3N2IA

2.25 angstrom resolution crystal structure of a thymidylate kinase (tmk) from vibrio cholerae o1 biovar eltor str. n16961 in complex with thymidine
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
208
structure length
206
Chain Sequence
MNAKFIVIEGLEGAGKSTAIQVVVETLQQNGIDHITRTREPGGTLLAEKLRALVKEEHPGEELQDITELLLVYAARVQLVENVIKPALARGEWVVGDRHDMSSQAYQGGGRQIAPSTMQSLKQTALGDFKPDLTLYLDIDPKLGLERARGELDRIEKMDISFFERARERYLELANSDDSVVMIDAAQSIEQVTADIRRALQDWLSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate kinase
publication title 2.25 Angstrom resolution crystal structure of a thymidylate kinase (tmk) from Vibrio cholerae O1 biovar eltor str. N16961 in complex with thymidine
rcsb
source organism Vibrio cholerae o1 biovar eltor
molecule tags Transferase
total genus 83
structure length 206
sequence length 208
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2010-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3n2iA00
2W83A 2WWXA 2PMDA 5TDHA 1XNJA 3KZ1E 1PLLA 3HYRA 4GSYA 4TL6A 1QHNA 1JAHA 1M7HA 1Z07A 1G7CA 2V4ZA 3RS4A 1G291 2ZRBA 3GJ5A 2GXQA 2IL1A 1TAGA 3TAHA 4BASA 5DISB 1XJQA 4H1VA 3U7HB 2RGEA 2GEDA 1EFUA 2PBRA 3FOZA 1FPMA 4BLSA 1JAIA 3A37A 3AP1A 4R7ZA 2WOOA 3OIWA 2RMKA 5HCIA 2GBLC 2E1RA 3EX7C 2D3WA 3VTKA 2ORIA 3FHCB 2F1JA 5B2ZA 4TLBA 3M1IA 3MAAC 4M2LA 1E2QA 3Q5EA 2X2FA 2QT1A 3MUFA 2ZJ8A 4MGYR 4TT3D 1E98A 2GETA 4KV9A 4L4UA 3QQ5A 1W0KA 1S1CA 5FI0B 2HT1A 3FTQA 3MCAA 2FSIA 3ND9A 3TUIC 2BKUA 4C0LA 4RD2A 3KQLA 2GXAA 2NMVA 4M9XA 4ZCMA 2IT1A 1KJWA 2HUPA 5F2EA 4PO8A 3K0EA 4TZ0A 4QM6A 4NCIA 4OKSA 1S3SA 1YR7A 3EC1A 1TNDA 4KSCA 3RC8A 1UF9A 4DEYA 5EXPA 1K5GA 4B35A 4E03A 2ZRNA 1I2DA 3U7FB 4MKIA 4TTPA 1A2KC 3GD7A 5J4KA 1T0JB 4Q1BA 1CRQA 3PEVA 4ZI2A 5K8UA 1O3YA 2WBLC 2YOGA 5EZ6B 4B3DA 3OEEA 3W6OA 1KMHA 2QGZA 3PEWA 1OB5A 2AN9A 1XXHB 4BFUA 4DUGA 4KLZA 2ZQ5A 4QBGB 2A7QA 4IRUB 1EFHA 4M4SA 4D0GA 5AUQA 2NIPA 3BWDD 4ASUA 2V6JA 4KVGA 2XX3A 1Z0DA 2PCJA 4LY6A 1ZM9A 1X1SA 3OAAD 1F2TA 4ARZB 2B8TA 1R10A 2Q3FA 1JJVA 4EJSC 4MYUA 2W00A 2BCJQ 2QA5A 2HXYA 1E6CA 1HT2E 1QRAA 2WIBA 1B23P 4QG7A 1UKVY 1GRRA 1L4YA 2IYTA 4DZZA 5B64A 1SKYB 5CDFA 2XNDA 5AUPB 1XXHE 2ZRFA 3QF4B 2XITA 4EPYA 2F1HA 1EFCA 2V6IA 3Q7PA 2IUSA 1G8FA 2QAGB 1JECA 3CPHA 3K9NA 2ZVPX 3TH5A 3E70C 4B32A 5FPTA 2BEKA 2XOKA 3CX7A 4PC6A 2AL7A 3NEJA 4BWYA 1H65A 1P6XA 1CLUA 3L2OB 3QKRA 1NMXA 2QUZA 4DT1B 4R71A 2ZU6A 3KUCA 1S3GA 4P4TA 1D6JA 3DOFA 4NCHA 4QHYA 3DKPA 5C1BA 4AG6A 2YYZA 2FFQA 5HKKA 2N42A 1YR9A 1P9NA 5FBRB 3EC2A 6Q21A 2CJWB 1KK0A 3P4XA 4OHZA 1S96A 4DCTA 3FKSD 4KSBA 3VNVA 4C9BA 1YR8A 2D62A 1FNNA 1P60A 2AK3A 2QPTA 2QRZA 4PPFA 1OXSC 3QXSA 3ZQ6A 3QXCA 1GKIA 1LW7A 5KU1A 4OHVA 2H57A 4RCYA 4HB0A 4RFSB 1FL9A 2IYLD 5AJZA 1KO7A 1OSNA 3LLMA 4X8OA 4CF7A 5IHPA 2JJ2D 3SJAA 3KTAB 1R0ZA 1W5SA 4QL3A 1Q22A 3KUDA 2ZYUX 1W4AA 2VL7A 1VYUA 1GM5A 4Q03A 3QXJA 5KDLA 2VHTA 1TF2A 3AP3A 3VR3A 5DYIA 2P6UA 2W6JD 2W6ID 5DI9A 5JI2E 2WPDA 1UJ2A 2X77A 1BH2A 4C0SA 2JLZA 5EP4A 1OB2A 3NHAA 4F4CA 4QBIA 1SVSA 1U8YA 2DBYA 2IBMA 4II7A 1JJ7A 1WDTA 2HF8A 1G3QA 3KJIA 3AP2A 3B82A 3AUXA 1YZTA 4MITA 5CIQA 2XXAB 1E9DA 3AGPA 1BMFD 2HF9A 2ZJBA 3UMSA 1NKTA 2JATA 4EQ6A 5KNBA 4PAOA 5L3SA 1G16A 3PFIA 1GNRA 4F7WA 2FFHA 3KQNA 2ZAOA 5FOWA 1XXHA 3K0CC 2C98A 5AJWA 3DZDA 4B3FX 2PZFA 1FQJA 3GPLA 4TYNA 4FWTA 3ZZ0A 5HCNA 3T06B 1CJKC 5CM9C 4AI6A 2Q6TA 4XSHA 1RFLA 1EFRD 1VG1A 1E0JA 3QUSA 4WW0A 3WRYC 2MMCA 4LOAA 3HDTA 1KMQA 3V4RA 1Q1ZA 1U81A 2HYDA 5EJEA 2FN4A 1TU3A 4JZKA 1VMAA 2REOA 2OAQ1 4XJXA 2IYQA 2P67A 4L8GA 3CB4A 4IHQA 4TMTA 1X8JA 5F98A 1RRGA 1N2CE 3IILA 2Q3HA 1S2MA 4IW3B 1DEKA 3UPUA 3Q72A 3QF4A 4DKXA 1FP6A 2WJYA 1KSHA 2R8RA 1IQPA 2XNSA 3ADCA 1QF9A 2FX3A 2C9CA 1DVRA 1UPTA 4UJ3A 4M22A 4BLTA 5LPNA 4TN1A 2ZE8A 4TQUS 3SNHA 2AWNA 4XOIA 1KIMA 3IBYA 2IEZA 1XMSA 3QG1A 1W36B 4TTQA 3KJHA 4A6XA 4Q1CA 1VHTA 1DAFA 3TW4A 2RGDA 1W1WA 4B2PA 4D6PA 2O8BA 3W6NA 4Y0VA 2AWOA 3SE0A 2JLQA 3R9WA 2IF0A 4F38A 5KHOC 4TMWA 2CJWA 3PEYA 3AUYA 3L0PA 1IAQA 2ZREA 4D4KA 4IKEA 4I4LA 3I62A 1FTSA 2OLJA 4KBFA 3U3OA 3IKJA 5G40A 1FNMA 1W47A 4I1SA 2F9MA 4EFMA 4CT5A 3D6TB 1TEVA 3B60A 2O0HA 1YRAA 3H4MA 3EZ6A 4QJ3A 1AN0A 2VA8A 3TJZA 4PPQA 3KTAA 1RRPA 2ZROA 1NF3A 2NGRA 5EUMA 3THYB 1OFTA 1FX0A 1YVDA 1JPJA 1KO4A 2ATXA 3M0EA 5E7JA 2WHXA 3LD9A 3I5XA 4JJKA 2EQBA 1E9RA 2ZRIA 1R0WA 3SS8A 2VP5A 3AKDA 2DPXA 2A78A 2QMOA 1VKJA 5FL7D 1Z22A 3P26A 4C2TA 1W0KD 3AB3A 2FMXA 2R44A 4O3MA 3PUYA 2ZS8A 1GRNA 4B2IA 1TEXA 3FE2A 1YHNA 3VFDA 2VQSA 3RANA 1UEIA 2FWRA 2ZYWX 2ZUCA 3RSOA 3W8RA 3Q9LA 3HU2A 5CLLA 4BLRA 2XXAA 5KDOA 1XDBA 1US8A 2P65A 4OK3A 4QNMA 3HWSA 4D82A 4PO9A 2QMHA 2AXNA 2FH5B 5JCPA 4Z54A 3CW2A 2QPAA 2R6DA 1IXZA 3LWNA 4TLDA 3RLFA 3IDQA 2CL0X 3NBYC 3BB1A 3O8BA 4ON9A 2V3CC 2EWVA 3U7EB 4CEJB 1LFDB 4A4DA 4YQFA 1L2TA 2C77A 1PUJA 4RKFA 5AJXA 2GZHA 4EDHA 3P20A 1WB9A 1RZ3A 5JJLA 3K9LA 2H17A 3F8TA 4OJKA 4Q9LA 2RHMA 4DUGD 1T8TA 1K6MA 2ZS7A 4TSFA 1QHGA 3CONA 1Z8FA 4LV6A 4M1OA 1VG9B 1XD2A 5M04A 2A5FA 1UBFA 4ASUD 1QBKC 4ZKEA 1XTRA 4ACAA 4DEXA 1XD9A 3BFVA 2WTUA 4OJQA 3QPWA 2CCJA 2QAJA 3AKYA 1TQDA 1QHIA 4AWXA 2Z43A 2D7CA 3KDSE 2J9RA 2OM2A 5SZJA 2XNDD 1GL9B 1ZU4A 2F3RA 1FTNA 1MRNA 2BMFA 1IY1A 4LYAA 1NLFA 1MRSA 1I4LD 3JVVA 4LBYA 4JLJA 4C0JA 3KKQA 2BM0A 2WSSA 4H1UA 2QE7A 5C2JB 4ZV4A 1E1RA 4KJZA 4D25A 2WOJA 2Z4SA 2ZE6A 2ORVA 4HDCA 3OEHA 1KY3A 1TF7A 3DMDA 1QZXA 2J7KA 3PJRA 4TQ9A 5HKKD 1XCPA 4Q7LA 5FPHA 1M2OB 2O8EA 2VH5R 4BPBA 2GA8A 3BORA 3PENA 2J0SA 1KI9A 3A1SA 5HR5A 1NJFA 1ONBA 2V1XA 2FA9A 3B1ZA 1Q3HA 1P2TA 4PC1A 1Z0JA 3THYA 2O8CA 4DIDA 2GXUA 2ZANA 2QAGC 2O0JA 3GEHA 3ZGXA 4B6FA 2WWYA 4P33A 2ONKA 1E0AA 4XVRA 2CXXA 1ZNZA 3B5JA 1SHKA 2W58A 4FMCF 3CNNA 4IDNA 4A2QA 4OHXA 4W7SA 1Z2CA 2ZU0C 1EG7A 2VTKA 1KDTA 4MRRA 1A2BA 3PXGA 1S0UA 2GJAA 5J4LA 2QP4A 2QP9X 4B3CA 4FMCB 2W0SA 1GNPA 4EAQA 1MABB 1WBDA 2MSEB 2VO1A 4JLBA 3R7WA 3MG9A 3THWB 2RHDA 1NMZA 3PEUA 3SJCA 1BYIA 3H84A 1KGDA 5FBWB 1PV4A 5BW8A 3FFAA 3I5YA 3BGWA 3ZIAD 1E69A 3GJ6A 3EPHA 3KXIA 1LS1A 1OH5A 5LD2C 4G5RA 4OQNA 4PSKA 1LVGA 2GCOA 4LHZA 4QGAA 1GL6A 5GVRA 1AJEA 5KUTA 3DM5A 4BZXA 3CNOA 1A82A 3QKSB 5JSZB 2HEIA 1R5NA 8OHMA 4TMXA 1CXZA 3VHXA 3TGPA 3KXKA 3I3SR 1TU4A 5LBIA 3AVUA 1AKYA 3K9GA 4KXFB 2UVQA 3ZS8A 1GRQA 1VCOA 2CDNA 2C9OA 2JASA 4R9UC 2QZ4A 2LKDA 5FOTA 1R2QA 1KAOA 4MKGA 4AKGA 4DCVA 4V0MA 2HJVA 3CRRA 3FMOB 3RABA 3LY5A 1E79A 1TUIA 3KFVA 4G0NA 3B13B 3T5DA 3KKNA 4UNRA 1E9CA 2XJ9A 4B71A 3FHOA 1BOFA 2Z0MA 2H5EA 3GLHB 5CK4A 2VBCA 4DLTA 4CEHB 3LAWA 4V0LA 2IYYA 3BFKA 1NVUQ 4URXR 2IA5A 1XZPA 1DAMA 2BIFA 3G5UA 4LPSA 1OH8A 1RC8A 3IPXA 2ONJA 4TQAA 1ZUNB 3L0OA 1A1VA 3U44A 1XJ0A 2EFEB 2ZRGA 1OYWA 2ZRAA 2VP6A 4JLPA 3T61A 3CRMA 5H1YA 3KKOA 2X8AA 2OV2A 3Q3JB 4EFLA 3WYFA 2D2EA 1RE0A 3GLHE 1J7KA 2V8OA 1R5OA 1J90A 2JLWA 3NHBA 4HLUA 4JKYA 3QF7A 4BZPA 2QEQA 5FUVA 3ICEA 5JS7A 3CRVA 3L82B 1W36C 2WWHA 5LDDC 4AK9A 2WM9B 2IS1A 3UWKA 4TZ6A 1G8PA 2G3YA 2XTMA 2NG1A 1GZSA 4NBSA 2D06A 2QG6A 4RKEA 1I4DD 4QHTA 1XEFA 3VR1A 2FZLA 1GFIA 1JBKA 2JIZA 2LWIA 1SKQA 3IHLA 4NL4H 5CYOA 2G1KA 1Q1BA 1W4CA 2VHUA 1NJGA 3CLVA 5AUOB 2FSHA 4ITRC 1DAHA 1RRFA 1DAKA 2A5GA 1HE8B 1T4GA 3E5HA 3AVQA 1G21E 4Q48A 1KYIA 1CTQA 1R5BA 2EFCB 2J45A 2QM8A 2WWIA 2XAUA 4HB4A 4NKRA 4PANA 1NVWQ 3TSZA 4CVNA 4AKHA 3HR7A 3QKSA 2WSMA 3BE4A 3PUWA 1E2GA 2EU8A 1NL3A 3ZJYA 3GFTA 1Z63A 2V55B 1ZU5A 3CZPA 4NCNA 1OXTA 3SBDA 5GVSA 1NN5A 4WZBE 1JEDA 1FW6A 1XPUA 4B75A 4TSFD 4IOMA 4YXWA 4DB4A 3AQ4A 1E4YA 1D9ZA 1J99A 2C5LA 3T34A 2AX4A 5LB2A 4DJTA 2IK8A 3A1VA 1N5IA 2ZM5A 4AIIA 4M53A 5P21A 3TMKA 1MO6A 4Q66C 1MV5A 4D0NA 2CLDX 3KJEA 3U3KA 1AM4D 3TUZC 1E2EA 2WJHA 1KK1A 3RRNA 2NO1A 3GLHA 4HAZA 2PCLA 1T6NA 2ZR0A 3ECCA 1SXJA 3TVDA 3LLUA 2G0NA 2JJ1A 4HAVA 3DM9B 5JWRA 3ZDQA 3WYGA 5SZKB 4US1R 1JR6A 5EP1A 1U0HC 1KMHB 1C1YA 2ZRDA 1II0A 3ADBA 1U8ZA 2WSSD 4P4SA 5AJYA 3SN6A 1E1RD 5B58C 3W6PA 1P9RA 1W5TA 3ZLJA 4NYMR 3LVQE 2BC9A 1GILA 3OEHD 2BMEA 3AF2A 2QQ0A 4A0RA 1MH1A 1T8UA 1CEEA 1F2TB 2CE7A 1XX6A 4ZO4A 3TKLA 4XVQA 2WWWA 1P2SA 4DLXA 1GITA 1ESNA 2F9LA 2RKOA 4IFEA 1VCMA 4DXAA 3TR0A 3JZMA 2IYWA 3KKMA 3SFVA 4WZ6A 4CW7A 2Q3MA 1VG0B 3MRSA 3CO5A 2DFNA 4QXAA 2F1RA 5KOYA 2A5JA 4Q4JB 2FNAA 1G18A 2DWPA 2UZ3A 4L9WA 2JA1A 1J70A 3NBZC 4TYWA 1I2MA 4B73A 1WMSA 4LK2A 1S9DA 1ZRHA 3RDPA 2EYQA 3K1JA 2YHSA 3UIEA 3LO5A 3K8YA 1A5TA 3QKRB 4CEIB 1P61B 4JKIA 1Z6TA 1N6PA 1TTTA 2A5DA 4FN5A 2QENA 1KI4A 4JT2A 2CLSA 4FD2A 5HZHA 1VIYA 5CDFE 1OYYA 5C46F 1CR4A 3U6BA 4IXMA 4PQRA 1KI2A 4V03A 2QSYA 1KJYA 3U60B 3TIFA 1H8EA 5CJPA 2WJJA 4LDJA 4WIAA 1YZKA 4C0KA 4GMXA 1Q1QA 4QBHA 4I1OA 4P31A 5FTMA 1N6NA 1NY6A 1GKYA 2SHKA 2IWHA 2OEPA 3VX3A 1WBBA 2ZRHA 4ZPXA 2ZI6A 3F3YA 5BYKA 1J8YF 5DGXA 2ODEA 1HQCA 4DDTA 1Z06A 3I8SA 4F4IA 3MFYA 3HR8A 1N5JA 3I4LA 4KVAA 2KE5A 1BKDR 2P6RA 1SULA 4A0FA 2LKCA 3QOFA 4NYIQ 5C4MA 1XTIA 3PUVA 4ZDIA 3A36A 4BECA 2F55A 5TV2A 2BKEA 2BHRA 5HE9A 2AD1A 2GESA 2BM1A 1DBSA 5EE1A 5TXGA 1KO1A 4JBWA 2AXPA 3BC1A 3QVUA 3CNLA 4GPTA 4NDZA 4PHHA 2CCGA 4PZLA 421PA 1E79D 5DLQC 2OG2A 5L3SB 4EQ6B 3NDPA 2VSXA 2EFDB 1MO5A 2CBZA 2J1LA 2Q9AA 4LJ4A 3L0IB 3KB2A 2GTPA 2FE4A 4P4UA 3V9PA 2DY1A 1Z0AA 2VF8A 3AKEA 3T15A 3SHWA 5KPDA 3O8RA 2OBMA 1KK2A 3BK7A 5E3HA 4JLMA 1FQKA 1Q20A 1W7AA 3I73A 2FF7A 1OXUA 2NZ8A 2G1JA 5JLJA 4TWZA 1II8A 3ZZUA 1ZAKA 3K70B 2BV3A 1P75A 4LJ6A 2ZS9A 4Q9JA 1E9SA 3CPJB 3OF5A 4ZCIA 1NMYA 1Q0UA 4U5XA 1TQ6A 5J47A 4QOSA 2V54A 5JCZA 5TMPA 3R8FA 2VSFA 4PAQA 1LY1A 3GLFA 1IN7A 2ZE5A 1OF1A 3PUXA 5JWHA 3LFUA 1DG1G 4Q4JA 1AS0A 1UADA 2IC5A 2CEAA 5HTKA 1JNYA 3RS0A 2J87A 2DFTA 1W0JA 2HLDD 4EPRA 2P3SA 4P32A 3IIJA 1G19A 1NVVR 2VHCA 1X8LA 1YQTA 3ASYA 3U2QA 3VU9A 4CEIA 3U4QB 1G5PA 4XWAA 4ESVA 3GJ4A 4D4MA 1OHHA 2QROA 4NCKA 1YKSA 2P2LA 4YMSA 2O8BB 3MD0A 2N1BA 4F93B 4AYXA 2VLIA 3DL0A 1SKYE 3QBTA 4HZIA 2C03A 2ZITA 3FDIA 4Q1FA 4WBSA 5J4VA 4DC9A 1ZD8A 5EE9A 2JAQA 4LJAA 1DAIA 4U02A 3NG1A 4I1VA 4KODA 2JIZD 4WOPA 5JS8A 2OAP1 2IYXA 3LNCA 3U7GA 2RH5A 4OL0A 1Z6YA 2ANCA 2CK3A 2ZIAA 5E7MA 4LJ9A 2GZAA 3AF0A 4DSNA 4Q9HA 3SZRA 4I81A 4R98A 4AC9A 2YKGA 4AG5A 3NIBA 1MO4A 1FX0B 1GKUB 3BH6A 3A6PC 1XMVA 2WVJA 1X3SA 3IIMA 4A82A 1TL7C 3Q85A 1ZD1A 1DO0A 4JLAA 2IX3A 2CHGA 3KL4A 3TVTA 4NH0A 5GJVC 4BZQA 4IVPA 5DYGA 2CCKA 4Q7JB 4IDOA 4YXWD 2Q9CA 2A9KA 5DNYB 3FGNA 3X2SA 5KNCA 3C5HA 3FMFA 5CM8B 3VR4A 4GBMA 4FMBB 3M4YA 3AKCA 3U3RA 4QJ4A 4Q9IA 4L9SA 5L8VA 1E32A 5KSZA 1R8SA 3WYAA 1ZM2A 3PITA 1US8B 2OHFA 4WZAE 3U6KA 4AURA 3QKTA 4RVCA 5FOXA 1OKKA 3EIHA 4GOXA 3QXXA 1JEEA 1QG4A 2CNWA 2YOFA 4K46A 4D4JA 4GNKA 1AKEA 1TUEA 1M6NA 3OZXA 1DADA 4LUCA 1S8FA 3FMPB 2JJ1D 1ODFA 3K09A 3LH5A 3QY0A 2C8VA 4KFRA 5GJCA 4XVUA 3A4MA 2DCUA 3I32A 4IXNA 4JIMA 2WWFA 4LBVA 4PC2A 3CH4B 3RRZA 1OH6A 4PHFA 3GJ3A 1RVDA 3LX5A 3NTUA 3X1YA 4C0QC 4QFMA 1XD2B 4LBZA 2OT3B 2RGNA 1DG3A 2J0UA 3TW8B 4DIEA 3IGFA 2OSBA 1L4UA 1W44A 3H86A 3RS2A 3SQXA 4GL2A 4XSGA 4BEJA 1S9HA 2GEUA 1DAEA 5E7IA 5EE3A 2JLXA 3H2YA 4H9GA 4GZMA 4RZ3A 3QXHA 1II9A 2PZGA 1ZVQA 1E9BA 1BS1A 1X86B 3D31A 4M9QA 1CP2A 3P27A 1KDOA 4P3YA 3RVBA 5FR2A 3U4QA 1ZBDA 2QY9A 4DSTA 4KYUA 1E4VA 2OLKA 1Z0IA 2CL6X 4W5JA 1VYTA 1CRPA 4BRUA 2IS6A 2IXEA 1E9AA 3KFXA 5JRJA 3B85A 3WXMA 1AS2A 2FEOA 3GMTA 3F5FA 2KJQA 3KQKA 4LC0A 3EG5A 2ZSFA 2ANBA 3DHWC 2HV8A 3IEVA 4PX9A 3GLGA 2O8EB 4E07A 1H8HA 4B43A 2PEYA 1G4UR 3JVUA 1GIAA 3RSLA 3CBQA 2YC2C 1G5TA 2ZE7A 2GF0A 3CRW1 2BMDA 4N0EA 5FTLA 2PX3A 4ABYA 1SVLA 4FINA 2O8CB 4JS0A 1H8ED 4JLNA 2PT5A 4PC7A 3NEYA 4IEEA 1GTVA 2ZTSA 3V00A 3LV8A 3MLEA 4KCGA 3MJRA 4NZYA 1ZIOA 2PMKA 1E2HA 4NPHA 1VTKA 3SYKA 4BFZA 2JLYA 1U9IA 5EP3A 1GWNA 3VR5A 1D8TA 3PV0A 4A8JA 2OBNA 1NG1A 1R7RA 3ZVNA 3BH7A 2C95A 3W3ZB 3B2EA 1NY5A 3OIYA 4UXIA 3VQTA 1P5ZB 3R7WB 2GRJA 3UG6A 3OIUA 2DYKA 1E2NA 2V7QA 4C2UA 2FU5C 5DHAA 2NO0A 1E2KA 2WJGA 2IYUA 1DARA 4HI0E 2YC4C 4EPXA 3E2IA 1FUUA 4M1KA 4YDSA 4UNNA 2ZYVX 4DVGA 1AGPA 4L15A 4IDHA 2FV8A 5FL3A 1D2MA 1Z28A 4OHWA 2YINC 1GSIA 1U94A 5B30A 2GCOB 1G7TA 2RB4A 3OEED 2IXFA 2OESA 4BFVA 2O8DA 2GVZC 3S1AB 2ZRPA 3EZ7A 2DFLA 2WKQA 4IOJA 2BOVA 3DOEA 3I92A 4V0NA 4XH9B 5L3QA 1SHZA 1E99A 2QGNA 2H1LA 4XTRA 1OFUX 4HYYA 4HLCA 3G82C 2FSFA 4ZKDA 5H70A 4RFVA 4F4JA 5JWOA 1RPZA 4QGFA 2Q0HA 2E9SA 1A4RA 1P4SA 3MGCA 1D9XA 1N6IA 1V43A 3CF6R 4XD7A 1Z83A 1U98A 5FUXA 5ANRB 4MRVA 2RGGA 2E87A 4IOLA 4NE2A 1G6OA 2OBLA 2CL7X 4E5UA 2CE2X 4LI0A 5CK5A 1SVWA 2GNOA 3MJHA 1KAGA 4A2PA 2H8KA 4RZUA 4NYJQ 4C0BA 2OCAA 2IUTA 5FPYA 5KSOA 1SGWA 4TYQA 1G8GA 1G4AE 5IRCD 5GJBA 1NBMA 3N70A 4MQBA 2VSOA 1WRBA 2ODNA 3RWOA 3GLIB 5F9HA 4KHZA 1W0JD 2G0TA 1VDZA 2XOKD 4BUJA 4CT4B 4ZDWA 4MDFA 3RHFA 3IPYA 1LF5A 2WAYA 3ONWA 1R4AA 1OHHD 5K8IA 4GDFA 2F43B 2A3RA 1OIVA 3HU1A 3K70C 4V0ME 3UWOA 3WY9A 3U44B 1ZMXA 1OH7A 2F6RA 4BFTA 1V5WA 4RD0A 4O2RA 3VKHA 2WKRA 3GLIE 5DO9A 2R2AA 4XWOA 1AA9A 5H8WA 2CK3D 2MSDB 4ILEA 4PPGA 3I61A 2VIIA 3B1WA 1KI3A 3MWYW 2H92A 3QPUA 3AVWA 3W90A 1QHXA 2ATVA 1IXRC 2QQEA 4B6EA 1PUIA 1TX4B 2FPKA 1F6BA 2JEOA 4MKHA 4MGKR 5DE3A 2OCPA 1YE8A 3PCRB 2XB2A 1TQ4A 5JEDA 4DWJA 1T3SA 4HUQA 4DLRA 2FJUA 3R9IA 3WHLA 2XTNA 2UKDA 2YJTD 3MWLA 4O0MA 5E4FA 1RYHA 2RGAA 5CB6A 3VR6A 4L5BA 4TLAA 2OXCA 2WPDD 2XEXA 2J59A 3CM0A 1L7VC 1DAGA 2PEZA 3TQFA 4PQYA 1F2UB 4LV5B 3GJ8A 2VP2A 4V0OA 4URVR 3IO3A 2ZSDA 1M1YE 4BFSA 3IHWA 4M9SA 2GAAA 4MRNA 1COWA 2NPIA 4ESHA 4Q4AB 1D5CA 3BAFA 3A1UA 1OKKD 2O5VA 2QTVB 1G3MA 3UANA 3AM1A 2OFXA 4JLVA 3S1AA 521PA 4YMUA 1IY2A 2CNWD 2ZPTX 4PPNA 2D4HA 4A92A 1AQUA 4HAWA 1G1MA 5JZVA 3EIEA 4RD1A 3BB4A 2EWWA 3K0FA 1OT3A 2ERXA 2ECKA 3H1TA 1J2JA 4GI7A 2IF2A 3D7MA 4UNQA 2RGBA 2BJWA 4PZYA 1G7SA 3X1WA 3DZ8A 4FCWA 2H16A 4Q00A 2BCGY 3K70D 4D2IA 3C16C 2RAPA 3A1WA 5CLQA 2H7VA 2RGCA 2TMKA 2C9YA 5DI3B 2CVFA 3NC1C 4TL8A 5GJWC 2BBTA 5JECA 2PJZA 5FBLB 4KLNA 1TMKA 3GLIA 4M8NE 2B7CA 4QGGA 4BFWA 3KQHA 1SXJB 5C4GB 5SZHB 4JVSB 3HP1A 2A2ZA 3LQRA 1KI7A 2F43A 4Z8YA 2GILA 4POAA 1EWRA 3NDBB 2Z4RA 2IYRA 1KZ7B 4P4SB 4YC7A 2JLVA 4N0DA 3B1YA 3ZH9B 1E0SA 1E94E 4KFTA 3PR1A 4Q1EA 4CDGA 3LVRE 4A0GA 1JR3A 4YMVA 5JI3E 1OW3B 4RY2A 5CIWA 3SI7A 3T1TA 2ASEA 4IJMA 4ZI3A 1E3MA 1JI0A 2C78A 5BN4A 2I3BA 4A9AA 3QSYA 2P6NA 3W9YA 1S1MA 1H8HD 2RCNA 4IFBA 1XP8A 4LJ8A 4HDOB 1IJFA 1SXJE 3C4JA 1M8PA 3SBEA 2QBYA 1EFTA 2R62A 4KFUA 1AQYA 3W3AA 1VIAA 3NBFA 1X8KA 2PJRA 2W2TA 1D2EA 1N0UA 2ZJZA 5SZIA 2D7DA 4M1MA 3GQBA 4Q19A 1KJZA 3SU8A 3IO5A 3J81k 4FI3C 1N5LA 4FCTA 3BJIC 5DHFA 2Z6VA 1CF4A 1NIPA 3TBKA 1DTSA 3HPQA 3PG5A 5FBQB 3ZS9A 2CMKA 2IHBA 2DB3A 5JJIA 1F2UA 4Q4LA 3WNCA 3QBVA 3GEEA 3UG7A 4B48A 1HE1C 4HAUA 2WMOB 2KB0A 3QE0A 3F0TA 4EFNA 2QM7A 1F3OA 1UKYA 1O87A 1W49A 2JJ8A 2V7QD 3L8YA 3QG5A 3WMGA 3K0AA 3EZ9A 3FYHA 4Q4AA 4JL8A 3SOPA 5K8TA 4AKIA 2ODWA 2DFKB 1GP2A 1CBUA 2J3EA 2GKSA 3U61B 4KYIB 3UATA 1ZINA 2YWHA 3TLXA 3REGA 2DWQA 1SZPA 1T91A 1KI6A 2DWOA 3WRXC 3MSXA 1NKSA 1YZGA 2GVDC 2B6HA 4OQFA 3ZVRA 1YZLA 4R2IA 1ZC4A 1SVKA 4NCJA 3GP8A 4GP7A 4JBYA 1HA3A 1MT0A 5JHGB 1GOTA 4ZIRB 4BGDA 3R8CA 4L16A 3EZ2A 2V1UA 4B76A 2OZEA 4OQMA 5HPYB 1XTKA 4TLEA 5DI3A 4D81A 1EWQA 1NG9A 1HT1E 3NH6A 1CJVC 2B92A 3CKLA 4XD7D 3TNFA 3TUJC 3FB4A 2NPFA 3VKWA 1M7BA 4G5GA 4B74A 1FOEB 3T35A 3OHMA 4EPWA 4JT4A 4P0TA 4NTZA 4RSGA 4DCNA 4EJSA 4NP6A 3EPKA 3QVVA 3IBGA 4M1WA 4OQLA 3FPAA 1NI3A 1NBMD 2AKAB 4QRHA 4G3XA 1Z6GA 2ZRMA 5FBVB 2NO6A 2QE7D 3DVLA 2GJ9A 2ZVQX 5IDVA 1P9WA 2QNRA 1IY0A 1EK0A 2BWJA 4OI2A 4KFSA 3THXB 1HUQA 4F92B 2CLCX 2I1QA 1UKZA 1G20E 1VECA 3B8HA 3FHTA 4BQSA 1TADA 4Q4HA 4JVLA 1N6RA 4QM7A 2D2FA 3A1TA 1II8B 5D3MA 1E96A 3QNUA 4DHEA 1Z5ZA 2JLRA 2CHQA 2R65A 2ZI7A 3E1SA 4JVMA 4LHXA 4M1SA 4ZCLA 5KSYA 1T0HB 2AK2A 2DHRA 2O0KA 3VNUA 3GLFB 1R8QA 4AYTA 4A15A 3A4LA 1HURA 1GG2A 1CJTC 1E1QA 2GWHA 2VEDA 3DKVA 3IUYA 3L8ZA 1QVRA 4FWIB 1VHLA 1ZNXA 3DEFA 5G3YA 3SYNA 4C0AC 5B57C 4B33A 5DN6A 4C4PA 3CH5A 2ZETA 3TK1A 4PTLA 4ZDKA 3BERA 4RD3A 4RZXA 2ZRKA 3PQCA 2ZJOA 3LBNA 1XTJA 1FFHA 1NN0A 3VU9B 3EPLA 1NNEA 5EXXA 3B9PA 4A1FA 2W0MA 1NRJB 3MMPA 3C14C 1PVOA 5KO2A 1JXMA 1E2DA 4GMDA 1AZTA 5LB4A 2C2HA 5A5GA 4LYHA 4K81B 1W46A 3AVOA 1X6VA 1X1RA 4UXHA 1KSGA 4QKQA 1ZC3A 3GLFE 4GOKA 2B8WA 4PC3A 2BMJA 3X1XA 2OXRA 2ZR9A 3AVVA 3UMRA 3LXXA 2AR7A 4HLUC 3X1DA 4B2LA 4Z1MA 4MYCA 1COWD 4DLZA 4QHSA 4OHYA 1QDEA 5J4YA 4D26A 3FFBA 3N2EA 4OQXA 4QGHA 2GK7A 2J46A 2N46A 1LNZA 2ZJAA 3EXAA 3PUZA 3KB1A 4XTCS 3QI2A 4ZIRA 3LQQA 3BB3A 3BIFA 3CPEA 2HCBA 1PLKA 2Q21A 4GRAA 3QPVA 4EUNA 4S2EA 2ZI9A 5FI1B 1ZW6A 4Y0AA 1GL7A 3K0CA 1UBCA 1ZM7A 1GAJA 4UNPA 3BBPA 3TSOA 4GFDA 1WF3A 4HATA 4JSYA 3P4YA 3SJBA 5FL7A 1NLYA 3IIKA 1P7CA 4M21A 4DSOA 1AIPA 1CR1A 2J7PA 3SYLA 2CHVA 1IM2A 4BLQA 2FZ4A 2YOHA 3FMIA 5BXQC 3SDZA 3TR5A 4TYYA 1KKLA 3QIAA 4CYMA 3QEJA 3PVSA 2PZEA 1TF5A 1P2UA 1KO5A 1XCMA 4E09A 5BWMA 5FUWA 4LYFA 3R20A 2AHOA 4UQOA 2R6GA 3WBKA 3MWJA 621PA 5JHHB 2OUKA 2GZDA 3WMEA 3THXA 1F60A 1XBTA 2Z5FA 1YRBA 2BDTA 1UEJA 3M6AA 2ZUDA 2LCFA 2HCJB 2VF7A 2OILA 2NOAA 1OXVA 1Q12A 3T5GA 3T1OA 4WXPA 2VRWA 2QMUA 5HE8A 1ZCAA 1YU9A 2ZJ2A 3FWYA 1JR3D 4DBLC 1KOFA 1T3HA 2J0UB 2J41A 1XTQA 2C04A 2G83A 2PT7A 2VYFA 1KK3A 4GZLA 1ETUA 5IK2A 3AVXA 2FPMA 2ODBA 1KHTA 4A2WA 2F3TA 4QJ5A 1OJLA 1FMJA 2PL3A 3HYTA 3ND8A 3OESA 4TMZA 4PR0A 3T12A 1UBEA 1G5RA 2GK6A 2YV5A 2KBEA 1KO8A 3CF0A 1SXJC 3GJ0A 1N0WA 1JQJC 4OI0A 3LW8A 4NU0A 1KTVA 3BH0A 4TL9A 4URYR 4BE7B 1XPRA 1K8RA 2ZSBA 4DDWA 1UDXA 2O8FA 1ZD9A 1MKYA 1XMIA 3ZD7A 2X2EA 3EAQA 2YZ2A 3Q8XB 1SQ5A 1K5DA 2VP0A 2WKPA 4E22A 1CJMA 1OE0A 4I99A 4J0QA 5AR1A 5L3RA 2ZR7A 2YWGA 3A8TA 3CX6A 3W5JA 2FGKA 1Q1EA 1EGAA 1KDPA 2J5XA 3UXMA 2XTZA 5J4HA 3GLGB 2GCNA 2WZQA 4URZR 3HPRA 1CULC 2VP4A 2I1VB 2OE2A 4Q02A 1U2RA 1Z47A 3CIOA 4G01B 2HXSA 4JL6A 2XZPA 3CWZA 3Q5DA 1VCNA 1IN4A 1WP9A 2WJVA 3CRQA 2XGJA 3GJ7A 5EQTA 3UK6A 1MR3F 2FDCA 3SFZA 3VKGA 3CWQA 5TY0A 1T9HA 1FMLA 2RGXA 1G64A 1U0JA 2UZIR 3GLGE 1XU4A 2PLFA 2GJSA 4IDPA 4A8JB 2QORA 4JVNA 4LJ7A 2G77B 4NYIR 4URUR 1S4QA 1N6KA 1NSFA 5LD2B 1U8AA 2L0XA 1Z3IX 1IN6A 1NN1A 2VPPA 4D0LB 4RD6A 5CITA 1G3RA 2REXB 3NKVA 1KKMA 4OI1A 1KNXA 3AEZA 3IEUA 1JB1A 2FFBA 2Y8EA 3ADDA 3B6EA 3RWMB 1OIWA 4DLVA 2OCBA 3AH8A 1DOAA 4JJZA 1DELA 1Q21A 2GHIA 5KDDA 4G5QA 4PO1A 5FPSA 4ERNA 4A36A 1YZNA 2P5TB 4Q47A 2NTYC 2CVHA 1XMJA 4KBGA 1RW4A 121PA 2QPOA 1SXJD 1KNQA 2KWIA 1AS3A 3NC0C 2J0QA 3ZIAA 1IXSB 5J5CA 2XJ4A 1QVAA 3BRWD 1PZNA 3RRMA 1N3BA 2ZI4A 4LCBA 4KO8A 2HJGA 1P72A 1JXOA 2O8DB 2QU8A 2XSZA 3TRFA 4TLCA 1XRJA 2FG5A 2GXSA 4YMWA 1T3LA 2BVNA 4IEIA 5L3QB 1IHUA 3PIRA 1ZP6A 3A4NA 1I4TD 2GDJA 2WIAA 1HEIA 1ZCBA 1M34E 1G8HA 4URWR 2R6AA 1VYVA 1N6HA 3VHLB 1E9EA 3B1XA 3SQWA 1W4RA 3I1FA 3DO6A 4LHYA 5BN3A 1P62B 3EWAA 3GCGA 4LBWA 4O2LA 4ARZA 4BEBA 4DDVA 5F9FA 4LHVA 3O8DA 2X1VA 2YNMA 2JLSA 3KX2A 2P5SA 1FUKA 1E2LA 2IXGA 2PH1A 2GAOA 1U99A 4FMDF 4LJ5A 3RS5A 3BD9A 3R9XA 4EIWA 2ZXUA 1TQ2A 4G5OA 2GEVA 5F3WB 1E1QD 1N25A 5TARA 4N3NA 3O47A 1ESMA 4JLDA 5DN6D 4FMDB 1G3UA 1Q57A 1F48A 3WBJA 5AJVB 2QAGA 1KSFX 4KI0A 4CIDA 1UKEA 4MRSA 4MUBA 3SC3A 3NVAA 5FUYA 2V9PA 2ZI5A 2XZLA 4GT1A 1XCGB 4OI4A 1U0LA 2EVWX 4DT1A 5BN5A 4Q1DA 4OK6A 2MSCB 4JMPA 4UNSA 2FEMA 1TPZA 2O52A 5JMTA 1Y3AA 1HH4A 2A30A 1NIJA 2QP3A 1NBME 3EIQA 1KDRA 2WV9A 1E2JA 1XEXB 5EXSA 5FFMA 3QEOA 4C7OB 1W2GA 4IOKA 3T1QA 4HZUB 1NN3A 2FSGA 4Z1MD 4ZDJA 1IN5A 1NVXQ 4HB3A 1UAAA 3AV0B 4NMMA 1VG8A 2ZAMA 4RFSA 5KNDA 3I8XA 2WICA 1SVIA 4BLPA 2AFIE 3AF1A 3EA5A 4HUQB 1C4OA 3K9HA 4U7DA 1N6OA 1UBGA 2WAXA 4D4LA 4F91B 2QTHA 4HUTA 3ICQB 1N6LA 3DDCA 1QHYA 5EXTA 1XZQA 1XFAA 2AD5A 3GFPA 4PXAA 1E0KA 4X8HA 2BBSA 3OFNA 3SHFA 4IVRA 2HYIC 1UFQA 4US0R 1DO2A 4QNRA 4KITB 2BJVA 2J7PD 4AD8A 1E2IA 5AUNB 5G41A 3CR8A 5JBQA 2QMEA 1T5IA 3LW7A 4TMKA 5GADl 1G6HA 1WQ1R 4XWKA 1KI1A 2ERYA 2IHYA 2X19A 1UM8A 1KY2A 3KXLA 4A6PA 4WVFA 5L3VA 1RYFA 4Q7MB 4X8LA 1KSJA 4D80A 2C96A 3UMFA 1Z0KA 3K0FB 3AVTA 4Q21A 4RZ2A 5J40A 3N5CA 4UXJA 1CR2A 1RIFA 5BQ5A 1WA5A 1XEWY 2JLUA 1RKBA 1NP6A 3NXSA 4V0KA 3WNBA 3FKQA 4OBEA 2HT6A 2IS4A 1PLJA 1XEWX 2JDIA 3V4FA 2NZJA 1R6BX 1VCIA 4JL5A 3THOA 3N2IA 5IK2D 3WHKA 2QT0A 2ZYTX 3KKPA 4PZZA 2BEJA 4Q9KA 5FR1A 1N5KA 5CYPA 4JLKA 5KYKA 2GCPA 1JALA 3UKDA 1GUAA 1CJUC 1RJ9B 1BYUA 1OXXK 5TB5A 3O8CA 3EW9A 3L0SA 1R0YA 1NSTA 2QTFA 2OCYC 3K09C 1LF0A 1DPFA 3AVPA 4PQFA 3RRYA 4QC2A 3K53A 1ZIPA 4BFYA 4DLSA 1OIXA 4B3BA 1ZYUA 2IYSA 1IN8A 1ZM4A 1Q44A 5FOVA 3L43A 2RGNC 3C15C 3SJZA 4WA7A 4N1AA 1IBRA 3NBXX 3ZZTA 5IT5A 2NQ2C 2ZJYA 5D3QA 3ZQJA 3NH9A 4B3XA 1XEXA 4MGIR 4C7OA 4AKEA 1P3JA 4HZUA 3P32A 1XF9A 4O25A 2IS2A 4LHWA 1MOZA 4R2HA 2ZEJA 1C9KA 2VHJA 4HSEA 3WP0A 1Z29A 1WE2A 2QBYB 1YJ5A 3IQXA 1YZUA 3D8BA 1FZQA 1OLOA 2VHQA 2YWFA 3BOSA 4BRWA 3X1ZA 5A0FA 5FTNA 5FOUA 3CF2A 2D74A 3ZD6A 1JR3E 3LXRA 1MO3A 2FPLA 3OE7A 1BO6A 4MYHA 4YDHB 1SVOA 4UKDA 3LRPA 3WNDA 5EE5B 3FVQA 1XWIA 4NONA 3RC3A 2NO7A 1EXMA 4HAYA 5KSPA 3VR2A 1Q3TA 2YVUA 4BLOA 2I4IA 3RS3A 4X8MA 2ZI3A 2GJ8A 4JBXA 1LV7A 5H68A 4TL7A 1DS6A 3K0AB 5BYJA 1QHSA 1AZSC 1EX6A 3B7GA 3EZFA 1Z08A 4K8OA 2KI5A 2W2XA 3TSWA 3U3JA 4W9MC 4S35A 2R6FA 2HDNB 3Q7QA 4XIGS 4DLYA 821PA 1J8MF 2FGJA 1KI6B 5KTYA 1U9IC 1JPNA 1ZM3A 3U5ZB 4DB2A 1Z2AA 4FCVA 4A8JC 4LRWA 4DCUA 3GJXC 3WP1B 4DRZA 1XTSA 2KBFA 3QKUA 4CEJA 1ZUIA 4MYTA 4TT3A 1HQYE 2QL6A 2XSZD 4M0LA 3AF3A 4YONB 3U3MA 4CZ2A 4MKFA 1WXQA 2EW1A 3D3QA 4V02A 2IWRA 2REBA 4QBFA 1E9FA 4DDUA 2IYZA 1P2VA 1HYQA 4LX0A 3REFA 1AGRA 3KJGA 2JCSA 4YMTA 1U90A 5DSZA 4NYJR 2IYVA 1E2FA 4A0HA 1RJ9A 1BIFA 3CUEF 3TAUA 1QHHB 2QN6A 5G3ZA 1D2NA 3BS4A 4EJSB 3LX8A 5FPKA 4AY2A 1ZNWA 4G5SA 1Z6XA 2FFAA 1CKEA 4EPTA 2P0EA 4DSUA 2EFHB 5JJKA 4GP6A 1CS4C 2IEYA 3RYTC 4PHTA 1G9XA 3SR0A 4MRPA 1YR6A 2WMNB 1XPOA 1JQLB 4KU4A 2H18A 5TVKA 1OV4A 5JFGA 4YLGA 4LPKA 5E95A 1L8QA 4Q7KA 4AYWA 4WXRA 2J0VA 2QI9C 3JZAA 1ZUHA 4I1UA 2A5YB 1SVMA 1OFIA 2PX0A 4Q4HB 1F5NA 5UKDA 2OFWA 4RJLA 5D3MB 1ZNYA 2YWEA 1OFHA 3OAAA 4IVQA 4HEJA 3OIVA 4NHOA 3W5IA 3IQWA 3QJYA 1G8YA 5HZKA 3K0SA 4NYMQ 4B3GA 3RS7A 2IUUA 2ZRLA 1UDWA 3C41J 3KQUA 1XJCA 3EPJA 1GNQA 4PFSA 3HU3A 3TE6A 3HJNA 2ORWA 4RD4A 3VX4A 5AK0A 4LSGA 2ZJ5A 1GVNB 1HTWA 2GBLA 1G17A 4HLDA 3W34A 5CJ2A 1E2PA 1M74A 2G9NA 1OPXA 3RNLA 4US2R 4HDQB 1ANKA 3BFXA 1N0VC 4HB2A 2HLDA 1XB2A 2FOLA 4HLQB 4JSTA 3TQCA 3A58B 2BBOA 2G6BA 4LV8B 3ZYCA 4FXPA 2B7BA 2QSZA 3DMNA 5EZ5A 2XB4A 3C7KA 2W2VA 1ZJ6A 4B44A 3SEAA 1G7RA 5EE0A 5FTJA 1MABA 3AF4A 2R9VA 3ZVLA 3THWA 3OFND 4U00A 3NWJA 1KI8A 4MDEA 2WJIA 1LB1B 3FKSA 3ASZA 3EASA 1W2HA 1GDDA 3C5CA 3ETLA 2F1IA 5K8LA 2XZOA 5IF9A 3RAPR 2VP9A 1W48A 1T5LA 2R6CA 4B34A 1CIPA 5CB8A 4LJYA 1DE0A 3B1VA 4LWZA 2MMGA 1B0UA 2JJ2A 4TYPA 1Y63A 2AKYA 4W5WA 1E2MA 4C0HA 4W5HA 5JEEA 2AFHE 4G1UC 4UJ5A 4PSAA 3VAAA 5G53C 5JSZA 4GOJA 2B21A 3C8UA 1Z6AA 1IJEA 5AWFC 3CR7A 1G41A 4M9ZA 2W6JA 2W6IA 2KSQA 1FP7A 2G88A 5ELXA 4MH0R 2JDID 3T1VA 1P73A 2GF9A 1CU1A 3EARA 1QHHA 1RRCA 1IOZA 4HAXA 4FW9A 2OO7A 3DPUA 4RCZA 1EESA 1VPLA 3EWSA 2ZUBA 4JLOA 4LZZA 4Q5IA 4MA4A 3GFOA 4Q18A 3LBIA 5FH9A 5A4JA 4MUAA 1BMFA 4TTRA 3GEIA 4Z51A 1IONA 1QG2A 5DIFA 2PLRA 3P1JA 2Z83A 4OYHA 4Q1AA 1Z0FA 721PA 4IDQA 1WCV1 4TMVA 4ACBA 3WMFA 4B47A 4CEHA 1NLZA 4PHGA 2F7SA 1R0XA 2EFGA 3LA6A 4DCSA 3AVYA 3EA0A 1KZGB 3G0HA 1XD8A 2BBWA 3I72A 4LYJA 5KPJA 3B78A 1W36D 3LDAA 4FIDA 1EFRA 2QRNA 2ZRCA 3QENA 4MGZR 4PAMA 5JRZA 2DR3A 4JYBA 3B9QA 5FOSA 2ZRJA 3LBHA 1PJRA 1ELOA 2OFOA 1W4BA 4JYCA 5EUQB 4C30A 2K5UA 4EPVA 1YZQA 4PSVA 1HY3A 3MWKA 3ZVMA 2C99A 3AGQA 3CZQA 5DH9A 4DLWA 2WWGA 5EP2A 4DLUA 4M1TA 3W8NA 4EKDA 2ZSEA 5C18A 4CRWB 221PA 2JGNA 4Q01A 1A7JA 4BFXA 4C3ZA 1CR0A 2Q9BA 3VMFA 2O8FB 4OK5A 1AK2A 1HV8A 2EYUA 1M7GA 3ADKA 3CX8A 3BXZA 3H0KA 4LGMA 1EX7A 4M1YA 2GJKA 3OE7D 4KAXA 1LTQA 4WAUA 4LC1A 2NO9A 1G3IA 1NVVQ 2ZSAA 4Z8XA 5FTKA 4CGZA 1LS6A 2IW3A
chains in the Genus database with same CATH superfamily
3KZXA 1U4SA 1QZUA 4IQ0A 2WWXA 2I6FA 4YJ3F 4F86A 2PMDA 5JQWA 2KM1A 3B20A 2LRHA 1PLLA 4DR6B 4LOIA 1Z07A 1M7HA 3FPEA 3AERB 1G291 4UC0A 3KSZO 2ZRBA 2DEUA 3TAHA 1LFAA 1TAGA 1Z62A 3QWBA 4WZBA 4H1VA 4NFSA 4BASA 5HGXA 4LEIA 4L75A 2Z56A 1QWOA 5ICFA 3BWCA 3PC2A 1JAIA 1Q0ZA 3AP1A 4Y6LA 4PLPA 1LBHA 1VLLA 4ZYTA 1A0OA 3F2IA 2BFOA 2C9BA 3LK7A 3UGJA 4BPRA 3VTKA 4FU0A 4BX3A 1RVV1 3C6KA 3UK7A 4H3HB 1EXNA 3MAAC 1EK2A 3KO8A 4YLEA 3Q5EA 1L9XA 2OV4A 2R68A 3MUFA 3LXUX 5EIBD 5F77A 5DULA 4JJFA 4KV9A 5J2TF 3V1LA 1GQQA 5LXTB 3RVDA 1FVFA 2IY7A 3LUHA 3PPVA 5D1HA 1JLMA 4EBBA 1FTGA 1YGYA 3FTQA 3MCAA 3TUIC 2BKUA 4C0LA 4RD2A 5I01A 2GXAA 4JI3B 1QPZA 2SICE 4ZCMA 2CFCA 2IT1A 3S8EA 1T5SA 1CX9B 2HUPA 2YBDA 4J2TA 4PO8A 5K3BA 1DDGA 4TZ0A 3BD7A 5E38A 5JS6A 3CVYA 1OX5A 1S3SA 4HDMB 3EC1A 4HNHA 4PIVA 2BGWA 5B2EA 2XYHA 1Z8HA 3TQTA 3IA2A 3IDSA 2ZRNA 1I2DA 1OBFO 2FN9A 4CXMA 4CLHA 3VJMA 3OO0A 4HH4A 5LQNA 3CFYA 1A2KC 3GD7A 4WFQA 2VDKB 1CZLA 4C3UA 4PBSA 4CCAA 1KFJB 3PEVA 3OT5A 5A4FS 4EFKA 4F2HA 1HYGA 3OZGA 3L8DA 4MR8A 4L4ZA 1VMIA 1XZMA 2GCEA 4QARA 3TLKA 4RK4A 1FSZA 4CQNA 3DF9A 3DZFA 1F4VA 1KMHA 3OEEA 3H18A 2IYNA 3OHPA 1IOLA 3EEYA 3QPBA 3T3DA 4UOZA 5IT9A 1XXHB 3HVJA 4KLZA 5I4CA 4LF8B 1ITZA 1GSAA 1K0FA 2A7QA 1H69A 3FBWA 3L7YA 4TZTA 4DF3A 1H4TA 3EXIA 1UMBB 5AUQA 1XZJA 1FLVA 2YASA 2HCTA 4B6PA 4F4HA 4IH4A 2V6JA 3RAJA 3G8YA 4GXRA 1Z0DA 4LY6A 3RAFC 1W5AA 1X1SA 3WLHA 2CV2A 5JXJA 2XQKA 1TKCA 2JEYA 1JJVA 2Q3FA 4FP9A 4MYUA 1CQJB 3DEHA 4Q3LA 4OGGA 4RMHA 5I7EA 2WTEA 2OV8A 3I45A 4E13A 2J5BA 2NTEA 2HXYA 2RIRA 3DLBA 5EIOA 1GZVA 1I4WA 1CNMA 1QRAA 2UZ1A 2XTAA 4J3NA 1LBQA 5KOHB 1B93A 3P0HA 1SCIA 5C7LO 3ZU5A 5B64A 1QQ6A 1SKYB 4U6SA 1EFLA 4WFKA 1TO2E 1IUOA 1MGOA 2I2XB 2XNDA 4M8SA 3ZTTA 4EEKA 1T2DA 4K9SA 1NC3A 5EJGA 3E3NA 3A04A 4MQEB 5C0OE 3UUEA 4KIFA 2VRCA 1Z7WA 2BEKA 2PQ0A 1GQSA 3OUUA 1M0SA 3NHUA 3R3JA 4WNCA 4NK4A 1IIBA 5BQPA 1TJ3A 4MVCA 4MV9A 2HLPA 4DT1B 4R71A 4DUPA 3QX8A 1VPDA 4TTVA 4BCCA 2WMYA 3DOFA 3JYPA 4NCHA 1T1EA 5DM1A 4AG6A 3STXA 1YR9A 1Z5OA 3ZHVA 3PRHA 1I3CA 1IM5A 1EK1A 7AT1A 3EC2A 1TMYA 2CT8A 2GN6A 2CJWB 1KK0A 1OX4B 3H8VA 4IJKA 1J8FA 1SU8A 3ABOB 4C9BA 3F96A 2QRZA 4PPFA 1U2PA 3LUDA 1CY7A 4PCLA 5EIHA 1VKRA 3WMRA 4CGYA 1LW7A 1NZFA 2NXEA 3AOEA 4BEVA 1GXSB 2ZBFA 1VBFA 2RSLA 3DMTC 1OWLA 1X7HA 3LTEA 5AJZA 4KQKA 5LA6A 3VJKA 1QG6A 3VTAA 4FYHA 5H83A 2NVUA 4YUYA 1DV2A 4IHJA 1ZK3A 3SJAA 2Q5LA 3KTAB 1GCAA 2OAGA 1R0ZA 2C0QA 1E60A 3ICWA 4QL3A 4ARSA 2BFCB 2VL7A 2XYVA 1ECLA 1YNSA 1GM5A 4Q03A 3NTXA 3QXJA 4K6HA 1BXGA 4MKZA 2QZ9A 3TCXB 4UTVA 3P71T 4NF2A 2VHTA 2G8LA 3UBTA 1PFKA 1QE3A 3WYDA 5DYIA 2P6UA 5DI9A 3TD6A 4UPDA 5AIBA 4DMFA 1OLUB 5DBOA 1BH2A 2VH2A 3WYCA 3G68A 3VPDA 5L4LA 3JAWB 4GOOD 3M5WA 4F4CA 1UANA 4L3VA 4MCHA 4QBIA 4WE3A 1U8YA 4OHRA 2E4UA 3ZCXA 2BY4A 2IBMA 1GAXA 3FWZA 5FWDA 1JJ7A 4BV2A 2I7CA 4AMYA 5JT1A 1XRRA 1IIRA 3LQFA 2IPAB 4ZO6A 3NTVA 1VLQA 1BMFD 3CZ9A 4P2GA 2XXAB 2ZJBA 3KWMA 1G0OA 1N2CB 2R1VA 4MV8A 1K8ZB 1L6IA 1G16A 1OWMA 1SEVA 2FJ0A 5ALFA 4DJEC 2FFHA 5C8YA 4CMHA 5FOWA 3KDAA 2C98A 3IUBA 5AJWA 5CH8A 5HF6A 2PZFA 4U1RA 1PSWA 2XXBA 4ZVNA 3OCCA 3ZZ0A 4ALJA 4TYNA 3OTHA 3SQMA 2LPMA 5MDHA 1SG9A 2Q6TA 1RFLA 5DHQA 4BVAA 2ZTUA 2V65A 1E0JA 2V7EA 1U6IA 3G9XA 3HADA 3AM3A 3HDTA 1KMQA 2PFKA 1Q1ZA 3D4BA 3QVTA 3UFXA 3WK7A 2FN7A 2REOA 1L3IA 4XJXA 5I9NA 5CB0A 3RIMA 4LVNA 4J16C 4IHQA 1RWNA 2P4QA 2Z5VA 5GV8A 3VSAA 1MMFB 1RRGA 3RTAA 3SC2B 2CY0A 4I08A 4R1TA 2Q3HA 2YQZA 3R1IA 3WFJA 2FZKA 4P54A 4FYVA 4CM8B 4JNKA 1LEHA 1F1BA 1FP6A 1T8WA 2JAWA 3MQ4A 4ROTA 2XNSA 3ICVA 3HVKA 4XLLA 4CLEA 4D9FA 3ZWKA 1G4HA 2C9CA 1UPTA 3PHJA 4W6QA 2VT6A 2PGIA 3MEQA 4II3A 4N65A 3DCYA 3IEMA 1D2CA 1RAGA 1QVVA 1RKQA 4JQZA 4EHFA 1SIUA 4B3HA 3DLAA 3AHJA 3ZDZB 3CVVA 3N87A 3FDZA 4TTQA 1PN3A 1AKWA 1CB7A 4Q1CA 1UAGA 1VHTA 3LYUA 3QMPA 2P6MA 4BN0A 2VUUA 2O8BA 3W6NA 2ZUSA 1NPTO 1YJAA 2IYOA 1SQ0A 5A5EA 3DDUA 4KLCA 3PI6A 2H00A 3S8MA 3X44A 5CB4F 3PEYA 4ZZIA 1AT1A 1IAQA 1RAAA 2P8SA 2ZREA 3RFXA 1QG0A 2P5YA 1RYZA 3DMFA 4D4KA 5IARA 4EL5A 2A92A 1U7HA 4I4LA 3RBXA 3USES 2OLJA 3ND5A 4KBFA 3WK4A 4EGFA 4JJIA 4R41A 1QGAA 2M98A 3V6MA 4A6DA 4BLWA 3L7IA 2F9MA 4E1VA 4EFMA 3D6TB 5K2OA 2O0HA 4MUKA 5K0ZA 1JILA 3H4MA 3COVA 5IDQA 5MFZA 2X5KO 5E6SA 4OQEA 3TJZA 3MB5A 1RRPA 3CLRD 3JQQA 2AC7A 2ZROA 3FJOA 5AVSA 4IH1A 3THYB 4C3VA 2QY6A 1OFTA 1FX0A 4U9IS 3HGTA 3SKYA 5M34A 1KO4A 1P2GA 5MF6A 3I5XA 1N2EA 3FY4A 2ZWPA 1QFJA 1R0WA 3K7EA 1L7MA 3AKDA 5H7XA 4K8RB 5EVJA 2DPXA 5CFQA 2AG1A 2P1ZA 1VKJA 1ONNA 1TK9A 2R87A 3C3BA 4C2TA 1BMDA 5DMHA 1ORHA 4AJ9A 4CFZA 3G2QA 3KWLA 5I7UA 5A4KA 3JQPA 2EZUA 4RVUA 2LIVA 2VVTA 4WLVA 2ZS8A 5ES3A 1E1CA 1JDNA 3KTOA 4WVLA 1V3VA 6REQA 1UEIA 1Y82A 2GZ1A 3E3AA 4XWGA 4UFOA 2VJCA 5DOVA 4QDXA 4KV7A 4H7EA 1IOVA 4Q16A 2FF5A 5LLSA 4OFXA 5DBGA 5GPBA 4LZWA 2Q0QA 1PSZA 3RT7A 1D04A 1NQTA 2B8EA 1US8A 2BGUA 5CPBA 2YBEA 4KGVA 4D82A 1IN1A 4PO9A 1PWHA 2A0XA 3F1LA 4LF4B 3PE6A 3UAVA 3AJRA 3ILSA 4L0CA 5JCPA 1UOOA 4YASA 2WUEA 3CW2A 2Z3ZA 4RF3A 2R6DA 1SK8A 3GRCA 4TVBA 1R5JA 2COEA 3VPSA 2PWPA 2BYTA 3L1VA 1LLDA 4QYIB 2V3CC 5CDHA 1Z4JA 3B6KA 1LFDB 3R3HA 5TEVA 2YTZA 1KQNA 3MC1A 3F7NA 4A4DA 3Q8LA 1DJPA 1WB9A 2LNDA 3IHKA 4MVJH 1FFCA 1RZ3A 5JJLA 1YXMA 3C3DA 3K9LA 4C4SA 1CNEA 2OGWA 1JN0A 1C1DB 4G4GA 4Q9LA 1I5EA 1L7EA 1OLXA 4AY3A 2HPZA 4ZHQA 1SXIA 1Q14A 4FZRA 1NP3A 5DBEX 1U3TA 1YBAA 4WESA 3IUQA 4L8WB 5T41A 4TWAA 1RZVA 1NFFA 3EA4A 2KX7A 1H66A 4RUKA 2MINB 1LV8A 4G4SO 4PNZA 3WLPA 4E2XA 2XKBA 1JHOA 5FA6A 5JALA 4G1VA 1A4XA 1HG1A 1QSGA 1XTRA 2AZMA 5DLDA 1VM6A 4GQIA 2C3UA 3NW9A 1EDBA 1VPTA 5EPOA 4D9GA 3FGZA 2QRMA 5CCDA 1K97A 1I33A 1Z13A 3QPWA 2CCJA 3AKYA 4FE4A 4IIBA 4RVFA 4XQGA 3MRXA 1ZA2A 4L4YA 1Z82A 2OM2A 3FUWA 2Y2UA 3FPJA 5SZJA 2DMRA 3UMMA 1EUCA 1S02A 1TMGE 1ZU4A 3IAHA 4N39A 1FTNA 1MRNA 2BHLA 1P5HA 5H82A 1IY1A 3HI4A 3E82A 5EWJA 3CY6A 4EKIA 3O8OA 1FFWA 2BGJA 3E61A 5AI6A 1VHQA 5LNK1 2YS6A 1T34A 2GYVA 2RHWA 4KMOA 1E1RA 1H5NA 4TRMA 4CQLA 3GHHA 2PE5A 4D25A 2XUDA 4DJ5X 3EQ7A 3KZKA 3BG5A 1XZIA 3MGKA 3JQ8B 3V32A 1FK8A 3T7CA 1HL7A 4MW7A 2JAPA 3DMDA 3C2QA 3DNPA 2FZCA 1WXDA 2OAEA 3IJPA 2ZBEA 1LC3A 3REQB 3U17A 2VH5R 3PENA 4WKPA 3VV3A 3U3ZA 2B0JA 2I2AA 3ZDEA 4FHFA 4FSXA 1ONBA 1RXVA 3PDCA 2CXOA 1Q3HA 2WHEA 3UV7A 3IDFA 4KQIA 3VPXA 2XB9A 4JLSA 1L7XA 2EZTA 1CYDA 4HXEB 2JFYA 4K87A 4DIDA 3PYLA 4GWLA 4RF2A 2Q27A 4X1IB 4BP3A 4Q82A 4E15A 5IYZB 5KQRA 1DTWA 4MUHA 2X40A 2QAGC 4UVEA 4QOEA 5D7BA 5B1SA 1FQOA 2POQX 2Q2WA 4P33A 3ZGXA 3ZKWB 4CLDA 2ONKA 4I8DA 3WP1B 5AYVA 3GRAA 1SD5A 2O2JA 2CJPA 4HGZA 4JYAB 4FMCF 4B6RA 4IDNA 2YQ4A 3KT6A 2B4AA 3TL2A 4LF7B 3DYBA 1FTYA 3VISA 1Z2CA 3L41A 3PHLA 1RMQA 4D96A 1TJ5A 1BXRA 2F90A 2VTKA 3NOOA 4YUVA 3MJEA 2FR1A 2NSJA 2P9BA 3M6WA 1QAQA 1GNPA 1WBDA 5JYBA 3K9BA 3SG0A 2MSEB 2VO1A 2XCTB 4MI1A 5F2NA 2DPHA 2I67A 2GZSA 2ZIGA 1NMZA 4N47A 2B2NA 2W6NA 3HY4A 4IY1A 1RI3A 1WLSA 3EDCA 4G4SP 2ZBDA 1OY1A 5GGXA 1RAEA 2YZGA 1KMMA 1M83A 3FFAA 3VPFA 5BW8A 1PWZA 4X65B 2L19A 4GWGA 1L4MA 4EH1A 2OHGA 3EPHA 2OWDA 3KXIA 5FDFA 1OH5A 4G5RA 3N0WA 2V5VA 1LVGA 1W1IA 2CV0A 2PBLA 1LNQA 2Q4DA 4LHZA 4ND7A 4AY4A 5CP8A 5A7FA 4P2BA 3WQHA 2BISA 1MEOA 5HIJA 3BQ9A 1QQ5A 1VHWA 1I80A 2HEIA 1Q1GA 4G67A 3JD3A 4C5CA 4TMXA 1CXZA 4CR6A 2GN9A 3WWPA 1QIEA 3AUTA 2NT4A 2J3JA 5AT1A 1AKYA 3K9GA 4X20B 1XPJA 2YMMA 1KEZA 3IXMA 1VCOA 4YQZA 1N33B 3PR3A 3N5KA 3OZRA 2ZWIA 4BTLA 2R5WA 5K99A 1A69A 4D79A 2OD2A 1V5EA 3RU9A 4S05A 1R4NB 4IF4A 4DCVA 1JBEA 1QQAA 4R4JA 4AKGA 1KPIA 3RABA 5ISMA 3KFVA 4G0NA 3KQVA 3B13B 4QPCA 1HYBA 5LUAA 1TKBA 3OLYA 5CT6A 3OZ7A 1E9CA 1POXA 1QE5A 3A3PA 3AEQA 2HFJA 3D81A 4HOYA 1BVHA 1E59A 1E6EA 4RSHA 5TGDA 4NV1A 5FLKA 4DIKA 5BMOA 5LOVF 4DR7B 1A97A 1NVUQ 1OASA 4IILA 1REQA 2H4HA 2WU1A 5IBPA 3ZE6A 4DV4B 4WQMA 3I01A 1G5QA 2Y0BA 3DL7A 1P0QA 2P30A 5F3DA 3IKLA 5IUKC 5AK3A 4CJXA 1WZNA 1WCXA 1RC8A 2JIDA 1U4NA 3FXAA 5FCDA 4KR7A 1J2EA 4JYZA 1ZUNB 3L0OA 1WKCA 3LSTA 2OYRA 3MT9A 4G0QA 2R84A 1OYWA 2BTQB 3BL5A 4OQZA 1NVBA 2ZRAA 2G5GX 2GT1A 3CRMA 1RRMA 2OHVA 2C61A 1SKBA 3TZ6A 2AYYA 4ZRMA 1J90A 1EA7A 4DZTA 3D6JA 2JLWA 1K98A 4HLUA 3ER6A 3OT1B 3QF7A 3HNRA 3CUTA 4GLJA 3RK1A 4FB5A 5BNIA 1N78A 2WQ6A 3M33A 5D3ZA 1L7DA 1SC6A 3THRA 1ZGZA 1JU4A 2TMYA 4TSRA 1MUUA 3AHFA 3QA9A 2JIRA 5LDDC 4KE8A 1LPSA 1W36C 2OVFA 3SXJA 1DEOA 3C3KA 3UK0A 2WU8A 2I7TA 1APBA 2JAHA 3DSRA 3IEIA 1YS9A 1CUDA 1X8XA 2VG8A 5LVAA 2NVBA 4U7PB 5ALXA 5SICE 4DEVA 1TM7E 3I28A 3VR5A 4F3CA 1UDRA 4YRBA 5A3QA 9ABPA 4E88A 4R1UA 2FZLA 3Q1LA 4LCEA 2DSNA 2JIZA 2LWIA 1W9HA 2PH5A 3FUVA 3JPWA 3LHKA 3PQ4A 4MS4B 4UATA 5CYOA 2VHUA 2Q1XA 3EOAI 3ICCA 4QA9A 3DWEX 1NJGA 3KP1A 4Y6SA 5ALPA 5AW7A 4JDPA 5F23A 3GWGA 4R3WA 1RRFA 3QITA 3HB0A 4CL3A 1HE8B 1T4GA 4FYMA 4JQSA 4QQNA 3E5HA 4F1WA 4ZZ0A 3AVQA 3PXUA 1KYIA 1RNLA 1R5BA 2J9YB 2J45A 2YUTA 2R7AA 1FX1A 3R2JA 4H1HA 3ER9A 5I51A 2K7FA 2AHRA 4AAYA 1MAHA 4RPIA 5BQ3A 1GJRA 2QX9A 2G28A 4J0IA 2RJOA 3W7BA 4RULA 5E6RB 3CWCA 3HNPA 4G8DA 4XDZA 1JTFA 3PGJA 3SX2A 4BX8A 3HCEA 3CGWA 1WLYA 1F8GA 4BEWA 5GVSA 4TSFD 3L6RA 1CEXA 4DB4A 3ZV3A 2J5KA 3AQ4A 1PJ8A 3C1TA 1F20A 4TROA 1J99A 2C5LA 2RKWA 4FDTA 3A1VA 4KR9A 4A5OA 2WJ4A 3HVIA 5KAMA 1RM4A 2WVGA 3HDHA 3DOIA 3UB4A 2CLDX 2Z3VA 3SGLA 3U3KA 1E2EA 3P0JA 4DNPA 3GLHA 3DDWA 3GRRA 1RAFA 2QM3A 3BSWA 4ND8A 1K3FA 5AKEA 1HGXA 2ZR0A 3IOEA 4MR8B 2CYAA 3IVRA 3TVDA 2G0NA 3DM9B 4BGIA 3ZDQA 2WDPA 5TT0A 4US1R 3V4LA 3H3JA 1KMHB 1C1YA 3SXPA 1EK6A 2Q8QA 2QVLA 2ZRDA 2BP7B 3C3AA 3C39A 4MSUA 1U8ZA 2WSSD 4P4SA 2CXQA 3CU5A 1E18A 4BP1A 1FRNA 4JENA 5IBQA 1YDEA 2X0KA 3D8HA 2PLAA 3VV2A 3HZOA 1CF9A 4FFDA 3ZD9A 1P9RA 3ZLJA 4NYMR 1OD6A 2FPOA 2YN2A 1B26A 1XZHA 2BN4A 4RPGA 3UXEA 1ORVA 1JT9A 4PG6A 4Q3NA 5JG7A 3RYFA 3AJ9A 5DT2A 2C58A 2OGZA 3CGGA 2MOKA 5KI6A 4ENRA 5K3CA 1WCIA 1V1RA 3CUWA 4CMKA 4E5NA 2F9LA 4JEUA 4D9BA 1SA0A 3HY6A 4KQ9A 1RZRA 1XAJA 2AZ4A 2QW1A 3DZJA 3LCJA 4DXDA 1EWTA 5REQB 4HFNA 4CKEB 3SFVA 4CUJA 4F7DA 1H5UA 2H4JA 4XGIA 3EE6A 4P93A 4AQDA 5JNRA 2W90A 2MYUA 4QXAA 1HFEL 4H08A 4KP7A 4UE2A 2WJ6A 4QPPA 5JUWA 4LMBA 3UAOA 4IEFB 2DWPA 4IJUA 3DB2A 2BRUC 2J08A 1N7JA 1Z56C 3ZPXA 1I2MA 4TYWA 4B73A 3IJ5A 1WMSA 4KL8S 1ZI6A 3OCWA 3NONA 4JI1B 3FJYA 3K1JA 3P96A 2OYCA 1C8LA 1EE9A 1PP4A 2OC4A 3K8YA 4CEIB 1P61B 1TTTA 2WJWA 3FR8A 4FN5A 1V3QE 1KEUA 5CNJA 3BQMB 1CY8A 4JT2A 4JQCA 4ZO7A 4FD2A 1ORWA 1AV7A 4KZPA 2X8JB 2C31A 3EUFA 1N7GA 4LMAA 4U4AA 5CEFA 2ECQA 1PV1A 1R6UA 1C9JA 4KXWA 1LWOA 4UOEA 4EA6A 2IVZA 1WABA 5CDFE 4PQRA 1KI2A 2GARA 1DL5A 4V03A 4EI2A 1YFLA 2O6LA 3H1PA 2E48A 3HA3A 1I7PA 2OENG 3PJFA 1IATA 1ILEA 2WJJA 4F1JA 1YZKA 1P2DA 1BH6A 2V7VA 3QTTA 4X1KB 4ZCQA 1UDCA 2VK1A 1N6NA 4G5FA 1PR9A 3KPJA 2SHKA 1IZZA 4G2TA 3PWKA 4IHJB 2IWHA 3VX3A 4EW1A 1UIRA 1WBBA 2ZRHA 3EGEA 1KPGA 4ZPXA 5BSKA 2R8YA 2EGUA 1FDUA 3EDOA 4X6XA 1Z33A 1HQCA 1TMOA 1LPOA 3FRJA 4C2BA 3HQ4O 3HR8A 3MT7A 3I4LA 4LW8A 3IV9A 3V9AA 3QUTA 2E21A 2Q7XA 4JC5A 1WHTB 4I3FA 5EQFA 2V6GA 5F64A 4HQOA 4ZDIA 3A36A 2F55A 1K0UA 5TV2A 1MAAA 4C88A 4WEOA 1RI1A 2BM1A 3I2FA 3OBIA 2QTMA 4JBWA 1NT2A 4ALLA 2X6RA 2Z6UA 4NV3A 3BHMA 4Y9UA 3B51X 3Q9SA 2ZAIA 1DFIA 3DD5A 1E79D 5EIXA 5A4IS 1V26A 1LKZA 1ORTA 2OG2A 4IIYA 1WMBA 4DMRA 5L3SB 3TD2A 2R1VB 4L02A 1CUIA 2VSXA 1Y8QB 3R6TA 2NX2A 1EVEA 1X70A 1E3DA 2EFDB 3BTSA 4MARA 4O2AA 1X0XA 3UJPA 4ZYXA 5ILGA 2Q9AA 1Q2UA 3F9IA 3G5AA 3PTLA 3IQGX 4YGXB 4OMUA 3HYCA 4YDRA 4FYWA 4ZCRA 1QUFA 1NVTA 2MYTA 3H6KA 4J43A 3UGQA 2VF8A 2FZEA 2GX6A 1YBHA 5HF9A 3SHWA 4JXJA 2YRFA 4BCDA 4CI9A 4RORA 2V7XA 3IDZA 3MRTA 3AHEA 2OBMA 3BK7A 4GUDA 3DDNA 1JEAA 4JLMA 4JP5A 1IBMB 4Y9DA 2KLHA 2NZ8A 4KE6A 4ZVOA 3MLBA 1Z4QA 4D74A 4MLPA 3P2MA 2BV3A 1P75A 4MO2A 2E5LB 2ZS9A 2VYCA 4GKVA 3CBGA 2HHCA 3OF5A 1N1GA 3R24A 3W04A 1ZJJA 4AU1A 4D42A 1TQ6A 4ZCIA 5TMPA 4CKWB 1NQAO 5DEIA 2HADA 3K05A 1M6YA 2AZDA 4QQ8A 3P2IA 1B8UA 3BMNA 3EAGA 1Z34A 3FD8A 4Z6KA 1JSCA 1PR1A 2CEAA 1T9KA 1JNYA 3LL4A 4C3OB 2PU7A 2WUDA 3AUJB 5FWXA 4MI9A 3RRJA 3EAFA 4PLFA 2OCGA 5HKLA 1ZHOA 1NVVR 4JCOA 1D4AA 5EJ7A 5HG0A 2G6TA 3UKOA 5IXJA 5LIRA 3U2QA 3T4EA 3VU9A 3LP8A 2P91A 3B52X 1F9AA 4B4VA 4D4MA 5J2UF 1K3TA 1OHHA 2WHPA 4FFPA 1P45A 1YKSA 4NCKA 1CLEA 1SMKA 1DQYA 4R83A 1O6FA 1UWCA 2NAFA 2N1BA 4YMSA 3HCRA 2O8BB 3I6YA 5DYWA 4ZC8A 1KBZA 3R3WA 1YQDA 5KS2A 3BXEA 1KOGA 1PI3A 4OJYA 2MIIA 5EE9A 4HAIA 5AVWA 2O50A 1N4DA 3QE3A 3CUUA 1DAIA 4U02A 1XDSA 5EVCA 1YO6A 4WOPA 4BY9E 1JW9B 5T4FA 3P9KA 1YB7A 2ANCA 2CK3A 5CHYA 2I87A 3HZZA 3ITNA 4PCVA 5E7MA 3VNBA 2I66A 4K3UA 5E6SB 3FNFA 4WX2B 2XE4A 4EFDA 4MS1A 2FP3A 3NIBA 3Q9NA 3QTBA 5SY9A 2QWXA 4KPUB 4B8ZA 5C1PA 4BU1A 1JFRA 1FX0B 1GKUB 4N5DA 5J59A 5K4GA 3HUFA 2V4MA 4C29A 2ZB4A 2C7QA 4JV5B 3ZXIA 1MW8X 5I9MA 2W8BB 3NAZA 2BEVB 2P4EA 3Q85A 1EWVA 3PDWA 1DO0A 2P0AA 2E0IA 4JLAA 2CHGA 4OXYA 4QXMA 3CVJA 4NH0A 2TRSB 1HFKA 4P9NA 1CK4A 1EUDA 4IDOA 1X14A 2H1CA 3UWDA 2C54A 2HJWA 4TS3A 2IHNA 4YXWD 4P0PB 4QXQA 3OMWA 1RBYA 3FGNA 4D5EA 1P3Y1 4L9RA 4P7BA 1WM1A 5CVDA 3KEGA 3VR4A 4FMBB 2PRKA 4OB7A 4XA8A 3DFKA 5CRIA 4EK9A 4RH3A 5FJIA 3WYAA 4WZAE 4NOLA 1US8B 5F3RA 1OWPA 3RUHA 5EFOA 3IV6A 1OKKA 1E6KA 1XROA 2J5RA 4F06A 4LMPA 5HSGA 3TF5A 2OCDA 3BWMA 1Y3DE 1QG4A 2P2YA 2YOFA 3O8QA 4FSDA 4JB0A 1XQ9A 4K46A 4ZI7B 5JPDA 1RHKA 1DADA 3OIGA 1WB6A 3GRFA 2OQ2A 3DAOA 1NQ5A 3G2PA 3KB6A 4MWGA 3OOYA 4FGJA 4WERA 5GJCA 4F8YA 2VHZA 1X2EA 3W0LB 3HO1A 1K75A 4WN3A 1XO1A 4YJDA 5EFZA 2WWFA 4WT7A 1VSUA 3CH4B 4MHOA 4QQKA 3RF6A 5DNAA 4PHFA 3RRZA 1IUKA 3ZLTA 4C0QC 4UEWA 1JS1X 2WYOA 4QFMA 4WESB 2NZVG 1OX6A 1M8KA 3C5VA 3IAM6 4GL4A 2AE1A 4LBZA 4EABA 1J7JA 1OGIA 2JCVA 1DG3A 3DB1A 2J0UA 4AVYA 1EUZA 3DH0A 3IGFA 3MCUA 1QF6A 1VQ1A 3RS2A 3SQXA 5G0TA 4MRAA 1RFGE 4P34A 1NVMB 1CJSA 4BEJA 5E7IA 4RAOA 4NPCA 2JLXA 1J4AA 3ESDA 3E1GA 4C4OA 1ZX1A 3Q7SA 5CGZA 4RZ3A 4BZZA 2Z1DA 1JDUA 4UTOA 4ER3A 4QYMA 5C1IA 2IOQA 5EWMA 4DSZA 2DG2A 1AQLA 1CP2A 5AJTA 5DNWA 3L7KA 4P3YA 1KDOA 3BKXA 1QIHA 4RABA 3TLCA 2GM3A 1EUCB 1MX9A 1UWVA 2VDRB 4KYUA 3ZTWA 3PICA 1PNQA 3P7MA 3D2AA 5L7TA 2ORED 3MQFA 2Q1TA 3N8DA 3O8NA 2OLKA 5DHPA 5EWJB 2CL6X 4OGFA 4R7GA 2KHZA 2WZDA 1CRPA 2X5NA 3ZU4A 1F12A 4E7OA 1XA4A 1SHLA 2FSVA 1S6YA 4DG8A 5JRJA 1TFUA 1N1MA 4FM9A 3WXMA 1FJGB 2CHEA 2DPMA 5J23A 1H2WA 4FHDA 4LC9A 5G1OA 4CMEC 1CB0A 1S5PA 2HV8A 4P83A 1Q0LA 2D1QA 3GLGA 3ZI7A 3IEVA 4RLFA 5JAMA 4IIVA 1H8HA 3AK4A 4HLNA 3F6CA 2PEYA 2Q5EA 3NS7A 3R3UA 3WKBA 4C7BA 3BT7A 1U3CA 4MQ6A 1G4UR 3JVUA 1GIAA 4HPJB 3CBQA 2ZE7A 3RSLA 2O1EA 1JEOA 3DYVA 4J6EA 1R6XA 1YHYA 1P19A 2GF0A 2BMDA 3CRW1 4MTCA 1POWA 1MTOA 2C20A 1SVLA 3A9CA 4RJKA 5IVDA 4WCFC 1Z26A 2FKAA 4H4CA 1IY8A 3DJYA 4Q12A 1ZY2A 4AIRA 1UBLS 1H94A 4IEEA 3V00A 1DTWB 2ZATA 3MLEA 3N2NA 1BG6A 1R6VA 4FDMA 1ZIOA 1E2HA 1R0KA 2F67A 1JG3A 4ZT4A 3ZGVA 3ZY5A 2C07A 3RT1A 3SYKA 4ZZ2A 3UEOA 4K6GA 3GRPA 4KKXB 2JLYA 2QR2A 2VDQB 5KTOA 1ZMBA 1ILWA 4OHKA 1D8TA 2VI5A 2WIGA 1DQSA 5F35A 1BXRB 2MYNA 4YWHA 4A8JA 5B3KA 3W5BA 2BL4A 2EF0A 1MH9A 3OJCA 2O2HA 3T38A 3UC5A 4LOKA 3EVTA 5AVTA 5IAJA 2C00A 5C5IA 2QN7A 1JGTA 1P5ZB 4D9MA 3EGIA 4QG3A 2ZXFA 3FNIA 2C3YA 4PZ0A 5H81A 4E33A 3SPXA 4HI0E 4P84A 4EKNB 5JNWA 1FUUA 5HKAA 3ONEA 3FNBA 5HCUA 4DVGA 1YTUA 1AGPA 3FLBA 4U6QA 2JJMA 4MUYA 2G07A 3LYLA 4L73A 3O1JC 1UT6A 4CHTA 2R0QC 3IPCA 4RXUA 3EQ2A 1VLZA 3D7LA 4YCSA 1Z5PA 4NEQA 3M3HA 3IKTA 2VBGA 1U94A 5B30A 4AQYB 1G7TA 3GROA 4XRGA 1RI4A 1NDQA 2IXFA 2VWHA 4KQ2A 4XFDA 3S1AB 1U9ZA 3COYA 1P1RA 2GHRA 4F5WA 3PNLA 3T3NA 4INOA 4YCJA 1ORDA 4IOJA 1XTVA 2BOVA 3DOEA 5L3QA 1O8BA 3UT5A 1SHZA 4CG1A 4XTRA 1OFUX 2IXTA 4ETNA 1PUXA 3LQ1A 4HLCA 1QIFA 3WHPA 4YAEA 4QGFA 1ZN8A 4XUEA 5LZ2A 4D8VA 4CV1A 1N6IA 1IBCA 1ZQ1A 3DBRA 4KKVA 2DRIA 1RWOA 3GGOA 4UUPA 3QU2A 3LCRA 4EEZA 1L4HA 2D59A 1HZZA 4JR1A 1HNZB 5CK5A 1SVWA 2GNOA 4EB3A 2EJCA 2VPZA 4RZUA 4NYJQ 1H5QA 4QU0A 2NUPB 4P1ZA 5FPYA 3TR6A 4C0BA 4WBNF 5FUMA 4TYQA 1G6Q1 1CS0B 2ZPUA 1G8GA 2YXLA 2OHHA 5DWDA 3QW2A 1JNXX 4ZANA 1SUSA 2VWPA 1VDZA 3F3KA 3H0CA 4CT4B 1XLTA 2YUIA 4ZDWA 3RK0A 4AG3A 5G4LA 4D92A 5H4HA 3K96A 1LI4A 1QOQB 2P9EA 4H59A 1U3WA 4OL9A 5FWAA 3WXBA 2BGNA 3CN7A 3RHFA 1GAWA 2OHXA 1GDTA 4MB2A 1OA0A 2IZOA 3ZHBA 1I24A 4UBMA 4Z0TA 1TCUA 1ZRMA 3PP8A 4MP3A 4O1HA 4XQ9A 4BJ3A 1PV2A 4EHJA 2A3RA 1OIVA 2H29A 1NP7A 3HU1A 3UWOA 3IE0A 4Q3KA 3ASUA 5EESA 4KLAA 1Z2EA 1EPUA 1L9KA 1OH7A 3QEMB 5IVIA 4YAGA 4BFTA 3KJQA 3NC4A 1XKXA 2P0YA 3IDAA 1V5WA 2ZPAA 4JFRA 1XNQB 4F2DA 4X94A 3GG2A 5JAQA 2CMHA 3GNLA 3GLIE 4RACA 5BN4B 4LY9A 2E5WA 2PD4A 1Y8CA 2HJ9A 2R2AA 1AA9A 1TK3A 3M83A 2DFVA 2R6ZA 2HL6A 1GARA 1IL0A 4KQFA 3T3MB 4GRIA 3FETA 5DCLA 1H0RA 5EJAA 3MWYW 3QE2A 1RC1A 1V1JA 3QPUA 2YWCA 4TUYF 4EG1A 2A88A 1T25A 3ZDFA 1GUFA 1GZ5A 1WXFA 3ES9A 1TX4B 2DTXA 2FPKA 5E0KB 4FIZA 1XQYA 5DE3A 2HO5A 3VVBA 4DWJA 5JEDA 1T3SA 5J9FA 4AJOA 5L6LB 1G59A 1A5BB 4CI0B 1I7DA 5AW0A 1MB2A 4B5LA 2XTNA 3O4FA 4LAFA 4TLAA 3P9ZA 1ADGA 1OPRA 2AOTA 2FRDA 2Y9MB 1J09A 2EWMA 5DCWA 3RTDA 3QMWA 1WXXA 1UP4A 2HEGA 2C4KA 3L7NA 1DAGA 3FUUA 1NW4A 1UPFA 3MTQA 4YBRA 3MMXA 1U0GA 1KEEA 1WMEA 3EW7A 4URVR 3JQGA 1PYDA 1WZCA 1HC7A 3UHOA 3JATA 4BFSA 3PFWO 1FSFA 1GCUA 1COWA 1P77A 1GG9A 3S68A 1C7EA 2EQ5A 1RR6A 2O3QA 5LBUA 1P1KA 4LGYA 3UGKA 3UJ3X 5K09A 1RM0A 2VQFB 2NAPA 3VPCA 4N82A 4BXOA 1RADA 1G3MA 2AI3A 2B1RA 3GUUA 3IOYA 4UQPA 3QBJA 1QFSA 2WILA 2RJNA 2WB4A 4N5HX 4RHCA 4YMUA 5HX7A 1T8SA 1BX1A 3LOPA 4I50F 3ZWMA 3GYGA 3PVCA 4ABTA 1Y1KE 3EIEA 1MX1A 3C6ZA 1D07A 1WVIA 3F7TA 1A9YA 1OT3A 4PX3A 3O2QB 3MJTA 3I23A 4JEHA 4ZQGA 2ROQA 3FLEA 3SF0A 2RGBA 2C4WA 2IDMA 5KINB 2BJWA 2XUZA 4E2FA 1KWGA 1J25A 1DINA 3LUJA 4YUAA 3W5CA 1JG4A 2ZRQA 4D2IA 4WXHA 1HFJA 2CGEA 5IS2A 3BZBA 4OB6A 1NW6A 2C9MA 3BM5A 2MJLA 3EBOA 4KREA 5DI3B 1IPFA 2AR0A 1A96A 3FW1A 3NC1C 3U56A 4TL8A 2X7JA 3TDNA 1RP7A 2SNIE 4D9JA 4KLNA 1CF2O 3W77A 4ZJYA 1AQIA 1XRSB 2MR5A 3CSSA 3IERA 5CT5A 4C7KA 4CMJA 4CLOA 1DJLA 1WUHS 2Y1DA 4JI8B 4LXYA 3IUNA 5CVVA 2XLBA 3N6VA 4R9RA 1L5SA 4RH0A 1BE8A 4UQLA 2X86A 5AI4A 1DKMA 1N75A 3KR9A 4BMYA 3IT0A 1M2GA 4DMUB 4QELA 3PQ5A 4JVSB 5AVRA 1HYEA 2A2ZA 2ZXEA 4AWBA 4YCCA 3BSSA 1SUCA 1AMOA 3B1JA 1SIWA 1EWRA 2E2WA 4POAA 4EGCB 1FNDA 1TT5A 2V74B 2Z8YM 4P4SB 4YC7A 5LN1A