1LD3A

Crystal structure of b. subilis ferrochelatase with zn(2+) bound at the active site.
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
309
structure length
309
Chain Sequence
SRKKMGLLVMAYGTPYKEEDIERYYTHIRRGRKPEPEMLQDLKDRYEAIGGISPLAQITEQQAHNLEQHLNEIQDEITFKAYIGLKHIEPFIEDAVAEMHKDGITEAVSIVLAPHFSTFSVQSYNKRAKEEAEKLGGLTITSVESWYDEPKFVTYWVDRVKETYASMPEDERENAMLIVSAHSLPEKIKEFGDPYPDQLHESAKLIAEGAGVSEYAVGWQSEGNTPDPWLGPDVQDLTRDLFEQKGYQAFVYVPVGFVADHLEVLYDNDYECKVVTDDIGASYYRPEMPNAKPEFIDALATVVLKKLGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferrochelatase
publication title Metal binding to Bacillus subtilis ferrochelatase and interaction between metal sites
pubmed rcsb
source organism Bacillus subtilis
molecule tags Lyase
total genus 117
structure length 309
sequence length 309
ec nomenclature ec 4.99.1.1: Protoporphyrin ferrochelatase.
pdb deposition date 2002-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00762 Ferrochelatase Ferrochelatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ld3A01
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ld3A02
1LBQA 2XVZA 2AC2A 3HCNA 3HCOA 2PNJA 1C9EA 2C8JA 1QGOA 1LD3A 2JH3A 2H1VA 2PO5A 3GOQA 4KMMA 2HRCA 3HCPA 2QD3A 1DOZA 2PO7A 2QD2A 2Q2OA 2XVYA 2QD5A 4CCSA 2QD4A 1C1HA 2Q2NA 2XWPA 1TJNA 4KLCA 3M4ZA 3HCRA 2XVXA 1HRKA 2XWSA 3W1WA 2H1WA 2HK6A 3AQIA 3LYHA 2QD1A 1AK1A 4MK4A 4KLAA 2HREA 4KLRA 2AC4A 2Q3JA 4F4DA 1L8XA 1N0IA 2XWQA 2DJ5A
chains in the Genus database with same CATH superfamily
4BO3A 3L7YA 3N2ZB 4KVAA 1I9GA 1GTMA 1U7OA 3COWA 3TLJA 4IJQA 4R7TA 1Q83A 1YU9A 4KUHA 3ZCSA 1Q0SA 1TJYA 4Z0HO 4LJLA 3QFCA 4I5DA 5FOXA 3TLKA 1LK0A 3R41A 3SXJA 3QBDA 1XLTC 2WSSA 4K2HA 5CDSA 3TX2A 1DOZA 2XVYA 3S1SA 4J1SA 1Y1TA 2QRVA 2HF7A 3BC1A 4JB3A 3BT7A 4MV5A 4REQB 4Z4IA 2D2VA 3EH1A 1PSZA 4NEGA 2NVWA 5KX5A 2CLKB 2CMKA 3MJRA 3MLEA 4MPDA 2H1IA 1VC2A 4FR2A 3FOBA 1RE1A 1N25A 2EU8A 1V1MB 1GTZA 3BJRA 1MC4A 1VSTA 3RV4A 5JHGB 3LRXA 3FCUB 4JI4B 2QRUA 1VLMA 1O6BA 1O6FA 1SC1A 2H92A 5I7RA 3F73A 3WWZA 4X64B 3K5WA 3AY6A 3OLQA 3KJNA 3KZKA 3VKUA 2HRDA 3O84A 4KXXA 4LVUA 3RUHA 4XIFA 1L5QA 2MMGA 5JJBA 2BBTA 3LFHA 3OM8A 1C3OB 3N28A 4GX5A 4R8KA 3TLGB 3DBOB 2ZRQA 5KSOA 3EVTA 1IEQA 2XLCA 5KNDD 1XL0A 4XWAA 2FN7A 4PX2A 4YN3A 4WZAE 1WCYA 2XWSA 1H1TA 3WS7A 2W2LD 2OKGA 2Y1FA 1Z7BA 4O4IB 5EVJA 1BFUA 2O8EB 2ZBVA 2D59A 4ALJA 3B6KA 1E61A 3I8SA 1FNMA 4H7PA 2A14A 3OIWA 4LK3A 4WXRA 5BN1A 5C46F 3AHFA 4JBXA 4OQZA 1U2QA 2OZVA 3QPAA 1IM5A 2AFIA 3MCVA 3FR7A 4QXQA 1SXJE 2PIAA 1A2OA 2W22A 3JWGA 5E7JA 3T5GA 4ZICA 3WA7A 1QYCA 1XWFA 1U1EA 1R8XA 4MW6A 3Q2IA 2G17A 2Z04A 2YXBA 3UGQA 2GZAA 3WGTA 1IBLB 5T4FA 5FOSA 3DW3X 2DETA 1N1MA 3OJOA 4LHYA 1ZH4A 5DGIA 5FFMA 1GA6A 2IWHA 5AJZA 2F62A 3H04A 3TOZA 4FVTA 3EEFA 4AZSA 5CH5A 2L2QA 2IYRA 1ZG3A 3EY4A 3D4OA 4FN4A 5C81A 2PIDA 4IBOA 1DAKA 1LRJA 2V0NA 1PWHA 2R8EA 1M54A 4JUCA 2Q3MA 5BYBA 4M9ZA 3T9CA 2JGAA 1Y8RB 3EB9A 1TKRA 2AUMA 4ZAFA 2AXPA 5FL7D 3HJFA 5FOUA 2CV1A 2FE1A 1Z7GA 4BS9A 1YCFA 1POWA 2ZR8A 1D2GA 2VYVD 4KTTE 4DVJA 4O1MA 5KNCA 1SQGA 1UOEA 4GP9A 2V5VA 1HFWA 2K6GA 2O2GA 2OBLA 4MI9A 4GF5A 2LCFA 4S1PA 2ZI7A 1KMQA 2I78A 3SFZA 3OZSA 2J33A 3HVIA 3O2NA 3O4RA 2JARA 3PFFA 4PYQA 4BNYA 5P21A 2Y1GA 4P0PB 2VAVA 4KVFA 1HRKA 1NUUA 1ZSYA 3FKJA 5FLEX 3DGFC 3HR4A 3Q10A 1JKJB 4DKJA 1U0TA 3SJUA 2HZ7A 1SCBA 1IHOA 1TOAA 1XQXA 2IY9A 2VFAA 2PT9A 3C6YA 2X4LA 4IYJA 4FN5A 4RL6A 3HXKA 1YUNA 1NW9B 3G17A 5B3LA 5FD8A 2X2OA 4MUBA 3Q7EA 5IT4A 4DLUA 4B7AA 5SZKB 4G86A 4YUYA 3CCBA 5DNVA 3CRNA 3IFSA 2QZPA 1KS9A 3DO6A 3FOFC 1DFGA 2W6MA 1JAYA 2XV1A 3OZ7A 2A5FA 4FR0A 2OZKA 3U3XA 3BRCA 4G0OA 1CJUC 2VZ8A 5LZ5A 5J5CA 4A2PA 1EFVA 2LIPA 4H4CA 1GKYA 2JFHA 3VDMA 1BQ3A 3PXCX 5LIPA 2IH2A 3LCUA 3B6ZA 1JVSA 1N4DA 2CJWB 2HXYA 2VK1A 4I99A 2ZYAA 4KPUB 4B6EA 5JPCA 3S68A 1F14A 4JKOA 3WWEA 1SUBA 5ADVA 2C5AA 2WHQA 4XE5A 3REFA 5ICGA 1Y5MA 1YONA 4YRDA 5LOVA 3HPRA 1X9HA 3PQ8A 5L3SB 2DECA 5E6SB 3FB4A 1C7QA 1NXTA 2OGWA 4F5EA 1TU0A 3FTPA 2HM7A 1RJ9A 3E3NA 1AV6A 1KAQA 5C52B 4E7PA 2BEUB 2CNWD 5AVSA 2BVNA 3T9DA 4BZWA 4EPYA 3Q7IA 3LGAA 5JH7B 2A7QA 1R8SA 4AAYA 4BP8A 5LD2B 4N8SA 4F9FA 1Y5RA 4IDAA 3DLHA 4UM7A 1SUWA 1HM5A 2IZZA 4NMHA 4X8MA 2GR9A 3UUEA 1XP8A 4BC0A 2J3EA 2MINA 4F72A 1L7PA 1DEHA 1RWOA 2GN0A 2UZ1A 4R41A 1HYBA 1L8AA 3AILA 1ISSA 4IMIB 1QMPA 1PD0A 3FTDA 2PCLA 1IU9A 2JDIA 3FZNA 4IUBS 3ZOZA 4IDFA 1JDZA 2FH5B 4E4TA 3SF8A 2B3TA 3P0RA 3LVRE 4LYHA 1GU7A 1TO2E 3K9BA 1T9BA 5ENDA 1P62B 1KI4A 4DLPA 2O2HA 1R88A 4F4CA 1J56A 3L7LA 1H4QA 1WB9A 2AX4A 4U6NA 4YJ3F 3Q9LA 1M2HA 2DUJA 1VJDA 2I8LA 3DTYA 1E4YA 2XA2A 4H15A 5TS3A 3L9WA 4OH7A 1KO1A 1FVHA 3ZD8A 4X8OA 3ZGNA 3NOOA 3ZQUA 1UM9B 3F96A 4CKCB 1G20A 4HN9A 4HRXA 3FYCA 4P81A 1SKMA 4AICA 4QFMA 1OC2A 2QEQA 1HE1C 3DHWC 4QOIA 4EG6A 4QZVA 3HCCA 3C4QA 5EQFA 1OCEA 1FXWF 3OPYA 3TYXA 2G0NA 1ECFA 1Q1QA 4OXYA 2HGZA 1JAXA 1ZBDA 3EQ2A 4PG6A 2VQFB 3HN7A 5LL6P 3IRUA 1JHYA 3VV3A 4WZAB 4C4PA 1FDRA 3FCEA 1JPVA 5CW1A 1HDXA 5KTMA 2ZM6B 1VRWA 2XJ4A 3TQSA 3UGTA 2ZAIA 4R2HA 5CVDA 2R8PA 4B74A 2VXOA 3HBAA 4EF6A 4DV3B 5F3WB 1ACJA 4TSFD 1EGAA 4V0ME 3QXJA 4J9VA 3RSGA 3HL4A 2IYVA 3ZGYA 4MHTA 2VS1A 3ZW9A 1G8FA 3D5EA 3R23A 3TI9A 1SXJB 3ZLUA 3LZDA 4PZAA 2BI8A 2JF0A 3I0NA 3JALB 3CPEA 4I1RA 4DR7B 2HA4A 5LU9A 3WKEA 5CP8A 5G41A 1AC5A 1P2TA 1RTTA 4JT2A 1UBSB 2DT8A 2IZ1A 4AP5A 3IODA 3O0DA 2C7OA 5KHAA 2VG8A 5GV7A 4KNWA 2ZTUA 3RVJA 1CE8B 1NIJA 1UIRA 1N57A 1U11A 3Q3EA 4QODA 2DKNA 1AQNA 3UOAB 4MVCA 3DXFA 4A2WA 5BUQA 1N78A 2WF8A 4KQMA 4MUFA 4B4DA 2NYAA 1K4KA 1KMHA 2I0FA 4C06A 4OY3A 3LQYA 3KHTA 3RSZA 5IANA 5IAJA 3A05A 1PR5A 3PXUA 4EPWA 3FMGA 3EOAI 4BNNA 4EYGA 2IZOA 3K8YA 3RVPA 2ZWPA 3VAAA 4LHWA 2KHZA 1SC3A 3E9ZA 2Z4TA 2OFWA 4PFQA 5IYZA 1P5RA 1L8OA 2EIXA 3I34X 4F46A 1VLZA 4EUEA 4FMDF 2EAUA 2PLNA 5JJIA 3TLMA 2WJ3A 4AUEA 3K1ZA 3QPWA 4BBZA 2J6HA 4TMKA 1ZC3A 1Z6AA 4IIDA 4BE4A 2EQ5A 2XMSA 1SBQA 1NMSA 1ZD8A 3A9WA 1R0LA 4BU1A 4ZIRA 3A9CA 3QKIA 5LBTA 4A10A 2WIGA 4B48A 3PQ5A 4BJ3A 4A03A 1N9KA 4HFMA 5LLSA 2EBFX 1PWZA 4F2HA 3I9V1 2GHIA 4Z86A 4L16A 3A3KA 1G6HA 4XYBA 5I48A 2AB0A 3WDMA 2HCBA 3G2OA 3O38A 4QICA 4GNKA 2A2ZA 5K8IA 4MA4A 1O9BA 1GIAA 3DL2A 1QFJA 3JXEA 5AICA 4DCUA 1HNXB 4LNHA 1C3EA 1JA1A 1Y1SA 3ND7A 3ZU5A 2YC4C 2GTIA 1DE0A 1PK9A 1KETA 1X1CA 3LP5A 3MJTA 1Z83A 4M86A 1FMJA 1NV9A 3HC7A 4P4SB 2NYUA 4GVPA 4L8LA 4Y2UA 2BONA 2DTEA 5ARDA 1H5NA 2J09A 2O8FA 1UAGA 1UPTA 4QBIA 5HOQA 2W2PA 4AWBA 1XO1A 4FMCB 2FQXA 1HBJA 3UOGA 2QJRA 3TKAA 1BO6A 3AFIA 3II6X 2IYXA 4KWIA 2WTUA 3FWYA 2BUAA 1GT91 1TM4E 4N9WA 3CJRA 1VKRA 3EXEA 4MGYR 4E51A 4MQFB 2AMYA 2DFLA 3RSHA 3RFUA 3PDIA 4AKHA 2ON6A 2DFKB 4PZ0A 3KTDA 4GDMA 1NW4A 1ODTC 2VJBA 1LFDB 4HQOA 1YRLA 5C8XA 2IUSA 4PZZA 2NO7A 1DQYA 4LMRA 1J07A 5IK2D 3ISTA 4D3XA 1CRZA 4OKNA 3OOWA 3ZD7A 1ZSVA 2NACA 5H80A 5BQXA 4RULA 5KUTA 4OGKA 2OHFA 2BM9A 2BHSA 2O50A 4WCFC 1IJBA 1HC7A 1N9GA 2FWPA 5KBYA 1P2GA 2QLMA 5HIAA 3D2AA 5DK4A 2IW1A 3FR8A 2P30A 5AM0A 4RKWA 1CD5A 3K8OE 3T4EA 4B8YA 4IXWA 1FX1A 2FX3A 2WJGA 5GVRA 3WOVA 4PN3A 1PT6A 2GEVA 2VPQA 4DWJA 4HR7A 4R6WA 3FM9A 4LJYA 4XJVA 1Z6PA 3CIOA 3WFZA 5KNDH 1JHVA 5DFAA 3L1JA 5WRFA 2ZI3A 3CF0A 4URVR 3G79A 3QOYA 4A15A 3HDHA 1UJNA 3O94A 1E7RA 3ZI7A 3DOHA 2G77B 2YHIB 5FI5A 3ER8A 2PUDA 2BZ1A 4RHXA 2E4XA 3AR3A 3W7BA 1QR2A 2QE6A 2H4XA 3PGLA 4RSRA 5J2UF 1WUIS 1IM8A 4R1UA 4XGIA 4AUNA 4MAFA 1M74A 4YMUA 5LQAA 1NUSA 1I01A 4L9SA 3ZDQA 3NNSA 5C8DA 1E5LA 4M8LA 4WV3A 4OQ4A 3RIEA 3IO5A 1T34A 2PCJA 4KGVA 1X39A 3SZMA 2CFRA 1YS7A 3WMRA 4BLQA 1A9SA 4CLXA 2WUGA 4MPJA 9LDTA 4PRKA 4ASUD 4WJLA 5FTLA 4M8NE 4B9AA 3ETGA 4CDMA 3ZE1B 3JRXA 1ONNA 5CGZA 3SBXA 4RTJA 4Z7OB 3IJRA 5F1KA 1XTBA 1TUBB 2WFZA 4ZCPA 1T2FA 5EJMA 2EW1A 4ESHA 5FUQA 4IAOA 4BMZA 1XU4A 3SZGA 3QFRA 2J6IA 2KPOA 1FB5A 4YXWA 4A73A 1HT3A 3V46A 1Y6GA 1UFVA 1NLFA 2Q4RA 3C6XA 5AWFC 4U7PB 5TPZD 5LIRA 1T8TA 1EHCA 1VGRA 3BICA 3U3JA 5K0BA 3JWHA 3S2ZA 2H11A 1FFAA 3M1LA 3BWVA 3KB6A 4UTPA 2C5FA 3OQVA 4KWHA 4Y18A 1UK8A 5A7GA 5CM8B 3O8RA 1RXSA 3W9BA 3UHJA 1RZRA 3HPQA 3TGWA 2B98A 1VSQA 2NO1A 3RLFA 2D13A 1YQGA 4Y98A 3FWKA 4Z9XA 2B99A 5HQTA 5M5BA 1JZTA 4CHGA 4EJSC 4HDQB 4FLMA 4MWEA 1GGEA 5HK9A 4HRAA 3TRJA 1YRAA 3VDNB 3K4PA 2J5RA 1YB7A 1ZM2A 3AUTA 2Z2ZA 1BWQA 3JD2A 4OK3A 3TLYA 3HWWA 4DS3A 4Q1VA 2OWDA 4KODA 4Q18A 5B3JA 3FRIA 5ALLA 3TIIA 1AA6A 5FA8A 5ERGB 1EVIA 4EGSA 2W4IA 4EX6A 2ENWA 1EG2A 1F2TA 3BS4A 4JBWA 1CJMA 3BMQA 4LVCA 4NR0A 2KM1A 5LSAA 2ASEA 1BXGB 2VJPA 5JS8A 2GT1A 5IVDA 1ADYA 5JTTA 2ATIA 4OQLA 1UJCA 3BFVA 3VV2A 2R6HA 3OQIA 3H8WA 4RHUA 3CO0S 1AXGA 3TO5A 3PZBA 5JNWA 2AN4A 1SVMA 4UBOA 1BVUA 2O2SA 1Y82A 3D6VA 4QXRA 2PX6A 2YWDA 5E4YA 1KEVA 3NBYC 3Q2KA 4B2IA 1E58A 4UOQA 4AZVA 3H11B 1SPBS 1M0TA 1NQXA 1OPRA 4RMNA 3WZ2A 4DRZA 1ENPA 1M2JA 1CPYA 3CR3C 2EG5A 2HBZA 4BMXA 1NJ2A 1TYCA 4EFKA 1H2YA 3AFMA 3KQMA 3TG8A 1NJ1A 1NVAA 3CURA 1RFLA 3OG9A 4M88A 4U2BA 1T4DA 2FPXA 2JCSA 5BMVB 4Y2QA 3QLUA 1BQ4A 2XODA 3QTBA 5F5XA 4CNQA 2I34A 3OP1A 1EMDA 3DVRX 2Q3CA 2WF7A 2ZWIA 4TKUA 5FPTA 2XW6A 4ZYXA 4XFDA 4NFSA 4QU9A 1AV7A 1V7QA 3UK2A 5KNBA 3JQDA 4ZQCB 3BGSA 3ZK8A 1GRRA 5C1BA 3WNZA 3D4BA 1EX9A 3PC6A 1JN0A 1T1SA 4FGKA 4NNPA 5FWYB 4HFNA 1RI5A 4YAIA 1E7YA 3ISJA 2DBVO 2GZ2A 3M5CA 3N8GA 1L5WA 3L0CA 4RD0A 4DMUB 3CLTD 1W36B 1FU4A 1ZMOA 2V97A 4RJJA 1LI5A 3B52X 1KYTA 4M55A 3V2HA 2E1RA 3CB4A 1T2EA 5G4KA 4FFOA 3WL5A 5FOQA 1OBFO 2GWRA 4KZPA 2R97A 1WXFA 3E3LA 1ODSA 4L0CA 4QDKA 4UD2A 2X8LA 4YALA 3L18A 1P2SA 1P2VA 5ANRB 3SDZA 5TC4A 1CQJA 4FJ0A 4MW0A 3HA3A 3QM1A 4WCDA 1I2CA 2BMWA 3ZI0A 1D4FA 1U9IA 2FUG1 3IKMB 3JQBC 3L7IA 4Y2GA 1TU4A 4RKFA 3LK6A 4KOEC 4AW9A 4BYMA 1PV4A 5GONA 5ITSA 3G2HA 3O1HB 3GIDA 3JQ9A 2RHLA 4L5BA 4NZZA 5K45A 4A7PA 4EBBA 4JC4A 2C00A 1F60A 3IHLA 3P71T 3KWFA 4MYDA 5EG5A 3KQNA 4X1KB 3LP8A 2H9AA 4YLYA 2JJ2A 2XA9A 4LOAA 4A2CA 3UAYA 5J23A 2GLXA 2ACEA 4KQ9A 3ZC3A 4YROA 3ONVA 4D1YA 1B8OA 1Z2CA 4AXXA 2AK3A 1YTLA 3P20A 4V0NA 1MX9A 1ULBA 2JH3A 2VOJA 3HJNA 1QJ4A 4S1WA 5D85A 3A37A 3DFKA 4UAVA 4DNFA 1AHIA 1Z4JA 2HBYA 3PWTA 2LKCA 3ECAA 3I9JA 4L73A 4NAVA 1I0IA 4H3VA 4UHKA 4AQDA 1TJ3A 3MA0A 4RYLA 3FNQA 4O4IF 4UHJA 4CCSA 5BYKA 4ITUA 4J0DA 3SSNA 2FW8A 2G9ZA 1MVLA 2KLBA 1T3ZA 3MGBA 3ZE9A 5IDQA 3SHWA 1YR7A 1Z47A 3LE8A 3S4YA 2E82A 3MSXA 1EVKA 2AG6A 2WY2D 1AMOA 5E1MA 1J0XO 2C5LA 4DCVA 1ZONA 3FD8A 3WQRA 4G8BA 1Y6FA 1VHWA 2GDZA 3PIDA 3ZWDA 3L5KA 4DHWA 4CKZA 3L8GA 3D2BA 3TRKA 1BCSA 2B9EA 3IUEA 4QJ5A 1QNLA 1DL5A 1YVEI 4YP5A 5FPSA 2UVQA 5LBIA 1TKCA 1XTIA 3ZVKA 2C82A 1SR8A 3GY0A 4RVNA 1E4VA 5FTNA 4NMXB 3EK2A 3UATA 2OAP1 2R3SA 3OZIA 5H4GA 1H5UA 3N75A 1N2OA 3ORSA 4MWOA 2EHDA 4JHXA 4M1SA 3QW2A 3ML1A 5A9SB 2ZREA 3VKFA 4MEAA 4KNYA 2PA0A 1GA4A 5HNKA 4ENPA 4WDQA 1QB8A 4NFYA 2A30A 3I2JA 3WLAA 2YYYA 4JEHA 2X6RA 3OZVA 2AC4A 1VFNA 1X0XA 2X3UA 1MH9A 3NBXX 1W19A 2P11A 5TMBA 1N2HA 4C6TB 1VDMA 1W35A 2RHTA 5BQPA 5FHRA 5KWEA 2OLEA 1FSZA 2C2GA 3DCNA 4PNZA 4MRPA 3LY8A 3SYNA 2HLHA 3DNMA 4EJ6A 5JQGA 4BATA 2X40A 2PBLA 3E48A 2R7LA 1Z75A 3IAXA 4WT7A 1KQFA 3Q72A 4IMJB 3A6PC 3S1LA 4N7JA 1V41E 2CVPA 2A92A 4GL4A 4C4AA 1OYWA 2JD0A 3OZDA 1Z8DA 3FF4A 2WTBA 4WXHA 4K88A 4TQ9A 1P8JA 5KYTA 2IIBA 2HU2A 1KDVA 2NXWA 1ZLXA 4FNOA 2FB9A 2PS9A 3NI2A 3R9XA 1PTJC 1TRKA 4DLSA 2P1DA 1TF2A 3U44B 2B36A 2YRWA 1COWA 4RPKA 2WKQA 2ZAYA 1XAHA 821PA 2NUTB 3TJZA 1ATIA 5JCJD 1NBOA 3FVRA 1DMSA 1R7RA 4AJNA 5JV5A 3I9V6 2I6UA 3T3GA 2ZIXB 4PRZA 1U2GA 5J5AA 1X1BA 2O3JA 3GOHA 1MVOA 3HYTA 3JZMA 4RKEA 2VHJA 2HFJA 4X44A 2H0QA 1R8QA 4MIOA 2P35A 2QL7A 2WJWA 3VO9A 1F51E 3PKIA 4WGGA 6LDHA 4QDJA 2FF5A 4HQ6A 5IJ0A 2GBFA 3R09A 4TTJA 4WI1A 2J08A 3ETEA 3N8DA 5HK8A 4RDXA 2XWPA 1RJFA 3L7DA 2YIJA 5TVKA 2B8NA 4LXGA 2WSMA 2Y4OA 3HNOA 3N2GB 5AJXA 3MRTA 1ZJ5A 4Z0TA 1XAGA 3RQSA 1JDJA 4YR9A 2Z6QA 1LC0A 3CZRA 3K0FA 2BUBA 2EYQA 2LW7A 3JASB 3JQ8A 3PC7A 1I33A 1O4VA 2FEWB 4GW3A 1JAHA 4H60A 4CT0A 3QV1A 1E3MA 2HHAA 2DXIA 3BIXA 2BMEA 1Z7WA 2HCFA 3IP5A 3Q9NA 1V4VA 4KXYA 3DZFA 5CXQA 2I2CA 1N6KA 1YZGA 1RC1A 2ODAA 2X9VA 3NORA 1OXKB 2QSYA 3ENZA 2R751 1TIKA 5K6TA 3G6KA 3WMWA 6NULA 5CEJA 1G5IA 2WM8A 5FYDA 3PPVA 2B1JA 2CSUA 5CYFA 2R2AA 3V1LA 3MCWA 3L8EA 2NQ8A 1HG0A 3EUAA 4FUQA 4PEVA 2BAGA 3IUNA 4DSOA 1J4AA 3N70A 3PHIA 3ZHVA 1YZLA 3FUCA 5EKXA 1JX6A 5TQJA 4CU2A 2RHWA 1G63A 4UAUA 1UDBA 2VXYA 4XQ9A 3IMKA 4AMUA 3C24A 4TVOA 5JYCA 2JD1A 3HCWA 3REQB 4GH5A 2G9VA 3CY6A 3BBLA 5K3FB 3NHYA 1FUYB 3DAGA 3PDCA 2VDKB 2XIJA 3I72A 3LY5A 3OU7A 1XV5A 5REQB 4C88A 1E6LA 3AM3A 3C74A 4ZXFA 2GM3A 1W9MA 1PT8A 3ZH9B 1KTIA 4KITB 4WAUA 5DTIA 4FDVA 3ZY5A 3MJHA 4BV3A 2JFZA 4MKRA 4Q9LA 1JFVA 1S7GA 4PCVA 4FLFA 1WMEA 1Y42X 2UYGA 3QPBA 1PTKA 2I4IA 4YAKA 5C5IA 5JDCC 5IVIA 1NF8A 1Y9AA 1G7RA 1YL6A 2JLVA 2O4CA 4A0HA 3K9NA 5CNJA 3WO0A 5HHTA 3SEAA 1EEHA 2OE2A 3OQBA 2FSVA 1SWWA 4UZFA 2XWQA 1XDDA 2EV9A 3B1JA 2PH3A 4OJTA 2E5WA 2B6HA 3TFQA 3W34A 1W76A 2VBGA 5EHGA 1GZ3A 1NI3A 2FW6A 2H08A 2OV4A 3TEFA 3FOAA 1M8JA 2VZ9A 1RI3A 2IUEA 2KYRA 4ND1A 2H51A 1F9AA 5J5VA 1E8DA 1VSBA 4EVIA 2LXNA 2ZJ0A 2Q7DA 1EWTA 1XLTA 4YRKA 4HWSA 1RRPA 2GFHA 4MRRA 4EITA 5CFQA 2XDQA 5DT9A 1ISMA 4TVSA 4G23A 5PGMA 1CJCA 5B6IA 2F43B 3AFHA 5BSTA 3K4HA 1UP4A 3NHZA 3E2IA 4A5OA 5FPQA 4RZQA 5E6UA 3ZZTA 4D81A 5F98A 1EUZA 3V4RA 5IP5A 1XRNA 1H2HA 2HSDA 5KHOC 3SSMA 2GN1A 4PINA 3UN1A 1PFQA 4B75A 4EDHA 5B64A 2Q5JA 1LBSA 3I58A 4NARA 4EJMA 4NI5A 4QGBA 4DBVO 3R0XA 5K7SA 3ICWA 4YLEA 1PDOA 2XNKA 3R44A 5K51A 3GXBA 4RYDA 1FP7A 2RGNC 4G4GA 2IPMA 4RVHA 1KDRA 1BE6A 2EC5A 2PEYA 4B17A 2XCSB 5A4AA 2PSEA 1CDDA 3ZWCA 2O2IA 1NJSA 5CW2A 2Z30A 1ZKDA 3ZV6A 5D3MB 3A06A 2HCJB 3MD9A 4K9RA 4PLPA 3FGOA 5KINB 1W93A 3E58A 2HA3A 4HZUA 2O2CA 3EASA 4U3JA 4CN8A 3K96A 4N0QA 3UAVA 1K7CA 2W90A 4F38A 3T7SA 4NECA 1D1SA 1JR3A 3IPAA 4LY9A 2AYZA 1NVWQ 1E2NA 4BKMA 3FVVA 5CLLA 2XZOA 3IQIX 2A3RA 4JA0A 1R4MB 1R9GA 3CSSA 1IZ0A 3DLCA 4MH0R 2V65A 2Y1LA 5KKNB 2E0IA 4IW3B 4JODA 1C7IA 4QGHA 1NPYA 5CU7A 3UC5A 3AMVA 4J7UA 1LBEA 3GWZA 3M4NA 3BCUA 2B61A 3EDQA 4DLWA 3WLOA 4GP7A 1N3IA 1H8HA 2VYCA 2A5YB 2G1JA 3BSSA 4I9HA 2KMLA 3BZBA 3RRXA 2J59A 1DDIA 4KRFA 3HCBA 2J0SA 3AHJA 4FMCF 1BH2A 3AU9A 3WGZA 3UGJA 2CUKA 1NPDA 4B6SA 4EGAA 1FDTA 4ER7A 3GG9A 1EIZA 1U8FO 2J0EA 4ND5A 4QLAA 1BRMA 1IVYA 3PX3A 4HAWA 4V39A 1GXSB 1EQAA 3WBKA 2YHBA 3FROA 1U04A 2JFQA 3L2OB 3SMQA 4WIAA 2XCLA 3T99A 3CGWA 4L9AA 4AJHA 3A9TA 2DAPA 3L1VA 3DMPA 1L5FA 5CAEA 1X7YA 4WNAA 1UEXC 2WJZB 1O6CA 1D2NA 2QTGA 3CMMA 1Y3FE 4ZI2A 4IRXA 4BWVA 3NEPX 9GPBA 5DGCA 2BFFB 1VJCA 2Y76A 2WYWA 7REQA 1FNSA 3AVQA 4FEGA 4KXNA 3HEBA 4BDTA 1PFWA 4OBBA 3N2KB 4AJOA 3BMXA 2SKCA 3GA7A 3HMQA 4YRCA 3VR6D 3WB1A 2DT5A 1H3NA 4GUAA 1Y3DE 1CIPA 2Y71A 4OB8A 1FFHA 1DADA 3ROXA 2F59A 3D6JA 4EKGA 2PY6A 4GBJA 3TZLA 1NP7A 4YCCA 1UKVY 2RJOA 5BQ5A 1IIRA 1WNTA 2ZJZA 3L4SO 3IUPA 2IUYA 2VI5A 3RSFA 1CY4A 4P33A 2VBIA 3DBRB 2YZGA 5ISMA 3GMTA 3W2FA 4JXKA 5CDTA 2VAXA 4YRQA 4NK4A 1R5JA 4PSUA 3SI7A 1S9DA 4KGXA 4RU1A 3M4XA 2HF9A 3UPUA 5CBPB 5F9HA 4HAXA 1RPAA 4MV8A 1ZVQA 2O57A 2Y8EA 2FEPA 3OIUA 5EE3A 1F3OA 1PJ2A 4XR9A 3Q3CA 1HDGO 3LUHA 4I9FA 1FZQA 1I2AA 3CYFA 3JD1A 1BNCA 1L4HA 2ZYUX 1KZYC 4JOSA 1KQNA 3B1VA 3UT5B 4MR7B 4FYYA 1NQ5A 4NU6A 3IQXA 3ASZA 5JSFA 1AZTA 3NM5A 4X1YB 2FXVA 2OVFA 4KQ1A 4HNVA 4KBGA 2E7ZA 3TWOA 2A4KA 4Z9YA 1NXXA 2XOEA 1SHJA 4BRZA 3ODGA 1ZFNA 3GUYA 3LLMA 4ML3A 4W8HA 2WAOA 4C4RA 1F7UA 3LCRA 1UC9A 5AFSA 3G2PA 2XNDA 3GRAA 3KAPA 3KZNA 1PEKE 3P52A 4XX0A 5CIQA 1EK1A 3E4DA 4YP9A 2AE2A 5L95A 4DA8A 1YVRA 2Q2NA 3DO8A 3V34A 1E9BA 1EH5A 1OZ0A 3AWIA 3GJSA 3IAHA 1LI4A 1OWOA 3R0QA 1OWPA 3JQCA 2Q7XA 5EIOA 2J9FA 4MKHA 3QEOA 5CLQA 1OAAA 1W2HA 2OFFA 5DLEA 1HEYA 1XKQA 1U02A 2C29D 2TMGA 3AIKA 4CIWA 1OXMA 4FM9A 4R0MA 2VWQA 2AOTA 1JLLB 2C9BA 4Q3AA 3P2OA 5HVNA 1T9ZA 3OU6A 4HOYA 2WD9A 3V42A 3CRMA 3MT9A 4G1FA 1K7XB 4MQEB 3ZHBA 2EKLA 2XUOA 5KU7A 3Q1LA 1CZUA 5I7OA 2CGEA 1RYZA 1T0HB 4D9BA 5FUMA 1LJ8A 3MTDA 4LY3A 1QX3A 4H1UA 2P27A 1SEPA 1TJ4A 4TSRA 4TXHA 4BUJA 3H3JA 3U9SA 2CLOB 1SCDA 4IHAA 5I4KA 1EFCA 1M1YA 4LJ8A 4PX3A 2IYUA 5K3CA 1SVWA 1JDTA 1HXHA 1AX9A 3QYAA 4G41A 4JQSA 3L4EA 4WK0B 2NO0A 2PEZA 3BXEA 3UJ7A 2EZ8A 1DRJA 2OMKA 4RIGA 1E63A 3H18A 4JQZA 4IIJB 4D9IA 4LZZA 3L04A 1P6UA 2HNAA 4O4LB 3FDZA 3NTRA 2QXTA 1S2IA 4RHYA 1QONA 2BGUA 3CT6A 3HQ4O 2AWNA 1RQRA 3T7KA 4M0FA 1FK8A 2ZYSA 4QHYA 3B60A 3IHKA 4II3A 3WNDA 4N7RA 1E2GA 2WI8A 3N74A 1WIWA 1YZVA 4LGYA 1TYEB 2WP8J 2YV1A 4IQ0A 1QHHA 1N6LA 4Q4LA 4GI5A 4G5RA 4BLPA 1X7XA 1T9KA 1ZMXA 3IE0A 4EB8A 5KYYA 4QQRA 1U3UA 2P67A 3UUWA 1ZM4A 2QWXA 2ZBRA 4CKBA 1AZSC 1DXOA 1R8JA 5FBLB 4TV8A 2ZRCA 2ZU6A 2ZWOA 3F6YA 3IT3A 5MFPA 1CZLA 1JIKA 2DSTA 3PCRB 3A36A 3QENA 2QQ0A 2XQVA 3JSXA 4UEKA 3QX3A 5E9WA 4PFSA 4EI7A 5THXA 1BG6A 3X3HA 3STYA 5A0TA 1X80A 3D0QA 4DARA 3NH6A 4Z7JA 2ZFUA 1E7MA 3WSWA 4BGIA 2D4AA 1AS2A 2J3KA 1M2VA 4IO0A 3RYHA 1MAWA 2XTJA 4KACA 1XDZA 5LKAA 4ARVA 4YJHB 2XMCA 3PV0A 3VPCA 1JSCA 4G1BA 5DJ5A 4MCJA 3OLWA 1DCMA 1IRXA 2J30A 3BH0A 2CYBA 4E11A 2Z9CA 1JFLA 5J3JA 3OQ6A 2ABWA 2JLSA 5TF0A 4TS4A 4QEDA 4LF5B 2NO4A 2QYTA 1NBHA 1H1DA 4D3DA 1WB5A 3OTHA 2P75A 5CVJA 3KQKA 1HEUA 4CEJA 3MTEA 5TPWB 4UU1A 3ENKA 1W25A 1LKZA 1I30A 1UPAA 1VECA 4P93A 4L4ZA 2IQIA 4RPJA 3EXHA 3D3WA 1KGDA 2VSYA 5EJAA 4DCOA 3NIFB 3F1LA 4QFCA 3UG7A 2FZVA 2CXTA 3BL8A 2QR2A 3AL2A 5KTPA 3GN1A 3HO8A 3PNQA 4GKAA 4XQ0A 3I9OA 3OJFA 1ZGJA 1WE2A 1MIOA 3ADPA 5AKHA 1Q14A 5IZ4A 1N3BA 3C3DA 4F5YA 3B3AA 2FWRA 3AKEA 3IH5A 4AZ3A 4Q47A 4LHZA 1E3TA 5DTRA 4BN4A 3CINA 1T1EA 3E2PA 4TMXA 4D9MA 2EERA 4L4YA 1MA3A 2P9QA 4I1YA 4S1VA 2B2CA 5ESXA 5EJ4A 2OXFA 4HNGA 3ZDRA 4BNMA 4W1SA 3KALA 1GZUA 1BDHA 3PEEA 1YA4A 3RUEA 5IYZF 1PK7A 4EJFA 3CONA 4F8JA 1ORWA 1SY7A 4HNTA 5HXAA 2I9PA 4HDOB 1CC1S 3L7NA 1JDNA 1FL9A 1SU4A 2Q6VA 3BWEA 3COPA 2Q5QA 3DF9A 1QM5A 3AJAA 5JQWA 1FXUA 3G0IA 3AG5A 3LU1A 1DWQA 3ND6A 1QVZA 4X1IB 1EDOA 3O2QB 3INTA 3VGJA 2W2OA 1MEJA 1Y7PA 1R74A 2JLAA 2WMOB 4LG1A 1G98A 2Q5FA 3ZCUA 4CM1A 1D5WA 3QVWA 1USUA 2DWUA 4UU7A 1S0UA 3GG2A 3A6LA 4MLCA 3KE8A 1XEWY 4MEJA 5KYNA 3QNWA 2AZ4A 3HKDA 5AHOA 3SF0A 4H35A 3R6TA 1PNOA 2QLNA 1RWQA 3I2FA 4TZTA 4C3ZA 2QN8A 5KTNA 4D8VA 5T6MA 3F8WA 5EAIA 1JEYA 1BIFA 2PKXA 4JJ4A 2E3JA 1NRWA 4WCFA 1ISRA 1N3YA 1AM4D 4G65A 4ZVVA 2J85A 3C3XA 5T3YA 5C7IO 2OBBA 1F1JA 4D8XA 1GDDA 1D04A 1D6JA 2CLLB 1OR8A 2ZR7A 3AK4A 3MTAA 4OEHA 4D2IA 2JK1A 1VE9A 4URZR 2EJCA 2JGEA 1L4BA 1WPRA 2D06A 1TCUA 4TKZA 3S2YA 5B30A 3VSBA 3H75A 4HGYA 1Q3HA 3TQQA 4KAAA 3PIIA 3W2GA 2YY7A 5JCOC 1LS1A 2ZRAA 4G37A 1M3SA 2FX5A 4NCHA 2HRBA 5BYAA 2BR4A 3SWWA 1LDEA 2Q8QA 2NN3C 2P1ZA 1N5DA 2K4MA 3EARA 2YZKA 3BWMA 3EGEA 4HWRA 1ZI6A 1E9CA 3DZIA 3LT0A 4PIVA 3V97A 3USCS 5DTMA 5HCNA 3GJ7A 1WVMA 3MWLA 4EPTA 1NW7A 4Q00A 5L3VA 3RRJA 3SC2A 3ZS8A 3VRHA 3C3MA 5GZ6A 4NBLA 1E92A 2GPSA 4FMPA 5TLSA 1AA9A 1S2NA 2FTKE 2GXUA 3AY0A 3QELA 5CNIA 2P0EA 3DOFA 5GV8A 2NU9B 4JU8A 2XHZA 1Y8QA 3OOHA 5HDBB 3WICA 4L2IA 5BN3A 1GQFA 3ZY6A 3TNFA 5EE5B 2QVGA 1Q7CA 5CURA 1P0QA 4EAQA 3AEKB 4P82A 5ECGC 3KUCA 1YBFA 2C5SA 1ZXLA 4PQGA 3AKDA 4LX0A 3W04A 4RENA 1H8EA 4E5NA 3AVOA 4ND8B 4X41A 2PL9A 2CN1A 4AB1A 5H83A 3R8XA 2A33A 3K1AB 3S2FA 5LZ8A 4DRXB 1QV7A 4AWAA 1V16A 3HUFA 1KKMA 1FC0A 1TADA 2BJHA 3ANTA 2PKWA 3GEHA 1E18A 2WSSD 4NE2A 5A71A 2VDWA 3U3MA 5K8CA 1FU8A 4M1OA 2JGLA 4OAPA 5FNVB 3ORHA 4BRWA 4D8UA 4DF3A 3LX6A 1MOZA 3PC8C 4PAQA 3S29A 4ZI7B 2C3MA 2NYVA 2A4MA 4PZPA 2Y1KA 4UM5A 5DRYA 1FP4B 1I0LA 1PG5A 4I50A 2PD3A 2PUHA 3Q40A 3G2LA 4UATA 1Z0IA 1P9RA 3HKBA 4RLFA 5CYOA 1QIEA 1X1TA 1PL7A 3E2MA 4TZKA 3GDOA 3THRA 5A6VA 4EX7A 2AOUA 1DCFA 1XROA 3LUJA 1JWBB 2A59A 1U8AA 4OATA 4TYMA 3B3JA 1GAWA 1KS2A 1QWOA 1VKOA 3TIFA 1TC1A 1XCBA 1LPNA 1PFGA 3BRWA 5DBEX 5BOVA 4E21A 4GFDA 5EMLA 2HSEA 1TFRA 1HE8B 1HDCA 1IWPB 3T1NA 3V1MA 2D54A 4TYWA 1MQ8B 3IP1A 3V3KA 1GCAA 4WXPA 2L18A 2PO5A 2O8CB 4RELA 3MS7A 5A6SB 1YMUA 2VC2B 3G9XA 4YP1A 5CDFA 3CNLA 2DWPA 1TO6A 1VZ3A 2IF0A 1XJWA 2ZATA 4HDSA 4ZDIA 2ETXA 1K75A 1W5BA 2NO6A 2QD4A 3HBJA 2R66A 2XGMA 1HK7A 2YBEA 3EQZA 4GD3Q 2PBFA 4XDGA 2X58A 2V6IA 2H00A 3A1NA 4FFLA 5EE0A 2I80A 4CV0A 3HA5A 3U3ZA 5EXDA 1LTKA 3GBSA 8ADHA 1XQ9A 2G5GX 1T8PA 4IIFA 4MJXA 1MO6A 4V02A 4WNYA 4X93A 3M34A 4OVKA 5BQOA 1FQOA 4OUKX 5T41A 4CKWB 4O1IA 4F91B 5JRJA 2DE0X 4B2PA 2F55A 1EVJA 2XTMA 1A5BB 1E2KA 3VR4A 1QU3A 1CF2O 1N5KA 2BEKA 3WC4A 3BAZA 2F8SA 4EZIA 4Q93A 2QT1A 4X8HA 4NV3A 5K8UA 5CB4B 3FCSB 4LOKA 3G8AA 1CT9A 1G9XA 4YGYA 1KVUA 1O0SA 5ALIA 5LP6C 5A3SA 3VU1A 4KOAA 3ZGVA 3BFJA 3TRHA 1XX6A 4C5CA 1V8OA 4EZBA 4U2EA 3RO7A 1F0KA 5FBRB 3LDFA 4A0QA 2ZIWB 1QBGA 5TGDA 1FLNA 4I3FA 4NULA 3VPGA 1HDOA 3BGVA 1B0PA 1OYYA 1V8BA 4FSDA 1DBVO 3GJ8A 4I5FA 2OXTA 3NFYA 1BXRB 1S2DA 3COSA 4JQCA 5TR9A 1KF0A 3V8VA 2YWEA 2C9MA 2XOKA 3IOMA 4TXLA 3EGOA 1XMSA 4EGJA 4XDHA 5ETJA 4P53A 3HWRA 4B6PA 3D6AA 3K09C 4Q6WA 1AHHA 1EINA 4WA8A 5U4QA 1XKXA 2QHXA 2RHBA 1RZUA 2EL7A 4JVNA 1GPKA 5BW5A 1R6XA 5KNCD 4MRSA 1RP1A 3LQRA 5DP1A 3WA6A 4P98A 4FI3C 4BUCA 3QU5A 3MQFA 2PRSA 3GJYA 5AIBA 5DWDA 5GIPE 1SU6A 2WW8A 5E1DA 5K4AA 1KDYA 4DJFC 3D9QX 4C1NA 3O26A 5CG2A 2UVDA 2FFQA 5EPEA 4CMCA 1OPXA 1VMKA 5HBGA 2BMAA 3UC9A 2GUGA 4F97A 2I33A 1SXQA 1QIIA 1EA5A 5FLYA 3HJCA 1Q1BA 2V3CC 3LUFA 4R81A 4RVCA 4P3OA 2B4YA 2P9EA 2Q5IA 1Q1EA 2R9VA 3KQTA 2OO5C 2OY0A 5A3QA 4XGNA 3SEQA 4DWWA 1P6XA 4MS1B 3VTZA 2IYWA 1T35A 3KKMA 4I4TB 4U00A 4EBFA 3S8EA 1WRBA 3LM8A 1M1NB 1NPTO 2Q5CA 3O9VA 1Q20A 2BFWA 5J4LA 1D2HA 3ANYB 3DBIA 4C0AC 2IYQA 2PSHA 4GC5A 4GPAA 4KXMA 2WSBA 4BV9A 1HSZA 3ZHZA 4YBZA 4Y67A 3SLKA 3EXFB 1XZPA 5IEBA 1FNDA 4OBEA 5B36A 5L9AA 1MJGM 2GA8A 2PWYA 4XX1A 1KZGB 5AVTA 4DMRA 1FE8A 2CXOA 4IKOA 4LDNA 2QDKA 4BKUA 1NMYA 4I5IA 1VI5A 3H1AA 4UUMA 2IHZA 3T7AA 3G85A 3LTEA 4BMNA 4NZYA 3AERA 2FEAA 3P19A 1CQIB 3H5LA 3IOYA 3UUFA 4EB3A 2HYIC 4B73A 4AMGA 4C14A 4I0WB 3U5ZB 3VZCA 3SGLA 5EXXA 4RSMA 3TIXB 3AH8A 1F6BA 4LWOA 5EWJB 2RH5A 3X0DA 4TUYB 4FFRA 2FZLA 2PMKA 5AM3A 1XLWA 1O87A 3ESBA 3EUWA 3B82A 2ILVA 1QH8A 1JXQA 4IMRA 2HT1A 4EUKA 1ZH2A 3R5FA 3T54A 2O0HA 2VJDA 2Z9DA 3WXBA 4RIIA 1RT9A 4DREA 2HGSA 3PZRA 4I55A 1YQ9A 3JR3A 4UXIA 5E7MA 4LXHA 2QN9A 4KXLA 4OLJA 3I01A 3H4VA 5B1DA 3RTEA 1J33A 5H81A 1WBDA 1P18A 1G19A 1EFPB 1I6WA 2FZ5A 1HE4A 3MF4A 3OQOA 4LPSA 3IPRA 5AQEA 2JDID 3H1PA 1FTNA 3SCZA 4XM2A 5J4KA 1IB0A 1KMMA 3V8RA 4FWBA 3Q5EA 4WHMA 2FWAA 4R2XA 4IIXA 5LLTA 4DSTA 4CM8A 3OTOB 3AESB 1KO7A 1KAHA 4R1SA 3S6JA 3NLLA 1M10A 1T9HA 4S1OA 4QNRA 3OIFA 3QPCA 3LH5A 1UM8A 2BKVA 2GSWA 4UU0A 2LPMA 1RRMA 3SVTA 3IBCA 1PU2A 3ORQA 2Q6KA 2FW1A 1TK2A 4NOMA 2SNIE 2QAJA 3NOVA 5TQ2B 3PVSA 4B32A 1PKXA 3DDCA 2QMZA 3K5PA 3QUQA 4RTOA 1R3DA 5K20A 3BUSA 2D0PB 2NSYA 3RJZA 3LXXA 4JC8A 3FNRA 1I8TA 2WFAA 4X1OA 1S2OA 2D0IA 5A4JA 4ZFNA 1QPBA 3H6KA 3HDYA 3LA8A 1HUQA 4TKLA 1JU9A 4WL0A 1A5ZA 1JTVA 2BZSA 2EQAA 3X2SA 4RDHA 4ENWA 1W0CA 3NIDB 4MRMA 3BHNA 2UZIR 3D2CA 1LRKA 1CLEA 1Q1GA 1A9QA 4I19A 1BEEA 2QV7A 1J0EA 4CEIB 4IX1A 1GNQA 4HLUC 3MLBA 4CLEA 4J2TA 2VPWA 1SG9A 2BCEA 1N5LA 2WMYA 4U0KA 1T8UA 3A6EA 1F0NA 3BYZA 3HLYA 3IB6A 5L51A 3CS3A 1PHRA 2VQ3A 3X1DA 1E0KA 1W85A 2F1IA 5HA5A 3P9YA 4RVOA 1N32B 3D4NA 4HWPA 4DXAA 3K16A 2R65A 3H6HA 3UKDA 5KSZA 4MUAA 1BX1A 1DBPA 5B55A 3ZD6A 2A5DA 3MTBA 4HNRA 4LOIA 4UXHA 4AF6A 1PQPA 3T7EA 4OTZA 5F7JA 5A5FA 2D3TA 4UTVA 3QYFA 4US1R 4RVUA 3LW8A 3TNJA 2GVNA 2O23A 1H66A 4N1AA 4KYVA 1XRLA 2X2EA 3ZHYA 1G21E 2Y1WA 1UCFA 1H0SA 1E96A 3A3YA 3OHPA 3KELA 5FBQB 3H86A 3W5DA 3J7TA 2PJZA 4ILKA 4Q6BA 4CCYA 2SKEA 3DAFA 3I64A 2XUAA 2H5LA 2LTAA 3H5IA 2YN0A 1VA4A 1QGED 5GADl 4X9XA 4LF7B 3A4VA 3DFFA 2V9ZA 1VM6A 1RJGA 3NP7A 3NC4A 3NKLA 4F6RB 3DOOA 3OZCA 4OB7A 4DOMA 1LDMA 3CKMA 3GA5A 4WPGA 3VBEA 1O1YA 4HGNA 4G8JA 1ZIXA 2Q29A 3CN7A 4TV9B 2JGDA 5IM4F 3GFGA 4HDMA 4YJKA 1QV6A 2IZ6A 3NHKA 1Y5NA 3PWZA 5DM70 3TXAA 2X22A 5EL0A 4NKRA 2CL5A 1T0JB 3MILA 4PYKA 1L2TA 2I76A 3ZIUA 1UJ2A 1XZEA 2YASA 3C43A 3U1BA 2WOOA 1C9YA 3OWOA 8LDHA 3FOZA 1SH7A 3I1FA 4O4LF 1BS2A 1CEQA 4G56A 1QO9A 1TPYA 4FIDA 2VJCA 3O1IC 4TSKA 4RHFA 3DBHA 4M9SA 5FL3A 4BFCA 3WXMA 4BPRA 3FLAA 2RC6A 2IEGA 1T9DA 3ELDA 3IP9A 3OCWA 4IFTA 4UREA 4XUDA 4OL0A 1ESZA 5HIIA 3I2KA 1TT5A 1VG8A 2F3UA 2P3OA 3I9FA 4P36A 4RDIA 2R1VB 1BU8A 3U3RA 3ZKWB 3LS2A 4GXRA 3DVLA 5JS2A 1LCIA 5JLJA 1P1JA 1CEXA 2XB4A 4BNDB 3KD3A 1L1EA 1ECBA 2Z1MA 3AQ4A 1J2UA 4PX5A 4EMTA 1SFRA 5BSWA 1K8ZB 4FEAA 1WZEA 4UDXX 2PJDA 5B1HA 4WOCA 2BH2A 4PS1A 1WMBA 3N07A 1J22A 4FNAA 4X6UA 3GMSA 2ZUVA 4IICA 2I55A 3A1WA 3GDHA 5HQJA 4DCSA 1ZEMA 2DQ4A 2MDTA 2W8ZA 3QKRA 4ND4A 5F2KA 2PUEA 4WFKA 1BHQ1 1JZSA 3AVYA 3WK9A 3B6EA 3FN4A 5IW8A 1CYEA 4ISCA 3MGCA 4IH9A 4JJFA 3FGNA 4QNMA 1BOOA 5KSPA 3TQFA 3E8MA 3ZXUB 2CJFA 4RQUA 5AW6A 1KJ8A 2POQX 3OZTA 3UFXB 4DLKA 1A98A 1KFBB 2GF9A 1HOXA 2RGNA 3MOGA 3U4QB 4IZOA 2D5BA 4DMMA 1GN9A 1FJGB 1GUDA 2ZTVA 2ZUCA 4CV2A 2QJTA 3FPCA 1MAVA 1QCCA 2FPGB 3V1NA 3MBIA 3OOEA 1OV6A 3VYSB 4AQYB 1DO8A 1U8UA 2OHHA 3PSAA 3SPXA 2QRGA 2V7EA 1YS4A 2AFIE 2R44A 4LJSA 5I9BA 4DDKA 4W5NA 3PUHA 1ND5A 1SXPA 3IVAA 3GW8A 1C1DA 1OLXA 1PEAA 2MR6A 2PWAA 4GI7A 4EW3A 1S02A 1W8IA 5F21A 2XBMA 2YJ5A 1WA5A 3TSCA 2UUAB 2R6GA 5F4BA 4CQJA 2R8ZA 4CL0A 1KOLA 3GP5A 3RBVA 2C8KA 1QANA 2I3ZA 4N0MA 3S7TA 1ZN8A 3OZRA 2DHCA 1WLSA 4B76A 3WWPA 3QEMA 3RTCA 5C32A 1MCZA 4FS3A 4EH1A 3EAFA 4X62B 3CN9A 2JJ8A 2ZRPA 4CTKA 2I2DA 2OZLA 3RVDA 1A2QA 5A06A 1B0AA 3NDIA 3RUIA 4JX8A 2BTEA 3QOWA 3HDTA 3U26A 1G7SA 2INGX 2RBGA 2Q27A 2VN8A 3KOUA 1MT3A 4J1NA 3CF2A 3P96A 4WOPA 4MCIA 1DUVG 2W00A 1W2WB 5KU1A 4LBVA 4UEOA 4YXWD 1M6EX 1OASA 1PW7A 1OLUA 3QH4A 4HNQA 2QW1A 1CP3A 4AO7A 1NG1A 3HJGA 4IHKA 4MUIA 1V48A 1NRIA 1RFGE 2PQ0A 2PUWA 2A0KA 2IOHA 3GZNA 4YQZA 1KIAA 2Q46A 3B53X 3RS7A 3NBZC 4BFWA 2AR7A 4IIEA 3V32A 4EPXA 4Q7QA 6GPBA 5D5PA 1T29A 1I10A 5KNCH 3KLPX 2P65A 4JC0A 4AM8A 1AKNA 4ZZ3A 5HQ3B 4K9KA 1RZRD 2NZ2A 4YMIA 1FBNA 1XD8A 1YBMA 2GQ0A 3FE2A 1G3QA 1E2MA 1UFQA 2E6UX 1KMIY 4MQ6A 3AONB 4P3NA 2ZRNA 2O52A 3AF5A 3C6ZA 2AD5A 4NF2A 3UHFA 1BSVA 1NAHA 2EBHX 3FI9A 3JQGB 4QGFA 2YUTA 4YC7A 1KR2A 5KREA 1AXEA 3VMFA 1FQKA 4JY7A 4B09A 2D00A 5A4KA 3F47A 3KQYA 4LYFA 2Y9PB 4NESA 1G21B 1Y3HA 2BZ0A 4XB2A 3C8MA 1G2QA 4ENQA 4YUXA 5B12A 4C03A 1E2HA 4CR6A 4YPFA 4B82A 3JWEA 4IQ4A 4ZEMA 1TPZA 1MABA 2I6GA 4OHVA 1US8A 1YB1A 2NG1A 4YASA 4QOJA 4EJ0A 2EF1A 1ZH0A 2BKAA 1GTVA 2Y1EA 3GV0A 5FYQA 5HX7A 5DYGA 1YOBA 2P5YA 4C4TA 2HMWA 1KH2A 3DCJA 4TN5A 4NBTA 2GKGA 3PITA 3JYQA 4BVAA 3KT6A 1GHTA 1RYMA 5D00A 2IU6A 2GYWA 2ZJFA 3WL3A 4DDVA 3VDXA 3TQIA 2EG9A 4AX8A 2V54A 2WAYA 3I2GA 1NOJA 4QG3A 4NOKA 3H9JA 1N2JA 2EKDA 3KUDA 1QK4A 5F23A 1PFUA 1QIMA 3THSA 2P9FA 5FWXB 4ZO9A 5JAZA 3S2SA 4P32A 2C4MA 4B6JA 1XYYA 4NH4A 2C4UA 2PXHA 4H1VA 5IAAA 1OE0A 5KTTA 1UANA 1BYIA 1IXRC 1AQJA 1UMKA 2ACWA 1SIWA 4WLNA 2K2WA 4INJA 4OLAA 2UYHA 2EJVA 3EZGA 5SV2A 2DBZA 3Q85A 3V9PA 3WB9A 5KKCA 3B6JA 2FKNA 1C3VA 1IXYA 1OXUA 1ZM9A 1LH0A 2QRVB 4OXNA 1EVEA 3LV8A 4OQYA 1JG6A 1TMYA 3PUJA 2JLZA 3EPHA 1LI7A 5KX5B 1NFQA 5KNBD 5GIOE 3A25A 3WJAA 3MCAA 3ZGZA 4BVGA 3H8JA 1EHYA 2CVQA 1UJ6A 1X15A 3C5HA 1IN5A 4POAA 4RZ3A 2QNRA 2MCFA 4YQFA 2RGRA 1A9RA 3OQPA 4KUEA 3ND5A 2B21A 3WGQA 3ICCA 1GTSA 4DCGA 5LMNB 3LSTA 3WI7A 1HV8A 1MJHA 1XTJA 3C6KA 3ABIA 3UYKA 4ZVMA 1G20E 2PJUA 2JFYA 3MJVA 1J9GA 1XFDA 3QU9A 4DHEA 2Q5EA 1SIUA 4P9NA 2RC5A 3O21A 5A7HA 3ZIAD 3ZQJA 3ZX5A 5DZSA 1CEYA 1M7HA 2GRUA 3ZK9A 1RBMA 4AF8A 1P2UA 4S0ZA 3G5AA 1D4ZA 4X8LA 4IWYA 3T6KA 3GDWA 1CY1A 3OA0A 2PGLA 3NVDA 4MO9A 2BFMA 2DHEA 2RJ3A 4FILA 2IIPA 1KHTA 5L53A 3L1KA 2A9FA 2Z5VA 3K1JA 2X0JA 4KR9A 4A8JC 5IT9A 5FFFA 2KB0A 1GGFA 4M1KA 2R84A 1YKFA 3KT3A 3EA5A 2JJ2D 2X8JA 1AD2A 4MWGA 4DPMA 2RHGB 1K6IA 3N2LA 4WH0A 2XNCA 2WJHA 5AW0A 3RAPR 4E4RA 4XUCA 3GVXA 1TLLA 1ZU5A 4AZWA 5LDDC 3DLPX 4A27A 2AFIB 2Y1CA 1FUIA 1EAMA 4GPTA 4JEMA 2Q99A 4FHZA 1WZUA 2DC1A 4OSPA 1K2WA 3WJ1A 4MW1A 4M0DA 4YH1A 2LR0A 1CUGA 3D5TA 3P4YA 3DDOA 1RHQA 1AVTA 3WK7A 4ZEWA 2CXNA 4RC9A 4B3IA 2O7QA 4JT4A 1HYHA 2I2FA 4Q3BA 3OAAD 5IXSA 2HIGA 2PPVA 3ENWA 4YI3A 5BW6B 1P80A 3GLRA 4QGAA 3EC2A 3WGUA 4RGBA 3D43A 1NTRA 3SC3A 2P8JA 1UR5A 3VC1A 4A2QA 3WYFA 1GFIA 1XTSA 3IJPA 2AHRA 4MV0A 1XTKA 3PQ6A 2BFAA 1MXFA 3G1UA 4UEWA 3BREA 1A77A 2CY0A 2D1YA 2RB5A 1VIVA 2QAGA 5FEMA 1BN6A 3MT8A 4LK2A 3FYHA 3WY9A 3QVLA 2PX5A 3GI1A 1Y4ZA 1YBVA 3L3BA 3LXMA 4LRTB 3UMCA 4G5SA 5ERYA 4G0NA 4MKIA 1UKZA 3KV3O 3JPYA 4MTLA 4WNIA 4FX2A 3TR0A 1U0EA 3WZMA 3LQ1A 1MAAA 2JI4A 3FYUB 2QG9A 1A1SA 3EMKA 5ALGA 4BO2A 1ZCJA 2C7VA 1PZMA 1Z5ZA 1D9ZA 4LE1A 4Y1EA 1RXWA 2FSGA 4QASA 5DGXA 2OBXA 2P2SA 2QZSA 4D97A 3N8HA 4PSDA 5AHXA 2QW0X 3N7AA 4DC0A 1LF5A 1WV1A 4B83A 1BDJA 3WK4A 1GZ7A 2FPSA 3N7TA 3SY8A 3TJMA 3AIIA 4O0LA 1LLQA 3CEAA 2JFXA 1BFDA 3LF1A 4WEOA 1EFVB 1Y7IA 2QX6A 3IO3A 3LKZA 3MGGA 4ETNA 3RARA 2QV0A 3THYA 4AY3A 3E7FA 1VFPA 4O08A 4OXXA 1G8YA 2GF2A 1MC5A 4KKXB 4OXIA 1X1QA 2AVDA 1ULAA 3A1TA 2UZAA 1M9NA 3FLMA 3OFNA 1QHEA 1WHSB 3ZDDA 1COWD 1UWCA 3JQQA 4LHXA 1JWAB 5LOVB 1TLTA 1BGVA 4ER5A 1HT1E 2WJ6A 3C3JA 4G0PA 2ZVPX 4OOFA 4ZARA 4TMTA 1LLUA 1MG0A 1TTHA 1GGNA 3RSLA 5JROA 1DEOA 2IE8A 1PHPA 1RJ9B 1YK1A 2A3NA 1J97A 3QUTA 4FW8A 4MI3A 1E5DA 3NC0C 2QTWB 1G7CA 4HSGA 5ER9A 3K0CC 2MYPA 4XCQA 3GPBA 4CKYA 1N0WA 1V2GA 2AMJA 3ZLTA 2JGMA 2YJTD 1T3LA 1NXPA 3LBYA 1AN9A 1KOJA 4ER6A 4B3DA 5GMOA 3BEDA 4GOMD 4FB4A 3DFIA 3KTAA 2UZ1B 4OA8A 1O5IA 4CIVA 1GWNA 5J43A 2K5UA 4U2FA 1ZD4A 2BELA 2AJCA 2V96A 4JI6B 1QQBA 1A95A 1P91A 2QQGA 5GOTA 1DC8A 1EFTA 1I3LA 1VGVA 2FGJA 1FSSA 1TC2A 2RDMA 2SBTA 3QF4A 3ROGA 3SF8B 1TEVA 4DLYA 2WNSA 4NCBA 1HDRA 4N5NA 2EFJA 3JWJA 1RIIA 1PJQA 2AN5A 1BEZA 1E7QA 2QRHA 4MVJP 5F4ZA 4JXXA 3O2SB 4LBWA 1L1QA 2Q9UA 4FFNA 1WKVA 3PYXA 4OYHA 1X87A 1OYOA 1FFDA 1NL3A 1J7JA 3FSGA 2CLEB 2H17A 4W5JA 5LA6F 4HEHA 3SX2A 3ZHOA 3UJDA 1HH4A 1H1LA 2P0AA 2Q1WA 1G20B 2ODNA 2B0CA 2P91A 2WJPA 2ZYIA 1JYSA 1QKKA 2Q45A 3DSRA 5ALYA 2R25B 4CG1A 3GBPA 4DMFA 1CZRA 3SQWA 3NT2A 5JANA 2B69A 1VRCA 2JA1A 1NULA 2P77A 3I6QA 3OPYB 5JCOA 1OI7A 1U2SA 4EUHA 5D86A 3I9KA 2CLCX 2ZPAA 4N3GA 4O8CA 1D07A 2FDXA 3OY2A 1W0KA 5IN5A 3GBVA 1GNPA 2ZTHA 5JCJA 5HS4A 5JY6A 1JV2B 4XCVA 4DUYB 2J3IA 4WZZA 3I1YA 4AKSA 4J6EA 3U4MA 3GP3A 1SCUA 1TKAA 3W6UA 3ZNPA 1KVQA 3B7WA 3JWIA 3ASUA 3FUWA 1O9HA 1L5OA 4QUIA 3JPWA 4Q03A 4RLHA 3LLUA 4J76A 1THGA 4M54A 4C4YA 3CLUD 3P0FA 4E2ZA 1JPNA 2D6FA 4CODB 4IUCS 1E2EA 5AI5A 4U5XA 3DWFA 1JJIA 2EX1A 5KJCA 4AS1A 3SYLA 4Q34A 2FDCA 2FN9A 4Y7CA 2JATA 3ZJVA 1U9CA 1SD1A 1G66A 1YR3A 2X8WA 4U6SA 3GLIA 4A23A 1FXSA 4FZ3A 1W29A 4Y9UA 2RGAA 1QIGA 2EJWA 1ZIDA 1JPUA 4FDAA 2QW8A 4YO8A 4UNNA 2A1IA 1CDZA 2Q6TA 1KMHB 3BH7A 3BULA 4IWNA 3FCAA 5GTDA 4KQ6A 3GLVA 3THXA 1CZNA 1HE3A 1TGYA 3P9SA 3ME5A 1MC8A 5D5HA 4C0KA 4OSEA 5CLGA 3V7UA 3EXAA 1Y89A 4WBXC 4YJ2B 3F97A 2FSIA 3GQBA 1PO7A 2F3SA 1WBJB 2WLSA 1OXBB 4C6SA 1N1DA 4K0KB 5JAUA 4XWOA 2P62A 4UFOA 3R7SA 1M66A 3RU3A 4ZYZA 3TTVA 4BP1A 1MO2A 4I46A 4BDSA 3SJAA 3DCIA 3IPCA 1LVGA 1U1CA 2F4VB 1GSAA 2RB4A 4LDPA 2GCGA 2HWYA 1HKHA 1QFXA 3QYJA 3T0FA 3T5DA 3H9BA 3QE4A 2HJGA 4I7EA 4IF4A 4Z49A 1RRFA 1VCHA 3E3OA 3C1OA 3HU1A 4FGJA 4R01A 3ZKAA 4ZVUA 5I6DA 1XMQB 3OMWA 1EP2B 1T1RA 3WLJA 1SIOA 1ML4A 5LQCA 5IVHA 1XMVA 2MTBA 2P6OA 4B7XA 4NS1A 3PFCA 4YAEA 1KORA 1IWBB 1E6KA 2FETA 2I7DA 5ALMA 2EL9A 1GAQA 4BTLA 4EECA 1LB1B 3EDMA 3AO0B 3M4ZA 5K9ZA 1PL0A 1ZESA 4NYIQ 4TV9F 3WISA 4ROSA 4PCAA 5ILQA 1JI3A 2TMKA 2XSZA 3EOZA 1J8YF 3EXIA 1JR3D 3N0VA 4JITA 4B1FA 3DUWA 1F2DA 3ZQ4A 4B44A 3DM9B 1T8SA 3KR2A 3R4CA 4TKVA 2O8FB 2JFGA 1AB5A 2UZ3A 2A9QA 4YYZA 2XF2A 2Q28A 2H4WA 1H65A 1CF9A 1SBCA 1ONSA 4H7KA 4OLHA 4KV7A 4WXMA 5CXUA 2VDPB 3CUTA 2WE8A 4DIUA 4M21A 4D9JA 1VTKA 4TTIA 2OP1A 1PEYA 1KZ1A 1Z7YA 3NTOA 3PS9A 1ESCA 1C3JA 1QH1B 3EXEB 4CKXA 5BR7A 4N5MA 1UK7A 3KPYA 3CZ5A 4KNVA 4QJ3A 1H8HD 2AG0A 1RQGA 2DY1A 2R68A 3OCYA 1QFYA 4IR7A 4XJSA 4BNXA 5H3HA 4G4SP 1M7GA 3HSYA 3O91A 2IHUA 4PSCA 4K9DA 2YFQA 1Z4LA 2A1UA 3W1WA 1GZVA 5KNBH 5JS1A 2CNKA 1ECPA 1JHRA 1DIGA 1GAJA 1M73E 3E5RA 1TD9A 3GNQA 4MKGA 4W5HA 4MB2A 4XPIA 5JNTA 2FCAA 3DDWA 4F60A 1QIHA 1E77A 3A28A 2B4TO 3BHJA 3CEHA 5ALSA 2PRYA 2FHPA 5BWCA 1O3YA 3K92A 3KQSA 3VU3A 5BVGA 1N9GB 1DBQA 1VKJA 2H18A 2V4UA 1Y9DA 3EHEA 4B3GA 1Z22A 1XU9A 2XZLA 4TLLB 2XDAA 1BZYA 2A0YA 4BO4A 1AE1A 2E4VA 2PWZA 2X2FA 3BA1A 2OAQ1 2ZULA 1EGMB 3DE0X 3E22A 4MWCA 2GHRA 1E9EA 2NVOA 3GD7A 4XD2A 1H6CA 4GQIA 5E4FA 5EEHA 2POCA 1K86A 4NCAA 2QUKA 4R05A 3LIIA 1FNNA 1TIBA 2OO5A 4PHFA 4ZU6X 3UHAA 2YJ4A 3ZJ4A 5BRJA 5EZ6B 3BEOA 5AI8A 1NVVR 4EQ6A 1Y1LA 3GC6A 5TB5A 2O7NA 1QGYA 2QRKA 2R00A 2PMWB 3JVEA 3HCNA 3WGYA 3ZWVA 3DW1X 1E1QA 4Q19A 3TSZA 4DIEA 3OWHA 2ODPA 4EY4A 1A50B 2J6BA 4RPLA 2P6MA 3B20A 5BV0A 3PDUA 4LJ7A 4J2OA 4F4IA 1EP1B 1J25A 2OXIA 1Y34E 1YZUA 4FU0A 2O8DA 1KOFA 3VTKA 3ACDA 1HLGA 4YBRA 4B5LA 1MH1A 5KOHA 4KI0A 4N40A 2JC3A 2OCAA 3R3XA 4PM4A 3A2KA 1B6GA 2CLFB 5I4BA 4R5HA 4XXHA 4UQLA 3RWMB 4DR2B 3JARA 1CCWA 5AW4A 1UXIA 4NEQA 1ZX1A 3VU9A 4J9UE 3E81A 3KJHA 3IEPA 3HRKA 1HZJA 1GJRA 3JR7A 5JAIA 2ZI5A 3RE1A 5IBQA 1V39A 3C6BA 4MUNA 3MNFA 3KT0A 4IMPA 1OX6A 1GPUA 2COKA 2GTPA 2NSHA 2XNDD 3JYOA 3DMGA 1Y7HA 3DYIA 3MTIA 1VJGA 3C45A 5DBIA 3KJZA 5IFLA 3ON5A 4NTZA 4XQEA 3ZNNA 5EI5A 3FWZA 3O83A 3QKTA 1EUCA 2Z2XA 4GE3A 4JOQA 2ORVA 4BBAA 2I87A 5F7OA 1V5FA 2YYZA 3INYA 3WRYC 5A3RA 3HWX1 2GJSA 3BMOA 4G4SO 5G0TA 4E88A 4H27A 1SBNE 2B3DA 1GCGA 3GFSA 3URKA 1XXHA 4EGQA 4TTQA 2ANCA 3NWBA 3QBTA 1OX5A 1IQUA 3TMKA 4IRMA 1EFHA 3RUCA 1F2TB 5F2NA 5DPMA 4EO7A 1ISIA 3I1IA 2JKVA 3IC5A 3O1JC 2V4ZA 2PU5A 1DX6A 3BTOA 5A2QA 3K70D 6ADHA 1T5DX 2OORC 4L5YA 3H42B 1XPRA 1TVCA 4MAMA 1QK5A 5D1HA 3TG2A 3OQIB 4JUFA 4MW4A 4QUJA 4IL5A 1VHLA 1FFXA 4EEZA 2V55B 4D41A 1AUQA 1GQQA 4UTXA 3RD5A 3R5XA 4BQFA 4L5JA 1PW5A 1U99A 3DM5A 1WXQA 2MJLA 1RKXA 4R1QA 4B4VA 1EGVB 1UBLS 4U7GA 5C5DA 1UAAA 4Q1DA 3VKGA 4LOHA 3MIIA 5HBRA 4AZ0A 2GPYA 1FYVA 4MS3B 5EHXA 3D8HA 1RTKA 1RSZA 1TB4A 3C1AA 1P81A 3B48A 3IOCA 1DPGA 4IX9A 4XDZA 1NOKA 2GPNA 3L41A 2C88A 2JGJA 4LN1A 3PLRA 4QTXA 4ZKDA 1BMFA 1K3FA 4RS4A 3LFUA 2AI3A 4JR0A 2FVXA 4JLMA 3KKLA 3SOZA 1FFBA 1JT9A 4L8FA 5DI3A 1X13A 4BLRA 4EF4A 1M83A 4NONA 4F9EA 1RAAA 1CR6A 1BE8A 1ETUA 1EPUA 1Z0UA 2F9LA 3M6MD 3OIVA 2O54A 3LXRA 4GE0A 1UFRA 1GNSA 2NTNA 3VI4B 2PFKA 4RKYA 1H85A 2J9ZB 3EWNA 5F3RA 2PKCA 4OAQA 4JHLA 4EMUA 5ALDA 3E70C 1UBGA 4GQAA 4S35A 2QY9A 5D5QA 3LTNC 4BO8A 3ZWOA 5CUQA 3H2IA 1HQYE 2CE7A 4UBLA 1MQ9A 1FVFA 1R4NA 2BR5A 4R7GA 5TRTA 2GAFA 3RGWS 4Q3EA 3TDMA 1NF2A 1UBHS 2PZJA 3FZEA 2IXFA 5KHLB 2ZJ7A 1E6CA 3PD1A 3PVZA 2FPLA 5G4KB 3Q41A 4ILEA 3OBBA 2VNIA 3DEFA 5MN5A 2NZUG 4FDUA 4V0QA 3I4CA 2RI1A 3BWDD 3L5OA 3NDJA 3TIGA 1XMJA 3G59A 4HUJA 4KZKA 1BGXT 4TLEA 2Y2UA 2XUDA 3ZWWA 1SUDA 3LF2A 4RV5A 3ROPA 5LQRA 3CCFA 3F8SA 5GONB 3PF8A 3IQFA 1FCJA 3CBQA 4CRWB 1Q92A 4MV7A 3T06B 3N5KA 1IBKB 3ETDA 3VYTB 2ZXEA 4HAZA 3WJ7A 5U9CA 1Z07A 3W78A 4QPZA 5FO0A 1JAZA 2Z5GA 3NV9A 4OO3A 4RM3A 4UOEA 1G5PA 3H1TA 5IEJA 5JTUA 2BDEA 4MJ7A 2J9GA 4IVPA 3O0TA 3R7WA 1JXMA 5H0IA 1KK3A 3NHBA 3CISA 4KPEC 3SIXA 3KS9A 1OU0A 4AO6A 1X7DA 2YBDA 4JI1B 1XF1A 4JROA 3SR3A 3F5DA 4UBMA 3U7FB 2I9KA 3WYNA 2HJ9A 1MRZA 3FVWA 3HLTA 5LR6A 2GS9A 1DI0A 1Q0QA 1W34A 1Z3CA 5AVQA 2J6CA 2WKSA 1YA8A 2JS7A 1ZOSA 1OBCA 1G3UA 2ERXA 4FINA 4RFVA 1L4NA 3I3OA 5FBHA 1MZVA 3C14C 1AMUA 4UNIA 1PR2A 1LLCA 1WUJS 4MXDA 1DC7A 1BYUA 4JJ8A 4RW0A 4A0FA 5J63A 1S2MA 1OAKA 4ZEOA 2YV2A 1BCSB 3IBYA 4LZJA 5JO0A 2NP6A 1UUFA 4XGKA 4A0RA 5B7PA 2DBYA 2XB2A 4ZJZA 1DV1A 1AKWA 2V7QA 5JE8A 2I7XA 2I2WA 2BP7A 2X15A 3FDXA 3IELA 1Z5UA 2MSCB 3ED5A 3R0VA 2OBFA 4QYWA 2F1OA 1G8GA 1M8PA 2FPIA 4CEHA 4E0BA 1UDWA 1JW9B 1NMXA 1RI2A 1FS5A 4K9QA 2ZITA 2DR0A 4E5SA 5GJWC 3KWJA 3PGJA 3DJYA 5KYWA 3W3AA 3UXYA 1QX4A 3IE1A 2C1EA 2G88A 3N58A 3DVQX 4HPJB 4M1TA 5IJ0B 4O2AF 3MB8A 1PIWA 1QK3A 2VHTA 3O4JA 3RANA 3WTCA 2X1VA 3D1VA 4XB6B 3L9XA 3RUAA 1UKBA 5D8DA 3HNRA 4MX8A 5JQGB 3RC1A 1FYWA 2V7WA 3UAGA 3UMFA 2UAGA 4KFSA 4B3HA 3V4FA 3H97A 2V3VA 5BUZA 2YWHA 1H2EA 3EIOA 1DAMA 4DM7A 3IV7A 2QUIA 4JI2B 2O5EA 3KB1A 1JR3E 4QXMA 2EHJA 5AI6A 1KY5A 3FPHA 5T6BA 4HVAA 5JALA 2Y99A 1OB5A 1EEXB 4KN8A 4ZVKA 1U28A 1T4BA 5AVJA 3DLIA 3QLTA 3HB9A 5KSYA 4D98A 1CKEA 1M6VA 3E82A 1C1XA 2EXXA 3CRZA 5TY0A 2P2GA 3TIVA 4FLEA 2AGVA 3CNQS 3VVLA 1I80A 1R0CA 2OXCA 5KC9A 3EVBA 3TCXB 2J48A 4F71A 1QRRA 3P0IA 4G6ZA 1H42A 2O07A 2XMPA 4I6JA 5TX7A 2Q3FA 3RFFA 4ARAA 3ENNA 2YY5A 5ICSA 4K87A 2D7JA 1GUFA 4YUZA 4JCCA 3RTGA 4PVDA 2D2IA 2XRFA 1XMPA 2R60A 1JNYA 1Z0SA 1UBUS 1GUBA 1C4WA 5KC8A 2DKFA 2QD5A 1AU9A 3KOOA 3U9LA 3GRFA 2ETVA 3MRXA 1UDRA 3QEJA 3G23A 1B2RA 2QGNA 4J7XA 1Z5WA 3HU5A 3JVUA 3K0FB 4Q16A 4UNPA 1DTSA 5BSMA 3T3EA 3JQ8B 3N0TA 2HZBA 1SD2A 4YDSA 1Z2NX 4BJHB 4EYEA 1FX0A 5IZCC 5JXJA 3E7WA 3OA2A 2B5VA 4TM8A 3U4HA 1OWLA 1H8ED 4R9NA 3SM3A 2G3YA 4C04A 2A67A 2QP4A 3P9ZA 3E0XA 4E1VA 3TECE 1TQ6A 1FFYA 3RGGA 2C99A 3SQDA 1BEUB 2Z83A 4WY8A 1K5PA 1V47A 4QUBA 3P9PA 2QMYA 3GWGA 3RS4A 2I22A 5KWIA 4P0TA 3DUFA 1JJFA 4FFDA 2H1SA 1XZDA 4H0CA 2PD4A 3VZRA 2KW5A 3L6EA 5E0KB 4C89A 4C6RA 1N5OX 4ZTZB 5C8VA 3A6DA 4IH1A 2BRUA 3GZ4A 2IDMA 3LGSA 1Z7EA 1QKIA 2KQUA 1EP9A 2LDXA 3H8SA 1BCRA 1NFRA 3U0VA 1S8NA 3I3SR 1SKBA 2AYYA 5ER6A 1E32A 1IL0A 1O6GA 4DLVA 5BYJA 2H7VA 3U1TA 4DIKA 1KYIA 1GGHA 1RLUA 3BRWD 3J81A 2H2IA 4YGXB 4YRFA 2PUCA 3MBKA 3PR2B 1L7EA 4YAUA 2DWOA 3IBSA 3PK0A 4PLTA 5ESRA 3EZXA 3ETCA 2FXIA 1O95A 5AVOA 2E49A 3ET5A 3HDJA 4D4LA 4DIMA 3GOQA 1LNSA 3FCXA 4K8OA 3EMVA 2BEWB 1P29A 1KE1A 1MTZA 1SK9A 3AM4A 3G6WA 4P6VF 3ZG6A 1Y3CE 4FCWA 1R1DA 2Y67A 3NALA 1C41A 1RD4A 1TUEA 4W99A 3KYDA 3DT8A 2J46A 1LWNA 4INAA 5ALPA 3V6MA 3BK2A 5CFPA 2JG3A 4LXXA 1JBKA 4IH4A 3WRVA 2PLRA 3HBMA 2HU7A 4L4UA 2HF8A 2FUEA 4ZYYA 4EA8A 1KEZA 7MDHA 1WXGA 4WUVA 2BFNA 5JAPA 1ZP6A 1SB8A 3T38A 3VR4D 3T34A 2R1TA 3O4FA 3UKJA 2PNJA 3R2JA 2JD2A 3KKNA 3NFRA 4L8WB 5ILGA 1ZN9A 4BHTA 2XT6A 4L4XA 3V4OA 1HSOA 5JSYA 4I1VA 2XHEA 4KEAA 3BD9A 5IAKA 5NULA 4CF7A 3DWGA 1C9NA 2YWCA 5E6UB 3HI4A 4HB2A 4GT1A 1XZNA 3UM9A 4YDQA 1W96A 1MOQA 5HFAA 1K08A 1PG2A 3GJTA 4GXNA 2CF6A 3E4CA 2XOKD 2B7LA 4GYJA 4YJ2F 1E3SA 3NKFA 5J1TB 4E12A 1DOHA 4F1WA 4MTCA 1M1YE 1Z73A 3CSUA 3LDUA 4FXPA 5DASA 1LTQA 4IDEA 3HDVA 1W48A 1KVTA 1R12A 3IDAA 2RAVA 3WK5A 2IGBA 3G2MA 4LHEA 1K7YA 1G59A 1F8YA 1LPSA 2NUAB 4AUMA 4ZVNA 2IC5A 3EBLA 1PL8A 1VL2A 2DP4E 2HN9A 1SVSA 4FB5A 4H0FA 4HZUB 1WUTA 4WQMA 4U3JB 4O4JF 2V7TA 3R6DA 3QWIA 4A8JA 1USVA 1WSBA 1HLPA 2ILTA 4MS4A 3D3NA 3A4NA 4JL6A 1G9SA 3PJDA 4IKPA 4K6OA 3S40A 5IT5A 1E59A 4IHJF 2YL2A 4WW0A 4F7DA 3QHPA 4UE6A 2C0CA 1Z6YA 2GZ3A 5F52A 3CE6A 5JAOA 1MW9X 4L74A 4Y1FA 2XUJA 3NYQA 1LFAA 5GINE 1WD5A 1GNLA 2GASA 2HDNB 5FNZA 3IA2A 4DIFA 2YIVX 4ERNA 1U8EA 4AURA 1SKQA 2FMXA 3AF2A 4JASB 2O1WA 3GGCA 3W2EA 2CL0X 4M9UA 1TECE 1V5IA 4OMDA 2QMEA 2JKYA 4YB8A 3ADCA 3A4TA 3CUWA 4EKNB 2QL6A 3Q9SA 5DCLA 3NW9A 1K8QA 2ZSUA 1DKOA 5HFJA 3WMXA 4Z7QB 4C08A 3SN6A 1P5JA 4GKBA 4KIJA 4KIFA 4RWZA 4RH0A 2VAPA 3EF3A 1EI9A 4M0LA 4ZV4A 1V1JA 3OZUA 3C48A 3A1FA 3I4FA 3OCUA 4C5AA 1JP7A 1X86B 4C29A 1U0SY 1Q1AA 3AUYA 4BFLA 1XJ0A 5EJEA 1H3EA 3BJIC 1Y1KE 2QQ5A 4HS4A 1P8AA 621PA 2H7CA 4MGZR 4QXAA 3RUPA 2CB9A 1NOIA 1ZU4A 2VNSA 5LLDA 2PKYX 4P4GA 1E79A 3QQPA 5EA2A 1CR0A 1NC3A 3RG8A 2GM4A 1E89A 3VH1A 1Z6TA 5CAEB 4QGSA 1X7YB 1LZLA 1YZFA 3KQQA 4WNAB 5HKOA 4RWEA 1ZRNA 2IHVA 2R7MA 4C2TA 4YRIA 4KQGA 2ZRIA 3IA7A 4W9NA 7REQB 2DPLA 2NAFA 3HP7A 4EPRA 3FJ1A 4I5EA 4L15A 4YCLA 2Z09A 3LWBA 2KX7A 1P4GA 2J0UA 2HPVA 2OCXA 3IIJA 3A3NA 3RUDA 2HWKA 3KR0A 1QZZA 1D2EA 3K9GA 1WU8A 2M98A 4H3SA 4TROA 3KZ1E 4QXOA 3DOCA 3C3AA 3QU2A 1R6TA 5DISB 1ZGCA 1TMKA 4KQHA 3BWXA 1RWXA 3KLMX 5AW2A 1YNOA 4F56A 2W7TA 5DCUA 3UT0A 1JFFB 4YDRA 2J1LA 5DBFA 4L95C 4M60A 4JGBA 2C7QA 1KRXA 1T9GS 2IV2X 5HKLA 4U9IS 1DKLA 1U2EA 1ORHA 2O0JA 3LT1A 4NBWA 2APJA 1QIFA 4QWMA 4CM4A 2IXBA 4JJIA 5I9IA 1FDVA 1KEEA 4EO9A 2G1KA 2I7TA 5BRNA 2CMFA 4IDDA 1SHLA 3DEKA 2VA9A 1RBYA 4X95A 6AT1A 2PYZA 2VAMA 3EFHA 1U0HC 2AE1A 2HU5A 4IUDS 4M76B 3GVIA 5T4BA 4R0NA 3VH2A 3ZDEA 3T5PA 3L8ZA 2SCUA 2CD9A 4HAYA 2BR3A 2WIJA 1Z36A 3K0CA 1J8QA 4BFZA 4M0PA 5H3LA 1U7TA 5LM3A 4XX0B 1OIVA 5BN4A 5LQMA 2XEXA 3FIJA 3EGIA 3DDSA 2PE5A 2PH5A 2W6IA 3RT7A 1FFCA 1Z16A 3ITNA 4G89A 1X92A 4MW2A 3IDQA 3GVPA 3RVMA 4IKEA 1DWUA 2CXXA 2ZYWX 3VJLA 2YUIA 3F5MA 1AK1A 2WTXA 3CUEF 5M7EA 2PAAA 3X1WA 1E1CA 4N4AA 5A04A 1ULTA 1D0IA 3HB0A 2RGEA 4B80A 3FNBA 3NMUF 1UT5A 1GPLA 2VEDA 3QTTA 1UT8A 3ZXXA 3VYRB 4DILA 1QFSA 5SZIA 4DJJA 2XMBA 3AX6A 3PNVA 2O14A 2ALJA 3RKRA 3K70B 1GRQA 1D3AA 4QO7A 1SKYB 3BSFA 1RM0A 2EW8A 5G3YA 3EG9A 5J4VA 1DFHA 5TEWA 1AN0A 4P7GA 3V55A 3H5RA 3ZPXA 1PR9A 2D1SA 1M1YB 4CGYA 1VB5A 4FDLA 3QW4B 2P6NA 1BX0A 2CW5A 5AXBA 4ED9A 4BC1A 3R7LA 2CZCA 1L7MA 3MTQA 1DTWA 1W5TA 4Z0NA 3OOYA 1YUBA 5E4JA 4LRSB 1VYHA 5FP0A 5AW9A 1I7SB 3FDZB 1DZ3A 5A4MS 2ZUEA 3PHGA 4OX9B 1JBQA 3M1AA 3RYTC 3A6HA 4FHGA 2WHRA 1DC3A 4QGGA 5FJIA 3WYGA 4X20A 4X6XA 2JIMA 4XOIA 3GA0A 1YIOA 4MA5A 3IUSA 1QHHB 4ZYVA 3DHEA 1N5JA 4MYSA 5I3ZA 1F8GA 1X7XB 4HATA 2JIRA 5FADA 2XOXA 3HLKA 4GYYA 3H2HA 4R40A 4EMSA 5F64A 5KYYB 3WNVA 2PKRA 1Q0UA 2VHYA 3AEYA 3AJRA 3LVBA 1Q19A 3DMYA 4TV8B 4C01A 4Q1BA 2RK4A 2Y6UA 2ZJ2A 3ZIAA 2JFOA 2I1WA 4XFKA 3ZWPA 3K6SA 1V8DA 5H02A 1A8QA 4KX3A 2IKSA 3SX4A 1D2CA 4E1AA 1FNBA 2ZGVA 4RK6A 3WIVA 4O1HA 1OQAA 2GF0A 3Q3VA 3AV0B 2G1UA 1TQ8A 4K6MA 1IC6A 5JISA 1F4LA 2ZIEA 4PANA 3TINA 2R6AA 1HTTA 3OO0A 4OQFA 4X45A 5BORA 1QTIA 1M2VB 4QO8A 1E8MA 3TI7A 3RYHB 2M1XA 3V7FA 3WSTA 3ZV5A 3EQ9A 2IPLA 1OREA 3JQRA 3FSJX 2FOXA 2EDAA 2ZIUB 4LECA 2HEGA 4NJOA 3ANXA 1NVFA 1WB4A 4FDTA 1U0NA 2GOYA 5HZGA 4XPZA 1ECGA 2GSDA 1KU0A 13PKA 4JI8B 3MERA 1P73A 4J49A 5EJ6A 3HRIA 1K68A 4JSTA 4JBHA 5KB3A 3BE6A 4JKYA 3FHJA 3CLSD 5BMOA 5CDFE 1UXOA 2BMJA 3I9LA 5DU2A 1L5HA 4OYLA 3WLQA 3R5HA 2MIIA 3EXHB 4XM1A 1PLLA 1C0PA 2MSNA 4L51A 4MIYA 3ZNQA 1XEFA 4HDKA 5KQPA 2HQSA 5FO1A 4AY2A 3DMFA 3SXPA 1EWKA 3FGZA 3KXPA 4FQ7A 5ELLA 1B1AA 4AU1A 1ZK1A 1MIOB 1KBQA 1XRPA 4YHBA 1U94A 3LLCA 4Y9SA 1J8VA 3U7GA 3H9QA 2ZIVB 4TLCA 1E60A 1X2BA 3K2BA 5GQSA 2EBUA 3V1YA 2V6GA 1EGQA