1LD3A

Crystal structure of b. subilis ferrochelatase with zn(2+) bound at the active site.
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
309
structure length
309
Chain Sequence
SRKKMGLLVMAYGTPYKEEDIERYYTHIRRGRKPEPEMLQDLKDRYEAIGGISPLAQITEQQAHNLEQHLNEIQDEITFKAYIGLKHIEPFIEDAVAEMHKDGITEAVSIVLAPHFSTFSVQSYNKRAKEEAEKLGGLTITSVESWYDEPKFVTYWVDRVKETYASMPEDERENAMLIVSAHSLPEKIKEFGDPYPDQLHESAKLIAEGAGVSEYAVGWQSEGNTPDPWLGPDVQDLTRDLFEQKGYQAFVYVPVGFVADHLEVLYDNDYECKVVTDDIGASYYRPEMPNAKPEFIDALATVVLKKLGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Metal binding to Bacillus subtilis ferrochelatase and interaction between metal sites
pubmed rcsb
source organism Bacillus subtilis
molecule tags Lyase
molecule keywords Ferrochelatase
total genus 117
structure length 309
sequence length 309
ec nomenclature ec 4.99.1.1: Protoporphyrin ferrochelatase.
pdb deposition date 2002-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00762 Ferrochelatase Ferrochelatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ld3A01
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ld3A02
3HCPA 4CCSA 2QD5A 3HCRA 4KLAA 3HCNA 2DJ5A 3HCOA 2Q2OA 2HK6A 2AC2A 2C8JA 2XWQA 4MK4A 4KLRA 2Q3JA 3W1WA 2JH3A 2XWPA 3LYHA 2QD4A 2PNJA 2XVYA 2PO5A 2QD3A 1N0IA 1TJNA 2AC4A 4KMMA 4F4DA 2HRCA 1AK1A 1L8XA 1C9EA 1C1HA 2PO7A 3AQIA 2QD1A 2H1WA 1DOZA 2QD2A 2XVXA 1HRKA 1LBQA 3GOQA 2HREA 2XVZA 4KLCA 2XWSA 1LD3A 2H1VA 1QGOA 2Q2NA 3M4ZA
chains in the Genus database with same CATH superfamily
2VP9A 3HSKA 2XXAA 2A1UB 1L1RA 4XPIA 1HX7A 3D8SA 4P0PB 2IPOA 5DBFA 3IKVA 1G18A 4MV8A 2CXHA 3G8BA 3GJ7A 3ORFA 4OIFA 3W77A 5AW0A 4KYUA 2VWPA 1GPJA 1WPXA 1L9KA 2Y8EA 3VR5A 5EE0A 2XT6A 3QTBA 4RXUA 3ZWBA 1B76A 1ID8A 2P67A 2JFQA 3KJGA 1QV9A 3EIEA 3OUUA 4XGRA 2PX4A 4K8OA 1G8GA 3VISA 4FCWA 3I5UA 1HH4A 4DBVO 3G02A 4CIAA 1KK2A 3TM4A 4AF6A 2WU0A 4F5EA 4CKWA 2GXSA 5H1YA 1N2XA 5FD8A 1O58A 3H1BA 1PYOA 3PS9A 2XB2A 4MUGA 1MIHA 3UWMA 3G59A 1DARA 4MUKA 4Z3KA 2WYWA 3VR1A 3R3UA 5AK6A 1U4NA 3OZAA 1NA5A 2IUEA 3CLSD 5D1HA 3RW9A 3T3OA 4XSVA 2IKQA 2BY4A 1VYVA 3KKKA 1WUTA 3U81A 5CEEA 2NAFA 2XE8A 2XQGA 2W5UA 2YZKA 3NVDA 4O4LA 3ZE8A 1T5LA 3JRNA 5EJIA 4Q3DA 1G20E 3N2NA 2CUTA 3E22B 1VOTA 1J56A 1OIXA 3N2ZB 4JU8A 4C4YA 4AIRA 5LWQA 3LF1A 2C5EA 1CE8A 2IUSA 3F9IA 1U2QA 4ZICA 3SBDA 5CAEB 1DAEA 2AMLA 4O4HB 3HUDA 5REQB 3U31A 3GGJA 1EDZA 3FF1A 3UAZA 4C07A 2FW8A 3WOVA 5HR5A 1LNZA 1O6CA 2GJKA 4Y0NA 4I1PA 4B4DA 5JRDS 4LDQA 4GL4A 4RCYA 5ALRA 1F2TB 3PX7A 3MD9A 4H9GA 4G1CA 4LXXA 4ANFA 5CT9A 2ZYDA 1SVIA 3DE6X 3PX2A 2D5LA 3QNMA 4WOBA 3M34A 4DJTA 3HJGA 3RVKA 5C0OE 1C2YA 1ZVJA 1PDOA 3E81A 1F1BA 1KY2A 1SVKA 4RV9A 2AYXA 4NR0A 1GAQA 1RLUA 2NU8B 3TD9A 3VU3A 1AX9A 1LLFA 5BSGA 3U0BA 1E9EA 1X9GA 4I5IA 4F71A 5FWNA 4MQEA 4JB0A 3BMOB 3FETA 1IEWA 3QFFA 4C78A 3WB9A 4XYBA 4ZV9A 3X1YA 4CCYB 1K1EA 2CHGA 2OOSA 2Y27A 3VYWA 5CRIA 3SC2A 2EJWA 3OBIA 3AIKA 3M3DA 5T7BA 5KDOA 5G2OA 4O2AF 1P1FA 1U8AA 1JVSA 3MNFA 1IJBA 1PJ4A 2Q6TA 1T9DA 4CLHA 1NUAA 3EGDB 4FK8A 4F96A 1EVKA 3RSGA 1DRJA 4CMIA 5TQ0A 3KUXA 3H7IA 3RAFC 1ULBA 2FMHA 5DBOA 1Y4UA 2LCIA 1ZJ6A 3A9TA 2N9UA 1XPRA 2ZIUB 2CVOA 2DUMA 5FPPA 4O63O 5J1SB 2LCQA 3K4HA 8MHTA 2Q99A 2QOEA 1DAPA 5C4MA 4JKOA 2IYSA 4KTTE 3DBLB 1X7ZA 3AB7A 1SQFA 3K9QO 1DZIA 4MI9A 4R54A 1SXJC 4OL9A 1OH8A 1K5PA 3O0TA 2E7ZA 3PL1A 2CB0A 1VE6A 3ZQ6A 2J85A 3RWMB 1K6MA 1NXOA 4C0KA 4UXJA 2GJ9A 3I28A 1P75A 2Q5QA 2Z3VA 2ZOSA 4RFLA 2NUTA 1QPZA 4ZQBA 1UBFA 2VC2B 2GA9A 4W1QA 1FXWA 4FZVA 1EQ2A 2HYIC 1E0AA 1BROA 1QAQA 3CG0A 1Q74A 4HDKA 2QG9A 2SBTA 1N2JA 1RCFA 1J09A 4DLUA 4GPD1 4KQWA 2G77B 3B6EA 2P0YA 1GAWA 1QGAA 1TMOA 3A4MA 4L50A 4NYMR 1T2FA 3WLNA 2QI9C 1BJKA 2C1XA 2PJDA 5K51A 1OUMA 1C3EA 3C7AA 3L7KA 3GDGA 4MV4A 1N7GA 1CUVA 1JFRA 5HKLA 1PR2A 1S1MA 4LDAA 5JW6A 1KC1A 3K09A 4YXWD 4H35A 2VOEA 5EHXA 2WZQA 1VKZA 2OYCA 4E09A 4I4TA 2O0KA 3A0UA 2A9PA 2EKQA 4HF7A 2OAP1 2R8RA 4O08A 5IN5A 5JRZA 1ZJ5A 2CXUA 4FNMA 3LGXA 5JATA 5D87A 3KPWA 4H18A 2QKYA 3AONB 3AKEA 1Q84A 3QWFA 3KIPA 3PIDA 4WXHA 1VI6A 4DMUB 4Y1FA 5L45A 1IC6A 1VC2A 3GVPA 5AM2A 4DRYA 2Z1MA 1JG6A 1EFPB 3RSOA 5DKFA 2PGNA 4MYDA 3FDXA 1KY5A 3BRWD 3O8BA 1ECGA 1N9GB 1PI3A 3HRIA 4LJYA 4DV1B 2WKWA 4LE0A 1KP2A 1KVQA 4LMPA 2GKGA 1CG6A 2OHFA 4JLNA 4U3JB 1KETA 4P92A 4NOLA 4EGSA 1X14A 4TYNA 1XZJA 4W5RA 1YT5A 2V9CA 4W4TA 5D6NA 4HVTA 2PE5A 1Z17A 2J9XB 4M98A 1P9RA 1X1EA 2P6RA 3JXEA 2D2VA 4D8YA 1KI2A 4F9EA 3KZKA 4JB3A 4D1YA 3OJCA 3KOXA 4QUKA 3SEQA 2VP0A 1R9GA 5GV7A 4DBLE 4OFZA 1O0SA 4AXXA 3VKHA 1TQHA 3WL3A 3BUSA 2MMGA 2PWYA 2SCUA 1MA0A 2QZZA 2XEDA 1I36A 3DS8A 4A6DA 1ZIYA 5CDUA 1D6SA 1J9ZA 2GM9A 3HLKA 3KSUA 3O84A 3U5TA 1SU6A 1I7NA 2WUGA 5EKSA 3S40A 4JJ7A 2TECE 4GXQA 3EXEA 1L7VC 2X86A 1LS6A 1DOAA 4X97A 2P79A 5AK5A 1I4WA 4DCUA 3FFBA 3TQCA 1P7CA 2B4AA 1WTAA 2D8MA 3X43A 3F97A 4L5IA 4HTAA 4LZZA 4G4IA 1IHDA 2VDRB 3J7TA 1N5IA 2F2TA 4YP5A 1DAGA 1JR3D 2ZTSA 3ZUPA 4X3OA 2AKYA 2GZ3A 4QYWA 4X1YB 2BJVA 3DF7A 1RRCA 1M67A 1PSZA 1ZM3A 4O2RA 4O1IA 4O2BB 1KI4A 2PAAA 5J2TF 1KFJB 2D62A 2WHRA 3A0RB 2MU1A 9LDTA 5GONA 3SU8A 1XTVA 5GV8A 4KACA 3WZLA 1CDDA 1PJLA 2FWBA 3EXEB 3AHJA 2F3QA 3IR6A 3O9ZA 2ZUVA 3D6MA 4E3WA 2XBUA 4DLVA 3SAJA 2WJ3A 2H5EA 4GECA 3BORA 5A4DA 4RNCA 4MA5A 3WLLA 1BSVA 3VPXA 1RRMA 3IQHX 1TLLA 1L5NA 2XSZD 3VZSA 1RRKA 1BO6A 2FXVA 5FOUA 2ATCA 4UBMA 3NDBB 1SG6A 2NYVA 4K86A 5KJ1A 2WTXA 1W34A 4X60A 3FI9A 3RS3A 3C41J 1ZA2A 3FFAA 4IGFA 2UUCB 7MHTA 3OJLA 3A6HA 4ODIA 4DRZA 1BWQA 3BIJA 5JFOA 2OWEA 3FCYA 1WCV1 3OTHA 4S1VA 1C9MA 4BO2A 1P9OA 4L5BA 3HP4A 3LAWA 3NB0A 4E2FA 1UQUA 2WOJA 4OA8A 5E7QA 4AKGA 2AX3A 5CVEA 4DSTA 5KPJA 2X76A 3RSSA 2A78A 3LJKA 4YRMA 3IPLA 1RVDA 5DLDA 2BEVA 4Q9JA 3U3JA 4GVLA 3ONWA 1O5TA 2X6RA 3AOGA 3KHKA 5FWXA 3LFUA 4J2OA 3JPYA 2E5LB 2IS1A 3N70A 1FPMA 4RJLA 4JLMA 3GLRA 2ROQA 3EZXA 1XZHA 5JY6A 3WB1A 3NUQA 1K8XB 1J22A 2J87A 1VB5A 1WWKA 4OI2A 4QRIA 4RIEA 4Z4GA 1TA4A 2Y1OA 4R2JA 4CUKA 2IH4A 1T36A 1X1RA 4X20B 4L4YA 3UAGA 4MW0A 1O95C 1V7CA 2W4QA 1WB9A 1W93A 3S68A 5GIOE 3E7DA 2BGMA 2FDCA 2ZJBA 2DM6A 1KAQA 4YACA 3HCFA 1NN3A 3UWPA 4JP5A 4MV5A 5CB6A 1AB5A 3T0FA 2HA2A 2R25B 3JYQA 5AVWA 3R24A 3PNBA 1MQSA 3ORYA 4GM4A 1A9XB 1LU9A 1DX9A 2VYCA 3N87A 4WNYA 3VC2A 2H17A 3B9PA 2GAOA 2ZJ5A 3AVPA 4AW9A 3FYTA 1RLTA 4EIWA 3UK2A 2ECQA 3MILA 1Y82A 3TW8A 4P58A 2MSEB 3IAFA 3LM8A 4D8TA 4E5SA 1NV8A 3CZ9A 3GLKA 1H9BA 3JASA 3OHSX 3ZWCA 4XX0A 2OCKA 2QTGA 1J5PA 1QGZA 4KQFA 1Q17A 1W52X 3BA1A 4Z1MD 2E4XA 2OXFA 3CLVA 1DHTA 2VDJA 2XMQA 4RORA 1SWWA 2PKQP 3DBLA 3TSCA 2BGWA 2I0FA 5I9SA 1RXSA 4FUQA 3GP3A 4MUFA 5E1BA 1TEZA 2I91A 1P3DA 4Z0PA 5EMNA 2ODEA 1SXJD 5EKXA 1DXQA 3ZWXA 2FP3A 4NZ9A 1V5WA 3UMMA 2IPLA 4OAPA 4TSRA 2HMUA 1MG0A 1UOPA 3AO0B 4QJBA 5F5XA 3H2JA 4MR8B 1II9A 1KARA 3FDIA 1JDSA 2WD8A 4Q1AA 5FBKA 1EFHA 1YV9A 3K9CA 5K0TA 2ZSFA 1DWOA 3HNPA 3IODA 4G36A 4RL4A 2ZR9A 3NVKI 4KVAA 2JJ1A 4Q0MA 1XC7A 3WDKA 1QVRA 4M3NA 1E79D 3K3PA 3NKVA 5DM0A 4BJ1A 4YLYA 3FSGA 3MUNA 3T5GA 2AQHA 2HCFA 2P6PA 1IONA 3A27A 3B1ZA 4I5EA 5EAIA 5F73A 3QU9A 4DMKA 3P2IA 5FTNA 2QAGB 4YDHB 4ZANA 5JV5A 1UODA 4U7GA 1I10A 4CU2A 2VNHA 3D4PA 3AIMA 3ZQJA 5ARDA 2FUEA 3PT9A 4NAUA 4WZAA 1EA5A 5I7OA 3GJQA 4R1OA 5I9NA 1AN9A 1OFTA 5GONF 4FT2A 2Q4EA 4I4TB 4RD6A 2VHYA 4WNIA 4IKOA 1KE2A 4C4TA 3LHSA 5L7YA 5MF6A 4HLNA 3FGPA 3E9YA 3LHDA 4PRLA 3ZLUA 2QTVB 3IV6A 3JAWB 4NOMA 2VUTA 2BT4A 1WJGA 2PQMA 2V7QA 3ZWKA 3AVYA 1PJTA 4WW0A 1E60A 3A14A 1MXHA 1AGYA 2UXBB 5DK4A 3AEUB 4HUJA 3S3TA 1TT7A 2RK3A 3ST7A 4C3OB 2CSXA 4O5OA 2M6RA 3DR3A 1YRBA 2HIAA 1N5MA 2OFPA 1A8PA 2OSVA 5F2OA 3MS7A 3NWBA 3PNKA 4B6QA 1WOMA 3GX1A 3MMXA 2I6XA 1R7RA 3OT1B 3HCNA 2P9FA 5AKHA 1SXGA 3H9GA 2ZRGA 5HQJA 3R7FA 1K7EB 3W5JA 3NHSA 5FLEX 5L3QA 2F3PA 1JHAA 9ATCA 1KQGA 4CEHB 1JTVA 1PS8A 3RRJA 3BVPA 1BA3A 3IA7A 5JQGF 3EDRA 5AI5A 3ZEAA 2IPXA 2WVAA 1M7GA 2ZVDA 3C85A 1TVCA 3L7NA 4MQUA 4QYIA 4X6LA 1U1IA 3JZIA 2YHUA 3HY3A 5I9BA 4LV5B 5KJCA 3STHA 3UJHA 2BFFB 2NUBA 3ZNOA 3EPJA 3V8PA 4Q03A 1ABEA 1JJVA 3IGFA 3CZMA 4R9SA 4RPHA 2DERA 2OCAA 1T8PA 1HLGA 1XNHA 1QONA 2CDRA 4EB0A 4MR7A 2CNBA 2RGAA 1JAXA 2EZTA 3D0QA 1JDTA 3ZYZA 4INZA 3E7FA 1EP2B 3DTNA 3IJPA 4HMPA 4CKEB 5BR7A 3J7AC 1UAGA 4GPIB 4EOGA 3BE4A 1GPDG 1XTPA 1Z7GA 2XD9A 2XUIA 4FGLA 2A0KA 2GN4A 2HMAA 4PGGA 4W82A 5CCEA 2DH6A 4ZALA 5IVDA 2FOLA 1SCKA 3DEIA 1GN9A 4BVHA 4KRFA 5K6AA 4I50B 2VTDA 3MELA 4OGWA 3VH2A 1ATIA 1SKUA 1NOKA 1YVPA 4LF7B 4EUKA 1Q0LA 1WSDA 4J43A 3PDUA 4DADA 5IMSA 1RWWA 3MCZA 4KNWA 3R8CA 3KQVA 4JEIA 4PCVA 5BQOA 4IJVA 3EPLA 2IY8A 3CUTA 2GKOA 3E15A 2A9FA 4BEJA 2WTNA 1Y48E 4QGAA 2G1PA 1RD4A 2HGSA 3AFHA 5KQSA 4KK3A 1NT4A 1XQVA 4OX9Y 4PZPA 2WR8A 2H1VA 4IXNA 4R1TA 2IP1A 2D54A 5JTTA 1P9LA 4PHTA 2DKNA 1XYGA 4IJUA 3RB8A 5EWMB 3SK0A 1EIZA 2VAPA 2PL3A 3HB1A 1N5KA 1OT3A 2V7XA 3VTZA 3PIRA 4KUEA 2C7GA 1LF5A 3OPQA 4CKCB 1TKBA 4Y6RA 1AKTA 3VBCA 3IDQA 5JS2A 3EH1A 1BS9A 5JFGA 3JSXA 5IXSA 1DE0A 2D5IA 1MEJA 2NV2B 4KWCA 5T67A 4LQDA 2AW5A 5DULA 5DOZA 1Z5ZA 1O0BA 1GZVA 4NZMA 2Y1CA 3TSOA 4X5OA 4Q00A 3VV2A 3AF1A 4WJKB 2QAIA 3UK0A 5C51B 1BA2A 3ZXYA 8ATCA 1QHHB 4KQKA 2Q3CA 4Z2YA 3VMFA 4EJSA 4HAWA 1MLDA 1IN6A 1QDUA 4ARZA 4CFZA 3KCQA 1I0LA 3PGKA 4X95A 2O8DB 4LNUA 2I7TA 3RKSA 4ZEMA 1VPEA 4PYOA 4X64B 1C41A 3MHPA 4ENUA 1PUJA 3WQHA 5BN3B 3H0CA 1ILEA 4R8MA 1R0WA 4TX1A 4YRIA 3HA7A 5LLSA 3TQQA 5JPDA 3LQ1A 2CE2X 2RK4A 3KJZA 1FNDA 3GGOA 3NHFA 2NO7A 4B3DA 1RM3A 1IB0A 3WIEA 4EL5A 2C5AA 1IU9A 1KJJA 3UQYS 3QUBA 3NWPA 4WDQA 4FZJA 3V6LA 1Z28A 5HS6A 1JXAA 3A9VA 5IVIA 4FW8A 3GA7A 3KC2A 3PFCA 4TV9A 3HGTA 3GRUA 3RTCA 3EGOA 4RA6A 4KSYA 5JBNA 5JO0A 2F3TA 3WKBA 5BUSA 1J0AA 3N8KA 4NENB 2ERYA 4BO7A 1I5OA 4K6MA 1XCOA 1HT0A 2WIJA 2ZRFA 3K94A 3A2LA 1K3UB 3CX7A 3JQFC 3KR2A 5AM1A 3BXZA 3QKRB 1H4VB 4ZMBA 3R9WA 4L4ZA 5K8VA 2DTXA 2ONKA 4XOIA 1E5TA 3QKUA 3W5UA 1V9SA 1NC1A 5FTJA 1WL8A 4OXQA 2NSLA 3UWSA 4QUBA 1G21A 4XPZA 2ZT8A 4KRGA 2C8KA 1UKYA 2HIGA 3MCWA 4E2YA 1C9YA 1W85A 1YVRA 3W6ZA 3ZQUA 1RRFA 3JAMA 1VHTA 2G6BA 3ZDFA 3E2IA 3WWOA 1BX3A 1MJGA 1TD1A 1KJZA 1QJCA 1E1CA 2QVZX 2WILA 2X0IA 3GJYA 4M60A 1BQ3A 1DI0A 3LXRA 4IGEA 4OI4A 5CLHA 2H0AA 2P6MA 3CXRA 1E9SA 1E6WA 4IV0A 4V1CB 1YFLA 1CV2A 1G5HA 2A4MA 4IMRA 5B1SA 4DIDA 3K0AA 4WN3A 4GLFA 2C2GA 3L2OB 1U5BB 4GI3A 3WDLA 1WKVA 2PH7A 4OHZA 4KNYA 3TFWA 3DKKA 2G17A 2WFMA 3GCXA 4RXTA 4TMZA 5TNXA 1UR5A 1K7FB 2ODBA 3L1JA 1W85B 2JFHA 5KOHB 1D1QA 2YJZA 4JEHA 2CUZA 3JX9A 4QFMA 5TVKA 2RGRA 2PMKA 4EENA 2XNCA 4DIMA 2OZVA 2FF7A 3J81k 5AHWA 4B3MB 1JKIA 3I0MA 1R16A 2BZ1A 1XBTA 3ACDA 4KDFA 3A6ZA 3OC6A 3BA6A 3TBHA 5FI0B 4B75A 2YXDA 3EF3A 1VLJA 3B70A 3DZDA 5MFZA 3N0VA 1MJGM 2GM4A 4ZGGA 1XCMA 2OBMA 1T2AA 2NUPB 3OO0A 2XUGA 3CWZA 3H5RA 2EATA 3L4SO 5I6DA 2OZLA 2OV8A 4YQFA 3G49A 1EK5A 5ER9A 3N2GB 3GZNA 2QYHA 3E1GA 2Y76A 4J91A 4DLBA 4EHJA 3T5PA 1OXTA 2I3GA 2PMEA 2R1VB 5DBIA 2CL7X 3UMSA 5JZMA 3R0XA 4H0FA 2Z8ZA 3E5MA 3AXTA 3DJFA 3DPIA 4GGPA 1G42A 1YCFA 4YECA 1QRUA 3WMXA 3KYIB 4RF5A 3LPDA 4ECAA 5HFJA 1J8DA 1CR2A 2FTKE 1JHYA 1Y0BA 4NMMA 1W25A 3IPAA 4LSZA 1SVNA 1CRLA 4OQPA 3SZGA 2K2WA 4QLAA 4CM6A 3EWAA 5KPDA 1PVOA 1GUDA 2JAUA 3BICA 4OHMA 2HCTA 3KYDB 3PGVA 1U2PA 5DOVA 5EUBA 2WJVA 3ESDA 1MOZA 1BWRA 4KYVA 1SUPA 2TMKA 4Q1FA 1C7IA 4LJRA 5K6TA 4JSRA 3NYWA 4OSOA 1QCYA 1YD7A 1EB8A 1Y1SA 4C0LA 3V8EA 1UXGA 2OB1A 3DD5A 3IOEA 4ZT5A 3ZGLA 1L8XA 3I9FA 1T2UA 2P3QA 3QMWA 4AROA 1PT5A 3TUIC 1AGNA 2XGJA 1R5BA 4HWTA 1FDUA 2CVHA 3P0EA 1PIWA 3VSEA 4B3SB 5LA6F 2WJHA 4XUEA 1HMPA 1M6HA 4ZAFA 1E9VA 1NYQA 1MC1A 3I34X 2ZVQX 3BRQA 2QMQA 3KYDA 1NBWB 3GRKA 3A3YA 3LDGA 3M2TA 3CCCA 3N8GA 2EBFX 1KU0A 1O89A 3JCZA 4QOJA 1NXTA 2B6HA 3FWPA 4TT8A 3UHJA 1JGTA 3GN1A 5FPKA 1ZH4A 1QE3A 4ARUA 3RSLA 5L9AA 4XR9A 1RBQA 2YC4C 1HL3A 4URXR 3LWDA 1KQFA 2GEUA 2PMFA 3NC1C 3A8TA 2G28A 4L8VA 5AVXA 2C1ZA 221PA 4H0CA 4MUYA 2XAUA 3KEGA 3I04M 4I6GA 3SZLA 1RCTE 2JH9A 4JQYA 4BNHA 1LC3A 5K0EA 4H1HA 2PX0A 4MLPA 4DUYB 2FMKA 1B6TA 4RULA 3QI2A 3VAZA 1G4HA 1KMNA 2OZLB 3E4CA 1NW4A 4I4IA 4FB5A 4BZXA 1F38A 5FLKA 3X3HA 3M4XA 5FB3A 4F2HA 5G40A 4D3XA 4HWRA 2JGNA 1HOXA 1YIDA 4MP3A 4BGDA 2ZBRA 1T2DA 5EJFA 1P2GA 2AGVA 4H08A 1UK6A 5IVHA 3LX6A 4WA8A 4LF9B 1KSHA 3EMVA 3H2KA 1G59A 4PHHA 2VK4A 2BHTA 3OA2A 5BT8A 1J42A 3IMEA 1N8KA 3C6ZA 3RPEA 1LDEA 1Z35A 3NGXA 3CBQA 3ROEA 2EWWA 7ABPA 4J7CA 2H51A 5TQVA 2ZCVA 1H2BA 2HKIA 1A9YA 5EERA 1ISGA 3ZU6A 4OQFA 4JB8A 2O48X 2Z2ZA 5K8CA 1QRDA 4Y2GA 2AJ8A 1Z6TA 2HWYA 2P91A 1DFGA 2DAPA 3CJQA 3DULA 3AEQB 1BDHA 4CMGA 5M29A 4JBHA 3ZW8A 1XEAA 1EI9A 1PN3A 2RHDA 3N0XA 3QFTA 4JCCA 3RHTA 1JLMA 4HPXB 2H4HA 3RHFA 1RIIA 4BNZA 5LLDA 1VE5A 4I9UA 2II6A 3H75A 1IATA 2NZUG 4PANA 4KX5A 5H3HA 4CKCA 4DM7A 3EFBA 2VUHB 2Q1YA 4LY9A 2B1IA 2H31A 4HNGA 5DEIA 3H9JA 1WXXA 4HNUA 3GUZA 1TM3E 3SVLA 4BQFA 2QR3A 4ENQA 3RREA 1NBMD 1SZPA 1ULUA 1WQ1R 3O9MA 4M86A 4BB6A 1ABBA 1PCXA 5K0SA 3ZZUA 4NK5A 1VXRA 3TQSA 3RC3A 1E2LA 1OV4A 2WHYA 2QZPA 3TIFA 3TB6A 4BMNA 2P7HA 2YBEA 1C1DB 1VJ0A 4HEJA 5KTYA 1KBOA 2ZYRA 4MB2A 2E85A 4FOTA 2WWYA 3U3DA 2BF4A 3H4TA 3U40A 2QQEA 3Q8KA 4PWZA 5IM5A 3G5MA 2IW1A 3N3AC 3OPXA 2QMZA 1JQKA 4II3A 1C2TA 4AY4A 3QKRA 4AJEA 4N8SA 4NCKA 4EYQA 4LF8B 1NGSA 3TZ6A 2A0UA 1XQ1A 3BFPA 3BD7A 2FPPA 1PVVA 2JCYA 3A58B 4LOLA 4XVUA 3I64A 1XLUA 2XY4A 4UCQA 3RKRA 2IUFA 4YO7A 2YTZA 2PVPA 3A6LA 2ZI4A 1YDGA 1CDOA 5AVOA 3TRFA 2XNJA 3LBAA 4L73A 4N3BA 1QKJA 2WDPA 2OESA 4UATA 4B3BA 4C2BA 5IVKA 1BYIA 2C29D 2HHAA 2F00A 3DZFA 1PVDA 1ZMBA 2C4TA 3GAAA 1IBCA 4M0PA 4FWBA 4XGIA 2IZ0A 1K3FA 2P2SA 2FRDA 5LXTB 2C7RA 1Z13A 1SIOA 1T24A 4ESVA 3QVOA 1PWEA 1ZGAA 2VDUE 2H9YA 5FWYB 1E6MA 1NASA 1QO0A 1MTOA 2OECA 3C1UA 1G3MA 1WPQA 1ECPA 1ZXBA 2CJWB 3EAGA 4W8HA 5LA6A 5TJHA 4CLXA 3LOQA 1FP4A 1U31A 4H3SA 4O4LB 4QOEA 1S2NA 3VH4A 1ZAYA 3VVLA 4I5GA 5KOHA 3KKEA 5IU6A 5JDIC 2C2XA 3EQ7A 3Q40A 4JYZA 3ENZA 3NJ8A 4NKRA 5GVSA 4KGVA 3CE6A 4UHJA 1SQ5A 4IIJB 1XFAA 3C1OA 2DFKB 3AUKA 4KPYA 1EAMA 4LHZA 5JAOA 1YUBA 3ZD8A 3PLRA 2GBFA 1U2GA 5HK9A 2BFWA 4J75A 2X2FA 5I4BA 1NMQA 2CDCA 3THWB 1EGHA 2J6IA 4QPNA 4E2ZA 2F55A 1H3NA 1NVAA 4JFRA 2XA1A 3GGSA 1FLNA 3ODPA 1QF9A 4BQSA 2YJTD 1GADO 2TS1A 3JW8A 4B3XA 3MEQA 3VZPA 4NYJQ 1D1PA 2BDUA 4PN7A 5AW7A 5JEDA 1FLVA 4RIIA 3SG0A 2P6UA 3IO5A 1CF9A 4WLFA 4QEZA 3K9HA 3MAJA 5JWRA 4ZDKA 1Z4PX 3BH0A 3BXOA 5AHRA 4C89A 1SUFA 1E9AA 3CZQA 3IPCA 1WBJB 3PC8C 3NOOA 4FYHA 1CQJA 1LTQA 4UAGA 3U9SA 4CW7A 1SUBA 2FA9A 4Y2XA 5ALYA 2ZJFA 4KLCA 5HK8A 4A27A 3LF2A 4YJ3B 3TQOA 5HZHA 4KMMA 5A6VA 2H8GA 3MFQA 1RJGA 2GA8A 1GNRA 1T6ZA 3NT5A 2HJVA 2WP8J 1ZM9A 2GHTA 2HH9A 3IP1A 3NFRA 1N33B 4AMVA 3SLRA 5HMMA 3DEKA 1Y1RA 3MD0A 3SKYA 3HGMA 1DQRA 4GR4A 3TVYA 2DFNA 3SS8A 1BJRE 2X23A 4ZN6A 5DCYA 1N2GA 2R85A 4Y9RA 5T64A 1PR4A 1OZAA 5THXA 3FNEA 3CRVA 4NI5A 2AR9A 3X0DA 4FN5A 5AM5A 4I4CA 4ZQHA 4D57A 1CQJB 1T1JA 1FNNA 2VLBA 2C20A 1E1RA 1GQRA 3HN2A 1Y81A 5D5QA 5DTMA 1TDJA 4ZYVA 3U4MA 3AFNA 2WSMA 1DDOA 3E9RA 4FFWA 1KBZA 4Y2JA 2OM6A 2QAGC 2QRLA 3JZDA 4J1TA 3DO6A 4QOIA 5DO9A 5B7PA 4YRSA 1QG2A 1SOWA 2IHZA 2Z57A 3F6YA 2LP4Y 1XRMA 2JI8A 2INGX 4I4TF 3GLHA 5FHQA 4X24A 3AVXA 1YRHA 2OC4A 2FPUA 3ZH9B 3JR3A 1N2ZA 4J76A 1QF7A 3O1LA 3WXMA 3SF0A 4GOXA 3QYFA 3SBOA 2H5LA 1THMA 3L1IA 1YMQA 3S2IA 4YV1A 3G7UA 4Q02A 2VP2A 3PQCA 1L1QA 3EWSA 1II8B 2OG1A 3NDJA 3UG6A 1LWNA 3EXFA 1XCLA 1DXOA 1U94A 1VMDA 4JZYA 2JNWA 5L40A 2JHPA 4DR3B 4HBGA 4EKIA 1T9HA 4X1OA 1Z6GA 1YUNA 3BGVA 4WCVA 2WFLA 2W98A 1XG5A 2ECPA 3OX1A 4Y6PA 3GEMA 5DE3A 4BDSA 5IHXA 2MSLA 3S1AB 1JEEA 5A4AA 4GI7A 5IZCA 4ILEA 3ZBPA 3WVNA 3QY9A 2ATXA 2Z3ZA 1FVFA 2CKDA 2X14A 3HUFA 2QQFA 2EBUA 3SVTA 2R8EA 3X1JA 1QB7A 3NLLA 1M8JA 1A04A 2OCXA 2JGIA 2VTVA 2LNDA 1DPGA 3VR2D 1Y4DE 3QBEA 1U3CA 3QWIA 2WA2A 3U19A 2VF5X 5CGZA 1NZFA 1DKPA 5AUOB 4WBNA 3FOFC 5A0VA 4U7FA 3BF7A 3KAQA 2A33A 4RVSA 2GBLA 2NPIA 4EKYA 3II6X 2KPOA 2K7FA 2MHCA 2QIPA 3R3WA 4O4LF 2R8ZA 3U7FB 3RU3A 2BP7A 4M8LA 5IJWA 1OYYA 2O3SA 3WWPA 1CEQA 3PQDA 5B58C 3ELUA 4JOSA 4RW0A 121PA 1UWLA 2ID8A 2V3VA 4ML3A 5TV2A 2IV2X 5JI3E 2HT6A 3ABRB 3SIPA 1KTVA 1QTRA 2CLMB 4W9RA 4B3HA 2FQYA 1SUEA 5AHXA 4DJJA 2Q9CA 2XMZA 1Y7IA 2M1ZA 2NXCA 2XCIA 3VXKA 4DNPA 2C77A 4IUBS 4CETA 1ULAA 4LHEA 1E5VA 3IXQA 2DU8A 1MFZA 5MN5A 2XCTB 1EM8B 2OT3B 1OVGA 4J1TC 3LMKA 4WKNA 2CHFA 3G0BA 2FDXA 1EDEA 1W8DA 2JIPA 4J0QA 4YO8A 4DA9A 1V8OA 3O7MA 2GD2A 5GVRA 5FAXA 1POWA 1WO8A 2KJQA 3A1NA 4WUTA 2E2WA 2NZ8A 3R7SA 2PGOA 1GQFA 2PZ8A 1PRYA 4IIVA 3NGLA 4TWJA 5DXAA 4YV7A 4G5GA 3GLHE 1L6IA 1QV7A 2C2BA 3B78A 2VL7A 3MRSA 3PFFA 2POQX 4PLHA 5A5VA 3S4YA 5B55A 4HQRA 3KVYA 2AMYA 3C87A 3RTGA 5BSEA 3EVNA 4R01A 5JSZA 1KBQA 1XLWA 2FF5A 2GILA 4ZXPA 1OI7A 3EXFB 3AFMA 2ZXUA 2YH2A 4FNOA 2Q4OA 3V1KA 1X15A 1U5CA 3LU1A 3DHEA 1LDYA 1J21A 4N7MA 4J16A 3DGFC 4HX2A 1W47A 3L8MA 2ONCA 3LG2A 4FD2A 3LTNC 1JPUA 4UDXX 4XUGB 1YQWA 1L4MA 1P0IA 5J23A 3PE4A 1ECBA 2QLMA 4R9UC 5CU7A 1F3OA 3ANSA 1ZIPA 5GADl 4GM1A 3IL2A 2NU8A 2B61A 2JHGA 1E9FA 4QEDA 2YL2A 4EM6A 3QX3A 3R9XA 4EHFA 1IH8A 4MYTA 2B2CA 3EYAA 2HBQA 4G41A 4L02A 4PQYA 4DQDA 5M04A 2WJJA 1YR3A 3PUKA 3NASA 1EQAA 1OWNA 2BELA 2BJWA 2OYRA 2ERXA 1HQCA 2QUAA 4AKTA 4CQMA 2XLCA 3PWKA 5L3ZA 3UQZA 4B3JA 5BVGB 3K8YA 4UBOA 1EUQA 1BGWA 3T3PB 4JXKA 1Y3HA 4CNQA 3JSAA 4GS5A 1UDAA 4N5DA 2IV7A 2LE0A 4X85A 2C8VA 1XZBA 1P5FA 1WMAA 2I4MA 4M9CA 5ALVA 5D8DA 1MOSA 3AILA 1YS1X 4BGEA 4AZ0A 5FJIA 2AFIA 2Y6UA 2Z2JA 4RPIA 4DAEA 3L6CA 4KREA 1VTKA 1PNVA 4IVNA 2CUNA 1U2TA 4YT5A 1SAYA 2WU8A 5EIWA 4AAYA 5KTRA 1ZGCA 1ZK2A 4YUVA 1G21B 3G2MA 3A2MA 3PC3A 4PLTA 3GHHA 1NKVA 1J2YA 5BQFA 2C9ZA 1XDUA 3ZOKA 2XZPA 3OIWA 1IHOA 4MW9A 4DG5A 2PO5A 2I67A 1LCIA 2ACKA 2JIZA 3KJFA 5A05A 3UT5B 3OVMA 5BR4A 3PCTA 4A4DA 4OKIA 1ENOA 3JQAD 2CNLA 3ILYA 4FDAA 5IBQA 4A2WA 1Y5NA 4RV5A 3H86A 1E9DA 3IE0A 1CC1S 3PE3A 4NU8X 1EWRA 3S28A 5CB4F 2PUJA 1ZX1A 4CM3A 4RVUA 5TQ2B 1R27A 2W9XA 3B1VA 3E35A 1QBKC 1R4MA 1VCOA 3GRFA 3BL8A 2DF8A 1GNSA 2CYCA 1JG3A 4BB9A 1F14A 1PEYA 2Y2UA 3OQNA 1CZUA 4AT1A 1XMVA 3A1SA 3V32A 2AD5A 2JJMA 1L8LA 2VHCA 3DZBA 2AQIA 4WMLA 2WNIA 1JQAA 2HDNB 2L42A 4PAWA 4AO7A 1CQWA 1RKXA 3PK0A 3UAYA 4N3NA 4C7XA 3ETNA 4ESEA 5EG5A 1NXWA 1W9MA 3B38A 5FORA 1HV8A 4DDUA 2A7QA 3LLUA 4TT3D 3U48A 3D5EA 3KQWA 2WABA 3QLVA 4V0OA 4BE9A 4YP6A 2IK8A 4LFBB 2VPQA 4YX9A 1RP7A 1LI5A 2D7DA 5KYUB 1M34A 5BMVA 2GEJA 1WXFA 3PUZA 5DTRA 4HL6A 1RWVA 1XCJA 1A5ZA 3OKFA 2IA5A 4PSUA 4WJLA 1H69A 1BE6A 2BMEA 3CG4A 4ND5A 5TLSA 2VJLA 4BNDA 3P0IA 3IVMA 3SQNA 1AZWA 3D3QA 3NAZA 3CH5A 3EZ9A 2J0EA 3SS7X 4HXYA 1BKSB 2VAWA 2FN8A 4WK4B 2XB8A 1TYZA 2P41A 2GERA 5GP1A 4WOCA 3FMVA 4JGIA 4MUXA 1JIVA 2EX4A 3Q3EA 3KOYA 4ZQIA 3C8DA 3FYSA 4O8ZA 3T9CA 4AD8A 4M1EA 4E14A 4H1WA 3UAOA 3B53X 3GT0A 1N2HA 1O03A 2YJ5A 4B3IA 2XIJA 1O4VA 4FKZA 3PYMA 4LYFA 1J70A 1B16A 2NZYA 1X80A 4M1KA 2B8NA 1L1EA 4PLYA 4CMHA 4TQUS 3OIDA 4EA8A 1NBEA 2JI6A 3CV3A 2HJWA 2BR5A 4RXMA 4C7KA 3I92A 2XKAA 2I6SA 2QDKA 3BM5A 3S2ZA 5EJGA 1IM8A 2FMUA 3HBFA 5ERYA 2H2IA 4BVGA 3NALA 5IUNC 4RGBA 2DZDA 2EHDA 2CE7A 4RIHA 5JXWA 2HIHA 5LMCA 3GLIE 1DADA 1GXSB 1TK2A 2H1CA 4MRVA 4RHYA 4YJHA 4YMVA 1ZH8A 3LO5A 4X1YA 1QGED 4RF4A 2JKVA 3AM3A 2BKAA 3OF5A 4M89A 5CTJA 4GDFA 2ZBPA 3GFGA 5AVQA 1XDGA 1XVAA 3SFVA 1PFUA 4RTPA 1J8VA 4ZK2A 5F64A 1HKHA 5E9WA 2ZSBA 2OWDA 3M6XA 4B0PA 2C99A 1JEAA 1V11A 2HSWA 3BRSA 4RZ3A 4ZAXA 1NT2A 5ILGA 3NS7A 2VDOB 3KSBC 3KQOA 1ISIA 1KEUA 1KO7A 2QMUA 2QN7A 3GLQA 2Y71A 4HWGA 2IHKA 4OL0A 2A5GA 4JUDX 2RE8A 1P33A 4N3GA 4J0HA 1S0UA 1D2MA 2O2IA 1AKQA 2J3JA 2GF0A 4WCFC 4UM9B 2JJ2A 3ICEA 4PFKA 2VNKA 4I9HA 3IIJA 4IIGA 4KQJA 4RO0A 5EMKA 1H2XA 2Q0QA 1PE0A 4MITA 4DUZB 1L4YA 2PUGA 3KWFA 2QVLA 3LYHA 1QG4A 1FQWA 1K0UA 1JI3A 3ROMA 3TBFA 4EVRA 5BXYA 1KR5A 1AZTA 3KHTA 2DLNA 4PLFA 2FJ0A 1CUCA 5CBPB 2X9NA 2IZOA 2JA2A 5SY9A 1WVMA 4CKYA 1OGIA 2BGIA 3C8ZA 1W88A 2WMOB 5C7YA 5ENZA 1F8UA 1FE8A 4G6ZA 3AHGA 1UKZA 1ZJWA 2OYSA 3LH5A 1W0KD 5KREA 2XWJI 3JWGA 2IFTA 1DFIA 3GP5A 3PC7A 4GI5A 1Q77A 1TAUA 2QRQA 4R31A 2FX3A 3H5OA 3DZ8A 1KZ9A 4FYKA 1G291 1IUPA 2IOQA 4KWTA 2YUIA 3WIUA 2PA3A 3WIOA 5HKKD 5JXJA 5JXIA 1XTSA 3UATA 2XBLA 5J59A 2IYVA 1UXOA 1EWVA 2VDQB 3GRCA 3QPVA 2WD7A 2ZTUA 4WRRA 2QJRA 2I9KA 3RRZA 4NL4H 3OURA 5FPHA 4PYMA 4A8TA 1PNRA 4MUJA 4JOCA 1TPYA 3OP1A 5C3MA 1HYBA 3E9DA 4N9QA 2JLSA 4DKJA 2ZBVA 1KQPA 1NE2A 3NBMA 5A9RA 3F9CA 2H18A 4C6SA 1LSJA 3HUTA 3E18A 2PSEA 3PKIA 3UCEA 5ITWA 3DXZA 1CX9B 1GRRA 2PRZA 1JFFA 2AEJA 2D7CA 5AI0A 4URVR 4LRSB 5EJ5A 1JFTA 1C8KA 4P7JA 2AFRA 1H2YA 2ZRLA 4NJEB 1XD2A 3H2HA 3LW7A 3PWZA 1JLKA 1QE5A 1XVUA 4BQRA 5DWQA 4D2IA 3KNZA 1C81A 2ACEA 5I9MA 4Z7NB 3P2EA 4Q4JA 3AY6A 3M3PA 4P53A 1W49A 1T9KA 3ND6A 3TRKA 2AV6A 2MR6A 4DDVA 1UCFA 3OJ0A 1TMGE 2CD9A 3TS1A 5IFLA 3WKDA 1KP3A 2KQUA 5INTA 1JEDA 4WN9B 4XM2A 5IJAA 5BORA 1YQQA 1K4KA 2GPYA 3LZDA 3IJ5A 3I39X 3DDOA 3EIWA 1EWKA 3FIUA 3URMA 3MMZA 2EW2A 1IXRC 1G8HA 4L2IA 1FFGA 3I2YX 3NAGA 2ZJOA 4DV3B 3UGKA 4D0SA 5K05A 1I2AA 1Y1KE 2VNIA 4KEAA 1ZJ4A 2ECFA 2OGUA 1SCDA 4MHOA 3KJQA 3O75A 1W88B 1B3RA 4UHHA 4CG1A 4HEQA 5C3UA 2QTAA 2H7VA 3E1KA 1RTKA 3BSYA 1IAQA 3O8LA 4P3NA 2A92A 4F1JA 4QU5A 3JARA 4YHBA 1BYUA 2FW7A 1G21E 2NZXA 1UP4A 4YUWA 2JLYA 1J5XA 2HT1A 3VR5H 3NGMA 3X1KA 2JB9A 4OM8A 2D1RA 2DBYA 3IILA 2RH4A 4IWXA 5F3WB 3HL0A 3O83A 2CDNA 1W94A 4J6FA 3TTTA 2BHSA 5DXFA 4CODB 3RV4A 3AC0A 2QWXA 5FYDA 1HLPA 4DLXA 3WK6A 1QIKA 4JT4A 1LDNA 2NO6A 4NNOA 4NFHA 3B2QA 2C07A 3ZY6A 4Y9SA 2PUDA 2A57A 2DMRA 2HFKA 3ZDXB 1EDBA 1RYNA 1LTHR 2VF8A 1AKWA 2FQQA 2Q5OA 2PXXA 2QJFA 2J9ZB 1LA2A 5EQDA 3SBXA 4TL6A 1HFKA 3R40A 1F20A 3TE7A 4NU5A 1XDBA 1KQ3A 4MO9A 1Q0UA 2J4CA 4QOSA 5IAGA 3GPLA 4PAQA 3WGUA 4BPRA 3RARA 3BE8A 3L9WA 3EA5A 3JD2A 3DM9B 2J7PA 3B89A 4JC5A 4XARA 1GQOA 1NW6A 3GUVA 1E7RA 2VT3A 4MJ3A 5EPEA 4LVUA 2ZU0C 5IEBA 3B9BA 3RFVA 4RMHA 1ZUD1 2XF2A 4XE5A 4LWPA 5LQMA 5A9TA 3UHPA 3K71B 4DC1A 2AZXA 3DMTC 2GNAA 1KI3A 1S2OA 2J67A 4AX4A 5HOQA 2IZZA 1N6HA 3AI1A 1R6AA 3JQ7A 4Y9TA 3FNQA 2WSLA 1U99A 3PRKE 1A7JA 3ZN2A 4UHEA 1T2VA 1BXRB 4QXMA 3P27A 4AZ3B 1I1NA 5CNKA 4Q4HA 3NAQA 1V8FA 2ASEA 4ETIA 4F3RA 5EIEA 4EVSA 1H8HA 3WHKA 1XRLA 5C53B 3RFXA 1N7IA 1TJ3A 2XLBA 1DXHA 2PZJA 3PQ5A 4EFMA 3CR7A 3KQKA 3PT5A 1RZUA 1O5IA 2H4FA 3FLAA 1XTJA 2FK8A 5HKAA 4WGGA 4ER6A 4ZU6X 1QYVA 2I8AA 5KVVA 1AIPA 1I4TD 5AKEA 4DB4A 2AOTB 4OHOA 1TEVA 2BDTA 5ES4B 4F7DA 3RTBA 4JSTA 2B37A 3FA2A 3H87A 4FEYA 4FFNA 4HLCA 1D0VA 4HNSA 4PZZA 3T7TA 3TQHA 3ECCA 1NR1A 1DEHA 3PWTA 1SD1A 1VG0B 3R7AA 4KGXA 1XJCA 2IDZA 1O6FA 4Q39A 1SHLA 5ESRA 4PCUA 4TYPA 1F4PA 3S70A 3WJ2A 1G2IA 3QVJA 3K1ZA 1QFZA 3DZGA 4GI2A 1W7AA 2ZFUA 3DXXA 3UPUA 3VPDA 3IJEB 3QTLA 4RGYA 3N2IA 4PO1A 5FAKA 1UQTA 4W5HA 5EKTA 1MJ5A 1XKTA 1G9TA 1W96A 3N8NA 5E6SB 3TZLA 2JLXA 1L7NA 1U7ZA 3RBVA 4EHBA 3DO5A 4PCLA 2CMDA 2QZ9A 3DBHA 2XZTA 2H4JA 5THQA 3C3PA 3GRVA 3Q1KA 4UHDA 2XUJA 3QF4A 1VRWA 4IFIA 1E89A 2OV6A 4QQRA 1PLJA 3U4AA 4HQFA 1KJYA 3A6DA 1R5JA 3QKSB 4U7WA 5AO9A 4A1OA 3ZVKA 1X70A 2B35A 3RGWS 3VKWA 3ZCTA 1NVXQ 3TYXA 4CXMA 1U1DA 3L7DA 1KZ1A 5KYXB 4J1NA 1Q0RA 3PDJA 3Q6IA 4BKRA 4GPZA 3MWDA 4LG1A 1JH8A 1PZHA 1PTJA 3RVJA 4A3SA 4R7GA 2P78A 4TTPA 2G0AA 3C3CA 1TAGA 1Y1TA 4X6XA 4FGUA 4G5SA 2EP8A 4AURA 4B85A 4F3YA 1P60A 4WZZA 5A5FA 5JI2E 4KFTA 3NHUA 1Q14A 3JVDA 4OXXA 5SYAA 4WVLA 4BFSA 4CDRA 3C1TA 2PVCA 3DE3X 4V0SA 4L08A 2SICE 2JGJA 5EXXA 3SS9X 5IJ9A 2O7NA 3L8HA 1FSFA 5BSKA 2HHJA 3L0PA 5KMGB 3HN6A 4YTEA 1LEHA 3DDZX 4PTZA 4BE4A 4D8WA 1PQ4A 1RZRA 4ZQCB 1FJHA 1Z0AA 3C4VA 3F7MA 3TTXA 3FMIA 1E94E 1LFAA 2D74A 2FWNA 2PXCA 3CS3A 4CTJA 1K92A 5I47A 1UOOA 2QN1A 5TS3A 2PX2A 5AUNB 3EEOA 3L93A 4JQSA 1HYEA 4QTUB 4QUIA 2XYVA 3MXOA 2PN1A 3K30A 4MCIA 4W8GA 1FRZA 4J0CA 3OIUA 4QLOA 1I94B 4FMBB 4P8RA 1MNAA 1UJ2A 1Y7LA 3QPDA 1EWQA 3IKTA 5E95A 1QC5A 5F7XA 1M3SA 3NX4A 3OUZA 1K0FA 2I7DA 4CR8A 5B58T 3QUTA 1W76A 2EZ4A 3EVTA 4KXMA 3B20A 5ADVA 3FHJA 4M4SA 5IHPA 1P2FA 2X4IA 1MRNA 1QR2A 4RETA 1TQ4A 5NULA 1MZVA 3F5DA 3DTTA 1E96A 4WN9A 5SYNA 3OX2A 3UY4A 4EI9A 3QQ5A 2QENA 5HILA 3T1VA 1GRCA 3GJ6A 1SUCA 4I81A 4IY1A 5KYTA 2Q7XA 3K0FA 2A8YA 5AVSA 5AVKA 5JCJA 2HM7A 5AVZA 1G7TA 3DDCA 2QS9A 2X19A 3DBOB 5G0SA 1PJRA 3FOBA 3GDOA 4AS2A 5IKOA 5KYXA 4IOLA 5EXEA 5EYPA 4D82A 2AG6A 3PFGA 4ND1A 4UJ3A 1TZMA 1FYXA 2KW5A 3NZEA 4JR2A 3C6QA 1X39A 4MGKR 3RIMA 3TZEA 4M9QA 4ZDJA 3ZLJA 5KEIA 2E4YA 1PWHA 1NVGA 2PKXA 1U2ZA 2ZBUA 5DLYA 4MUNA 2CDAA 5BN3A 4XD7D 3QVLA 4PZAA 1JHMA 3QXHA 1VCMA 4EG5A 5JQWA 1WUIS 2ZYIA 3CLTC 1YZYA 4KPUA 5JS7A 1FYFA 1LXCA 1ZG3A 3IHLA 1OCEA 1HG0A 2AG8A 3MSXA 1J8YF 4IXMA 4GZ6A 4JL5A 4I14A 3V33A 2IX9A 2E5FA 2CHEA 2DCUA 4CGYA 3ED5A 2YJ4A 5HBRA 4Z5XA 1PFYA 3IVGA 4Z4HA 2VWHA 1O1YA 3EQ2A 3JQAB 4I4NA 1ZNZA 1PF7E 1VB3A 1SD5A 3GPCA 4NBNA 1L5ZA 2NZ2A 1IK4A 2P30A 4OEHA 5H16A 5FX2A 3MT0A 3PNYA 1VLVA 1R0CA 3GJSA 1EEXB 1UBJS 2PM8A 3N2GA 1YB2A 2B2NA 2H54A 5ALDA 1OXUA 2RONA 5ALSA 1MJNA 5BV1A 1QFXA 1Z6YA 2AC7A 4GF5A 4J49A 4ZCSA 1OWLA 2XJ9A 3LHFA 4ZPXA 5CB8A 1JSCA 2JZOA 2VPTA 3UN1A 4P80A 5GJBA 3H97A 1DLJA 4OV6B 1ODTC 2ZIXA 1BTOA 2O7VA 1T91A 2YZNA 4RKYA 3L7OA 1ZPDA 2WPDD 2DX7A 4UEOA 2GASA 1H4TA 2J9FA 2NTVA 2IOFK 2X0NA 2YS6A 3IOMA 3PVSA 4YXFA 4LX0A 3TAUA 4CEJB 3GRRA 2UZ1A 1TC1A 1WV1A 3FPJA 4HN2A 4K26A 5LBUA 2H08A 4GXNA 4IM7A 4XCXA 5B4TA 4ZRMA 5K0CA 2NTNA 3GEHA 1TK3A 5I51A 2GJ8A 1HPLA 1HG1A 1P6QA 1Q1NA 1T6BY 3DCYA 5LKRA 1H0KA 4HPWA 1I7QB 4G24A 4ZOEA 3HB7A 3ZGNA 7MDHA 4QUGA 1FTGA 1N34B 4GL2A 2O1EA 4GT1A 4MZXA 3TFOA 3VGPA 5WRFA 1KMHB 3EUWA 5J43A 2WAXA 4ZXFA 4IGIA 4LVNA 1P5ZB 4AP6A 3UB2A 1L5VA 3GMSA 3KXLA 4YP1A 2CVPA 3Q7QA 4AP9A 2P2YA 5D6OA 3HO6A 4GZ5A 5HF8A 1APBA 1XRQA 1CS0B 4DJEC 1JE0A 1VL5A 2FFBA 1U90A 3FMFA 4D3FA 3ABQB 2CCGA 1L5KA 4JXZA 3FI0A 2YWHA 2O3UA 3TLYA 2YWDA 1F4LA 1TTQB 1A96A 2I8CA 3NTOA 1E79A 4O4JB 1RBYA 3DBHB 3EIQA 4EZIA 1T0JB 1XTBA 4BNDB 4DDKA 2G82A 2XOKA 3PFBA 4D4LA 4A73A 5CA0B 3UHAA 1E2MA 5HQTA 2AQ8A 5KHAA 3OOHA 4KFSA 2PL1A 4CMIB 2WNHA 5LQNA 1E69A 1EYZA 3G1UA 2I80A 4AQDA 1OH6A 3ZHVA 3RIYA 2XF8A 3L92A 2GFHA 2PKQO 2QUIA 1Y6RA 2A9RA 3BIWA 3EFOA 1DELA 3GJ5A 3KO8A 3RVMA 1GRVA 4ZYZA 4QRDA 2BH9A 1YFJA 4R0MA 2OM2A 5CHYA 2IS6A 1PQYA 2NGRA 3BULA 4WH0A 5A06A 2VHZA 2DR2A 5AW1A 1RI3A 2Q3JA 4KBFA 4ZVTA 1ZO8A 1JG4A 1D6MA 4CR7A 4U3JA 1YXMA 2IOFA 4CMEC 3GGCA 1DCFA 2J3KA 2OXCA 1YC2A 4OM7A 1S8FA 1R6XA 1J4AA 3AOEC 3Q3GE 3K9NA 3MUEA 4LKRA 5EIAA 5D3QA 2A0WA 3L7MA 1NW5A 3HEAA 3VFDA 2OCPA 4U0KA 1JLHA 3EG9A 3IAS1 3AU8A 1S3FA 1MAUA 5GZ1A 1L5QA 2FSGA 4DMMA 5LMNB 3AIIA 1A8HA 3TZCA 2QAJA 4R1NA 1HTBA 1UBHS 3CJTA 4ARAA 4CI9A 5K6AC 1L7XA 2BM0A 4FMPA 5JECA 4K1XA 2V45A 5LDGA 4IYJA 4URUR 3DLTA 3CQ9A 3LC2O 2VVTA 2SKEA 4EBFA 2EDAA 4IOJA 3C3EA 4CNBA 4WASA 2EW8A 1RHKA 2P2DA 3MWDB 3F5FA 4QBHA 3KFLA 3WYAA 1SD2A 5LOVA 1Q7GA 1F2UA 4CIVA 1C4XA 1RM0A 2WYVA 1EFRA 3N86A 4LHYA 4F45A 3DDWA 4QULA 1SK9A 3T1HB 5KJEA 1NXSA 3BTVA 1FFAA 5F52A 1XP5A 1IZYA 2VR1A 5C1PA 1NL3A 1NW3A 4GUDA 1OXMA 2GLUA 1E5LA 3CUVA 3DYIA 3F8WA 3HUUA 4CQLA 3JWEA 4L5CA 1P9NA 3ITDA 4HH0A 1U0BB 1PZXA 1RXCA 1SGWA 1KZ7B 3JQBC 5FUMA 2ZTHA 4JI5B 4CL2A 1O54A 5KVCA 2Z6AA 1LWOA 3JATA 2X7XA 3ZY2A 2PSFA 2WF9A 4EHDA 4L8WB 1SB9A 1Z16A 1Z56C 1DEXA 3KPJA 2I66A 4GVPA 4H7FA 3CMMA 4DGQA 3AUXA 2VZLA 2G9UA 4JT2A 1UPXA 2PXHA 3C74A 4LIPD 4YPFA 4YUAA 5T6MA 1CY0A 2HHLA 3MFYA 3SP1A 1ZSYA 5JY1A 2NAPA 1XMXA 5I9TA 2P8SA 5E9JA 2FEMA 1JWBB 4BJ6A 1MNQA 4EARA 5A5EA 1KRHA 2NP6A 5LQJA 4YJKA 4EGFA 3P26A 5FPYA 4YAEA 5HCNA 1XZEA 4HEA6 4OHKA 1DTEA 1GG2A 4AMUA 2OXTA 2PBFA 3UCXA 3L8YA 2DQYA 4DJFC 1H2FA 2AFHB 2Y3IA 3G6KA 3F2IA 1PK7A 3GEBA 1U3UA 3HYTA 4CKZA 3LPMA 3PD1A 1ZH2A 4EWLA 4X7RA 3BMNA 4ZYXA 5GZ3A 2O2ZA 1UKVY 2QD4A 13PKA 1X0XA 3ESZA 3K8ZA 1LC0A 4IBOA 4L8LA 5IC5A 5IYZF 1YVUA 4HWSA 1VFPA 1P2SA 1BEEA 2A35A 4QHSA 1ORRA 1IPFA 3AH8A 5FOSA 1T4CA 3NVMB 3GFTA 3D7RA 2J3EA 2JD1A 4QPZA 2BEKA 1SCAA 2B1GA 4FX2A 4BBAA 3K32A 5L7WA 1RYEA 4XUCA 5E6UA 3WRWA 2ZYWX 2FSUA 3H8WA 3I1YA 5ICSA 1A1SA 3UCFA 1R66A 5EL0A 2HRZA 4L6AA 2HAEA 3DEAA 1RI1A 3GDHA 1P80A 1Z8DA 2HLDA 1J00A 3IB6A 4G0QA 4MEBA 3NU1A 5EINA 4KIFA 1SHTX 5DM1A 3CLUC 4LEIA 2O54A 1LVHA 4WADA 4D8XA 1JXOA 2QLTA 3LL7A 5IWAB 2FSIA 1KEPA 3M6UA 1AQ6A 1L3CA 4A5OA 3K20A 2A7XA 4UQPA 4DHEA 1DOHA 4FFMA 4TWZA 1JU9A 2Z8YA 5CR9A 4MW5A 5J9FA 1SPXA 3R44A 2FOXA 5IJ0A 4FVTA 1MEEA 1RS0A 2YFKA 3AQ4A 1PR9A 5JWHA 1VSUA 5K3FB 2RGDA 2BGLA 1JSLA 1KPIA 2QTHA 1FYEA 1G2PA 1N3IA 1NNLA 5AK3A 5J4KA 1CIJA 1X94A 4NFSA 1YOVA 3CN9A 1VGVA 3ON5A 2VHUA 4I9NA 4YRZA 4CL8A 5CB0A 3PJRA 2GN1A 3MT9A 4DIUA 3ZU5A 2BCGY 3F5QA 4P2BA 4NV1A 1II0A 1OFVA 2JBWA 4YXWA 1PW7A 3EZFA 3RS8A 5F51A 2VYND 2Z30A 1K3TA 1UXKA 1JJFA 2CJXA 2OKCA 3CPHA 3FMOB 5T57A 1VLMA 2VP5A 3RS9A 1US8B 2P1DA 2FFJA 5CMLA 2XR1A 1W1IA 4LWQA 3ZIDA 3R2JA 5U9CA 2AI3A 4DIEA 3V46A 2HGZA 4KI0A 1IXKA 2ZQ5A 4GX2A 3K05A 2JI4A 3THYB 2D1SA 5JADA 1QQ5A 1FTQA 1HDZA 1ZGHA 1Y5LA 4GP7A 4IG4A 4QGHA 5DYGA 2Y99A 2DWOA 3Q4GA 3ZIUA 5DCWA 3D54D 4LZPA 1WHTB 5J5VA 1EX7A 1YZVA 3LX5A 1F12A 4XX1A 3KK0A 4BX0A 3THOA 1E4OA 3E27A 1YI1A 4B82A 2ACVA 1HE5A 1SCQA 1VI2A 3V48A 2EJBA 4D25A 1EPUA 5JJIA 1FMCA 1M6VA 4K9RA 4DNXA 1KMHA 3EZLA 1MABA 1Z7EA 1TI7A 1YZ3A 4G9BA 3ILVA 4TWBA 1ZINA 3V3KA 5GZ6A 4GIBA 1HI9A 5BN1A 1JLLA 4H3VA 1PGJA 5ADWA 3I4FA 1RTTA 1QCCA 4OYYA 3BX1A 3UKOA 2D6FA 2HNBA 2XAAA 3N0WA 4YRTA 3KALA 2O4UX 4IDCA 4JKIA 3WI7A 3ZD9A 5IDVA 1NYRA 2WE8A 4MVWA 4N5NA 3RE1A 3JQQA 3BXGA 4N49A 3ZR4B 3H11A 4R83A 1OPRA 4OFWA 4RPJA 4YQZA 3O92A 4G0XA 4AS1A 2DUWA 5FPQA 1KYTA 2MSNA 2BLNA 1TF7A 2W6MA 2PX5A 3TVDA 1X38A 4HOYA 3PQ2A 1KQOA 4F9GA 4IXWA 5BY2A 1VG8A 3U7HB 3RSZA 3V55A 3PC4A 2WM9B 1Z37A 3OZVA 2QM8A 4O29A 2HA7A 1RC0A 1YTLA 4YMWA 3SPXA 3QE9Y 5FWDA 3M83A 4II7A 2J4FA 2FPXA 2XECA 4WY2A 5KYWA 1CJMA 2OBBA 1I0IA 1H0RA 3GOQA 3K0CC 3LKZA 1FFEA 1NC3A 3GFSA 2WWFA 1UZMA 5TQJA 1JA0A 2H5IA 4G1UC 1CUJA 1I8TA 3QFCA 5EPOA 1LK0A 4EYKA 1NG1A 3I9JA 3ICWA 2SKDA 3W5BA 3QMVA 5KYVA 1KO8A 5DSZA 3BT7A 1NJSA 5BWBA 4CT5A 1G7RA 1U1EA 2FE4A 4K2HA 4BWYA 1RJ9A 4TGLA 4CKEA 4DOMA 3AVTA 3DTVA 1Q6YA 1OF1A 1K8ZB 1J0CA 2B5OA 1OW3B 4MS3A 4ATNA 4BJ5A 1T13A 1CUIA 1F9EA 2DHDA 1F8FA 2NSJA 3DF9A 3FIJA 5K0BA 1AHHA 1UBGA 1H2ZA 1H8EA 1S2IA 2EAUA 4MRPA 5IYZB 2C58A 5AQ1A 5JHHB 3U44A 1YU9A 4KWHA 4RPKA 3WJ7A 4AJ9A 5JEEA 2RG1A 3OOYA 1C0LA 4LXYA 3EARA 3VI3B 3W06A 3SHFA 2Z2XA 2A5FA 2WSBA 4KXFB 3LHKA 1QHEA 3BWYA 4DYDA 3IPRA 3NHBA 2NUAB 3GLFE 4CM4A 1M2HA 2VYVA 5B12A 4HKTA 3O1HB 1B0PA 4BNMA 5HS4A 2HADA 2I03A 2JJ8A 5K0JA 3D6JA 2W6IA 4QE3A 3AR7A 1L9XA 1MABB 4BP1A 2X0KA 2JGAA 1UBMS 4I3GA 3T52A 1PFVA 3LCRA 1EZ1A 1Z7YA 2RBEA 1CUSA 2R6R1 2GBIA 3MG9A 3VOSA 5HWSA 2QROA 2W6ZA 4PIPA 1GNPA 4QATA 1KEZA 1ZN9A 5IF9A 2HL6A 1WQ4A 4GICA 5CA1B 3W2GA 1OBHA 3CVXA 3CH7A 1DOZA 2AN5A 3N7UA 2PPLA 1QYXA 2C5LA 2C9YA 4RZSA 4U4AA 5DIZA 4B3RB 1ZC4A 2R79A 5HDQA 5JUWA 1F6WA 1SC9A 3B48A 3L6DA 4IWNA 4RJKA 1VHLA 1CS4C 1FTSA 2PGAA 2CXRA 5DBGA 4LF6B 2YVAA 5D5PA 2EFEB 1W19A 2XXBA 3IP8A 1ODSA 4JJ6A 4NZNA 4CHGA 4B3FX 3TCKA 4WKBA 1JLRA 2H3HA 3F8TA 2D2XA 5K99A 3GNSA 1G38A 1YCDA 3AM5A 1XQYA 3EUAA 1XDWA 1XD8A 2BGJA 4YDRA 1MTZA 5KWSA 1AQNA 5TPWA 4BUZA 1YS4A 1V4NA 4AJ2A 3WLEA 2CDBA 2OR3A 3TG2A 3ULKA 3W4KA 4XCVA 3HVRA 4WXEA 3AZPA 5AI4A 1ZC3A 1BFUA 1O8BA 2DXIA 4LXQA 2C7OA 5TT0A 2JGEA 2IEIA 3AL0C 3P9IA 3QPBA 4PNEA 4YAFA 1Z0UA 4TS1A 3TOCA 1YZGA 1QYDA 2H8KA 4YRFA 4KWEA 3ZGXA 4D4KA 1STOA 4II2A 2HPVA 2CFCA 4Q7KA 1DBRA 1OAOC 2RH9B 2IYWA 3ME5A 4X1KB 1JNYA 4E7PA 3QVMA 1ULHA 4MR9A 2FZGA 4AUKA 1JMYA 1YDHA 2NT4A 2YJNA 1ZD1A 3A7DA 3K1AA 2EF1A 4YRAA 2ZIGA 3NIFB 2O3QA 3NHYA 3Q2OA 1G60A 3S7ZA 5CFNA 3EGVA 2QORA 3IH5A 4Q9AA 3IAHA 2PMBA 4X71A 4OQXA 5LZ5A 2OBNA 1W0JA 2Q3HA 3PPVA 3ZHTA 2C7VA 2IZ7A 4HWPA 4FD3A 4W5WA 4X92A 5T4BA 5BWMA 3QVVA 3AZOA 1T10A 3PD0A 4URWR 5C80A 1ZITA 2W37A 5FF9A 3UAVA 3S99A 4LJKA 3PEWA 4BAGA 4QXOA 2OC9A 3DW1X 4LQ4A 5CDSA 2CUKA 2GB4A 1W73A 5DMHA 5HJEA 3A4IA 1P5JA 1XSEA 5EIBC 2F8LA 3D8NA 2B99A 2GHRA 3OTQA 3B2NA 1E59A 2BN4A 1RC8A 1V39A 1ID1A 2BL4A 3A26A 2HDHA 3WWEA 5LFAA 2JFYA 3RUPA 4TV9F 1FMJA 2WW8A 1LW7A 4PAMA 4DG9A 1QYWA 1XTRA 3L46A 4FR2A 3AFGA 1SVLA 2ZVJA 1HKUA 4RH3A 4NONA 1V1RB 1NULA 5SZKB 3DZIA 1MDFA 3GELA 2VKTA 3WO0A 2DYKA 4E11A 2BKVA 5L7TA 1KKMA 4HNHA 4EI7A 1QO0D 3A4YA 3HCCA 1G1MA 4I1IA 4KSBA 4PC1A 3QKIA 2XEXA 4PHGA 1CUYA 4DUPA 1H5NA 4MV0A 4QQNA 4BRUA 3G2NA 2Q29A 2G09A 1ACLA 3SOZA 4NCBA 3ZWMA 2M9MA 2Q45A 4DRXA 1DQPA 3GH1A 2PH1A 3U26A 621PA 1XU4A 4LNAA 1NQTA 3SHTA 4IH9A 2CK3D 3HY4A 2Z08A 3KKPA 1XIVA 1UDRA 4DIKA 3PB3A 4AU1A 4ARBA 1Q0TA 3FDFA 1E32A 3WX0A 2YKGA 3HFSA 1GQSA 4DIBA 3CN7A 3REQB 3U7RA 4EHHA 1DQYA 4MQ5A 1F1JA 5TGDA 3URKA 1ZAKA 2P3SA 4GC9A 4UVEA 3UOGA 1XZNA 4FYMA 3P9QA 3ASZA 1O6GA 4E5NA 2HK7A 3B85A 3HA3A 3HCOA 2GFIA 5TPZD 2AKEA 2H85A 3RAJA 3WTBA 4U6NA 1NLFA 2GXUA 4WLUA 4Y2RA 4FR5A 2VRCA 1YOBA 2PIAA 2NO4A 1XQ6A 2LVBA 2CCJA 5HTKA 5EJMA 5TQ2A 1CFJA 1RP1A 3TZHA 4RL6A 5JTUA 3ROTA 2TMDA 3BCRA 4YRKA 1ORHA 3PEFA 5L8VA 3SX4A 2XMCA 1U0EA 3RJ5A 3DL4A 3ZJ4A 1TA9A 4M8NE 1PZGA 1A69A 1FEZA 1ANKA 1FFBA 1JQEA 1V8DA 1VIYA 3PITA 4NH0A 3GJRA 1SU8A 3BWEA 2Q1TA 4JV5B 4R2XA 3GA5A 1O2DA 1W1UA 3QHQA 4TTJA 1IMJA 3ND5A 1MD9A 2FWPA 1XMOB 2V7BA 3U3MA 1D8TA 4AKIA 2ATEA 3QJGA 1LZLA 3EIFA 2IXDA 3DBRB 3IOYA 3NHWA 1PBNA 2A0XA 2VKQA 3L79A 1Z25A 2XI4A 5EN4A 3SX2A 1UOEA 4EEXA 3BXFA 3ZDCA 1DG1G 3QVUA 1Z2OX 1MCZA 3QBVA 3HWRA 3MJRA 1NKTA 1V47A 1ZVVA 1Q0PA 2YRXA 3MWJA 3GIDA 3N5CA 1UC9A 2XOXA 3RSCA 1FSPA 1YQDA 5A9SB 1U65A 1ADFA 3HU2A 5EE1A 5EJ9A 2M32A 3HR7A 4N0PA 3REGA 3WLFA 2ARKA 3QHPA 5F7OA 2XT9A 5A3JA 3N0RA 2F3RA 4Q1BA 4RKFA 3TLGA 4OHYA 3Q11A 1QJ4A 1BXGB 3R7BA 1Y3IA 3O2SB 1M72A 2CFRA 1CY6A 2G1AA 3ZJUA 1Y8ZA 2RARA 1DMSA 1OTHA 3K5IA 1QZUA 2QPTA 3A36A 3AVOA 3LLVA 4NCNA 5G0UA 5LB4A 4KLRA 3PXEA 4MQ6A 1T5HX 2FG5A 2QN8A 2X5JO 3LCUA 4DVGA 2B1QA 1N1EA 3UG7A 3BAZA 3H7AA 2XNDA 1DAHA 1Q19A 1VJGA 2D0OB 4LSWA 1T1EA 3RBAA 4BWFB 3KQQA 4RTLA 5IT9A 2WB4A 3EW9A 4KVGA 1QWOA 1U0NA 3CX6A 3HKCB 3PCRB 3TE6A 3H0EA 4H77A 1YRYE 1JW9B 2P90A 1XX6A 3KLMX 5AXBA 4AXBA 2HRRA 4JC4A 2OFFA 2JGFA 4FONA 4EAQA 4F8YA 2ES4A 3QE2A 4X66B 3LD9A 1FBTA 2QV7A 4HVCA 4MO2A 2IP2A 2WYIA 1AS2A 1S2DA 1QQTA 1RE0A 3D2CA 1JEYB 2FOIA 1HT2E 1ZCFA 2ZW9A 1IN4A 2C3YA 5EFOA 4ZT3A 5BWNA 2VPXA 1V8BA 1N2CB 2JFBA 4AQYB 1OYWA 4L76A 1PTKA 1UM8A 1Q2UA 1YJAA 3WRVA 5HM6A 4B8ZA 3ZV5A 4RTRA 2YV2A 4ZHQA 3K2IA 5CITA 4U7DA 1ETHA 1SCBA 2QL5A 2IIVA 3ETDA 3HMKA 3H5VA 2WSSA 2Y1EA 5KQMA 2X2EA 1LRKA 1CY4A 2HYDA 1YR7A 2ZDGA 3HADA 3FBWA 1GZ5A 3VX4A 3WGNA 5A4MS 5KMGA 3ZDRA 5AR1A 3K2BA 5C52B 1K89A 2WSYB 1PZFA 3T3HA 4H4DA 1TFRA 3QU5A 4YPOA 1UEXC 2JJYA 1E2PA 2R3SA 3CGWA 4FZRA 4XWOA 5DLQC 2DLDA 1INLA 1MO3A 1TM2A 1WZNA 2GZ2A 2YIJA 2H4WA 1YJ8A 3NBZC 4QPCA 1E2FA 2OUKA 1T5SA 2H5JA 1QH9A 2RGYA 4MAFA 4R5MA 5LYYA 4Z4FA 4V0RA 2FSHA 4IQ4A 2R6CA 3WBFA 4CTKA 4J29A 4K9QA 3EGXA 4EKNB 2HA5A 3Q3IA 1PJAA 3O4HA 4JNCA 1SQGA 2BKLA 3RODA 1XZAA 4KOAA 3ET5A 2DLCX 1RWMA 5TMEA 3EVFA 1IXYA 3E0QA 2WD7B 1WMBA 4Y3UA 1A1VA 1NV9A 4EMSA 3GLIA 1YBMA 2H2FA 2HMTA 3ZEIA 4PNZA 1GPLA 5AVJA 3K1AB 1M75A 1DB3A 2HLPA 5LWHA 2JRLA 2B3DA 2V5UA 4JI8B 1E61A 1GQYA 2Q1XA 4R2IA 2JLZA 2J3MA 1DBIA 5L3VA 1VSTA 2QY6A 4RD1A 4AKHA 1ESMA 3HO8A 3WGMA 3WKAA 2YQ4A 1L4EA 2RIRA 3WK7A 5FWYA 5K8JB 2QD3A 4JI1B 4Z7QB 2IU6A 4ENTA 3HABA 4IVPA 2AG0A 4YRQA 2XRFA 1I01A 2ZETA 2YN2A 2H06A 4POAA 5K01A 4P7BA 5F9FA 1SHKA 3TD2A 4B43A 4D6PA 3NM6B 4BFTA 3AINA 1HNWB 3MAGA 2HU8A 3D8BA 2Y0BA 3BJRA 3DAFA 3W9BA 2WTEA 2XQJA 3PC6A 4CQNA 1UMCB 4ZTZB 1FSZA 5D5HA 2DTEA 4JVMA 3WGOA 3VNVA 1S3IA 4XQ0A 4LSGA 3L1UA 1WSBA 4I08A 3UB3A 2VXYA 3MRXA 4ZFNA 2FPPB 1IBSA 2VRWA 2G08A 2WAYA 2X5OA 3M5WA 2WKRA 1PJ2A 3CUEF 4JVSB 1C0PA 5E1MA 2FU5C 1NYTA 1P39A 3K15A 5TVGA 3UVEA 4MLDA 4AYXA 3KAPA 4GYWA 3W5VA 4ZDWA 2QEQA 4I9GA 5KTSA 4JASB 5B6JA 5E3JA 2YRFA 5IM4A 1GT6A 2N0SA 2DQ4A 4MRMA 2RGGA 2F9LA 1SQ0A 4JBWA 3A1UA 4KQGA 5IT0A 2XTMA 4DHWA 2XD4A 4IICA 4QPDA 4FYXA 1LBHA 2DUUA 1N2SA 1VCHA 3W78A 3HJNA 1TGYA 2CJYA 4TS9A 4A1FA 3GYGA 4JD5A 3MJ4A 4C7MA 3B13B 2W0SA 4BX2A 4KOEC 1L7AA 1V43A 1VL6A 2R97A 1KE1A 4JDUA 1L2TA 2IOHA 2C2WA 2DUJA 4YQYA 5EQTA 3NTLA 2RG7A 5FBLB 5FQNA 4EO9A 2JLUA 1A76A 3LUFA 3F4KA 4MPDA 5CLQA 2D1YA 4UE6A 3ADPA 2CZCA 1ZQ9A 1HLDA 2RAFA 3MAAC 4B48A 3SX0A 3GROA 5ARBA 3CNEA 1KEWA 3WLOA 5KKAA 2J6CA 2K2QB 3OY7A 1KXZA 1Q3HA 5DTQA 3D7MA 2CY0A 4HYTA 2JF0A 3T1NA 5TIIA 4TV8B 4OQ4A 4K9MA 5D85A 1OREA 4EPVA 2RHGB 4F3NA 4ZHQF 1QKKA 1REQB 5EJ4A 1SC3A 3L7YA 3Q5DA 2QRNA 4MMXB 3H65A 3K0KA 3GNQA 1E92A 2C7BA 3BL5A 2C54A 4HZGA 2R66A 1O94C 2PRIA 3PBKA 3HPRA 3KSMA 3L4KA 4LXHA 1HEUA 1EDOA 3OE4A 3NRCA 1KGDA 2OV3A 2P11A 2XW6A 4HNAA 1ZXXA 3E9MA 2BF7A 2R2GA 2UZAA 2LV8A 3EC1A 3R5TA 4WKCA 2RHMA 4ZTBA 3V1YA 4IIJF 4BQPA 5LN1A 1GCUA 1LF0A 2G0TA 5U4XA 6GPBA 1YJCA 3NBQA 4OG2A 4BO6A 1XQ9A 3ZK9A 2QGZA 2J0QA 1U8XX 3F90A 4G4GA 4F86A 1T0PA 4QFBA 2ISSD 3RG8A 2EL9A 1EFVB 1V2GA 4LRYA 2B25A 5FUWA 2PY6A 1IOVA 1RVV1 3DOCA 1I3OA 1TQ8A 2IXAA 1G3RA 5DHAA 1SRRA 4WUVA 4TZ0A 4KH0A 4NU6A 2G71A 3RU9A 1V5EA 1DTWB 1R8SA 1YDEA 4FEGA 4YIHA 5BSFA 4M1SA 2FG6C 3UYKA 4UTNA 2VSXA 5LXTF 4KIJA 3AEKA 3COYA 2PAFA 4M1OA 4JQCA 3WBBA 2GRUA 1L5OA 2H1SA 3SKVA 5H9VA 3RS5A 2RC6A 4PYIA 4B31A 3WIDA 1NI5A 1GLVA 3E9QA 1DJPA 3PENA 4F4UA 4F4HA 1JH9A 4HFNA 1W36D 5KQPA 4MWBA 3W5AA 4Z49A 3DE1X 4HZIA 1Z0FA 2DFLA 3CEPB 3UJNA 2L18A 3IIIA 1OZFA 3HU3A 3Q0EA 4LDPA 2GD0A 1BXGA 3IP9A 3V1UA 1A82A 3MTEA 3UMRA 1YQGA 3SIWA 2HSDA 1J23A 4IHKA 4DMFA 1PR1A 3P2OA 4EYEA 4EI8A 2R87A 2ZSIA 4Q4AB 1VDZA 4MR7B 4X61A 2BP7B 4LYHA 4YMHA 4LOKA 3OFNA 2OV4A 3QX9A 2WHXA 1AGXA 3NBXX 3I53A 4D80A 2F1KA 2ST1A 1HFJA 4B6FA 4Z99A 3A9UA 1GD1O 5JDCA 3ZH2A 4HGPA 5AOVA 2W2MA 3F5MA 4RGQA 3W5CA 1YBFA 2V7QD 2VSFA 1CZRA 3V2GA 3A37A 3WC4A 3MT7A 3BC1A 1BCRA 3PYXA 4MS4B 4X62B 1WXWA 4LJ9A 1QE0A 1LLQA 1TYDE 1MU0A 1W2HA 1REQA 3WQQA 8ABPA 1Q15A 1WEKA 3FOZA 3N2LA 3ZXSA 4EABA 2Q2VA 4YRLA 4YMSA 1QS0B 4ESOA 1O6ZA 1EB9A 3AM4A 4TVBA 1DJMA 3IHWA 3DHNA 3OT1A 3KETA 1UADA 2YDYA 3K73O 5GONB 5IM4F 3R76A 3JQ8A 5CYFA 4G5YA 3VV3A 1P6UA 1CDEA 1E2IA 2AMVA 3L8EA 3LGSA 3HHPA 1OD6A 3ZU2A 3W9SA 1A3CA 2GZHA 4KQCA 2Z4RA 3MRTA 2ZE7A 1RZVA 4UM9D 2YWEA 3EGXB 4PXYA 4DA0A 4UM7A 2E87A 5AOBA 4C1NA 1QBGA 3RWBA 2P9YA 1PZEA 3ZK7A 2IYOA 2YCBA 4HSEA 3ZV4A 2L17A 1L5FA 4YAWA 3WZMA 3WLRA 3CUSA 1JFVA 1VCNA 3IAUA 5AKKA 4ERNA 4H31A 5TPWB 4A0QA 1UFKA 2E48A 2JEYA 4PSVA 1XTIA 4RSHA 1BE1A 1PK9A 2CMKA 5K8UA 3HB0A 1B93A 4Q48A 1E0JA 2C9CA 3AERA 3G2LA 1LZKA 2NIPA 3R0IA 3ROGA 3WMEA 1UPUA 1YHNA 1TU4A 1V11B 2O3RA 4Y6QA 5EJ2A 3WL8A 2WIBA 1XZIA 2YYSA 3CR8A 1Y33E 3E5RA 1DL5A 2DECA 2Q0HA 4LYEA 2FX2A 3SE7A 4AO6A 4AJLA 3R9XB 4KVZA 1M1XB 4CLOB 4XYLA 5JAUA 3CR3C 3OECA 4C06A 1TTTA 5KCZA 5PGMA 2IYAA 4XZ3A 1R5OA 4U2DA 4AJJA 2VJOA 4CF5A 3W8NA 5M7EA 1OJ7A 4DGSA 5C34B 4XFJA 1L4NA 2ZDQA 4OQQA 3RYHB 4OHRA 2W00A 2HX1A 4ITUA 3S0JA 1U5AA 4U9UA 1FFYA 2QSUA 3E5HA 3HBAA 4AZSA 4WAUA 1K4YA 3NP9A 3LIPA 1HEIA 2EQ5A 4V02A 1NW7A 4BO4A 3KDPA 4TS3A 3WISA 3X2EA 4XR4A 3RVDA 4TZKA 3OY2A 2VXOA 5HYVA 4ABTA 1DKNA 2HUPA 3RTEA 1HZZA 1EA7A 3IDOA 3LPNA 2VK1A 4P34A 5KC8A 2I78A 1UUFA 3F46A 3GHYA 4A8HA 1XWWA 1NJFA 1YBAA 1GSIA 1GRNA 5DRTA 3OZCA 1QWSA 4Y6LA 3WGYA 1DRUA 1N57A 4NENA 4RBNA 4KDRA 5CDFE 4MHSA 1YZNA 1QC5B 1ISMA 1OBCA 3ISJA 4NHOA 3A06A 3QEJA 4JLUA 4Q3BA 3UEOA 1PWZA 4G97A 4Q3NA 4D9FA 2I8LA 2J6HA 3EQ9A 4I6JA 4N7JA 4UHCA 1P5HA 4FFRA 4G85A 4ENVA 5K2OA 5E2BA 3U4QB 3E70C 1KDOA 1D3AA 1P6XA 4O4HA 5HVNA 5ITSA 4UW9A 5B1IA 1BMQA 1GILA 3BWCA 3GO4A 1ADGA 1IE3A 4ZVRA 2UYCA 1L8AA 4Z6KA 2Z5VA 1JR4A 3JZMA 3A1EA 4RTNA 1ZUWA 4F2DA 2G8NA 5SY4A 4L78A 5B7QA 1M2GA 1LLCA 9MHTA 3OEYA 5JDCC 1CWUA 2AJCA 3DOJA 5I7SA 5CD1A 3TVTA 1B2LA 1L4UA 3ZLTA 2B7BA 4HRAA 1MQAA 3ZCPA 4XTCS 3DUFB 4IIFA 3BJEA 1LSUA 1YR9A 5I4KA 3AVVA 4K6HA 3VUFA 3RIEA 3UBMA 3VTAA 3QP9A 2IYTA 3PC2A 4A03A 2ZWIA 4IKPA 4LSMA 4OJNA 3VZCA 3C2QA 3CGGA 4ND2A 1XRRA 1HGXA 3B5JA 3LQKA 1SUWA 4WFKA 5JC1A 3NH9A 4LISA 1HFWA 4TQ9A 4BGUA 1E1KA 4UUOA 5IK2A 4DNQA 1O87A 1UPCA 4B3CA 4F06A 2Y1WA 3RUFA 1I7SB 1D07A 5F1OA 1CR4A 4ZI2A 3IBGA 4YAGA 1XKLA 1SKMA 1SXJA 2X5NA 4GYKA 3QIVA 2DULA 1M6WA 3ND8A 3EVEA 3H5WA 4MA0A 6ADHA 1GTMA 3V34A 3CMCO 3GFVA 4BTEA 2XUZA 4WOPA 1P1RA 4RHFA 4DA7A 3I58A 1DO0A 1LPNA 4R1PA 3ZHSA 3WB0A 1AS3A 4K03A 1M1ZA 3N6XA 2ZWOA 3O8QB 4MIYA 3SR4A 4CI0B 5AJUA 1K6IA 2IEYA 3ESRA 5FBRB 3DAHA 1YS6A 3Q9UA 5HPYB 4KSCA 3HCRA 4P93A 4CCSA 5IDQA 2E89A 2WT4A 4LVCA 1JT9A 3GLTA 4X90A 3RS0A 1FDRA 2ZJAA 4K88A 3DPSA 3EMKA 1E1LA 5BSTA 2RH8A 4HNAB 3N6VA 3RS4A 3TTYA 1A7KA 2O8FA 1ZP6A 4C7VA 1N9KA 3EB9A 4RZ2A 4N7BA 1F5NA 4TXJA 2Z83A 1B14A 3HSSA 5ALHA 2BMVA 4UFPA 3DOEA 4OHUA 3I5XA 4I55B 1SIWA 3KVNA 5FR2A 5CJ2A 3WWCA 2JIBA 2HRQA 4L16A 3MS4A 3KSZO 4UZEA 3OZ7A 3UPDA 2G3YA 4W9NA 4HAZA 1I6KA 1NFRA 4HFMA 3BDVA 4ZQFA 4HWKA 4XWAA 4O4JA 4DQLA 2ZUFA 2IU4A 3QNWA 5CW1A 3TX6A 1HF3A 3AEKB 4R6XA 4ZV7A 1UL1X 5DYNA 3TX2A 2JEOA 2PS3A 4YAIA 5J40A 1SVOA 2A3RA 4TKLA 3R7LA 4PLPA 1S01A 5I9LA 5JJLA 1M1NB 3FWYA 3NFYA 2A4KA 2L69A 2IYFA 1M5UA 3VZRA 4EGAA 5GY7A 2BUBA 5K5EA 1TE2A 4RE6A 5HTOA 2PWZA 4WXRA 5TXGA 1HE2A 1G9XA 2ZJZA 4NPAA 3QG5A 2KLHA 4CKXA 2F3UA 2MR5A 5CH3A 4BB5A 3PXGA 1M54A 1NE7A 2Y4NA 4KWIA 2VF7A 3VSDA 1N6OA 1RNLA 5FI3A 1P72A 3A3OA 4ZCLA 3SKXA 4KN5A 1QSGA 3HO1A 3JD4A 4KPFC 3NMUF 2GARA 1HDRA 1QGUA 1MN6A 4FFOA 3RAGA 1D6NA 1SZJG 4IVQA 3EZNA 4QDKA 1U8CB 1O08A 1FRFS 2XRYA 3DE2X 3IVAA 3SEFA 5JCXA 1GKIA 5F76A 3KXDA 1LBEA 3A3NA 4L1KA 1UAYA 2QRHA 3WL6A 3SC3A 2AVDA 2BFCA 4HP8A 2P77A 2ZRAA 3IAAA 4X84A 5F12A 4DDHA 4HXGA 4DSNA 3OC0A 3ET4A 3HRKA 1C3VA 5IKPA 5L3QB 1SOVA 3DJYA 2L0XA 4NH4A 3W34A 1JQBA 3D4NA 1F2UB 2Z5FA 1JG1A 1QGUB 3WGLA 1Z8FA 3F98A 2ZSJA 1WXDA 5IP5A 2F67A 2JAXA 1VKRA 2QRVB 1LKZA 1SWVA 3T9BA 3FGZA 1DCTA 3TRDA 4AWAA 1PR3A 4S3MA 5LM3A 1JFFB 3IS3A 2FPRA 3HLTA 1N0HA 1WZEA 4F3TA 2EJUA 1YI8A 4GUAA 3D4OA 1I9CA 3NYIA 2GJAA 1J07A 4L8GA 4NECA 4U5QA 1G16A 5LCXA 3WHPA 5LDDC 2W11A 3D8HA 3MYYA 1E1NA 1EVIA 3R0QA 2QUHA 2YMQA 1NVVQ 1OXXK 1IBLB 1CQIB 3QE4A 2LR0A 5FOVA 3ZZTA 2Y9PB 4ALIA 3R0JA 2I9PA 4NRDA 4PRZA