3N2IA

2.25 angstrom resolution crystal structure of a thymidylate kinase (tmk) from vibrio cholerae o1 biovar eltor str. n16961 in complex with thymidine
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
208
structure length
206
Chain Sequence
MNAKFIVIEGLEGAGKSTAIQVVVETLQQNGIDHITRTREPGGTLLAEKLRALVKEEHPGEELQDITELLLVYAARVQLVENVIKPALARGEWVVGDRHDMSSQAYQGGGRQIAPSTMQSLKQTALGDFKPDLTLYLDIDPKLGLERARGELDRIEKMDISFFERARERYLELANSDDSVVMIDAAQSIEQVTADIRRALQDWLSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 2.25 Angstrom resolution crystal structure of a thymidylate kinase (tmk) from Vibrio cholerae O1 biovar eltor str. N16961 in complex with thymidine
rcsb
source organism Vibrio cholerae o1 biovar eltor
molecule tags Transferase
molecule keywords Thymidylate kinase
total genus 83
structure length 206
sequence length 208
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2010-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3n2iA00
1G8HA 3TRFA 5FPYA 2QA5A 3KKPA 5EQTA 2O0JA 4EPRA 2ORVA 2W6IA 1Q12A 3K9GA 3IEVA 4Q4JB 4V0LA 3AVTA 4GFDA 4HI0E 4L16A 3LW8A 1CIPA 2OSBA 1IY0A 4L8GA 1U2RA 1KGDA 2XJ9A 3B1ZA 5JRZA 5JJKA 1XXHB 3GJ4A 4A92A 2Z4SA 4IDPA 2H16A 5JJLA 2IXEA 3KQUA 1G3IA 2CK3A 1EFHA 3B78A 2QUZA 1AZTA 1COWA 2RAPA 4PC7A 2I4IA 5JWRA 3ASZA 2ODBA 5D3MB 2G88A 1R0ZA 2DWPA 4HLCA 1MKYA 2VO1A 3KJEA 5H68A 3S1AB 1IHUA 1DVRA 2NPFA 3CRVA 2XSZD 3KJGA 1II9A 1IN7A 2NPIA 2NMVA 2X8AA 4AURA 2IS2A 2ONJA 4LSGA 2VIIA 2JDIA 2JIZA 2AD5A 4NL4H 5CIQA 3KXKA 2JJ1A 3EASA 1R10A 3A4MA 3AP3A 1N5LA 5CJPA 1KMHA 1Z2CA 2J87A 1DTSA 4KYIB 5FTJA 3SJCA 3IIKA 5AJZA 3O8BA 4UXHA 5JBQA 4CF7A 1G8YA 3THWA 1JAIA 2QM7A 3A1WA 1VG9B 1Z63A 3VKHA 2ZRCA 3WP1B 2BBOA 2JLSA 4YONB 4WA7A 3L8YA 1OB2A 3DM9B 1XB2A 2PX3A 3DVLA 621PA 2C95A 1Z83A 2ORWA 5AJYA 2C5LA 2ERXA 5FBLB 3KKOA 1GAJA 4G5QA 1W36B 1UDXA 4IXMA 4UNQA 4B43A 3KB1A 4PXAA 1XP8A 1G64A 2RGCA 3K9LA 4KODA 1Q3TA 1Q1ZA 3P1JA 3FWYA 3CR7A 2HXYA 3SZRA 4DSTA 5KNDA 1G6HA 2MSEB 3N2IA 1E2PA 2O52A 3PFIA 1G5PA 2WJIA 1XMVA 3B1WA 3NEYA 2GXQA 4B3DA 3IPXA 5E7JA 4V0KA 1T8UA 2Z83A 1UFQA 3TKLA 1KJZA 1E0JA 5KPJA 4JLDA 1E32A 3AUYA 2ZU0C 1M7HA 3IQXA 1DS6A 1U9IC 1YZNA 2IF2A 2GAAA 3Q7PA 3SNHA 3BFXA 4P31A 5KHOC 4Q9LA 2OUKA 2IW3A 3X1XA 4ESVA 4B3GA 2NO9A 4Q00A 2J0SA 3ZZUA 3ADKA 2IX3A 2P2LA 1MRNA 2W6JA 1I4TD 2WVJA 2WZQA 4D4KA 2BHRA 3Q85A 3TAHA 4GZMA 2FSGA 3B6EA 4EUNA 2NQ2C 1UKEA 4OK3A 3H4MA 1OSNA 1U8YA 5ANRB 2QBYA 1MOZA 1ONBA 3MWKA 4M2LA 1ELOA 1GRNA 3PR1A 1SVOA 1XTIA 4P4UA 3U3RA 4TYYA 5FOUA 4QBGB 3TLXA 1X1RA 3OAAA 1NNEA 2KB0A 5TVKA 2V7QA 4JLJA 2A30A 3MD0A 2D7CA 3REFA 3TJZA 3TSZA 4DWJA 4ZDJA 2HYIC 3D8BA 4QRHA 3UG6A 5BXQC 1O87A 4B6EA 2GF0A 4Q7JB 4KBGA 4XVQA 2ZI7A 4MGKR 3RRMA 3VHLB 3X1ZA 4NTZA 2C77A 4YXWA 1YVDA 2WWIA 2OZEA 4HLUC 3OIWA 1CS4C 2NO6A 5FTLA 3GJ6A 5JI3E 3B85A 2W6JD 4C0QC 4WAUA 1TEVA 1WBDA 3AH8A 1EWQA 2O8BB 2OG2A 5DH9A 2VH5R 4C0LA 4RFSB 2AKAB 2FF7A 2I1QA 4AKHA 3P20A 1ZM2A 1NKSA 4L5BA 4BWYA 2HT6A 1Z8FA 5EE0A 3BS4A 4B71A 3UMFA 4CW7A 4CEJA 2ZR9A 2Q9AA 1S9DA 3BD9A 1VMAA 1TF5A 5FH9A 1RRGA 3BORA 4IFBA 4WZAE 1YZQA 4ZDIA 4ASUD 4GI7A 1C4OA 4DT1B 3VNVA 2BVNA 4OQXA 3AM1A 5JMTA 4TSFD 3V4FA 3QVUA 1D2EA 2EU8A 4W9MC 3I1FA 3O8CA 3MWLA 2CHVA 5F3WB 1W2HA 1HYQA 2Q3HA 2QGZA 4BECA 3X1DA 2QMHA 5AUQA 4Q5IA 2ZRBA 1F6BA 4M9QA 3DZDA 3RVBA 3GJ3A 3TBKA 4QGAA 1KOFA 4L4UA 1FX0B 2H5EA 3W90A 4FWTA 4FMDF 4UNSA 1IJFA 2D7DA 4B34A 2B8WA 3EPJA 5FUWA 3R8CA 1E2MA 5LPNA 4HB0A 4A82A 3R9XA 1P75A 3SYKA 2G77B 3ASYA 1GDDA 4NE2A 4ASUA 3MWJA 1OF1A 3N2EA 3C16C 2QN6A 4V0NA 3KKMA 1IXSB 1J90A 1W36C 4I99A 2IYVA 1GRRA 2PJRA 3K09C 2AFIE 3SN6A 2FGKA 1VG1A 3P27A 1XMIA 1ESNA 4AWXA 5E3HA 3AVVA 4BLOA 2QAGB 2ZRFA 1OH8A 1A2BA 1KY3A 1FUKA 4W7SA 4B74A 4LGMA 1NLFA 3AVOA 5HCIA 1WXQA 3H84A 1KAOA 1G7TA 1E1QA 1FQKA 4DHEA 3BH6A 1BOFA 3ZVNA 3TNFA 2AX4A 3HU2A 2QE7D 4IEEA 5JS8A 1FTNA 1G17A 4S35A 4A1FA 1F2UB 2KSQA 4C7OB 2ZQ5A 5EE9A 1N6NA 1UKZA 1W4CA 3WBKA 2DWQA 2Q3FA 3PCRB 3L43A 3LD9A 2ZROA 3FHOA 3UG7A 1CR2A 1G3MA 1KKLA 4XD7A 2XB4A 4Q66C 3RRYA 3PVSA 4BEJA 3FPAA 1EFUA 4DDTA 5F98A 4ZKDA 4NP6A 1W46A 4M1YA 1ZD9A 4OL0A 4BFXA 2ZYWX 4GP6A 4E09A 2GXAA 4XH9B 2VHCA 1AS2A 1G8PA 2QI9C 1KO7A 4KFSA 4LJ9A 2IYQA 5FL7D 4DLSA 1D2NA 3GLFB 4RD0A 1Q57A 2ZRJA 3HR8A 3IEUA 3CUEF 1TUIA 821PA 4CEHA 3KTAB 4UNNA 2NO1A 3NH6A 4DXAA 3KB2A 3E2IA 4Q48A 3OEHA 1OHHD 4R7ZA 4P4SA 1IY2A 4A2WA 1M6NA 1Z6AA 5JWHA 3U5ZB 1ZUHA 3MJHA 3IIJA 1S3SA 3EXAA 4M1SA 4XWAA 4DSOA 5GJWC 5DI3A 4WXPA 4UNRA 4URYR 1OXXK 2HDNB 4E22A 1W49A 1N5IA 4HYYA 4LHYA 4ZPXA 4B3CA 3EIHA 3SE0A 3LVRE 4ACAA 4PPQA 4ERNA 1Q1EA 3DKVA 4G1UC 3WMEA 4QHYA 2Q6TA 4FCWA 3SEAA 1UEIA 2XTMA 1D5CA 1OXVA 1P73A 5DGXA 5FTNA 4DT1A 3K0FB 1DE0A 1KDPA 2H18A 1Z2AA 3TH5A 3HPRA 3QXCA 3DM5A 1X8JA 1G9XA 4HLQB 3TSWA 4ZCIA 3UK6A 4NYJR 1HQYE 3IDQA 2ZVPX 3LXXA 3T06B 2NOAA 3GFPA 2ZS8A 4IVPA 2XZLA 4EJSA 1M2OB 1ESMA 4KSBA 4Q1DA 2EYUA 2J3EA 2ZXUA 4PSKA 1GUAA 1ZP6A 1E96A 1EWRA 1FOEB 2QGNA 3AF4A 2JAQA 4Q18A 5J4KA 2ZJAA 3GFOA 2ZSDA 4QJ5A 1P60A 2AK2A 1FQJA 4I1SA 4B2LA 2IYRA 5CK5A 3TUIC 4DIEA 2ZIAA 1K8RA 1E2IA 2GBLA 3CH5A 1X6VA 3EZ6A 2WWHA 1IJEA 4G0NA 4ON9A 3WRXC 4JLNA 5AUOB 1TF7A 5B64A 1CF4A 3UWKA 4O25A 2SHKA 1IOZA 4KSCA 4HEJA 4CT5A 2QP3A 2FPMA 5GJCA 4C4PA 4D26A 2R8RA 3OHMA 1CP2A 4X8OA 4V0OA 2EWWA 3CPHA 4MITA 3U3KA 3U7FB 5EUMA 1N5JA 4GRAA 4DDVA 1MO3A 1NMYA 2CJWA 1TTTA 1PZNA 4BZPA 4JYCA 3QG1A 4R2IA 1UBGA 1Z6GA 3I5XA 4ZI3A 2W2VA 3QSYA 3THYA 2F7SA 1ZU4A 3OF5A 4GOXA 4O3MA 1R0YA 1Z22A 3EW9A 5K8TA 1OKKD 4TYQA 2CDNA 2ZRDA 1IQPA 2RGBA 1DELA 3D6TB 4F38A 2A9KA 1OYYA 3A4LA 4LJYA 5IT5A 1YE8A 2BBWA 2AWNA 2V9PA 4Q7LA 1ETUA 4JS0A 3Q3JB 3TR5A 1P2UA 5E7IA 4ZIRA 1NBMA 3NG1A 3R7WB 3T61A 2XAUA 3EPKA 2OCYC 1ZINA 2GKSA 3EIQA 5LB4A 3HPQA 5JSZA 1Z0JA 1R0XA 2Z6VA 3AF2A 3M0EA 4CEIA 4JJKA 4POAA 3P4XA 3BGWA 4HAYA 2CNWA 3AQ4A 2OM2A 4D4MA 3VKGA 4B35A 4N0DA 3OEED 3ZZ0A 5C4MA 1OPXA 1W47A 3CRW1 4N0EA 3EAQA 1G4AE 3DO6A 2ZREA 3EZFA 3THOA 3MJRA 4BUJA 4TMXA 5EP3A 4D4LA 4CEHB 5EE5B 1YR8A 4US2R 1U81A 2DHRA 1SKYB 1KI1A 3ZIAD 4M21A 4P3YA 1NIJA 4D0LB 5LBIA 3BXZA 2D2FA 5ELXA 1I4DD 4FCVA 1CRPA 5J40A 3RNLA 3K70C 3QPUA 2XXAB 2D2EA 2ZRGA 4PO9A 4DKXA 1I2MA 2JJ8A 2VHQA 1N6LA 1R8QA 5L8VA 3C8UA 1E2QA 2IYWA 3RYTC 1MO4A 2A78A 1QHXA 3QI2A 1FL9A 4G5GA 2IYUA 3M4YA 521PA 4CEJB 1XCGB 3UPUA 4QNMA 4G5SA 1AK2A 4B3BA 3ETLA 3OESA 3A36A 2PMDA 4B44A 4XJXA 3K0FA 2GESA 3SFZA 5DO9A 3RSLA 2J0UB 1RZ3A 4QBFA 3AF0A 1E2KA 1NN5A 1XCPA 3RABA 3VNUA 2KE5A 4Q9KA 4LV8B 2IT1A 3C14C 2RB4A 3PIRA 3CF6R 3F5FA 1N3BA 2KJQA 3WYFA 1EX7A 3K0AA 4KVGA 4EPYA 5L3QB 2FPKA 2ZUDA 1CJKC 4RZUA 2EFDB 4IKEA 1Z06A 1Y63A 4EPWA 2GXSA 1KI7A 2QSZA 2FSIA 3CF0A 4HDOB 4KFRA 4AG5A 3CLVA 3C7KA 4XSGA 2HLDD 4L9SA 4HAWA 2QL6A 2GJ8A 4RJLA 1J70A 1DAMA 2Q9BA 3KQNA 5A0FA 2FZ4A 5SZJA 2ZJYA 1D8TA 4A6PA 3CW2A 3RS0A 2F43B 3SJZA 3NDPA 5BN4A 3EPHA 3I62A 4M9ZA 4MKIA 2A5DA 3LDAA 1P5ZB 4QL3A 3ZQJA 4Q01A 5F9FA 4JL5A 2QAGA 4JBWA 2C04A 3SQWA 3GLHE 4JL8A 2PL3A 3EIEA 2V7QD 3W5IA 4EAQA 2ATVA 4LCBA 3CNNA 4ILEA 1M7BA 5EP4A 3THYB 3B9PA 1GG2A 1VKJA 4TMKA 4DCVA 3VR5A 4ZKEA 5DHAA 1G291 1RJ9A 2DYKA 3E1SA 2V55B 5JEDA 2J45A 2GEVA 1UADA 4DBLC 1FMJA 2OV2A 2WJYA 1II8B 4PSAA 1MV5A 3R9IA 4C0BA 2OEPA 5DNYB 4Q9IA 4XVRA 3DMNA 1F2TA 1PLKA 2WSSD 3B60A 3NC1C 4IDNA 4TQUS 1QG2A 2VTKA 3CRQA 3OIUA 5FUVA 1IN5A 1VPLA 2R44A 3GLFE 3GQBA 3DMDA 2ZRKA 4OHZA 1E4VA 2RGGA 1XEXB 4LJ8A 3ZVMA 2W0MA 2QU8A 2HF9A 4ACBA 2OILA 1RRPA 1W4RA 4PHTA 5P21A 1IONA 2QEQA 1KZGB 3LBIA 5G40A 2HUPA 4UJ5A 3PITA 1W7AA 4NMMA 1XD2A 3VX4A 1L4UA 4AYWA 1G3QA 4LJ7A 1MO5A 4IOLA 1E2FA 4Q7KA 4Q1CA 3GLIB 3OE7D 5AJXA 4BLPA 4FCTA 2CHGA 4W5JA 3VR2A 4XIGS 2IYYA 4B76A 1U99A 1J99A 1X8LA 3SHWA 4D82A 5DI3B 1SKYE 3MSXA 1Z0AA 2Q0HA 1IBRA 3ICQB 4ZO4A 2DFTA 5BQ5A 2FE4A 3D3QA 1SXJB 4YDSA 4TYNA 1E1RA 1VECA 2CL0X 1C1YA 4UNPA 4Q4LA 3KJHA 1Z28A 2KWIA 3OIVA 4HB4A 5GVRA 3T1QA 2KBFA 1YR9A 2J1LA 4A8JB 3L0OA 1XWIA 4B2PA 2GILA 4GPTA 3SDZA 4CDGA 1O3YA 4MUBA 5FUYA 2D3WA 2J0UA 3GLHA 1AGRA 2XZPA 3N5CA 1SGWA 2LKCA 2OCPA 4GSYA 4PZLA 4QFMA 1KTVA 1GL7A 4PO1A 4HSEA 3CPEA 4KLZA 3BH7A 5J4YA 4CIDA 3WBJA 2ZPTX 3B13B 2RHDA 2BJVA 4PFSA 3HU1A 5TMPA 5B57C 1R7RA 4NYMQ 4WW0A 5JRJA 5FOTA 3RSOA 2J41A 1DAFA 3BWDD 3FOZA 2C78A 3O8DA 1A2KC 3I8SA 1E2NA 3BB3A 2FOLA 3SR0A 5KSYA 2EYQA 4TLCA 2OAP1 2JLZA 1WB9A 2REOA 3CX8A 4Q9HA 3W5JA 4EPVA 1ANKA 3REGA 4GDFA 3FKQA 3CZQA 1TF2A 2ZM5A 3HJNA 2ZRPA 4KU4A 3ZGXA 3TE6A 4HB3A 1KO5A 2JLQA 3PUYA 3AVYA 2CMKA 1UBFA 2XZOA 2G3YA 2Z4RA 1NIPA 1ZIOA 4LHWA 1BS1A 2I1VB 3HYRA 3QF4B 1G41A 2XNDA 4HZUB 1XU4A 4BRWA 4TT3D 2PCLA 2HCJB 4MRVA 1JNYA 3AVPA 4LC0A 1B0UA 4JT2A 3NEJA 2ANCA 2CHQA 3NBYC 4V0ME 4XD7D 1E2JA 2WSMA 3ZD7A 2GHIA 4A0HA 1R5NA 5AJVB 1TPZA 4IXNA 4MKGA 5B30A 3BB1A 1Z6YA 5JLJA 4IHQA 4TMVA 1OYWA 2NZJA 4OQFA 1UBCA 3RLFA 5J4HA 4LUCA 3BJIC 4NYIR 1FUUA 2O8CB 3UWOA 2AXNA 3FKSD 2K5UA 4WOPA 4UJ3A 5FL7A 5TDHA 2YVUA 3IHLA 2ZVQX 3QE0A 2DPXA 4LHZA 5F9HA 2JLRA 1RJ9B 2PZFA 5IRCD 1OHHA 1XD8A 2FDCA 2RGNC 1QHSA 4Q1FA 1DAKA 2XNDD 1VG0B 2DR3A 5JCPA 1KY2A 4GBMA 4B32A 1TQ4A 3U6BA 4EPXA 2ZR0A 1OFUX 3K0CC 5H8WA 4O2RA 4QOSA 1XTQA 3DHWC 4IDHA 121PA 5AK0A 4PTLA 1YZUA 4KYUA 1NVXQ 2JLXA 1E9DA 1XPRA 1E2EA 4OK6A 1JR3A 1B23P 1L7VC 4MGZR 2ZE6A 3E5HA 4URUR 1E1QD 3CONA 3QKSB 1RYHA 3NH9A 4ITRC 3LY5A 4LX0A 1CR0A 3GLGA 5AJWA 3R9WA 2P5TB 3C5CA 2C9OA 1D2MA 1KZ7B 5LD2C 4S2EA 3ZD6A 5H70A 2V6JA 2VSFA 5G3ZA 2J59A 2GNOA 1I4LD 2ZR7A 3GEEA 2R9VA 3PUWA 3THXA 3AKCA 5FOWA 4MUAA 2N42A 2FSHA 1W0JA 2XXAA 3BRWD 4DLVA 3W34A 4Z51A 3GLGE 2QAJA 4O2LA 2FEOA 3G5UA 1FFHA 1IM2A 1SXJC 5KPDA 5IK2A 2GJKA 2UZIR 5FBRB 3B1XA 3KL4A 3LQRA 3FHCB 4FI3C 1ZD1A 1IXZA 4I1VA 1DADA 4K8OA 2P6UA 3TAUA 4DLYA 5EJEA 1FNMA 2ZYVX 3ND8A 2OCBA 2NIPA 4V03A 1E9BA 2EWVA 4NU0A 4BFUA 1XEFA 4M1OA 3KXIA 1EFTA 5KDOA 4DIDA 1S8FA 1TMKA 2CCJA 4QJ4A 1X8KA 1H8HA 1QHHA 1E9CA 1QHGA 1WE2A 2BMFA 4A6XA 2GJSA 2JLYA 1GNPA 3NIBA 3UMSA 2VYFA 3FMFA 2RGAA 2ZJ8A 4KHZA 4H1UA 4D25A 5FOXA 1W0JD 1KJWA 1AZSC 3VR6A 4PC1A 4PPNA 2AN9A 2DFLA 3CBQA 4NYIQ 2LWIA 2OFXA 4H9GA 3SJBA 5DN6D 4MYTA 1NVVR 1SHKA 3LO5A 4AKEA 1ODFA 3QIAA 4AKIA 4U02A 3RWOA 3VHXA 3ADDA 2FGJA 2EQBA 2JJ2A 4UXJA 2GCPA 1US8A 3GEIA 1OKKA 4TMZA 1GITA 3QF4A 3K9HA 3WP0A 2OBMA 2O5VA 4HZUA 2IUUA 4WXRA 5E7MA 1NI3A 3IBGA 5K8UA 1YR7A 1JJVA 4YMVA 2IL1A 1SVLA 1DG3A 421PA 4LDJA 1PUJA 2P6NA 1NLYA 3CH4B 2EVWX 1NBMD 4C0JA 2H57A 2QMOA 2ZJOA 2QT1A 2O8DA 1XJ0A 3CRRA 4CT4B 3EWSA 2J46A 4RD2A 4QNRA 4TMWA 3WNBA 3LLMA 3FGNA 3QKRA 1Z3IX 4M8NE 3TVDA 2VA8A 4EQ6A 5SZIA 1XTKA 1E2LA 3Q7QA 4TLEA 1G20E 4OJKA 4IFEA 2ZI5A 3VMFA 4OI1A 1YZTA 1HT1E 2WJJA 1KSGA 3U44B 4MDFA 3H2YA 1KI8A 3ZIAA 2J7KA 1U0LA 5IDVA 2IYTA 3OZXA 1LNZA 1W0KD 2MSCB 3JZMA 5KDLA 1PLLA 2FWRA 2E87A 5D3MA 1P2VA 2VP5A 4OQNA 2IS6A 1N6OA 1ZC4A 4GOJA 1FNNA 4G01B 3S1AA 1OIVA 2QM8A 5HR5A 3B7GA 4G3XA 2AWOA 4LK2A 2R65A 3V00A 1LY1A 2OE2A 3NXSA 3QY0A 4FXPA 3ND9A 1G19A 4MQBA 4J0QA 3AF3A 3KFXA 5TARA 5EUQB 3GLIE 2RGNA 4JBXA 3VR3A 1VCNA 2BOVA 3QKSA 4DLUA 1X86B 2E1RA 3P32A 1R5BA 1KMHB 3A1VA 1FX0A 1XMJA 4MYUA 4OK5A 2ZJZA 1T91A 3IO5A 1V5WA 1U9IA 2QROA 2HJVA 3LBHA 4F7WA 2FPLA 1SXJD 4YQFA 3LXRA 1S1MA 3THXB 1GWNA 1LF0A 2IXGA 1JALA 2JJ1D 4NKRA 2QP4A 4RFVA 2QTFA 3HP1A 1JJ7A 1T4GA 1DAGA 2C8VA 5JI2E 2X2FA 1AQYA 4KFUA 1EFCA 4EIWA 3I72A 1E9RA 1RYFA 3TQCA 2HLDA 3ZVLA 5EXXA 1KMQA 5BW8A 4FMCF 5KNBA 2ZJBA 3AVXA 3PV0A 3LLUA 3QXJA 3EC1A 2ONKA 5B58C 1GL6A 4BASA 3B82A 3Q5EA 1RIFA 2VP2A 1UF9A 2ZUCA 3IPYA 4NYJQ 2XTNA 2YYZA 5HZHA 1Z6XA 1QHHB 3TUJC 1NBME 3H0KA 4K46A 4PHFA 4PQFA 4YLGA 5SZKB 1WQ1R 2YV5A 3PUXA 4BFTA 4CGZA 4ABYA 4DJTA 2IWRA 1II0A 1KSHA 2B92A 5FBVB 3MMPA 3U60B 1JEEA 3B2EA 2C2HA 1NVVQ 2AR7A 2PLRA 4C7OA 1IY1A 2EFGA 1GKIA 1GSIA 2KBEA 5FR2A 4LJAA 4TQAA 5DHFA 2JA1A 3WHKA 3DEFA 3RS5A 1JEDA 3W8RA 1LB1B 1T9HA 3GP8A 2P67A 3EA5A 5BN5A 1NG9A 2CEAA 4DVGA 1VTKA 4Q47A 2WWXA 4MRRA 1MR3F 2WWGA 1W2GA 3B9QA 4LBWA 5BYJA 2H8KA 3SOPA 3FFAA 3SC3A 1E94E 1YU9A 4ZDWA 3TMKA 4DRZA 2ZSAA 1G18A 5CLLA 3RS7A 2CE2X 3I32A 3B1VA 2BBSA 5G41A 5K8IA 4KBFA 4HUQA 4IEIA 4JVSB 3DKPA 1HT2E 1TUEA 2WSSA 2A5GA 3MLEA 3K0EA 3PUZA 5KNCA 1Q21A 4URZR 1QZXA 1N6IA 2C96A 3EZ2A 1WDTA 1RE0A 4JLKA 1JI0A 4X8MA 2MMGA 2X77A 4B33A 5JEEA 4PPFA 4PSVA 2YWEA 5HCNA 2CL7X 1YZLA 2WM9B 4KXFB 3Q72A 2CVFA 2CXXA 4M9XA 5IF9A 4A0FA 4JSTA 1VYVA 1K5DA 2HJGA 4AD8A 1VYUA 3A1TA 5AWFC 3RS2A 2QT0A 1W5SA 4BFWA 3SI7A 1UAAA 1GIAA 4M53A 3SBDA 3GJ7A 2ZRMA 5KDDA 3U7HB 2WJHA 1WRBA 2J7PD 3OE7A 4HAVA 2RGDA 4MDEA 5CITA 1F60A 1KNQA 2R6DA 2UVQA 1CR4A 3AVWA 4URWR 1AA9A 4X8LA 3QUSA 4Z1MA 5GADl 2P0EA 2GTPA 3GJXC 3WXMA 1CJTC 5CK4A 4LI0A 1KKMA 2QRNA 5D3QA 4TL6A 1ZC3A 4HAZA 3IO3A 4URXR 2P3SA 2VHTA 3A37A 2O8EB 1E1RD 4I1UA 5HKKA 1SQ5A 2GK6A 3C4JA 3CM0A 2JEOA 1J8MF 1JR6A 3T34A 4TYPA 3UIEA 4QGHA 3A1UA 3ADCA 1OH6A 2JLWA 1XMSA 1YHNA 1KK0A 3GLGB 3WMFA 2B8TA 2L0XA 1DG1G 2ODEA 2YWFA 4Q21A 4DB2A 1TADA 1CEEA 3RHFA 3NHBA 4A8JC 1MH1A 3C41J 1SHZA 3F3YA 4QHSA 2D06A 4CVNA 5E4FA 1Z29A 1P62B 1PUIA 1LF5A 4DCSA 4Z8XA 1EXMA 2GRJA 5EE3A 5JECA 1E69A 2V1UA 2F55A 4AK9A 5JWOA 2ZYUX 2IXFA 2Q3MA 2YC4C 2V4ZA 4PANA 3D7MA 1HUQA 2IF0A 3MRSA 2VRWA 3QXHA 1U0HC 2XITA 3OIYA 3O47A 1G21E 5L3VA 2CCKA 2QY9A 4JSYA 1BYIA 3ZLJA 5DYIA 1T8TA 3C15C 2TMKA 3SU8A 1R4AA 1A82A 5FPSA 1A5TA 4OJQA 1TU4A 5TXGA 2WHXA 5FPKA 1AS3A 3TR0A 2OHFA 2GVZC 1KK3A 2BCJQ 1N0VC 3I8XA 1E99A 2R2AA 1KO8A 2PBRA 3QJYA 4KAXA 5FTKA 1E9AA 4DEXA 1DO2A 3B1YA 1Z0FA 2R6FA 3CRMA 5F2EA 3VR4A 1E98A 4D0NA 4M1TA 2VSOA 2DFNA 4PR0A 3FKSA 2DY1A 2F1RA 2WPDA 1KI4A 5GJVC 4OI4A 3GJ5A 4ARZB 2ODNA 1ZCAA 2D74A 3CIOA 1IN6A 4DCTA 1W4AA 1US8B 2W6ID 4CEIB 2OT3B 4EFNA 4Y0AA 5KTYA 4NHOA 5IHPA 4WZ6A 1R2QA 1HQCA 3WMGA 1GL9B 2GEDA 4HUQB 4DDUA 4NCHA 2ZTSA 3QXXA 3BH0A 4HAXA 1VDZA 4DSNA 3EWAA 3PJRA 1XBTA 2IYXA 3KTAA 4P32A 1G7RA 1ZUNB 3I73A 1HA3A 1TQ6A 5H1YA 2CK3D 2N1BA 3NVAA 4GL2A 2RMKA 3EARA 1KDTA 3LVQE 3QKRB 4LYJA 2IA5A 1NJGA 2Z0MA 3GEHA 1SULA 1RRCA 1KI9A 3HWSA 4LWZA 3AKEA 3K0SA 3V4RA 5L3SB 3AUXA 1JPJA 2UKDA 1RC8A 3VKWA 721PA 4B73A 4NCIA 2XNSA 2W0SA 3KZ1E 1ZM9A 5JFGA 4BFZA 2DBYA 1BMFA 3AGPA 4TQ9A 4ZDKA 1T5IA 3CF2A 4C30A 3EA0A 1M74A 3KKNA 4EFLA 4RCZA 3LA6A 4TT3A 2FMXA 2WWFA 3W6PA 4G5RA 1P61B 4JVLA 4QBIA 1ZYUA 1UM8A 1LVGA 1G3UA 1SXJE 2CCGA 2ZE8A 5LD2B 2ZJ5A 5FBQB 1OW3B 3NBFA 4F4IA 1ZD8A 3U2QA 3AV0B 3W3AA 5J47A 3QPWA 4EDHA 1FP7A 2ZE5A 4KLNA 3SBEA 2OAQ1 1VHTA 2NO7A 4DDWA 2HYDA 3K0AB 3UATA 3V9PA 5CYPA 1Z5ZA 4HATA 1LV7A 4EJSB 2YZ2A 4BPBA 4NPHA 3OFNA 4A15A 3LH5A 2IYZA 1S2MA 3ZH9B 1TQ2A 3ZDQA 1NSFA 1CULC 4PZYA 2Y8EA 4IOMA 1BMFD 3FHTA 4KI0A 2ZS9A 1CU1A 1Q3HA 2FG5A 4QXAA 3NC0C 1Q1QA 1W44A 1Z0IA 1ZIPA 2PT7A 3PENA 4N1AA 1PJRA 1KK2A 1DEKA 4GZLA 2G0TA 1VIYA 4U5XA 4PAMA 4Q1BA 4LYAA 5DN6A 3BIFA 2ATXA 1JB1A 1DAHA 1LS6A 4LOAA 4Q1EA 1UKYA 1VCMA 1W4BA 4QKQA 3CNOA 1E6CA 1SKQA 3K09A 4DEYA 4QM7A 2GK7A 4IRUB 1E0AA 5CYOA 1YJ5A 1KJYA 2XB2A 1TNDA 1SZPA 4HAUA 4LJ6A 4CRWB 2OESA 3QKUA 2ZU6A 5BYKA 4D6PA 2XX3A 1KDOA 4OQMA 3LNCA 1XFAA 4FIDA 4AI6A 1JQJC 1WBBA 1XDBA 3MFYA 1XZQA 1U98A 4PHHA 1TX4B 4FN5A 4IVQA 4DLWA 1NN1A 3CZPA 1E79A 2D62A 3TGPA 4PC2A 4YDHB 3DDCA 2BM1A 4LRWA 1XTRA 2BDTA 1R6BX 5IK2D 1II8A 2LKDA 1RRFA 2PT5A 4BQSA 3NDBB 3I3SR 5EZ6B 3H86A 4ARZA 3WNCA 3J81k 1GOTA 5KSPA 2GF9A 4ZIRB 1E2HA 2GJ9A 1DO0A 1N6KA 3IIMA 3QG5A 4RKEA 1G3RA 4C0HA 2QTVB 4HDQB 4HUTA 3FB4A 3PEUA 2HCBA 4PQYA 2ZEJA 1L4YA 2WJVA 3WRYC 1S96A 3MUFA 3A58B 4RSGA 3U6KA 4GMDA 4YXWD 2OLJA 1MABB 3ZJYA 1NVUQ 3K53A 5L3RA 1G4UR 2FFQA 1CJMA 1M1YE 2YKGA 4NYMR 5J4VA 5E95A 1H8EA 4DZZA 2CNWD 2ASEA 3VU9B 2B7BA 2QG6A 4CZ2A 1LW7A 3Q9LA 3SYLA 5L3SA 2WAXA 3U61B 2ZANA 3QEJA 4CYMA 2I3BA 3LX8A 3ADBA 3ZS8A 1IXRC 1P2TA 1XXHA 4XTRA 3UMRA 2H1LA 4RFSA 4TL7A 4WZBE 1ZM3A 1OXTA 1CLUA 3DL0A 2O0KA 2D4HA 4LHVA 5DYGA 1AIPA 1X3SA 4G5OA 1NSTA 2VSXA 2C98A 2IUSA 4JBYA 5C4GB 4C0AC 3ZZTA 2QQEA 3PXGA 5FR1A 2VQSA 4RY2A 5KSZA 4PC6A 2FEMA 4TLDA 3EX7C 4RVCA 2FFAA 4TTPA 2QSYA 2VP0A 2ECKA 1F5NA 1QHYA 5FI1B 4P0TA 4H1VA 4EKDA 2F3TA 1R5OA 4MYHA 1H8ED 1G8GA 1NMZA 2O8EA 4TWZA 1YRBA 1EK0A 4QM6A 4QGGA 2ODWA 2PZEA 3U4QA 2FNAA 4ESHA 4HDCA 1KSJA 4ZCLA 3I5YA 1E9FA 1IN8A 1CXZA 3KUDA 3RC3A 5A4JA 2VP9A 5L3QA 4OHXA 3DOFA 2ZJ2A 5FOSA 3FYHA 1TL7C 1DOAA 2GXUA 3PUVA 3AP1A 2RKOA 1J7KA 4B2IA 3VQTA 3AKDA 4BZXA 1GTVA 1L2TA 3IUYA 8OHMA 3LRPA 2QPTA 1QDEA 5M04A 1TU3A 4OKSA 4JVNA 5C46F 1G5RA 2BCGY 1G7SA 1XCMA 3VFDA 4Z8YA 1JECA 4AIIA 2XGJA 4QHTA 4P4TA 2JGNA 1MT0A 2OLKA 1XEWY 1G5TA 4M1KA 2OO7A 2FX3A 1WF3A 1CJVC 2VF7A 2NG1A 5K8LA 3FTQA 5DLQC 4PAQA 4RKFA 1X1SA 1ZNZA 4LJ4A 4KFTA 2JLUA 4MA4A 1P2SA 3RANA 4I81A 4Y0VA 4MKFA 1ZU5A 3QOFA 1OJLA 4XSHA 1KI6A 2G83A 2X1VA 2YOHA 1A1VA 3LX5A 5JJIA 4DUGD 1NRJB 2FJUA 2W2TA 4JL6A 4MRPA 5KOYA 3CNLA 4RD1A 3K70B 1XXHE 2J5XA 1ZM4A 2AK3A 3ECCA 2JASA 1F2UA 1P6XA 3F0TA 4X8HA 2YWHA 5FPTA 1DAEA 4XVUA 1VCIA 1H65A 3QPVA 2G0NA 3A1SA 5CIWA 4DSUA 5GJBA 2QZ4A 1T0JB 2PH1A 3IKJA 4BRUA 2V8OA 4GMXA 2JATA 2FH5B 2ZS7A 1VIAA 2GJAA 2RCNA 4JLPA 3LV8A 1M8PA 2F9LA 1SVSA 2PCJA 3WYAA 1BIFA 1ZCBA 1R0WA 1OB5A 5HE9A 3LWNA 4B3XA 4D0GA 3CWZA 1PLJA 2VPPA 2J7PA 1KI2A 1E0KA 1OFTA 2NTYC 1GM5A 4NH0A 2E9SA 3L8ZA 4WVFA 1A4RA 1E0SA 3QF7A 4PZZA 4Z1MD 1D9ZA 4DLZA 1F48A 3K8YA 1CJUC 1KHTA 1OH5A 1U90A 2Q9CA 3N70A 4NCNA 3BFKA 5CM8B 2G9NA 2WKPA 1D9XA 3X2SA 2O8FB 1HURA 1N0UA 2V1XA 2JCSA 3TK1A 1JPNA 3PG5A 4P4SB 1GNRA 2A5YB 3KQHA 2WOOA 2QNRA 2WJGA 1XF9A 2H92A 2R6AA 3Q8XB 2R6GA 2G6BA 1Z47A 4LJ5A 3T1TA 4Q1AA 1PVOA 2OFWA 4MKHA 3GMTA 1E4YA 2QORA 1P9RA 2CE7A 3SS8A 3UKDA 4OI0A 2O8BA 1N6HA 5DSZA 2X19A 2WOJA 5G3YA 3Q5DA 1QF9A 4U00A 1JQLB 3CO5A 4TLAA 4GP7A 1S3GA 2KI5A 4KV9A 3K9NA 2PEZA 1S1CA 2WWYA 3HYTA 1N2CE 4IJMA 1HV8A 4GNKA 4DC9A 4YMUA 4RCYA 3ICEA 4OBEA 3BE4A 3QQ5A 4FMCB 3UANA 2A7QA 1LS1A 1KO1A 1HEIA 3QEOA 2EFHB 2PX0A 2QENA 3CR8A 4HLDA 3U4QB 5JS7A 4F93B 1EGAA 2QP9X 1KO4A 1OXUA 2WKQA 1YKSA 3U3OA 1GVNB 2YOFA 4C3ZA 4DCNA 1XPOA 3EZ9A 3RDPA 1Q20A 2XTZA 2ZETA 4MH0R 3MCAA 1ZM7A 2BJWA 1NF3A 2GZDA 3VTKA 4V0MA 1L8QA 4BFSA 1G1MA 1GZSA 5G53C 4DB4A 4FD2A 1P9NA 1W36D 1YZKA 3SJAA 1HE1C 1XJCA 4TMTA 5HZKA 1QVRA 4LBYA 2ZITA 4FMDB 3T15A 3WHLA 4DCUA 3K0CA 2GVDC 3NBZC 3I61A 2WWWA 3L0SA 2ZRIA 4BFYA 2IEZA 4BEBA 221PA 3KFVA 4HLUA 1RVDA 4QC2A 4JMPA 4D80A 5HKKD 2WPDD 3HR7A 2RGEA 3MAAC 4NBSA 3SYNA 2WIBA 4A0GA 2VEDA 1XD9A 3DOEA 3KQKA 4UXIA 2IS1A 2P6RA 3FMIA 3KKQA 2A2ZA 2PZGA 4IOJA 4YC7A 3W6NA 1Q1BA 1RFLA 5CB6A 1U94A 4Q4AB 3AKYA 3BB4A 2ZRHA 2AXPA 1T3HA 2CJWB 4BE7B 1CRQA 1N25A 2XOKD 2R6CA 4I1OA 3B5JA 4LBZA 3RAPR 1NKTA 1YQTA 3I4LA 1SVMA 2BEKA 1YR6A 5DISB 5HPYB 2GZHA 4GOKA 3L0IB 4PHGA 1SVKA 2WKRA 3EG5A 2ZRLA 3AEZA 3AVUA 4LBVA 4JIMA 1LTQA 5TB5A 2F6RA 3ZVRA 1EG7A 3IQWA 5DI9A 2WICA 1T5LA 1WCV1 2N46A 2OXCA 3T12A 4IOKA 1SVWA 2UZ3A 3TW4A 4OHYA 2VF8A 1CR1A 2IWHA 3ZYCA 1XEWX 3R7WA 3RS4A 4AYTA 1PV4A 4LY6A 4TLBA 2BIFA 2QMUA 4A2QA 4M22A 4TTRA 3DZ8A 1XTJA 4GT1A 4C2UA 2OXRA 4MGYR 4US1R 1AQUA 1U0JA 1AJEA 3QKTA 5EP2A 1EX6A 3IILA 1MABA 2XOKA 1J2JA 2C9YA 1E9EA 1YRAA 1Q0UA 2WIAA 1E3MA 4JT4A 2VBCA 3D31A 5J5CA 2ZI3A 3KJIA 4QBHA 1GILA 2QPOA 4JLVA 5JCZA 1N0WA 1GKUB 2ZI6A 3LQQA 5AR1A 1KYIA 1JR3D 2QQ0A 2VL7A 2QPAA 2REXB 3R20A 4BFVA 1COWD 3BK7A 3QENA 4PAOA 3VU9A 4DLTA 3JZAA 2ZE7A 1HH4A 3P4YA 3G82C 1E9SA 4FINA 1OXSC 4Q02A 1OFHA 4US0R 1U8AA 2HEIA 2XSZA 4JKIA 3AVQA 2QRZA 4LPKA 1UBEA 1ZBDA 2W00A 5KYKA 4I4LA 2R62A 5EZ5A 1RPZA 2V3CC 1CKEA 3QBTA 2IYSA 2J9RA 2JDID 2JIZD 3U7EB 2PLFA 3CKLA 3TVTA 2ZSBA 2P65A 4U7DA 2C9CA 2IEYA 1OH7A 2GCOA 3FVQA 1S9HA 3RRNA 1GNQA 3T5DA 4NDZA 1ZW6A 1F3OA 3OAAD 2GBLC 4IDOA 1KAGA 2NZ8A 1W48A 2ZAOA 3EC2A 2A5JA 1XPUA 5C18A 2EFEB 2HF8A 3QNUA 2GCNA 4B75A 4YMTA 4P33A 4RD6A 1ZRHA 4KO8A 3HDTA 3W6OA 1DARA 5EXPA 1EESA 3A4NA 1H8HD 5DIFA 1U8ZA 1XJQA 3G0HA 3NWJA 1Z6TA 2V54A 3EPLA 3ONWA 1NL3A 2OFOA 1G6OA 1DBSA 4NZYA 3X1WA 2GDJA 2RHMA 3GPLA 4B6FA 2VHJA 2ERYA 3O8RA 1FW6A 1HY3A 5DE3A 5UKDA 2W83A 2NGRA 1A7JA 4D4JA 1NN3A 4D2IA 4A36A 2NO0A 1XNJA 4IVRA 2B21A 4C0KA 1ZNWA 4XTCS 1NP6A 1E79D 2F9MA 4TN1A 4HZIA 4Z54A 5EXSA 4JYBA 2FFHA 2GA8A 2F43A 3CPJB 2WTUA 2JLVA 4AG6A 3IHWA 3TQFA 4NONA 4C0SA 4JLOA 3RS3A 3M6AA 2JJ2D 2VLIA 5GVSA 1Q44A 3PEWA 1GRQA 3FFBA 1GKYA 3KQLA 4TSFA 1N5KA 3OFND 3KXLA 4Q4AA 2OCAA 2O8DB 5AUPB 2ZSFA 2FFBA 1S4QA 5A5GA 3HU3A 2A5FA 3M1IA 4B47A 4Q4HA 2ZRAA 5JHGB 4YMWA 1KI6B 1Z0DA 4EQ6B 2J0QA 2HV8A 3CX7A 2V6IA 3T1OA 4NCKA 1NMXA 2G1JA 1OE0A 2CLCX 5KO2A 1FZQA 2WV9A 2AFHE 4FWIB 1OIWA 2ZUBA 4RZXA 1KDRA 3I92A 1W5TA 1BKDR 1UDWA 4K81B 4PPGA 2BMDA 2AL7A 4BLTA 3U44A 1NY5A 2IHBA 1QHIA 4OYHA 2YINC 4HB2A 3KDSE 3KUCA 4A4DA 4EJSC 3B8HA 1Z07A 5J4LA 3LFUA 4WIAA 2W58A 2ZAMA 1DAIA 1MO6A 1BO6A 1UPTA 4UKDA 1ZJ6A 3QVVA 4IW3B 3CB4A 3LAWA 3T35A 5FFMA 1QVAA 1V43A 5JSZB 2YNMA 1ZNYA 4FW9A 1VCOA 2YC2C 3SHFA 1W0KA 3L2OB 4QG7A 3FMPB 3QXSA 4M9SA 3VAAA 4YMSA 2BV3A 2BM0A 1AGPA 3GJ0A 4JLBA 4A9AA 1NN0A 4AC9A 3K70D 3F8TA 2PMKA 1M34E 3W9YA 3TIFA 4FMBB 4R2HA 2WBLC 4B48A 2O8FA 1JBKA 1YZGA 5CDFE 3FDIA 1NJFA 3WY9A 1RKBA 1T3SA 4Q03A 3TSOA 5EXTA 2DB3A 3R8FA 2QE7A 1HE8B 3GJ8A 1AKEA 4MGIR 4M0LA 3BFVA 2MSDB 1AKYA 3A6PC 4BLQA 2ZRNA 5B2ZA 4JZKA 3U3JA 5CM9C 1TEXA 2BEJA 5HTKA 4PO8A 1SXJA 1XX6A 5LB2A 2Z5FA 2IS4A 3FE2A 3TW8B 2BKEA 3UXMA 3GFTA 1VHLA 1OV4A 4DLRA 1WP9A 2DFKB 3ZS9A 2GZAA 2IUTA 4EPTA 4XOIA 4F91B 2GCOB 1XZPA 4OHVA 5BN3A 1GFIA 1FP6A 1D6JA 4Q9JA 5CB8A 2IC5A 1AS0A 1E2GA 1KI3A 1G8FA 1TAGA 1J8YF 1M7GA 2LCFA 1BYUA 2FU5C 1OIXA 2FN4A 3BBPA 2C03A 4OQLA 2ANBA 3OEHD 4RZ3A 1ZUIA 2QAGC 2IK8A 4KVAA 4PQRA 4F92B 2RH5A 1QBKC 2W2XA 3H1TA 4IDQA 4ZCMA 2DWOA 5C1BA 4F4CA 4W5WA 3C5HA 1CBUA 1QHNA 4DUGA 1R8SA 5JHHB 1QRAA 4BGDA 4C9BA 3DPUA 4B3FX 2FA9A 3PQCA 5FUXA 1XRJA 5AUNB 3NHAA 4AYXA 4KITB 1Y3AA 2PEYA 4M4SA 2AKYA 1UEJA 4BLSA 3PEYA 3AF1A 5KSOA 3RWMB 5CJ2A 3IGFA 2J0VA 2CLSA 2GAOA 3CWQA 1MRSA 3T5GA 4R71A 4MRSA 3T1VA 1JXOA 1KK1A 4JLMA 4LPSA 3P26A 2BWJA 4MRNA 2MMCA 4D81A 4XWOA 4Q4JA 2AD1A 2GEUA 2ZI9A 4Q4HB 1Z08A 3EZ7A 1W1WA 2XEXA 3BAFA 5C2JB 1C9KA 4PX9A 5LDDC 2O8CA 4WBSA 4E07A 2Z43A 2QMEA 5TV2A 2BMEA 2H7VA 2X2EA 4V02A 2A3RA 3L0PA 3PEVA 5FI0B 4LYHA 1BH2A 1KIMA 3L82B 1NG1A 2IBMA 4TYWA 1UJ2A 1T3LA 1N6RA 2REBA 4OI2A 1VG8A 2P5SA 4F4JA 2YHSA 3CX6A 2Q21A 1JR3E 1NY6A 5EE1A 5FBWB 4E03A 3GCGA 1CTQA 3QBVA 2WAYA 1QG4A 4TZ6A 1Q22A 2BC9A 3NKVA 1RW4A 4UQOA 4NCJA 1T6NA 1F2TB 1FMLA 1K6MA 1FTSA 2BBTA 5KU1A 4C2TA 2WMOB 3BC1A 2F1IA 1OFIA 1ZVQA 2FSFA 2QTHA 4RD4A 2GWHA 3X1YA 4MYCA 2H17A 2YOGA 1XEXA 3LW7A 2XJ4A 5TY0A 3WNDA 4AY2A 2VHUA 3AB3A 5FPHA 3IBYA 3MG9A 4TL8A 3BOSA 4JJZA 3LBNA 4XWKA 1K5GA 3A8TA 4JVMA 3ZQ6A 1XD2B 4EFMA 1P3JA 4W5HA 2GETA 2IHYA 1KNXA 1G7CA 1TQDA 2OBLA 4N3NA 4TL9A 3VR1A 3AGQA 3GLIA 1WA5A 3THWB 4L15A 4R9UC 3RRZA 2OBNA 3AP2A 1KSFX 4OHWA 2EW1A 2ZYTX 1Z0KA 2CL6X 2PJZA 4KCGA 6Q21A 1AM4D 2HT1A 1VYTA 4BLRA 3MWYW 1NLZA 3BERA 4RD3A 5CDFA 4URVR 3NBXX 4AKGA 5HE8A 5BWMA 1GP2A 2HXSA 4LC1A 4TZ0A 1EFRA 1P4SA 2ORIA 4Q7MB 2RGXA 5FOVA 2BMJA 2CVHA 3E70C 3FMOB 1OLOA 5FTMA 1I2DA 2FZLA 2IYLD 4A8JA 3GD7A 3MGCA 2YWGA 4BZQA 3U7GA 4M1MA 2ZSEA 3VX3A 4QJ3A 4RZ2A 1P72A 2B7CA 1T0HB 1FPMA 2VP6A 3GLHB 1WMSA 2BKUA 4TTQA 1ZAKA 2O0HA 1DPFA 3OEEA 4E5UA 3JVUA 3W3ZB 1XTSA 1P9WA 3K1JA 5KUTA 5EP1A 3KX2A 2G1KA 1SVIA 2F1HA 4QGFA 2EFCB 1G16A 4JLAA 1OT3A 2FV8A 3JVVA 1N6PA 2CBZA 1P7CA 4Q19A 2VP4A 2WMNB 1E2DA 2DCUA 1AN0A 4II7A 4ZV4A 3U3MA 4LHXA 1EFRD 3WYGA 2F1JA 2B6HA 1LFDB 2CLDX 4L9WA 1ZMXA 1JXMA 2ZI4A 4LV5B 1IAQA 4LYFA 2F3RA 1ZNXA 1JAHA 3SFVA 1HTWA 1UKVY 2C99A 3TUZC 2QBYB 2YJTD 3RC8A 3SQXA 1NVWQ 4KJZA 4LZZA 3NTUA 5FL3A 4O0MA 3W8NA 2AHOA 4ZI2A 4M1WA 5CLQA 4A2PA 1S0UA 4JKYA 4R98A 4LV6A 4DLXA 4PC3A 5JZVA 5SZHB 4A0RA 1IN4A 3GLFA
chains in the Genus database with same CATH superfamily
4CMCA 1SY7A 1YZVA 2QA5A 4JX8A 1T5HX 2HADA 3DQZA 3OLCX 5CT5A 5EQTA 1MVNA 3P19A 4O29A 1DDOA 2G9ZA 1WZUA 4QEDA 2KW5A 4W6ZA 1X7GA 3PI7A 4GFDA 5DNAA 4HI0E 3LW8A 3MYYA 1W52X 1X42A 1BU8A 1O6FA 1ZLYA 1KGDA 3B1ZA 4RHYA 1C41A 3DE3X 1QH1B 2O14A 3TE7A 4E5PA 4P9NA 4AJJA 1TM4E 3G1TA 4ER3A 4AVYA 3OQOA 4O3FA 3KCNA 2LDXA 3FIUA 3LFHA 3C1OA 3LF2A 2IXEA 5JZ9A 4R69A 2GPWA 2IPAB 2IYNA 4ENWA 4JI8B 3LHDA 3ZG6A 5DHRA 3R7FA 1IOLA 1ENZA 1AZTA 1JSCA 3EXHC 3ZKWA 4NPAA 3T5PA 1FJGB 1P9OA 3HEMA 3ASZA 2HRCA 3MTEA 5F1YA 3Q12A 4EW6A 1R0ZA 2DWPA 2PS1A 4MARA 1YB2A 4GI1A 3VYWA 5A4AA 5C7IO 5JDCA 2VO1A 4QOFA 5CVEA 3R7BA 1CZNA 1BX3A 4L74A 5DBGA 5J63A 2NPFA 1YUNA 3TOVA 1K4MA 3KJGA 5TS3A 2DFPA 4PNEA 2GCIA 1IN7A 4M1EA 3IQGX 2X8AA 3W5CA 1PGOA 2IS2A 2OK7A 2P4HX 2NSDA 1NUAA 2AOXA 2VT2A 3R5HA 3O31A 2ONJA 4C6TB 4DA6A 5JTTA 1I7PA 1EB9A 4NL4H 5CIQA 1KTIA 4K9NA 3A3NA 3O9VA 4C1BA 5AM0A 1Z7GA 3MINB 3MWEB 3IFSA 1OVMA 1R10A 3AP3A 2PKYX 2F1OA 2QSUA 4KMSA 1N5LA 3RHSA 4MGEA 1LEHA 1X1AA 1Z2CA 3C6MA 4BX8A 4CMHA 4DG8A 1TAQA 1UJBA 2RIPA 3IEIA 4U8GA 3SJCA 3V3KA 1DFGA 3OPYI 4WERA 4GMHA 2A92A 4CL8A 4RJTA 1GXSB 1OLXA 4ID9A 2F4VB 1ISMA 2VSNA 5GOTA 1TM5E 5JSYA 4OYRA 3W2EA 1S4MA 2PUGA 2KYRA 1JVSA 2GYWA 1J5XA 3IAM1 3AFGA 3VKHA 4RKRA 2ZRCA 2WU4A 2BBOA 2BI7A 5CVDA 3M89A 3L8YA 1EVZA 1RKQA 4MYDA 4IFIA 2ZSJA 3RM3A 4ZYVA 1XB2A 2A9RA 2HCTA 3L77A 2PX3A 1NFRA 4RACA 4V38A 4ZT4A 2HSEA 4EHJA 2JNWA 4MVCA 1Z2EA 4E13A 2XYVA 5K8JB 1AHNA 2F90A 1XELA 5FBLB 3KKOA 3KHSA 3A2LA 3RS8A 4G5QA 4CTMA 1W36B 5JFTA 5LVAA 3V8NA 3W2TA 4NMLA 4B43A 1XP8A 1Z4LA 1G64A 2RGCA 3KKKA 3OJWA 4GOND 4NU5A 5A62A 3P1JA 5CW1A 3FWYA 2O4CA 5E6RB 5LIRA 1B6SA 4KZKA 1UMCB 1EYZA 3IDOA 5BVGB 2R8EA 3L7IA 2O52A 3R6GA 3BRCA 1SJ9A 3PFIA 1SG0A 2E6KA 3D7RA 3GLQA 3N07A 1KEKA 1XMVA 2GHRA 1CEYA 4PZUA 5HF5A 4BKOA 3A4YA 4V0KA 1JTFA 2I3DA 4EVIA 2Z83A 1UFQA 2YHIA 1YDMA 1KJZA 3TKLA 5M7EA 4JBIA 5KPJA 3AUYA 5BPFA 2ZU0C 3QPAA 1K2VN 1U9CA 1Y9DA 4H60A 4FFPA 3UH0A 4HC4A 2WAOA 1ZH8A 2XTAA 5ERYA 1E4EA 5AO9A 4HDRB 1ADBA 1FYDA 1WMBA 1BXRB 1XT6A 4Q9LA 5KHOC 3FPLA 3O9MA 1E3IA 1Q95A 5FA5A 5LC1A 4B3GA 3CRZA 4PZ0A 3KOYA 2WZQA 3IMEA 1DKPA 1ECJA 2H1WA 2I7DA 3GUHA 2FSGA 3KUUA 4GZMA 4YVFA 3O8OB 1DRVA 3P0IA 5ANRB 1ULAA 3HHPA 3FWZA 4JEUA 1T10A 2G7MC 1GRNA 1KH3A 3KHTA 1E6KA 1NDUA 2AJ8A 4P4UA 4UUNA 3HV0A 4UCWA 3JTMA 3U3RA 1X1RA 3OAAA 1H3EA 1D4AA 4MMYB 3FYDA 1VGRA 5TVKA 2PU5A 4A2CA 4UTPA 3FY4A 2G36A 2D7CA 2Y99A 4G1FA 3S7TA 3IE0A 3BTSA 1V6AA 3SVTA 1UXOA 1Y5LA 3D8BA 4UE2A 2NN3C 4QRHA 1YVUA 2P78A 4NC9A 4J2TA 2FSUA 3NLLA 6REQA 3AR5A 4BRZA 1XV5A 3UQZA 1M9NA 1P7ZA 1KBQA 1QNLA 4RA9A 1RAFA 2UZAA 4J94A 4Q7JB 4XVQA 5LU9A 2ZI7A 2J6HA 2ZBUA 3IOMA 3NGLA 3RRMA 3VHLB 1O0CA 1NQUA 1WULS 2OZEA 3LUHA 3H83A 1NQAO 3OIWA 1CS4C 4RV9A 5FTLA 4J0EA 1B8PA 5JI3E 1NXPA 2HA5A 2OECA 4BMDA 4WKPA 3AH8A 2DLCX 1JMYA 3GDGA 2O8BB 5DH9A 2VH5R 1XRSB 1PWEA 4RFSB 2DT5A 3WLRA 2FF7A 1ZM2A 1NKSA 4U7FA 1WKVA 1Y3DE 4BNFA 2SKCA 4QX6A 4B71A 3SPXA 4YI5A 1EJ6A 3I8OA 3IBCA 4CEJA 1S9DA 5FH9A 1TUBA 3Q1LA 3HM9A 1YZQA 3K8OE 3IB3A 1GYPA 5C5IA 4Z49A 3K1ZA 1P3Y1 3C3JA 3OTGA 4DT1B 2BVNA 3LXMA 1QOZA 3LUKA 3H3JA 4OQXA 2LE0A 4TSFD 3V4FA 4BZWA 3MLBA 3QVUA 2HA6A 2EU8A 2WLTA 2NYAA 2D0OB 4W9MC 3I1FA 2VJOA 4JOCA 2HPHA 2JLBA 3DE6X 3MWLA 1GA6A 5F3WB 1E6EA 2Y77A 3H5OA 2B5OA 3OCYA 4L75A 4DNFA 4MI9A 2M2IA 1G9SA 2MR6A 2ZAIA 1ZR2A 3NW9A 1V5IA 5AUQA 5A7HA 4V1CB 2OCGA 4M9QA 3L8HA 1PGQA 2H2IA 3DZDA 3GJ3A 3LA8A 1KOFA 2QQGA 3OTHA 2AFIB 5C0OE 2H5EA 3IQDB 4F9GA 5HZGA 4FYXA 3CF4A 4PCVA 2D7DA 1EGHA 4LJSA 5E0KB 1ODIA 1JE0A 4B34A 1P1KA 1Y42X 1BMQA 3N2NA 4MVJA 4ZC8A 4QUDA 3AR3A 4H77A 4W5OA 3AL3A 3JXEA 4HB0A 3SYKA 1C0EA 1QCCA 1C14A 4KMRA 2G77B 5JMWA 1RPTA 2CXRA 3MOIA 4I4TB 2C7GA 1RWVA 1OF1A 3N2EA 4NE2A 4ASUA 4LZJA 3OLYA 2ZWOA 1A9PA 1J90A 1YNSA 4LE1A 1QGYA 1U0SY 1FB5A 1T26A 3EEFA 3ZHZA 4I99A 4GBGA 2XUKA 3FDZA 2PJRA 1F14A 4P7BA 3R4CA 4KW7A 5FWAA 1L1FA 2FGKA 2MWMA 2GBIA 3P27A 1N1GA 3K16A 3NTXA 1O95D 3OG9A 4AWXA 3J7AC 5I45A 2GS9A 3ELYA 2EC5A 3I1JA 5E3HA 3WB0A 4BLOA 1REQA 1GVHA 4H08A 1B8OA 3HJHA 4WK0B 1Q83A 1KY3A 4BUZA 1T0IA 3OTWA 4L57A 2B2XA 4LCJA 2FW0A 3PQDA 4B74A 5JYBA 1Z36A 3FCYA 4YAUA 1X87A 3I09A 3VH2A 1G7TA 2GO1A 2HREA 1LDGA 1NOIA 2PRSA 4BMOB 3A10A 4MB2A 3JQQA 2NNLD 3DAGA 3ABRB 4UZFA 2NU8B 1JP7A 1F2UB 4A1FA 1KVQA 2BFCA 3OZSA 1C0PA 4J4BA 4WOCA 2ZQ5A 3AY3A 1XWFA 1Q14A 4HXYA 1M8JA 3ZR4B 4YUVA 1WPXA 4UBJA 4DW8A 3NB0A 1D0SA 3L1JA 2DWQA 1X15A 5KNLA 5JYCA 1YS4A 2WYIA 5HMMA 3I2FA 4I50A 1XVVA 1CR2A 3UB4A 1NRIA 3AEQA 5G0SA 4Q66C 4OIMA 3PD0A 3PDHA 3DR5A 3JQ9A 4JGGA 4AX4A 2WPNA 1KA9H 2V3VA 2VYVD 1KYVA 1W46A 2PSDA 4RX1A 4WJKB 1P39A 2AN4A 2IHJA 3AXSA 5AVSA 1Z8NA 4GKJB 4GP6A 4E09A 1QR6A 3PK0A 4MV0A 4YJGB 1RYMA 2VHCA 4EZEA 1HZZC 2IYQA 2BZ1A 5DLDA 4DLSA 3GLFB 2PMFA 4N49A 3W77A 4OMDA 3CUEF 3C3KA 1PW5A 3DE0X 1B1AA 4DFDA 3B1JA 4PQFA 1Z62A 1C4KA 2VK8A 3MF4A 2D1QA 1IK6A 4DXAA 3E2IA 1OREA 5FJJA 4UBKA 2J3DA 3VH1A 2B2CA 2WYUA 5KVVA 2WHRA 4P4SA 3NFRA 4A2WA 1M6NA 1ENPA 1RLTA 1V5EA 2UYGA 4G97A 4UTVA 3U5ZB 2IPMA 3PTLA 3MJHA 3HJAA 2Q8PA 4P54A 5FB3A 4BE4A 4EITA 2C7RA 2ZJ7A 4M1SA 1JFTA 4IZOA 2E6UX 4DSOA 1T2VA 4BUCA 1EFLA 1Y1SA 3QEMB 3PC7A 4CE6A 2HDNB 2XTJA 3QUTA 2VQDA 1UT6A 1WDWB 2AEMA 4KRYA 4LI3X 5DB4A 5JO0A 1X7HA 1T0UA 1TB4A 1Y7HA 4JT9A 4B3CA 4K05A 3EIHA 3WLFA 4FJ0A 4BKPA 5LYJA 1YQDA 2QY6A 1K4YA 2C7VA 3DKVA 4G1UC 2X5KO 1KGSA 2FW8A 3KWMA 3PD7A 4D98A 1R4MA 1XTVA 2C58A 1SK8A 1UJ5A 4KNWA 4MIEA 4MCHA 5B7PA 2SBTA 1RU3A 4NZMA 1OX4A 3G9UA 4HEA1 3BKXA 3NUZA 3Q3VA 1CUFA 5C5CA 4HLQB 2LRHA 4ZCIA 3UK6A 3AT1A 4NYJR 3WNZA 1O6BA 3IDQA 2Z6QA 3VVLA 5EEHA 5F9MA 3WGGA 1CRWG 5A1TA 5EJ7A 5FUBA 4L0QA 1AV7A 5JNTA 2HF2A 3CU5A 3SGLA 1UBKS 2XA9A 2XUPA 2ZSIA 1SFRA 1P8AA 3G9XA 4D5GA 3BJMA 1PQ4A 1GUAA 1N3LA 4P5DA 1Y8CA 2HHHB 2QGNA 4GWLA 1T1JA 5BMVF 4MJ7A 3L7OA 4QODA 3DYBA 3JRNA 4CTJA 5C1PA 2HJHA 3I1YA 4P7GA 4FDMA 4LMPA 4JLUA 4GVLA 1FQJA 4I1SA 3VC7A 3TQTA 5ES4B 4RVOA 4RV5A 2EZ9A 4NOJA 1VRCA 2PL5A 3OIDA 3PFHA 3WRXC 2GD6A 3Q7EA 3UWKA 3NJ8A 4CN8A 5KKNB 2SHKA 2G72A 3D3NA 2BFFB 3K9BA 4HEJA 4KSCA 2QP3A 5GJCA 1ZK1A 3OJFA 2ZIFA 5HFJA 3FSGA 3T38A 1A9TA 1CD5A 1PBNA 2ZRQA 3IP6A 5BSKA 1V41E 3IPAA 1ISSA 5I4BA 3OHMA 2H4FA 4V0OA 1AKRA 2GN9A 1VCHA 3ORYA 4LE0A 4MZXA 2RAUA 4OB8A 4ONEA 2FG7C 3U7FB 3E0QA 3JAWB 1QTQA 1KAQA 2VCYA 4GRAA 4IKOA 2QUIA 1V3QE 4G9BA 3ZHXA 4DDVA 1MHTA 1NMYA 1T15A 1TTTA 1XZEA 3IKTA 3FCCA 4UVIA 4BZPA 4L9RA 1UBGA 3BCSA 4L78A 1SXQA 3ID6C 3L4BC 2WSBA 1QMPA 3OF5A 3LO8A 2C2YA 4JDUA 3EW9A 1YT5A 1CVLA 2V98A 1LSSA 1OKKD 1LBTA 2CDNA 2QRUA 1DJQA 2ZRDA 1IQPA 1J25A 5AVVA 1DELA 2MJLA 5JIBA 2JK1A 1R27A 4QDZA 2JG3A 3BIOA 1OX5A 5K3CA 1YE8A 1GLGA 2H52A 4EARA 2AWNA 5DMXA 3Q3JB 4EHIA 2OZVA 1SC4A 4N41A 1NMSA 3CPSA 1OC2A 3NG1A 2Z9DA 1BKYA 3EIQA 5K0NA 3LBFA 4MGHA 1FQOA 4PG8A 1R0XA 2BEUA 1IN1A 1UC8A 1RWWA 3VR4H 2QF7A 1KARA 1XDDA 4CM3A 2CNWA 1XKTA 4M99A 1TXGA 2ONZA 5FHRA 3VKGA 1DWOA 1RYDA 1YXMA 2N47A 3CLUD 3L79A 1LC0A 2C97A 2P75A 3OEED 4X85A 5C4MA 8MHTA 1JKMA 5HOEA 1QPZA 2X8JA 3EAQA 3EZFA 5EMNA 3THOA 1G5FA 3CR3C 3IUJA 4DUZB 4CEHB 4QG3A 4NHEA 3LSYA 1MGPA 3MQ2A 1Y9JA 1SKYB 2DHRA 2ZDQA 5KWVA 5BOVA 5BQXA 5B1EA 1MD9A 1QIKA 5EIOA 5KVQA 1YRWA 1NIJA 3P0HA 4P3YA 4CDRA 1I9CA 4K9QA 5BRAA 3MT9A 1I4DD 3E18A 4FCVA 4R9VA 1E7SA 4X24A 5J40A 3K70C 3MGKA 5TEVA 2C1XA 3ACDA 1W1IA 1B1CA 4HLNA 1QTNA 3TX2A 2D2EA 4FYIA 4CR8A 1QONA 2ZRGA 5CFQA 2XXAB 1EIWA 2JCGA 3COJA 2P1DA 3W8FA 1R8QA 3ND5A 3LUCA 1R6TA 4XQCA 5JVDB 5L8VA 5LL6P 1QH8A 3RYTC 1MO4A 1U3DA 2OGSA 5J2TF 3TCXB 3WKBA 5E6UA 1KQPA 1QP7A 4OHCA 521PA 2QVYX 3IVCA 1GV0A 1VL6A 1XCGB 4H16A 3UPUA 2CDRA 4GKAA 5DMHA 3K9CA 3AUUA 2DJIA 3OESA 5ALKA 2MDTA 2EP7A 3S4YA 4XJXA 1J0XO 4LRUA 3T3GA 4KNVA 1YULA 4YP0A 5DO9A 5JISA 2V7PA 2J0UB 1RZ3A 3OO1A 2X41A 3AF0A 1E2KA 1O2DA 1NN5A 3C74A 5BORA 3RC9A 2EAUA 2O7SA 2N3ZA 5EKXA 1AHPA 4Q9KA 2IT1A 1SU4A 5TR9A 1QIEA 2DWUA 4FJ1A 2XCUA 2X0JA 3JYQA 1N3BA 3DVQX 4INPA 3K0AA 2GBCA 4OOEA 5CFNA 3HO1A 4KN5A 5LFAA 1CJKC 1Y4AE 3JS5A 4RZUA 1SCBA 5IJZA 3OT1B 4OJTA 1XZBA 5KEIA 3NJ4A 2GUGA 1RFGE 4XSGA 3FAZA 1V7CA 4ITUA 2BLLA 2HLDD 2Y0DA 3RF7A 4RE5A 3WFJA 4YUYA 3QJ5A 4HAWA 1LQUA 5DCUA 5K09A 4HSGA 1HOTA 5ALIA 1G8AA 3UMBA 1ZGJA 3JWPA 2WE8A 3I04M 1F38A 2IY9A 3NX4A 3KQNA 5F7ZA 1ECFA 2ZJYA 2F2TA 1EZ1A 4DM3A 3D8UA 4JI6B 3BFJA 1SEVA 3RS0A 1U4SA 3QA9A 4CFYA 1RRKA 3OE5A 2F43B 1ZSNA 3AJ9A 3EPHA 1YRHA 3NHKA 1IIBA 2Z08A 1T1GA 4WMLA 2DXIA 1UC4B 4M9ZA 1XZCA 2CF6A 2A5DA 2P6PA 5LOVF 3TW0A 4EG4A 2M32A 1W0CA 3H5IA 1FP4A 3BMXA 5AQEA 1J5PA 5THQA 1U3UA 3CVWA 1QYWA 3H8WA 5JXJA 3JAWA 1I6KA 3GLHE 4EY8A 5IBQA 3ZCRA 2F8SA 4KB5A 2D13A 3C6XA 2V7QD 3W5IA 2B4QA 3JQ7B 3QVMA 4LKOA 1R0CA 4W99A 3ZXUB 4EAQA 3GA0A 4ILEA 1M7BA 3SAJA 1LX7A 7ADHA 4EOGA 1GG2A 1U5BB 1O6ZA 3KWJA 3NAGA 4TMKA 5T3YA 1MG5A 3IT2A 3H16A 1L7XA 5ES3A 1G291 2EV9A 2UZ1A 4YJHA 2DOKA 3WJAA 1KJIA 3BE8A 3BRSA 1DDGA 1NJ5A 1BNCA 5F7XA 3FCOA 4QQNA 3GWZA 1V47A 1VSBA 3Q2IA 2ZULA 3G7NA 2IDKA 1IBMB 4Q9IA 2B36A 2H7CA 3K73O 4XVRA 5HDQA 1XVLA 2QL5A 4RAOA 3E3AA 3B60A 3EFHA 2SKDA 4KWEA 1JIKA 4IV5A 3F9RA 1XLUA 4IMJB 2M1XA 2X2OA 3E03A 4EL5A 2WJZB 1SPBS 1ZK2A 2CN1A 1T43A 1E4VA 1C8BA 3ICVA 1MA0A 2PO5A 1XEXB 4OSOA 4ZGWA 1T24A 2QU8A 3S40A 1NOKA 3A11A 3A6LA 4FN4A 1IONA 2O2JA 1P4GA 2QEQA 1NU6A 1M5RA 3V3TA 3V1NA 2HUPA 2HU8A 2X86A 4N4AA 2EW2A 2QRGA 4F06A 1KZ4A 1XD2A 3ZI7A 2WG1A 1Y80A 1G3QA 4LJ7A 2QMQA 3PNOA 4DADA 1JLKA 3BE6A 1E2FA 1VPEA 1BDIA 4TS9A 1HLDA 2A9JA 1UMBB 1YWGO 3LUAA 2IRWA 4JQCA 4CIAA 2CHGA 4QBKA 2NVUA 2OBXA 1QX3A 1DIBA 2IYYA 2ONYA 4FYYA 3T7DA 3OU2A 5HG0A 3RODA 2GZ2A 2DHCA 1VI6A 3S28A 4KWCA 1UWCA 2AE2A 2IEAA 3H5LA 4IGKA 1I6LA 4GHWA 4JXZA 3K5IA 3JAMA 2BRUC 3KYBA 3T1NA 4E2XA 3DE4X 2P5UA 3ZTWA 4TYNA 4WWHA 3MJFA 1QB7A 2F62A 3JQAA 3B6KA 1Z28A 2KWIA 2CXUA 2PBLA 3D4OA 3I9FA 3JALA 1Q7TA 1IAVA 3OIVA 4YRJA 3T1QA 2QLFA 4A8JB 4X6LA 1SUSA 1NXVA 1MORA 4TWAA 4G0QA 4DCOA 4JXJA 1T0PA 1UINA 1NW9B 2WTAA 2H4ZA 4TKLA 3GLHA 4YRRA 2LKCA 2OCPA 3HKCA 2QG4A 4D9CA 1GL7A 1MJNA 4HSEA 4LXYA 2DVMA 3IAM6 1SIWA 4AN0A 4RXMA 1LX6A 1UBTS 3FVRA 2PH7A 3WBJA 1Q7GA 2JFBA 3O6VA 2WB2A 4R0NA 2D7JA 2G8LA 1ZN7A 3TOCA 4MICA 4NYMQ 4RAQA 3QX7A 5JRJA 1FFGA 3ZY3A 1YQ9A 4Y1GA 4GKKB 3WRYA 3O8DA 5CU7A 3WA7A 1I5RA 3QLJA 3I8SA 3M33A 1E2NA 3BB3A 2FOLA 4OGLA 2EYQA 3IC5A 1N7JA 3RFFA 1Y81A 3G5TA 4OXRA 4UNIA 3Q7TA 4IDAA 3CX8A 2R8YA 4KRFA 4M0MA 1FSPA 4HS4A 1OMOA 1UPAA 2P9EA 2K2WA 2ZM5A 3VGJA 2ZRPA 3QJGA 1RWNA 2SKEA 4MUMA 3TE6A 1JF8A 1JLSA 2ZUFA 1ZRMA 2XAAA 4M38A 1UFRA 3VYRB 2Z4RA 3KQSA 4GWGA 1T3TA 1G41A 2XNDA 5J3JA 1LU9A 1EP1B 1X7DA 4HZUB 3ZWQA 1SBZA 4RLFA 2HCJB 4RVGA 3DB2A 3LPDA 4MRVA 1XZDA 1F6DA 4JT2A 5KYYB 4MVJG 4XD7D 3FW1A 1KDZA 1H69A 2G63A 1DOHA 1S6YA 1UT8A 3DVSX 3F4LA 1YE5A 2WU1A 2FMIA 5AW8A 1Z6YA 4Y30A 4RHFA 5JZMA 3GFSA 2EX4A 1NXOA 5L6MB 4OQFA 2CLKB 1UBCA 1XRPA 4CL0A 2I3GA 3L7JA 3NKLA 4EJMA 1FUUA 4AS3A 2MTBA 5LMCA 2AXNA 1M1XB 2K5UA 2YX1A 3GLUA 4UJ3A 2VYQA 4WOPA 2B4KA 5TDHA 5BRJA 3QE0A 3FVTA 1YL7A 3DF9A 3N2LA 3U1BA 4RTLA 4YJ2A 2UZ1B 1C3JA 1RSZA 4K9LA 4YJHB 5IP5A 4C14A 1LZKA 1NWCA 2HO5A 1OHHA 1FS4A 5F4ZA 1IBSA 2FRDA 1PEAA 3GPBA 4FZJA 1DAKA 4Q1FA 2A33A 4GBMA 3QM1A 4B32A 5IM4F 2B0JA 4BNIA 4MQMA 4ZMSA 3U6BA 3ON5A 4F9EA 2YYAA 3W2FA 1OFUX 2HJRA 3K0CC 1NXSA 4G25A 3E2MA 4RZSA 1TYDE 5E0OA 3W1WA 2BFPA 1XTQA 3A2MA 1GZ5A 4L5IA 4HDKB 4KL8S 5JZVA 5ESWA 2Y1EA 4GPZA 1L8AA 1NQVA 3BGVA 4P53A 5HSGA 4AO7A 1E9DA 1GNSA 3ETDA 5D87A 2QYTA 2BZSA 4IPTA 4OK6A 4AJIA 4XFJA 6ADHA 2X8BA 1B23P 1SKBA 4GC5A 3GRAA 1I36A 2R1TB 2Q3EA 5IT9A 1RYHA 1MN6A 3DJYA 3M6XA 4LX0A 2EBUA 4LFCB 3PBKA 1K66A 1NC1A 2QN8A 2CJYA 1QK3A 2G70A 3R5KA 4PLPA 5AJWA 3RTGA 1O6GA 3S7ZA 2F00A 3C5CA 5GM1A 1Z5NA 3WLAA 4EGFA 4BGDA 3ZD6A 4B3HA 2J3QA 3G02A 2C3MA 3LPMA 5DT9A 1EVYA 3CXRA 1J8QA 4WNYA 2ZR7A 3GEEA 2R9VA 3RAFC 2BI4A 4H3HB 4WGFA 3VPDA 1X9HA 2COKA 3BAZA 4I8DA 5J2UB 1W0JA 3BRWD 2E3JA 2YXEA 3EXG2 3HS3A 3UV3A 4DLVA 4F4HA 2QAJA 5JUWA 2Q1TA 3FBWA 4YPOA 1DEXA 4CGYA 3OECA 4GXNA 1TJ4A 2X6RA 5IK2A 2QRLA 2VYVA 3ENVA 1N32B 2GJKA 1L5KA 1CG6A 1RXCA 2UZIR 3OCXA 3FHCB 1ZD1A 1RP1A 4H15A 4K8OA 4PYMA 4RF5A 4Z3DA 4J4TA 4R2WA 2ZP1A 3JR3A 2G07A 2XUOA 4Q3BA 2WABA 4NFSA 1RBQA 1PK9A 2CEKA 2NIPA 3EVCA 4OF4A 2PUCA 4NU6A 1UJ4A 3NR2A 1EFTA 1X7WB 2CCJA 1EK2A 3DBIA 1QHHA 1E9CA 1Q7CA 1SHTX 2K2QB 4O6VA 4YJGA 2BMFA 4JKOA 4ALMA 1E2UA 1W1UA 5IJ0A 2LBPA 5KOHB 4H6VA 3NYIA 2XNJA 1NXTA 2W8BA 2YWRA 5IX8A 1E7YA 3SCZA 3FSGD 4O4IA 1XMQB 4KHZA 3KYCB 5C8XA 1JHZA 3OUZA 2YDXA 3OC6A 1J6UA 4DC0A 1SBQA 4FFLA 1CY2A 2FPGB 2AN9A 2DFLA 2Z3ZA 3CBQA 2OFXA 3F8SA 4NZNA 1TPYA 4XPIB 2YRXA 4LNUA 3RASA 1A9YA 4KQGA 5DN6D 5J58A 2LXNA 5JZBA 4FHFA 4BLVA 3K05A 4N6NA 4KWIA 3IMGA 4LRTB 1NX9A 4YRIA 1ODFA 4IXTA 4G0UA 5C8ZA 3EVEA 4DRXA 3QIAA 4AWAA 1ZEMA 3RWOA 3VHXA 1SRRA 4FE3A 1MPXA 3ADDA 2FGJA 2EQBA 1CS0A 4HJXA 1AUQA 2JJ2A 1ND5A 3A3YA 4G8DA 4GEGA 3TNDA 3WGQA 1C7IA 3ZX5A 3C7CB 3OURA 5M5BA 4URHA 5JDCC 4IIXA 3HMKA 3QMPA 1HL3A 3GH1A 3UAWA 2OBMA 3HACA 2PGAA 4LJLA 5E7MA 3HCAA 5T3UA 1YR7A 4RS3A 1XKXA 1E2BA 4X94A 1SVLA 3SD7A 4BNUA 1OJ7A 5BN4B 2JJQA 3O4JA 421PA 1YF3A 2OV1A 1NLYA 2J3KA 3SHQA 3N86A 3TXXA 1WSDA 3QH4A 4B6SA 2Z2KA 1KZ6A 4HGZA 4K9KA 2J46A 3G3EA 4QNRA 1ZI8A 2FX5A 4FBGA 4MA5A 3VTZA 2VF4X 3LRTA 4UU8A 2PRJA 2O7VA 1AB6A 4C4XA 4ZHQA 1PV4A 2DH6A 1UAGA 3WLTA 3H2ZA 4TLEA 4KACA 4ZK6A 2Z30A 4LAFA 1OVGA 2DTEA 4OB6A 1IPFA 1QZ3A 4FFNA 5E1DA 3T6KA 2BMWA 2DUMA 3PNMA 4P3XA 3ZDZB 1YZTA 2RJ3A 2WJJA 4MDFA 5DWQA 1H2HA 1FRQA 1GPMA 4TXJA 4FEYA 4MVYA 1MEJA 1U0LA 1Y5NA 2V74B 2ZT5A 2IYTA 3OZXA 3RVKA 2I6QA 1A97A 4EMTA 5LN1A 5B3JA 4Z5XA 3M4XA 2E87A 3V8VA 4M0FA 3L0BA 3LP5A 1J8DA 3A70A 3LUPA 4OXXA 1B0ZA 3TIIA 1O1YA 2AB0A 2ZTUA 3MOGA 4G01B 4GPIB 5HR5A 4Q34A 3UHPA 5LJIA 4G1BA 4OSEA 1RYNA 2R65A 3WIVA 4C0XA 1UMDA 3FKJA 4YCJA 3V00A 3C3XA 4BN0A 2HK7A 2WI8A 3HNOA 2OE2A 3ZDCA 4HL6A 4FXPA 1EQ2A 3ZCUA 1G19A 3KKZA 1VHQA 1SCJA 4J0QA 3AF3A 4MQBA 4O59O 2Z6UA 3GRKA 5EUQB 2R97A 3AOEC 3WL3A 3NDIA 4AUEA 3KIPA 4X7BA 1VCNA 4IH4A 2M6LA 1IZ0A 1MEOA 2XV1A 4MV3A 2HZ7A 4ZT7A 3UW1A 1DTEA 1FX0A 1HDRA 1XMJA 2EHJA 3D8NA 5J59A 3I28A 5BPHA 2DU8A 2MSNA 2HJVA 2AQHA 3LBHA 2FPLA 3PC3A 4AMGA 4Z4EA 1S1MA 1TTPB 1LF0A 1MGOA 4BGUA 1H42A 2J30A 2Q6VA 1LPPA 1PU2A 2INGX 2ORYA 3M5WA 1NW6A 2P4QA 4G8BA 3HP1A 3VMMA 1JJ7A 2FPOA 3KJZA 1ORIA 1BH6A 1PJTA 3QQPA 4WGGA 4DA8A 3ECSA 2FF5A 1IK4A 4RTNA 3CEMA 3QEAZ 4BGIA 4QLBA 1U8TA 3CNHA 3NTRA 4OTZA 5CA0A 4YCCA 1YZYA 3ZU5A 5JNVA 1A8UA 1EVEA 1M75A 1RYFA 2HLDA 3MIIA 1KMQA 4IJ6A 3TQCA 3V8PA 4OGGA 3WGVA 1PGPA 1F4VA 2B34A 5JH7A 3LLUA 4J3NA 2GHTA 2I6UA 3PQ7A 3EC1A 2JIQA 2ONKA 2HK6A 3N74A 4MW2A 4RZHA 4XB1A 2ZUCA 3OOYA 3IPYA 3GGCA 4NYJQ 4R1PA 4QSHA 5CEEA 3NONA 1Z6XA 1KORA 1DBPA 1QHHB 2OORA 1I1NA 4RSRA 1PJ4A 2OV4A 3G7SA 2EP5A 1XTTA 2DGDA 1A5AB 3L6EA 3DEHA 2YV5A 4RESA 4YLGA 5JJCA 4DJTA 3CY6A 4QDJA 4MW9A 2Z9CA 1II0A 1KVTA 2WJ6A 3H65A 4LZLA 3MMPA 4JVOA 4BLWA 1JEEA 3KQVA 5FBVB 4IQ4A 1AMNA 4MLDA 3VOBA 1BQEA 6NULA 3M4NA 2C57A 1H4VB 4I8IA 4LNUB 4QPNA 3D8RA 5LQCA 5LQRA 1WOMA 2SCUB 3TM5A 2KBEA 1P6QA 3HYCA 4RVNA 1B6TA 1FSGA 1OA0A 4EO7A 1H2YA 5DHFA 4DUYB 5J2TA 3TTTA 2BTOA 4IDEA 4EY4A 1T6ZA 3GP8A 3NAZA 4Y6LA 2CUNA 1VTKA 1KQOA 2WWXA 4DYVA 4EA9A 4MRRA 3HB4X 4S05A 4PO3X 2CYAA 3EDMA 4FQ7A 4RMNA 2KLBA 2BN4A 3B9QA 3GW8A 1QM5A 1XYGA 4OOFA 4DRZA 5JPCA 2FWPA 3UO8B 1GNLA 3X2EA 5CLLA 3RS7A 5IYZF 2BBSA 4HMPA 5AI9A 2H1RA 5A3SA 2R751 1W73A 1A8QA 4IEIA 2Y66A 3DKPA 1E60A 1AKUA 3KETA 4UVHA 4PZCA 4HAIA 4XUEA 2RG1A 3AHGA 5H02A 4GPAA 4URZR 1N6IA 3EZ2A 3I83A 1H93A 1VI5A 5I7AA 4PPFA 4ZVPA 2YWEA 5HCNA 3DAYA 1U8FO 2WHPB 1YZLA 4EW1A 3Q72A 2CVFA 2E0IA 2EIHA 1EA5A 4QQKA 2HL6A 5IF9A 3FXAA 4O4LA 4JSTA 4A0FA 4AD8A 2HJGA 4CG2A 1N34B 2QTTA 3KOMA 4RORA 1YHYA 2RC5A 2ZYDA 1RWXA 3A1TA 3R09A 3ZW8A 2QT0A 4DL9A 1PJSA 1W5SA 1VJDA 4YRGA 1C9DB 1GIAA 4MJXA 3F6SA 4M53A 4H7HA 2GASA 3SBDA 5I6DA 4A4DA 1WRBA 3A26A 2IW1A 4HBGA 3OE7A 1ZK0A 2RGDA 4MDEA 3Q40A 1F60A 4LG1A 3HCNA 4UU0A 3AVWA 4A6DA 4OA8A 2H9YA 1DPGA 2WM8A 1P5RA 4B8ZA 5G02A 5KX5B 1ZOPA 4B4KA 4UATA 1KKMA 2QRNA 5CT4A 5B55A 1ZC3A 4HAZA 2E85A 2EKQA 2ZB8A 4RTPA 1JHMA 5TPWA 2P3QA 3IPRA 4MS4B 2JEOA 1BVRA 1D5WA 3T34A 1KFJB 4TYPA 1Z4KA 3SMQA 2QN7A 5WRFA 4P5PA 3A1UA 1YAHA 1H5QA 1XMSA 1TT5A 4UHEA 5F21A 1EWTA 3VR5D 3WMFA 5I7EA 2B8TA 2L0XA 5G1NA 1NOJA 4ZO9A 4BHTA 4F2GA 3M3HA 4RQTA 1V45E 1CEEA 4ALIA 3RHFA 1OU0A 4JNKA 2GEFA 1Y1KE 2FZGA 1YMQA 1RHUA 3F3YA 3HA7A 3LSTA 3WLLA 4CVNA 2X9QA 3WKCA 2NUPA 5GZ6A 4YUWA 8AT1A 4NAVA 4AXXA 3A06A 1HXHA 3RADC 1KC1A 3HVRA 1RCFA 3PLNA 4P0PB 2V1UA 1SD5A 3FYCA 1DHTA 1GGVA 3N2GB 4U7PB 2O3QA 3VR4D 3TIVA 3DDHA 2XBLA 1YR3A 1TQ8A 5BVHA 1VSUA 2BCEA 3FVVA 2PGDA 4H6PA 4PANA 4C0WA 3H9QA 4JJGA 1K5HA 3MRSA 4LXXA 5GV8A 4NMXB 1XAIA 1LPAB 3A27A 9MHTA 3OIYA 2P40A 3C7AA 3KQOA 4BNWA 2UVPA 2CNKA 3MTQA 1G21E 2IHVA 4QVKA 1CQIB 3G2QA 4QPCA 1FBNA 2QRHA 4D9EA 4JSYA 3TLKA 2C3OA 5IJAA 1F17A 2XCIA 4RKYA 3UTCA 1AUOA 5DYIA 4L27A 4YV0A 2TMKA 5CPBA 3EQZA 4QUEA 4DIBA 1AO0A 4OJQA 2WEKA 3GGOA 4Q0MA 2I78A 4ZVRA 4P2GA 1AS3A 1NZDA 1YIAA 2ZKIA 1J7JA 3WBFA 4KAJA 1Y8RB 4EVSA 1YNOA 1YQWA 1KK3A 4RK7A 3BGSA 2GKGA 1MDFA 3AMVA 3FR8A 5JCXA 3HL0A 3AR6A 3JQ8A 8ABPA 4WNIA 2K6GA 1E99A 2R2AA 2PBRA 2VI5A 3QYFA 4BJ1A 1R18A 2GKOA 4Y2HA 4Y67A 5CMLA 3TLEA 3HJTA 2M6SA 4I8XA 9ATCA 1I1HA 2OKCA 4FTWA 1ORHA 1CJCA 4B79A 1DO2A 2E48A 2J4DA 2XRMA 2O2GA 4GBED 1U80A 1E98A 4S2UA 2VSOA 4KIFA 3LJKA 4CIVA 1PWZA 2EKDA 3FKSA 4HV4A 2F1RA 4UHFA 1V4NA 2EHDA 4BYGA 4F96A 2R68A 3GJ5A 4KWHA 4ARAA 3MSCA 3CIOA 4XM1A 3EGDB 3OZIA 1FFXB 3C3MA 1HE3A 1ZMBA 2DE0X 1WTAA 4AZTA 2DERA 1US8B 1C4XA 2W6ID 3HI4A 4FC6A 1AMOA 4ZZ0A 4MDYA 3KAQA 3Q9SA 4HFJA 4I1YA 5LUBA 2VXYA 1ABFA 3QW4B 4BO4A 1SA0B 2R5NA 3WMGA 4DDUA 1EP3B 5E9AA 4JOQA 3QXXA 5HMLA 3VAZA 1V9SA 3U0BA 3BH0A 3VI4B 4PRYA 1VDZA 1AUVA 1XDUA 3FCAA 1WX1A 4ZPJA 4DSNA 3IS3A 4W7IA 3WDKA 3ZLVA 4BMSA 2RKWA 3R3ZA 3H5RA 4IWNA 1ZUNB 3I73A 4NENA 3OY2A 3DOHA 5COQA 5H1YA 1KEUA 2CK3D 4ZTBA 3IUNA 1Q15A 1PGNA 5EHZA 2RMKA 2ZJ0A 1KDTA 3HLKA 4LYJA 4WEOA 3NNDA 5DXJA