1LD3A

Crystal structure of b. subilis ferrochelatase with zn(2+) bound at the active site.
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
309
structure length
309
Chain Sequence
SRKKMGLLVMAYGTPYKEEDIERYYTHIRRGRKPEPEMLQDLKDRYEAIGGISPLAQITEQQAHNLEQHLNEIQDEITFKAYIGLKHIEPFIEDAVAEMHKDGITEAVSIVLAPHFSTFSVQSYNKRAKEEAEKLGGLTITSVESWYDEPKFVTYWVDRVKETYASMPEDERENAMLIVSAHSLPEKIKEFGDPYPDQLHESAKLIAEGAGVSEYAVGWQSEGNTPDPWLGPDVQDLTRDLFEQKGYQAFVYVPVGFVADHLEVLYDNDYECKVVTDDIGASYYRPEMPNAKPEFIDALATVVLKKLGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Ferrochelatase
publication title Metal binding to Bacillus subtilis ferrochelatase and interaction between metal sites
pubmed rcsb
source organism Bacillus subtilis
total genus 117
structure length 309
sequence length 309
ec nomenclature ec 4.99.1.1: Protoporphyrin ferrochelatase.
pdb deposition date 2002-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00762 Ferrochelatase Ferrochelatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ld3A01
3.40.50.1400 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ld3A02
2QD2A 2QD3A 1C1HA 4KLAA 2JH3A 2PO7A 2Q3JA 1LBQA 2XWQA 3LYHA 4F4DA 2AC4A 3W1WA 1LD3A 3M4ZA 4MK4A 2C8JA 4KMMA 2PNJA 2Q2NA 2Q2OA 2XWSA 4CCSA 1HRKA 3AQIA 1AK1A 2XVYA 3HCPA 2DJ5A 2XWPA 3HCNA 3HCOA 2AC2A 2H1WA 4KLRA 2XVXA 2XVZA 4KLCA 2QD4A 1QGOA 1DOZA 2HRCA 1TJNA 3HCRA 2HK6A 2QD1A 1C9EA 1L8XA 2H1VA 2PO5A 1N0IA 2QD5A 3GOQA 2HREA
chains in the Genus database with same CATH superfamily
2FUCA 5AVXA 1AF7A 1A72A 4PQRA 5DXAA 5HHTA 1NYTA 3EIWA 2IHVA 3UT5A 4EGSA 2WMYA 2FDRA 2FMTA 1ZU5A 1PZXA 4UM9B 2WVGA 2CMDA 4URVR 2H2FA 1WSWA 4JBNA 3HCWA 1YRHA 3FYHA 4H1UA 4WNYA 3VKHA 2IH4A 1FRZA 2GMWA 2APJA 1JDUA 3ZZMA 4J0HA 1RWMA 1Y3HA 3QXHA 5HZKA 3FCUB 1TI7A 4KO1S 1IOZA 3OU7A 4DNFA 1D6SA 2I3ZA 4F2GA 3A1WA 4F86A 5LMZA 1BXGA 2C2YA 3ZHSA 4ZYVA 1J6UA 1GUZA 1C41A 3ITKA 3JV7A 2QD1A 1ZXLA 1W6RA 3K20A 3TQOA 4ZVSA 5BQ3A 1UMBB 4B3TB 2G1PA 1WY7A 1KYQA 2V7BA 3WKBA 2O1SA 3HUTA 3A32A 3TTYA 3OOWA 1ABFA 1VL6A 3T6KA 2XIJA 2XQIA 3QFCA 2FHPA 2BFCB 5CVJA 2CKMA 4QVGA 4C0XA 2JHCA 2XEXA 2V6BA 4DB2A 3U3KA 4D9FA 2JCGA 1P1HA 3GFRA 1IVYA 3LCVB 2Q4EA 3LK7A 3QV2A 4LNAA 4ND4A 5ALGA 5AVKA 5MFPA 5JUWA 1GYQA 2CUKA 4ND3A 4WZAB 2OV4A 2X13A 4ABTA 3PBKA 4M9ZA 1MHTA 1R8JA 2R9VA 1DOZA 1WF6A 4FZVA 4HN4B 4TRRA 4YV0A 5CEFA 1JGTA 1O0SA 4YXWD 2R96A 3JQGA 1E96A 4KP7A 1HDZA 4OHMA 2F90A 2IUSA 3HR7A 1I9CA 4F8YA 3HVRA 3NI2A 3AF0A 3QBVA 5L51A 3WQSB 1TO2E 1QTRA 4TLAA 3FG9A 1C1XB 1NN5A 3D8HA 1SQFA 4YFYA 3F1LA 3ELDA 3PGA1 3DF9A 5BSRA 1JQ5A 3SLGA 1B7GO 2J46A 3AEYA 1AQUA 1BMTA 1G64A 2X41A 3LBIA 1LVUA 4I6EA 4COOA 1NKVA 3ME5A 1W5BA 4R4JA 4A4DA 5BURA 1X39A 3H11A 3M7IA 5BPHA 3DMPA 3Q4GA 2FRVA 3PK0A 4GMDA 1A9XA 2BI4A 1L1RA 3KOZA 3SD7A 3RAGA 3TIVA 5A02A 5JBQA 3KQUA 4MYTA 2P7IA 4MKRA 4IMRA 2NT3A 3UCXA 4IOMA 1VKZA 1RWQA 5MHTA 2PMEA 2Z4SA 2VZEA 1QDEA 4F6RA 5EZYF 2NU8B 2ASVA 1S2IA 3GRKA 2V7WA 3E1GA 3G17A 4UHCA 3FUVA 4TMVA 1R9MA 1P31A 3EPKA 1F0PA 5BUZA 4ZOEA 1K9VF 1HOXA 2XAUA 2QMHA 1NIPA 2IV7A 6PFKA 2W22A 5EWLB 2XB4A 2RE8A 3AB8A 2DUUA 3C5EA 1XQWA 4AMBA 3MJDA 4TMZA 4D9HA 5B30A 2WILA 5HYVA 2F59A 3KAPA 1F7VA 1ZK4A 2COKA 2JLSA 2B82A 4CKCA 1U0FA 1D2AA 4IF6A 4G0ZA 3U44A 2F17A 4CN9A 2FGJA 4RV9A 2VWPA 1V1MA 4X8MA 4XQGA 3ZI4A 5IDQA 1YB6A 4YRPA 5EMLA 3B70A 5K8TA 1NM5C 2I2CA 3UXMA 2PL5A 2KYRA 3QX8A 4IGKA 3FLBA 5HEKA 2GB4A 1ULTA 4RK7A 3V4OA 1M7BA 1V5GA 2BMFA 3KL4A 4JU8A 3OQOA 5B1EA 3OG9A 1E1RD 4RF2A 1EWVA 2CNNA 3DV9A 3PEWA 3KJEA 3MTGA 1U98A 1JSZA 4AIIA 3OFVA 4FKBA 2ZM6B 3QI2A 1COWA 2P5SA 3MQ4A 3UKJA 1QHSA 1JMVA 3BX1A 3ZZ0A 1TRKA 3OF5A 1XIVA 3HY6A 4X1YB 1NR1A 1RAFA 1KVSA 4RH0A 4C14A 2DFDA 3GCDA 4FBGA 5AKZA 1I2MA 3A04A 1Z7BA 3HP1A 3BB1A 2GCEA 4G2NA 1NVVR 1SA0A 1YE5A 2Z98A 3CVOA 1TW2A 3CB2A 4LMBA 4A2WA 4BNJA 1EE2A 1GPNA 4ZTUB 1Y4DE 4W6ZA 3K0BA 4F4DA 1XWIA 4A7PA 4MVJD 1XTVA 2GLUA 3QVOA 4NF2A 1A82A 1CUAA 3JWEA 3QPBA 3T06B 5HJ2A 4H17A 4ABYA 2PGOA 4MTLA 3LT0A 4DIMA 3H2BA 3R7DA 3CNQS 3BXFA 1PFYA 2JCSA 5FUWA 5SV2A 4XJSA 4B6FA 3P2KA 4GEGA 4NMXB 1KRXA 3G85A 1HNNA 1R9JA 4CLOB 2YXEA 3MD9A 1E8MA 4KLCA 4NAUA 3CXUA 3T7RA 2PVPA 2GO1A 4B2PA 4AYWA 5JBNA 1D1PA 3KL2A 2CJYA 2C4WA 3D0RA 5LMUB 3KV3O 4JELA 3WP0A 2EJVA 4AF6A 1W4LA 4C4XA 4OHZA 1H1DA 2OHHA 3QKUA 4IFBA 4B32A 2I7DA 3T95A 4F6CA 4PO3X 2BCEA 3TTVA 1GZSA 1RI5A 2XNHA 3B3GA 3T35A 5JMPA 3U4GA 3R20A 4W1QA 2WJWA 4Q7QA 2DF8A 4OA8A 1BQ4A 2ZE5A 2VF4X 4TWAA 1VCIA 2ID7A 2A6PA 5DHPA 1E62A 5JZBA 5AKYA 2VUSA 4HGOA 4IIGA 1FP2A 4ZI7A 5HUJA 2VDUE 4CV1A 3HGMA 4UM8B 8GPBA 3CZ9A 3KELA 4RKRA 3IIJA 3JQ6A 1H65A 4DTIA 4DXHA 1J0BA 2QQ0A 2UZIR 3N2IA 2PMKA 3E4DA 4FFPA 2IXDA 3CRW1 5F23A 4IRMA 4J16C 4NXNB 2UVPA 4JLWA 2JLQA 1QIHA 4E5MA 2NTNA 3E1KA 4OAQA 4YXWA 1HNXB 3ETDA 2LIVA 4EPWA 1X77A 2HU5A 4L07A 3TZQA 1Q92A 1UJ5A 1V47A 4DA9A 5GM1A 2JLCA 1Q19A 2ZJ0A 4IICA 3SXUB 4TQAA 2OGTA 2WM2A 3LRTA 4RD2A 3TNFA 2HQRA 5CG1A 2UXBB 4KOAA 3MAAC 1I3LA 2VLBA 1ISJA 3GVIA 2IYSA 1I7NA 4OIMA 1C3OB 3VNVA 4XWOA 4RTNA 3HDQA 2WWYA 5JMTA 1FIUA 4D45A 3ETNA 1US8A 2C8LA 5UKDA 5AW8A 1H4QA 4AMYA 4DWOA 4F5EA 2W6JD 4LCEA 3KT6A 1E3TA 1KK0A 1QG2A 3K6JA 1XLVA 4Q1EA 4PLGA 1ENYA 2VPYA 3IP3A 4PYNA 4ZAZA 2NVOA 4GVPA 3WOVA 2VQDA 1ZIDA 3MCTA 1Y8QA 5K3DA 2P1ZA 5ULLA 3UGTA 4CFSA 3EMVA 3JR7A 5C1DA 4JXXA 2VHCA 3VU0A 1P33A 4ACBA 4DXAA 1PGOA 4CF5A 5LU9A 4QEZA 2NG1A 4YRJA 2YRWA 1W76A 2XOKD 2ONZA 2ZUBA 2PMFA 4Q4LA 4KPUB 5EWJB 3GIDA 5D00A 1DEAA 1BJTA 1WU8A 4QDJA 2PZAA 5JCZA 5GOZA 1GR0A 4LJ5A 4L2IA 3RVQA 2L82A 5E4TA 5BSHA 1BDBA 3O6VA 4DBVO 3NHWA 4PNEA 1ZD8A 4U2EA 3Q6IA 4AKHA 1X1TA 4CQLB 3QWBA 5CFRA 1C8VB 2VJQA 1JJIA 3FOZA 3BIFA 1TCVA 2C42A 3OZSA 3CNHA 4BWVA 3L7YA 4HLNA 3O82A 1ONNA 2AFIB 2R2AA 3KQHA 5JEDA 3I09A 4LVOA 1PQYA 3AY7A 3FPSA 4U39A 1KRWA 3ZOKA 4OQYA 5CXUA 4E30A 3R3JA 1REQA 5NULA 4DM4A 1E1RA 3HYRA 2QUZA 5F7XA 4BLRA 3C5VA 3I4CA 3HKEB 1ULHA 4ZVTA 2FA9A 1I4EB 3W2EA 1K97A 1NN0A 4IOJA 4Z86A 4YP0A 1Z63A 2JD2A 2MR5A 1N6RA 1VM6A 4OGGA 1H2HA 1T9ZA 1C8LA 2CDBA 3F0TA 1R27A 4X20B 3P20A 1Z5ZA 1W75A 2JLAA 3E18A 1CF9A 3GEBA 1SWVA 2C3MA 1XU7A 3J81k 1HE3A 1YZUA 3ACCA 4YCBA 3RUPA 1Z56C 4C29A 4DDWA 1RI3A 5KQGA 2YJ6A 3W8NA 2HC9A 2R6DA 1XZIA 3I01A 2PUVA 1JBKA 3VYVA 4EJ0A 5LPNA 2JH3A 1HKHA 2Q4RA 4GXNA 1F6BA 4MDFA 3K0FA 1RYMA 1DHTA 2QVCA 5B1HA 3VHRA 1MAAA 4A16A 4MVJA 1U3CA 2JRCA 1XZLA 2AG1A 2O4UX 2OQIA 1AGPA 3L49A 1LKZA 1XD2B 2WIBA 4M6WB 1H6AA 4GL2A 4X6XA 3EH2A 4LQDA 3BT7A 4D9EA 1A7JA 2OCYC 1BIFA 3IMKA 3T7TA 3AFGA 1CB0A 5ETJA 2XKKA 2D74A 2F8SA 1ISRA 4W5QA 2HIHA 2Z5LA 4N3GA 5CBKA 2AMYA 1T3ZA 2CCGA 1RZUA 2GKOA 2OV6A 2V4UA 1YBHA 3KXDA 4B6PA 5JROA 5KNCD 1ZK2A 2IU3A 3SVTA 2JZNA 3L8EA 1NQOA 4FZ5A 3RBXA 1NJ2A 1CVRA 4ZHQA 3D6JA 1R88A 3BF8A 2O50A 5I6DA 2QTVA 3PVCA 2QUJA 3QK7A 5DCWA 4E5PA 2NSJA 5K3EA 3OKPA 4LDRA 3GFBA 4TMFA 4A3SA 3ZW7A 4DXDA 1QF6A 2P9EA 1R5BA 4HX2A 1H23A 2PNJA 1NATA 4ZVLA 5G3ZA 3UIEA 4EKGA 1CKEA 4R9UC 3U0BA 2Q6KA 4KVZA 2C4MA 4OMFG 4YAUA 4TYNA 2V74B 2OL4A 2REOA 1PR0A 3D02A 4MDHA 4DMKA 1GPDG 3TNYA 2Q62A 3M9XA 1JWAB 1FVXA 2AOTA 2G9ZA 4AL4A 3GGJA 2H2DA 4J0DA 1Z5VA 2JI6A 1JS1X 4XIJA 3CY6A 3ZWDA 4NY1A 5AESA 2O59A 2O1WA 4F4UA 1ZICA 5TC4A 3PFFA 4LJLA 4DYVA 3HBMA 4Y2VA 5EXSA 5G1NA 1JB1A 1UQTA 2JAUA 3HWWA 1P5RA 3HUDA 3PFNA 1UH5A 4MS1B 3SYLA 3WGYA 2HSDA 1LC3A 1CHDA 4HADA 1BE0A 1E94E 4ZVQA 5IVDA 2WSSD 2PGJA 5TT1A 4TVSA 4D2IA 3T7AA 3HB5X 1LWNA 1PDWA 4HQNA 2HNBA 4CHGA 3HCNA 4WESB 3PFBA 1YQTA 3WLPA 4HPWA 1S1CA 4MI1A 3DGEC 4B33A 4EL0A 4N54A 4FQ5A 2W6JA 3DULA 2PVCA 3L7KA 4K87A 3KOMA 4XD7D 4DAOA 1TX4B 4L6CA 1WBDA 1K4YA 2OWDA 5EAIA 1N0IA 1QORA 1QH1A 1H0RA 4EG4A 7REQA 2FSVA 2PD4A 4RFLA 1F9EA 2B2XA 2C5FA 2J5XA 2XW6A 3DW1X 1QUFA 1TYDE 5FJJA 3RVNA 5EIBC 4K6KA 2A30A 4PNZA 4YJHB 1DAIA 1ECGA 1D1TA 2HHCA 2O8CB 3DFUA 2YJ4A 1QIKA 1UWLA 4EEXA 5GGYA 4YPVA 3OM9A 3T1OA 2XOKA 3EXIA 3MUOA 4RD3A 3QVWA 2WWVD 4CDGA 1AXGA 3S0JA 3K09A 3PTLA 4QT4A 5JZMA 1LY1A 2GK4A 1G8KA 2VP9A 3T34A 3V8RA 3FNFA 1VGRA 4AMVA 2B4RO 2VJAA 3SKXA 4X0EA 2WYUA 2YXLA 1T5BA 1F12A 3KR2A 4O08A 3GXOA 3IAS1 4G1CA 4WA8A 1VYHA 2O2CA 3CLVA 4L0MA 4PR3A 5HUQA 4ASUD 2JLVA 2CLLB 1C9YA 2C5SA 3I01M 4RABA 4WKOA 5D85A 4JI0B 3HO1A 5CP8A 4EX7A 3ICCA 1XC7A 2WPNA 3N0TA 1KWGA 1ZRHA 2DRIA 3RGGA 4TZKA 3VQTA 3BPSA 1Y5MA 3RYFB 4DCNA 4BVAA 3CC8A 2LBPA 1SBTA 1KI9A 2ZKLA 3ROGA 3T61A 4DCVA 2QP3A 3JYHA 3T3DA 3WGMA 4WFIA 3BDVA 4XVCA 4RY2A 4C0HA 1HDIA 3NIWA 1T2UA 1X42A 2NYUA 3REQA 1BVYF 4Z4EA 1NKSA 2X40A 1TECE 3RVMA 3O2QB 5BV2P 4LOIA 2CL5A 2IXTA 1TAQA 1IM5A 1A4UA 3QYFA 1KYWA 7ABPA 1YRAA 1N77A 1XDZA 3VYSB 1EVZA 1L3IA 2GGSA 4ZYXA 3ER9A 2XD4A 5EIAA 3U4CA 2BAGA 2P6OA 4D02A 3ZKWA 2X0KA 3F78A 3TNDA 2C9CA 4C4SA 2O5EA 3OA2A 2A33A 3L8GA 1OI3A 2I6XA 2BFPA 4S2UA 4K6FA 1E64A 3TMKA 3KZOA 4RFSA 1SKBA 3CEMA 5GQSA 3OZVA 5FH9A 2XQFA 5L9AA 4CMHA 1V5IA 2XDQB 1VG0B 1Z4LA 3UH1A 3CPSA 1SXGA 4J29A 3PWSA 2Z1MA 3FCOA 3GGGA 4U2KA 1AMNA 2RGEA 3MUEA 3IR6A 1Y1SA 1VPEA 5B6PA 1U2PA 2PFKA 3BD8A 2CHEA 2JFUA 1S6YA 2CEKA 1EUZA 3IMCA 1N5DA 2GLTA 2SKDA 4KN8A 1DWUA 5KNCA 4EPYA 3VDRA 1IVNA 1SUDA 1V8OA 1Y7IA 3GQBB 1PJTA 2DQSA 5EZ6B 3ZCUA 4D8XA 1LVHA 5JXIA 4Q3KA 4FOTA 2D6FA 3IT2A 4Z4CA 2B7BA 2AFVA 3F5SA 4J43A 4WAUA 2XCIA 4ESOA 3PGLA 5HCIA 5FYDA 3SHFA 5REQA 2BZ0A 5KZMB 2WQ6A 2I9PA 1GV1A 2A59A 1YO6A 3T5PA 4PO1A 1Z82A 2BGTA 4ZO7A 1KAHA 3ISTA 3BMNA 3LTNC 3CCFA 3CR3C 2HPZA 3E3AA 3KZ1E 4PINA 5K05A 3HYTA 1QHXA 5FLEX 4QO7A 2VF7A 3PLNA 2YY7A 2QGZA 1W30A 1X9GA 5ALOA 3N0XA 4DA4A 4DR5B 5T64A 5I7RA 3ROQA 3ZXSA 1CQJB 1PD0A 1XKXA 1ADGA 3U3MA 3C5CA 3L0ZA 4KUEA 3SFTA 5A2QA 4MWBA 1E6EA 3HUEA 1U7WA 3EF0A 2QE7D 3OZXA 3RRZA 4HEJA 4BJ1A 2BMEA 2Q8QA 4FCTA 2JIQA 4JEIA 4Z54A 4NTZA 4F46A 1YUMA 1H2EA 1M2VB 1T0PA 2R60A 2CYBA 3QFSA 2F1OA 2FZCA 5HPYB 4OH7A 4Y0VA 4K9LA 4G6ZA 1PVOA 3W06A 5FBVB 1YBVA 2OLKA 4EMTA 4PW0A 2BWJA 1E5LA 4KRYA 4B5LA 2WSSA 3B60A 5JXGA 2JS7A 2D62A 3LX6A 1J7KA 2CMHA 3R3VA 1HTBA 4IMPA 3K8YA 3AM1A 4Q4AA 3BL5A 5AKXA 2N42A 2VSQA 2I2WA 5A6SA 1OIVA 1YR2A 4XD7A 3UJHA 2YOHA 2O7NA 1ZH8A 4AJLA 1RI2A 2H8KA 4OHWA 3R76A 3I6ZA 1DXQA 1DWPA 1E4EA 5ENVA 5JNUA 2IXEA 3OLXA 4NX2A 3GAAA 1BS9A 3OKCA 4G4SP 5T8KC 1O1YA 1JHVA 2CLCX 1JHZA 1O97C 5CDGA 4TT3D 4FBLA 2CNDA 2FG5A 3I76A 3BMOB 1ENZA 4CDRA 3JWGA 4G24A 4WLFA 2IE0A 4HDRA 1NN3A 1O54A 2Q4TA 2VOEA 3V8MA 2ZRFA 2Q27A 1KYVA 2UZ1B 4FKZA 5ADVA 3EXG2 3B6MA 3C8MA 4K1LA 3DDWA 4WN9A 5CLJA 4URXR 1IPFA 2YKGA 2I0FA 3EOBI 1IB6A 1VYUA 3BL6A 3ABSB 1XRSB 4H1WA 5K6AC 1MG5A 3QU2A 1G3IA 4TV9A 1BQ3A 4YB8A 5K8IA 1S01A 4ZQFA 3AEXA 2WUWE 3X0DA 2VBFA 4G26A 3IPYA 3BOSA 1EVEA 3C39A 4FJ2A 2NW6A 4ASUA 3JZIA 2J3EA 4N6NA 4BAZA 4TZTA 2XYHA 3S2IA 4LBYA 3PC7A 3QEBZ 3WKCA 4BXOB 3MA0A 3JD2A 4JYMA 4IHAA 5JYCA 4TROA 5KOYA 1DBPA 2BKAA 2Z3WA 2XUHA 3NC0C 1QCYA 2AZ4A 5I3CA 4MHTA 3PE3A 4DDKA 1Z4OA 1A9RA 2EHJA 4A9AA 4N49A 2WNHA 2Z8YA 4MH0R 5B1YA 3H97A 4D44A 4EB6A 5TR9A 8AT1A 2WKRA 3RC8A 3JQEA 3NP7A 2BONA 1JW9B 3E0XA 1QK3A 1SVUA 2IOYA 2R8EA 4QBHA 4GE3A 4U7JA 2HZBA 2B1JA 4MK4A 5DHQA 3ZDYB 1S02A 3AYXB 2FAXA 5T7BA 1QR6A 3A25A 3PA8A 4KXMA 3P7MA 3SQNA 4J1NA 3R8FA 2DKOA 3OJCA 4G67A 4DLLA 4W9NA 3EZ9A 5DRTA 4KPFC 2RHCA 3ET5A 3PC8A 4IMJB 3VNQA 4CMJA 3B5EA 3QFHA 3DEYX 1RWWA 3O21A 4JQZA 4D9BA 2OCDA 1KNQA 4EBBA 1KFBB 1WDWB 4MA0A 2DCMA 2PXAA 1KP9A 2WFLB 1OE0A 1AKYA 2ZT8A 2ECOA 2ZYHA 4I46A 2WWGA 1KFJB 1KH1A 3GHHA 2IV3A 3STXA 4IBOA 1NG9A 1IQPA 1RHRA 1T9CA 5KVCA 1HFKA 5CYOA 1DV1A 2WU3A 1H2XA 1TJPB 3AESA 1QIFA 2JAQA 3GFFA 2NUPB 3GGSA 4A82A 4DNXA 1XJ0A 1HQDA 1OFUA 3KYBA 5A5GA 5GAJA 1M2OB 5K6RA 4QYWA 1QGUA 1KY2A 2ALJA 3AHCA 2JVJA 2E6KA 2V7UA 1DCMA 4I6JA 3UJ8A 2YVAA 2Q6LA 1OROA 5T3UA 3ZHUA 4PYIA 3R6GA 4P8RA 3AKEA 1JN0A 3SHOA 4AD8A 1GGEA 5AICA 1I4WA 3AXSA 1HE4A 1OT5A 2BHTA 3OIUA 3ZLBA 2QX4A 2W6OA 1XVUA 5B4TA 1FYXA 1WSBA 4Q4HB 5C1PA 2UUBB 2JB9A 1YD7A 2C2HA 2OCPA 4NICA 2QN6A 3DCIA 4BBJA 3O03A 3QNMA 4YCSA 2EC5A 1EDBA 1BHO1 5TV2A 4Y67A 1PWXA 4JS0A 5L4NA 1XBTA 4I2NA 2R00A 1UC8A 2WV9A 1VHLA 1P7VA 4S24A 3JWPA 2N46A 2IYOA 3KU1A 4ZQBA 3FBGA 4EQZA 2Q1SA 5F1YA 4F1JA 4D8WA 4LJYA 3E82A 4PYQA 1VL8A 1VIMA 1V6CA 3L07A 3MBKA 3H2ZA 3U1BA 2QTCA 4FIZA 2FE4A 1OBHA 3ZU4A 1V1RB 3L1VA 4C4YA 4CEHA 3K0AB 1EFRD 4HQFA 1PG2A 4LRUA 4LOHA 5LQUA 3FPHA 3THOA 1T29A 3HWRA 3QX7A 5L95A 3R23A 4S1WA 4YXFA 3BGWA 4EYGA 7AT1A 5LLSA 4JJAA 1YDMA 2ZJBA 3SGLA 4CTKA 1IY2A 4FS8A 4ZJYA 4U5QA 3BTSA 4L78A 3ZLUA 4BBZA 4MWDA 3EEQA 2FWNA 4Q39A 3MJFA 1WHTA 2QRZA 1WXFA 2QYHA 2A0WA 4RETA 4Q9HA 3GJ0A 5FHRA 2WU0A 2ZYUX 4WY8A 1JJAA 5DCUA 3U3ZA 1MDBA 3UUGA 1T5TA 3ZLTA 4AQDA 1QX4A 1BKDR 2PU7A 3BDAA 4DLVA 4M0DA 4HHEA 5E1DA 5TGZA 1W2HA 2ZIWB 4MR7A 3WE7A 4LHXA 5KINB 4M55A 4TT3A 3C6QA 1XA3A 4NHOA 4DUZB 1TJYA 1RFLA 2W4QA 4AW9A 3GFSA 1XN4A 1YVRA 3QG5A 2AQIA 1GKIA 1RBZA 2ZQYA 4M99A 4R01A 2X7JA 5AYVA 3ZHOA 4BVEA 3RUDA 1ZOOA 5CX4A 3GLFB 3TSCA 1DKUA 2YWCA 1RYYA 3ASUA 2OGWA 2QL7A 2BSAA 4NOKA 1MKYA 1IHXA 2JJ2D 1YKGA 2G5GX 5DBFA 4V0SA 1FFBA 4BZQA 3ZEAA 4GC9A 2RHLA 4G5YA 1SOWA 2AJTA 2XLBA 3ODPA 3I9V1 3M6IA 2B92A 3BHJA 4J03A 4NBKA 4PRYA 4KACA 4RQAA 3SFZA 4BJHB 4X00A 1TGVA 1CZNA 1OFVA 1ZI9A 2C5AA 2WFAA 4EMBA 1PZNA 2ZDHA 4NI5A 3VR1A 3N0VA 3NDPA 2BFMA 2A1IA 3SEQA 5BN4A 4L5BA 1A5ZA 5EWMA 3O8BA 1PJRA 4FFBB 4R8RA 4UMDA 3U9TA 1PJ3A 5BQXA 4LWQA 1ZL2A 1Y4ZA 4CKEB 4QUJA 1GT6A 4MGKR 3TVDA 1ARZA 1WDLA 1Z0ZA 1E77A 2GEBA 2PVSA 3O95A 3RIXA 4EY6A 1DUSA 1MB2A 1UBTS 2IUYA 2HJVA 4EHLA 3JR3A 4O3FA 4JT2A 5ERGB 1SG0A 3SLRA 1FXSA 4WLEA 4Z0HO 4CIWA 4EUHA 1WS6A 3AUFA 1U2GA 1RAEA 3PFGA 5JWRA 4FMCB 3IS3A 4PGHA 1ES9A 5DM1A 1CY6A 2R1TB 1ODTC 2Y6UA 2ZIFA 1YJBA 2VNJA 2N47A 1B41A 1ELOA 1PYGA 4M9SA 4YMWA 4YJ2A 1RRCA 1LLUA 1WKBA 1OUMA 1V2GA 3FZNA 1HWYA 2XRYA 4NEQA 4LF6B 3MCAA 4F97A 2OP1A 2W2NA 2CCJA 1YK1A 4Y2RA 4E5SA 4F6LA 3VJRA 1Q83A 3AOEA 4ME6A 3EIHA 1SRRA 4N5LA 1AS2A 1ONOA 4FLMA 3LUDA 1L5NA 4CQMD 1BMFD 3CVWA 3THXB 1R18A 4YTEA 4HPJB 4NABA 3WYAA 4M1ZA 1XEAA 2P78A 4NNOA 1BDHA 2C3YA 4P38A 1R12A 3A6EA 3OPNA 1NYRA 2Y8EA 16PKA 4EGAA 3IIIA 1ND6A 1JTFA 4MGEA 2ETVA 1OVGA 1WUTA 2HREA 4G8BA 3RO7A 4KSYA 3T0IA 3W5UA 4M21A 1I13A 4XQCA 4UUNA 3UQZA 5CB6A 1KPGA 1LSUA 4U2GA 4XGQA 3E8XA 1B16A 1UJ6A 1KZ4A 1U8ZA 5AKEA 2O5VA 2R6AA 4XX0B 3WGGA 1OFHA 4RJKA 3UF0A 2Q21A 2WV7A 4W8HA 2IYLD 4UTOA 2DHDA 3A6ZA 4IH1A 3ADCA 2XBLA 3EZGA 1J5PA 3R0ZA 4QGAA 3ZYCA 2NZYA 2LIPA 1OH5A 3FMPB 1M75A 3OY2A 3GT0A 4JQOA 1TZ2A 1SIUA 4UMFA 3EEFA 5LCXA 4IV5A 2WJAA 4EPXA 5B4UA 1QE0A 1P7WA 2EWVA 2ZRBA 3TVYA 2QBYB 3BXHA 2BELA 5FI0B 3LNCA 2MYNA 4K9RA 1W2WB 3F4BA 3KBBA 1UXOA 4JVOA 3U13A 5HJ7A 2OBFA 5E1BA 3CIOA 1JMKC 3ILHA 1IWPB 2OUIA 1KMQA 5FOTA 4PO8A 3PVSA 2C2GA 4I1VA 2O7RA 4KZKA 1YJ5A 3U7QB 4CLHA 2NP6A 2GLXA 2HPAA 3AILA 2GO7A 2IITA 1UM9B 2NUBA 3DXXA 3VYUB 2UUAB 4IUCS 3F3YA 5HG0A 4BLPA 4MWGA 1E5VA 2J67A 5J23A 1XK6A 1EFRA 1SXJC 2BI7A 2ZRQA 4UHJA 2YHBA 3K5WA 4OKIA 4BB0A 1X7WA 1QHHA 1Y3BE 2FGKA 2CT8A 2H5EA 4U7PB 4E5YA 3KEMA 4I2VA 4XTCS 2Z3ZA 5DBHX 2BEVA 3GB9A 2WHYA 4QRDA 1MJFA 2TYSB 2GJSA 2WWXA 1KRHA 4TMYA 4NAHA 2F43A 1BVUA 3EXG1 4ZFNA 3EB9A 1Z4PX 5CK5A 2C07A 1FFDA 3K4HA 4G8CA 4YRMA 5J58A 3AKCA 4LV6A 5KIAA 1MXHA 5JTUA 5IJAA 2H07A 4GUAA 3DHYA 4AUEA 1K5DA 5HKLA 3CLUD 5E6RB 3G9UA 4LSMA 3VO1A 5HOEA 2YWHA 1L5KA 2V98A 4TSFD 1NDHA 1VMAA 1DIRA 3ZWWA 1USKA 1JSXA 3E5HA 4FOOA 5ECYA 4OQMA 4ZAXA 4D4KA 3DEKA 1QO9A 2PXHA 3P9YA 2VDQB 3MIIA 4HB0A 4OQNA 2JJ2A 2PUFA 5CNIA 5ALMA 1RRVA 3K9FC 4X60A 2ZJ1A 2QM8A 4DV0B 4F3KA 4Q4JB 1WPRA 2EARA 1N5OX 4GX2A 4NEHB 4Y98A 2BGGA 5CA0F 1HKUA 3D2BA 1TLLA 4MRSA 1VJTA 3FZYA 4OLBA 4L22A 4NOLA 4DT1A 4BQPA 2UDPA 1HDEA 4PHHA 3WWOA 1OLXB 4IKEA 3T5MA 1DADA 4XARA 5LYJF 3PQEA 2MSDB 3C6ZA 1BFUA 3ADBA 1XA0A 3HGQA 1A27A 2NV2B 3KYJB 3CNLA 4QLAA 5IFLA 2DQKA 1WEHA 2HK9A 1U3GA 5ITZA 1RJDA 3SJZA 1ZCJA 4FFSA 4YMGA 2PUGA 1CVLA 1R37A 1UINA 1D6JA 4LXTA 4CKYA 4B34A 5BRNA 1R9GA 1T2CA 5E4FA 2Z5VA 5DIZA 5K3OA 1RQ2A 2DH5A 1FXUA 1M8FA 2PYDA 2WINI 1T36A 2P35A 3CX4A 2WG0A 2FWMX 4JJFA 5FUYA 3FFXA 3ZHXA 3DO8A 1MB4A 2KBEA 1XXHA 3SJCA 3ZBUA 5JHHB 2J9ZB 4XDYA 3PQ6A 1U0HC 2AE1A 3W77A 5DM60 1Y33E 1GVHA 3H8VA 3GEGA 3NAQA 5LBIA 1XTTA 2G80A 2FUG6 5CLQA 1KK1A 1R10A 4XRRA 2C98A 3MB8A 4CQMA 2RONA 3U3RA 1CY4A 2I62A 3O8NA 3HB4X 2WSLA 4RF3A 1VPLA 1EVJA 4P93A 1ZS9A 4A73A 5CBPA 1UK8A 3EG5A 2AJ8A 4FZJA 1ANKA 2VUIB 4IDDA 3T1VA 4DLRA 2AMFA 3GRYA 2GFHA 2J33A 3BGOS 3WK8A 2OZLB 4UPDA 1DPGA 1I51A 1KMIY 2FNAA 3E23A 4U8HA 1E1LA 1WCIB 1CJCA 1C14A 4RAQA 4R5MA 3NU1A 4PO9A 5IC6A 4AN0A 3KFVA 1N2CB 1Z0DA 1WZ2A 3LV8A 5LBUA 3IULA 5F5NA 2WKSA 5BVHB 3RYTC 3S55A 2DLCX 2X8WA 4CTJA 2H1VA 4JB0A 3HLKA 2H1SA 1HXHA 2FP4B 2FZVA 3T52A 1NXTA 2H7YA 1RTKA 3D7RA 3TOCA 3HC7A 1JAZA 3PPVA 4DLXA 3IR7A 4B09A 2G67A 2X6QA 3SBDA 4C1BA 3UT6A 2P1DA 2C82A 1KI4A 1ZMXA 1ZVMA 1QIDA 2AVNA 5C4GB 5JAUA 4DSOA 4ZO6A 4F5DA 4ZAGA 1NNUA 3QZUA 2RGXA 2FK7A 3MPUA 1GL6A 4K9NA 2ZUDA 4R8KA 4ECEA 3Q6MA 5J4KA 4GXTA 4W5RA 5DNWA 4ZAWA 3E2PA 4HUQA 3JWIA 5MN4A 5F1KA 2HHHB 3QLUA 3GUCA 1MEJA 4W5WA 4DLUA 4X6LA 2HMAA 4WBSA 2RG1A 1MQAA 3SBEA 1ZD5A 2ONKA 4DZRA 3O8CA 4RA9A 3IAM6 3KCNA 3S2UA 5FV4A 3DUFA 3D6FA 3I32A 3O9ZA 3RAFC 3C3CA 1AUXA 1T4MA 2QMQA 2QVGA 1YS6A 2VSYA 3K4PA 1AS0A 2ADOA 3O93A 4W8GA 3QU7A 4XYMA 5KYXA 5EMMA 4GQIA 1QAMA 1SVWA 3TIFA 1D6MA 2CLSA 2R4TA 3GCWA 1Z68A 2F7SA 3CPEA 5TS2A 1GYPA 3NT2A 4K2HA 1SWWA 4ZVMA 3WGTA 3LC7O 2IODA 3EDYA 1T9GS 4RXUA 3F5MA 1SGWA 3SR4A 3NBUA 2WTNA 2B4QA 2OBNA 2VBGA 3C3DA 4JX8A 4KV7A 3GMIA 2YZNA 3MIZA 3T15A 3BQNB 1VHDA 3W8RA 4KSBA 3UN1A 4B73A 2Y1XA 2GYVA 4L5YA 1I7QB 4MUIA 1M8JA 3O8OA 2JH8A 4DMMA 1FFEA 3BF7A 4TSFA 4GWKA 1JRLA 4LE0A 2YTZA 4N6OA 1YZGA 2VTVA 3TZBA 1KY3A 2FEPA 3DKKA 3UV6A 2IBMA 2JD0A 3A4LA 3NHLA 2DT5A 2NU7A 3RFUA 4ENWA 3FXAA 4KUGA 4MGHA 4MYUA 4DTCA 4EHBA 3Q72A 2J0UB 3EE6A 4YUXA 1GPMA 2G08A 4QBFA 4CM9D 4ZXFA 3OPXA 2JLWA 3FVVA 3HXLA 1K8XB 3UHOA 3TR5A 5LYJB 3NEJA 3WB0A 3KKOA 4D8YA 2FKNA 2W93A 2WW8A 4HDAA 5FA8A 3IHTA 3GVHA 5BYJA 2PSFA 1WZNA 4OFWA 3V1TC 4DHEA 2IZZA 3EOZA 5EKDA 1THTA 1UXKA 3D3NA 4NYIQ 2FW7A 4FYJA 4GIBA 4Y1RB 2K7FA 1VDZA 1XZNA 3DMTA 5K8JB 3NG1A 4L8VA 2IEYA 3EK2A 3RROA 4HY3A 2ODWA 3ZIAD 4BFCA 5JO9A 4PGFA 4F85A 4ITVA 1MIOB 4RSMA 3O3MB 3IOBA 1FU7A 2FF7A 4RGYA 4B3XA 2XV1A 3A9RA 3AL3A 2B1IA 1IXRC 1JEDA 4PGGA 1YXMA 1I5OA 1U9IC 5K4AA 4F06A 1KR2A 4JI4B 5KYUB 3VZBA 4RCYA 3OCJA 1HE2A 4FONA 1ODLA 4ND8A 3SFVA 3ZTYA 1ZY2A 3I34X 1EZ1A 3IIKA 3JQ7A 4PXYA 5FR1A 4DYHA 4L7QA 3KVNA 2PKRA 3SOZA 1RWXA 2CHUA 3JAMA 1DO0A 2Q5OA 2ZXEA 2ZB4A 3EBOA 1UPUA 3FFTA 3GCZA 1E0JA 3PJEA 2C0CA 3ZE8A 3DBHA 1I2DA 2ZUUA 3R41A 2RJ3A 2B1GA 1X6VA 1WCWA 2Q9CA 4RMIA 4ZALA 4QODA 1UEJA 4DMRA 4RIHA 2DWUA 3L6RA 4G1MB 4AJ9A 3NXKA 3EQ2A 1SR8A 4RIEA 3ONFA 1Z17A 4ERXA 3RREA 2JJQA 5LDGA 2A5LA 3WRYA 1XK7A 1K75A 1Y1PA 2CD7A 3EXFB 3OA0A 1XWFA 3OPYB 4L73A 4OJMX 5EIHA 3FUTA 4AULA 4V2IA 3WNBA 1DTWA 4KVFA 2NXJA 4NH4A 3TNLA 1JEJA 3DAHA 4P31A 3C43A 2A5YB 3AUAA 4MW0A 4Q1FA 1XNJA 1CPYA 5LA6A 2JKZA 4A6PA 1I7SB 4FW8A 2B3TA 1JG1A 2Q5HA 2NZ2A 3KWJA 4QIHA 4QHTA 3PU6A 1NUQA 4KLNA 2IYVA 3EXHC 3UJDA 1QK4A 3PXAA 2FPRA 4GI1A 4JOQA 3ZGZA 4AO8A 3VTFA 3HNOA 1DJOA 1X1BA 2QVXX 2G1JA 1C1HA 1EP1B 3PWTA 3T7IA 1QX3A 1AUPA 1L9XA 3DCJA 1KVQA 1MA3A 2CGEA 4LXGA 5D87A 5HIIA 4D8VA 3MBIA 3WQHA 1QH8B 1XXLA 3HK2A 5A3RA 2VDRB 2XMSA 1H2AS 4GVLA 4YAKA 1KXJA 4OMDA 5DGCA 3EDOA 3MUFA 1BX1A 6AT1A 3MINA 4OQXA 2OXFA 5K0JA 2ZIGA 2FMXA 2GWHA 1IHDA 1UWKA 3UFXB 1UBJS 4ZT3A 4YWHA 3IUMA 2YZMA 1IIRA 4XIFA 4M1OA 4EO9A 1TEZA 4MWCA 1E2DA 3F6YA 4G4IA 5FJIA 4E12A 2YBEA 2QTFA 2WA2A 5G4LA 3DMRA 3IPLA 4MUFA 3ZC3A 3LU1A 1QBKC 4PTZA 2ATEA 1Z0IA 1D8AA 1P74A 3INTA 4PYRA 5M3BA 2OB2A 4X97A 2WU1A 2M6KA 2I67A 1DDGA 3H5RA 3IGFA 3RRFA 2A2ZA 1HTTA 2ZJAA 1FYEA 3JXEA 5JANA 3U7JA 1CS0A 4LK2A 3NHPA 3UA4A 1KSHA 3IMFA 3ESYA 1WABA 5AWFC 1JH9A 1BFKA 1J4AA 4BNHA 3RVKA 1G8YA 4MOWA 1N4AA 1E3LA 5HFJA 4CMGA 1HNZB 1OZFA 1QF7A 1UXHA 3OFSA 5DK4A 4DLKA 2AZMA 1UMCB 4RXTA 5A5FA 5TF0A 2HT6A 2O20A 3AERB 4EYKA 1M0SA 1N7GA 3D8TA 3N5CA 3UTCA 1A2BA 1XFAA 1OTXA 2PH3A 3H2HA 2OXCA 3BS4A 3G02A 4PCLA 4QUKA 4DLSA 5B3JC 3WVNA 1JHDA 1X8LA 3QKRA 3IQIX 1E6KA 4AWXA 3PICA 2YASA 4QU8A 4BVFA 2O5RA 2D2XA 4X95A 5LDDC 1B23P 4CM9A 1GNQA 3IT3A 2Q2NA 4J0FA 3DOEA 2IIQA 4YAWA 3USES 4FB5A 7MDHA 3WLSA 2VPQA 3TGWA 5IP5A 3GK3A 1Y3FE 3DE3X 3G0GA 1RD4A 3DE0X 3RVDA 1XZGA 2NACA 3PFHA 3QUBA 3SC6A 2MWMA 1D3AA 2ZPTX 1M6WA 3IBGA 3TLEA 1S9HA 3I8SA 4QGBA 5LJLA 4BMPB 1G7CA 3CLRD 4B7XA 4DNOA 4AMUA 4PYJA 3PDHA 4O0LA 5FXMA 3ZXXA 2HDNB 1RW4A 3GEHA 3VTKA 1U8UA 3GNQA 4RZXA 1T24A 1EUQA 2H1FA 3F8TA 4GDMA 3ZIAA 1JSCA 2XPCA 3UMJA 1YR6A 4XCXA 2D3TA 2G71A 4RAOA 4Y6RA 3MERA 5AI6A 2R6GA 3VBEA 1PVDA 1C0IA 2V58A 3N8GA 3QSGA 3RWMB 4AT1A 1G59A 1UMDA 4K28A 1TU0A 2WYIA 5TVGA 1G8FA 2OHGA 2NUAB 1SC4A 4BE4A 2JHFA 4TXNA 5JATA 1BCSB 2GJ8A 3S1AB 3DEAA 1EVYA 1G3QA 1ICEA 2G82A 4KV9A 4QBTA 5DW3A 3RG8A 4UPEA 1ZXXA 3MNFA 5CLLA 1QC5A 2ONCA 3D4BA 5LXTA 2G3YA 5D2CA 4BIIA 5GVRA 2AKEA 1H66A 4INPA 2C4UA 3GWZA 1OI7A 2FR8C 4F93B 5LNK6 2O1XA 3VDMA 1ULBA 1XP5A 1ZIXA 2XJ9A 2GYYA 2GYWA 3ZD9A 1KH3A 5AFSA 2NZ8A 1NURA 4RHTA 2JZOA 4J6EA 4F9GA 3C5HA 4L28A 2Y9MB 2BEUA 4TYQA 2IZ1A 3A05A 4LYFA 4XM0A 1OWMA 2GVNA 3ANLA 3JQ9C 2WF5A 3KXKA 3TZCA 4JLBA 2OQVA 2A5FA 3IQGX 3OSUA 3QBTA 2Y0DA 1TCUA 2ZT7A 5JQGF 3FSGD 1UDAA 4G1BA 4OHVA 3E9DA 3KSRA 3EA4A 1RLTA 3GNSA 1RQ7A 3GDWA 4C2BA 2WT8A 1FNSA 4CTNA 4FHZA 4NYJQ 2PWPA 5TXGA 2Q41A 1DKOA 5GOTA 3SC2B 5PGMA 3V4SA 3Q12A 1VIYA 2NVUB 2X4GA 2IX3A 2LCQA 5F5XA 1I33A 2PRSA 5JZ9A 3JD1A 3R75A 1Z5PA 3W04A 2GAFA 4IW3B 2W6PA 2C2ZA 3UC5A 1U8TA 1MX1A 3F1KA 1NI3A 4DV3B 2E85A 1Y3DE 4NPAA 4F60A 4YAIA 1NBIA 3GZTB 1SCIA 3KOWA 1U2DC 2B8WA 3UCEA 2H5IA 1DIHA 1JDBC 2QAJA 1FU8A 1NM5A 1WUHS 1Z2AA 3VVCA 1Z2OX 1EESA 4Y9RA 2P77A 3M3HA 2G9NA 1GPWB 1J8DA 1B8VA 4LYEA 4L74A 3ZH2A 4JI6B 2Q50A 3TIGA 4EX6A 4XXHA 1D1SA 4V1CB 3LBFA 1GRQA 4XFDA 2BKVA 3B1YA 4UDYX 3BHMA 3IAFA 1T5HX 3WHIA 4GFDA 3ZCTA 4YQYA 3VOSA 5IHPA 1YMVA 4IIJF 3DM9B 4EJ2A 2FG7C 3DMGA 3KVVA 4YJ3B 4ZEOA 1JIQA 2IV2X 5BMVF 4YUYA 1O4VA 3PDCA 4CFZA 5HKKD 3BMQB 3COJA 4HDMB 1RZ3A 4E08A 5LZ9A 3LYHA 3IX7A 4PAOA 5T6MA 1IZ7A 4TVBA 1WVIA 1DRVA 1UBUS 2YMQA 1GPUA 3PIRA 3OLWA 3KVYA 2OXRA 3L93A 4KQFA 4PIMA 1DC3A 2JLZA 4P2GA 3PUYA 1BWSA 2X5KO 2YHIA 5K7SA 2QRQA 2XZDA 4JAVC 3L18A 3RUHA 1GIAA 1YAHA 3G0OA 3ETLA 5IT0A 4Y2TA 2P5YA 4QEKA 1G55A 4IH4A 4ESEA 2CFSA 2ERYA 1OYYA 2GJ9A 4PNPA 1EP9A 4RQUA 2GCIA 1VJ1A 4DSZA 5BSMA 3ILSA 2F3PA 5HRCA 2X4DA 2R7AA 3KDSE 2FQYA 3I45A 3A9TA 4Q3EA 4MW5A 2CXUA 1YU9A 2HA7A 3DM5A 4NZPA 4RW0A 5CJPA 3PI7A 5FBWB 3VC2A 1U0BB 3C70A 3DGFC 3K0CC 4FDLA 2TS1A 2OUKA 5H3CA 1ORRA 1M1YE 1FP4A 1MO4A 3LVRE 2YN0A 4RPCA 1KH2A 2LRHA 3CTPA 1WEKA 3KQTA 5TPWB 4GMHA 2CWWA 1ZI6A 3O1HB 3AGQA 1I1OA 2QL6A 3DXYA 2W2LD 3ED5A 2E4YA 2HLDD 4FGSA 1G41A 1KEZA 4A2PA 5IN4A 4K40A 3OPYI 1Z18A 4PTYA 1BKSB 1L3CA 4BMDA 3TJZA 1UQRA 4I9GA 3BJMA 2NWQA 3FCSB 2AXQA 3D3EA 3JQ8A 4OB7A 1FZTA 1PVVA 2RHMA 2FSHA 3FB1A 2PUHA 2X8JA 4CR6A 4EF6A 5K03A 3N9IA 4MS3B 4J16A 4D9KA 2PIAA 3I5UA 2O2XA 4GGOA 4IIHA 2V7TA 1NLFA 1PWZA 3LG2A 4U3JB 4W82A 5ALZA 2ESRA 4QUDA 4TL8A 3VAZA 3BSFA 3RF7A 4B3SB 1TAUA 4NCJA 1QRAA 2WK1A 3K1AB 2CNOA 3A27A 4ZCQA 5HS6A 3VBCA 4TZ0A 2FUNB 2WG2A 4FGWA 1JEAA 1JLLB 3GLKA 2D0OB 2PT9A 2WTBA 1G2QA 3MCZA 3HVHA 3VHXB 2I99A 2JBHA 3IQWA 2G9VA 3QU9A 5G1OA 3PR2B 1MU0A 1YQGA 4HDSA 3BGDA 4JLOA 1X1SA 1U5BA 4E5KA 4MARA 4OQ4A 2HOQA 4X64B 1Y37A 4Z4HA 2DR3A 1MF7A 5K3FB 2RAVA 3AINA 3LUCA 4WZBE 2HKIA 1DQZA 3SSOA 1CQIB 2D1TA 1G5HA 4QGHA 4D57A 4O2BA 3NVAA 4HGZA 2JGJA 4R05A 1IJEA 4DIFA 2XUOA 4JI7B 3ZW8A 1ZJWA 1RYNA 3I6IA 1DUIA 3PNMA 2GQ0A 4H7IA 5FWYB 4IFTA 2AC7A 1ISFA 1BXRA 4TKZA 5EIBD 3NMUF 3KV1A 3D1LA 4IYJA 2BMJA 1A5SB 2CXPA 4RESA 3RTCA 2PV0A 3FSGA 5DX8A 5IM4F 2IHJA 2VJNA 3A6FA 4KQ2A 5FOVA 2O0HA 3EYWA 4AJ1A 4XJTA 1DXYA 2PANA 3SICE 2ZB7A 1Z5UA 2F00A 5FLXA 1OPXA 5FP0A 4BHTA 4C3ZA 1NXWA 1XQ6A 3L1IA 1E5XA 5B3AA 3ZCPA 3DBVO 4OVKA 2V4MA 3V7UA 4EJ6A 1SKAA 1BNCA 1LDYA 1DLIA 1ZIYA 3GRVA 3AEKA 1B3RA 2CLMB 2PKQO 3VU9A 5IYZF 2GPNA 2V9CA 2CYAA 4M8KA 1MOPA 1VGVA 1N2HA 4B46A 3IJEB 3NPAA 3WWCA 1XEWY 1PJBA 4H0NA 4JXKA 5KJ6A 4I36A 4M22A 4AO7A 1J5EB 1JF8A 3NALA 3EEBA 1YQUA 1NJ8A 3PT9A 4IDEA 2Q6VA 3KS9A 3BK7A 2DH6A 1MPTA 4Y6PA 1U8YA 3IBFA 5E8RA 2C29D 4JNCA 1SG6A 2DMRA 3G68A 1SIOA 1AY0A 1Z0SA 4TVKA 2CK3D 4B79A 4M9XA 4F8JA 5GZ3A 2JIRA 3FSEA 4J7AA 5JSKA 3R7FA 3KSAC 1LBSA 2BOVA 3DQZA 3PCTA 1L1QA 2EHDA 3AEQA 3SZOA 5BMVB 2C2OA 3RV4A 4C22A 1KY5A 1I80A 3MILA 1G9SA 3G5LA 1YA4A 3RSOA 3X1YA 2AOUA 4LDQA 2GD2A 5HKKA 1RVDA 2MSLA 5H82A 3N07A 4R16A 3LCCA 1XCOA 3DEJA 3THWA 2HU7A 3N76A 3C1OA 3QKSA 3RNOA 5FL7D 1XQYA 2IL1A 2BL4A 5J5CA 1Z6YA 3WMRA 5F51A 3VR6H 5JSZB 1W25A 2AFHE 3LRPA 2CKDA 3P0EA 3IESA 1GGNA 4S1VA 1PEAA 3TW6A 3BUSA 3L01A 4Q3CA 5T5QA 4ZCTA 3H8SA 1X8KA 4P32A 3NVDA 1NJGA 3T9DA 4D7AA 3QITA 5DGDA 5JYEA 4G37A 2UYGA 2E37A 1BN6A 1SD5A 2C00A 2INGX 3ESBA 5JH7F 1MTOA 4IZHA 4I66A 1XX6A 1D2HA 1OX4A 1M34B 1TC1A 3PKIA 4K03A 3SE7A 4AKTA 10MHA 3H5NA 5IJWA 2QMEA 2XR1A 1AIPA 4GW3A 1ABBA 4WXPA 1MEOA 3ASVA 4OJKA 2QX9A 3EEYA 2QRLA 1IJKA 1P8JA 1I30A 2Z4TA 5EP2A 4BGEA 3CNBA 1TVEA 1PO7A 1ZN9A 4OXNA 5A04A 2YH2A 1ADFA 1WXEA 2P3LA 3K70D 4JUAA 1XZBA 1P81A 2KM1A 2OENG 4N18A 4JI2B 2D1FA 2HLDA 4P4SB 4TTTS 1IN1A 3L4SO 2YC2C 1UJ4A 1ZCAA 4NESA 2AEJA 2JVIA 4QBIA 2I2AA 7MHTA 1PT9A 1LFAA 1BH6A 1KNXA 3CX8A 1PFWA 3DDCA 4QPJC 2ORIA 3H9EO 2FDXA 3P0HA 4RQBA 1ZVQA 2I34A 3A1VA 4KQ9A 1HEYA 3AB3A 4GLBA 4MUHA 4QDXA 1Y8CA 2JGEA 2PZKA 3OEED 3PNSA 4LI0A 5EZYA 3TW8A 3OECA 4HNTA 4RF5A 4ILKA 1U8CB 4IGEA 4IJWA 3U7IA 4NBSA 3ETCA 4FE3A 3BXPA 1B0PA 4FTWA 4EW6A 1SOMA 1SQGA 2XVYA 3LXXA 1K6EA 3DDSA 1Z0KA 3G1WA 4G0PA 4P7BA 4C08A 2YFYA 3E3MA 4MPTA 3NM6B 3WWDA 1RRKA 2EZUA 4L5CA 5H3HA 4CNBA 2V7EA 4CI9A 3KCQA 4KO8A 5JI2E 2DLNA 4NBUA 5HNKA 4YT8A 1K8RA 1VHWA 2Q5EA 3ZE0B 1F48A 1SUSA 2VRBA 3GZNB 4GR5A 4V1CI 2WM8A 1QRDA 1T2AA 5HVNA 2GRAA 3OIDA 2UKDA 2R7KA 4MYRA 4HJXA 4YRGA 5JJLA 1KAOA 1YH3A 1K06A 1X2EA 2JGAA 3AETB 2YJZA 4JZKA 3B38A 3SXJA 1OOEA 1EJ6A 2HCBA 4QAJA 5LKRA 5CLFA 4PYKA 3ESXA 3L0DA 3L6CA 2JNWA 5FIUA 2YCLA 1BW9B 2FWBA 1PQPA 4HX5A 5I9TA 1M2EA 3OURA 4IDHA 3PD7A 4IJMA 4QNMA 2IRWA 3IJ5A 2J30A 3KB2A 2VSOA 3NBMA 1HX7A 3FR8A 4IJ5A 3TQQA 3R0QA 3A3PA 2VYFA 3HHEA 4HNQA 2KW5A 3JQAB 1GG9A 2IW3A 4NFHA 1OFIA 1YZFA 2ZRMA 3ZQUA 3SK0A 5FWNA 1OXBB 4YYEA 5E7IA 4OFBA 3NIDB 3NPMA 1AK2A 4XGNA 3R9KA 1PE0A 3Q11A 4MA5A 1RQXA 1KERA 4N65A 2WRZA 4URZR 2H7XA 4YN3A 1TOAA 2D1SA 2JFQA 4JUDX 3VC7A 1II9A 2OORC 3ABRB 1TJ3A 3H4TA 1ZO8A 4R0MA 1KSJA 2EW1A 4IAOA 1DJQA 3DVAA 1TU3A 1RXEA 2J08A 2QMZA 3DYVA 4E0BA 1E98A 2VPIA 1PK9A 2CK3A 1MPXA 3NIGB 4URUR 4BEJA 3TB4A 1FW6A 1RBQA 1SXJE 1T34A 3LPAA 4KX3A 5GWXA 3B7WA 3N6XA 2Z6UA 3NUQA 3RJZA 2D5LA 1MP0A 3D8UA 2ZR9A 4LEIA 3C8DA 1KY4A 3DL7A 3EG9A 4KR7A 8MHTA 4M0PA 2PD6A 4ZOAA 2HR1A 2DUMA 3ICVA 3WQQA 2ZITA 4MRPA 5IXJA 5L3ZA 4MWZA 3A58B 2BFBA 3R3YA 3ADOA 4YGYA 3URKA 3CVJA 1ODFA 2EL7A 4L3VA 2QWXA 4RTMA 5GZ6A 1C4WA 2KJQA 2V5AA 3OQVA 1T9GR 5FL7A 2KS6A 2AK3A 2QPLA 3GCXA 4EHIA 5LMNB 1CJUC 1J2JA 2I7TA 3DUWA 2HMTA 4PM4A 1PKXA 2JA1A 3OLZA 2R6HA 1E9FA 1ST3A 8ADHA 4O02B 3FJOA 3HJUA 2B5WA 4GH5A 2AWNA 3KOUA 3IVCA 4TKUA 5AK6A 3VZQA 4ZI3A 5HSGA 5JH7B 4F2DA 1DE0A 3QMWA 3M81A 3R6LA 3D5TA 4E5VA 4OV6B 2I2DA 4H3SA 2C8JA 4G81A 1YBAA 4L4YA 3OFKA 4JK3A 3OT1A 1SPBS 1PRYA 5FPYA 3WR5A 3KRTA 4QOFA 3IL2A 1U7OA 4M8NE 1J56A 3X1MA 5DCYA 3WIUA 4EUNA 3Q8XB 1X1RA 4FEGA 1B76A 4HJRA 2ZTVA 2C3OA 4C3UA 5A0TA 5KTKA 3P94A 2FSPA 1DS6A 2D5BA 2FP3A 5LIRA 1II8A 2HRZA 3P4YA 4DDTA 1UXJA 1WPXA 3NRBA 4Y0AA 5ALYA 4ZCPA 3NTLA 1QKIA 2YHSA 3T54A 3K0HA 4F84A 5KB3A 3KT3A 5A4DA 4KIGA 2F62A 2WZCA 2B4YA 4DQDA 4KYTA 3IB6A 1BD4A 2QX6A 3AFNA 3NTUA 1FPMA 1F9AA 1ZITA 2BFWA 2GCNA 3QPVA 4KO4S 2RIPA 1LPOA 2NYRA 3FJYA 5IJXA 2I8LA 3TRIA 3ZDFA 4BKMA 4ZEVA 2R0QC 1Z16A 1L0BA 2LWIA 3OEEA 1ECFA 2VDKB 4H77A 5CCDA 1JT9A 2G4VA 4IXMA 5TMBA 1AB5A 2FPIA 1ZI8A 2GN1A 1MO2A 1A9ZA 1XLTC 3AUJB 2D8MA 2FQ1A 3GDGA 4FCWA 2VXBA 4P0TA 5ECWA 5J9FA 3IBSA 4DRYA 4YRAA 2DBVO 3GH3A 1RPJA 5H5JA 1KAEA 2BUCA 2Y68A 1PR2A 4B83A 5C4IA 3CGGA 4KZPA 5C5CA 2AFRA 4UUAA 3P9QA 5C1OA 4A6XA 4BFWA 4ZDKA 2BKUA 3SBXA 1JE1A 2VFAA 2DPYA 3TXAA 3WRVA 4E2FA 1SAYA 3PNVA 3UOGA 4WCDA 1KMMA 1XEXB 3TE7A 1RWPA 4R54A 3B78A 2JFOA 5L3QB 3KJZA 5BPFA 3AIOA 2LP4Y 4HWSA 3RS2A 1V7ZA 2VIIA 3JVVA 1HZZC 3LL7A 4O2LA 1WBBA 3KSMA 3M4NA 4H3KB 4XLTA 3AP3A 3DBLA 5U1PA 2NSHA 5TGDA 3V9AA 1YIOA 2RGRA 2IIPA 3VNSA 1LBTA 4IGIA 1PSZA 2JG3A 1VCOA 5T8KA 1N3BA 4BLSA 2BKEA 2HDHA 1L5LA 3B3QA 1ZIPA 2H8GA 2M6SA 2PSEA 3A1CA 3FJ1A 3GT4A 4UCXA 3VVLA 5B7QA 1WO8A 1QS0A 2VK4A 4IIYA 5CIQA 5LZ5A 1CG6A 2G0NA 5A9RA 3IO5A 1G38A 3K9GA 4AVYA 1FJXA 1I14A 5H1YA 5G4KA 1Y9DA 3LHFA 3QXXA 1MAHA 3ROPA 5CB4B 3ZD6A 1VBFA 3CSDA 3GAMA 1NNEA 3HJCA 3VVBA 2SHKA 2ORED 1CEEA 3O31A 4MUEA 5IUJC 1F14A 4QAQA 1GPH1 1GG2A 1SOAA 4BY9E 2ZGVA 4KHPB 4WBXC 1Z4IA 2CMFA 1M1YA 2ZI6A 3FPBA 4DJ5X 4DLNA 3FYUC 1A04A 3TDNA 4TQ9A 2HO5A 3V80A 1RSZA 3VSDA 9MHTA 1FW8A 4TM7A 3MTIA 2XE6A 2NZVG 3UGQA 1JR3E 5E9WA 5CLGA 3HB0A 2FWRA 4PG6A 3NJ8A 5JJIA 4LJSA 4UE2A 3HP7A 3BE6A 3E3NA 4Y18A 3D6MA 2OD9A 4XM1A 3L4KA 1U9CA 4AWBA 4B85A 1VE3A 4ACAA 3R9XA 2VAPA 3O8QA 3OCXA 3B2EA 3JALB 1WD5A 1DTSA 3JVUA 3CUEF 5IXSA 4V03A 1Y8AA 2HXSA 2VDWB 1XZEA 1P9NA 1SCNE 2EKZA 2QTZA 4ARIA 4O4LA 3D3JA 4S0XA 1JTVA 3LOQA 5JRZA 1WMSA 2VHQA 3HCBA 1PHRA 3E9CA 3FB4A 5AH0A 4JLAA 4NYMQ 3Q9SA 4I81A 4D26A 4FM9A 3Q85A 4JWTA 2H1LA 1JLSA 2RCNA 2C1XA 2EWWA 3LQ4A 4OQDA 3GY0A 2JCYA 2LCIA 2VNAA 3KQWA 4HB4A 4NFLA 1P9LA 4ZJZA 5FPKA 4FFVA 3GJSA 3LL4A 5K0TA 1ZJ4A 1OHHD 1OREA 2QM3A 2LE0A 4JR1A 1NC3A 3DZCA 2VPZA 3I30X 3HBAA 4OHOA 4ZA2A 2ZYDA 5JE8A 5BNFA 2BH2A 1FDUA 3D7LA 2JBAB 4MVJP 2N75A 5KI6A 4Y6QA 2CE2X 3ZJ5A 3S8MA 4BU1A 1VSTA 3PWZA 5FOWA 2WYOA 1ADYA 4WZBA 3PHHA 5EYPB 3R0XA 5C0OE 1ZCBA 4JD5A 3C6BA 4UM7A 4D0GA 2XUPA 5BW5A 4UNIA 5ICFA 5JAPA 1A4IA 5CJ2A 3TLGA 1OH7A 1KYTA 3LKVA 1Z4JA 3UJ9A 4YV2A 4ZJUA 2NOAA 2O48X 3AJEA 4QNNA 5CCXA 3HXQA 1KPHA 2QSJA 4R51A 1JJ7A 3B3JA 4PV7A 4ZU3A 1UBRS 1D4ZA 5FUVA 4KXLA 3EGIA 3H5LA 4RDXA 2G7MC 3FFAA 4BO9A 2PXXA 3ND6A 4POOA 1TF7A 3A0UA 1Q57A 2GPBA 3CG4A 2DG2A 1G66A 3JCZA 3A6PC 4D3XA 1JR4A 4GM4A 5DNUA 2IYZA 3BAFA 3OHPA 1K7SN 3N53A 1LJUA 2AWOA 1MAVA 2F1IA 4Z7QB 1Z15A 1QK5A 1KZ9A 2XT9A 2OTCA 1SG9A 5F7OA 1NY5A 3L8YA 2JARA 4UUPA 4QYTA 2JFXA 2O3QA 3EVGA 5ICMA 2AVDA 3UHFA 1RCTE 4X41A 4Q9AA 5EI5A 3VUEA 4BMXA 2O06A 5AIBA 1HT1E 1T8YA 3ZZNA 1PWEA 2C4TA 3BDIA 3P0JA 4FW9A 1OGYA 2XE8A 1QG6A 1DQNA 4R69A 1L7AA 4OKSA 1JQ3A 4Y2YA 4JOCA 1KEPA 3LVQE 4CFYA 3G13A 2OZKA 3X3HA 1E9CA 3LY8A 3FD8A 1Z3CA 1HEIA 2BUAA 2XVMA 4P7KA 1RJGA 3ZLVA 2YVUA 3VR6D 4JKOA 3IPXA 3W6NA 1R0WA 3MWFA 4XWGA 1SXJD 1KZHA 3ZNOA 1CUHA 3RHTA 1APBA 4URHA 3LWDA 2IYYA 2XBMA 4XDHA 2H4XA 1UOQA 5BQPA 3KTOA 3VFDA 1AMUA 4WACA 2I4RA 3NVMB 3TXYA 4Y7DA 5HQ3A 2HEGA 5HE9A 2ZYRA 1MXFA 3R3HA 1X7GA 2GD1O 4UAGA 4R2KA 3W05A 4INJA 2ORYA 1DIAA 4RTRA 1R6VA 4D80A 2P4UA 4KJXA 4LHZA 2G5PA 2X23A 5G0VA 3UJAA 3RW9A 1VI2A 1QFJA 3O84A 2FN8A 3ZNPA 2AN3A 4YAGA 1ZM2A 2JKVA 2OYSA 4M8LA 2VWHA 2AFHA 2BF7A 3CNEA 1G2PA 1YJQA 1YR7A 3QOXA 1Q17A 4O29A 2HV9A 2BZSA 3VC1A 2PSHA 1NXSA 1EE1A 2FZKA 5A9TA 4HVCA 2X0DA 3A1NA 2PJDA 4NG5A 4BQFA 4OHBA 2Q5IA 1Q1QA 3DC2A 4LXQA 8ABPA 1CLEA 1FX1A 1IAVA 1USIA 2BISA 4HEA6 2R8XA 4K1XA 4BTEA 2CLDX 2CMGA 5H68A 3ZTTA 3CJRA 4BL5A 1D0SA 4UDOA 1V7QA 3RRYA 1G42A 1N3IA 1MZPA 1R1DA 4BO8A 4IHKA 1I9GA 3VZSA 3MFYA 2C59A 3KFXA 4DG8A 2AXNA 2CSXA 3O4VA 1NZDA 3DE1X 4HAIA 3OCWA 2HGZA 2BRUC 1ADBA 3LJKA 4AUNA 5F12A 4A0GA 1TYBE 2ZJFA 2VUHB 3IVRA 1DSSG 5F76A 1H3NA 4L0DA 1GAQA 1I10A 1N6OA 2KSQA 3NOVA 3BJIC 1WDTA 4H1TA 4RGVA 1K8YB 2NZWA 3WDSA 4BAGA 4B84A 1D2GA 1P4GA 2D7JA 1JXOA 3GLHE 3FVTA 2WB2A 4FGUA 1JAXA 4L8GA 5LQMA 3NHRA 3E22B 1F8GA 3ZU6A 5CR9A 4ZEMA 1DKLA 4KQKA 4N76A 1CF2O 1PS9A 2J6IA 3P2JA 3QA3E 4NATA 5FI3A 1OZHA 3RVJA 5BW6B 3UPTA 1E9SA 1Z7GA 3A3NA 2ZJ6A 3TUIC 4ZZIA 2XH8A 3NB0A 1OAKA 2BFFB 2I4NA 1IFXA 3AB7A 3I9NA 1KYYA 5HP4A 3QWFA 3WS7A 1LJ8A 1A95A 2G04A 3B8EA 4L5AA 4ND2A 1OV4A 2PGLA 2NPFA 3QNWA 1TF2A 3K2IA 3R5KA 2GBLA 4M76B 2AEMA 3LWNA 1Z83A 2DE0X 3BFVA 1NVTA 5FNZA 4HUJA 1GGVA 4O8CA 4DIUA 1XD8A 2PZEA 2NXEA 2ZTSA 1UPAA 4JEMA 3ZHRA 2N1BA 4LZPA 4MIYA 4UBJA 3G8CA 1SCBA 2R5FA 4JKYA 4CYMA 4ESHA 3FHJA 3H2KA 4RVNA 2OFFA 5KNBD 2EJWA 2QUHA 2X19A 4KR2A 2X8LA 3WA6A 3S99A 1GA1A 4RIGA 2DULA 3UNXA 3E05A 3ACDA 3PQ4A 1UMKA 1H2RS 4J94A 4L4RA 3WLTA 1GUYA 1A9TA 2W37A 4LK3A 3EZ6A 5DI3B 5EE9A 2C0QA 4AJ4A 1MVOA 5BRAA 2F8TA 2XB9A 2C97A 1FF9A 4I08A 3C41J 2PS3A 1UAYA 3JQBA 1TM4E 1Q74A 2IYWA 4R1QA 1M2HA 2VS1A 4QUEA 1FTGA 2QIOA 3GGDA 1A8QA 2YMPA 4YRLA 5E9JA 1GN8A 1TUEA 4LN1A 5FEUA 1DKQA 2PMDA 1YZLA 2ZRAA 2OOSA 4MYDA 3TRDA 4B3FX 2WC1A 2QLBA 4ON9A 1IZZA 1E6UA 4NV3A 4ILEA 1HL3A 3WL4A 1E2PA 5B55A 5GADl 1P17A 3C8UA 2E1RA 3PDUA 4OU5A 4JOSA 2HCRA 2Q2VA 2XGGA 4DMLA 4YRSA 2IS6A 3MWDB 3PHLA 1PJZA 4FYWA 4KYVA 2VXOA 4LV8B 3HNRA 2GWRA 4FLEA 1QHGA 1ZH2A 3HFRA 3UFBA 1PR4A 2QZZA 5CA1B 1JR3D 3TXXA 4MGIR 5KOHB 3G8DA 2ERXA 1XPRA 2ZT6A 4FI3F 5KYWA 3I53A 3NBAA 3H6KA 4CIVA 1RPTA 3FR7A 2IEDA 2XNCA 3S2SA 2GD6A 1OYWA 3VDNB 5COAA 1SXJA 2WTXA 3LUPA 3EWSA 3M6VA 3RUIA 4DADA 1QUEA 2WD8A 3WJ2A 3PC6A 3GAZA 4C78A 2DT8A 4LIPD 2ISSD 4WT7A 4D79A 5JLAA 4DY4A 4ZI7F 1NBHA 3E48A 1QIIA 4NIMA 1J25A 2YIJA 4WRRA 1KI6A 4RZHA 4C7MA 4F4FA 2DQYA 2ZE7A 3RYCA 3AKZA 1GAWA 2BGLA 1GQOA 5F7ZA 4IEIA 4Z49A 1SKYE 4Y6LA 2ACVA 5K4HA 3CLSD 1WDKA 2GPSA 2NVBA 3HVJA 1UQUA 1K63A 3AM4A 3JQGB 4TKMA 1Z4QA 4X93A 4HNUA 1NRXA 2W6NA 3KEGA 3FRIA 4EHAA 5C5DA 2VAXA 3BSYA 5G0SA 1Y5IA 2NUTA 5LP1A 1I8TA 2JLUA 1FZQA 2CN1A 3VDQA 4CKWB 4AZTA 4XIYA 2JIPA 4DCCA 3T1TA 1QWOA 2ZSKA 3E9QA 1FSFA 3C0KA 1KIMA 4XX1A 2E18A 2JZCA 2JEOA 3EBPA 3HKBB 3PF9A 2C9MA 4IUYA 3L4BC 4TL9A 3RVBA 4ITUA 3H9CA 4BVLA 3U37A 1M5TA 3AR7A 1W0KD 3G2IA 2KX7A 1PTJA 2N9UA 5BR4A 5CTJA 1X7XB 4HNSA 2PHZA 4J4BA 5I7WA 1C1DA 1GGJA 4MLPA 1SBHA 4ARAA 2XF8A 5EP3A 2GN4A 3FSJX 3W4IA 2ZEJA 4HQRA 3UMMA 4LG1A 1EFTA 3S29A 2PX3A 2DUJA 5FFMA 1NG1A 3WRXC 3E5MA 4HUTA 3MW8A 4ND7A 1C30A 4F6RB 1SVIA 3LCJA 2VDMB 2OCLA 2B35A 1UT6A 4EB3A 5FKJA 2O4CA 1XMOB 1QLWA 1TO1E 4HX9A 1NUHA 5MN6A 1RWVA 4YMHA 2R87A 4LSGA 2PBZA 2A0UA 5EPEA 3DFKA 4K8RB 3OZRA 2Y0EA 1JLMA 4EVQA 5FO1A 1XRQA 4ZK6A 1UJMA 1QRSA 2LXNA 2GZDA 4Z0NA 5U4QA 1KOJA 3IUEA 3RVSA 3KJGA 3WHPA 5HGXA 3OQIA 4BE7B 2BGJA 2PKWA 3K6SA 1KI2A 1Z39A 2ZBEA 1ABEA 3WOHA 3VSAA 1GPYA 2Q6TA 1MB0A 1KOGA 1MQ9A 3MLBA 4EG5A 2JFZA 2R6ZA 4Q1AA 1JR6A 1KJWA 2O07A 3AIMA 3OEWA 3R5SA 1E2GA 2PX4A 3ZGNA 2QRJA 1RCFA 2I03A 4I1SA 2NO0A 3AHFA 1CERA 2FQWA 4AZ3B 4B76A 2EG5A 4NZOA 4GR9A 2IHNA 5A4IS 2M98A 1GTL1 2OBXA 1GKKA 1H0HA 1EJBA 3H0CA 4UNQA 4XKJA 4AY4A 1DP4A 5G3YA 2VDOB 2WA1A 1MC5A 2M2IA 4ZKEA 4HH3C 3ZZUA 3AQIA 4M7PA 5KNBA 3HDVA 2DWQA 1E92A 1G0NA 3MGGA 5DFAA 1KDZA 3WADA 3AF2A 2PU5A 1BOFA 3DONA 3B9PA 3VZRA 4DDMA 2SKCA 1S7CA 5YASA 1JT2A 1SA0B 1F06A 3PGMA 3A4MA 3F7TA 2H65A 4PQFA 3QEMA 1N1DA 1SC1A 3ZE1B 4ZOLA 4BOYA 1ENOA 1CP3A 1PYDA 3S27A 1ZNWA 1RKXA 1X15A 2QGNA 4IDFA 2FPGB 2SKEA 1I0IA 4LJAA 3U39A 2J3QA 5DGXA 4BP8A 3A7EA 3QM1A 5IVHA 5BN5B 4MVJF 5DLQC 1YDWA 1P4AA 4D8UA 1QFMA 2EV9A 2FQXA 4DLYA 5BSKA 2B4TO 3CLTC 2IP4A 3GUVA 3IP6A 4N0DA 4G5OA 1U99A 4CLRA 4TUYB 4BGIA 1PW7A 3O73A 2ZG6A 3SYMA 3LMKA 1VLLA 4ZIRA 3CF4G 2Q4OA 2H57A 9ATCA 3VO8A 1KQPA 1TIBA 2A4MA 2NU6B 3F6RA 4UNPA 3ZJYA 3ZWXA 1AQ6A 3RGWS 2GKSA 4B7UA 1JR3A 2QP4A 4B4VA 4ZHQF 4U6NA 3LGAA 3PNOA 4BO4A 1G60A 2CE7A 3ITEA 4DR3B 1BD3A 3ORFA 3FUCA 1GU0A 1O6CA 1GZHB 1XLUA 1A8SA 2AR7A 3HNPA 2X2OA 3X1ZA 1VG8A 4MKIA 2I78A 3Q3GE 5AHKA 3VDXA 3GWGA 3GOHA 5FDFA 3S5UA 1NW6A 4GF5A 3C7CB 4PS1A 3K31A 1CZRA 2QLFA 1EGMB 3Q9UA 4E3WA 4ZI7B 4PAWA 4TTAA 3JAKB 4OGWA 3RJTA 5LZ8A 1H85A 4G0UA 1Z34A 3W7VA 3M89A 3AHJA 3IDSA 1U3VA 3PHIA 1E2JA 2CXOA 3CRNA 4GECA 5EJIA 2J8ZA 4JT8A 1XLWA 1SCAA 3DAOA 3ACBA 3SS8A 1XQVA 1V4NA 2YV1A 1TMKA 2QL9A 3OUZA 4KUHA 1YS2X 3DZ8A 3K05A 5CCBA 1E89A 3KAJA 4JA2A 1L5GB 5JNVA 3K5PA 4QM6A 2RBKA 3KQLA 4A8HA 1P1CA 1T9DA 5I7HA 4MRMA 5AM5A 4PCAA 2PJRA 2ZW9A 4HAUA 4X7RA 5FBRB 5BV8A 2J32A 3K5HA 4N0EA 2P3QA 2Z8XA 4JBWA 4LHYA 4RTPA 1C81A 3FF1A 4AJIA 3DYBA 3LQKA 1YQEA 2FJPA 2J6CA 4J1TA 3VMMA 2O8FB 2F9FA 4HLUC 4N3NA 4TLDA 2VXYA 2EVWX 5J2TF 3ES9A 1JDNA 3DEIA 1JALA 5ALPA 1W0KA 3FOFC 1BQEA 2R751 1PV4A 2H48A 4KE7A 4KQIA 2PWZA 2FR1A 4Q82A 1DIOB 1V3TA 2VHWA 1AZTA 3LP8A 3QEAZ 5JCOA 1O77A 2JIMA 1JSLA 1I36A 2RK6A 1HDOA 4WLVA 3I73A 3BRCA 2QUKA 2GM3A 1XNGA 1FQJA 3EVNA 1EXWA 3FBWA 3TQCA 3F3KA 4DLPA 1N78A 1R4AA 2RI6A 2JK0A 3CGWA 1Y8QB 2ZTMA 3HJGA 5IX8A 4FFRA 2YX1A 1PT5A 3PG5A 4FCCA 1QFSA 1MORA 3DDZX 3B82A 3W5BA 4JI8B 3QQPA 3W5CA 1RE1A 1T5OA 2TMGA 2XQGA 4PFJA 4DC0A 1DEXA 2AV6A 4UTNA 2ABWA 3GN1A 3FYDA 2EOAA 2FFRA 3OPVA 3P5BA 1ZZGA 4UBMA 2CUTA 4DA8A 4NPHA 1QHNA 3RSHA 4MV8A 4EEKA 2C54A 2FJUA 2WEKA 3FFWA 4J0IA 2X5NA 1IOWA 1U9IA 1YHYA 2WQZA 1J1IA 1V16A 2P9HA 3GJ7A 4LSZA 1HORA 5FWDA 5KOJB 1IDN1 4HWKA 5GZ1A 5SYNA 2BFOA 1KHTA 2IIBA 3MWYW 4DLTA 3CLKA 2ZT5A 2VF5X 4W8OA 2HCFA 2FPKA 3WHKA 5T67A 3OUUA 2YJ3A 3E70C 4KNWA 3GD5A 3N05A 4GX0A 2G77B 5DKFA 3PYXA 3PGVA 1R0XA 4DIEA 3K32A 1Q6ZA 4UJ5A 3WL6A 5FNVF 5MFZA 1OLUB 1REQB 3HZHA 4F56A 4NU5A 5KO2A 5IKEA 3RVLA 1EI9A 2BFDA 1LTKA 2A9FA 4LZAA 1UC5B 3ESZA 1PUJA 4V0OA 4IXTA 3B1JA 5AXAA 5MGNA 3ZTWA 3MN1A 3QPAA 2VQ6A 1ML3A 1XRRA 3LLSA 2GK3A 3C3JA 4F38A 5J4LA 2Z08A 3P32A 4AY3A 2BZ1A 3C97A 4QXAA 3TPFA 4A1FA 1DQPA 2FZGA 3ZGXA 3DLAA 5C4MA 2P41A 2W90A 2BBSA 1CBUA 5EJ7A 1ZESA 1TEVA 4N5MA 2Z04A 5BYKA 1DJLA 3FKQA 4CV2A 2FMHA 1YWGO 2RDMA 3KYDB 3R4CA 2QZJA 2QZPA 3SWWA 2RBGA 3DEHA 3LUKA 3EDMA 4H4EA 4AYXA 1NP6A 3KQKA 2EWMA 5IHXA 4YT2A 4I7EA 4PFSA 1KEWA 3GR6A 4WNAB 1EUDA 5EE0A 2K5UA 1JI0A 1JIJA 2OZPA 4H3HB 4OF4A 1PNTA 4YJGA 3BGSA 3N2LA 4UE6A 1GL3A 4EI8A 3S68A 5SY6A 4GKKB 1OU4A 2FEWB 5KSPA 3ROFA 3UO8B 2PGAA 1N2GA 1JAIA 1P4RA 5A3SA 5JAHA 1XZHA 5JSUA 1E99A 4WTOA 1Y48E 3AFIA 3WLJA 1YCGA 1KBQA 1G19A 2HV8A 2FOIA 1PWHA 2OP0A 1Z88A 2IDMA 2VHYA 2XVZA 5JYDA 2PZJA 3Q9NA 3RFCA 1A9SA 1KFEB 1RE0A 2RKBA 3IR5A 3L04A 2C3PA 3JAWA 4NQZA 4OATA 4ZHQB 1EFKA 3PWKA 5ILQA 2QTVB 2B4AA 4U0KA 1PEKE 4QU9A 4J4TA 1NQXA 4MNTA 5JHGB 2X6TA 4MMXB 5D3MA 2B2CA 1FMFA 2DWOA 5J2UA 2A88A 2GNAA 4J75A 2NX2A 3TBHA 3FZGA 1CQZA 3W9YA 1LSOA 2C83A 2V1XA 2MINA 2PUWA 3IBCA 4CI0B 5KYYB 1HLPA 1QAQA 1V45E 4GE0A 1ZMBA 1C7QA 2WFZA 4KMMA 4O2AA 5CA0A 3RT1A 3HKCA 4HDNB 3SAJA 1WUKS 4BO7A 4DC1A 4MEBA 2L0XA 4ZZ3A 1NPYA 1F2DA 4PXAA 1UR5A 2CLHB 3A10A 3IMGA 5FPSA 2AOTB 1E9AA 2P9GA 4MV9A 3MCWA 2O5CA 3R8XA 4D82A 1T43A 3RU3A 3FZQA 1YZHA 1E2QA 1UXGA 4WCFB 3NYQA 1WW8A 4BJ6A 1KBZA 4DAEA 1IBKB 2QTGA 1T3GA 5E7QA 2V0GA 1G4AE 1T5SA 2PY6A 3O7MA 3QMPA 4PRKA 1CUFA 4QXQA 3SYRA 1MC1A 2XI4A 4JNKA 5BWNA 1D7AA 3M6LA 5F5LA 3PTAA 3BFKA 5EP4A 5EQFA 3JYLA 4GZLA 1NNLA 5EP1A 4TWJA 1N3YA 1UWCA 1Z0FA 421PA 4BN5A 4C7OA 1H3FA 4O1MA 3M6AA 4NMWA 4GOND 5EJGA 4UREA 2EFCB 1RACA 4LWOA 2HN9A 2VJPA 1ZGHA 4LYDA 5H16A 4BATA 1P2VA 3HJFA 5JSFA 3DZFA 1PQWA 3UV7A 4P5EA 5DHTA 1VKRA 1WTAA 2NTEA 3AHGA 3J7TA 2QLJA 2PS1A 3U4IA 4NCIA 1NW5A 4UW9A 1QH1B 2A8YA 1BGVA 2KQUA 1DXHA 4WN3A 2RH4A 3KNZA 4GGMX 4E5UA 1Y9EA 4BMZA 4DR4B 1H6BA 2F1JA 3QLTA 1H6DA 2Y05A 4OQEA 4NCAA 1JG2A 4EG3A 2HQ1A 3GGPA 3I1FA 1CDZA 3SYKA 4I19A 4E21A 2ODPA 2PL1A 3G49A 5KTSA 3KHSA 4I9NA 3ZHVA 4C0JA 2VAWA 2QRKA 2J5QA 3VKFA 3EQ7A 4QHSA 4M0FA 2P5TB 1WAMA 1SZPA 3KKEA 2C20A 1RYFA 1U31A 2BE7A 2XCOA 4QQRA 1NE7A 1E7SA 3W5JA 2GXUA 3DV0B 2P27A 3EIUA 3K5IA 1JKFA 1CIVA 3MLAA 3HR8A 1J2RA 2CBZA 5I7AA 3TL2A 4EK9A 4TV9F 4ICIA 4ER5A 5EJ6A 5FAKA 1JWLA 1KP3A 1A4RA 1XAJA 3G6KA 3HL4A 5HF6A 5F9FA 1Q12A 1AT1A 2NM0A 3FPEA 1P7CA 3BE8A 5DYTA 5F73A 5IEJA 2JLXA 4RM2A 2QLLA 3SXPA 4BFTA 4OHXA 1A5AB 4N41A 2GESA 4REQA 1LNQA 1N2BA 3SYNA 4BMOB 1XJWA 2Q6IA 2G09A 4UFNA 1T3TA 3B1FA 2NAFA 2ST1A 3DTTA 3SHTA 3VGPA 4ENVA 2G8NA 2W6ZA 1JILA 4MIOA 4UM9D 3OX4A 5IANA 1KEVA 3CWZA 1USUA 2ZVPX 2HFJA 3HCPA 3REQB 4BEWA 1TK3A 3UMSA 1DBRA 2W48A 3JQ9A 4B40A 3KP1A 4ZEWA 4AI6A 3QFFA 2RHBA 2YY6A 3H9GA 5EHNA 2ZI9A 4TQGA 3EIXA 5ERXA 5C35A 2EU8A 5IT9A 4RZSA 2BR3A 5JASA 4JB2A 2NO7A 1AM4D 4WLUA 1M9NA 3LT2A 3VPGA 1KO8A 2G83A 1POXA 3IDAA 2OPHA 5KHLB 4KIJA 4PN3A 1VIDA 3OZTA 5CPBA 3AVOA 5CAEB 1H93A 4MI6A 2DBQA 4RFSB 1C9KA 2Q5QA 4Q34A 1UZUA 2IHYA 1ZSYA 1UOOA 2QTRA 3PSHA 4Q7EA 3PUJA 4EHJA 2DWCA 3OF2A 2FEKA 2PV7A 2VATA 4TLCA 5EGNA 2ZAOA 3O92A 4FHGA 1HRKA 1NJFA 1RZVA 4II3A 4MV4A 1G6OA 1VZ2A 4OCZA 4U5XA 1GTRA 1P0IA 2RC5A 4HMQA 3GAFA 3SJBA 1U2DA 1WB6A 3IE1A 2QKYA 1MRZA 1E32A 4PHGA 5C81A 1X86B 4XW2A 2A3RA 4J07A 3WNDA 3IUQA 4DQ0A 2FF5A 2FN4A 4IX1A 5CT8A 4IHQA 1FTSA 3I2KA 2C9DA 3OWHA 2J9FA 1XHLA 4S3MA 1AO3A 4LZZA 3L77A 3PGKA 5AM1A 1R8YA 1L7EA 1UEXC 2Y6VA 4FDVA 4NBLA 5GP1A 2MTBA 1PS8A 4GZ6A 3ZWAA 4KVGA 4BRZA 4FDAA 3ML1A 1W52X 2BP7B 1G8HA 1JKMA 1HDXA 1EVLA 1NJ5A 4OD0A 5KAPA 4E14A 3P9SA 4GBMA 1FTNA 4KTTE 1XNQB 2V6MA 1BEUB 2IZ5A 4RIIA 2LTAA 5DN6D 2QVZX 3I4LA 5ER9A 2QR5A 4WOKA 3I0MA 4EUFA 4GP7A 3UK0A 1I1QB 2P4SA 1C4KA 5B1DA 4REOA 4L5IA 1K2WA 5TVKA 4ER6A 4DA0A 4PZCA 4O2RA 4H0FA 4RMJA 5KNDA 1S3FA 4ZDIA 5KWEA 2J0SA 4D25A 4CLXA 3E35A 4B3CA 5DULA 3YASA 2G72A 4I4TA 2OBLA 1SD1A 2B7CA 1N5KA 4ARZB 3DAGA 3ZWPA 3R7NA 3CPHA 3Q1KA 1FPQA 4R9NA 5IDYA 3AHIA 1X38A 4TSRA 1PI3A 3VSCA 2W42A 1J09A 3OBIA 4GI7A 2DWPA 4JLDA 4GX1A 3Q3CA 4Q0MA 1UDXA 3W3AH 3TAHA 3HJTA 4EITA 6REQB 5KEIA 5FYQA 5C3MA 4OO3A 3TQRA 1OB2A 2ONYA 3EVTA 3BFPA 4S1OA 4W5JA 4DSNA 2W5UA 3BH7A 2BEJA 1E4EB 2HJRA 5LIPA 2CL0X 5DOVA 2O3UA 2Q0HA 4J2OA 4EHHA 3K9CA 2H31A 3M2PA 1YS9A 2C5LA 3AWIA 2NN3C 4ZMSA 1U5AA 2V54A 3QF7A 1HDYA 5LVAA 4I1IA 1DV2A 4MWOA 4Q93A 5FA5A 3AWDA 2PZLA 1W36C 2QJRA 4PFKA 3EYAA 1FSSA 4ISCA 3FOBA 1A8HA 3GCGA 3F96A 1GZ5A 4EIWA 2OCKA 4HLDA 4OH1A 4C88A 4CMEA 1HQCA 2B1QA 4MVJI 2J4DA 2FSSA 3M34A 4OQFA 1UL1X