JRJA 1KI3A 5CLLA 1XPUA 2X2EA 5L3VA 4JLPA 1P3JA 4M1KA 1S96A 1SVLA 1AS2A 1DAFA 1U99A 1VMAA 3K9GA 3WMGA 1ZUHA 2QE7D 2B92A 1GVNB 2ZRDA 1G7SA 3BWDD 1L4UA 4TL8A 4ESHA 1EFCA 1G6HA 4G5RA 5CITA 2VF7A 1N25A 2ZRLA 1G18A 3ZS9A 4M1YA 1TPZA 3CW2A 3ASZA 1IM2A 4RD0A 3CH5A 1OPXA 2QP4A 3FFAA 3CF0A 3AEZA 4NKRA 4DUGA 4HZUB 5GVSA 3U7FB 1EGAA 2VL7A 1Z8FA 4RD1A 5SZKB 1WE2A 3MJRA 3OIWA 3X1YA 2NO1A 1Z0KA 3KQKA 3RDPA 1H8EA 2RGNA 4MRSA 3V4FA 5KPJA 1R5OA 1ZUIA 2FA9A 4I81A 3NTUA 2IX3A 4D0GA 2R6FA 5JS8A 3CX8A 2ZROA 3BBPA 1N3BA 4HAUA 1SVOA 2FZLA 5G40A 1P5ZB 4Z1MD 2REXB 3PUZA 1S8FA 4GBMA 5FUVA 4B47A 1GRNA 3KB2A 5TXGA 5LPNA 1G8PA 4DT1A 1PV4A 1AQYA 4UXHA 2CXXA 1W2GA 2ZR0A 2C04A 2ZRBA 3AF1A 1VCOA 1N6IA 2DBYA 2A5YB 2ONJA 2NMVA 4PQFA 1TUIA 4LY6A 1KMQA 4M4SA 5JJLA 4LC0A 3CB4A 4TL6A 1K8RA 3CO5A 2W83A 5HCNA 3DDCA 2XZLA 2H17A 4XJXA 2ZJYA 4HAYA 5ANRB 1XTIA 4Q4JB 3VHLB 2XJ9A 5E3HA 3CKLA 1XMVA 2GJ9A 2O8BA 1K5DA 1DOAA 3GJ0A 4PC2A 4QGHA 4S35A 5C1BA 3CNLA 1UBFA 1R0XA 1ZM7A 2QORA 2OZEA 2YJTD 4FMCF 5UKDA 4LJYA 1WP9A 2VSOA 1KJYA 3HP1A 2HDNB 4WA7A 3PEWA 3O8CA 2C9CA 2ZE8A 1SXJE 1G8HA 4QHYA 2IUUA 1ZYUA 4AC9A 3HDTA 4LV8B 2BM0A 1NLFA 5AJXA 2JASA 1SVWA 1Z22A 3HPQA 4YDHB 3TSWA 2J3EA 3VR5A 1NNEA 3Q3JB 3CX6A 5FR2A 1RVDA 1UM8A 1W4BA 5JSZB 2DFTA 3C15C 1E9FA 4BLSA 4BFSA 4OHXA 1GITA 2IYUA 3EA5A 4TN1A 4EFMA 1MKYA 5EE1A 2QQEA 2QU8A 2ODNA 2V55B 3NBYC 3PUXA 1E2JA 2ZS7A 1NY6A 2JLRA 3OAAA 4Q19A 3OEHA 2Q9AA 3QEOA 1OF1A 3LQRA 4I99A 4EUNA 3FHCB 1N5LA 1G3RA 4UJ5A 3QXSA 4EPXA 4GP7A 1Q21A 5G3YA 3UMFA 1TU4A 2IYVA 2VP9A 1CP2A 5G53C 2VP2A 4K81B 4KLNA 4A2PA 5JFGA 3O47A 2C78A 3SBEA 1XEXA 4AG5A 4PAOA 4M1OA 4CEIA 1JAIA 2IYLD 1Z6YA 1U8AA 2NQ2C 4NYIQ 2JAQA 3AKEA 3JVUA 1D9XA 3CF6R 2C03A 1NMZA 2QTVB 3KQLA 3LXRA 1GL7A 4GI7A 4Q47A 1CJVC 2CK3A 4E07A 4A0HA 1W5SA 2AXNA 1KTVA 4L15A 3UWKA 1GIAA 4XVUA 2J41A 1C1YA 2QPOA 1FX0B 2Z0MA 4KI0A 5LB4A 2ZRIA 3LLMA 1SHKA 3LAWA 3U4QA 2G0TA 1YVDA 1ZU4A 2IF2A 4TMVA 1X86B 1RC8A 5CB8A 1IY2A 1T3SA 1TEXA 3EW9A 1NBME 2B7BA 2Q3HA 1E2PA 1QG2A 4LBZA 1CRQA 3GLIA 1E0SA 4IFEA 3TBKA 2DB3A 2IEZA 3R7WA 2JLZA 3IBGA 2D74A 2F6RA 2AK2A 1E32A 2ZR9A 2HF9A 1KK1A 3W6PA 2WM9B 4B3DA 5L3SA 4MKGA 4WZAE 3LNCA 1BMFD 1DAGA 2VEDA 1PJRA 3B5JA 2BWJA 4V03A 2F1HA 1SVMA 4A6PA 1X8KA 3KTAB 4IHQA 1TTTA 1KO5A 4BFWA 3H1TA 2GEVA 4BLOA 4TZ6A 2C8VA 1ZJ6A 5FTKA 4C2UA 2GXQA 3QKRB 2W6IA 3PUWA 2BCGY 3FGNA 3BC1A 3GJ3A 2QUZA 5DGXA 2J7PA 4PC6A 3LVRE 4DCUA 2DHRA 2Q6TA 4LYJA 3ZVLA 3ZQJA 3KKNA 4HB2A 2GCNA 4DDTA 1QHYA 3W8NA 4NE2A 3U7HB 4KFUA 4ZI3A 1EG7A 2CCJA 4CEHB 1X6VA 4NYJR 1MT0A 1P75A 1LF0A 4DRZA 4CEJA 1E9EA 1QHNA 3L82B 1IN5A 4OHVA 2VHTA 4WXRA 4MDFA 2FPKA 4C0AC 2DFLA 1Q0UA 2Q3MA 4A92A 1OXUA 1Z0JA 1DTSA 5KHOC 3NBFA 1E3MA 2VHJA 4AI6A 4YMTA 2E87A 3DEFA 5JHHB 5KNDA 5A5GA 1BH2A 4LJ4A 3TJZA 5HZHA 3FE2A 2ZJZA 4LBWA 4IFBA 2OCBA 2RGCA 1FNMA 3BE4A 2YOHA 5FBRB 1P9WA 1SULA 3LD9A 3SR0A 1M7BA 3EIHA 5DIFA 3D8BA 4CVNA 3LXXA 4QM6A 1E2IA 3B60A 3KJHA 5JBQA 4HDCA 3W9YA 3SFVA 3RS2A 4BLQA 3W90A 2OT3B 4XH9B 1ZVQA 4TT3D 1KDRA 1GKYA 2N46A 4DEXA 3EPHA 2RH5A 4AYWA 2JLSA 2QPAA 5KNBA 1XTQA 2RGBA 4JL8A 3KXKA 1N6RA 3QF7A 2WMOB 2QSZA 3KKMA 3VHXA 4W5HA 3KZ1E 5L3QA 3O8RA 1OT3A 1NKTA 2W00A 4RKEA 4EPVA 3KJEA 3GP8A 4JIMA 3HU2A 1GUAA 5EP3A 4OQNA 4TZ0A 4UJ3A 5JJKA 4IXMA 4MH0R 4XD7D 3NKVA 5FUWA 4IKEA 2YWEA 2YOFA 3AVXA 3G0HA 2IS6A 3BERA 2NPIA 4JBXA 4ZO4A 3SU8A 3FKSA 1G64A 5K8IA 4PQRA 2QGNA 3BIFA 3PR1A 5KDDA 4GT1A 4GZLA 1E9AA 2FMXA 4LJ7A 3Q85A 2WIBA 3REGA 3B9PA 2JLYA 1AKEA 1GFIA 4XIGS 4BZPA 4EPYA 4MKIA 1TAGA 2C77A 3WYFA 5H8WA 3AH8A 2OXRA 1Z0FA 1UDXA 4UNPA 2R44A 1G3MA 4P4UA 3ADCA 3DPUA 4C0SA 1U0LA 1NSFA 2R2AA 2YC2C 3CBQA 2XAUA 5L3RA 3U3MA 4Q66C 5CM9C 5J4KA 1JEDA 4MRPA 4BZQA 2VF8A 3ZQ6A 2WHXA 2HXYA 3CUEF 3ZLJA 3R9XA 1ZNWA 1XD9A 4DLZA 1AZSC 4V0LA 1ZAKA 2OV2A 5B30A 3ADKA 4ARZB 1FOEB 1V5WA 1MRSA 2H16A 2J9RA 3B13B 5TMPA 1E99A 5HE8A 3SS8A 3ZVNA 3DKVA 5BN5A 2R6GA 1QDEA 1ZIOA 2CLCX 3M1IA 1N0VC 3T12A 1FP7A 1VYVA 3TVDA 1GM5A 4FMDB 4AIIA 1NN0A 3B78A 4LGMA 2V1UA 1HURA 3IILA 4HLQB 4TQAA 1UKYA 2ZRPA 1XDBA 3RAPR 2WSMA 2OLJA 1U0JA 4NH0A 2FOLA 1N6KA 2KSQA 3GFPA 1E2NA 3JZAA 4HAZA 4OQLA 5AUNB 1WCV1 4N3NA 1J90A 4OHYA 1J99A 3IEUA 4DLVA 3FMFA 4DT1B 4PPQA 2A7QA 1JNYA 3B1WA 3IO3A 3L0PA 5F2EA 1Q1QA 1U0HC 2QNRA 5C2JB 2MSCB 2W6JA 1LV7A 4LYFA 4B6FA 1IJFA 1E1QD 5FL7D 2CDNA 4FN5A 4YC7A 5E7JA 3X1DA 2QAGA 3T06B 3VX4A 1W48A 4LCBA 4G0NA 1OYWA 1QVAA 4QRHA 4KAXA 2QQ0A 1RFLA 2MMGA 1KKLA 3WY9A 1D2MA 1D2NA 1Z2CA 4DDVA 1T4GA 1T91A 2FWRA 4Q7MB 1A82A 5DHFA 2XNSA 3N2EA 1W5TA 4P31A 2AHOA 1G8GA 1EX7A 1P7CA 1GG2A 4ZCLA 4Q7KA 4PPNA 5JECA 4GFDA 4F91B 5JMTA 4D26A 2QA5A 2WJIA 3AVQA 3K9NA 4OQXA 4D2IA 1VDZA 1RIFA 1VCIA 4OJKA 2W0SA 4EIWA 4JBYA 1WXQA 2OFWA 3I73A 1HV8A 1PLJA 4AKEA 4HAVA 4Q9HA 4IDQA 3FMOB 4TSFA 2BEJA 4HB0A 3OFND 4F4CA 2WTUA 4O0MA 4EJSA 2R6CA 4O2RA 1KI9A 1IXRC 4Q1AA 4AYTA 4LYHA 5DN6A 2GTPA 3G82C 2V4ZA 1AK2A 1OIXA 4A1FA 2HEIA 3TE6A 2LWIA 3BH6A 1VIYA 2F1JA 2ZRNA 1NF3A 4GL2A 2Q21A 3ZIAD 4R2IA 4D4LA 3AF0A 2G0NA 3SN6A 4Q9LA 4BFXA 3QBTA 4F93B 3CLVA 1XTSA 1GNPA 2OG2A 1ELOA 1W36D 3V4RA 1QHHA 1XNJA 4YONB 4ZKDA 4D0LB 1DG3A 4ACAA 1PUJA 1SKQA 2D2FA 5DHAA 4PSVA 2Q3FA 2WSSD 1N5KA 1W46A 3AM1A 3KUCA 1FNNA 3WYGA 2F3TA 2GWHA 4MKHA 5B57C 2V6IA 1Z28A 1AS3A 1EK0A 1OW3B 2ZJBA 4D4KA 3FOZA 3WHLA 1G5TA 1SVIA 4E22A 5JCPA 1RPZA 1XEWY 3CH4B 3KJIA 1XJCA 2G1KA 1GKUB 2OFXA 2ZI6A 3BJIC 2QMUA 2FSHA 2N1BA 2CLSA 3WP0A 2XTMA 3O8DA 4FWTA 4K8OA 4TMXA 2A5FA 4CF7A 4GOJA 5EE5B 2KBFA 4B74A 3QKTA 2ZETA 1KNQA 3EA0A 3RSLA 4DLYA 1ZRHA 2ZSAA 2RMKA 4YMUA 5AUPB 3R8CA 1EESA 3N5CA 3VR1A 2ZYVX 4JT2A 3UWOA 2XTNA 1JXOA 2F3RA 3W8RA 3GLIB 1U8YA 3WXMA 4C0BA 1BYIA 3U5ZB 1S0UA 2FFHA 3IKJA 2VHUA 2O0JA 3KXIA 5FR1A 5K8TA 4JS0A 4NHOA 2O8DB 3ZJYA 1N6PA 3IEVA 1DE0A 1LNZA 2OXCA 4QKQA 1KO1A 2YZ2A 2WWGA 1OFTA 3BS4A 1JR3D 2P5SA 3PG5A 3VKWA 4WVFA 1R2QA 5F98A 1JQJC 2EFEB 3IIKA 4ASUA 4LJ8A 2WWHA 4XVQA 1XP8A 1YZLA 2PMKA 2F9LA 221PA 1PLLA 3QXCA 3IBYA 1S3GA 4TLAA 4HAWA 2IYQA 3NBZC 3Q72A 1JPJA 2JDIA 4C0HA 3PUVA 4JLOA 4TLCA 1G21E 4KXFB 1FPMA 1I4TD 4YQFA 3UANA 4RD6A 3RS3A 4LI0A 2IUSA 2WKRA 4YXWA 4DIDA 4CEJB 1T9HA 5GVRA 1E0KA 3MSXA 2R8RA 3LH5A 5KSPA 2XNDA 2CBZA 4BPBA 1BO6A 3U3JA 2BC9A 1WMSA 1E1RA 2QT1A 3H86A 3UXMA 3M4YA 4Q4HA 3VKHA 1Z83A 1HYQA 2MSEB 3JVVA 2WWFA 5EZ6B 1Z0DA 3DL0A 2R6AA 2V7QD 4NMMA 4Q03A 4LV5B 4B34A 1XMSA 2G3YA 1E2EA 3GQBA 1OFHA 2YWFA 4IVPA 1OHHD 4NP6A 5IK2D 2OEPA 2XOKD 2NO6A 4HDQB 1COWD 3AUXA 3GD7A 3T34A 3AQ4A 3K0EA 3C14C 4DEYA 4RZUA 4YDSA 2BKUA 1Z3IX 3GJXC 4FINA 2OCYC 4G01B 3RANA 3SNHA 3WBJA 5AR1A 1PVOA 3FMIA 3VR3A 2QY9A 1XXHA 2BVNA 1YZNA 3UMSA 2VO1A 3GEHA 3VTKA 1IN6A 2EW1A 5L3QB 1DG1G 4G5SA 1OKKD 3R9IA 2G1JA 1J8MF 3NG1A 4GOKA 2FGJA 3B82A 2C5LA 4QJ3A 4TL9A 1KSFX 2E1RA 3MG9A 2IYRA 3BB3A 1KO7A 2VHCA 1ZM2A 2QROA 3IDQA 5C4GB 1UBGA 1N6LA 3QVUA 1KYIA 4LRWA 4D4MA 4G5QA 3THWA 3A1SA 1ONBA 1GAJA 2FE4A 4DHEA 4A8JA 3NDBB 3PEVA 3QXXA 2A5JA 2CCKA 1G7RA 3WNBA 4HSEA 1J7KA 2G88A 4PQYA 5JI3E 1E9CA 4JJKA 4NBSA 3SYKA 2GRJA 4KSBA 4TYNA 2D62A 3UKDA 5EJEA 4B2IA 2RGEA 1P72A 4QNMA 3TUJC 1WRBA 4OQFA 4JSYA 3TQFA 3GPLA 3AP3A 3EPLA 1ZNZA 4XTRA 4IJMA 1Z06A 5B58C 1YHNA 4F7WA 4TMWA 4ZI2A 5FBVB 2GBLC 3W3ZB 3DZDA 1CULC 2OCPA 3WP1B 2OM2A 3B8HA 4OYHA 4MYUA 1IY0A 4N0DA 5E4FA 1SXJC 2QMEA 4E03A 1JBKA 2FG5A 3K70D 1KHTA 2J46A 4DCVA 2ERYA 3AVUA 4NYMQ 4XWKA 1GZSA 3C8UA 4XVRA 5JEDA 3TW8B 5FOWA 2O8FA 3K9HA 4JSTA 1NP6A 1NN3A 2IYYA 3IQWA 4H9GA 2QAJA 4V0OA 4ZKEA 1UKZA 4P4TA 2DFKB 1U8ZA 3CIOA 4URYR 1LW7A 1N6OA 2ECKA 2YKGA 4ARZA 1Q3HA 2B21A 1KY3A 2VQSA 3FPAA 1E9DA 2O8EB 3I32A 3CRVA 1M7GA 2PX3A 2ZE5A 4X8OA 4R7ZA 3UG6A 1NN5A 3LW8A 3VMFA 4UKDA 5FPKA 4OQMA 1P60A 1W0KD 4LYAA 3EZ7A 4PPGA 4C0LA 1KAOA 1GNQA 4FMDF 2NZ8A 4Q1CA 3RS4A 5E7MA 2ZJ8A 4FCVA 2KE5A 3IIMA 1H65A 1EFRD 5DH9A 1FW6A 1XCPA 4JL6A 2FZ4A 4J0QA 2I1VB 4JKIA 5TV2A 2Z4SA 5J47A 1E2LA 4LDJA 2QAGB 3GLHE 3DO6A 3ZH9B 2X19A 1TMKA 3OZXA 5CJPA 5EZ5A 2H18A 2UVQA 4X8MA 2DR3A 4IXNA 2EWWA 5CB6A 4HB3A 2XGJA 5IRCD 3ZDQA 4F4IA 1R0WA 2AK3A 2ORVA 3V00A 5GJWC 3I61A 4HLUC 4FW9A 1D2EA 1GP2A 3OE7D 2GBLA 1G19A 3ECCA 2FV8A 2ZUDA 1EXMA 2JLQA 3LDAA 1NLZA 2ZANA 4NU0A 1Q1BA 1Z6GA 1SXJA 1RRFA 2WAXA 3SE0A 4A2WA 3OIUA 4X8HA 3VX3A 3A1TA 3I5YA 1VG0B 3ETLA 5JLJA 3QUSA 4TLBA 2WPDD 1OIWA 4EJSB 2HYIC 1OSNA 1RJ9A 3AGQA 3EC1A 2HCBA 4M1SA 2IL1A 2A5GA 3VNUA 1DAKA 4TQUS 4WAUA 3QPUA 4ZDWA 4HEJA 2CLDX 2O5VA 1L8QA 1Q1EA 4WZ6A 1YZGA 2W2TA 3ZGXA 1Z6XA 1YKSA 1UBCA 5SZHB 1G16A 5FOTA 1DS6A 2JCSA 2YHSA 4FMBB 1F3OA 4QGFA 4Q48A 1VG9B 2WJYA 2Q9CA 4UXIA 5HKKD 3P1JA 1NY5A 1QHHB 3AVPA 1SQ5A 1H8HA 1TQDA 2QT0A 2GZDA 3D3QA 2DY1A 3KB1A 3SOPA 1XF9A 4W7SA 4RD4A 2P2LA 4QBFA 1FUKA 4NPHA 3AUYA 4JVMA 4B3XA 4P33A 3MRSA 3NVAA 4QXAA 4KYIB 1D6JA 3I8XA 3CF2A 4EAQA 3LQQA 5IF9A 3WMFA 2CNWA 5D3MA 2IW3A 2V3CC 4MITA 2UKDA 3G5UA 4TWZA 2ZI7A 1SKYB 4C3ZA 1JJVA 2BJWA 1XTKA 1VHLA 4R9UC 4HLUA 4CGZA 4B3GA 3GLFE 2JEOA 2WV9A 1UAAA 5F9FA 4Q02A 4LHZA 1G4AE 2DWQA 3PUYA 1MOZA 1TX4B 4Q9JA 3H0KA 4DSOA 5G41A 2IWRA 2CMKA 4A9AA 5JCZA 1D5CA 4OHZA 1UKVY 3WMEA 1AZTA 1VKJA 5AUQA 1KSGA 1UEIA 2BCJQ 1NBMA 5DISB 2VSXA 2BBTA 2PEYA 1R8QA 1ZD1A 4CRWB 2JLWA 1R6BX 5GJBA 3F3YA 4QGGA 1KJZA 5DYGA 3QIAA 2FF7A 3SZRA 3T5GA 2VA8A 3OEEA 1MH1A 2JJ8A 1IXZA 2ODBA 3CR7A 1A4RA 4BECA 3DOFA 1NMXA 1UJ2A 1R5BA 4QL3A 3RHFA 4C0QC 3GJ4A 3QKSA 2NO0A 4URZR 1Q57A 2ZQ5A 4Q9IA 3W6OA 2O8DA 2ZI4A 3FMPB 4CT4B 1KSHA 2GVZC 2WWIA 1Q22A 4KVAA 4BUJA 1NVWQ 2GETA 4FCTA 2YINC 4LX0A 5FBWB 3RYTC 1WA5A 1UDWA 1E4YA 5TB5A 1Z0IA 3VQTA 2OAP1 2C98A 4LBYA 3REFA 4LHWA 1P9NA 1HH4A 4AKIA 1X1RA 1FQKA 1E2DA 4LPSA 3BFVA 1D8TA 4PAQA 4I1VA 1MO5A 1VYUA 3U60B 1B23P 2BM1A 3KUDA 1RRGA 4Q4HB 2GCPA 1JR3E 2BIFA 1E9BA 2NGRA 3A58B 4I1SA 2SHKA 1GOTA 3TAHA 4DWJA 4BFVA 3ZS8A 1P2UA 5FPSA 1KNXA 1ZM4A 4YLGA 4KYUA 1G7TA 4GDFA 3FDIA 4L16A 2PMDA 3GJ8A 3NHAA 5CLQA 5FH9A 1Q3TA 2HJGA 3HU3A 3ND9A 2CHGA 3SQXA 4L8GA 4URUR 3UIEA 2XSZD 2ZRCA 5BQ5A 3CZQA 4JLKA 1DADA 2GK7A 1OH8A 2H57A 2I3BA 1QVRA 1II0A 1W44A 5BXQC 2Y8EA 1G9XA 1X3SA 2Z83A 2GVDC 4A2QA 3CONA 5FL3A 3QVVA 1N5IA 1O87A 1XXHB 1E79D 2ZITA 3AF4A 2RGXA 3CM0A 3HU1A 2C2HA 2EWVA 4R2HA 3B7GA 3QENA 1SZPA 4Q1EA 2XTZA 1JAHA 5AWFC 2O0HA 3E70C 1RYFA 2FPMA 3TVTA 3EZFA 1KAGA 4QM7A 2QBYA 4NYMR 3LO5A 4FD2A 2EFHB 5EXTA 4C0JA 4Q4AA 3THXB 3CRQA 4M1MA 4HZIA 3J81k 2HLDD 4JLVA 4JYBA 3ND8A 4A36A 3FFBA 3THWB 4ZCMA 4A8JB 1ZBDA 2NO9A 2O52A 2PJRA 5H1YA 1CLUA 2VTKA 2HYDA 4QBIA 3L0OA 2VPPA 2F1RA 4PR0A 3KKQA 4ERNA 2QRZA 3VR6A 3KFXA 3KFVA 2GKSA 5CM8B 1N2CE 3V9PA 1CS4C 2F1IA 5HZKA 2IT1A 4LBVA 4FI3C 1KZGB 2REBA 1XFAA 3Q5DA 4I1UA 4P4SB 2NPFA 1ZM3A 2VRWA 1M1YE 3SHWA 4BEJA 1QRAA 3KDSE 3LBNA 4C9BA 2QAGC 2GESA 1KZ7B 4HB4A 5EUMA 3RVBA 1II8A 1OXTA 5KUTA 4HUTA 3HJNA 4AD8A 1K5GA 2RHDA 3BB1A 3BFKA 2VSFA 4B33A 2ZAMA 4XWOA 2JJ2D 3LV8A 1GTVA 5HPYB 3GLGE 2D7DA 2ZR7A 1IN7A 4PSAA 4E09A 3TRFA 5EUQB 1DVRA 4WXPA 2PEZA 2BMDA 3IUYA 3KXLA 2O8FB 4WBSA 2OILA 3CWZA 5HR5A 1NL3A 5J4LA 4MUBA 3BORA 4M0LA 3NH9A 3P4YA 3B9QA 2ATVA 2BKEA 2ZYWX 4RCYA 5TVKA 1KSJA 2EYQA 1P6XA 2NOAA 2IA5A 1XD8A 4NONA 3SC3A 2ZRKA 3DKPA 1GILA 5DI9A 3QXJA 4Q9KA 3WNDA 3QF4B 2L0XA 3A36A 4NCHA 2FN4A 4EJSC 3KX2A 2P6RA 5FOVA 2IUTA 1N0UA 3T1TA 1PUIA 1YJ5A 4N1AA 2QE7A 1XPOA 2WKQA 3LW7A 5DE3A 3ADBA 3LX8A 2AXPA 2P6UA 4JVNA 1CR4A 4RSGA 5A0FA 2ZUCA 4ESVA 1HE1C 2PCJA 4ZDJA 1DAMA 3AP1A 1RKBA 3L2OB 4PHGA 4QJ4A 1ZINA 1UFQA 3NEJA 2NZJA 2H5EA 4IOKA 3SYLA 2OESA 4MUAA 2O8EA 2GZHA 2FEOA 3GEIA 4HATA 1FMJA 4Z8XA 5JS7A 4AY2A 4CDGA 5E95A 1US8A 4UQOA 4DUGD 1NJGA 4UNRA 2UZIR 4ON9A 3LBIA 3TGPA 2HUPA 1E2FA 3L0IB 4EPRA 1Y3AA 3NC0C 4WIAA 5J4HA 1C9KA 3LLUA 1H8ED 4GOXA 4A6XA 4PO1A 5KSOA 4ZV4A 3S1AB 5DYIA 3B85A 2FSFA 1M6NA 5AUOB 1M74A 3NBXX 4GMXA 1E9RA 3H2YA 5IHPA 2IYZA 1KI8A 5FBLB 1P2SA 4DKXA 4Z1MA 4CT5A 1OFUX 4C7OA 2REOA 1EFUA 3QXHA 1ZUNB 3MWYW 3GMTA 1SXJB 1HQCA 1ZD8A 2IYSA 4EDHA 5FOXA 2ZU0C 4M9ZA 4DB2A 1SVSA 3B1VA 1NJFA 1RRPA 2R6DA 5JI2E 1YR7A 3CZPA 1ESMA 4LJ9A 1RJ9B 1FFHA 3IGFA 3QNUA 3ZVMA 4KCGA 1LY1A 2GXSA 1G41A 1G5RA 1YZKA 1CR1A 1U81A 1UKEA 3OE7A 4IDHA 6Q21A 2OO7A 1LS1A 3SQWA 1XRJA 4MYTA 5LDDC 2OLKA 1QZXA 4AYXA 3QI2A 2J5XA 2OBLA 4GSYA 4L9WA 4M8NE 2FDCA 1CRPA 4PC7A 3SBDA 3Q7PA 1AKYA 1QG4A 3NIBA 4NYIR 3U2QA 4A0RA 4MRNA 4JLMA 4QHTA 2XITA 4DCSA 2QPTA 2HT6A 4UNNA 2A78A 5J5CA 4M21A 3AVOA 4XSHA 2RCNA 4RJLA 3RWMB 1T5IA 5J4YA 1HA3A 4KITB 2ONKA 3TR5A 3TMKA 5KDOA 4IEEA 5GADl 1F2TA 4Q01A 2W58A 3DVLA 3GJ6A 1TQ6A 3BOSA 1QHXA 2DCUA 5AJWA 2I1QA 5P21A 4PZYA 1G3UA 1Z47A 3TSZA 1NIPA 4KVGA 2WMNB 4LZZA 1V43A 1AIPA 1RYHA 1TF5A 1W36B 5AK0A 1YQTA 4LJ6A 3RS7A 2FFBA 2LCFA 3W34A 3W5JA 1XU4A 4URXR 5FPHA 1E94E 3EWSA 5D3MB 4UNSA 2ZTSA 1YE8A 5E7IA 3OAAD 3T1OA 4V0KA 4ACBA 4IEIA 2VBCA 3P4XA 4B76A 2CCGA 3T61A 2AKAB 2KJQA 2QRNA 3NHBA 3VAAA 3OEHD 2QTHA 4M22A 1KY2A 3QPVA 4BZXA 3BH7A 3EXAA 2C9YA 5ELXA 4IVRA 4FIDA 2P0EA 4KBGA 5TY0A 1DAIA 2XXAA 2JLVA 2J1LA 4LOAA 1ZNXA 3BD9A 2RB4A 2LKDA 3GCGA 5F9HA 1L4YA 2EFGA 1WDTA 1OH6A 1OYYA 2F9MA 1KI1A 4PX9A 4TTRA 3RS0A 2J0QA 4A82A 2QM7A 4IDPA 1GDDA 4V0MA 3BRWD 3CWQA 3NDPA 4U7DA 4L4UA 2IXFA 1LS6A 1MO6A 3I72A 1F6BA 4RZ3A 3K0FA 1TQ2A 4PO9A 1T3LA 4DLRA 1HEIA 5DI3B 5LB2A 2IS1A 3WNCA 3MJHA 4POAA 3HYTA 3RSOA 3DM9B 1IN4A 1DO0A 1VECA 2CK3D 2ZVPX 4TQ9A 4JLAA 3QKSB 2ZRAA 3RLFA 2WZQA 4MA4A 2GCOA 5DO9A 3ZZ0A 2YVUA 4KBFA 821PA 2FNAA 3AVTA 4DXAA 3TH5A 2P3SA 3VKGA 2FSIA 3I92A 2E9SA 4Q7JB 4A8JC 1YZQA 3LY5A 1XCGB 2O8CA 2ZXUA 2ZYUX 3QJYA 2CL0X 2Z5FA 1FTNA 5G3ZA 3VR4A 3E5HA 3K9LA 2JIZD 5AJVB 3PJRA 1E69A 1QHGA 2VIIA 2YOGA 4EQ6A 3VNVA 2CEAA 2WIAA 4QG7A 4JL5A 1E9SA 1E0AA 1SHZA 2IK8A 3Q9LA 1B0UA 2GZAA 421PA 1F48A 1DAHA 1BMFA 3EZ6A 1GKIA 4DLSA 5LD2B 3R8FA 1OXVA 1S9DA 2ZUBA 5J4VA 4B3CA 4PTLA 4E5UA 2DFNA 3BGWA 2P6NA 2X1VA 2NG1A 5EP1A 2JA1A 4HLCA 2HCJB
chains in the Genus database with same CATH superfamily
1ULSA 2C2ZA 3O4FA 3DHVA 1GGEA 2QZPA 4F60A 5IAAA 4YJ3B 2Z9DA 2Y77A 5AQEA 3NVDA 4KJZA 1RWQA 4WCVA 4RZXA 3ZBPA 2W6PA 2DXIA 3GFVA 1CQWA 4MDEA 4X63A 2J0VA 1DQRA 1N75A 4XCVA 3WXBA 4EABA 1JHYA 3K1AB 2H8KA 3WIVA 1MD9A 3FW1A 3RVDA 3N39C 4JYCA 4U9UA 4X6UA 1JLKA 2CL6X 1UBRS 1K5PA 1DCKA 3NEAA 4HWRA 1PEAA 3O3OB 1P1IA 3E8MA 2J8ZA 4GG1A 4W1PA 4Y0AA 1SB9A 4CWAA 4Z51A 5JWRA 1V96A 2GA8A 2XVXA 4M38A 1NT4A 2OKGA 3O0DA 5EAIA 3ANXA 1VRWA 5EWJB 4Q4AB 1VIVA 3BZUA 5EG5A 2NV6A 2OCAA 1IBLB 1LVGA 1P77A 1TDJA 1R9JA 4M88A 5DBIA 4UZFA 1Y4UA 2ZJFA 1KDOA 4QTXA 2HWUA 3AB7A 1JTFA 3ZTWA 2UVPA 3M1LA 3OF5A 4HDSA 3RHZA 3DKIA 3JX9A 3MM4A 1SEVA 3IAS1 3O4VA 1XEFA 2ZAYA 1XZPA 1CWUA 4MRMA 2Q1SA 3A4MA 5FPTA 5C53B 2J0UA 2P4EA 4MRAA 4W5JA 5ALDA 4DREA 4FT4A 1MU0A 2A5DA 4M1WA 5BWOA 3LQKA 2EF1A 2ZPTX 4JQZA 3RU9A 5I7VA 4G0QA 1LLUA 1TU0A 2R9VA 3S44A 4PYLA 2NSDA 1IB6A 3PVZA 4FCWA 1QBGA 4DMRA 3Q8XB 1H2BA 2R8YA 2PUVA 2XQVA 3SI7A 4ZTUB 4HUQA 1KOGA 4Y1FA 2PS9A 2Z8YA 1IIBA 3PICA 2DBVO 2XYRA 3CPEA 1MCZA 1X7WA 2HKIA 1E1DA 2JJMA 1PWXA 4LX8A 2ZVDA 4JJFA 5DXJA 4EYEA 4MS3B 5F1YA 5BRNA 4EEXA 5T57A 2R6R1 5JYCA 4UULA 3C4JA 4KPFC 3TFOA 3AF6A 1YMUA 1OYOA 3A9WA 3FDXA 2B5OA 1C41A 4OK3A 2YV3A 1MC8A 2WJJA 4C6HA 2XZOA 4II3A 3MD9A 2G40A 4F45A 5GQSA 3FKSD 5B6PA 3O8BA 3BTVA 3QJGA 1XZQA 3PC3A 1O6GA 2PUBA 1JT2A 4OI0A 5ALSA 5EQTA 2QMOA 4ZEWA 4LDPA 3OE1A 5LYJA 3T1VA 4UPEA 2GUGA 1RLIA 4L07A 4RCVA 4WDRA 1HRKA 1DFGA 2FP4A 2V9PA 3L79A 4H15A 3VTAA 1U9YA 2FHPA 1PGJA 4F9TA 3TQQA 1NIJA 1OI4A 1H05A 2ANCA 2I2AA 5TMBA 4PS1A 1O95C 4AXBA 1UJBA 5K99A 3RT1A 4RK4A 4LHSA 2RG7A 3L41A 1DC5A 1WX1A 1XO1A 4HDRB 2IX9A 1LW6E 5AM5A 2DTXA 1NBWB 5C3UA 2XLCA 3FIUA 3TRJA 4C4TA 1F8UA 1E4EB 1CQJA 2ZRQA 1SVKA 3GCWA 2BMAA 5AVOA 4R2HA 3VC7A 4AL4A 2NU7B 2BFPA 4UE2A 3LCUA 5EGNA 4R2JA 4CN8A 1ACMA 3EIQA 4ZFNA 3H1AA 1CUXA 4HH1A 4JLWA 3CRMA 3QKIA 1P73A 2CXTA 2R11A 4F3TA 2VWQA 3NTVA 1QR2A 2ZIFA 2FXIA 2F8SA 2ANBA 3BWCA 1E2HA 1F8YA 3OWXA 3P9CA 1US8B 1JFLA 2DHEA 5E4JA 3W5IA 3PCRB 1NU6A 4AUKA 3KT0A 3TLZA 2YZGA 1LTQA 1IPHA 2JHCA 3UK6A 5I45A 1UMCB 3F1LA 3NGXA 3QVGB 3LZCA 1HYEA 3GPDG 5IJ0A 1CUCA 1RADA 1S2LA 1SVNA 4FS3A 4PSDA 4AECA 1ODJA 4J1NA 4WN9B 5JVDA 2YFYA 1K4KA 1DQNA 4HRXA 1LRLA 5KYXB 3PUJA 2BSQA 1KO8A 2JD1A 2VT2A 3RVOA 4RVHA 1RHRA 2AR7A 1Y34E 4I46A 4NHEA 1GL6A 2HA4A 3A6ZA 2ZW9A 4P3YA 4YJHB 1Q0QA 1KJ8A 1VE3A 5DBEX 4GYJA 3OTIA 1W36C 4YALA 4LWQA 2GF9A 2IZZA 1GNSA 4AZ3B 4BUCA 1XWWA 1LK5A 4KMSA 5DLQC 1CUWA 1SCUB 1N9GB 2PL3A 4JLBA 4LDAA 2JD0A 2Q3EA 5KEIA 1KK3A 3EODA 3GWZA 1OZHA 4MV5A 4P92A 2C2XA 5K09A 4C4RA 3K9QO 3IR6A 3NZEA 1RRCA 3Q3GE 3GK3A 4IKOA 2P9CA 1XLWA 3EGOA 4FJ2A 4QT0A 3MS2A 2DKOA 2F43A 3OT1B 4C30A 3AVVA 1EUCB 2DYKA 3NP9A 3D0KA 2NU8B 1ONOA 3C6XA 4W9MC 3VDRA 1R8SA 3LLCA 3BCHA 1ZI6A 2CVOA 3QYFA 4NG4A 2AVNA 2BKVA 2X4DA 3IVAA 1GQQA 1QM5A 3KKEA 3CB2A 2VF4X 4EENA 2HR1A 1O95A 1TRKA 4M37A 1TLFA 4B84A 1YQQA 1E5TA 3OA2A 2VPYA 3CNOA 4RE5A 1TUBA 4NJMA 1R8JA 4L0DA 4RETA 1E3SA 3TRIA 5BT8A 3DE6X 3DEJA 3WTBA 4C4OA 1GZUA 2CDAA 3B7PA 5CT9A 2ZZKA 4HDMB 3UCEA 4BO9A 1AKRA 1LBHA 1LDEA 1OB5A 2P0AA 1UMBB 1ZC4A 4PXSA 4KAJA 5EZQA 2AD1A 5KJ1A 1X8JA 3F4KA 1L5HA 3PITA 3OZ7A 5JHGB 3OU7A 4MHSA 3KQNA 1QFJA 1X80B 2KBEA 2PZGA 1V47A 4JA2A 5IBPA 4B8ZA 4C21A 2NPOA 3AK4A 2V6MA 1PG2A 1JLRA 5KOJB 2AEMA 1H4SA 2D2VA 5EUCA 5EKDA 1DBPA 3D7LA 3ZGZA 3RYFA 4V3CA 2ZJ2A 1II9A 3EMVA 1TYEB 1KO4A 2V7XA 4MW0A 2E89A 4F5YA 2W2OA 1S2MA 1DEAA 2GASA 3VSAA 4ERXA 1K8QA 3A8TA 1X87A 2EX0A 2JCYA 2QD3A 2BTQA 3DHEA 3I5MA 3NXSA 4Q18A 1PQWA 1YZHA 4XDHA 3BCRA 2H4XA 4D9IA 1F7UA 2QV0A 3IA7A 2JEZA 1NVDA 1RKXA 2C4NA 1T8TA 2WWXA 3ELWA 3F4LA 3H2GA 5CK5A 3JD0A 5CA0A 5BUSA 3I5XA 1KE1A 3GMDA 1DU4A 1WMAA 3SHFA 1R4NA 3P9QA 3W9SA 1V6AA 5CIQA 1BDIA 1NMSA 3K32A 3UBTA 5DM1A 3QFFA 4QDJA 4ARCA 5LD2C 3L8FA 2PH5A 2XXAB 1G7CA 1DQSA 2AN9A 1R10A 3GT4A 4E2YA 1ZGGA 4UATA 1PNRA 4BB9A 3URMA 2DQ4A 1QIDA 2ZK7A 3HP4A 3P19A 1RR6A 3V2IA 1YRQA 2MYNA 1JDSA 1KZ1A 2NYVA 4F84A 5FTJA 1YQWA 2VHVA 1N78A 3LRPA 2YIVX 3UJHA 5L95A 5T5QA 2CHQA 3RKUA 4M9CA 5A2QA 3JS5A 2NUPA 3AF2A 4FNOA 4M3NA 3RU2A 4CCWA 1I4LD 3NKLA 1XL0A 4BKRA 3MWDA 5HZMA 5I51A 1DRUA 1PR3A 2Z9BA 4C43A 1H2FA 3CXUA 3WIUA 3E7PA 4EARA 1SJ9A 4X1IB 1T5BA 4EYOA 4J3NA 2BFAA 1CIJA 1U0OC 1ETUA 1QKJA 1U1DA 3BB4A 3CUKA 3OFJA 4JSRA 2J0SA 2B8WA 3LECA 4MSUA 4K9OA 5HWSA 3H6HA 4IH9A 1MT3A 2BGGA 3S2YA 2YUIA 5AJUA 4ZVNA 1CJKC 3UOGA 3IAM1 2F8LA 3GRFA 3A1NA 4IM7A 4H4CA 4BP9A 3K9BA 3RYHB 7MHTA 3MUFA 1ST2A 1DUIA 3N05A 1O96A 2BGJA 1NBAA 4BN4A 1TQHA 1RHQA 1DIGA 2XWJI 4UNSA 4YP6A 4O25A 1RBZA 3M7IA 1GQ2A 3MEQA 2QP9X 4IUDS 1AJEA 4EQ6B 4LFCB 4QPZA 1CS0B 1WWKA 5KYWA 4YAKA 4YJ2B 3MC1A 3PV0A 4F1WA 3MLAA 4ZCIA 2ECOA 2C99A 3IT1A 1JXMA 1RKQA 1BS9A 1TM4E 2BGKA 2CUTA 2OQIA 3E3LA 3GP3A 3HXKA 5LLSA 4Q21A 2OE2A 3N2GA 2VDOB 3UJ3X 5IH3A 5K3DA 1L7DA 1JHMA 2CYCA 3ENNA 4J07A 4N3BA 1RSZA 2X2FA 3QFRA 3G2OA 2V1XA 3ZUGA 4ASUD 5DNDA 2R85A 3LL4A 3QVJA 1ZLYA 4FGSA 4U5XA 2YVQA 3WRYC 5AW1A 1MOPA 2JIZA 4HDAA 2P40A 2H5LA 2YRXA 3OA0A 1HFJA 4IS2A 4NC9A 4B83A 4F9EA 4IJ5A 4GECA 2QQ5A 1E20A 2JDID 3L7IA 4KRYA 3ANLA 3G9XA 4JKYA 1QTIA 2BUCA 3EK2A 3JRXA 1CB0A 4HPJB 4IOJA 521PA 2P4UA 4R16A 3GLIE 3EPRA 1DXHA 5BNFA 3V7WA 3W5DA 4LNUA 4UEOA 1YZUA 2BHRA 1MABA 3LFUA 3T7TA 4OH1A 4AJLA 2PZFA 4E2FA 4ZICA 5CDSA 1OB2A 5JCJA 2YDYA 3AKYA 2PBRA 3JZFA 1XEWX 4YJ3F 1TCAA 2C2GA 2HMYB 3FX2A 4B6RA 4BRWA 1K89A 2D00A 2ETVA 3JASA 3MLEA 1UDCA 2ZIXB 4XJSA 3HZZA 4WOPA 5IJXA 3TW6A 5D3QA 3K70C 1IXYA 1FXUA 3TLKA 2PIDA 4YFVA 1U3UA 4BFTA 1ZXXA 1Y82A 5INTA 1QQBA 2VXCA 4RKQA 1M2OA 3W79A 2OV8A 2YVKA 4KVZA 2HXSA 2RC5A 4HDSB 1CQIA 4IX9A 4RHCA 4W6QA 1XK7A 1B6RA 3C7KA 1OBCA 4XWTA 4CL2A 5DNYB 2ZCJA 4MRMB 5AVRA 2AX4A 2J0UB 2J4FA 2XOKA 1U2SA 3D7NA 1M75A 1YR8A 4IJKA 4KEAA 3PEYA 1CR0A 2VQ6A 1P2VA 2EVWX 3EGIA 4JFRA 1D6MA 4KYVA 2IH2A 4L3VA 3AB3A 3A10A 1AH2A 1AGXA 1G8YA 2I8CA 5F52A 1Y48E 5HYVA 4HGRA 1KMNA 4MWDA 4CIAA 1DTEA 3PIDA 3W1EA 2VTVA 1DB3A 2BONA 1TMYA 1AGRA 3SD7A 1JQBA 1A50B 2GDJA 4LWZA 1NC1A 2J3MA 1KDZA 3GDOA 2H7YA 5KI6A 3VR3D 4EGFA 3DDZX 4HUQB 1IB0A 3TLGA 3I4LA 3TRHA 3ILYA 2X8JA 2O3TA 1CJBA 2VAPA 1ZD3A 5CYGA 2B4YA 1AS0A 3KZNA 2I99A 3AETA 3FUUA 3QFSA 3HLYA 2AQ8A 5F78A 2JL1A 4Z8YA 1Z39A 4YMSA 1UZLA 1J70A 1OTXA 3CF4G 3SEAA 3AM5A 4Y9UA 1E77A 4CV2A 1L9XA 1WUTA 4FMPA 3D5EA 4YYZA 3IBFA 2FWBA 3E35A 3P2EA 4KIJA 4ZQEA 1PQPA 1SIWA 1NYQA 3IXLA 4R9RA 3DDOA 2JLXA 3VPDA 4CQMD 2IXTA 5LYJB 1S8AA 2JJQA 3PQ3A 5HOEA 2VDMB 5D5QA 5EJFA 3WRYA 4G5FA 1W9HA 2FP4B 4BQPA 4IOMA 5JXGA 5LJIA 4KH0A 1Z63A 2WM8A 5AVZA 2EJBA 4BMSA 2HMSA 1CB7A 2H7CA 1E59A 2I91A 1CUFA 2O7SA 2JGDB 1XHFA 4S2UA 3D5QA 2D1SA 3TRKA 1VP9A 2GGSA 2VP0A 1PT6A 3GP5A 4GLLA 4J16C 1FZQA 3RC9A 3T5CA 4UTRA 1CQJB 5F33A 4G8BA 1QYXA 3X1ZA 2FWNA 4B4UA 1DSSG 2BAGA 2CE7A 3L8ZA 3QRWA 1H0KA 4R1OA 3F5DA 1VRVA 5M5BA 2GXAA 3W9BA 2V6JA 5AP9A 1O7JA 1YIOA 5FHRA 5CT4A 3VR5H 3U44A 1CY0A 3THYB 1JBEA 2IOQA 3GDFA 2B5WA 1DJLA 2XIJA 2XCSB 1WZ2A 1A9SA 4F0JA 1A0OA 1LDBA 1PGPA 2J87A 2OB1A 2GBIA 3DHNA 3N53A 3ZNQA 4EGAA 3CPJB 3FZEA 5C46F 1NVVR 4LRTB 1L4NA 4J0KA 1XE3A 2IS4A 2QR5A 2ZT5A 4IUCS 4J7XA 3B7WA 3RFCA 3UJ8A 2WWYA 2WJ4A 4IDNA 3QPWA 1T8UA 2FPSA 3GLTA 2VPWA 2WJGA 3R0VA 4ZEMA 1UBOS 4P34A 5J2UA 3PNVA 1TO2E 5JPIA 5KOYA 3QMVA 2ST1A 2BJVA 5L4LA 4AK9A 1S3SA 2H92A 3WMRA 1ECBA 2NTEA 3T3PB 3LOQA 3WDSA 4IWNA 5JVDB 3JYQA 2Z2XA 3OCUA 4X20B 3UGKA 2Z4TA 2RAUA 4MUIA 4YQEA 5T6BA 4CV0A 2WQ7A 4K26A 2Q7DA 3BG5A 4LDZA 5DX1A 2BE9A 1LB1B 5AO9A 4FUTA 5H9VA 3UKJA 1E2MA 4NAHA 1A7JA 1X38A 4FDMA 1FMTA 2QD4A 3FKQA 3PXDA 2W98A 4KXLA 4ZOCA 1HDRA 1XLTA 4G4GA 2J9XB 4N3GA 2J07A 2WU1A 1EFTA 1OFGA 1CEXA 5JRZA 1C9JA 1X7GA 2NV0A 5SZIA 1SELA 1UWLA 1P0MA 3SR3A 3LPNA 2X8WA 3ZWCA 1T4DA 2COEA 4BNJA 2QTWB 3D3KA 5B1EA 2F43B 3MA0A 1EFHA 5ITWA 3AY3A 3ESDA 3O4IA 3OZEA 2WSYB 1C1XB 4UTPA 4QU9A 4LIPD 4FSDA 3TZQA 1NXWA 4FWIB 1CZHA 4ZPJA 3ZY2A 4C4PA 4GX2A 4R8SA 1TE2A 2BEKA 2R7AA 3VR2A 1XELA 1WF6A 1XALA 1L8XA 3TSAA 4NDZA 3KC2A 2I3AA 2V54A 1GQFA 1P0PA 2FSUA 4MUKA 4U2FA 2ZDQA 4E12A 4CHGA 2DBQA 3QMPA 3KKPA 4EPWA 4ESEA 1F9AA 3OJLA 4ZT4A 3H6GA 4WBNA 2VZEA 5L40A 1ADFA 2WD7A 3FJYA 2UV8A 9ATCA 3AEYA 3KM0A 1BDJA 4GBJA 2ZUTA 1DEOA 1R8YA 1VCHA 4KNVA 4B32A 1RWOA 2YMMA 2F7SA 4DB4A 1UJ6A 3ORHA 1NW5A 2CXUA 2GRUA 2WUWE 3TX2A 1E5QA 3DC2A 2FTKE 2ZSUA 1Z08A 1E2QA 4U2BA 2B25A 3G8AA 1VHQA 2WPDA 2VH5R 4RVCA 4DLXA 4FT2A 4LXGA 1Y8QA 3QEJA 2PUFA 4ETWA 2BFDA 3L6UA 5K8VA 4MULA 2C7OA 4PO3X 2JKZA 1LQTA 4IQ8A 2GM3A 2PGDA 1Z68A 2HK9A 1KDVA 2HA2A 4HVAA 4UHEA 2B4QA 3X43A 3JQPA 1KZ6A 1XX6A 4NTZA 4Q4JA 4FZJA 3DVQX 1GRRA 2WA1A 2FFJA 1AKQA 2H52A 1XF1A 1X1TA 4R1QA 5CA0B 4Q1BA 5TIIA 1GXSB 4JBWA 3VI3B 3G9UA 4YI3A 3EULA 2HCTA 3PDCA 1WBJB 2YWHA 1M9NA 3Q7QA 1MC4A 4QBHA 2J59A 2XGOA 1I2MA 3WGKA 1UJ5A 2QYTA 2VTDA 1FU7A 3UMJA 1MDBA 2DBZA 2G77B 2X0EA 5H3CA 4L2IA 4KDFA 1K5HA 4IUYA 4BJ1A 1N2IA 4BTEA 4D92A 4V0QA 4DVGA 5DYWA 5KYTA 4IIBA 4PYJA 1MO4A 3ROEA 1N2SA 3JATB 2XT0A 3FTFA 3A1UA 4S2EA 1N5JA 5EP2A 3CUWA 2WLTA 4YNBA 4B3FX 4RZIA 5DM2A 1NBOA 3KPYA 4CKCA 5B55A 5HRAA 1YS4A 3V42A 1LX6A 2QUAA 4DW8A 2AQKA 4BKOA 3BRQA 1B15A 4WBXC 2WF8A 2XQKA 4PTYA 1V5IA 3ZDDA 1YR6A 4R41A 3DO8A 4YWJA 2D7JA 3IPYA 4JV5B 1UPCA 4C6TA 3VPSA 4DABA 2TECE 5E4YA 1KPIA 4AULA 1IXSB 4OAQA 1AN0A 3EF1A 3KQSA 1GQOA 3UTCA 1NULA 2FXVA 2XQIA 5AJYA 3HBAA 2IZ5A 4MWZA 5TQ0A 5KYKA 2WU8A 3VFDA 4BFUA 4OLJA 3HS3A 3NT2A 4GMDA 3WGGA 2I65A 4HPXB 1I24A 4QNNA 1PHRA 2PJDA 2RGAA 4HGYA 4RLSA 4UOQA 3E0QA 3ETHA 5H3LA 5C8YA 4BIMA 3A9VA 1NI5A 4UE6A 1O96B 3I0ZA 3HFJA 1HUQA 2HSEA 2Q6VA 2VJNA 2XE4A 2RHWA 1RWWA 3ZN2A 2ZRFA 1H6BA 1M5TA 3PEUA 5JWHA 3ZX5A 4B2LA 1IUKA 1AZWA 1WTAA 1Y3DE 1Q1NA 1NBMD 3T3DA 4TMZA 3FJOA 5DJ5A 2MMCA 4DWVA 4EY6A 1I8TA 2DF8A 2MIIA 4MB2A 4NARA 4HAXA 3RVPA 4B48A 3GJTA 4XYLA 4UPVA 2EFYA 2I2BA 2NXCA 3GIWA 4K6MA 3SVLA 1IVNA 1G4UR 4KFRA 1JA1A 1W47A 2CXRA 3A1DA 1CY6A 3AY6A 3N2GB 1ZMBA 3EVGA 4BV2A 4EB3A 4ZI7F 2PXAA 5HSGA 4MX8A 4GX1A 2QW1A 3O84A 4OBWA 3U9LA 1NBEA 2O2HA 2IBTA 3F73A 4ZQIA 1KL7A 4JEUA 2EU8A 3HCWA 4TKMA 3PQ4A 4KQGA 4LK3A 1F0PA 4BVHA 4MV0A 2AD5A 2BEVA 2OHVA 1CF9A 1R0CA 2PIAA 1OH5A 2P6MA 4W5TA 3ZPXA 3HJRA 4YJ2F 4NH4A 2OBFA 4ZTZB 2XZTA 2X0RA 2G1PA 4BE7B 1MOQA 1IMOA 3DWGA 5CT5A 2DQYA 1RW4A 2QX9A 3FFWA 1YJBA 4ZXFA 4B6JA 3EHEA 3A6FA 1OJ7A 1P5RA 3ANSA 4WZBA 1AHNA 3GO4A 4QAJA 4MWTA 1XPRA 4RL6A 2I2FA 4EJ0A 4XVCA 1Y9AA 2CJYA 4LNUB 2G72A 2YZNA 1MABB 3D1LA 3I2GA 4M9XA 3ZIAA 4JJIA 5ALFA 4BNWA 1TAUA 3AKZA 5SZJA 5CX4A 5KOIA 1A72A 4HEQA 4YACA 5KYUA 3JASB 4XJTA 3AU8A 1LLQA 2Z57A 2IELA 3LGSA 1PW7A 3HJGA 3M89A 1JZSA 3R20A 3NHPA 4C04A 2P9EA 2YR0A 3RIYA 1XZDA 4PC3A 5TC4A 1M2OB 1GSAA 3GFOA 3EWAA 1ESZA 4XB1A 1M72A 4ZALA 4N65A 1CQIB 5KINB 4G0PA 1SCBA 1R4ZA 3KWLA 4H0FA 3O8OA 2V4UA 4WKOA 4E0BA 1MPXA 4EL0A 1PSZA 4YJDA 2OHJA 3KQKA 1MAVA 2GTIA 2XCLA 3TB6A 2FN7A 4DIOA 5ESXA 1ZK4A 4PXAA 4AWXA 3KJGA 5HNKA 4GZ3A 3AHEA 3W5CA 5A3JA 4DARA 1D04A 1XDSA 5F12A 1U9IC 2R4UA 2IGBA 3H5IA 4Y0VA 4AKTA 4AMUA 1X3LA 4DG9A 1MRNA 1QK3A 3C3AA 2EGHA 2F8MA 5EJMA 4CIDA 2DPLA 1X1EA 1T2DA 2K4MA 2GJKA 1WDWB 3AFMA 3TLGB 2X8JB 2BN4A 3M5PA 4KQFA 3GU3A 1T29A 1W2HA 3S8MA 1MB0A 3AETB 2I66A 3NEYA 1SC9A 4IVQA 2H85A 1CZLA 2FOXA 2BV3A 4NF2A 4QQKA 5EIWA 5EMNA 2I6GA 3SPXA 5FFMA 3STHA 3TOZA 4C07A 1XMXA 1WMFA 4BNYA 4N49A 3OM0A 3RRXA 1Y6ZA 4BUZA 4HCJA 2FW8A 2XB6A 3G88A 3GROA 5CA1A 1PSDA 2BMFA 3QG5A 1NTOA 1SQ6A 2YWBA 2WB2A 1XZKA 3HCEA 3PYLA 5EESA 2IYWA 2MWMA 4B44A 4MRVA 4H18A 4XGIA 3T7RA 2OBMA 1K27A 4RSRA 2Q5CA 2BMWA 4CMIA 2JI6A 1VPLA 2JGNA 2QJTA 5B3LA 3G23A 1U1CA 3C5WP 1XJQA 1NG9A 4MDHA 1NSTA 4CU2A 2P4SA 5F5LA 4OXXA 4DNXA 1XXHE 4DSTA 1QKKA 3NP7A 5ITSA 1W6UA 2E5WA 5JSUA 5K3EA 3K05A 2P62A 4WACA 2V5VA 2W93A 2X42A 3EA4A 2H7VA 3A4LA 1W4AA 4X1OA 5LYJF 1C3EA 1OD6A 2A94A 2YHIB 1EFAA 1E18A 5C18A 3STUA 5BNIA 1GCOA 1FTSA 3CEJA 4MMYB 3L46A 1V16A 4QEKA 2P3LA 2K87A 1YB1A 4TMYA 1JSXA 3JYLA 3LIPA 5L9AA 1JB1A 1IY1A 3PRYA 3E3AA 4XGRA 3K0HA 4AJ1A 3OZRA 5JJCA 2PUHA 4HP8A 1ZMXA 4R0NA 2QRQA 1U4SA 1LPAB 3P26A 3L7CA 3MJTA 2WWRA 3PQ8A 1UODA 2ONYA 5J2UB 5I6DA 4Q3BA 3NDIA 3BSWA 1PHPA 3G0DA 4IINA 3WWCA 1V6CA 5GONA 4LZNA 1L7MA 4CL3A 4I4CA 2IEYA 3ZE9A 4GO1A 2VH2A 3ZW8A 1OJLA 4R6XA 5EE0A 4N6OA 1U9IA 3PC6A 4Q9AA 5CB4A 5CLLA 3A2MA 4RXMA 2O23A 2Q1TA 3BGIA 5FNVA 1WVGA 1GT91 1P3JA 2AH5A 3ZBQA 3K9GA 4B6OA 1DAFA 3NFRA 5LYYA 1PUXA 1ZUHA 3RSQA 2ZRDA 1RAIA 1T9ZA 2EP5A 2VPQA 4IJVA 1F2DA 1LI4A 4QXRA 3SLRA 3T4EA 1HNXB 2ZP1A 3LP5A 5IJ9A 1L4UA 2BR3A 5BW6B 4D8VA 4WJLA 5JVDF 2MJLA 5L51A 1N3IA 5I01A 5CBPA 3M49A 3H87A 1U0TA 2VF7A 2W6QA 2ZRLA 4G0ZA 4IGEA 4UU7A 2B4KA 3KFLA 2E48A 3CW2A 5EJ4A 5CIYA 5AKYA 2GOYA 2I0FA 1O1YA 2DSNA 4BQFA 4POOA 2QP4A 3U09A 3NPMA 4DUGA 1C7QA 4OXKA 3MGBA 1MZPA 5D5PA 1EGAA 2VL7A 1I7SB 1WE2A 3PHGA 1JPVA 3OIWA 1AUQA 3R8XA 3PWTA 5KPJA 3CUSA 3EOBI 1SOUA 2ZWAA 3ROQA 1O58A 3L3BA 3ZI4A 3F74A 2PYIA 2P9ZA 5G4KB 2R6FA 3W2IA 1T4CB 1P0QA 4KE6A 3DAHA 4WBNB 2FZLA 2WD7B 1LQ2A 2REXB 2GQ0A 5U9CA 1Q7BA 2R86A 1GPJA 3NCTA 1W5FA 5AM3A 4OGWA 1B0PA 1GRNA 5B7NA 3GBSA 5PGMA 4D9HA 2Q6KA 2WABA 1DIHA 1AQYA 4UXHA 3ZE7A 1W2GA 4BLWA 2FEXA 2ZRBA 3AF1A 1Z75A 5ER6A 2EG5A 3ZCSA 5KB3A 1GPWB 2DFDA 4LF7B 4MCJA 1NWHA 3UENA 3EZLA 3L7YA 1TUIA 1YA6A 5FXMA 1Y8QB 1UXKA 3F7MA 4CTNA 2LNDA 2BFDB 1MTZA 5EC8A 1L1RA 4JC5A 2XRMA 2W83A 1T4MA 3ZIUA 4MEAA 1NONA 4JYPA 3T9CA 1JDJA 1K1EA 2H17A 2O20A 2ZJYA 3PTLA 4HAYA 3DOOA 3PQ2A 4Q4JB 5A71A 3WLKX 2D5BA 2CC2A 4EG3A 1SM4A 5E3HA 2XJ9A 2INGX 4QOJA 1XMVA 2AC2A 2O8BA 1W19A 2IUYA 4DJDC 2P5YA 3ZU3A 4GR5A 4AWBA 1P81A 1J07A 1UBFA 1R0XA 1G8AA 1HETA 2OZEA 2MCFA 1VMIA 2QTCA 1QTRA 5UKDA 3VSEA 4L76A 1KJYA 4Y9RA 4B8YA 2WNHA 4BMOB 3EXEA 1YK0A 3PEWA 3T9EA 4XM0A 1U5CA 4L2IB 5DTMA 1YI0A 3O8CA 4NS4A 4QHYA 4UUAA 1C50A 2IUUA 4IEFB 3IKVA 3ZNOA 4AC9A 4YRNA 2Q49A 1B26A 3HDTA 5DHPA 3NAZA 3CVWA 2DHCA 4NEGA 4JP2A 1H6AA 4OAPA 5CA0F 1IRXA 2ACEA 2WYOA 4L85A 1FFXA 5SYAA 3VYWA 2Y1EA 2PZJA 5FR2A 2Q7XA 5B53A 3VISA 2PUCA 2W6CX 4GL4A 3TNLA 4BLSA 4BFSA 1J9ZA 4ZCRA 1GNTA 2ZYGA 2BF4A 3NYIA 4C6TB 1GITA 3DAFA 3EA5A 3TXAA 3R09A 3AI2A 4YV7A 3TL3A 1XXLA 1GGJA 3BMOA 2DGDA 5TQ0B 1EZZA 2JLRA 5D84A 1FMFA 3VO1A 3NC4A 2P69A 2RE8A 3BICA 3WZMA 5EIAA 3RGGA 3SXUB 4GE3A 3OEHA 4G4SP 1V37A 1QNLA 3D2BA 3LC1O 3A2KA 3OLZA 1MDFA 2XMZA 2Z2KA 2QN9A 3O94A 4UJ5A 3S7TA 1Y6GA 3R40A 1LK7A 4MWOA 1E2BA 5G3YA 3JYOA 3PC8C 4F8JA 3NDBB 1TU4A 1CYDA 1K3UB 2YWXA 2YUTA 4JJ7A 5FWDA 2GVNA 1EVLA 3Q6IA 3VC3A 3PTAA 3I8OA 4AS1A 5CW2A 2HMVA 3SBEA 3UA3A 1FUYB 1XEXA 3BX1A 4PAOA 4M1OA 1F0NA 3BCSA 3QHAA 1CK4A 1F9EA 2E3JA 2IHUA 2NQ2C 3Q9NA 3QFCA 4NYIQ 4AP5A 5EIEA 3DQPA 4DMFA 4JI5B 3N5KA 3GZTB 5TT1A 1D9XA 4N8DA 4DRXB 5KTRA 3K73O 3QW2A 2X6TA 3VJRA 2HBRA 2C31A 1XRLA 1YS6A 2BEVB 4UW9A 1PFWA 1M5UA 1I3MA 2J41A 1C1YA 2Z0MA 4QUKA 3AJ9A 3IFSA 5LB4A 1J0BA 3HCBA 3NM6B 4XASA 4W4TA 5F51A 5CVCA 3P97A 1P8JA 1ZU4A 4TRJA 5A05A 2C82A 2XKBA 3FDZA 3QPDA 1ZJZA 5IAJA 1NBME 2X22A 3EAFA 3AR5A 1CRQA 4XDGA 5AW6A 2WK1A 1T6XA 3UMGA 3FYTA 1ISFA 2IEZA 3R7WA 4S1PA 5KYUB 2G4VA 5TPZA 3RRFA 2JLZA 3PX7A 2AYYA 1SZDA 2XMDA 5EHQA 1E32A 1QGYA 2HF9A 2JFXA 1EE1A 2YN4A 1THZA 2VK1A 2WUVA 3CLSC 5L3SA 2UU9B 3EYWA 5FUQA 5HUJA 1PJRA 3HA3A 1UBNA 4NENA 3KR9A 2L42A 4I4TA 1TTTA 1I7NA 1E6LA 1P91A 4IHQA 1KO5A 2XUPA 1X1CA 3SQNA 1ZJ6A 1XWFA 1FLNA 1J24A 1JDPA 3O8OB 5TE9A 2W6IA 3M8KA 2BCGY 3BC1A 4EYGA 4ENPA 3LUJA 2QUZA 1C9YA 4XUEA 3UK7A 4ENTA 4RLFA 1L3IA 1PD0A 4O3FA 1FJXA 3QLVA 5BPHA 2ID9A 2PL1A 3ZVLA 4MVJM 2D1QA 2C88A 3RUIA 3W8NA 2I76A 1AF4A 1J42A 4NE2A 5MGBA 3RVQA 1Z4OA 3OWHA 4KFUA 2A58A 1EG7A 1Y80A 4GQAA 2B3TA 4R1UA 3IIIA 4GHWA 1P75A 2J08A 1U0SY 1LF0A 3PC8A 3TPCA 3UB2A 2GM4A 1DRVA 2O1WA 3WKAA 2OVFA 4OHVA 3TJRA 1XKQA 1YVRA 4D42A 3GARA 2Q3MA 1OC4A 3DSRA 1OYVA 3OPXA 3RFVA 3KVVA 4Z1OA 3NQ41 4L57A 1A5SB 3AUFA 4FHEA 1WP4A 1E3MA 2VHJA 4MV1A 4HX2A 4ZVSA 3DEFA 1INLA 1BH2A 1E3WA 1QCCA 4IIUA 5CA1B 2GKOA 4OEHA 1N34B 1QH8A 1L7BA 4LZLA 4IFBA 4MWGA 1G20A 4WK4B 4G4JA 4BNVA 4BX0A 1NT2A 4E6EA 2B35A 3SR0A 2R7LA 4CMAA 5DIFA 1E3JA 2XUKA 4CMIB 4CVNA 4QM6A 2O7QA 4J4TA 3NTLA 3RC1A 3EGDB 4PG5A 2WAAA 1HFEL 4XGNA 2Y76A 4MWSA 3RS2A 3SFVA 4XWWA 2V7VA 4L4ZA 3KEMA 1UXIA 1P5FA 3TQHA 1GKYA 3DCYA 1QV9A 2XY4A 3B1KA 2CFCA 2YCBA 3DUFA 3CZ9A 4WK0B 1XTQA 3VVCA 4P3OA 1N6RA 4DIFA 5ADHA 5TF0A 3WGJA 3WAKA 1AHPA 3K2BA 4JT8A 1EAMA 4RKEA 1V4BA 4ZQCB 2V74B 3GP8A 4JIMA 5JAOA 3CNEA 1ABFA 2V7TA 4YRZA 5JJKA 4DLBA 1DQYA 1V16B 5DBGA 1F51E 4WLVA 3NKVA 1PR9A 5BQ3A 3O83A 2HM7A 2QW8A 2BYTA 4U5QA 4HFNA 1KVRA 5LQJA 4JBXA 3IAFA 1TXGA 5DOZA 5K8IA 1ZN2A 2IU6A 5C1IA 4MEBA 2BEWA 4EG0A 9LDTA 1BEUB 4D02A 2JARA 1YDEA 2JFYA 4S3MA 2IITA 2P9HA 4LJ7A 1G63A 3N8GA 2PHZA 2WIBA 3OBIA 2IKSA 2VRBA 5GONB 5L6MB 3PHBE 3P9IA 1X74A 4XIGS 2QL9A 4UVGA 4EPYA 4MKIA 3OBBA 1TAGA 4GSLA 5KQMA 5CB4B 2C7VA 2I3GA 1Z0FA 1IWBB 3ZYZA 4RQAA 2Q2VA 5FNVB 1W4LA 3V4ZA 5CNMA 4MLZA 5JAQA 1QP4A 5J2UF 3Q2OA 3E5MA 2P2GA 3P0HA 3C6BA 4U8GA 3EEOA 2VJBA 1M67A 5CM9C 3C7TA 1R6AA 4KWHA 4MRPA 5CFLA 1B4DA 3HM2A 4QPJC 1L5RA 1XD9A 4LISA 3RW9A 5A1TA 4V0LA 3B3QA 5LUBA 1QC5A 4K3UA 3GEDA 3O1HB 4A0QA 3FPJA 1V5WA 3AINA 1C7ZA 2Q1YA 4Z99A 1L1QA 3HK2A 5HE8A 5D7NA 3VNBA 2XNHA 3DKVA 5AI8A 5BN5A 3C0KA 4KQ1A 1Y5LA 3Q3VA 1XR3A 1D1SA 3FMGA 1WU8A 2CLCX 2HN9A 3M1IA 3SX4A 3WV4A 4QYMA 4TRRA 3VV2A 4CIYA 1N0VC 1NJ8A 2RD2A 4WOBA 3TVDA 3GLQA 4MV3A 1GM5A 3AJ8A 1Z4NA 4ZZ3A 1G4HA 1HURA 4HLQB 4HN9A 3CR3C 3HZHA 3P0FA 3I9NA 1LA2A 1DJPA 3KVNA 1SD5A 4TQAA 1UKYA 4UBKA 1X7YA 3A9UA 2BGIA 13PKA 4KDEA 2VJCA 1LKZA 2OGTA 4HNQA 5AT1A 1KY5A 3RAPR 4S0ZA 1U0JA 3I45A 1N6KA 2KSQA 3FFTA 3GFPA 3IDOA 3JZAA 1TKAA 5AUNB 3FCCA 4LYDA 3ZX4A 1J90A 5K05A 4OHYA 2KPOA 3IEUA 1GVHA 3M81A 2V4MA 4MUEA 1ATZA 1W9MA 2A7QA 4PPQA 5ALEA 1JNYA 2CXOA 4GZ6A 3U49A 1ZG3A 1M34A 1T3TA 3A14A 4UHFA 1BCSA 2HMTA 4OY3A 5B6IA 2VTEA 1VLHA 3NT5A 5IT0A 2Y0CA 4LKRA 5MFPA 5EWLA 2EDAA 2OB2A 2WYVA 1U0HC 5HF5A 1XYVA 2BFBA 1JG4A 2MSCB 5K2MA 4WBNF 5C2JB 1M2WA 4P83A 1LV7A 1SD2A 3E3OA 4W63A 1IJFA 4MPRA 2ZBQA 3MNFA 2CDNA 2WJ6A 1HDYA 1K63A 2LDXA 1NATA 4BAZA 2QAGA