1LD3A

Crystal structure of b. subilis ferrochelatase with zn(2+) bound at the active site.
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
309
structure length
309
Chain Sequence
b'SRKKMGLLVMAYGTPYKEEDIERYYTHIRRGRKPEPEMLQDLKDRYEAIGGISPLAQITEQQAHNLEQHLNEIQDEITFKAYIGLKHIEPFIEDAVAEMHKDGITEAVSIVLAPHFSTFSVQSYNKRAKEEAEKLGGLTITSVESWYDEPKFVTYWVDRVKETYASMPEDERENAMLIVSAHSLPEKIKEFGDPYPDQLHESAKLIAEGAGVSEYAVGWQSEGNTPDPWLGPDVQDLTRDLFEQKGYQAFVYVPVGFVADHLEVLYDNDYECKVVTDDIGASYYRPEMPNAKPEFIDALATVVLKKLGR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferrochelatase
publication title Metal binding to Bacillus subtilis ferrochelatase and interaction between metal sites
pubmed rcsb
source organism Bacillus subtilis
molecule tags Lyase
total genus 117
structure length 309
sequence length 309
ec nomenclature ec 4.99.1.1: Protoporphyrin ferrochelatase.
pdb deposition date 2002-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00762 Ferrochelatase Ferrochelatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ld3A01
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ld3A02
2PO7A 3HCOA 1C1HA 3LYHA 2XWPA 4KMMA 2PO5A 2QD1A 2XWQA 2HREA 4KLCA 2HK6A 2HRCA 2XWSA 2QD2A 2JH3A 2Q2OA 1DOZA 3M4ZA 2AC4A 1AK1A 2QD3A 1QGOA 1HRKA 2Q3JA 1TJNA 2AC2A 1LBQA 3AQIA 4KLRA 2PNJA 3HCNA 1C9EA 4MK4A 1N0IA 2C8JA 2Q2NA 3HCRA 3GOQA 4KLAA 1L8XA 2QD5A 2XVZA 2QD4A 2DJ5A 3HCPA 2XVXA 1LD3A 2H1VA 2XVYA 3W1WA 2H1WA 4F4DA 4CCSA
chains in the Genus database with same CATH superfamily
3C3EA 3HFGA 3L0BA 3LQ1A 4PFKA 3EPRA 1CE8B 1LBIA 3TFQA 3GRZA 5LNK6 3OZWA 3M3DA 3DOEA 2W42A 3O38A 3TXXA 3HV2A 4L5YA 5LSAA 2WSBA 1LF0A 2LW7A 3QVSA 4O3FA 4BB9A 4E13A 5C4MA 2GB4A 1GNLA 2I1LA 2VRCD 1QFMA 3RT7A 4DR3B 1ZM3A 2AJCA 1DU4A 2X5XA 4LQ4A 4X1YA 4ZOLA 5IEBA 3NBYC 2ZSKA 3L84A 2YWDA 3IT3A 5AI4A 3IAM6 3AESB 4ECAA 2UYHA 4ZVRA 2AFHA 3RGWS 2P7HA 3MJVA 3TKAA 1AKYA 1BHSA 2RH8A 3AO0B 3ELWA 3QX9A 1HT1E 1MPXA 2LIPA 3DXZA 2HLDA 2C5EA 4RIGA 4QGHA 2JBAA 2I6FA 5CGQB 5SYMA 3GP3A 5COBA 4BFUA 3I9FA 4M98A 1B15A 4FWBA 2Q3EA 1CUHA 5FO0A 3SJZA 5LQMA 4K05A 2X7HA 3ABIA 1ZRNA 3WQRA 4G89A 5KVCA 1GYPA 5SZIA 5EP2A 1XQ1A 3F73A 1W6UA 4EA9A 1UR5A 2AN9A 1H2FA 4LZWA 4OMCA 4WCFA 4CMIA 5A4FS 1VLMA 2ORYA 2R6GA 3ELDA 1X13A 3PSAA 1P61B 1KTIA 3MQFA 3QFRA 4BVJA 4XGIA 1OPXA 1T1EA 1AA6A 4PQFA 1Z13A 2JGNA 3M2PA 3T5CA 4K3UA 1OH6A 2ISQA 1EA7A 4JOSA 1K8QA 4P93A 4XRGA 5JYCA 5KVAA 2OYCA 2HADA 3SC3A 3LC2O 4W1QA 1TEZA 5EJFA 2G3YA 3NAGA 4D8YA 3FYCA 1HNZB 2IHJA 1UINA 1XZEA 1TF7A 4B4KA 4IY1A 1AE1A 5AUQA 3K5HA 4A1OA 4U3JB 1PL7A 3AKYA 4EBBA 5BUZA 3H4TA 5J2UA 5L3VA 4QTTB 4CKWB 2JDID 1WCXA 3DB2A 3FGPA 2OBMA 3H5VA 4QLOA 5A03A 2WYWA 4MQFA 3T9FA 2QAGC 5IAAA 5BR7A 1NAHA 2NSJA 4J90A 4Q05A 5JARA 5L4LA 4ACAA 3S8EA 5FDFA 2NP6A 1GAEO 2ACKA 2O6LA 2I1WA 4ND6A 1TIBA 1W52X 1Z88A 3JQFC 5E4YA 4MKGA 1SOUA 3DGFC 3G17A 3K70B 3QUAA 2ZIAA 4CM8B 1JYFA 1NC1A 1VTKA 2BMFA 3TSYA 3H18A 5M5BA 3TE6A 4KIJA 2Z9DA 4E14A 3KV3O 2XQIA 2I4NA 2RKBA 1KQGA 1T0JB 4A36A 4NCIA 1XZIA 5GOZA 1LS1A 1FTYA 1PF7E 1S01A 2GM5A 1P1IA 4P84A 1TYDE 2Q3BA 4PIMA 1FRQA 3TDMA 4DJEC 4B3GA 2ONCA 3A05A 4OKIA 4WSOA 1UWLA 1T9GS 2PY6A 2X5NA 3DEIA 4B87A 3BK2A 3MTBA 4MWDA 1XD9A 4Z8YA 4A2WA 1QIDA 4MVJP 3VO9A 3PQCA 2GF2A 5LMCA 1NJ5A 2CL6X 1T4MA 4UM8B 5K3BA 1XT6A 2OBNA 2WAOA 3Q72A 1DXYA 3EZ7A 4C1NA 3HP7A 1SKYE 1GKKA 1XAHA 4C3UA 1AKUA 1W30A 4FGLA 4HAUA 4MB0A 3RFXA 3RS8A 3W4JA 5DBOA 2D2XA 4GPTA 1WABA 4WXEA 5JRJA 2DBZA 1ZH8A 2FZ4A 2HU5A 1Y1LA 2EKBA 4E5DA 3CCFA 1K0UA 2CDAA 3GT7A 3KUDA 5LU8A 3I39X 1IM2A 1DZ3A 2JCGA 5LCXA 3ZZ0A 4UOQA 2INGX 4Y30A 1QH0A 4BMZA 1P6QA 1NN3A 1V71A 5TSDA 1YQGA 4NHEA 4RD4A 1HX7A 4D4GA 2I3AA 3EEQA 2XXAA 3PJRA 3FMVA 1AQUA 4X1YB 3NJRA 4I5DA 4ZOLB 3NI2A 4CKYA 3UGKA 2QRUA 1KQNA 1ODJA 3G7NA 4B43A 1T24A 2GZSA 5K0NA 5F9FA 1UDBA 2OL4A 4EITA 4HQNA 1IN5A 4E5MA 2AFHB 4LJAA 1RFGE 1MGPA 2Q0HA 2GPWA 1XEAA 2JBAB 5SICE 5FJIA 4ISCA 2FFBA 4QEDA 3HYRA 1Q1NA 3S4YA 5CDGA 2CZCA 1QCZA 2GJ8A 2ZJ0A 1YQWA 4B45A 5A7FA 3DA8A 5IC5A 2A9RA 5GJVC 1FMJA 4MW2A 3TM5A 2C58A 1CP2A 1I6WA 5J2TF 4WCFB 4CMIB 1X0XA 5DNDA 4MIOA 4TYQA 5IDVA 4PYIA 2O1SA 4P08A 1R1DA 1E2IA 4HQRA 3VO8A 1HDZA 4DDVA 1ZL2A 4BMYA 4YS6A 3HYTA 2XT9A 3RYIA 4IJKA 2NSHA 2WYVA 4NONA 2VSXA 4JT2A 3ITEA 5KYGA 1PBNA 3WGVA 1RXUA 2ILTA 1NW8A 3OIYA 3IB6A 4NQZA 1QGAA 1WBJB 1PL8A 3GI1A 3IBTA 1EFAA 2A7QA 1WDMA 2E18A 4I81A 1CJVC 3KT3A 3NXSA 2RAUA 4RBNA 5FO1A 2CUZA 1DSSG 2VG8A 2WHXA 3RS0A 3V8MA 2RI6A 4L8YA 3UMBA 3G49A 1WXHA 3GHHA 3ECAA 4UVIA 1JLSA 4Z49A 4MQFB 5GADl 2VYVA 1LW6E 4FX2A 4A7PA 3VFDA 3DHNA 1WMDA 4L9WA 4Z99A 5T64A 1PR0A 1ECBA 3QVLA 5BSWA 3KYBA 4TYNA 1ZCFA 2G9RA 2WT4A 1FP7A 1QYXA 1E7WA 2E6UX 4L7VA 1V9LA 3OA0A 5FFMA 4IG4A 1ZI8A 4MKZA 3TRFA 3I53A 3Q5DA 2Q5JA 4M88A 1DBRA 5LA6A 3PFCA 2JJ2D 4CW7A 2IYVA 4B0OA 3O9MA 3BOSA 3K5IA 4HAZA 4YIKA 1X7GA 2P5YA 2ZVJA 3ACCA 1S7GA 2P5TB 3ROMA 5BW5A 5FA6A 3FSGA 4HGQA 1O0CA 1RPJA 3TPFA 5KDLA 1QE0A 3T1OA 4RZHA 3C6MA 3UMVA 3EOZA 2I67A 3QWBA 3FVWA 4BP1A 2ZTSA 1FX1A 2NM0A 3JYQA 4TOIA 3RBXA 1KI6A 3OEED 3P2MA 2EG9A 1AM4D 1AF4A 4JVLA 2KLBA 5IM4A 3BBLA 2IYSA 1EDZA 2MSDB 4JMLA 3KUUA 1UXJA 4TTIA 3PD1A 4DRYA 3IDSA 1CUEA 1P0PA 3NUZA 5IG2A 2P4QA 1PZFA 3NP7A 4JXKA 3NKFA 3URMA 2AD5A 4RY0A 5C9ZA 3LUFA 3DGEC 5EE3A 3FWNA 1ST3A 1ZR4A 1WY7A 4DQDA 4RHCA 1JB1A 1BW9A 2GKOA 1VHTA 2I4IA 3CTMA 3EGEA 4X45A 2RIRA 4HUQA 4BVLA 5G41A 1D4FA 5E7MA 2EZ4A 3ZCTA 2VBIA 2FZGA 4HEA6 5DBIA 2GF9A 1L8OA 2F17A 2F1HA 5EQDA 4XM1A 1PK9A 3JWJA 4D96A 4Y2GA 1X1SA 2E49A 1FOEB 2WU4A 1P4RA 1E79D 1WMAA 1LX6A 1V7ZA 2ZT8A 2VFAA 1I13A 4FHGA 3ICVA 1XUOA 1BA3A 4HB4A 1YHNA 1FMTA 3AHFA 4UUMA 2WIDA 5ILQA 4QAJA 3X1YA 2XXAB 2UYGA 2HTEA 3BHNA 2A0XA 1QV9A 2IELA 2Y1CA 1WBDA 4TSKA 2C0QA 2GBPA 9LDBA 3BE5A 1B0UA 1ZD5A 4KR9A 3QX3A 2GFIA 4G41A 1R2QA 4DDKA 1JEDA 3BFPA 5DX1A 3WWCA 1SCBA 2P2SA 2O7RA 3RU2A 2QTVA 3I2GA 3SQNA 3TFOA 3W4IA 4E5PA 1H8ED 2Y0PA 2EGUA 1PR4A 3A4MA 3S70A 4D3FA 3OQJA 3V8NA 4M8SA 3CTPA 1FQKA 3RRJA 4N5DA 4M8IA 4Y67A 4XR4A 3TTVA 2ZXFA 4YDHB 4XXHA 5JYBA 2ZBEA 1A9QA 3RC7A 2JVJA 3CM0A 3NHUA 4TQ9A 4EHFA 13PKA 3GEDA 2BFPA 2WM9B 4KEAA 4M0MA 5EI5A 4YV7A 2FR8A 5IK2D 5CDHA 1C7RA 4MQLA 1MR3F 1J56A 1J9EA 1U02A 2O2SA 5CDYA 4FYWA 4MGEA 3KB8A 5KO2A 1AT1A 4C06A 1W59A 3ZWWA 3DBVO 4B40A 2VRWA 5F78A 4ERXA 4RTJA 4OBXA 3M6FA 2GETA 3IPLA 1FDUA 1E2JA 1ZK3A 4CF4A 1IN8A 3TVDA 3RYIB 4PV7A 1J6UA 5T57A 5FWNA 1ZQ9A 1SG0A 5CW2A 5CXUA 4N9QA 1QMPA 1Z0IA 3D7NA 1RAAA 3IERA 5B1HA 4AS2A 3VR6H 2AR0A 5TF4A 3FCEA 5JI2E 2WF6A 2Z1NA 1ND5A 1Z4QA 2AG1A 4XVHA 5CUQA 3R0XA 1X0VA 4EDHA 5J58A 2XZLA 1HFKA 2GM9A 4AJ1A 4DQ0A 1YZNA 2M6KA 4EMSA 2YWFA 1RTKA 2Q07A 1OFHA 3CS3A 3O7MA 2EERA 2R5WA 2O2YA 3Q3IA 5SZHB 4YMTA 1UOEA 1VJCA 4JK3A 5SZJA 2O1WA 2P90A 3L7CA 5BSVA 4R3WA 2WM8A 3I3OA 4IV0A 3I9OA 3OLXA 4O4HA 3R3HA 2WLTA 2R6ZA 1SK9A 2R6CA 4WKNA 2QRZA 4J49A 2OVFA 5KJ6A 5IZCA 4Z4GA 5LP1A 1QG2A 5LA6B 1VL1A 1L4YA 4QQ8A 3VM6A 2OGTA 2Q5QA 4Z54A 3COJA 5FBQB 4DTIA 1QFSA 1I2DA 1B8UA 2BUAA 1CJSA 1K27A 4YMUA 1UKYA 1RE0A 4C78A 2A78A 5BRJA 3SKVA 2IITA 1XROA 1P5ZB 3E5NA 4JJKA 4G9GA 1YDEA 1E2PA 4I0WB 4EELA 3IO3A 1KI6B 4FIDA 1PUJA 3VR6D 5K05A 3IQGX 4F2HA 2QJWA 3HA7A 2GH1A 5DLPA 2GVDC 2EJWA 3INTA 4PEVA 4YAUA 4MDFA 4PPFA 4V0RA 5BYJA 1K66A 3PEWA 3CH5A 1YS7A 3HYLA 3KO8A 3NM6B 1XWFA 2NTEA 3WAJA 3TIIA 1MB3A 4PRZA 1EGAA 3EYWA 2OYRA 1JKJA 3A3OA 5IVIA 1ZA2A 2D4HA 5AI0A 2G5PA 3HKDA 1BW9B 2PZFA 3IIKA 4UZEA 5JBQA 3P45A 3AVYA 4HUQB 3ZXSA 3GJZA 3ZWBA 3QE0A 4HL6A 3NHYA 4D6YA 3I8OA 1G2IA 4FFBA 4Q9KA 1E69A 3JQAD 2YXDA 4ND2A 2J9FA 5ADHA 1H66A 3DHYA 4GOOD 1YRYE 3BUSA 1G1AA 4F5DA 1WMBA 4N0PA 5BN4A 2XD4A 3AZQA 3C48A 2J87A 4KN5A 2AI3A 1JG4A 3IP3A 1DIRA 2EWMA 4F3YA 1PJTA 4V2UA 1DRVA 4IMIB 3FTFA 4MWCA 2IXEA 4H1HA 4EHKA 4NDNE 3LY7A 2AD1A 5K5EA 4N0MA 2CJWA 2ORWA 4XRRA 5EC8A 5FLYA 3F98A 3ND9A 2D2IA 3T9BA 3K94A 1V4NA 4NMHA 1PYOA 1Y9DA 2O52A 1C29B 2QTVB 1TVKA 1PGQA 5JRZA 1R6DA 4K87A 1GZUA 4W8HA 2PMFA 4R1OA 3F67A 1FU4A 5KTPA 2C9DA 4LBYA 1XPJA 1P1RA 3FCOA 3FYUC 2ATXA 2FOIA 2ZIEA 3IQEA 4JGGA 2H65A 2WU1A 1MG0A 4LZLA 4YI5A 4HB2A 2X13A 2E55A 1AKVA 2FB9A 5LQCA 3ZZ1A 2HZ7A 3ABQB 1LA2A 5AW8A 5FTNA 5FLXA 1UK6A 3HCCA 4G0UA 5KWJA 2VJKA 1X80A 2FCAA 2ZYIA 3IAS6 1OYYA 4K9QA 2G7MC 2J3MA 3VOAA 3WV5A 3F7MA 2ANCA 4GPBA 4W5NA 1Y6FA 4CV1A 1SD1A 5ALTA 3KQYA 4BJ6A 2E9SA 3TCNA 3MGCA 3G9TA 1FYWA 2RMKA 1RM0A 4KXQA 4E5KA 1KJ8A 4LTDA 1NNUA 3G5MA 3W6NA 1T1SA 2VF7A 4OBWA 1KMNA 1TQ2A 4A5OA 1T0PA 5TGZA 2I71A 1YQEA 2HV8A 1DDOA 2XUGA 5E95A 4RZSA 3WYNA 1NQTA 2GHTA 4D80A 5FL7A 3VX3A 4O25A 4L8GA 1M72A 1B8PA 3H19A 1GZ6A 3BHMA 3KEQA 2EVWX 3VUFA 3SEAA 1MO5A 2ZEJA 1O97D 4KSYA 4Q3CA 4YP6A 3LCJA 1XV5A 2Y67A 3RJ9A 5A9TA 2PIAA 3DZFA 3QMWA 4PX9A 1FSPA 4MB6A 1NQWA 4DC9A 5KIAA 1YDMA 3LRPA 1HM5A 3WGZA 1LZLA 1SM4A 3DT6A 4R9UC 3UKDA 4CMCA 5TIIA 4EKEA 1NWHA 3L9XA 1KZYC 421PA 4A6XA 2OBXA 3LT4A 3MFQA 4O4HB 3ND7A 2R8YA 3WQBA 3G6WA 3AHJA 1UJBA 3CUSA 3NHZA 4YRBA 2HR1A 1KMQA 3WK7A 1TPYA 2LKCA 4JJIA 1RXSA 3GA5A 3AUTA 4E15A 4KXXA 3SXUA 4C6TA 4NXMB 5FBVB 4RVCA 4IHJF 5IDXA 3L18A 1DAHA 4POOA 5LMZA 1CQIA 1PUIA 2YVKA 4DSAA 1NXSA 1YF3A 2GESA 4K28A 1M6NA 4GLLA 4JUBA 4K9KA 1G66A 2FNAA 4W9RA 1JDJA 2FJ0A 3CC8A 4LJYA 3VZCA 2WJ6A 1PWXA 1UPCA 1KEEA 2Z6VA 4I9UA 1J2RA 4HVAA 2PNFA 3C0KA 3JZDA 3OZEA 2IEBA 3P0EA 4R7ZA 2EX1A 5DTRA 5ESXA 1BROA 4K6CA 5E7QA 2I55A 1FNSA 5K6AA 1P7YA 1UC4B 4B5LA 4CKZA 1ZOPA 3HG7A 5DGHA 5CVVA 1NOJA 2YXBA 3TMKA 1KGSA 5A04A 1YRLA 5ITZA 2JFZA 5KNBH 5BOVA 4G23A 1X77A 3TINA 3JQ9A 5I7VA 5K0BA 3UK0A 1V3QE 4YRTA 4PZLA 1SBQA 4IICA 3WHKA 4CQNA 1JKJB 1RWXA 2DPXA 3MJHA 4IZOA 3H9JA 3HKDB 4H0CA 1EX1A 1GCUA 3MG9A 1N8TA 4FFBB 1QVAA 1A9YA 4TM7A 3LLMA 3LK6A 3Q0TA 2DY0A 2IUSA 4IWXA 2J9FB 2QI9F 2XTAA 1K6MA 5F9HA 5EIEA 4X85A 3T35A 4M1SA 2CLEB 5BN4B 2C31A 2P4EA 2C04A 3VNSA 3ZHRA 4CCAA 2G9NA 4NBVA 1WCIA 1JJIA 1SGWA 3BIJA 1CY2A 4CETA 2UZ4A 2VKTA 1KFBB 3K8OE 4L5IA 4U39A 3PNMA 3PQDA 3HC7A 3EWIA 1WOMA 3L8FA 9ABPA 2H29A 5DHUA 1QTRA 5K0ZA 1K2WA 2CJWB 1SQGA 2QLTA 3TAUA 3Q8LA 4GI3A 4GMDA 1P1JA 1IVYA 4EUKA 3DL7A 3L79A 4KR7A 2X8JA 2XKJE 1XVUA 721PA 1HZJA 1C0KA 2B2CA 2XNDD 4NZYA 5ER9A 1TVKB 3UENA 3L1KA 1RWVA 3L1VA 1T8SA 3QKSA 5JEEA 1RJWA 2ZRKA 2A67A 2CDNA 1NSTA 2TMKA 3ZZNA 5KNBD 2VJDA 3VISA 5B6PA 1JE1A 1R6AA 4LJSA 2X8WA 3THSA 4WL0A 4WHMA 5B1YA 1ZWKA 2FFRA 2XNKA 3NZEA 4J1SA 3RS9A 5BSUA 4Y98A 4IP0A 4YR7A 1Z6AA 4RTRA 1Q11A 1UK9A 4U5QA 2PAFA 3ETEA 1X80B 1KKUA 2BJVA 3KDAA 3M6LA 3NBFA 4P4TA 3TJRA 4KLNA 1NLZA 1N2GA 2PRJA 1KSHA 4FQ8A 4FCCA 3DS8A 4IKEA 1NUHA 2GN9A 1EJBA 2WWRA 5BORA 1K06A 3OZAA 2GEVA 4RHUA 4JLWA 3SEQA 3W9BA 2VZ8A 1AKWA 1TMKA 3G0CA 1BIFA 1PW5A 1PKEA 5H82A 3MUNA 3RDPA 3RSSA 5K8VA 1WR8A 3A6DA 4CEHA 4A8JC 2C9ZA 3H2SA 3MLBA 2H85A 3INRA 4K03A 1A7AA 1G4HA 2G07A 3BIOA 2H06A 1ZM9A 3AI2A 4ZJYA 5JV5A 3KOWA 3O2SB 4FHZA 2QUAA 1VJ5A 4GXNA 4YRLA 1RQXA 2WD9A 3G1WA 1L7BA 5E7IA 1SEVA 2JIOA 4HADA 5FV7A 3GVPA 1SUCA 1P7VA 1SVWA 3MWLA 3NTQA 4HWRA 1BJRE 4IDEA 1DQNA 1UFKA 3THOA 3THYA 3S1LA 5ADWA 2CYBA 2GJ4A 4W9NC 4HZUA 1GFZA 4OQDA 5KTMA 2C1EA 3QVUA 1UT8A 1WQ4A 1ZY2A 3QU2A 5EKXA 2XRYA 1RXYA 3KYIB 3ROQA 2AQHA 5LNK1 1FIUA 2VQEB 2UVDA 2G9UA 3ILSA 3OF2A 5EGSA 5D01A 1B1AA 1NVUQ 2YJ5A 1R3DA 2OLEA 3HGTA 4H2DA 5B58T 4MVCA 1IC6A 2ZI5A 3G5AA 2ADFA 4PXAA 3S27A 3SXUB 1SKQA 4C6TB 4KI7A 2BHTA 1GYRA 1QFZA 1E7RA 1CQIB 3KT8A 3NTLA 4URVR 3X1KA 1Y1QA 2WDZA 3IAM1 5ES4B 4XWWA 1UAYA 1XA0A 2AT1A 4B1FA 1TM5E 4M89A 2I2CA 3DKVA 5BN1A 2F3QA 1VRWA 3EWSA 2VTDA 4ZPJA 2Z6QA 3MS2A 1YQUA 1JIIA 3KPVA 1U81A 4YLGA 1KEEB 2P2DA 4DLRA 5IFKA 5JH7F 3LXRA 2GZ3A 3GJSA 3UWDA 3H8SA 2QNRA 2RGAA 4GSYA 4CMHA 3TL3A 5CFOA 3OWOA 1TIKA 2Q4OA 3Q7SA 4QOFA 3UB3A 1OBCA 1E1KA 5IMBA 3O8RA 4P80A 5ITZB 1YD7A 2DCUA 3PYXA 1QP0A 1OCEA 1NJ2A 3H3JA 1DWQA 4IGAA 4YECA 3SX4A 3W6OA 2FQ1A 4DIUA 3P9SA 4TTSA 3E8SA 4NL4H 4HBGA 3NTOA 1W4AA 1O0BA 5A3JA 2ZQYA 2X3UA 5HE9A 3ZU4A 1NXQA 1T3LA 4FLEA 2NUPA 1XJQA 3H7AA 3BDIA 5HG0A 5IDWA 5P8WA 5EKSA 3VBCA 1VMIA 3PR2B 3UJBA 2ASVA 2Z4SA 2JLAA 3NAZA 1Q7GA 3L8CA 1LTKA 3OUZA 3W3ZB 2X14A 5AVKA 2PG3A 2KWIA 3EXHC 3PQ4A 2A5JA 2R65A 2WR8A 3CPEA 4OLHA 6Q21A 1WCIB 3X44A 1ULZA 2CXTA 2HWYA 3NRJA 2C9BA 3CVVA 3IAUA 2R6AA 5FBHA 2LPMA 1A96A 1IATA 1C3EA 2J9GA 1SU8A 4KE9A 3VVMA 4EZIA 5HZHA 2CWWA 3IL2A 3A6KA 3EY4A 3FNRA 4EGJA 1QQTA 2ZU6A 3C24A 2ZVPX 3JU3A 2ZRHA 2YBEA 5DW0A 3SOZA 1G5QA 3W9SA 3WNZA 1XTZA 2DAPA 2NZYA 2P9YA 2X8JB 3BFKA 3MZ0A 4NBWA 1JLRA 1QHHA 1WWKA 3SP1A 2HDWA 3MWGA 3QKSB 4GR5A 4ITUA 5CNIA 2FR0A 2EAUA 2HK8A 3HLTA 2BBOA 5HVNA 3TR6A 4XA8A 5AKLA 2B1QA 3IUJA 5ICCA 4AN4A 1QAOA 3OEWA 1XWWA 5DTEA 4BMXA 3W1EA 5KTNA 4Z7QB 1UBRS 3VR1A 2G1PA 2PYIA 2V4ZA 1BCSA 1W4ZA 4YP7A 2VDNB 2OEPA 1QZXA 2BHLA 3A3NA 4LA4A 4PR3A 4Y6SA 2Y9PB 4Y2TA 3RSOA 1EQAA 2P6PA 4HP8A 5BQOA 1CNMA 1E2MA 1CP3A 3DZJA 2PO5A 1E0SA 3D6FA 4H15A 4J2TA 5FAKA 3AFNA 1IBLB 4D9KA 5GTDA 1JI0A 4BO4A 1KYWA 4GMKA 3JZMA 1TM7E 4MV7A 1BE1A 1HG0A 3L49A 1OWPA 5DCLA 1A0OA 5DBFA 3DMHA 4CEHB 4CT0A 2FR1A 2PQ6A 1HDRA 1RWPA 2CJPA 3KJZA 2ERYA 3OKPA 1HE4A 3Q8XB 3QPBA 4GBJA 4OXRA 3ZCVA 3DNMA 5LD2C 2B1RA 3NHPA 4PYLA 3PK0A 4BRSA 4P6VF 1XQXA 1Q14A 2VSQA 1B74A 2CXPA 2XB4A 4US1R 2BPOA 5B2FA 2C96A 1EFCA 1NATA 2FQYA 1E5LA 1W4LA 4OYHA 1FS4A 2GYVA 3LHSA 4HFNA 3CNLA 5EIXA 3UIEA 2Z8YA 2HF8A 3QTLA 4QUBA 3THYB 2A86A 4K0KB 4OG2A 4FINA 4G56A 1P39A 2ETXA 4HK4A 1HFEL 3HUTA 4HZUB 2PUBA 4UUBA 4ZT5A 4V02A 5EIWA 4DZZA 1J7KA 1EJ6A 1QNLA 5EZQA 5CCEA 2P2GA 3FKQA 3SR3A 3WTBA 3P2KA 1JH8A 1F8YA 3VPCA 3IELA 5ALSA 2DBQA 3R5JA 4FT2A 1E2FA 5E4TA 4I50F 3TQTA 5JFGA 1GRCA 1MO6A 1ETUA 5I4BA 2PR2A 2ZAOA 1OYVA 1U9YA 3I6MA 1AMNA 1QIIA 5D6NA 2X0EA 1JHRA 2XH8A 3T1QA 1US8A 2QJRA 4IIJF 4JUCA 4ZD6A 2EFDB 3PHGA 2E4AA 1NF9A 1QQAA 4BKPA 1E1QA 2X22A 3AINA 1VE1A 4P81A 4NH4A 5BSHA 2R4TA 3ISTA 4RKEA 2A58A 3E2MA 3JRNA 3VTFA 2A0YA 5AVYA 3I34X 1A71A 1KAGA 1XZMA 2YVLA 2ZE5A 3HM2A 2NPIA 1ZISA 3JVEA 1TVMA 2GILA 4DCGA 3ILXA 4WBSA 1ZKMA 2YJGA 3FMIA 3O91A 4YRGA 1JDNA 4P5PA 1GQRA 1SXIA 1D8TA 4MKRA 1NXOA 3F3MA 3FTNA 4BEJA 1G8MA 2Z2IA 3OJLA 2IOYA 1KMCA 1ZGGA 2UXDB 1MCZA 4TTQA 8LDHA 2LGJA 3LPAA 1AS0A 4GAEA 4BE4A 4BLOA 2DH6A 4MV0A 2H48A 4PAGA 5JAIA 2G1AA 3DAOA 1JDUA 3L4BC 2NUPB 1AC5A 3R3YA 4IHAA 4QFMA 2EJUA 3HBLA 4OLFA 4JASB 1VMKA 1NT4A 2BR5A 3C7AA 3RIXA 4AO6A 2RGYA 2EHDA 2FGKA 5GMOA 5SYNA 4UJ5A 1EVEA 1GL3A 3V7FA 4IXWA 4K9MA 1Q7TA 2VUHB 3LF2A 5JJIA 1AZTA 4MYRA 4KHPB 3NORA 4MKHA 2UVPA 3Q15C 1SC1A 3WLFA 4C22A 1TC2A 4EL0A 2V5VA 4TMYA 1EWRA 1HDEA 3OOWA 4G1VA 4M60A 2GR9A 1BGXT 1JSXA 2PFKA 4KRXA 1Z68A 2LDBA 3CLSC 4UZFA 4PYMA 5AK4A 3MEQA 5FNZA 4AN0A 3N7UA 4MCIA 2O9JA 1IQPA 2QN1A 3BDVA 2GBGA 4EHLA 1I3OA 2RH5A 2JZNA 2FKNA 1GLGA 1QHHB 4U00A 2V58A 3C45A 1WY5A 3QGMA 1BHJA 2VCEA 3ESRA 3SJBA 5M3BA 3LPNA 1QO9A 3LUKA 4IUDS 3KL2A 3UKJA 4ZHQB 2Y1FA 3KAPA 3X1WA 1C3JA 2D5BA 2QR5A 3L1UA 4OFBA 2OCYC 2XBMA 4PYRA 1BCSB 1XVVA 4Z9XA 1KH2A 2JEZA 3PPIA 3RRMA 2VP6A 1GEEA 3UPUA 5FOSA 2G9ZA 4GRAA 4QPCA 4XYBA 4F71A 1TK9A 1V2HE 1YQTA 1OE0A 3JD3A 3D3NA 1JPJA 3AWIA 5ARDA 4B8ZA 2ZBUA 3LKBA 3VZSA 4B31A 4DLTA 2H17A 1YR8A 3H8VA 3V2UA 4BMCA 2QM0A 5TEVA 4NAVA 3HR4A 4JI5B 4CG3A 5EG5A 2HXSA 1JXAA 1XZDA 1S2MA 3H3XA 3IJPA 4GZLA 3DMNA 4CUKA 4NX2A 5AXDA 1H9AA 1J8QA 4RDCA 4ARCA 4KBFA 3WNBA 4YT5A 3P26A 4LI0A 2IXAA 1U6KA 2QENA 1UPBA 2OGZA 1F9EA 5FLKA 1GPAA 1S2LA 3K71B 1IOVA 3OSZA 3E1SA 2CFCA 1NW4A 5HIMA 4EAQA 2DHRA 4EFMA 5H16A 4GQAA 1UM8A 3O03A 1LJ8A 4QXQA 3LAWA 1Y6JA 2VH5R 4TN1A 3EYAA 3N59A 3EFBA 3COVA 3TWOA 1OBFO 4WTOA 1E18A 2ECKA 2YFKA 1X7WA 1ZN2A 2QM3A 3PUVA 4HEA1 3MM4A 4RC9A 4W7HA 3UJCA 1CEXA 1RE1A 3A1NA 3ZHUA 5A4DA 2VCYA 3E9ZA 2Q9BA 4DV3B 3ZY6A 1SXGA 3DOOA 5ALKA 5IWCA 1F6DA 1O6BA 4MV8A 2HMVA 4RFVA 5F2OA 4JU9A 2IZZA 1MO4A 3QRWA 5LBTA 4C7MA 1JDTA 1EVIA 1MB0A 4KDRA 1BFKA 3C16C 1US8B 4UREA 3FFXA 1E8NA 4WCFC 5E8RA 3RVLA 3GVCA 4FBLA 5IKEA 4U7JA 5HIAA 4K88A 1KPGA 4MNTA 3WKEA 3PUJA 4FONA 1UP6A 2QD3A 3LQ4A 5JMTA 5TB5A 2ERCA 1P19A 5LZ7A 1XJWA 1MB2A 2XPCA 4CKBA 4Y2VA 2GZDA 3QFFA 2AL7A 3C6QA 3KVNA 5K51A 3UJ9A 3ZU2A 1T6XA 2DZDA 4C2BA 5KDOA 4HNQA 2QTGA 3C5VA 3O73A 4BRUA 3HCDA 3GLFA 3SLKA 5CXQA 5EMLA 1QOPB 4PXSA 5LJLA 4ZZ3A 3PXXA 1I1OA 5I7SA 4RQUA 1VP3A 4LDJA 3TOZA 2J4FA 2XV1A 3D0KA 3UQYS 3TO5A 2FEOA 4UXIA 3SBOA 5EJ8A 4I55A 3DEZA 3GWGA 3G9XA 4QPZA 1B16A 3B6ZA 4X54A 4PPQA 1VE6A 3AHCA 1NUUA 3RSLA 3TQFA 4C9BA 2ZT7A 3DFKA 3I0NA 3GFSA 4UTXA 5KTSA 3EN0A 2I22A 2IP4A 2TRSB 2UVPB 3D3KA 2WJPA 4D44A 2GS9A 3HJRA 3ENVA 3N2YA 2VAVA 2JAWA 1R8YA 1CQPA 1KFKB 4X6LA 4D43A 3SVTA 3M82A 4AP9A 1JQLB 1UC8A 4G2NA 5AP9A 4Z1MA 2FRVA 1DEXA 2BWJA 2PZ8A 3CX4A 3ETDA 5DBHX 3TBHA 4LSGA 2PM8A 3KC2A 2NU9A 3BWEA 3GRKA 4RGQA 2KE5A 4FT4A 3BHJA 3ZD8A 1U4SA 1XDDA 2SHKA 3M4ZA 3NVDA 2XMBA 1KI8A 1DKRA 5TV2A 3I5UA 3QPWA 3EEIA 4WLEA 1FUUA 1Z12A 2C9YA 4R8SA 4WA8A 4FOPA 3PJEA 2WPDD 3WJ1A 1S3GA 1R4NA 1SUPA 2VCHA 2WSIA 1UODA 3FLAA 3GA0A 4ZVUA 5A5FA 4YVFA 5IUNC 4DUYB 1Q0QA 3T7SA 4EFLA 2HYIC 2WF8A 3FIUA 5DT9A 4DQUA 2XVZA 4RZ2A 4PS0A 1XB2A 1N2JA 1FZTA 4KV7A 5BY2A 1HLGA 4B7AA 5JANA 1F60A 2P91A 2QLLA 2DLCX 3I01A 2O54A 1KQ3A 1Q91A 1TD9A 3DWEX 4OQEA 3H9UA 5FORA 3TLAA 1LBEA 1XMQB 4QYIA 1E77A 2LP4Y 5K8IA 2COKA 4FGUA 1U1DA 2VJMA 1T2UA 2CL0X 4FSDA 2E89A 5BXQC 5JAMA 4QDXA 5DHFA 5TGDA 1IBRA 3PNPA 2HA7A 1WD5A 2QUBA 2P8JA 1XN1A 4FDVA 2BUBA 1GADO 3CX3A 2WNHA 1U7OA 4BO3A 3N5CA 4HNRA 4B2PA 2XQFA 1YK0A 2ONYA 3OU6A 2P8SA 3B5IA 2JD1A 3HVHA 3JVIA 4FBMA 4ZTBA 1UKBA 5IWAB 3AVXA 2OV4A 3GLKA 3M83A 2PWYA 1HBJA 2QSJA 3M6AA 4F3RA 3ITDA 3E3MA 4Y2QA 2W6OA 1TZMA 1NVXQ 2R7LA 5KTTA 1X7WB 4EYEA 3NCHA 4KIWA 3W5JA 1LU9A 1ZU4A 2BV3A 4FMCB 1WV0A 1J06A 3KU1A 1CZRA 2EL7A 1C2YA 4XIFA 1PR3A 3EIHA 1D2HA 1G7TA 5C53B 3JD1A 3BJRA 2CNNA 4EG6A 1L1RA 2GNAA 3A4VA 4QECA 3W2EA 3C8UA 4TWIA 1M6VA 4EVQA 2HJWA 4BNZA 1K7XB 3MFYA 3QBDA 4XWAA 2WUFA 3AVUA 2DQKA 1M5RA 3OQOA 1N1DA 5BNWA 4MV4A 1T2CA 2F7SA 3TW0A 1YR2A 3DLBA 3LPCA 2PEYA 2AJTA 3ECCA 5BUQA 3COYA 4BJ3A 1QF6A 1IUOA 3QE2A 1Y7TA 3GGOA 4UQPA 2ZJ7A 1TDJA 2A3NA 4CKBB 5FFFA 3SHVA 4ERNA 1JNXX 1P9WA 2VDPB 3F5SA 4UDXX 4PSCA 3E27A 1DUIA 2IEAA 2A8YA 2BDUA 5TQJA 1L5SA 3GLFB 3GHYA 4TL6A 1FUIA 1RYNA 1K7FB 1Y42X 3IAS1 2EW8A 4HDKA 4X3PA 5KDDA 3LFTA 1NFQA 3F97A 5IJWA 1NW3A 2XXJA 3HE3A 2CNWA 4EZBA 1T5OA 2OZPA 1X42A 4I55B 1MRNA 1UMKA 2VYND 3A4YA 5ADUS 4KN9S 2QSZA 4NQRA 2VJLA 3LP8A 4PQRA 2HQSA 2XUAA 4HLNA 4M9ZA 4S24A 3ZQUA 5BV2P 2HK9A 4NYJQ 4Y7CA 3MWDA 3N3AC 2Y77A 1HFJA 1MZVA 3PUIA 1GU0A 2IYRA 4YT8A 5FPHA 4AU1A 4DREA 6NULA 5DYTA 3KSBC 1AHIA 3UUWA 3SKYA 1H4TA 3RNLA 4AQDA 2QX7A 3MTDA 4R2JA 1N5DA 4YJ2F 1OT5A 2ZJ1A 2J45A 1HL3A 3DDZX 5EA2A 3AEQA 3UN1A 4F5YA 1U1GA 4TT8A 5H68A 1CUBA 2VDWA 1HY3A 1HNXB 4MICA 5CURA 5KAMA 2NU9B 4KK4A 3KD3A 1MQ8B 1UANA 3L5OA 2IUTA 3IOCA 5HR5A 3S99A 1ACMA 2GRAA 4XQGA 2XCLA 3BTVA 1QRAA 4GIBA 3F6CA 2XNJA 1DINA 2AUTA 2FPRA 1BDMA 2AN5A 2PX4A 3GEMA 3U3KA 5M34A 2DFLA 1R4NB 2H1WA 3R5SA 1TIPA 1BXGA 5KEIA 1A8SA 4FNMA 3OEHD 1J0CA 3EVDA 1OZHA 2CB0A 1F6WA 2Q8QA 5K20A 4IQGA 3PDUA 1ORDA 5CIWA 5FTKA 3WYEA 4BNYA 4J91A 4I6JA 2DFVA 3G5TA 3DDNA 3QQ5A 4V3BA 4TVBA 4RHEA 3CVOA 2D1SA 3P4UA 4XJTA 4QYIB 3ETCA 3VSBA 4R8KA 3DZIA 1A82A 1CUSA 2VJMB 3ZNNA 4HLQB 5K8JB 2ZTVA 2ZSAA 5CVDA 4JGIA 5JWOA 4WPGA 4WBNA 5KX5F 1ISMA 1Y5MA 2EEZA 2JHGA 2WP8J 2ZJAA 5B1DA 3N0RA 1NNLA 4O2RA 1R0RE 1KYQA 2C78A 5L9AA 3Q8KA 5I3CA 3OY7A 2VYCA 4DMHA 1BYUA 1MX9A 3DL4A 3LL7A 1VHDA 2PRZA 3E61A 2V7QD 4KDFA 4QLAA 4AAYA 4AULA 4BN0A 3QI7A 3ESZA 1A2BA 1M5TA 3DZGA 2FUCA 6REQA 1K1EA 2ZR9A 3TLYA 2HREA 3KTAA 4CTKA 2ZG6A 3HXKA 5CBPA 4U7PB 2DT8A 1W5SA 3STHA 3A9WA 2IV3A 3C3JA 3T5DA 1C0PA 2AK2A 3AXSA 1ZHHA 4S12A 3ZNOA 4ZC8A 4DDHA 2P1ZA 3R5HA 3PFIA 3W7BA 3X2EA 3OIGA 3B48A 4G01B 3H7IA 4RDIA 4MMXB 1CR1A 4YHBA 2FR8C 1M6VB 3A26A 2GGSA 3KG2A 5JD3A 4D9JA 5LJIA 1VCMA 5DNCA 2RHLA 3UJPA 2LWIA 5JSFA 3NYQA 1GU1A 2P0EA 1JG1A 1YMUA 1G6Q1 1FTQA 3AIOA 3CZRA 3D6AA 5DSXA 3ZBUA 1Z9BA 1N8KA 4LGCA 1XSEA 1U3UA 3HCOA 3ND5A 2W6QA 3CN9A 1H9BA 3O4IA 1CZHA 3QKIA 1WU8A 4X66B 3R9IA 1GAJA 4JZKA 5FHRA 5FOTA 3KR1A 2J5BA 1EM6A 4MKXA 5ICMA 2OV1A 1BE6A 3LZDA 1OXUA 1SVNA 2QTBA 2V8OA 2F3PA 3L7LA 2XTJA 3QWFA 5HYVA 2PZEA 4YMGA 5KTYA 4ZWNA 1JE0A 3RG2A 1N33B 2V7GA 1Q74A 1V5GA 3FUWA 1Q0TA 1YIAA 4HDKB 3RHSA 3E9EA 5HIKA 5KWSA 3EARA 3Q9LA 5B7QA 4YO8A 4M0DA 1Z7YA 2QD4A 3IHWA 3DCNA 3PYMA 3EH2A 3I0ZA 3QJYA 2GEKA 4HLCA 5DLQC 5AR1A 5JE8A 4Q4JA 5TS2A 2PXHA 4X20A 1ENYA 2AKYA 2OG1A 1F3OA 2PS3A 3AETA 3TEFA 1WL8A 4LRXA 2X1VA 1B3RA 4EG5A 1RYFA 3MWDB 3FWPA 1C8KA 1GPJA 2CYAA 1H1DA 4L5JA 4LF6B 3OLWA 1VG1A 2OMKA 2GEFA 4RCZA 1M2EA 1JV2B 3EVZA 4DANA 5IZCC 1A88A 1XI2A 2LRHA 1ZGCA 5G0SA 4QT4A 3TECE 3LXUX 3IEPA 1IJBA 1PFGA 4DYVA 2IH2A 4DMKA 1SIUA 1JR2A 4IRUB 4XYMA 3AEQB 3UJAA 2EV9A 4OMDA 1LKZA 4J16A 4MUEA 2ODTX 1U1FA 4JR2A 2VDWB 3REGA 2Q3DA 1P0FA 3AR7A 5FUWA 4CU5A 1H23A 2J6BA 3EGXA 3ES9A 4PNPA 3V1LA 2B30A 2EX4A 4U7TB 1ADFA 2FWRA 3CEJA 3LT1A 1YNOA 2LV8A 5JVDA 5KJ1A 2HGZA 4KW7A 5EHQA 3C7CB 3JPWA 2C5LA 2C94A 2HXGA 1H0HA 1BHQ1 4WFQA 2MIIA 1BXGB 2F48A 1AZWA 5FTLA 3UHJA 1WXXA 2WQZA 1QHGA 1ZN7A 2HQOA 4KRFA 5EKUA 3KP1A 4O1IA 4PSKA 1PK8A 3DW3X 1OH5A 4F2GA 1MAVA 1QKJA 2EJCA 4FN5A 5K0TA 3E35A 1VRVA 4H1VA 3QJ5A 3ASZA 5F2EA 4YMVA 5B1EA 3C43A 4V2IA 4JR1A 1Z33A 3IESA 1J99A 3HCWA 4CRWB 2E4UA 2DUMA 1XQVA 4WBNB 2HSWA 2R6HA 1GPH1 3QIVA 4GYWA 5ITVA 2O5VA 1QQ7A 3NBXX 1HE1C 4LY3A 2D3TA 1LVUA 5CMLA 2PL3A 1QLHA 4UARA 5DNAA 1NJGA 4KWIA 3UMGA 3PC3A 2DBRA 3KOMA 4XUDA 4EY6A 1JEOA 1RAHA 5J4HA 1Y6QA 2F3TA 3GN1A 2Y93A 1JFSA 1OREA 1WX1A 2YYZA 1XLUA 2KBFA 1HRDA 4U7HA 4B71A 3TGLA 1QIFA 4OLAA 3WFZA 2C3OA 2ZFUA 1N0WA 3S5UA 6REQB 1XNJA 3BD9A 3ENQA 3KTAB 3GJ3A 4NG5A 4RLFA 2WV7A 1U7ZA 1JXOA 4OB8A 5CBPB 1J90A 1JFVA 4JBNA 1OGYA 2C9CA 3AKDA 2JS7A 4M21A 4O5AA 4PZ9A 4Y6QA 4YYEA 3ZJ5A 3VOSA 4D42A 5JALA 5FRDA 3AUUA 1PP4A 2JFQA 1JIVA 2FGJA 4J1QA 3EMKA 4U9UA 1E20A 2O4CA 5FWYA 1ZVVA 2IGTA 1Q0ZA 1KPHA 1Q1ZA 3MSCA 4QDJA 2ADOA 1NI3A 4LGMA 1K4YA 4C03A 4MUGA 4UBJA 1XRMA 4GZ5A 4C20A 5CYPA 3BGOS 4FE3A 2ZATA 4IHKA 3LBAA 1DEAA 1G0OA 1T5TA 4KJZA 4A0QA 5FNVA 1GPDG 4UU7A 1DG1G 4LOJA 3GPLA 3K1AA 4PC6A 1FJXA 1L6IA 1KMMA 1XQ6A 2CSXA 1PBTA 3W3AA 2GCOA 3K0FA 4I5IA 1FS6A 1YZGA 4I08A 2IVFA 2FI1A 1G3QA 3ESYA 5D84A 2KLHA 1PZGA 4HFRA 1UADA 1MABA 2OD2A 1LPMA 2WYOA 1PSDA 3OM1A 1CDOA 5FFNA 4FWIB 5CVJA 3HR7A 1RM5A 3I2FA 1N2CE 1LC0A 3OPYA 5FBRB 2HSZA 3CFYA 4H6WA 3A06A 3DONA 2AGVA 4NSNA 1WUKS 1YE3A 3U80A 2NVWA 4FFRA 5IP5A 2F59A 2ZSDA 4KLCA 4KPFC 4JLNA 2OA0A 4EPXA 4ZHSA 1D6MA 1VP9A 3MT9A 4JT9A 2QV7A 4K9NA 4Q4JB 1A77A 3G8BA 5J63A 4PFSA 4X20B 1SA0A 4P3YA 3S6JA 3AETB 1T29A 4NBLA 4UXHA 4WI1A 2O2HA 3NETA 2OMEA 2YZNA 3QOFA 2BIFA 4YQEA 5ERGB 1AUOA 1VYHA 3LGXA 3U61B 4B7XA 2OAQ1 3WKDA 5E7JA 5AESA 3IUEA 3PDCA 2XUDA 1WXQA 4OL9A 2YUTA 5EIFA 4B7CA 3IVGA 2WHEA 3G23A 4P3PA 4YQYA 4JXZA 2FRDA 1PX2A 3LT5A 5KS2A 3B1FA 3JAKA 5GVRA 3GFFA 5EUCA 1E2HA 1XDUA 3EGXB 3VDRA 1QTIA 1VLJA 4TMZA 4OOEA 4ND8A 1D3AA 3I9NA 3IOEA 4RY8A 5D7BA 3V1MA 1P2SA 3VUEA 1T3GA 1YS4A 4RE6A 4O4JA 5JVDB 1FFHA 4HN2A 1E3EA 3M70A 4MP6A 5K6AC 4IUYA 2XQGA 3FLMA 2A5YB 3T1VA 2J9RA 3EQ6A 2ZBQA 5GV8A 4WKBA 2ZQZA 2A0UA 5JSYA 4S05A 3JQ9C 4R8RA 4YAKA 2FZLA 4PONA 1F6BA 2Y1XA 3JSXA 4KQEA 3I04A 4OXKA 3ZZMA 1WF3A 2IZOA 1B76A 1ODSA 1SELA 3W4KA 3N86A 4EM6A 1FDTA 3M49A 1CUWA 1XVAA 1I80A 2Y2UA 1VDZA 2Z9CA 2CL7X 3UOWA 3UUFA 3EF1A 3L0CA 3JALA 1RIFA 3P2IA 4LQDA 1TMGE 1D4OA 2OT3B 2XF8A 3QUSA 1LLQA 4KQFA 3WQQA 1NF3A 3RU7A 3BRCA 3JQ8A 5IH7A 4W5QA 4OP2A 4PN7A 2EGHA 3V4FA 5KSYA 2G1KA 4WJKB 2E5FA 5HHTA 4UCFA 1J09A 2MSEB 1U28C 4P36A 1X1DA 1RLTA 4FGJA 2VP9A 1TCVA 4PRYA 4ER7A 4MI6A 1HE3A 5EUMA 1JAZA 6LDHA 3DHEA 1J39A 1M1YE 4NZPA 3ZDXB 4A73A 4HNUA 1JWBB 5HW0A 4CIDA 3ESBA 3L7AA 2HKIA 1GPYA 3FOBA 3HDTA 2JVKA 3HNOA 3IJRA 4MCHA 3FRJA 3IEUA 1ZJZA 3UC9A 3RS3A 4DMGA 4FR0A 4CIVA 4RMHA 2CNOA 4DIDA 1QS0A 1YRBA 5AI9A 3E2PA 4CKEA 4FOOA 5D5PA 4LE0A 3EQ8A 2OXRA 3BORA 4MQ6A 5ILOA 1TO1E 1J23A 3LTNC 1I5EA 5FWYB 1B8VA 3DMPA 4C2AA 5SY4A 1L5ZA 2RHCA 3N05A 2GNPA 4GLJA 3O2QB 4YXWD 5I45A 3F6YA 5JECA 3ABRB 3NIFB 1OHHA 2G70A 3JWGA 5DPMA 3TSZA 4J7XA 1XL0A 2DUWA 4AJNA 1J1IA 1NR7A 4TKZA 3NV9A 3UATA 1C7ZA 2ISCA 4F56A 5FNVB 4QGAA 3K1AB 2Z3VA 3ZWNA 1IOZA 1QIGA 1TI7A 4DCMA 4YCSA 2OKCA 3HEAA 1LCIA 4QU8A 1DB3A 1M5UA 5FHQA 2GCOB 3K0FB 4OIMA 3WAGA 3HWX1 3PQ7A 5IASA 2ONZA 4BBPA 1MNAA 1FSFA 2XA9A 1ULTA 1JAIA 2A33A 2Z2XA 4N49A 5EZSA 1EGQA 4JSYA 1MABB 3KT0A 4AJHA 5LBIA 2WAMA 1A1VA 1YQQA 3GV0A 4CCYA 1P9NA 3OOHA 2JH3A 3R44A 3BXZA 4RZUA 3GJ6A 3OPYB 4REMA 1GDTA 1MVOA 1ZBDA 4NICA 5IJXA 4F1WA 2FG7C 3K8YA 3CX8A 4JJFA 2DB3A 2QRQA 2VSFA 4P4GA 1T9CA 5CJPA 1EZ1A 2ATVA 2QVZX 1CJBA 1VXRA 4D2IA 4E6EA 3SZLA 4YV0A 2H1RA 2YV2A 1SA0B 2XXBA 4G5YA 5AHRA 3U37A 2XWBF 2XGJA 2VHWA 1PVVA 5IUKC 3A1EA 3SFZA 2Q4TA 1GP2A 1LPNA 2OZKA 3DQQA 2H2HA 4BAGA 3PA8A 4UBMA 1L1EA 2AQKA 4DDMA 1XRSB 2G71A 4FHFA 1JDVA 3MIIA 1Z4JA 1J25A 2E4WA 2L0XA 2OPBA 4XDGA 1CG6A 3VSEA 1HA3A 1PJ2A 5DGIA 3G5LA 3BSWA 3LVQE 2NV2B 3JAKB 3NHKA 1JFLA 1V26A 2J7KA 5CU7A 4LTNA 2M98A 4HQ6A 2GD0A 2FPUA 4HD8A 5FWXA 1HT3A 1ZGAA 3IXQA 1YJ5A 4ND8B 2O20A 3UM9A 3GQBA 4IDDA 1KEKA 1WSWA 3OCVA 5EIHA 1EMDA 1FNNA 3M33A 4O4JB 2R7AA 4DV1B 4TRJA 2EYUA 1HDGO 3DKKA 4GX0A 3AV0B 1ODTC 5AVSA 2HT6A 2DERA 1NVDA 2DWOA 1E7YA 3B36A 3D8UA 3R9XA 2DWUA 2CFRA 3LC0A 3A37A 1MLDA 3PE3A 1PSWA 3RIYA 1U7PA 3GJ5A 5K01A 2VHUA 4BNKA 1Y7LA 2GA8A 1J24A 2XYHA 4M1YA 2M6SA 1QONA 1FPQA 3L8EA 3JALB 5FI0B 1G0NA 2F9MA 5K8TA 2J3HA 3PR1A 4EYQA 5K4AA 4UEKA 5CT4A 4D8VA 1SN7A 4IYRA 3JQ8B 4X8OA 4JX9A 2D8MA 4LW8A 1TO2E 3SIXA 1LNQA 1GRRA 1UBTS 1P72A 1VECA 3AYZB 2RHHA 1Z6TA 4Q34A 3T0IA 4Q6BA 2EKLA 3IKMB 4FZJA 1C3LA 1R0CA 2DPHA 2H4JA 3N2KA 2XYVA 2J3DA 1PS0A 4E6PA 1JIQA 2AFRA 2PJZA 2WJ3A 3RFCA 1EG7A 4WLVA 2GZMA 4K1XA 4KZPA 3EMDA 2HMSA 2WFAA 1NBMA 2AJBA 3RLFA 5BPHA 2Q9UA 5K6TA 2HA5A 3EFEA 2PVPA 2OZVA 5I51A 5TVKA 1QS0B 4CKEB 1YO6A 1SU4A 2A84A 1RHRA 1GUAA 1NYQA 1M8PA 5LQNA 4JYZA 2YRXA 3FFBA 1P2TA 3BD6A 3BJIC 1L2TA 4JBIA 2YY5A 4ED9A 2VPPA 3VTAA 5IN4A 1RRMA 2AJ8A 2GLTA 2J48A 1JHZA 1LSJA 5B4UA 2H8GA 2Q6IA 5DEOA 1XMIA 4BWVA 1N2EA 1KF0A 2OBYA 3VDXA 3I5XA 1SC3A 2QW0X 2D62A 3OD5A 4YN3A 2SNIE 5CYGA 3AVOA 3OZ7A 5IYZA 4TS3A 4HC4A 3C4QA 3QY9A 4X41A 5EXTA 1KP3A 2NSLA 1JG7A 3PGMA 2XUFA 1LFDB 1POWA 3ZCXA 1PQ4A 4IRMA 3PKZA 3E3LA 3ZWDA 5FBKA 1F2VA 3MW8A 3OMXA 3Q3EA 3ZWAA 4F12A 3RAEC 1P4GA 3I1FA 5JAZA 3SFTA 3PP8A 3ASYA 4QWMA 1IN7A 4RVSA 3GUUA 4R05A 4KU4A 1UPUA 3UHPA 3WLJA 4YYZA 1M9NA 1QHIA 3PBKA 4G4JA 3A04A 3TW8A 3WBFA 4CCYB 3DV0A 2HYDA 1ZD9A 1XZ8A 2C0CA 2P7IA 2KMLA 3D7SA 4IX1A 1L5KA 1KDOA 2GNOA 5ALIA 3DKPA 1EVZA 4OGKA 4CKCA 3B6KA 5HUJA 1QFXA 1OT3A 3JQGA 2PBLA 1P29A 1R5BA 2ZCJA 2E4XA 4G97A 1E1RA 3WWYA 2GA9A 1JH9A 3ZOKA 2X76A 3N74A 3QYAA 1UXKA 5JQWA 4E5VA 3P2EA 1NDUA 1RR6A 3EA4A 4TMTA 2QT0A 1N32B 1VLHA 2R1ZA 4B6JA 1XZAA 1VCIA 4QU5A 2GD6A 4PY2A 2VSNA 1QFYA 2CB9A 2AS0A 5F12A 2X6QA 1ESEA 1Q0PA 4YACA 4B6QA 1O58A 3AUXA 4KREA 3ROGA 1ZJ6A 2OVBA 1QGZA 2PDAA 3ACDA 3IQIX 5A0FA 1JEAA 1IHPA 2Q3HA 1EDOA 3I37X 1UL1X 4JA0A 4NHOA 4FCTA 3V9PA 1VJ0A 1UFOA 4WXHA 2YWGA 1JG2A 3PC6A 2HSDA 2BDTA 3Q85A 1Z7EA 1C7QA 1YWGO 1JTEA 5FWXB 2W2LD 3BXEA 4QVIA 1VDMA 2B4AA 2VKQA 2R3SA 3GQBB 4IJ5A 3WGLA 5MF6A 2EP7A 4ZI5A 4KI0A 1ZUNA 1FPMA 3MXTA 4EKYA 5GZ3A 2F43A 3ZG6A 1PTJA 1KS9A 5CA1A 4OLBA 4EFNA 2CDRA 2PIDA 1R9NA 3DDUA 2YDYA 3ADCA 3QEOA 2GK4A 4EMBA 3KB1A 1MJNA 3PXCX 4FSHA 2WTAA 3R9XB 4CIBA 3K9WA 3BFJA 2ODNA 2G76A 1HLDA 2E85A 3QUBA 1ADBA 3HKCA 5IVKA 1F8GA 2N42A 3KWFA 3E82A 5KC8A 3ZDCA 4AN1A 3KHTA 4WCVA 1RPNA 3ZHVA 4QSMA 4YRSA 3DVRX 3Q3JB 1G55A 2DUJA 2H52A 1QO0A 3CLRD 2HGSA 8ATCA 3JD0A 2OFXA 5BXYA 1MJGA 1NYRA 2C8LA 3THWA 4A3SA 4KACA 3GJ0A 4RK6A 1Z75A 2QG4A 2BYTA 4GSLA 3DE6X 4G8CA 3D5TA 3GNLA 4HGNA 4IW3B 4X6YA 5J1TB 3AUYA 5ULLA 3RU3A 3WL5A 4NENA 3TSOA 3GNSA 3N2KB 3OAAD 2PVCA 2HV9A 1Z4IA 4HRAA 1U0EA 1N6KA 1IAVA 1XCLA 3V4PB 5K3DA 3I6QA 2CHVA 5DB4A 3PTZA 1V7PC 2AFIE 5JSZA 3QVOA 4BVGA 2CXUA 1U7WA 121PA 4F3NA 1ZH2A 2UZAA 4MB2A 4U7DA 1RRVA 3JWPA 3B2EA 4LWQA 1E8DA 4R7TA 1TFRA 4BWGA 5JATA 2MSLA 2ORIA 2P4SA 4LUCA 2PE5A 1DPFA 5EXSA 1UXHA 4FKZA 2NNWB 3OO1A 4PPNA 4L3WA 1IHXA 2Q1SA 5IYZB 3LCMA 4G37A 2HA2A 4Y2XA 4MWEA 4AJJA 3UMYA 2CHQA 4N3BA 2PMEA 4M37A 5KSWB 3NAMA 1N0HA 4RF4A 3RWBA 2IBTA 4ASUD 4K81B 3KOXA 4NBKA 5EHZA 3SYNA 1W2WB 2FPMA 3IYLW 1QANA 3QA9A 5B4VA 3NV7A 3VV3A 3C4VA 4BZZA 3A0RB 2Z98A 4LHSA 5DMHA 1JSRA 1W34A 2QZSA 3LNCA 5YASA 4EHDA 1NXPA 2RGNC 1AXGA 2JGLA 3TW8B 3RRZA 1DQZA 2WJJA 4OBEA 3DV0B 2G67A 4L74A 4LHVA 4TMKA 5L3RA 2X9NA 3VR3A 4ETMA 2F3RA 2VRBA 3KOUA 4CKCB 2FSVA 3OHSX 5EWLA 3ZE9A 3WLNA 3JQGB 5INTA 2L17A 3PPXA 5ALVA 2IKQA 2ZUBA 4PLHA 3JQBA 4HT3B 2Q5EA 2VP4A 2Z56A 3E5HA 3GLGE 3V55A 3ZJYA 2F8TA 4FEAA 4YUWA 2C5SA 5ITWA 2FEKA 3WYCA 3F4BA 4PCAA 2Z95A 1IEWA 4B46A 3HMKA 5MHTA 3CNEA 2WC1A 4XEHA 4BV9A 5LZ2A 3EZLA 4WZBE 1DKMA 2QY9A 4QOGA 1PJBA 1ZUD1 2I6SA 3FHTA 1GUFA 1G5TA 4UMFA 4PWZA 1IXRC 3SSOA 5JYDA 2XMZA 1FXSA 3A9TA 5K4HA 1Y8CA 2ZB2A 1SZJG 3RIGA 1L5HA 4D26A 1E99A 3KYCA 1KAMA 2V6FA 4ZCMA 3K9HA 2NSDA 3U4AA 4Q3DA 1M0EA 4GWLA 2K2QB 3T5PA 2MOKA 3HBAA 4BTEA 2JHFA 2XYPA 3KYJB 4U1RA 1TOAA 1ZUNB 3DMGA 1I7NA 2F43B 1T9KA 5CA1B 1Y1PA 4RVFA 1X74A 2OM6A 1P74A 1V11A 5KBYA 2TECE 1KETA 1TPZA 3K9CA 4XW2A 3VKUA 4UVEA 1S2IA 2IYPA 4KAAA 3VH4A 4I1RA 1SVIA 1ZW1A 3HKCB 3KJEA 1G20E 1TMOA 2XDQA 4LYAA 4MZXA 2VF5X 4U9IS 2OPHA 3MMPA 4EABA 5LQJA 2F8MA 2NU6A 3BXFA 5AW6A 3PFFA 1TQ6A 5HF6A 3EOAI 3S44A 3FCAA 4FCVA 4Y7DA 1VI6A 3OZFA 3DT8A 2IUYA 3FH0A 5L6LB 4C4AA 3GN2A 3F2IA 3L92A 1ZL0A 4KGXA 3QIAA 1P3JA 4GBGA 1OFTA 5FQOA 3RF6A 3IFSA 4ZO4A 4DNFA 1ESDA 4NENB 3I83A 3H04A 3SGLA 3TRKA 2VYFA 3AI3A 3AIIA 3T7AA 3ZEIA 4DR6B 2PTHA 2WWIA 2OB2A 3HSYA 3LH5A 3KXIA 3NQ41 2ZRPA 4JCOA 4XUEA 4XB2A 2AYXA 1A72A 2YJZA 5JROA 1L7XA 3NBZC 1BEZA 2C9OA 5JSZB 1U0TA 4YPVA 4FFDA 2I6XA 3ESXA 1JFFA 2A9KA 1RC0A 1AJEA 3GCZA 4WGGA 3WK5A 2P1RA 5MN4A 4Q1DA 4H7PA 3RIHA 4U2BA 1A4UA 2PMCA 3UAGA 4KMSA 3DE4X 3Q7TA 1ACLA 2HLPA 3H5WA 1I3KA 2WHRA 1TADA 2JIZD 4OXIA 4S1WA 5KOHA 3U7GA 2YWBA 3B1XA 1K2VN 3FCUB 3G1UA 1CY4A 3ODPA 3AI7A 4D8TA 3LF1A 3D2BA 1GG2A 2YQ4A 4LGVA 1KY2A 5AK6A 1XKTA 1OIXA 1MC5A 2VO1A 2HA3A 1XO1A 4FWTA 4NF2A 3UXYA 3HVRA 3V48A 2D1FA 2C4HA 3HJTA 3R40A 4QM6A 1E3IA 2KX7A 2J0EA 4DIOA 2FHSA 4XPZA 1KZGB 4EH1A 4G3XA 4G5QA 4ZQBA 1XEFA 2B8NA 2QGFA 3VSCA 2Q49A 1I8TA 4FFOA 4KAFA 4MUHA 4BO6A 4ARIA 1F3LA 5HK9A 3OTQA 1GSOA 4Z0NA 1MAHA 1J8DA 1Q16A 3PCXA 4R2WA 5EWLB 2L42A 2B4QA 1OLSA 1C9NA 1V6CA 2QMUA 4IH4A 1KNXA 5BSMA 1GAQA 3R3VA 5CNJA 4Y3UA 2OGSA 3TOVA 4NTZA 3WHIA 3X0DA 3TDNA 3MMZA 3CZ9A 1Y7PA 3AOEA 1RP7A 1HEUA 3DEFA 3LHIA 3CB2A 4BQPA 3VA7A 4FUQA 4CL3A 3NIDB 3K3PA 4UBKA 1B93A 3WLAA 3KZVA 3P0HA 2H63A 4W5TA 3J81k 2RDMA 2AIRA 2WUDA 3PFGA 2H3EA 4R5HA 1FUEA 3ZC3A 1GA6A 5FX2A 2AEFA 5E6SA 1UBCA 4RELA 2JI6A 1WVGA 1VSUA 2J3LA 4UE2A 3WZ2A 3WIEA 1J8FA 4M8LA 1X1EA 4GVPA 3W2HA 3V1NA 1L5HB 1SXPA 1V4BA 3KYCB 4Q03A 3LVBA 3PT5A 4Z2YA 3A28A 1KRWA 1BRTA 1KEUA 2DYKA 1ZA1A 4OATA 3I28A 1GLNA 1SK8A 1O8BA 3DZCA 5CBKA 5FUYA 2CBXA 4DLZA 5BOSA 3BZWA 3GUZA 4LZNA 4X8HA 5LQDA 4JL6A 1F51E 3NG1A 3ZHZA 1KMHA 3ZDDA 4DMCA 2BMEA 2C1ZA 1AQLA 2EQBA 2NVOA 4X1IA 4C0AC 2OGUA 4EPVA 1V11B 2QUZA 5IUJC 4C0LA 1SURA 4R0VA 4E2WA 5T4EA 2GCEA 3LYHA 4I3FA 3IB3A 5TE9A 2BSXA 1W35A 4ER5A 2XDQB 5LQUA 1H93A 1XF1A 1A8PA 1PYDA 3E23A 2B9VA 5A06A 2PD6A 2NU6B 4JB8A 4DA7A 5GAJA 4FE4A 1QG6A 2AB0A 2C88A 2DWPA 4DEVA 2H2GA 1H6DA 3Q0IA 2W6PA 3WLTA 1C7FA 1OBHA 4A8TA 4I6EA 5KVVA 2HSEA 4U2KA 2Y6VA 4XLLA 3AIKA 1YI1A 3D7KA 4FVTA 5C8ZA 4MRSA 2HQBA 1P4JA 3FCSB 1UKCA 1J20A 1XXHA 4IIDA 4KZKA 3WBJA 1PNTA 1W4BA 3K72B 1A5ZA 5DHQA 4AMBA 3U39A 5KSOA 4IAOA 4LVCA 4R51A 4MX8A 1MV5A 1E3DA 4QOEA 4Y1RA 5CVTA 1A9SA 5J59A 4R3NA 2XGOA 1E5DA 3GGPA 1RJEA 3TG8A 1EGHA 3GWZA 3GDOA 1DDGA 3K32A 4UFNA 1JFFB 4HI0E 2WHQA 1TCBA 1KO5A 3QBVA 5CX4A 1YH3A 3KQWA 4EKIA 2XSZD 3CH7A 1CT9A 3R3ZA 2QRKA 2IV7A 2BTOA 1HTTA 2VQ6A 4N8SA 4B2YA 4BECA 1G2OA 5KVSA 2WT9A 1Z26A 4WY2A 1HQKA 5HILA 1G8HA 3R5XA 5IHPA 2A4MA 1EGMB 1NX9A 1ZYUA 5KOHB 1E58A 2WB4A 1JMYA 1RBQA 1VKOA 1CZOA 1EUDA 2B2XA 3OTWA 1C1HA 2PMDA 1N5IA 3D8RA 1QZTA 4KITB 4KN6A 2VHTA 2Q62A 2YC4C 1TZJA 2O5CA 4BLSA 1DHTA 4FHDA 2FUNB 4DCNA 1RKQA 3TNYA 3K6SA 1XZPA 4L5AA 1JFRA 2PA3A 4S3MA 1GG8A 1CB7A 2WYHA 3AMVA 4F3KA 5ICFA 2O14A 5BN5A 1LDEA 4RV5A 5FI1B 1GNQA 4FDAA 1E7SA 1OLSB 3UUEA 5IVPA 2R00C 3L4JA 3UBTA 3LX4A 2BT4A 2F4VB 3OPNA 4MA5A 1VHLA 2P2CA 2VAMA 5AW1A 1EVQA 2WOOA 2YUIA 1G8GA 2E1RA 2FPLA 1IK4A 1IWOA 2C00A 1CTQA 2DY1A 2IXFA 5C80A 3RKUA 3IPCA 3GVHA 5FUXA 2QYHA 2W6CX 1N78A 1CHDA 1AQ6A 2C3MA 4FKBA 4L75A 3BA1A 4LRWA 5ED4A 5BUCA 3WKCA 4EDFA 1G9XA 2IS6A 3KEFA 4G25A 4FHEA 1ONPA 3TKLA 3I6BA 4AUKA 1CRZA 5E6SB 2NYUA 2JKVA 2LR0A 4B3DA 1DKUA 4GH5A 4BGIA 1L4MA 1D2MA 1Y48E 3R4CA 1GFIA 3KKKA 2WUWE 1YR1A 4RPHA 1GXSA 3G89A 1RP1A 1PCXA 3Q2IA 4QJ5A 1YUBA 3K0HA 3D4NA 1Q17A 2R44A 3G13A 4JELA 3M8KA 1XZJA 4MXDA 5DI3A 1JTVA 1VJ1A 1Y6ZA 1RVDA 1U8EA 2IYOA 3MJFA 2AA3A 1OIWA 4CNQA 5BOSB 4OYYA 3T9CA 1MHPA 1Q5PA 4HX9A 1KMHB 2GD1O 2XWQA 2GSWA 4X1IB 4ZXPA 4P22A 3R7WA 4BS9A 1XPUA 2IPNA 3B1KA 3K1ZA 4ZVNA 1UP7A 3JYLA 3K09A 4I50A 3T5TA 3JR7A 4JLMA 2DPLA 3F7NA 3GX1A 2Z1MA 3CV3A 4RPJA 3IAAA 2HHLA 2FX3A 3I64A 4BV3A 3MHTA 4C21A 2GLXA 1C5KA 2H5JA 3D3JA 1ZIOA 4QBFA 3BIFA 3L7MA 1RI4A 1CIJA 4PQEA 3NX4A 4Q24A 2C5HA 2QPOA 4JUDX 3IA2A 3ROTA 4JROA 1F9AA 3L40A 4RABA 1JEYB 1UPXA 3AJAA 3KKNA 3IUSA 1SRRA 3MUEA 3NHFA 4O2AA 4OGLA 1TKAA 1NUQA 3PXGA 4FB5A 4A15A 3QBTA 1ZINA 3ROZA 4M7RA 1J5PA 1C3VA 1QQ5A 1YASA 2NYRA 3GELA 3NOVA 4RH1A 4KFSA 4XR9A 1R4AA 2WPNA 4FW9A 4QFDA 3ZV5A 4Q4CA 4WKOA 1XXHB 1J2JA 1JILA 2JIQA 1NVTA 5DM60 2OQ2A 4QRHA 1YJQA 2P9TA 3FTCA 4GT1A 1UDCA 2C7VA 5BPFA 1WZ2A 4J16C 2P9FA 4F4HA 5LXTA 2AJDA 3LXMA 3WL7A 3OWXA 4N39A 3ZDAA 5BV8A 3QEAZ 1E4OA 1VE7A 4OGGA 4Y1RB 3KXKA 3M6MD 4BDSA 3ANMA 1U0FA 1UDWA 3ME5A 2W71A 3DPUA 4PYKA 4RSHA 3KIPA 3MHPA 5TXGA 1ZW6A 2DSTA 2GJAA 4K9LA 3HY4A 1GITA 3HDYA 1YC2A 4RX1A 1CEEA 1I1QB 3KOYA 1JIUA 1N0UA 4IZHA 1W87A 4PBTA 3S2EA 4DDUA 2GARA 2NTJA 4U9HS 1VPEA 1HORA 2C7GA 4IJUA 4EATA 4LK3A 5KTOA 4RO0A 1DJMA 2VHZA 4MI9A 1WXWA 1GQSA 1CC1S 5CH5A 5DP2A 3ANNA 2PBZA 4MIYA 4D8WA 2AN4A 1EUDB 1S9HA 4ENWA 5GONA 4DA6A 4FIZA 2VHJA 3PF9A 4MYUA 4YRRA 5ICGA 4HDOB 3DLIA 3NB0A 5LYYA 3ZEAA 3TG2A 1H1TA 4Q15A 5D3ZA 3N0WA 4M38A 3D7LA 4NPCA 2UUAB 1BXKA 3DVAA 1NN1A 3K6SB 3LUHA 4CQJA 1X87A 4HS4A 3BXOA 1SULA 3D54D 2QN8A 2DHEA 5BN5B 1EUQA 5CDFA 2V7BA 3D9QX 3HA5A 1OUMA 1S8AA 3K0KA 4JC0A 1LQUA 2UYOA 2PUVA 1O94C 2Q3CA 3KALA 1IDN1 2F64A 5G4KA 5AQEA 4P3XA 3EVNA 3ZV7A 5DNYB 3ZY5A 1HRKA 1OH7A 3SPXA 5CVUA 1ULBA 1FRNA 1DFGA 1XZKA 2R1VA 3DZDA 4LTMA 2Q0SA 2ZSBA 3EEYA 1MAWA 3EIUA 3QF7A 5HFAA 2H9IA 2ZBVA 3I4FA 5BT9A 1USKA 2AEMA 1MORA 2KBEA 2ZYSA 3LDGA 3E7XA 3TQQA 2PXAA 3U4CA 2JJ1D 3CNHA 1MEJA 1XU7A 1YDHA 3ICPA 1VJRA 2IQ5A 3ROXA 2HRBA 5EAIA 3IBGA 3C3AA 4IDHA 1DG3A 2M1XA 3BSYA 1OXXK 3GPBA 1GXSB 3NANA 1L5LA 3WJAA 3CVUA 4CEJB 2JANA 4KQWA 4I1YA 1M1UA 1HR0B 5TPZD 4DLWA 5DI3B 2APJA 1HETA 2FDCA 3E58A 1VKJA 1LPOA 1F38A 2DX7A 2BMVA 3ZWYA 3R7WB 3DWIA 3QHQA 3BM5A 3U4DA 3O9VA 5CIQA 1PZNA 2X0DA 3TLMA 4DSTA 4Q9DA 2YKGA 3MNFA 4I50B 3DHVA 4Q1CA 4EKDA 1TJ3A 1FB5A 3BWMA 2X40A 3ENNA 4I5FA 4XX0A 4OEHA 1DXHA 3BTOA 3W79A 2QTAA 1EFRA 4JVSB 3WK4A 3ZHYA 3K1TA 4QKQA 3MJ4A 1SHTX 1DJPA 2G25A 2WHYA 1K4KA 3MS7A 4DIEA 4DLNA 2JIMA 2ZUUA 5I7UA 4JLBA 3Q87B 4CBVA 2O8FA 1Y3IA 3CEHA 3R5TA 1AOXA 1II9A 1SCAA 4QGSA 2AV6A 2BP7A 4O2AB 4KODA 2JGMA 2IW1A 5K2OA 1G17A 1U6IA 2FN3A 2O23A 5BSGA 3BXPA 3LQYA 4I8XA 4YGXB 3KSMA 3ONVA 1JPNA 5JY6A 4M53A 1ZOSA 4J7UA 2ENUA 4KSCA 5E1OA 5TF0A 3ZV6A 5GOTA 2FMKA 3GRPA 3FZGA 2J0UA 3P0JA 3BD8A 3TAXA 1PNVA 3UFBA 1G4AE 1YKGA 4NABA 3U9TA 5LXTB 3DO5A 5ETJA 2Q9CA 1MQSA 2ZI9A 1A7JA 3E9NA 4W63A 4BC0A 4MDEA 1ZK4A 4BFZA 5CEJA 3KXPA 4TRMA 3LLSA 5TPWA 2OO3A 3ZK7A 2RHMA 3EIEA 1QYIA 5JJCA 1GGKA 1L4NA 1C80A 1NSYA 5F5XA 1JR3A 5EXEA 4EL5A 1SOWA 3PUHA 4LYHA 5G0UA 2CMGA 2OZLA 2H7VA 2CCKA 3NHWA 2VHEA 3BMCA 3W5DA 1DRKA 4GBMA 4G36A 2BH2A 2UXBB 3RK0A 2ID4A 1PQWA 3DOFA 3O4RA 5LA6F 4AXBA 4YDQA 3HSKA 3L43A 3NOXA 2FSPA 1FL9A 3FYDA 1G6OA 1L4EA 1HDCA 3QKTA 1JR4A 3L0IB 3VZBA 1U2RA 3IMCA 4DJAA 3DM5A 4RFLA 1MJGM 1ZS9A 5I9TA 5KWIA 3DLHA 2WINI 2NXJA 5GONB 1Q77A 1GR0A 2QP4A 2VHCA 2O7NA 3F4LA 1KDZA 3SYLA 1M2OA 4TXLA 3JQ7A 2CXHA 2JFBA 5AH0A 3WLKX 4EY8A 2X19A 2FV8A 1U31A 2B98A 2XECA 3D02A 5LD2B 2PWAA 5IM4F 3DVAB 1DC7A 1L5RA 3L04A 4HSEA 4EB8A 1YRAA 1G3MA 3WL8A 3AR5A 4GKJB 1P1HA 3Q7QA 2ZSIA 3HJFA 2JIRA 4PAWA 4DCUA 2P41A 5DDIP 1B26A 3OVMA 5CJJA 4C4OA 2Y1OA 2R62A 4TM8A 1EI9A 5GZ6A 3AL3A 4MWTA 4BZPA 3KR2A 821PA 1ELOA 5LLDA 3BEDA 4JQYA 4UCWA 4WIAA 5G4KB 1Q6ZA 5CR9A 3DMYA 1D9XA 3IPRA 3VKVA 3EZYA 4TRRA 3I92A 4ZARA 2FZCA 1TTHA 3LUAA 5HJ5A 2R1VB 4WT7A 2EARA 1U80A 2VRCA 3IR5A 3OOJA 3ZKWA 2GT1A 2FLWA 2XE4A 2V59A 3DE3X 3WV4A 5HDQA 3GLHA 2QJOA 4URWR 1AXRA 1CJKC 1V6AA 2ZBGA 4J1TC 5F3WB 3IHKA 4LHXA 2D7CA 3OJCA 4G1UC 3O75A 1V8OA 3UJNA 3AQ4A 5AM0A 2CF6A 2DTDA 1Q1BA 2G77B 3ECSA 3MWEA 5TX7A 1L8QA 3TH5A 3W3AH 3OIVA 1BMFD 1KY4A 3AF1A 4KIFA 3S2GA 2E7ZA 3ENZA 3UGTA 3ZDEA 4BATA 1VKZA 1Z5OA 1C9EA 4BFVA 4KFRA 4ESOA 1Z4OA 4Q93A 2FWJA 2QTRA 1L7QA 4WOBA 4YRPA 5LYJA 2P9HA 2MYUA 3GJTA 3EULA 3PQEA 2OAEA 4FDUA 5C18A 2R7KA 1EP3B 2DLNA 4HRXA 4XX0B 4OGWA 3U0VA 3VC7A 4D3SA 3M5PA 2K87A 5AM3A 3I6YA 2YYYA 3GNQA 3SX0A 3FOFC 4OQ4A 4X7RA 4DCPA 3GEEA 1LC3A 1YL5A 2I33A 3P0IA 3UGQA 2EOAA 2VDOB 1XCJA 1GO2A 1K7YA 2RSLA 4IMJB 2O8FB 3FMPB 2Y1DA 2FZVA 4RZ3A 3ED1A 4AF6A 2O8DA 4UCQA 2GCGA 1Z3IX 1DCMA 1W0KD 2BP7B 3S2UA 4CNBA 1MZPA 3RCBA 4UHEA 1JX6A 3V8PA 4BJ1A 5LOVA 2IZ5A 2JFUA 1KI2A 1LPPA 3OM0A 3R3UA 1C7EA 2HRZA 1EWTA 4HJXA 3CF6R 4Y1EA 3U1VA 5D3KA 3VU8A 2OY0A 2IYLD 1SCKA 2JDIA 2X0JA 2YJTD 1WCV1 4L95C 5EE1A 3USZA 5CH3A 1RHQA 3WADA 1OFIA 3W3AD 2NT4A 3LDAA 2IF0A 3AW9A 5FPTA 4ES6A 2ZRJA 2J0UB 2M6LA 1Y3CE 2FWMX 4PO8A 3TIFA 2P2LA 1RTTA 4R1MA 1AMUA 4ZT7A 3SHOA 5HTOA 3M5WA 3KVVA 1QP8A 3QITA 5TPWB 1Q7RA 2D06A 3F1KA 3PCTA 1QFJA 4AG5A 1MW9X 1HDYA 5MFZA 1R12A 5I4CA 5CLFA 3UQZA 4OUKX 1DIOB 2JGJA 3VQTA 2OZLB 1YVRA 3BMCB 3V80A 1ZD3A 1THZA 1XQ9A 2JHAA 2VDLB 1QKKA 3EA0A 3GZTB 1FZQA 1GDHA 3O31A 4H60A 3V7YA 3WJ7A 3KQSA 3PRYA 2F1OA 3ML1A 5EQFA 1DKQA 1DO0A 3TVTA 1W36B 2C57A 2CUKA 3GRVA 5J23A 1QOQB 5AOCA 4KQ1A 1Z0ZA 2QN7A 3JV7A 4XCXA 2P1DA 3A2LA 3X43A 1ODCA 4UNSA 4ENUA 3EUAA 3WDKA 1K3UB 2DHCA 1M2OB 4IV8A 3AEZA 4YASA 3SEZA 3JQ7B 2PMWB 3PS9A 2BGUA 4Y0NA 1Z56C 2HK7A 1X1RA 4JI8B 4FYMA 3G2KA 9GPBA 3VC2A 4ZO9A 4J1NA 1O6CA 1Q3KA 2IS2A 2DQSA 2ZAYA 3IT1A 1YC5A 3M6XA 4FNGA 4MDHA 2OWEA 4UHHA 5GM2A 1AKQA 1LPAB 3OURA 3PFHA 3RTGA 3T3MB 1R5OA 4R0MA 5M7EA 3IKLA 1JGTA 1T5LA 2WVJA 1Z6PA 3GH1A 4Q16A 3D6TB 4FLMA 5EFZA 2H3HA 4Q7EA 3HCAA 1B8OA 1Z74A 5BQFA 3G0HA 4OFWA 3VR4H 3CEAA 4YDSA 2W48A 4BGVA 1YJCA 3QLUA 4ODIA 4I3GA 1NQOA 3UT5A 1NZDA 1O1YA 2X0IA 2FUEA 2NXCA 3NRBA 3OKFA 2Y3IA 4ONEA 4ZV9A 2OLJA 4L8VA 4MPJA 4S1OA 4WXYB 5DOZA 4RPCA 3RREA 1W1WA 3NOQA 3DQZA 4JT4A 5KHAA 5HBGA 3QEBZ 3L6DA 3ZKWB 4D3DA 3OKAA 5J47A 4R40A 3T3DA 5LZ5A 3GLHB 5A9SA 4ZOBA 4NRDA 1U7DA 2OHVA 2FEAA 4NOJA 3A3PA 4WD3A 1GIAA 3WWOA 2FN7A 1DJOA 3I9V6 3R09A 1D2CA 2P9GA 1QHYA 3MWEB 3U17A 4F8EA 4ZYTA 5C46F 5J43A 2IBSA 4TL8A 1GPBA 4A92A 1LNZA 2D2VA 5L3SA 1NQXA 1NV8A 2PCLA 1U9CA 3GBPA 3PX2A 4QVKA 2WUVA 2VNSA 1OAKA 2CDBA 1UJMA 3I76A 3KKOA 4RJIA 3FVVA 2Y71A 3EDYA 2CNDA 2RGUA 3MCWA 5JPCA 5LYJB 1H2YA 1Q7EA 3HFJA 3IVMA 1Z15A 4LRUA 4NYMR 1I0IA 2OQVA 1FJGB 1Z47A 2OD7A 4K9OA 1PG0A 1T3ZA 4BQOA 3VR4D 4ZC1A 1E2BA 4TLDA 3LT2A 1QIJA 1UC5B 2VDRB 3V32A 3PE4A 2C4NA 3ST7A 4I6GA 3NHAA 3OX2A 5CM2Z 1Z82A 1ZP6A 1WW3A 2NOAA 3ONDA 4LISA 3ZE8A 3G0DA 2O8DB 1JQKA 3KWLA 4JEHA 4JSRA 4OHOA 2OOKA 1RSZA 4INOA 5COAA 4FXOA 5AXBA 3TZBA 1I1HA 3AF2A 4K0RA 1N1MA 3VBEA 5LOVB 1SVMA 1ZHFA 2VT3A 1N3LA 3T38A 1N0VC 4YAGA 5KAPA 4JV5B 5ERXA 1KEVA 4BTVA 4YV1A 1PAUA 3DJYA 4CCWA 2DG2A 3A70A 2NTYC 4G1FA 3CVYA 2PKRA 5EMMA 2YJ4A 3SVZA 2Q4EA 1MFZA 1B0PA 2QRHA 4MO9A 3UT6A 3KJFA 3STXA 1Z17A 2ORED 3ORYA 1RT9A 2X23A 4AZ3A 4TKUA 2NZ8A 3DVQX 3IUPA 1P5HA 3KQVA 5GJCA 8ABPA 2ATCA 3R20A 3RS4A 5TARA 3FPSA 5IXSA 3F0TA 2B25A 2I0FA 2JJ2A 2XX3A 3HSSA 5EERA 1U1EA 3X1JA 4PQYA 1PTJC 3VZQA 2QMQA 1M33A 1TU3A 2DT5A 3PNYA 1M1NA 4YLEA 2YMLA 1DCFA 3HJNA 4UTNA 1GN9A 2EC5A 3X2SA 1IHYA 5KNDD 5LDHA 5AOBA 3U1BA 3V4SA 3O4VA 4P7FA 4DADA 1XR3A 1KL7A 1PX0A 2YIVX 2HUNA 4ZYLA 1SCIA 1D5WA 1AX9A 3OEEA 4O33A 5JD6A 3RV3A 3SYMA 2P30A 2GAOA 2IWHA 4F92B 3PHHA 4RHFA 3JYNA 3A14A 3L6OO 2QTLA 1R8JA 1XAJA 5DISB 5KYKA 3QENA 4HCJA 2AOTA 2OHXA 5JDIA 4J3JA 4IPTA 1I9CA 2PBRA 4BFTA 2RC6A 1L4GA 4GMFA 3U62A 2W2VA 1KYTA 3F4KA 2SECE 3TQRA 3FETA 4K6FA 3VPSA 3AR9A 2WMYA 1ZJ5A 2ZP1A 3NNNA 1RD4A 1Z0DA 4ZCPA 2WABA 3R7BA 3VHXA 2D2FA 3C8DA 3ZQ6A 4DARA 1AMOA 4CM9D 4Y2YA 3SR0A 1AO0A 4KRYA 3KXDA 2C3YA 2YV4A 3MWYW 3O8NA 4MULA 2G72A 1Y8AA 1KVRA 3UT5B 5J40A 1E79A 4A0RA 3SLRA 5FA5A 2RIPA 4IYJA 4IZIA 3TVYA 5DFAA 3LZ6A 1W25A 3S3TA 2ID9A 3HL0A 3A1TA 1D04A 3BCRA 4EPTA 2QZJA 1WW8A 2CLDX 2VT7A 3LHFA 4LPSA 3U3OA 3ABSB 5A9SB 4KFCA 2FSUA 2GMWA 2R1TA 3R9KA 3QEKA 1GQYA 1H69A 4UM9D 1T9GR 4MWGA 2QDXA 3ORQA 3LWBA 4HS9A 1VIDA 3AUSA 3M9WA 1H8EA 4QDOA 1KZ1A 1G3RA 1UDRA 3DULA 3T7KA 3PEFA 5L3SB 2CKMA 5K7SA 1KDPA 1PD1A 1WB6A 3PJFA 4Q6WA 2RHTA 3L5KA 4DDWA 1PUXA 4O0MA 3MPOA 3T5MA 2RK4A 2FWAA 3ENKA 3ESQA 4MMZB 3MGBA 4JS0A 5IK2A 3WG9A 1KZ4A 3DJFA 2CMFA 3CCCA 4KNWA 1XU4A 2CLFB 1LWNA 5G3ZA 4QYWA 1J21A 3E3OA 4MW0A 4IOKA 1MRZA 1H6BA 2DMRA 1EUCA 1IN4A 1WVMA 5AHXA 3VC1A 3I73A 1XVTA 4BEVA 4IL5A 5CB6A 3MBOA 2X1HA 3AVTA 2RKWA 3LLVA 2NU8A 1Z39A 2M6RA 2OXCA 2YCLA 5AI6A 2FSVC 2B1JA 3UCXA 2B83A 2YL2A 2UYCA 4RL6A 1I94B 4Q1AA 2R8XA 1M6WA 4MUJA 4F06A 3C97A 3M6VA 1VA4A 4JLVA 1ISJA 4RCYA 1V5WA 1N6HA 5A4KA 2QVCA 3WOVA 2FSFA 2IY7A 3BZBA