3N2IA

2.25 angstrom resolution crystal structure of a thymidylate kinase (tmk) from vibrio cholerae o1 biovar eltor str. n16961 in complex with thymidine
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
208
structure length
206
Chain Sequence
MNAKFIVIEGLEGAGKSTAIQVVVETLQQNGIDHITRTREPGGTLLAEKLRALVKEEHPGEELQDITELLLVYAARVQLVENVIKPALARGEWVVGDRHDMSSQAYQGGGRQIAPSTMQSLKQTALGDFKPDLTLYLDIDPKLGLERARGELDRIEKMDISFFERARERYLELANSDDSVVMIDAAQSIEQVTADIRRALQDWLSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate kinase
publication title 2.25 Angstrom resolution crystal structure of a thymidylate kinase (tmk) from Vibrio cholerae O1 biovar eltor str. N16961 in complex with thymidine
rcsb
source organism Vibrio cholerae o1 biovar eltor
molecule tags Transferase
total genus 83
structure length 206
sequence length 208
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2010-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3n2iA00
4Q9LA 3UPUA 2ZJ5A 5FOWA 5JRZA 2NGRA 4HATA 5UKDA 1NNEA 2QY9A 5ELXA 2ZAOA 5KOYA 2AR7A 2H16A 1RIFA 2ZRCA 1AM4D 2DFTA 4HDCA 3GQBA 4Q4AA 1T4GA 1P2UA 4NCJA 3CX7A 5HTKA 3TNFA 3W6PA 1SZPA 2V54A 4LJ4A 4JL5A 1ZVQA 5JJLA 1DO0A 4GZMA 1XMVA 1AK2A 1ETUA 3VKHA 2J9RA 1E2DA 3AKEA 2C99A 4Q4HA 1AIPA 1CEEA 1JXMA 2HV8A 5AJXA 5BYKA 2EYUA 4C0AC 1DE0A 2WTUA 1AKEA 3IPYA 1G3QA 1G5TA 4XTRA 1OF1A 4HAZA 4ABYA 2CNWD 3U44A 4FWIB 2O5VA 2RGGA 4JLNA 4ZDKA 1CR1A 4B74A 5F3WB 4TSFA 1ZM3A 1UKYA 1XZPA 1GKIA 3AF3A 1VG8A 4JBXA 2FMXA 4IDHA 4P33A 3O8CA 2JLSA 3D6TB 4JJKA 3QI2A 5L3QA 2HXSA 1CULC 2OBLA 2P6UA 2ZRKA 5CJPA 5LPNA 1W2HA 4E09A 1X1SA 4K81B 3O47A 2O8BB 3B9QA 2OFXA 3TGPA 1F48A 1WB9A 1JECA 1OKKD 3L43A 2I1QA 4CZ2A 2PLFA 4BFVA 1G291 4UNRA 3IQWA 5FUWA 3JVVA 3X1XA 4KVAA 1YVDA 2GVDC 3QY0A 5J47A 5AJWA 2BEKA 2DFLA 4V0NA 5LDDC 1MH1A 1CLUA 3CH5A 4RD2A 3FMFA 1GTVA 5CIWA 5CB8A 1EESA 1U0LA 4P4UA 3EAQA 4V02A 1FMJA 3RS7A 4MRVA 3T1QA 1OIXA 3A4MA 2VSOA 3V4RA 1JXOA 4S35A 4EDHA 3D3QA 2NQ2C 5L3RA 4ERNA 4C0QC 1FZQA 4FINA 2ZROA 4QHTA 2EWVA 2WVJA 4YMSA 4DCVA 2O0KA 4KBGA 4DLWA 2GXAA 1EWRA 2QMHA 1NRJB 3SHWA 3GLHA 2ZS7A 4Q1AA 1DG3A 1E2PA 3KFXA 1GSIA 2CJWA 2VIIA 1KDPA 2N46A 2WWFA 3Q72A 3ADBA 4CEIA 2P2LA 3K0EA 3PV0A 3E1SA 4JLVA 2IS6A 2W00A 3DKVA 4D4KA 2OCAA 2AWOA 2GVZC 5B2ZA 3GJ4A 5TV2A 4CEJA 2J41A 4JZKA 2VEDA 2FFQA 3W3AA 1XTRA 121PA 3CRRA 3THWB 1Q1BA 2W2TA 4Q00A 3BS4A 3EPHA 1HTWA 3HYRA 2ZM5A 1GILA 5FUXA 621PA 3T1VA 4PAMA 2V7QD 2J3EA 1Q1EA 1G19A 1YZGA 3OEED 3GJ0A 3MWJA 2D3WA 4I81A 5FUYA 3A4NA 3A36A 4K46A 2CLCX 5BW8A 3WBJA 3QXHA 3ZZTA 1U9IA 3VR1A 3K09C 5TMPA 5CB6A 4NBSA 3QKSA 4E5UA 1OXTA 2GESA 3C16C 1J7KA 4N3NA 1CJMA 2HLDD 3GJ3A 3B85A 1B23P 3PEVA 1GRQA 1KI6A 4W7SA 3BC1A 5A0FA 4DB4A 1DG1G 2J87A 3L0SA 2F55A 4B43A 5C4GB 1CIPA 2YWGA 2XSZA 3DMDA 4PZYA 4WZAE 4B3DA 4RZXA 4TYWA 1G6HA 3RRZA 5C18A 5D3MB 3C15C 5P21A 5TB5A 3V9PA 4QKQA 4PPNA 1E6CA 1ZC4A 1WDTA 1F2TA 4EFMA 1G7RA 1Q0UA 4Q4JA 1MV5A 2AN9A 5B57C 5EP1A 5FBLB 1G1MA 3OIVA 3THYB 3WP0A 1K5GA 4TL6A 1RRPA 3BORA 3NKVA 1KO5A 4ESHA 1IONA 1J70A 1ZNYA 1NKTA 2FPMA 4M1TA 2GJ9A 2ERXA 2FU5C 4M9SA 2WSSA 3ASZA 5FPHA 2XXAB 5KTYA 4B47A 3KJGA 5G41A 2GXSA 3EXAA 2X2FA 4IDNA 1FPMA 4I4LA 2NO7A 2ZSBA 1NJFA 2MMGA 4XD7A 1UF9A 3CRMA 1EFRD 4BUJA 4JSYA 1OE0A 4C7OA 2HXYA 4BQSA 4MH0R 4ARZA 1CKEA 3PJRA 1R5NA 4MGYR 1WQ1R 2YWFA 2AD5A 1PUIA 4XH9B 5CLLA 3ZVRA 3AVTA 2J7PD 3M1IA 4JJZA 4D4LA 4WZ6A 4URZR 1QVRA 4EFNA 1U2RA 3ZIAD 1IN6A 2A9KA 2B7BA 5JHGB 1KK1A 5IRCD 2QG6A 4IEIA 4Q66C 5EP2A 2BV3A 3B6EA 2I4IA 2RGXA 4ZI3A 5CDFA 5AJVB 1KSJA 3C5CA 4X8MA 5B64A 2VHQA 1PLKA 4G5RA 3A1TA 1J8MF 1O3YA 3QXCA 4DLXA 2K5UA 4FMDB 3SJCA 2OBNA 4KVGA 3ONWA 1E9EA 1MO6A 4HZUB 3AP1A 2GZDA 1XDBA 5JSZB 1UFQA 5HKKA 2F9MA 2WKQA 3QKUA 1ZU5A 1E1RA 4LPKA 4DDVA 4WIAA 3ZS9A 2O8EB 2FV8A 2V4ZA 4UKDA 4HYYA 4BFSA 2IUTA 5DIFA 3SEAA 1XMIA 5H8WA 2W6JA 2PBRA 2QZ4A 3IHLA 3VNVA 4UJ5A 4KFRA 2ZU6A 4EKDA 2V1XA 5KPDA 3PIRA 5CM8B 3K0AA 2IHYA 1OT3A 1YKSA 2XX3A 4HLUA 2CK3A 4DKXA 2RB4A 2QROA 3RDPA 3DZ8A 3OE7A 2EYQA 2FH5B 1JEEA 3A1UA 3T15A 3R8FA 3CNNA 4TT3D 5DN6D 1KK2A 1HT1E 3SBDA 3B82A 1SVMA 4F4CA 4OI0A 4A1FA 2IXGA 2XNSA 2IUSA 3UIEA 2ORIA 1E9BA 1US8A 2OG2A 1JR6A 2B6HA 2XAUA 2WSMA 2VRWA 4BFZA 2ONJA 2R8RA 3D7MA 4YMTA 1OYYA 2WICA 1BMFD 1C9KA 3TVDA 2J59A 3HU2A 4KO8A 1NY5A 2ZE8A 3V4FA 1K5DA 1CR4A 4NMMA 1FQKA 2YVUA 3MMPA 4PPFA 1TUEA 1I2MA 4TQAA 5H68A 2DFKB 3RS3A 3FE2A 3UWOA 4D0LB 1GM5A 1VIYA 3FHOA 3AVYA 3NVAA 4QHYA 1XJ0A 1VYUA 1ZNWA 5H1YA 4N0DA 3BFXA 5M04A 2W0MA 3PUZA 4TLDA 5FR1A 2P5SA 3QG5A 1Z8FA 2OLKA 2ZRFA 5SZHB 5FUVA 5K8TA 3RS2A 4QJ5A 1P5ZB 4AKGA 4A6XA 2YOGA 3CR7A 4LC0A 4JLBA 3M0EA 1GKYA 4MUBA 3SQWA 3QKRA 1VTKA 1T9HA 2VSFA 3F8TA 2GK6A 2IYRA 1FNMA 2H92A 1X8JA 4PQFA 3EIEA 3KFVA 1NF3A 4LY6A 1CJVC 4TL9A 3B13B 2G0TA 1RFLA 3A58B 2IS2A 2BEJA 1XD8A 1Z0FA 3RHFA 1VYTA 1ZUIA 1COWD 3GFOA 4I1SA 4IRUB 1KHTA 1Z47A 5KNDA 4I1OA 1L4UA 2ZUDA 3SOPA 1OFUX 3AGPA 4LV5B 2Z4SA 4NH0A 3QE0A 2DYKA 2R65A 2Z83A 2C8VA 3TLXA 1F2UA 4ASUD 4E03A 3KQUA 4EPRA 4ESVA 3CF0A 4JLMA 4QJ3A 1OH6A 3RRNA 5J4LA 2V6IA 3J81k 5HR5A 1DAHA 4OBEA 2YWHA 3OF5A 3GEIA 4N0EA 1Z2AA 4IDPA 1ZUHA 1II9A 3V00A 1EFHA 1SVIA 4V0KA 2G77B 3BAFA 2VHCA 4MYCA 1OIVA 1VCIA 3NBZC 3IBYA 1EGAA 3OAAD 2IEYA 4PO9A 2KBEA 4E07A 3MSXA 2JJ2A 1EFTA 2DY1A 3GJ5A 1CS4C 4DDTA 4YONB 4LGMA 1SXJA 3LBNA 2OCYC 4NL4H 1S4QA 1E96A 5E7JA 3LXXA 4RVCA 2GNOA 2F9LA 2ZYUX 3I5YA 3IO3A 2CCGA 5KDOA 4DC9A 1S0UA 1XBTA 1OFTA 2HF8A 1FMLA 3AVOA 3NXSA 3QXXA 2FGJA 1S3SA 2KI5A 4WBSA 1KI9A 2GJ8A 1Z6YA 2ZYTX 3TAUA 3L0PA 4L15A 2QM7A 1HURA 3C14C 3FHTA 3GCGA 5EP3A 1H8HD 1ZD9A 4GMXA 3PVSA 3BJIC 5KSYA 2Q3MA 1PVOA 3VKWA 3CO5A 4RZ3A 1G21E 3QQ5A 1BOFA 3ZDQA 2QAGC 1NMYA 5FOVA 2VP4A 1L2TA 3OEHD 3OESA 4M1SA 4UQOA 4CVNA 2PEYA 2YC4C 1CP2A 4ZPXA 4TYNA 1OH8A 1JQJC 1DAEA 2WM9B 5BXQC 4KSCA 1E4YA 4B3GA 1YZTA 2Z4RA 3CKLA 1M2OB 1E0KA 3HP1A 5A5GA 4C4PA 1XCPA 3ECCA 2OLJA 1LV7A 1QZXA 2VP9A 2ZR7A 5JWOA 1NVVQ 3VFDA 4TMZA 1ESMA 3B8HA 2E9SA 3KQLA 3U7GA 2HYDA 4P4TA 4UJ3A 3AF2A 2BJVA 1KJZA 4URVR 1OH7A 4HAWA 1OXUA 2RCNA 1G17A 1NI3A 4P0TA 4BEBA 2UZ3A 3PENA 2FPLA 3ND8A 3ZD6A 1FUKA 1VCNA 3KJHA 2JASA 4BECA 1GL9B 3BB4A 4OKSA 4DRZA 3IO5A 1KTVA 2D7DA 2ZRHA 4LRWA 3OFND 3VR4A 3ICEA 4D4MA 5DGXA 2JIZA 1BIFA 4GDFA 4AYXA 2IYUA 3SJBA 1MRNA 5C4MA 2V1UA 2IF0A 3FKSD 3TE6A 3ZGXA 1W2GA 5G40A 4C0HA 4PC3A 4Q9KA 3NH9A 2BJWA 3TAHA 1ZM7A 821PA 2G1KA 4CT4B 5KUTA 1W0JA 2GBLA 1A2KC 4Q9HA 3ND9A 2E87A 3GEEA 1DEKA 5FOSA 3E70C 3UKDA 1A7JA 1HA3A 2FE4A 4BZQA 4JL8A 2P67A 4GMDA 4D0NA 2J0SA 1X3SA 1P4SA 4TYQA 5EUQB 4V03A 2RGNA 4B76A 3GLIE 4CEHB 1JAIA 1E2EA 1W5SA 4B32A 4P31A 1Z0KA 1MABB 1G7CA 3Q5DA 3TUIC 3SU8A 4Q5IA 4YDSA 1S96A 4W9MC 3CPJB 2XNDA 4TTRA 1WF3A 1HT2E 3E5HA 1UJ2A 4IW3B 4PQRA 1VMAA 2WPDA 2IYVA 2ERYA 4TLCA 5KHOC 1YJ5A 3GJ6A 2FEOA 4DJTA 2RHMA 5J4VA 3LY5A 1GITA 5FL7A 1GP2A 3GJXC 5EJEA 2BWJA 1N6IA 2CEAA 2DFNA 3SYLA 1NBMD 3LBIA 4DLUA 3EZ6A 1NSFA 4QOSA 3NWJA 2WKRA 4M2LA 2VYFA 4OI4A 1UAAA 2QT0A 4OQLA 2J1LA 4CRWB 2ODNA 4IXMA 3C41J 3LLUA 1U9IC 3IEUA 3NEYA 1N5KA 2A5GA 2O0JA 1D5CA 4JYBA 5JWHA 4AURA 2GCNA 4KFUA 4TN1A 1G64A 2CHGA 3P26A 3REGA 4DCSA 4P32A 2RAPA 1H8ED 2ONKA 4LJ9A 2TMKA 3FMPB 3ZH9B 2PT5A 1NSTA 4O25A 5JJKA 2C9CA 3IIMA 3QNUA 4V0MA 5EXXA 2WHXA 5D3MA 1JR3A 2FN4A 4JLKA 5CK4A 3TVTA 2AL7A 1W4AA 2QRZA 5EE5B 5J40A 3Q7QA 2HT1A 3VHXA 3KTAB 4EJSC 4HSEA 4FMDF 1KKLA 1T91A 4OJKA 3BD9A 2ANCA 2Q9CA 3RS4A 4C9BA 3UMRA 221PA 2MSEB 3IKJA 3VQTA 1LS1A 1EX7A 3THYA 3R9XA 3AVXA 1X6VA 1KJWA 2IS4A 3UG7A 3F5FA 2DCUA 4LBWA 4YDHB 4AK9A 3O8DA 2J7KA 2W6ID 4M22A 3NC1C 4DT1B 2QTVB 1P2VA 3HYTA 3W5IA 1NN3A 3IPXA 2ZRLA 3G5UA 5CM9C 3QVVA 3GPLA 1FP6A 2BVNA 2ORVA 5C1BA 1TQDA 3NG1A 3B7GA 1KI2A 2V6JA 3QKTA 5CLQA 2C77A 3AF4A 4G5OA 1G7SA 1KY3A 3SR0A 3SYNA 4A6PA 1AJEA 3AUXA 4XJXA 2QBYA 2BHRA 3BFKA 4MYUA 4QG7A 4W5JA 5LD2C 4BEJA 2OAP1 1DAIA 4B75A 1XX6A 4G5QA 2BBOA 3L8YA 5JS7A 2G6BA 2Z0MA 1Q3TA 3NH6A 4L4UA 5F9HA 1N6NA 1XD2B 5F98A 1NVUQ 3JZAA 3PUYA 4DSNA 3W8RA 3QPWA 1PLJA 1UPTA 3EZ7A 3AB3A 2QGNA 1OHHD 4BFWA 3ZS8A 4F7WA 1G5PA 1N0UA 4Q19A 4LOAA 2CHVA 3K9LA 1E2HA 2D4HA 1JQLB 2XEXA 3EPLA 4UXJA 1EFUA 1U99A 2VL7A 3KKPA 3LVQE 2VO1A 4RFSB 3WNBA 1Z0JA 3T34A 4XTCS 1M6NA 4JMPA 2A3RA 2ZI3A 3MG9A 2G88A 4RD1A 4JT4A 4HZUA 4Z54A 5JSZA 1GL7A 1OJLA 3KXKA 4L8GA 5DI9A 4TZ6A 4BLQA 4I1UA 3LQRA 2IWRA 1RC8A 1G9XA 1W36B 2O8EA 1J99A 2WWWA 2XITA 4C0SA 5E95A 4DCNA 3IQXA 1OXVA 1KI4A 2GCPA 4ZI2A 3BXZA 3KUCA 4II7A 5CIQA 4QGAA 2AWNA 2XGJA 1QBKC 1UKZA 4HLUC 4PHHA 2ZJOA 4XVUA 1N0WA 1XP8A 1CTQA 4IHQA 1G18A 2JJ1D 5FTLA 3RABA 1M1YE 1FTNA 3X1DA 4NZYA 3HR7A 4FI3C 4ZDWA 4JKIA 3SBEA 1FP7A 3TSZA 3EPKA 2FSGA 3VAAA 4GSYA 3P32A 2BMDA 4LC1A 1AS2A 3A1VA 5EZ5A 4IDOA 2CHQA 4KI0A 2ZYVX 3A37A 4NCKA 4X8HA 5EQTA 4CGZA 4A82A 4WXPA 4JKYA 3OZXA 1XTJA 2A5DA 2FX3A 4XVRA 1P6XA 1W7AA 4OQFA 3AQ4A 2FNAA 4MKHA 1AS0A 2DPXA 2Q9AA 2PT7A 3I8SA 1K8RA 2RHDA 3WNDA 4QNRA 3UG6A 2CBZA 3B60A 4NYIQ 4OI1A 5K8UA 3GLFB 5LBIA 4GP7A 3BB3A 1XXHE 2F7SA 4M1KA 1MO5A 4BFTA 3GLGB 2CL0X 3GLIB 3NEJA 1C4OA 4GBMA 2XTMA 4XSGA 4PSVA 1MT0A 2RGEA 1N3BA 1OKKA 3EARA 4G3XA 2WIBA 1M34E 1U8AA 3A8TA 3R7WB 4Q01A 3QEOA 3R9IA 3LRPA 2IF2A 5HZKA 1P72A 3EC1A 1YZKA 4MDEA 2REBA 4WA7A 4AG5A 2ATVA 2OCPA 2NMVA 1N6HA 3CRVA 3QF4B 1ZMXA 5JHHB 4IOKA 1VG1A 3W5JA 1XTIA 3TQFA 2A7QA 4LJ6A 3PXGA 5KO2A 2H17A 1MKYA 4WOPA 4HLQB 2WAYA 4TWZA 1U81A 1IBRA 8OHMA 2KB0A 5FOUA 4BLOA 2YJTD 4H1VA 3TW4A 2IEZA 1P3JA 2VP0A 2H5EA 1NVVR 2UVQA 4CT5A 5KU1A 2KWIA 3NBFA 1S9DA 3AVUA 1E79D 4HDOB 4MGZR 1XTSA 1KJYA 2NIPA 2G1JA 1QG4A 1IOZA 1Q1ZA 2PH1A 4PAQA 2CCKA 2ZRBA 4Q1CA 1KNXA 2AHOA 4M4SA 3SE0A 4H9GA 4MDFA 4Q9JA 2GJAA 3LLMA 5KPJA 1XJCA 3CRQA 4LHVA 3CONA 4MGIR 2OFOA 1HY3A 2JLUA 2NO9A 1IN8A 2BMJA 2ZTSA 2P6RA 3W6NA 4A8JB 1UM8A 2DB3A 2O0HA 1A4RA 3WHKA 4NU0A 1WA5A 3RC8A 4Z51A 2ZRIA 2V7QA 1A5TA 4FIDA 3OEEA 4WAUA 5DH9A 2ZRAA 3UWKA 4TL7A 5GJVC 2FDCA 2FWRA 5TVKA 4PC2A 4OYHA 2QSYA 2HYIC 3U3JA 2REOA 4X8LA 1CJKC 4FMCB 3TR0A 1XTQA 1GFIA 4LJ5A 4WW0A 1OXXK 1XPRA 4JSTA 2R9VA 4KITB 5TXGA 1E1QD 1G3RA 1N6LA 2R6GA 2REXB 2ZPTX 5AWFC 3SJAA 1SXJC 1QHHB 4V0OA 2DBYA 2VTKA 2ZRNA 3CH4B 1CU1A 2QMOA 3I5XA 3T35A 2W2VA 5ANRB 3TIFA 4WXRA 1E99A 4HUTA 2QSZA 4DCUA 3RLFA 2LWIA 4Q7MB 1OW3B 2RGDA 1SVLA 4Q7JB 1KMQA 3WRXC 1BKDR 1Z08A 3MLEA 5J4KA 1WXQA 4NYJR 2FJUA 1ZU4A 2FSHA 1RYHA 4TL8A 5KSPA 4A4DA 4GNKA 3NC0C 2IA5A 3GLHE 3NHBA 1AS3A 4M9QA 2PZFA 3MGCA 3LX8A 4HB0A 4B71A 4C0JA 2MSDB 4NONA 5TARA 1FFHA 2BBSA 1I4TD 4JLDA 5HCNA 1LF5A 3NHAA 4Q21A 3CX8A 3VU9B 4ON9A 1NJGA 1VIAA 4IOJA 4QL3A 3U3RA 3SI7A 3G0HA 1XCGB 1R2QA 3CM0A 4PSAA 1JJ7A 4C2TA 4LHXA 4F93B 1G20E 1OH5A 4DVGA 2X8AA 2CE7A 5DHFA 2QL6A 2HT6A 3IIJA 2WV9A 5JRJA 1E2MA 1W47A 3KJIA 4RZ2A 1VDZA 4J0QA 4C0KA 4MKFA 5DYGA 1G4UR 5DYIA 3W3ZB 2WWHA 4KLNA 3U61B 4B44A 3U7EB 4KSBA 1G6OA 2VF7A 1N6KA 1GRNA 3IUYA 4OQNA 1W0KD 4ZDIA 5JCPA 2OXCA 4L9WA 4Q02A 3ZIAA 4G5GA 1T5LA 4PPGA 2F3TA 3ADDA 2WJIA 1E2GA 4XD7D 2PEZA 2H1LA 3Q9LA 4URYR 3I61A 2R6DA 1QHGA 1FUUA 2Q6TA 5IK2A 3K70C 5AR1A 4I99A 1FOEB 4M9ZA 1K6MA 3VX3A 1WP9A 1II8B 3EZ9A 2B92A 1EK0A 4B3XA 1WRBA 2JGNA 5AJZA 2FFBA 3B5JA 1XNJA 3HPQA 4PPQA 4JVMA 1ANKA 2E1RA 1ZCAA 4Q1FA 2QE7D 3U3OA 4DB2A 1LS6A 5HE8A 1XEWX 3WXMA 4TMXA 4KFTA 1LY1A 4Q4LA 2H8KA 2XJ4A 2D62A 4CEHA 4P4SB 2IBMA 2ZI9A 2ZRGA 3C4JA 4U5XA 2JLZA 1MRSA 2J0VA 2O8FB 3CPEA 1MABA 1KSHA 2DWQA 1JAHA 1XXHB 5E7MA 4DIDA 3K0FB 2XZPA 4PZLA 2N1BA 5FPSA 4PANA 3LFUA 3PCRB 2GKSA 1HE8B 1NMXA 4PSKA 2BOVA 3RVBA 1IY2A 1D2MA 2AK2A 1G16A 1RRGA 5EE1A 1E1RD 5DN6A 4F4IA 4ZIRB 3GMTA 3MWLA 1OB2A 2FSIA 1XMSA 5AJYA 3H86A 3H4MA 2R2AA 4AKIA 4OK3A 3DHWC 1IM2A 3IILA 4MRSA 4Q48A 1SQ5A 2W6JD 2DWPA 1LFDB 3KX2A 4AKHA 4A0HA 2PCJA 3WYGA 4BLRA 3KQNA 2ZRMA 2RGAA 4QGFA 5IT5A 3ADCA 5J4HA 2QAGB 2JEOA 3RS5A 1KY2A 3OE7D 2YKGA 4JLOA 2C96A 1E0JA 4WVFA 2N42A 4YLGA 2ZSFA 5JFGA 1XEXB 2BKUA 3UMFA 3THXB 3LAWA 3H1TA 1CJUC 1VG9B 5SZJA 2X77A 3CIOA 2QP4A 4LYHA 4NHOA 1SVKA 3FMOB 2C9YA 4HAXA 5SZKB 5B58C 1Z6GA 4LHZA 3KTAA 4A0RA 2A30A 2CVFA 2EU8A 4JVLA 1Z0IA 4C0BA 2Z5FA 5FOTA 2GAOA 5C46F 1Q3HA 4B3CA 2QTFA 2ZSAA 3CBQA 2BM1A 3NBYC 1NY6A 3QOFA 4MYTA 4N1AA 3AVVA 4LJAA 3TUZC 4IOMA 1QRAA 4W5HA 4DZZA 1W44A 5L3VA 2NOAA 4TMKA 1F6BA 3DDCA 4YXWA 1QHXA 5LB2A 1N2CE 2WJHA 1EFCA 4DSOA 4X8OA 1KAGA 2GK7A 4M1WA 1KDTA 1NP6A 2WAXA 3HWSA 5DLQC 3WMEA 1QHIA 1UBEA 1FX0B 3QG1A 1F3OA 2WKPA 1COWA 3KKOA 4ZKEA 4MRNA 6Q21A 3AVWA 1RVDA 3EIHA 5FTNA 4L5BA 4B3FX 1G41A 3DO6A 3G82C 3SZRA 4DSTA 1OFHA 2F1RA 3CF2A 3W6OA 2MMCA 3LVRE 5GJWC 1V5WA 2WMOB 3FPAA 4IEEA 2YV5A 1OYWA 1WE2A 2GWHA 5CYOA 4A0GA 1IY0A 4U02A 1M74A 4ASUA 2ZJ8A 4NYIR 2PMDA 3M4YA 1XD2A 4QGHA 1U94A 2WJVA 1L8QA 1TU4A 4OHZA 2V9PA 2D74A 3T5GA 2GA8A 3EWAA 4ZCMA 4D80A 3ICQB 2IC5A 4IVRA 2P5TB 1I4DD 3C7KA 5DSZA 4A9AA 1E9AA 2FOLA 4GI7A 2D7CA 1R10A 2ZJ2A 5AUNB 3OAAA 2W83A 1YU9A 4DUGA 1T8UA 4C2UA 2Y8EA 4PHGA 4KCGA 2ZVQX 5TY0A 1VG0B 3SDZA 1DBSA 4I1VA 3PITA 3UXMA 3QBTA 4TMVA 4B34A 3WYFA 4A2WA 1DO2A 1RZ3A 5HPYB 4PC1A 1SKYE 3TQCA 4IJMA 1G7TA 4JLAA 1IQPA 4ITRC 4FW9A 1G3MA 1XJQA 4LCBA 3FB4A 4EFLA 4BFYA 1PLLA 4TQ9A 2JJ2D 4BZXA 2HDNB 3LA6A 1RPZA 3F3YA 5IHPA 2Q0HA 2NO1A 2UZIR 4JBWA 1CRQA 1SXJD 2JATA 4PR0A 1N6RA 1P73A 2RGCA 3NTUA 3OEHA 4HB4A 1LVGA 4AYWA 4BLPA 3X1WA 1E69A 4LBZA 4Z1MD 5KYKA 1Q57A 4XWOA 5FPKA 3BERA 4QGGA 1D2EA 1SVSA 2EVWX 3FYHA 1DADA 5GJCA 3EX7C 4C0LA 3CR8A 4ILEA 3SS8A 3VX4A 3UATA 1P61B 4EJSB 4V0LA 4R2IA 1QDEA 3BK7A 1JI0A 2ANBA 3DVLA 1YZQA 1E2FA 1HUQA 2G83A 1Z5ZA 1ZM4A 2J0UB 2Q21A 4JYCA 4Q4JB 4DLTA 3TBKA 3VMFA 4EQ6B 3GJ7A 4YQFA 4H1UA 2VPPA 2OCBA 1L4YA 1ZIOA 4URUR 5AUPB 3GLFA 3P4XA 3GLGA 1LF0A 4M8NE 5D3QA 3GLIA 4GRAA 4PAOA 4GL2A 3OIYA 4BGDA 5L3SB 4L9SA 4PO1A 3RSOA 4CW7A 2O8BA 3AV0B 3OFNA 2CMKA 3VR5A 3AVQA 3OHMA 3TUJC 4AG6A 1SXJE 1Z06A 2F1HA 1J90A 1ZP6A 3OIUA 5FFMA 3R7WA 3SN6A 4GOXA 4AKEA 2ZXUA 4MKIA 4U7DA 3NBXX 2A2ZA 2GF9A 4FMCF 2ZJAA 2GRJA 5G3ZA 1W4CA 1E32A 1GOTA 2FA9A 3FKSA 4NYMR 1N25A 1U8YA 1KK3A 4PHTA 1U90A 2F6RA 4ARZB 5LD2B 1ZUNB 1OFIA 3KXIA 2BCJQ 5DHAA 3QF4A 2HCBA 4AD8A 3I62A 2CE2X 1JALA 1OV4A 4CF7A 1IN4A 4UNSA 4TMTA 1N5JA 5AUOB 4B33A 1YQTA 1P2SA 1IN7A 2J5XA 3AF0A 4BLSA 1TQ6A 1AGPA 2D06A 4EPWA 4D4JA 4B35A 2WIAA 2QGZA 2AXPA 4QM6A 4O2LA 5JI3E 4O2RA 4NDZA 1KGDA 3PUVA 1E94E 4HEJA 4LSGA 1KDRA 3BE4A 4LK2A 3WMGA 1KO8A 2BKEA 1Q44A 2OFWA 4OK6A 3GFTA 3L2OB 3SHFA 4EIWA 2W0SA 4NYJQ 3ZZ0A 1Q1QA 3K70D 3SQXA 2GHIA 4OHXA 5J5CA 1Z2CA 4DEYA 5F9FA 3K0SA 1CJTC 2RH5A 2LKDA 2BM0A 3HDTA 4LX0A 1AGRA 1YR8A 4HI0E 1W0JD 1TL7C 3W8NA 2FZLA 4LZZA 1RKBA 4DLYA 3ZD7A 5BN3A 3KQHA 2NZ8A 2WOOA 3THWA 1FTSA 2OEPA 4A8JA 2QQEA 1GVNB 1UDWA 1NBMA 3HPRA 1GWNA 3KUDA 1YR6A 4LV8B 2AFHE 1LW7A 2ZITA 2ZI7A 4ZO4A 1HE1C 2XNDD 1T5IA 1SKQA 1VYVA 4TLAA 2IXEA 2ZRJA 3LH5A 4UXIA 2WZQA 3L82B 3B1WA 1GDDA 4NCNA 3RWMB 3D8BA 2A5YB 4FCVA 4GZLA 4LPSA 1H8EA 5FL7D 4BZPA 4D2IA 3U6KA 2XZOA 3TK1A 4O3MA 4NP6A 3THOA 2FSFA 1ZW6A 1XU4A 3CZQA 4Q03A 2IL1A 1AKYA 1KI7A 4US2R 3GEHA 3GJ8A 3ZQ6A 1EXMA 3DL0A 2GAAA 3BBPA 2XOKA 2FPKA 5C2JB 2QMUA 1XZQA 2RMKA 4DLRA 2IYXA 2IK8A 3DOFA 5DI3B 3KKNA 3O8BA 4G5SA 1E9SA 2AFIE 1W1WA 1VHLA 1VKJA 2ZE7A 4LYJA 3VU9A 1W46A 3MRSA 1KO7A 1JR3D 4RD6A 2KSQA 1RJ9B 2XXAA 5G3YA 3KZ1E 2VH5R 1KKMA 5BWMA 1R8SA 3E2IA 4PTLA 3R20A 4PC6A 4Q7KA 2P3SA 3OIWA 1R5OA 4KYIB 4RZUA 4F92B 2WJGA 5GVSA 2VF8A 4XSHA 2IS1A 3I3SR 2F1IA 2ATXA 1YRAA 4HAVA 1TF5A 1SULA 2Z43A 3AUYA 3VKGA 2ZSEA 1QF9A 4R9UC 5FOXA 3W34A 3NDPA 2GF0A 2HJVA 2F43B 3LXRA 1NN1A 1NVXQ 4EPYA 3MWYW 2FF7A 4LJYA 2WJJA 4QXAA 2CL7X 2PL3A 1GKUB 3U5ZB 2C9OA 1DVRA 1S8FA 2JDIA 1X8KA 4LI0A 2NZJA 1MR3F 3W90A 3T06B 3N70A 3BOSA 3CX6A 1ZYUA 1WBBA 4DSUA 4CYMA 3BH0A 1DELA 1N6PA 3Q8XB 1KK0A 1JEDA 1XF9A 1VCOA 3HU1A 1N0VC 4QFMA 1JR3E 1R5BA 2B7CA 4HUQB 4TLEA 1II8A 1U98A 1KYIA 1YZNA 4LUCA 2GEDA 5JJIA 3EZFA 4YMUA 1P9NA 2Q9BA 5BN5A 3P4YA 4Z8XA 3R9WA 1IXZA 3U60B 1TPZA 5JS8A 2ZRPA 1DAFA 2JLYA 3RC3A 1CF4A 2QORA 4NCHA 1JJVA 2O8CB 4Q9IA 2R6FA 4P4SA 4JT2A 5JBQA 4M0LA 2JLRA 2O8FA 2QU8A 2ZJZA 3CRW1 4FMBB 2GCOB 3QIAA 4EUNA 3K9HA 4PHFA 1XXHA 2YZ2A 2ZI4A 2AK3A 3EASA 3H84A 5TDHA 3B1ZA 2I1VB 2FG5A 1I4LD 1SXJB 2JJ1A 5K8IA 3I73A 3Q3JB 4ZKDA 2BDTA 2O8DB 4ZIRA 2ORWA 1ZRHA 1LTQA 3CB4A 4RFVA 3SC3A 2ZUBA 1Z28A 1Q22A 1FQJA 4M1OA 4OL0A 1PV4A 3B9PA 1Z0DA 4URXR 4IKEA 4KHZA 1E2LA 4LHWA 4W5WA 1G3IA 4C3ZA 1JPNA 4FCTA 4QHSA 4DEXA 4QM7A 3WHLA 2CNWA 5FPTA 1A82A 1GUAA 4B6FA 2QAGA 3MJHA 1X86B 4DIEA 3KXLA 1AZSC 1XPOA 1NG9A 4MYHA 2P65A 2CCJA 3K9GA 4TMWA 1ZC3A 5AK0A 3PG5A 1RYFA 1XEXA 2BMFA 4JLJA 3THXA 1TQ2A 3FMIA 5FBVB 3GP8A 4UNPA 3WNCA 2ZANA 1ELOA 1S2MA 3FWYA 1G8HA 4PFSA 3QUSA 3ADKA 3U4QB 4OI2A 2GILA 5E3HA 4BE7B 1XWIA 3IHWA 1IAQA 1KMHB 4MA4A 2CLSA 4XWAA 3TRFA 4CIDA 5JCZA 3AP2A 3VR2A 3MJRA 4YMVA 1AA9A 4FD2A 4TSFD 4CDGA 2IYYA 1UADA 1NLFA 4ZCIA 1ODFA 2ZR0A 2CLDX 3B1VA 4M9XA 2P0EA 3WBKA 2LKCA 3K0CA 3FFAA 2QA5A 5FI1B 3BB1A 2YWEA 3BWDD 2NTYC 1ZM9A 4R7ZA 4FXPA 3ZLJA 2PMKA 3MUFA 3Q5EA 721PA 1LB1B 2DWOA 1FX0A 1E3MA 2YNMA 2LCFA 3WRYC 1NIJA 1KI8A 3N5CA 1P9RA 2QQ0A 2A78A 4F38A 3C8UA 5JECA 3T1OA 2QM8A 4RKEA 5EXPA 5FBRB 3HJNA 1ZIPA 1E79A 2WMNB 4KYUA 3K70B 3VNUA 1RW4A 1TU3A 5KNCA 2ECKA 3U3MA 3UANA 2VLIA 2UKDA 2ZJBA 4KFSA 3IBGA 2C98A 2OHFA 4XVQA 1OLOA 2PX3A 3T1TA 5EE9A 2ZS8A 4JL6A 3S1AB 5BYJA 2ZE5A 2HEIA 2VHTA 4F4JA 5A4JA 2XZLA 2IYZA 3N2EA 1EWQA 4JIMA 1R0YA 3ZVLA 3I32A 1N5LA 3LNCA 1S3GA 5HCIA 1QHSA 2MSCB 1O87A 3GFPA 4LJ7A 1L7VC 5DE3A 4PQYA 3LDAA 4YMWA 4BFXA 4US0R 1E2QA 5KDLA 4DDWA 4C30A 5LB4A 4DLZA 1GG2A 2PJRA 1E1QA 3K8YA 2GJSA 1E2IA 2HLDA 3I4LA 4PZZA 5FTKA 1KOFA 4D6PA 2OILA 4BASA 3KJEA 1W36C 1QHNA 2VHJA 4R2HA 1W49A 2J45A 4PXAA 1TADA 3FVQA 3BH7A 4QRHA 5KSZA 4OJQA 4HAYA 1IJFA 2PLRA 5HZHA 3FOZA 1Q12A 5IF9A 2F1JA 4IXNA 1R6BX 2HF9A 1G3UA 1PUJA 2EFDB 1H65A 1NVWQ 3TH5A 2ZQ5A 2GZHA 2WOJA 1ZD1A 2VP2A 4NYMQ 1R0ZA 3A4LA 2OV2A 521PA 3KKQA 1B0UA 5IDVA 3WMFA 5CJ2A 4XIGS 5EE3A 5AUQA 3UK6A 1XTKA 3FFBA 5KSOA 3QXSA 1KNQA 4MUAA 3ZVNA 2OSBA 4Q1EA 4POAA 3CNLA 4LWZA 2XSZD 4LBVA 2B8TA 2VP6A 3KL4A 1GNQA 3PUXA 2DHRA 1TAGA 1G4AE 2ZI5A 4EJSA 3DPUA 3U2QA 1UBGA 4M53A 1NG1A 5HE9A 3RRYA 1AZTA 4RKFA 5GJBA 1IXSB 1RE0A 4U00A 1IY1A 2QN6A 2IYLD 1EFRA 2EFHB 3Q85A 4TQUS 2J0UA 2JJ8A 4EQ6A 1U8ZA 2YC2C 3I72A 4HZIA 1ONBA 2CL6X 4KLZA 3I1FA 1JPJA 3EPJA 2IWHA 3L8ZA 3KB2A 2J0QA 1P60A 4XOIA 3EW9A 4RCYA 4MQBA 4DWJA 5L3SA 2OZEA 4AIIA 3QEJA 2A5FA 2J7PA 4B73A 5K8LA 2WSSD 1IJEA 1W0KA 2JLQA 2WWXA 3MAAC 1GZSA 5DISB 3X2SA 4KODA 2B8WA 1X8LA 3AKYA 1W4RA 4M1YA 4B2LA 1Z6TA 3I92A 3REFA 2Q3FA 4OQXA 1TF2A 2GZAA 3RAPR 2A5JA 1FNNA 2QBYB 3AKDA 1Z29A 1GAJA 1UBFA 2QUZA 1GNRA 1DS6A 1Q21A 1ZD8A 4L16A 1ZJ6A 4IVPA 2EWWA 1J8YF 1HV8A 4FN5A 2GBLC 4IDQA 5FL3A 2QE7A 1R8QA 5FBQB 1A2BA 2ODWA 1Z6AA 5FR2A 2V55B 4ZV4A 4NCIA 3AP3A 1HH4A 2IT1A 3CWQA 4M1MA 4RD4A 4QNMA 5JMTA 1Z3IX 2IYWA 3QBVA 4NE2A 5IK2D 2RGNC 1MOZA 2OT3B 4HLDA 1QVAA 1GRRA 2FGKA 5CITA 1V43A 2KE5A 1E2KA 4GOJA 2EW1A 2QPAA 4EPXA 1DPFA 2CVHA 1RRFA 2FFHA 1E9FA 4IOLA 1XCMA 2ZRDA 2GTPA 4UNNA 3U6BA 2OBMA 2WWYA 2OESA 4KU4A 4Q7LA 5EXSA 1F60A 1T3SA 5HKKD 3T12A 5JZVA 2PJZA 4TT3A 3FDIA 5BQ5A 1DAMA 1R0XA 2X2EA 3CLVA 4KJZA 4Q1BA 1NL3A 4Z8YA 4A8JC 1BS1A 1ESNA 1PZNA 1OPXA 3EC2A 5G53C 4JBYA 1TX4B 3LV8A 1G8YA 2C03A 4A2PA 1YZUA 3DMNA 1FL9A 2IW3A 4QBIA 2YHSA 4RD0A 1D8TA 2W2XA 3X1ZA 2JLWA 4DXAA 2CK3D 3RS0A 4AYTA 4RSGA 1E0AA 4LJ8A 1BMFA 2D2EA 4AC9A 1UKEA 3BFVA 1D9ZA 4LYFA 1KAOA 2JAQA 3SFZA 2IHBA 2CDNA 3DKPA 4Q4AB 2NO6A 3PEUA 4ACBA 5CDFE 2H7VA 4OK5A 3EWSA 1T8TA 2QRNA 3HU3A 4DLVA 4YC7A 4NTZA 2HCJB 2OE2A 3JVUA 4S2EA 2IUUA 2JLVA 1S9HA 1N6OA 1KIMA 2ZETA 4Q4HB 2PZEA 1G8FA 2CXXA 1M7BA 3R8CA 2R6CA 1UEJA 1VCMA 3U44B 2QNRA 2FZ4A 3SFVA 4BRWA 1NLZA 3MFYA 4TYPA 2QP9X 1HYQA 3BGWA 1YR9A 5DI3A 3KB1A 2YYZA 4A15A 2ZIAA 2H57A 4ZCLA 1Z63A 2XJ9A 1UKVY 5L3QB 4FWTA 421PA 1XEFA 1F5NA 4DT1A 3CWZA 4LV6A 2SHKA 2ZYWX 1VECA 1RJ9A 3K53A 5FBWB 3GD7A 3QXJA 5CK5A 2OO7A 1TQ4A 2VQSA 1P2TA 1ZM2A 1TTTA 2WWIA 4PO8A 3FHCB 2AXNA 2PX0A 3QPUA 2YOHA 3TSOA 5JEEA 2ZEJA 3BH6A 4GT1A 2QAJA 2EFEB 1BO6A 3QF7A 2F43A 4MKGA 1D6JA 1VHTA 1SVWA 4Q1DA 1UDXA 4G0NA 4YXWD 2ZI6A 3L0IB 1XPUA 1P75A 3EA0A 3IGFA 4LHYA 3RWOA 2C5LA 3U7FB 1C1YA 1YZLA 2I3BA 3IEVA 1LNZA 3LW7A 1E98A 1E2JA 4AWXA 4A36A 3GLHB 1T0HB 4G01B 1EX6A 2OAQ1 2ASEA 4RFSA 4R71A 4HUQA 1XD9A 1JBKA 2CJWB 2RGBA 4UXHA 1E9DA 4CEIB 1PJRA 1XRJA 2C04A 2JCSA 1HQCA 3H2YA 2R62A 3ZJYA 4K8OA 3TKLA 4MRRA 1J2JA 2AX4A 1GL6A 2BMEA 4B3BA 5BN4A 3D31A 2W58A 4A0FA 1UEIA 4CEJB 2IYTA 2QPTA 2XTNA 4JLPA 3AVPA 3QENA 3SYKA 2PZGA 4HB3A 3VR3A 2QT1A 2O8CA 1U0HC 2ZUCA 4KV9A 4WZBE 4MGKR 3P27A 4GOKA 5FI0B 1ZBDA 1BYUA 3EG5A 2GCOA 3SJZA 4D25A 1SHKA 1XMJA 3BIFA 3C5HA 4DUGD 4HB2A 4EPVA 3QVUA 2ZSDA 1H8HA 1NMZA 3K09A 1KZGB 3N2IA 3DOEA 2IYQA 2ODBA 3QKSB 1CBUA 1Z0AA 2ZR9A 1YR7A 4LBYA 4RJLA 5H70A 1OB5A 1ZNXA 3U7HB 1TNDA 2O8DA 4Y0VA 1W36D 1X1RA 2VBCA 2XB2A 3BRWD 1WMSA 2C95A 4OQMA 1KI6B 1Z6XA 4Z1MA 3VTKA 5L8VA 4HLCA 2QMEA 4TZ0A 2YOFA 1S1CA 1R4AA 3AGQA 1YHNA 3P20A 3PEWA 4Q47A 1Z83A 4NKRA 3PR1A 1XFAA 1P9WA 3F0TA 4F91B 1TUIA 1VPLA 1N5IA 3EA5A 3RANA 4HDQB 3KKMA 4BWYA 5JLJA 5JI2E 3NDBB 5DO9A 4AY2A 1F2TB 1Q20A 2ZREA 2JA1A 1HQYE 2GDJA 2OM2A 2IX3A 1YE8A 5EE0A 1W5TA 2NPFA 3MWKA 2QP3A 3LX5A 1E9RA 5EZ6B 1KSGA 2KBFA 1R7RA 4JVNA 4TYYA 1QG2A 4FCWA 4PX9A 1U0JA 1D2NA 1E4VA 4PC7A 3U4QA 1CRPA 3AH8A 4LYAA 2IYSA 1KMHA 2ZAMA 3ZYCA 3CUEF 5EP4A 2VP5A 3T5DA 2IXFA 1CXZA 2BC9A 3MD0A 2V8OA 4KAXA 5FTJA 1T6NA 3L0OA 3QPVA 3FTQA 4C7OB 2GJKA 3B78A 1AQUA 3ZZUA 1IXRC 2AKYA 5FTMA 2C2HA 2YINC 3LW8A 3K0CC 4QJ4A 2O52A 2DR3A 1UBCA 3DM5A 5SZIA 4NPHA 4RY2A 1R0WA 2RKOA 3IIKA 2KJQA 1NN5A 3TSWA 4D26A 2XB4A 3LQQA 4QBHA 3TMKA 1E0SA 1YRBA 1JNYA 2JIZD 3AM1A 3A6PC 3UMSA 3LWNA 4B48A 2HJGA 4BPBA 4JS0A 2H18A 3A1WA 1KZ7B 3RSLA 1SHZA 1CR0A 2GEUA 1Z22A 2EFGA 4GPTA 3NIBA 1RRCA 5GVRA 1M7GA 5J4YA 4R98A 2EQBA 3DM9B 1DAKA 1NLYA 4OHVA 2BBWA 4US1R 3S1AA 2BCGY 1BYIA 1G8GA 2ODEA 5JWRA 5EXTA 1DTSA 3GLFE 1KI3A 3GLGE 4Q18A 2XTZA 4A92A 1M7HA 5KDDA 4TTQA 1SGWA 2ZJYA 5FPYA 4DCTA 4B2IA 2WJYA 3JZMA 4DDUA 2Q3HA 5EUMA 1TMKA 1T3HA 4DLSA 3K0AB 2GXUA 1S1MA 3ZQJA 1DAGA 3RYTC 4QBFA 2Z6VA 2ZVPX 4M21A 1E9CA 2WPDD 1G5RA 1MO4A 2NPIA 3CF6R 5F2EA 1QHHA 2ZS9A 3MCAA 1OSNA 2FEMA 2F3RA 1NKSA 3RRMA 1XEWY 1IN5A 1SVOA 2EFCB 2VHUA 3AKCA 4IFBA 1DOAA 1ZINA 4RD3A 1OXSC 1DARA 3B2EA 1US8B 4OHWA 2OUKA 3TR5A 1QHYA 4D0GA 3CW2A 4URWR 1BH2A 5JEDA 2GEVA 2G9NA 2D2FA 4HAUA 2BIFA 1ZCBA 2X1VA 3PQCA 4P3YA 1ZAKA 3VR6A 1EG7A 1FW6A 4QC2A 1Y3AA 4KBFA 3PFIA 2J46A 3WYAA 4DBLC 3M6AA 1KO1A 4B6EA 4BFUA 2C78A 3EZ2A 2QTHA 5E4FA 2G3YA 5B30A 5KNBA 1GIAA 1KDOA 2W6IA 5GADl 4OHYA 4ZDJA 3O8RA 3QJYA 4QBGB 1IHUA 3ETLA 3RNLA 2BBTA 3SNHA 2VA8A 2XOKD 4TTPA 1Z07A 3H0KA 4MRPA 3KDSE 1TEVA 3WY9A 3QSYA 1E2NA 4EPTA 3WP1B 1NBME 1T3LA 1MO3A 3B1XA 1KSFX 3B1YA 3TJZA 4EAQA 3CNOA 1NN0A 2ZU0C 3QKRB 1SKYB 1W48A 4TLBA 2QEQA 4DHEA 2R6AA 4G1UC 4GFDA 2NG1A 5DNYB 3ZVMA 1II0A 2V3CC 3K9NA 1TF7A 2QI9C 3LD9A 1TEXA 4MITA 1HEIA 1XB2A 4KXFB 4IVQA 2X19A 4O0MA 4IFEA 1OHHA 2ZE6A 2WBLC 1I2DA 3PEYA 1JB1A 3AEZA 4D82A 3Q7PA 1AN0A 3EIQA 4V0ME 3CPHA 2GETA 4BLTA 1WBDA 2B21A 4Y0AA 3P1JA 1KI1A 4GP6A 1ZNZA 2P6NA 3U3KA 3I8XA 2GXQA 1WCV1 3LBHA 3CZPA 1F2UB 1M8PA 4D81A 1OIWA 2AKAB 1GNPA 2G0NA 1CR2A 2JDID 1W4BA 4E22A 3W9YA 1P62B 3IDQA 2QPOA 4B2PA 5FH9A 3LO5A 2HUPA 3TW8B 3PUWA 3A1SA 3X1YA 2OXRA 2PCLA 2VSXA 2WWGA 4AI6A 4BRUA 3K0FA 1P7CA 4LDJA 1KO4A 2NO0A 3HR8A 3K1JA 3DEFA 2QENA 3ASYA 3FKQA 3DZDA 1Y63A 2FFAA 4XWKA 4JVSB 5E7IA 4A2QA 2JLXA 5CYPA 1AQYA 2L0XA 3VHLB 4RCZA 2R44A 3T61A 3KQKA 3AF1A 1G8PA 1NIPA 1T0JB 2AD1A 1D9XA 4ACAA 1A1VA 4UNQA 3FGNA
chains in the Genus database with same CATH superfamily
3CVXA 4Q9LA 4FDTA 4JEIA 3UPUA 3GZNA 2NGRA 3DQPA 3WIUA 4KFCA 2QY9A 5ELXA 5JYDA 3M9XA 2I33A 3KL2A 2H16A 1RIFA 3OIDA 2CY0A 4ZWNA 4W9NC 2Y1GA 1EIWA 4HHEA 3V5NA 4HDCA 3WDSA 1C9NA 3AOEA 1CEXA 1T4GA 4ZHQF 3CX7A 3GFBA 1OTHA 1ZK1A 5AXCA 1MFPA 1I7SB 1S7CA 2V54A 2Z3VA 2VI5A 2GBCA 3PXXA 3SZGA 4C4ZA 5LP6A 4JI6B 4EZBA 1ETUA 1FXWA 2J9RA 2QF7A 3AKEA 3VKHA 2C99A 1ZSNA 1JXMA 4R2JA 2R86A 5AJXA 3QELB 2FWAA 4BVHA 2CT8A 4OAOA 4KQHA 3IALA 5I7UA 1G6KA 4HFRA 1QKIA 2B2NA 4P7GA 3U44A 1LLQA 3CURA 1BCSA 4C4RA 3NLLA 3N2YA 4B74A 5F3WB 4G0QA 1KH1A 4TZKA 1ULAA 1D07A 2FG7C 5MFPA 3O9VA 2JNWA 2C9DA 2IZ0A 3HCAA 1VFPA 3ZWBA 1U2DC 1VG8A 1P0IA 4JBXA 2FMXA 3JAWB 2O5RA 2X8JA 4A7PA 4WKNA 4ZEVA 4IDHA 3IL2A 1H9BA 3ABSB 4CL8A 2ZRKA 2P6UA 3F2IA 2EAUA 2QU7A 5LPNA 3OOWA 1M1NB 1ND5A 3NJ8A 1X1SA 4K81B 2O8BB 4FGWA 1NLUA 1SU4A 4I1RA 2YJ3A 1PR0A 3SJUA 1WB9A 3V1YA 2OCIA 4N65A 4BP3A 1AU9A 3CISA 1M8JA 2PLFA 4KKXB 4CZ2A 1XA0A 2I8CA 3FCYA 4UNRA 3JVVA 3WDLA 4DJEC 3ZDBA 4R40A 3PQDA 3VR2D 3DTVB 3QY0A 5J47A 5AJWA 2BEKA 5LDDC 1H4SA 2R60A 1UK8A 5ICSA 5JPCA 1U80A 4J0KA 2ZTVA 3RVRA 5FIUA 2QX4A 3FMFA 1KHHA 2RARA 3LDGA 5CIWA 5CB8A 4L4SA 4M8KA 2QN1A 1SVNA 3T1QA 5BYAA 5KYYB 5LXTA 2VSOA 4O4HA 4S35A 3HE3A 1SQ0A 5L3RA 4XUDA 2I9PA 1R0KA 2O2JA 4BGUA 1FZQA 4AMZA 2ZROA 1JHZA 2WVJA 4YMSA 4KBGA 4OP2A 4RTOA 2B1QA 3S1SA 4F8EA 1D1QA 1ONNA 1TMOA 5E8RA 2W6QA 3AIIA 4OHUA 4KPFC 3HGTA 3IR5A 4KJXA 3ANNA 3ZZMA 1C1DB 2QL5A 3Q72A 4IQ0A 3ADBA 1PZHA 4CEIA 3A3PA 1EUQA 2P2LA 5CFZA 3RSCA 1PSZA 4Q9AA 2FDRA 5BSKA 2RBEA 3ISVA 4G1FA 2CXOA 2W00A 3DKVA 1MOSA 3DZJA 5G1NA 3DMHA 2GVZC 1Q6YA 2WFLA 2XUZA 5TV2A 2DQZA 4PTZA 5BN1A 2O4CA 4JZKA 1YBVA 2VEDA 4M0FA 4U7WA 5DYNA 4DNQA 4F12A 121PA 1VE3A 3SG0A 4CKEA 1UODA 4KYVA 3BS4A 3THWB 3ILYA 5I8PA 2BZGA 1AK9A 1RLJA 5FUXA 5L6LB 5E3JA 4ND3A 2ZYRA 2QZPA 3BFJA 1AHNA 4R3NA 2QYHA 4JP1A 3COYA 1V1JA 2R66A 1YB5A 3MINA 4ZVKA 4CQLA 4I81A 4DEVA 3A4NA 1EFAA 4MA5A 3UJCA 2Q1WA 3VOBA 2W9XA 2FZCA 2AI2A 1OVGA 1Q15A 2HA7A 3KS9A 3VR1A 3WLLA 4EP1A 4QATA 1GQFA 3QKSA 4QA9A 3T7AA 3WBFA 3MCZA 3PFHA 5LQUA 3OP1A 2HRRA 5CA1A 2HLDD 2BCEA 3AHDA 5AICA 1X38A 2HT1A 3K3PA 5JD5A 1ULBA 3FAKA 1GRQA 1S3IA 2NZWA 2CDRA 4NNJA 3L0SA 3R7AA 2CWWA 1V7CA 4ZVPA 4PSUA 3DMDA 3E5NA 1JPUA 4XGRA 2A1IA 1OUMA 3QPCA 1T6BY 4HO1X 5P21A 3ETDA 1DJQA 3GF4A 3OMWA 3WS7A 3J80A 3O8QA 1P7YA 3Q88A 2XI4A 4PPNA 4DMRA 1MEJA 4QOIA 1ZC4A 5EZYA 1P2DA 2HN9A 3FH0A 4QOFA 1Q0UA 2EZTA 2OO3A 2VBIA 3PCTA 3UMVA 4UUOA 1Z12A 5EP1A 5FBLB 4YQZA 5ADUS 2H7CA 5B57C 2AMYA 1CUJA 4UD2A 1K5GA 3EGVA 3NKVA 3L0CA 1FFXB 1PTKA 1KYVA 4R1MA 3SYTA 1ZNYA 3HZRA 2FPMA 3FZNA 3DLCA 1AUPA 2FEXA 2WTEA 5AK5A 3H8VA 2ORYA 5ESXA 5KI6A 4NEGA 4B47A 2ODAA 2EERA 3KJGA 1CRWG 5CVJA 2CXTA 1SA0A 4ZZ2A 4I4LA 1YD7A 3UENA 2AVDA 1ZGCA 2MMGA 3CRMA 3L01A 4Q3BA 3A7EA 1W5FA 3AILA 4JVOA 3P0FA 1NM5C 2FEKA 1OE0A 3P2EA 3OPYI 4ARZA 3ZCQA 4DC1A 5AVQA 1OJ7A 2JKZA 4ODIA 2AE1A 3PJEA 4QOJA 4U7FA 4ALNA 4FCCA 5CLLA 1KP2A 3AVTA 1GQQA 1H9AA 1I4OA 3UKJA 2UV8A 3WA6A 1R74A 4KPEC 1WOYA 1KTIA 1P1HA 1EWTA 1E3TA 2Q3DA 1YIAA 2VATA 4PCUA 4YJDA 4EM6A 5JHGB 2QG6A 4Q66C 3PDWA 1IM8A 3B6EA 2RGXA 1RHRA 2YW9A 4ZVMA 1GPUA 4JP8A 3UUGA 2XR1A 1OAOC 1YQ9A 3B48A 3AI3A 4C5CA 4KQWA 3M6VA 4MUFA 2VHQA 1PLKA 2J5KA 4D57A 2WZBA 3C5VA 4DLXA 1FSSA 4GMKA 3GRFA 1DQSA 1FBTA 3T4UA 3M3HA 2PBFA 1TK3A 4R9RA 1MO6A 1AXRA 4HZUB 1EINA 3VVLA 2VDPB 5E6RB 5BN5B 5HKKA 1Z7YA 3ZY6A 2D8MA 4IHJA 1E1RA 1ZWLA 3F1LA 2JHPA 4YI3A 1ISJA 3ZS9A 4FFWA 1T4CB 4U4AA 2FV8A 1SC9A 3GPDG 3HWWA 2O8EB 1GT91 4TYMA 2XDWA 4L02A 1ZGBA 4YRPA 1IPFA 1CF2O 2O57A 5HEKA 3HLTA 3PGLA 2QDXA 3USCS 3K0AA 2VLBA 5EG5A 2XX3A 4AJ2A 1EDBA 4DKXA 1Y1SA 1YOVA 3D6MA 1NMSA 1UJBA 2X9QA 4NFLA 3M8KA 4K3UA 3DZ8A 5EI5A 3OE7A 1VL1A 2EYQA 4JP5A 1TKRA 2XGOA 2FW0A 2NUAB 3ZXIA 2IPMA 1X7DA 3IVMA 1CUCA 1DTWA 1WNTA 1YMVA 3EXG2 4LQ4A 4TT3D 5KQLA 5KTRA 1HT1E 2C2OA 4O0LA 1SVMA 1Z2EA 4OMUA 2XUOA 4KH0A 4RY9A 4F4CA 2J9GA 1V9LA 1XZHA 4L4XA 1D6SA 4O8CA 2AOTB 1FX1A 3UIEA 1ZD5A 1B6SA 3BTUA 3G79A 2PNJA 1QU3A 2CEKA 1EM6A 2CFSA 1OYOA 1PT6A 4BKPA 2IVZA 2HA0A 4M0KA 2HM7A 4XUCA 4F84A 2R8RA 4HUJA 2MIIA 2JFGA 4J43A 1O8BA 1F2VA 4YMTA 1GFZA 2QY6A 3QVSA 1WKCA 4QD3A 2B5WA 2YZNA 5K6TA 3M70A 4I4IA 3OTQA 5ICMA 2HMUA 3HJFA 2ZE8A 1NPYA 2I6GA 4FU0A 4NMMA 1FQKA 3K92A 4UVEA 4F1JA 5JSUA 1J2YA 1VLJA 1TUEA 4D6XA 5FEUA 4NBTA 3R74A 3RK1A 2Q5CA 2OOSA 2N9UA 1BGWA 3JQQA 4URHA 2QLFA 3T0FA 3UH0A 4L50A 1ZNWA 5I9NA 1B8OA 2C84A 5EWLA 1B93A 1WKBA 1YAHA 2P0AA 2PRSA 3GDWA 3O3OB 4HDKB 4TLDA 4WLEA 2ZRFA 3Q12A 5HYVA 2VZEA 2YMQA 1NUHA 1NQ5A 1VSQA 3GZ4A 4PU0A 5FUVA 3RS2A 5HJ7A 1L5GB 3DAOA 2I6XA 4RDXA 2F4NA 1QGAA 1QB7A 2GM5A 1RAHA 2OZLA 5FLXA 3TLYA 3A3NA 4F4DA 4JLBA 2JKYA 1GKYA 1KE2A 1WUJS 4K8RB 4INAA 2GK6A 4OVKA 3TN7A 2ZDHA 3VJKA 5CCBA 1V8FA 2H92A 2ZB4A 3LZDA 4YGYA 3P94A 5AVZA 4CMIB 4F3TA 2P77A 4PQFA 1G0OA 3GOHA 2OYRA 3CVJA 1NF3A 4UDOA 2P9HA 1CJVC 2VWGA 3AINA 4JFRA 4UTRA 4Z3OA 1ESZA 2G0TA 3NGLA 1RFLA 2IS2A 1KJ8A 3LTNC 3UYLA 2BEJA 4TS1A 1JA1A 3I8OA 3ITNA 4U9HS 1COWD 1SXGA 3COJA 2D1RA 1KHTA 5DLPA 2UYHA 3DPSA 4PGGA 1N4AA 4PLFA 3SOPA 4CL3A 1OFUX 1UXHA 5DWVA 1L5RA 2FUG6 3KYDA 4NG5A 1U63A 1VP3A 4BMNA 4F2GA 3QE0A 1M1UA 1ECBA 5IH7A 2PUCA 2OMKA 2IV7A 1O96B 1X94A 2IKSA 4ASUD 4Z4FA 1P1FA 3ZOZA 3D8RA 4HYEA 2P11A 4QJ3A 3NC4A 1WD7A 3RU3A 4P36A 2V6IA 1N5MA 5J4LA 5HR5A 4EW6A 2C8JA 3CLKA 2FZGA 2YWHA 1PK7A 3H1BA 4GXNA 1Z2AA 4KQ1A 4LOKA 4CMBA 3WLHA 3BAFA 5GGYA 4MYCA 3UGTA 4FE4A 3AR5A 1HL7A 1Q0PA 3JQEA 3D0QA 3IUBA 1VCIA 4NIMA 4NU6A 5AOCA 3IBYA 4JOBA 4Z86A 5FTWA 1TJNA 4OHRA 4FX2A 5F7ZA 3RYCA 2KBEA 5D3KA 4KSYA 4M7RA 1BW9B 2QRVA 4HPXB 1CS4C 4CMAA 3AFNA 4P3OA 4YONB 1SXJA 3F5QA 4HEA6 4IEFB 4IQ8A 1QGOA 3UWSA 1DXQA 5E7JA 4PCAA 2GNOA 3FZEA 3K1YA 5F1PA 3IO3A 5JXGA 1UMKA 4JJ8A 4TT8A 2JAOA 2PTGA 3T3GA 3FBGA 4BNNA 1XBTA 1OFTA 5IPFA 3UV6A 3PFCA 3QXXA 4F7DA 4MVJP 2Q2VA 2WPNA 3OLYA 2KI5A 2IJGX 3FYUA 4PG5A 1PS8A 1L1EA 1YGPA 3WJ1A 4ZHSA 2QM7A 5E1MA 5DP2A 5FNVA 5LQKA 4BIMA 1PJQA 3GLQA 2RHBA 4OKIA 5BSGA 9MHTA 1XQYA 4GMXA 1CQWA 2VNKA 5FF9A 3E7DA 2W6PA 4MHTA 1BOFA 3LSTA 3UHOA 2HKIA 2GLTA 2XUKA 1O54A 4LXXA 5FOVA 5ARBA 2QMZA 1ISGA 3PDIA 3Q9SA 4F1KA 2RGRA 3I5YA 3LUBA 2Z9CA 2B1JA 2CJYA 4IY1A 4TYNA 1OH8A 1EVKA 2WM9B 3KQWA 4J4HA 3ESYA 3RTCA 5BXQC 1E4YA 4JLWA 1YZTA 3QV1A 5CFMA 1FB5A 1E0KA 2M98A 2R1VB 4RZIA 4MAMA 2VYND 1UP7A 2FLWA 2OLJA 4MPJA 2ZR7A 5CURA 3RSZA 3T4PA 3N0XA 1E5TA 1Q1AA 2ZT7A 3F71A 3FVVA 4TMZA 3VFDA 4AFNA 2E9SA 1P0PA 5AM5A 2PKRA 2TMGA 4G63A 3STHA 1JDZA 2CZQA 1PDOA 4UJ3A 4GIBA 4LZPA 5CU7A 3IURA 5AKEA 5EWJA 3V42A 5A3VA 3W2EA 3ZBTA 4JYAB 3D7RA 4UPDA 4ZYZA 1CY4A 5IDXA 4C05A 4P0TA 1M5TA 1KL7A 1IJBA 4REMA 4HQ0A 5AIBA 1JFVA 3I9V1 1CUIA 2VQDA 3PENA 3M9LA 2R85A 5CA0F 3DMTA 4E5VA 3ZD6A 2W2LA 5I6DA 5K09A 3KJHA 2JASA 4BECA 3BB4A 1EUDB 1WSWA 1T9DA 2RHOA 4LRWA 4OHCA 5HM8A 5HP4A 4I5IA 4RORA 4RMJA 3OZSA 2G63A 3H5VA 2BP7A 4D4MA 3JQAD 4M6WB 5GINE 3QWIA 1SKAA 3C3EA 2WTBA 2XB6A 1ATIA 1EU1A 5KVSA 4PYIA 1OZGA 4RK7A 3A06A 2IYUA 3NETA 5C4MA 3DD1A 2V1UA 1D2GA 1DJLA 3SQOA 1C3XA 1DKOA 2JRCA 5G02A 3HXQA 3O74A 3X1JA 1Y80A 3ESDA 4MULA 4OBWA 3KFLA 3NH9A 2BJWA 4RXUA 2ID8A 1HORA 2Q3BA 4UNIA 3C8HA 3PZRA 4LF8B 5DCYA 1R4MB 2FQQA 1L7RA 4M0MA 3ND9A 4LDNA 3TQSA 3L6EA 3VBCA 3T54A 4RO0A 3ZDCA 4XB1A 1O6FA 1A7JA 4Y67A 2OA0A 3TSCA 3DA8A 3LG2A 3ETHA 4N41A 1E4EA 1F0NA 1NRXA 4EQZA 4CG2A 5ALPA 4E13A 1T4MA 4K9SA 3H65A 5AM4A 3R7LA 2AOXA 1ACMA 3MWDA 1I6MA 1ZY2A 1JAIA 2X5XA 3SIPA 4B32A 1Q0SA 4MPTA 4YQEA 1BHO1 1Z0KA 3EGWA 4B80A 2AFIA 1S96A 1P4JA 4K6CA 1A1SA 3DEIA 4TTRA 5TR9A 4DFDA 5HX7A 3ZZNA 2AG8A 4DY6A 4KPUA 3QEBZ 4WJZA 5MN6A 2IYVA 1AUOA 2Q49A 1SG6A 3ICVA 1AURA 5KHOC 1M76A 3V7YA 2RHMA 4YMGA 5TLSA 3C6QA 1N33B 1GITA 3GUZA 2ZBFA 4L8WB 1XJWA 3Q1KA 2BWJA 3ECSA 4FDUA 4G86A 5FI5A 2DFNA 5DEIA 5JJCA 1H2XA 2VZ0A 2DFPA 4IZHA 4LECA 5ITSA 4WFJA 2NQ8A 2VPXA 4B3TB 3S7ZA 4XB2A 3K9FC 1Y98A 4IH4A 1AQJA 4OQLA 2BFAA 4FFBB 2C4TA 4D9NA 4I3HA 3BUSA 5I7EA 3LLUA 1GL3A 1C2YA 4ARVA 1MDFA 2O0JA 2FKNA 4JYBA 1MG0A 5F51A 4TN1A 1NATA 3M2PA 3WICA 1E6UA 2Q3CA 1XRLA 2P7IA 4AU1A 5BW4A 3CSSA 3R0JA 1GCAA 4LXGA 4P32A 1OBCA 3GGJA 3I09A 3Q7EA 4LJ9A 1FEZA 2TMKA 3FMPB 2DVMA 2FMUA 2PT5A 4HFJA 3TXXA 3FPGA 2Z2ZA 1A77A 3MIIA 3VNAA 4D45A 2BMAA 3QNUA 3HZZA 4RY8A 4V0MA 1SKUA 2QD3A 4GRDA 4NJOA 1GRCA 5EXXA 3OZFA 1UMBA 3C7DB 5H3CA 3SWWA 1D4OA 2F3UA 4HTAA 5CK4A 2AL7A 2QRZA 1WB4A 3ZH2A 3K31A 1K86A 4PYMA 5FWAA 3ZHXA 2VKTA 1TOAA 3D6VA 1B1AA 1TCUA 1TJ5A 3GU3A 1T91A 4HGPA 2WF7A 4QEKA 1S2DA 4EYKA 4C9BA 2WABA 3PE4A 1C0IA 4HDAA 3HFSA 1IZZA 4G07A 2ISCA 2WNSA 4D98A 4XRGA 1DMRA 5BO5A 1D5WA 1QS0B 2DCUA 3INTA 4UTOA 4WSOA 2FSVC 1LPNA 4R9NA 4PGMA 4WZBB 1TO2E 4XQ9A 1EFKA 3OQIB 3QE4A 1VLQA 4M22A 5JADA 4R54A 2HAEA 4LNAA 3OCJA 3FROA 3WE7A 5I3CA 5K0BA 3F67A 5AMXA 3W5IA 3INRA 1NN3A 3CG4A 3WGHA 2OV3A 5CM9C 3HNRA 4GI2A 4DA0A 3GPLA 4LRTB 1J8DA 2ORVA 2OUIA 4ND8A 1X7WB 5D01A 5CFRA 3S8EA 3C3CA 3B7GA 1FLVA 1B0AA 3QKTA 4AY3A 1Q5PA 3TIVA 2E4WA 2J4FA 1FDUA 4DA7A 2P30A 3BMXA 3CYFA 3N53A 4CTMA 3T7EA 5K8CA 1L8OA 2QBYA 4QG7A 2PVCA 4FGZA 2GPBA 1AVTA 2OBFA 4QPJC 3TEJA 1GLNA 3DZFA 4RW0A 3DZBA 4G5QA 1SPBS 4W8GA 1S2OA 2R97A 3EF1A 4GVPA 2G6BA 3GX1A 4L4UA 1MO2A 1C3LA 3HRKA 4IVNA 3IUEA 5DTEA 2PVSA 4DSNA 3QPWA 4XOUA 1T2AA 2OK8A 5D3ZA 4EY3A 3EZ7A 4BFWA 3AB3A 3QU9A 2XXJA 2ZRQA 3ZS8A 3HSYA 1G5PA 4Q19A 4E7OA 2DLDA 3OTGA 3PJFA 3IT2A 4LOAA 3K9LA 1UDRA 2J5QA 1TJ3A 3MAGA 3ZD9A 1NZFA 1W2WB 5JLAA 4EYQA 3WXBA 1YH3A 3D2LA 3GNLA 5THXA 3RAEC 1DHTA 1U7TA 2RJ3A 2VO1A 1T0IA 2X2OA 4TXMA 4UHDA 3FSJX 3ZGZA 4JNKA 2ZI3A 4RD1A 4NU8X 4EL5A 4JT4A 5EJIA 1NVAA 3U1VA 5HUJA 1EAYA 2D1TA 4AJHA 5ELMA 3JW8A 1P44A 3X44A 3KXKA 3SHVA 3UEOA 1EWKA 1Q0RA 5DI9A 1AMNA 4BLQA 2VG8A 2W11A 3LQRA 1RC8A 1N8SA 2DUMA 3NGXA 4PLTA 1EFVA 3E9RA 3IAS6 1Y8ZA 4XIJA 1P7WA 3UJ3X 1P91A 4LTMA 5E95A 5IVDA 4C0SA 4DCNA 5IJ9A 3A2KA 4YJHA 2MSLA 2F59A 3O2SB 4RPJA 4AN0A 2P9ZA 1F8YA 4K40A 4W9RA 3H1EA 4YAEA 1SURA 2Z2IA 1NI4A 1RACA 4HY3A 1ZVKA 5HM6A 3ICCA 4QGAA 4CG1A 1LDNA 1NBIA 2OPBA 1QBKC 4HLUC 4PHHA 1JP7A 1B6TA 1SBCA 5COBA 3ZGYA 2VPWA 2M9MA 2HJHA 4IHQA 1G18A 5FTLA 5CTAA 3RYHB 3X1DA 5JNUA 3Q8MA 4NZYA 4OREX 3SBEA 1FP7A 3EEFA 1W35A 2P1DA 1J0AA 3TSZA 2FSGA 3LRTA 3SVZA 3H4VA 2FF5A 1U2EA 2QD2A 5IYZA 4AO8A 4I9UA 4LC1A 1AS2A 4NOMA 3GY0A 3IODA 3ZHBA 2P4EA 2KS6A 2BDEA 3ITDA 4J6EA 3WWOA 1L7PA 4N5NA 3R3JA 1W5EA 4KI0A 3MK31 3DT9A 3TJRA 1H4VB 4LZAA 1W34A 1W85B 2I54A 1L3IA 3JY6A 2X3YA 3OZXA 1L4GA 2FMIA 1FY2A 2FX3A 2JBWA 3AEQA 3TB6A 1OI4A 3RAFC 4GXTA 1W7AA 1TQHA 2DBRA 3SAJA 4NMLA 3TIXB 3FI0A 2UUCB 3WMXA 1K8RA 2QUJA 2RHDA 5LQDA 2DC1A 1TYEB 3UG6A 2CBZA 1VI6A 3AOGA 4OI1A 5K45A 3GLFB 5LBIA 4N40A 3NGMA 2RCYA 3GLGB 4BP8A 1T9KA 2CL0X 3JYNA 4OOEA 2W6NA 4WGFA 1C4OA 4YALA 3OQJA 4XSGA 3DL7A 4OQYA 1Z5GA 1JAYA 1OKKA 1ZVJA 3EARA 1U8AA 2OB1A 3ZLUA 1GCGA 4D46A 3V1LA 2FRDC 3PSHA 1Q7RA 4ZZ3A 1TRHA 1SIWA 2PIAA 2YR0A 3L8MA 4NZZA 1YHZA 2IF2A 3SXUA 1OZFA 1P72A 4CM8B 5I4BA 4GVLA 1M5UA 1TLLA 1E8MA 1MIOA 2ZJFA 2VDJA 1CR6A 4TSRA 1EJBA 2YWDA 3K6KA 5AM1A 1N6HA 5ALNA 3DQZA 3QF4B 1HTTA 5CDHA 3OUUA 4IOKA 3OOYA 4TPKA 4U2CA 5ALVA 3UJAA 4MJ3A 3TZKA 2NTNA 2A7QA 3PXGA 4GWKA 5HK9A 1E3SA 4TWZA 1U81A 2C4MA 2HMVA 3GPIA 2KB0A 2P41A 3LK7A 2YNMD 4LDQA 4TS4A 2DKFA 3RIXA 2HPZA 3AJ8A 3FUUA 4R2KA 4HRYA 3HY6A 2IX9A 2R5NA 4GPAA 1P3JA 3UGJA 5K99A 3HUTA 2XDYA 4ZO8A 4S1PA 3AVUA 3ZJUA 5DBEX 3FJYA 2NIPA 1KJYA 3OCYA 2G1JA 4FYKA 1T4DA 1QG4A 4J0FA 1CUSA 3NFRA 3A4TA 4ZOLF 3H75A 3DXFA 5LA6F 1K9SA 4LSMA 4Q9JA 4I8XA 5DLEA 2GJAA 1AB5A 1WM1A 3KZCA 1YJQA 3KWLA 5G4KA 3F6BX 4UTXA 1BS9A 3UMCA 2EP7A 2WDPA 4E2FA 5CFQA 4HVCA 3FNFA 3LFTA 4MS3B 1IN8A 3G85A 4NI5A 2NQTA 3BGIA 3HVKA 4LTDA 2FJ0A 4KTTE 3WHKA 2GZMA 3CY6A 4MEAA 3MJSA 3RI3A 4Z51A 1A5TA 4WAUA 2VJMB 1R00A 3DBVO 4TL7A 2DUNA 3BF7A 4L74A 1OWLA 2DMRA 2FWRA 1NXOA 3C74A 4KNVA 4Q3CA 5CLGA 5TVKA 5KQGA 3Q3GE 2ZJ0A 4ZEWA 1TCAA 3LFHA 1CJKC 2I4NA 4BHTA 2AYYA 4CV0A 3NHYA 1Z4PX 4LJ5A 1OXXK 4JSTA 5TXGA 2HWKA 5D5PA 2R6GA 3SJAA 3LT1A 4PE5B 5C1PA 2BY4A 3KT0A 4GPEA 2DCMA 2N75A 1PDWA 4XGIA 1MU0A 1G59A 2YXLA 2QSZA 4Z9XA 1KA9H 1Z5OA 2LWIA 2WWRA 4V3CA 1HI9A 1RBYA 1SD2A 3AJAA 2YDXA 5FA6A 5LJLA 1GUDA 5HDQA 3WRXC 1BMTA 5EERA 3UK2A 4QU5A 4YAUA 1ZA2A 3PQEA 4F2WA 3UT5A 4EA8A 3TZBA 2FSHA 1INLA 2EARA 1DEAA 3INYA 3KZVA 4TL8A 2I4MA 1JKJA 1RWBA 3W7VA 4FB4A 2GRAA 1YRWA 4K86A 4WT7A 4UU0A 2V0GA 2RD2A 2HR1A 1WUTA 5B7NA 1YS4A 3O82A 4RMGA 4K0KB 3E53A 5GONA 3LUCA 4M9QA 4M88A 3LX8A 4GBGA 2FPRA 2H85A 3ANYB 5FXMA 3CVYA 4KOEC 4B71A 3F9IA 2BGUA 2HHHB 5TPWA 4ZYYA 2QVBA 4MQEA 1M2OA 4AUEA 5HCNA 1LF5A 2Y1CA 3G8CA 3L1VA 1JEQB 2G4LA 3CX8A 2Y1EA 2AQIA 4MUHA 1NNI1 3ENKA 1NJGA 1VIAA 2QXTA 2ZYSA 4IOJA 4ON9A 5K1ZA 3U3RA 3DWIA 2R1TB 1KJNA 2JLBA 3GBVA 2Z30A 4EMUA 4WHMA 3CM0A 5EQJB 3S4YA 4QGBA 1G20E 3ZWDA 1CUHA 3ZWWA 3LP8A 3H2BA 5JNVA 1A50B 5BV0A 3ZDYB 1J0EA 1W47A 1CC1S 1K5HA 4BYMA 3IVAA 4C0KA 4QUIA 2Q7OE 2FZKA 3PFFA 5EGNA 4Y2PA 3HWX1 4KLNA 2R1ZA 2X76A 2JGMA 1WDWB 3U7EB 3H83A 3IAFA 1GRNA 4OQNA 4ZDIA 5JAZA 3U48A 4TV9A 1VSVA 3ZIAA 3D8SA 4G5GA 2PL1A 4BNDA 4OMFG 1Y9AA 2GN8A 2OZPA 1K7YA 2ECPA 2WJIA 1A4XA 4IDFA 3CEMA 4KQCA 2H1LA 4LDPA 2FPUA 1R6XA 4LE1A 4XD7D 4URYR 5KYGA 2R751 1AH2A 3ESXA 3DJFA 1JDBC 3O26A 3ROZA 3IP5A 5IK2A 4I4TB 4RSHA 2I4TA 2JARA 3L6BA 3ESCA 4RHYA 1DQPA 4K87A 1NT4A 3EZ9A 2N47A 3IFSA 1AGXA 4B3XA 5A1TA 3QYPA 1E6LA 2XUAA 2FW7A 4NAVA 3WADA 1C14A 4KEAA 4OO3A 1P19A 1ANKA 2NXEA 2ZT6A 2B2CA 4JVMA 4Q1FA 4R0NA 3WGNA 3E3NA 4DB2A 1UDAA 2V3WA 2CVQA 4GMGA 3VA7A 5ALXA 2E5LB 4F9TA 1U3TA 3BSYA 5JH7A 1EZ4A 1LY1A 1QV7A 3GVCA 1ZZGA 1ISRA 2DAPA 2W2KB 3U13A 1OWMA 4Z3KA 3NUZA 4FFMA 5IBCA 1ULHA 1FYEA 1WTCA 1JTVA 5JR3A 3KEGA 1D2RA 2ZRGA 3C4JA 1I2BA 4WKBA 1A9OA 5K3SA 4F46A 2JLZA 1ND6A 5B3JA 1YB6A 1TYCA 2DWQA 3EQ9A 1EJ2A 1JLMA 3DV9A 3BBLA 3BILA 3VJLA 1UM9A 4ETWA 1RQ2A 4PANA 3LFUA 3PCRB 2GKSA 3PRYA 4M38A 1HE8B 5DRTA 3VVBA 4UFPA 4G26A 1OC2A 2BOVA 1HNZB 1SIUA 1RRGA 1UWCA 4E15A 5B1DA 1A72A 1V95A 2ZCUA 3KHUA 1DIBA 3MWLA 4ZIRB 3BJMA 5AOAA 3DNMA 1EXNA 3N6XA 1RM4A 2GKOA 4YFYA 3RC9A 1V71A 1PSWA 3L06A 2HJSA 5IWAB 3DHWC 2FDCA 2BR4A 3IILA 3D9QX 4MRSA 4X66B 1EUYA 5SY4A 3IKLA 3EG9B 3HKBA 2PD6A 3KX2A 3LZ6A 1NC3A 4UATA 3KQNA 3BT7A 2P69A 4F8JA 3PD7A 1AXEA 4LOJA 3D81A 1YS1X 4U6QA 2AMJA 5IT5A 1T6YA 4H0CA 1X2BA 3I9NA 4KX5A 2WU1A 1ECPA 1F51E 1QTRA 4XDZA 3RS5A 1YCDA 2C58A 3NT2A 4JLOA 4LDRA 1A5SB 2VYCA 5FO0A 2N42A 1SUEA 4KO3S 3ZWNA 5J23A 3A27A 4CE6A 2AB0A 2B4RO 1XEXB 3RTBA 4Q0MA 3FLBA 1LRJA 4BBJA 3H1TA 5KWJA 3BMCB 1VG9B 3ZCRA 2IIPA 5I9LA 3GWGA 2PMFA 6ABPA 4NHOA 4UUQA 3FMOB 5DZSA 4DZTA 2C9YA 4ZGBA 4HAXA 4WN3A 3PK0A 3S28A 4YNBA 1Y8RB 4OV6B 4CKBA 3V6MA 4JI8B 1BAPA 5DWDA 3UA4A 5AW8A 1CG6A 1O03A 4LJRA 3WL5A 2CVFA 3KP1A 5CRIA 2DZDA 3ZBPA 5B7GA 5FOTA 2X0KA 1O6BA 1Z88A 1Q3HA 4CTNA 1BWPA 4EENA 2ZSAA 3CBQA 3NBYC 1U28C 2FWIA 3QOFA 4CV2A 4PXYA 3PQ5A 4FNMA 3UTDA 1X70A 4W5HA 3V6LA 2GEFA 4N0MA 3R0QA 3ODGA 3H0EA 2OV1A 4I4NA 4V38A 5ALJA 1HEYA 3X1KA 3LKDA 3D4LA 4HRVA 5KNDH 5LB2A 3E18A 3AEXA 4J2OA 2Q8QA 4X8OA 4K9MA 4CM4A 1NP6A 3OD5A 1KJJA 3KAJA 1QHIA 4G6ZA 5DM1A 1BX0A 3CF4G 3DXXA 3FGZA 1FX0B 1D1PA 1XTVA 2VQ6A 2QQ5A 1YFKA 2A0WA 1AX9A 3G8BA 5HBGA 1AHHA 1WCIA 4ZKEA 1A8SA 1T26A 1G41A 3DO6A 3G82C 1Y3BE 4PAWA 1MQSA 1PF7E 3G2OA 2BI8A 3HB0A 3NHJA 4WTOA 4KHPB 4LS3A 4B87A 2MMCA 5ICCA 1ZKMA 2NVUA 2Z9DA 3TD2A 2YV5A 1M2NA 3W6UA 2GWHA 2AYXA 3A9SA 1T5BA 3MF4A 4HDSB 4C4XA 1JZQA 2PMDA 1XD2A 5EYPB 5DNCA 5M5BA 3DDHA 2G5TA 1TU4A 2QVXX 5AVYA 3E3LA 4L3VA 1G55A 3OZUA 4ZCMA 4UTNA 2Y9MB 4GOLD 1A9YA 3ICQB 2IYEA 2W6CX 1K68A 4KXQA 4IIVA 3N8DA 4EF4A 4OLBA 2QNBA 3N6VA 2R6ZA 4JB0A 2R1UA 3MTBA 4C3UA 1NUQA 3NIWA 2FP4A 4KIWA 4FYPA 2CDBA 3ECAA 4F06A 5AUNB 4W5NA 3SKYA 3DMFA 3LPNA 1T8UA 2HIHA 3QY9A 2I67A 4DSOA 4M8SA 4DUGA 5A5DA 2XE8A 4PNHA 4KCGA 2WHPA 2ZVQX 4WQMA 3PCXA 3PQFA 3IHTA 3SDZA 4I1VA 3U3ZA 1VPTA 3R2JA 2WTAA 4OIFA 1ZQ9A 4UAJA 4WOJA 4XGNA 3RWBA 5ULLA 4B34A 1I7PA 1PT9A 2PD4A 2H5IA 4AY5A 4R5HA 3W5SA 5KVVA 2JL1A 3O3MB 1NUAA 1ZL0A 4J91A 4PC1A 4MMYB 1V4BA 4MYRA 2OXEA 2ST1A 1VLLA 3ZCTA 4UU1A 1SHUX 3HN6A 1LGYA 3NDJA 4ENUA 2WD7B 2EJUA 5A9SA 4FW9A 1QRRA 1DKLA 1X7ZB 4AY4A 4BLUA 4AMGA 6YASA 2HXGA 5HGJA 2H00A 2I71A 3D4PA 1FA9A 1UKBA 1NQXA 1L1QA 1Y81A 4NJEA 2HDNB 2D0DA 4M86A 4Z99A 3F3YA 1H1TA 4C1NA 4PFKA 2NO1A 3NUQA 4L0DA 2VBGA 5GIOE 3U17A 3IMKA 1K7FB 4GBED 4P3NA 3OEHA 4FOPA 1LVGA 4GUDA 1G9TA 4CIWA 2BEWA 4LBZA 1TZCA 3ZV7A 5CXSA 3G9UA 3IP6A 1P0QA 1LDMA 5AK4A 1RSZA 1SVSA 2EVWX 1GFSA 3RGGA 1A4IA 4CF6A 2EKZA 1C9JA 4I46A 1XRMA 2ZIXB 3EX7C 3CR8A 2GM4A 1JQ5A 3UATA 1P61B 3DZHA 4DS3A 2CLOB 3I2IA 2OHXA 1ENOA 1RU3A 4YJFA 5H9WA 5KJFA 1KBQA 4BXOB 4MHSA 4XIIA 3TZ6A 3VR5H 4WNAA 3DVLA 2G83A 3C24A 4PO3X 4Q4JB 1Z5ZA 2Q21A 5CHEA 3IAM1 3C8DA 3GJ7A 5EWMA 4ZU1X 3IVCA 1P4HA 1H6BA 4M36A 5IUJC 3DLPX 1IEVA 4M8NE 1J06A 4QREA 2ZIFA 5D3QA 5KYVA 5A6SA 5DF1A 2VTBB 3OIYA 4HQFA 4P1ZA 4L9SA 5DNVA 3ZW7A 3AV0B 3VR5A 3TD9A 3TUJC 1IQUA 3M6IA 4JGIA 4OQZA 2PWYA 4JD5A 4B3JA 1ZP6A 2WA1A 4WY8A 1PJTA 4AKEA 3SN6A 1XZFA 2ZXUA 1BE8A 2YJ5A 4U7DA 3NBXX 4YMLA 1DXHA 1UJ6A 3AYXB 3MJVA 3PUHA 1AUVA 2EIHA 5C52B 1P80A 3V1UA 2UUOA 2GRJA 2GLUA 4AF7A 2E37A 3LQ4A 3LDFA 1KZHA 4NESA 3UHPA 4UW9A 1WEKA 2CKMA 5DHAA 1DFHA 4GEGA 1RFGE 4RFLA 3EMVA 3I62A 2E5FA 4CF7A 4GSKA 1IN4A 4CMJA 5AUOB 4BO2A 5JUWA 3VZDA 2J5XA 4X85A 3DS8A 5BT9A 4D4JA 4FWBA 4GYJA 4MQLA 2WIAA 2QGZA 3EAGA 3LUFA 3NJRA 1DC4A 2HJ9A 3E9YA 3RVPA 4DPKA 3S3TA 4NDZA 3U1BA 2MU1A 4LSGA 2EX4A 5CEJA 5IEBA 2QTNA 4C04A 2XD4A 1BE1A 1FMTA 4WK4B 2JJQA 3SHFA 4R3UC 3L2OB 3B6IA 1A4UA 2Z2JA 1Q1QA 5LZ8A 3RRXA 1E61A 4D02A 2BONA 2GHIA 2AJTA 4GI3A 4ZK6A 1NW9B 1Z2CA 3BXOA 3BZUA 4MWSA 3ZY5A 5I4KA 3K0SA 5F9FA 3BDIA 3HDTA 4XPIA 2V6FA 3KC2A 4KIGA 1KQOA 2F62A 4O8ZA 3EXG1 3FOWA 2LZ0A 5IXSA 1YJCA 2ZBQA 1NV9A 1UZMA 3AEUA 3TM4A 4EB8A 5BN3A 3KQHA 2WOOA 4LEIA 1U0SY 2OEPA 4FZ5A 2HRQA 3Q11A 2PGAA 1EK5A 2H51A 2QQEA 3QNWA 2FQ1A 3RTDA 4E11A 1JRLA 2HB6A 1Q0LA 2HSDA 1NBMA 3TQHA 3FRJA 4CLEA 1BA3A 3C48A 4MV7A 4BCCA 2ZUSA 1CZLA 1PFWA 4NG4A 4ND7A 1Q50A