1J90A

Crystal structure of drosophila deoxyribonucleoside kinase
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
195
structure length
195
Chain Sequence
b'TQPFTVLIEGNIGSGKTTYLNHFEKYKNDICLLTEPVEKWRNVNGVNLLELMYKDPKKWAMPFQSYVTLTMLQSHTAPTNKKLKIMERSIFSARYCFVENMRRNGSLEQGMYNTLEEWYKFIEESIHVQADLIIYLRTSPEVAYERIRQRARSEESCVPLKYLQELHELHEDWLIHQRRPQSCKVLVLDADLNLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Deoxyribonucleoside kinase
publication title Structural basis for substrate specificities of cellular deoxyribonucleoside kinases.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transferase
total genus 74
structure length 195
sequence length 195
chains with identical sequence B
ec nomenclature ec 2.7.1.145: Deoxynucleoside kinase.
pdb deposition date 2001-05-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1j90A00
4P4SB 1SHKA 2OT3B 1VPLA 5KDDA 2ATXA 3QY0A 2F55A 1QHGA 3G0HA 3CW2A 4P0TA 3A1SA 3KQLA 3BH0A 1RRGA 3C16C 2RGEA 1GNPA 5EP3A 1XWIA 3CO5A 3WYGA 4CEJA 3BC1A 2J87A 3D31A 1W0KA 3CM0A 3FKSA 2GF9A 3K0AB 5HE8A 1G3UA 3PUYA 2ZRAA 4X8HA 3IKJA 4MRPA 5TV2A 1NRJB 5L3QA 4YMTA 4G1UC 2AR7A 4WAUA 4TMWA 1KO5A 2WSMA 3GLIB 1N0WA 1NN3A 2JJ1A 3SJCA 2GESA 2VSFA 1G8FA 3L0PA 4MRRA 2OFXA 2VHTA 1G1MA 1D6JA 3CWQA 1F6BA 2O0KA 3IQXA 4G3XA 1L2TA 4Q1BA 3WYFA 1FUKA 4JBYA 4DLRA 3BB4A 1FX0A 2F9MA 1ZM3A 4QHSA 2QBYA 2RHDA 4C0QC 1R10A 2JLSA 3GPLA 4QNRA 1ONBA 3OFNA 4ITRC 4F38A 2B6HA 4D80A 3LO5A 2ZYTX 3K0SA 1CS4C 1SZPA 2W6JA 4PXAA 1M2OB 2OE2A 1AZSC 2W2VA 4Z1MA 5L3SA 2Q21A 3L0SA 4LZZA 3W9YA 4X8OA 3KQHA 1GL9B 3KJEA 4ESHA 2N46A 1W36C 4MGIR 3WP0A 5BN5A 2FH5B 2P6RA 4A8JB 1Q0UA 5K8UA 4Q01A 1Z07A 1N6PA 3MRSA 3QKUA 5KSZA 2Z83A 4PQRA 2BBTA 3DOFA 3EARA 1XCGB 2HCJB 3AKCA 4V0NA 5KPJA 2CL7X 4DEYA 3AVVA 2RHMA 3G82C 2ATVA 4M53A 4QRHA 1NP6A 1P3JA 4JSTA 2E87A 4NYMQ 1Z6XA 1KMHB 2PBRA 3LRPA 2YVUA 3OHMA 5B30A 1R2QA 2L0XA 621PA 3QXXA 4J0QA 2IS6A 5KHOC 1L4UA 4Z1MD 4QHTA 3BH7A 3T1OA 4Q18A 1JR6A 3GLHE 1VHLA 3OEED 1W1WA 4U00A 1DAMA 1KI2A 4BZQA 2WWXA 3NXSA 1HA3A 2P6UA 821PA 3W6NA 3CPEA 4HDCA 1IHUA 1X1SA 2F43A 3N70A 4KAXA 4BLRA 2QA5A 1YR8A 2QUZA 4P4SA 4H9GA 2HT6A 2OEPA 3ZIAA 3TAHA 2ZYUX 2EWWA 2QTHA 1YZNA 2V7QA 2ERXA 4XJXA 4JL5A 2X2EA 3L43A 4URYR 4Y0VA 4A36A 1E2PA 5JECA 4NL4H 1VIAA 1JR3A 3P1JA 1IXRC 3K0AA 5BXQC 1TUEA 4XVRA 1UADA 2OCAA 1KI7A 4L9SA 1G18A 1UEIA 1YZKA 4QBGB 1DTSA 3GLIA 3QUSA 1UKVY 5FI1B 2BBWA 4KVGA 4MKGA 2PJZA 4URWR 4JLVA 4QOSA 4TN1A 4XWOA 4QBIA 2RGNC 4GMXA 4KJZA 2V7QD 3CNNA 1E79D 1W2GA 2VF7A 3TKLA 3TBKA 3AB3A 3F5FA 4HAYA 3IHWA 3A6PC 4IHQA 5JHHB 3Q5EA 3IQWA 2JLYA 1PZNA 2FG5A 3U3KA 2WJHA 3THWA 4AKHA 4PHHA 1NF3A 2FU5C 3VHXA 5EE9A 3QXHA 5FUXA 4S2EA 3PIRA 1JQLB 1EFCA 1LV7A 4CEIB 3SN6A 4B3XA 3CIOA 2WJGA 2CNWD 3T34A 2FGJA 2RB4A 1TQDA 3K9NA 1E9AA 2WOOA 2ZYWX 4JLAA 4TQUS 4LWZA 3FOZA 1FNNA 3RHFA 1OFTA 2HLDA 2UKDA 4JS0A 1E0AA 3UANA 1OFIA 4A8JA 2WJIA 4B3FX 1CIPA 1BMFD 1ESNA 2DCUA 4C0BA 1YRBA 4PSAA 4OQFA 3UWKA 5GJBA 2ZE8A 2NZ8A 2XOKA 2OBMA 1OIVA 2QPOA 5HPYB 3LBHA 1XNJA 4IDNA 4C0JA 2VIIA 2NQ2C 1JXMA 4Q7MB 3AEZA 1QRAA 1ZD9A 2OESA 1X8KA 2FGKA 5J47A 1FNMA 1XB2A 4MRVA 1GL6A 2IXGA 4AYXA 4N1AA 3U3JA 4GPTA 1YZUA 1HT1E 2G88A 2W0SA 4HB4A 1YRAA 3QPWA 5CDFA 4US0R 4M9XA 1E2MA 4KYUA 4O2RA 1QVAA 1D9XA 3P4YA 2O8FB 1NY5A 4LPSA 2BHRA 4N3NA 4LYJA 4PPGA 1U2RA 1IJFA 3I1FA 3DL0A 2C95A 5AUOB 2QI9C 4CF7A 2E9SA 5DH9A 2GETA 3TH5A 4KSCA 1LVGA 5EJEA 4WXRA 1I4DD 2J9RA 4RSGA 1T0HB 1PLJA 1D2NA 3QKSB 4MUBA 1KDTA 2AN9A 2GCNA 1NG1A 3AVPA 3HWSA 4F4IA 3K0EA 1UEJA 2HXSA 1Z6GA 2VP0A 2XSZD 4A2QA 3U7GA 2Z5FA 5FUWA 4DLVA 3NIBA 1QHYA 4TL9A 2VP9A 5JRZA 3IIKA 3W3AA 5LDDC 1KY2A 4IXNA 1ZYUA 2ZTSA 3EAQA 3AM1A 2QE7A 2OLJA 2ZI7A 2GCOB 4TSFA 4Q4HB 1KY3A 2WOJA 2IEZA 4DT1A 3RRYA 4HAXA 5E7MA 1EWRA 5HCIA 2ZJ2A 4L4UA 5KDLA 2D3WA 4IFBA 4FXPA 1E2FA 5TXGA 4YONB 1UBCA 3R7WA 4FW9A 5KU1A 1FPMA 1V5WA 1OFUX 1XZPA 3KZ1E 4OJQA 1NMYA 3NHBA 4QL3A 4CEIA 3Q72A 2V6IA 4PAQA 1SVOA 4C2UA 4HAWA 4M2LA 3SJZA 4PAMA 1XPRA 4EKDA 1G19A 2GJAA 3RRMA 1G8YA 2ZE6A 1ZM4A 2J1LA 4LJYA 3ZZTA 1II0A 5TY0A 1DADA 3CZQA 1EWQA 1YE8A 2IWHA 2YC2C 3RC8A 5LD2B 1ZU4A 1J70A 2BIFA 2QRNA 4B44A 3K9LA 1UPTA 3SJBA 2ZVPX 3GJ5A 5TB5A 1T4GA 3FPAA 1TQ6A 4LV6A 3SC3A 1VG0B 4LJ8A 1NIJA 1TX4B 3KJIA 1Z2AA 1M7HA 2REOA 1GRRA 4JVLA 3UK6A 1XTJA 1YR7A 2AK3A 5IK2A 4XTCS 2EYUA 4Z54A 5JLJA 2J0UB 4QGGA 5KSYA 2ZSBA 5A4JA 4CEHB 4NDZA 3ADDA 3PEYA 4JVSB 3U60B 5KPDA 4IRUB 1CF4A 1IY2A 3NWJA 1M8PA 2QAJA 1JPJA 4LJ6A 1COWA 4P3YA 2ONJA 3UMFA 4I81A 2ZSFA 5FTLA 4H1VA 4YXWD 3ICQB 2PH1A 5LB4A 1AIPA 3O8CA 2WAXA 1PVOA 3Q7PA 3THXA 2WMOB 1OSNA 2ZR9A 3VR4A 1U9IA 1H8EA 5FR1A 4LJ9A 4DCNA 4RJLA 1XD2B 2ODNA 3FFBA 4MA4A 1TQ4A 1G3IA 2D4HA 4NMMA 4B6EA 1KAOA 1OT3A 3LW7A 1DBSA 4C3ZA 4DDWA 3AUXA 3TVTA 2NIPA 4DZZA 3QE0A 4M1SA 1E1RA 5F2EA 1G16A 1G7RA 2FPMA 2RGBA 1BS1A 5KNCA 3SI7A 4ZPXA 4E03A 1W5TA 3QKRA 1E69A 4B32A 1NLZA 2UVQA 1KSFX 1HT2E 1YVDA 4KV9A 1GUAA 4F7WA 2ZROA 3Q8XB 3MFYA 4KBFA 1OIWA 2DHRA 4MKFA 3ZJYA 3LDAA 2MSDB 1R0YA 1HUQA 1US8B 4IDPA 2V1UA 1WRBA 1HQCA 2XNDA 4G5RA 2R62A 1P62B 2AWNA 3LXXA 3GQBA 1KI3A 2WSSA 1YZTA 2IUSA 2QAGA 3B1VA 4M1TA 4ZDJA 1S9DA 1UKEA 1DAGA 2FSIA 3K09C 2YJTD 4W5JA 3CB4A 2IL1A 1UDXA 4P31A 4YC7A 2XTNA 2JLRA 1QDEA 1TPZA 4F4JA 1OB2A 4DCTA 3I5XA 1CR4A 1XEXA 1W44A 2DFKB 5G40A 2GRJA 3O8BA 5DN6A 4TT3A 2KJQA 4DIEA 3GLGA 2JLUA 2PJRA 5F9FA 1JAIA 3RAPR 3NG1A 4OI4A 1QVRA 3B1WA 2JJ2D 3CUEF 3OEHD 1TL7C 1IN8A 3KKMA 2BBSA 4OQLA 4Q4JB 2PMKA 4KFUA 4UXHA 3NDPA 3DMNA 1Z6AA 3A1WA 4JKYA 3QBTA 4ZDWA 5KNDA 3U7HB 1G5RA 1E1QA 4CDGA 1G5PA 2DY1A 2YZ2A 5BYJA 2I1QA 1KMQA 2VL7A 4BLTA 1EXMA 1UJ2A 1IONA 2HJGA 3QPUA 4PSKA 1SQ5A 3T15A 2H5EA 4Q9IA 3IDQA 4JBWA 4DSUA 3U44A 2GK7A 2J45A 2QP9X 4TT3D 1XPOA 2C8VA 1G41A 2JLVA 4C7OA 3AP3A 4XSHA 3LFUA 3SQXA 3MG9A 3EASA 1A7JA 5FPTA 3KB1A 5C4MA 4NCIA 4BQSA 4L15A 2O0JA 1GWNA 2ZI5A 4TMZA 1X1RA 3M6AA 3UG7A 1EFUA 2B7BA 3HR8A 1XF9A 2R44A 1Q1EA 2N42A 1EESA 1GTVA 4KO8A 4FMDF 4KBGA 1E1QD 3TE6A 1XD2A 1A5TA 3D6TB 1M1YE 1CRPA 4LV8B 2BKEA 2ZRHA 1F5NA 2ZRJA 2ZRIA 2W0MA 2WWHA 3AVQA 4NONA 1E0KA 3EZ2A 1P2TA 5JMTA 4Q4AB 2QM8A 1QHHB 3DKVA 4JL8A 1PUIA 5J5CA 3WRYC 1DO0A 1G6OA 5B57C 3L8ZA 3NEJA 5EP4A 3U2QA 5LBIA 1FL9A 4BFUA 1VCNA 4A0FA 3FYHA 3PVSA 1KKMA 1NNEA 3T5GA 1US8A 3EX7C 1L7VC 2P3SA 1I4TD 1M34E 2WICA 3CF6R 3WNDA 4Q7KA 3BK7A 2G6BA 2XB4A 3H1TA 2ZRMA 3OF5A 1E9DA 2PL3A 3BWDD 1BH2A 3D7MA 4PQYA 4DLYA 2FFBA 4P4TA 4CT4B 1WXQA 4BASA 4R71A 4U5XA 3EC1A 4OJKA 1R5OA 4Q19A 2VP4A 1VYVA 3CBQA 3ADCA 4XSGA 2FSFA 2CLCX 4XH9B 5KNBA 3RS5A 3UG6A 4KFTA 5GJCA 1SKYE 3TR5A 1GNQA 3KL4A 1BYUA 4B3CA 2WPDA 1W46A 4TZ6A 2AK2A 4BFSA 4V0MA 1U8YA 3K53A 1NG9A 1K5GA 2CVFA 3KTAB 3QXCA 1QHIA 1WA5A 5JEDA 1Z06A 2XGJA 4JT2A 1CTQA 4E22A 1N6RA 2ZJAA 1FOEB 5AJVB 2C9OA 2JIZA 4Q4JA 5G3YA 3SHFA 4BLQA 1NBMA 4B73A 1XEFA 2ZJYA 4F4CA 2P6NA 3LV8A 4W5WA 4JT4A 3Q9LA 3QBVA 3NC1C 4B2LA 3V4RA 2REBA 4KI0A 3U4QB 1RE0A 2J5XA 4C0AC 1MOZA 5CB6A 1S1CA 4TMTA 3B1XA 2XTMA 1D2MA 2ZRPA 5P21A 2ORIA 5EXTA 2YOHA 3X2SA 4JIMA 2FZ4A 2P5SA 2FPLA 3PJRA 2IHYA 2KSQA 3W8NA 3NH6A 1FP7A 4AWXA 4B76A 2QTVB 2ZJZA 1TU4A 2HEIA 3KJHA 1G8PA 4LHXA 4TTQA 4IDOA 1GKUB 4XOIA 3AF2A 3U3RA 1ANKA 4D2IA 3UMSA 2W2XA 2IHBA 5CITA 4YMUA 2DYKA 1H8HA 3ZQ6A 4U02A 1KSHA 1R8SA 4IDHA 3W90A 1KO8A 3ZD6A 5GVSA 5J4LA 4C0LA 4NYJR 1B0UA 4GZLA 4PO9A 1QHHA 3DEFA 1U81A 1GITA 4NCHA 1P9WA 5F3WB 4IOKA 2C03A 2WMNB 4I4LA 5CLLA 2PCJA 1RRFA 2V8OA 3NBXX 5EZ6B 1HE8B 4B71A 1LFDB 3ZVNA 5FL7D 3RNLA 1CRQA 1U9IC 4TLEA 1SVLA 5KO2A 5C46F 2DB3A 1S2MA 2F9LA 3UXMA 1RJ9B 1S0UA 1RZ3A 4H1UA 5EE5B 1H8HD 1R5NA 3R9WA 1G17A 1KDRA 2R65A 4IVRA 2RGAA 4Q1AA 1JNYA 2AX4A 4M1MA 4A0GA 1GZSA 1R0XA 2O52A 4DJTA 3T1TA 4TYQA 3GEIA 2AD1A 3GJ0A 5EUQB 2YOGA 5H70A 3SDZA 4ASUA 1D2EA 3MJRA 4JSYA 1TTTA 1OV4A 4DB4A 2BC9A 4G01B 3LWNA 1NI3A 3KKOA 1EFRD 1JJ7A 3RYTC 2H18A 4A1FA 2JCSA 4EFLA 1T3HA 2KE5A 2A5FA 2V55B 1T5IA 3GLHB 4BFTA 4FCVA 3PFIA 1A82A 3U3OA 3SEAA 2F7SA 2GXUA 4UJ3A 2QAGC 1E2GA 2TMKA 2BMFA 1N5IA 1P2VA 1Z83A 2JAQA 5FOWA 3T12A 4URVR 1HV8A 1LB1B 1Z22A 3AGPA 5K8TA 3CNOA 4OQNA 2ORVA 3VU9A 4YDSA 4LGMA 5E7JA 4IFEA 1P61B 4RFSA 1FTSA 3M1IA 1J7KA 3EWAA 1KZGB 4MUAA 4URZR 1NJFA 5CM8B 1TF7A 1EGAA 1U0JA 2VRWA 4TTPA 1S3GA 4C4PA 2IYZA 1MRNA 2VBCA 2K5UA 2OCPA 3IPXA 3VR1A 5IT5A 4ZI2A 2JLZA 1VG9B 2JA1A 3RRNA 4MYUA 5H1YA 3LXRA 1IXSB 4DBLC 1MO6A 1WQ1R 2P0EA 4TMVA 4X8MA 5FL3A 3DZ8A 3ICEA 4WIAA 2IS1A 5AUQA 2GXAA 1SHZA 1RPZA 1H65A 4K81B 5IF9A 1NVVR 2BMDA 1FQKA 2C5LA 3NBYC 2FFQA 3P32A 4OHWA 3TMKA 2C9CA 1UBFA 1U8ZA 3TRFA 3RS2A 3R9IA 2YWEA 2CLDX 3CRRA 3RSLA 1AA9A 1P73A 2Z0MA 1Q44A 4B34A 4XWAA 1F2UB 1GNRA 2X19A 3HR7A 3GJ6A 2IS4A 3BFXA 5GJVC 4A15A 2QGZA 2A78A 5IHPA 2EFEB 3G5UA 3U61B 2WVJA 2BCJQ 3SZRA 1Z0JA 2X77A 2ZRKA 1W7AA 4OI0A 3KXKA 1IXZA 4B3BA 4LBYA 2IWRA 1KAGA 1ZCAA 3FHOA 1HYQA 4FCWA 3VR2A 5E95A 5FPSA 2BMJA 3Q7QA 2CE2X 2MSEB 3FB4A 2IC5A 4AD8A 3H2YA 2OV2A 2SHKA 4D4LA 3OEEA 3QENA 1QBKC 4EPRA 1TU3A 2PX3A 3W5JA 4JL6A 4PZYA 1SULA 4Q9KA 1Y63A 2REXB 4MQBA 4JVMA 1IY0A 3HYTA 3GLHA 4NPHA 1ZMXA 2VHCA 4QC2A 4D0LB 4OQMA 3I4LA 3WY9A 2A9KA 4CYMA 5J4KA 5JFGA 1LNZA 2YWFA 3MCAA 4L8GA 4IVPA 4HZIA 3IIMA 4PPFA 5JRJA 4DCVA 2ZRCA 3HU3A 3C5CA 1VG8A 4KYIB 2B92A 4BRWA 2QENA 4AC9A 1OYWA 1EFTA 1GAJA 3C8UA 3DVLA 1J8YF 3QG1A 4L5BA 2V4ZA 4EJSC 1GSIA 3LD9A 1KI6B 4M1WA 5C18A 4HAUA 1E2HA 4O2LA 4KCGA 1Z6YA 1OKKD 3KUCA 4QGHA 3REFA 5CLQA 4LOAA 1GKYA 3EIQA 4ERNA 5F9HA 1UFQA 2FFHA 3TK1A 2O8CA 1SXJB 4TLCA 721PA 4LJ4A 4ZKDA 1FUUA 4C2TA 2VHJA 3KFXA 1E79A 1Z0FA 4GP6A 4GZMA 5JSZB 3VX3A 1I2DA 4NHOA 4LYHA 3CF2A 3HP1A 4I1SA 3EA5A 2KBFA 1TAGA 1OH5A 3D8BA 5CIWA 2J0VA 2XITA 4HZUB 2D06A 2IS2A 2FX3A 1AS0A 3FMIA 3VNUA 4M1KA 2ZI3A 5CYPA 5DIFA 1KI9A 3KXLA 4XVUA 2CNWA 3ZLJA 2PZFA 4MRSA 1MO5A 3T35A 4V03A 5JEEA 1OB5A 1N6OA 5DNYB 3H86A 1GP2A 3DOEA 5DHFA 2DPXA 4M4SA 3EPHA 3IIJA 5EE3A 2YWHA 5HZKA 1BMFA 1FMJA 3B1ZA 2MMGA 2NO9A 4OYHA 2ZSDA 4FI3C 3RANA 3VR5A 4LHZA 5FOXA 1U98A 3VMFA 2VSXA 2QNRA 2GVDC 4MGKR 4ABYA 4RKEA 3A4NA 1XTSA 1XEWX 4B47A 4EDHA 3FWYA 3GJ7A 1E0SA 4IEIA 1MO3A 2LKDA 4P33A 2Q9AA 4RD4A 4UNSA 1KDOA 1TUIA 3VR3A 2QT1A 3UWOA 3TUZC 2EFHB 2XNSA 2PMDA 3ASYA 3FDIA 5D3QA 421PA 3C5HA 1Z5ZA 4TMKA 5JS8A 1JB1A 2C9YA 2ZRBA 2NPFA 3AQ4A 2QG6A 4M9ZA 3ZH9B 3NEYA 2B7CA 5CIQA 1YR6A 1WP9A 3PENA 5C2JB 1T0JB 1B23P 4CT5A 4OHZA 1KMHA 2FV8A 3X1YA 3GFTA 4P4UA 1XU4A 3CRMA 3U7EB 2ZS7A 3PCRB 3PEUA 1OPXA 4B2PA 1T9HA 3N5CA 2VTKA 5ELXA 1N5LA 1T3SA 2WWIA 4KXFB 1CKEA 2OHFA 1KI6A 1G3QA 2RCNA 2XSZA 3MWJA 4D25A 1Q3HA 1E2LA 3BAFA 4QNMA 3TIFA 4Q9LA 4P32A 4XIGS 4KHZA 2C77A 3WHKA 1XDBA 4MKHA 2QMOA 1CJVC 1CU1A 1RYHA 2JJ8A 3BH6A 3DM5A 4IJMA 4QFMA 4D81A 4DCSA 4XVQA 5BN4A 2ZSAA 2Q9CA 2VO1A 3ASZA 2C99A 5EP1A 3WYAA 2VSOA 3W3ZB 2NGRA 2QU8A 5EE1A 2QP4A 2ASEA 2XB2A 2QN6A 1DS6A 2HT1A 4YMSA 1DAEA 4GSYA 2NZJA 2QT0A 3O47A 1FP6A 1EFHA 3F8TA 5AUNB 1J2JA 4MGZR 3SYKA 3QXJA 4HZUA 2DWOA 4JZKA 2IYTA 3QVUA 4NYIQ 1Q1ZA 1SXJE 2Z4RA 3K70B 1I4LD 4HYYA 1KJYA 4ACBA 5KSPA 3J81k 3EPJA 4CW7A 3RS0A 1SXJD 2H1LA 4FMCF 3OAAD 4DLTA 1KO4A 3TGPA 5FOVA 4PTLA 1O3YA 1S4QA 2D7CA 3RWOA 2A5JA 2DFNA 1DE0A 3OIWA 5L3RA 2OILA 4BE7B 2XTZA 3BE4A 3E1SA 1KK2A 2BM0A 3A36A 4A82A 4ARZB 4EPYA 4F91B 2AXPA 2ZI4A 3W8RA 3AF1A 3CH4B 4JLOA 1XBTA 1CJMA 2GEDA 4NP6A 1AJEA 2ONKA 1II8B 5L8VA 1GVNB 4BFWA 4NCJA 2G1KA 2HUPA 3CR7A 2GHIA 4JBXA 5AK0A 4B3DA 4POAA 2OBNA 4HSEA 1ZC4A 1OH8A 4DDTA 1E2JA 1GRQA 1P2SA 3IBGA 2EWVA 3OE7D 4QJ3A 4QGAA 3B8HA 3DKPA 1X8JA 1LY1A 4ZDIA 1XTKA 3QF4B 4YXWA 2O8DB 4BFYA 2NMVA 2GXQA 1VYUA 2I4IA 4LYAA 2ZAMA 2WAYA 4GP7A 3R9XA 1VTKA 1E99A 3WP1B 5A5GA 1P7CA 4GOJA 3UMRA 1DAKA 2FNAA 1S96A 2EU8A 2ZU6A 3PG5A 2B21A 4TL8A 4V0KA 3CRQA 3T61A 1N6LA 4JLPA 2OAP1 1ZBDA 4HI0E 1ZINA 4HLQB 1NN1A 4HUQB 5CK5A 3PR1A 2QORA 4DDVA 4V0LA 1G5TA 2B8TA 4AKEA 3FMPB 1HTWA 4HLUA 1KZ7B 1N0UA 2O8FA 1G3RA 1E3MA 1EX6A 4I99A 5FBWB 2GCPA 1ZM2A 2IYUA 3C14C 4TLAA 3DPUA 2QPAA 1QHSA 4D82A 4R2IA 2IYRA 1ZUHA 4BFXA 1KKLA 3ZD7A 1I2MA 2J41A 4AG6A 5A0FA 1KK0A 3B78A 4KLZA 4EFMA 2RH5A 4RVCA 2VF8A 1JAHA 4D4KA 3VAAA 2H16A 3QKSA 3QNUA 3KKQA 5AJZA 2HXYA 4B6FA 1AN0A 2OO7A 4NYMR 2ZRNA 3MMPA 2GAOA 4NKRA 3SNHA 3RABA 4FWTA 2JLXA 4GFDA 1NMZA 3B60A 5FFMA 4EAQA 4EPWA 4BPBA 3WMEA 2FSGA 4PX9A 3BIFA 2PZEA 4HB0A 4RZ2A 4BUJA 4LX0A 1G9XA 2IT1A 4DC9A 3B5JA 3PEVA 2GCOA 3E5HA 4Q4HA 2GKSA 1R0WA 1IJEA 2W6ID 2ZANA 4MYCA 3PUVA 1DAIA 2JJ2A 2UZIR 4GOKA 3MWKA 2FDCA 4NCKA 1SKYB 3OEHA 3C7KA 4DVGA 1UAAA 4QJ4A 2ZS9A 4ZIRB 3KX2A 2B8WA 1R7RA 2WWGA 3UKDA 2WWFA 2V6JA 1II8A 5G53C 4M8NE 3AKYA 1VDZA 3K70D 3GLFB 3QOFA 2FWRA 1T3LA 3ZZUA 3PV0A 2EQBA 3BFVA 5DI9A 4JYCA 1XTQA 3TNFA 1P4SA 5BN3A 1OH6A 1VCIA 1E9EA 3B13B 1W36B 4I1VA 3CWZA 3T06B 3ZS8A 521PA 1DG1G 3D3QA 1ZC3A 3WRXC 3IUYA 1MT0A 4HLDA 5JJKA 3DHWC 1CJKC 4ZO4A 3VNVA 1AQUA 4D6PA 4W9MC 3H4MA 1G4AE 4LC0A 2JEOA 2OFWA 4JLDA 3QF4A 4HDOB 2O8DA 1CJUC 3AVWA 2W2TA 2XAUA 3IGFA 4QJ5A 5FBRB 3CNLA 1WB9A 4LI0A 2IYVA 1NLYA 3F0TA 4TYPA 3V9PA 1GL7A 5LB2A 5FPKA 2GZAA 2R6AA 5CYOA 4A6XA 4EJSB 2JGNA 2XZOA 2VH5R 2D7DA 2LKCA 1P75A 2J0UA 5FTJA 3TQFA 5FBVB 2NO1A 4CEHA 4JLKA 4OK6A 4FIDA 4A8JC 4QBFA 5D3MB 1P60A 4YLGA 1W0JD 4DHEA 3OZXA 1QF9A 1ZNZA 2PX0A 1XD9A 3HYRA 3MWLA 3KQNA 1QZXA 3BXZA 1G64A 2C78A 4NU0A 4V0OA 1DAFA 4Q9JA 4TWZA 5JI3E 1E96A 2ANBA 3AGQA 4DDUA 2ZIAA 3ADBA 3QKTA 5FPHA 4Q1FA 3UIEA 3X1ZA 4LY6A 2CE7A 4B74A 4HB3A 1T6NA 2CVHA 2GNOA 1L4YA 2RAPA 4TQAA 4K46A 4BFZA 1SVWA 2ZE7A 4AKGA 1JXOA 3TVDA 2AKYA 2QEQA 4F93B 1GG2A 3T1VA 4B35A 4GT1A 5L3VA 1NL3A 2CL0X 4BZXA 4PFSA 1KSJA 4Q00A 3S1AB 4HAVA 1AQYA 4LBZA 2R6GA 1Y3AA 4LHVA 1ZNXA 3H84A 4FN5A 4LSGA 4QXAA 4BZPA 5JJIA 2DWPA 2FE4A 1PJRA 3MSXA 1U99A 2F1IA 4HLCA 1V43A 3AVTA 4MGYR 1HQYE 3ZVMA 3AVXA 2ZREA 4KU4A 4OHVA 2QQEA 2YWGA 5JWHA 4CRWB 2XX3A 1N6IA 1VCMA 4ZKEA 4ZIRA 3KQUA 1NVUQ 5CJ2A 3LQRA 4UNNA 5C1BA 4MYTA 2C2HA 3IO3A 2G77B 2HCBA 4ZV4A 4B3GA 2X2FA 4OK3A 4A6PA 1J8MF 3GP8A 2H57A 3QEOA 1U94A 3NHAA 1G8GA 1R6BX 3BJIC 2XZPA 5J4YA 2N1BA 3CPJB 3HJNA 4RCZA 3AVUA 2DBYA 5GADl 2CDNA 1W2HA 5AJXA 3UATA 1NY6A 4G5QA 2OBLA 2GVZC 3K8YA 2QROA 2CCKA 2J59A 1FW6A 3JZMA 1NKTA 1W4CA 3GLFE 4GOXA 3WMGA 3I5YA 1G20E 3FMFA 3L0IB 2XJ4A 1OXSC 2WJYA 1G21E 3SQWA 2O8EB 3KUDA 4JLMA 2HYDA 4M1OA 5B64A 4CIDA 4QKQA 5FBLB 3WXMA 5BWMA 1KNQA 2HF8A 3TUIC 1W36D 2IW3A 5DI3B 1GKIA 2EYQA 2RKOA 1IN5A 1P2UA 1QG4A 3GJ8A 3THOA 3I8XA 3LLUA 2UZ3A 2P67A 3HPQA 4NCNA 1XTIA 2OSBA 2G83A 3TJZA 5G3ZA 4YMWA 4JJZA 5E3HA 5DO9A 3KXIA 4MH0R 4EQ6B 2ZXUA 2YC4C 1ZJ6A 5J4VA 3I72A 5J40A 3ZVLA 4GI7A 5FL7A 4IXMA 2V54A 4LC1A 4NBSA 4EFNA 4DSTA 5BW8A 4UNPA 1FQJA 2VQSA 1AGRA 2KI5A 3T1QA 1D9ZA 5EE0A 3FKQA 3GJ3A 4W7SA 4ZCMA 1VIYA 3FFAA 4BLOA 5K8LA 3SOPA 3HDTA 2VPPA 3GMTA 1E9SA 1Z63A 1GM5A 3UPUA 2EFGA 2J0QA 4O0MA 3DM9B 4Q4AA 1M6NA 2J7PD 2WJVA 4LPKA 3W6PA 2GJKA 2JDID 4RZXA 4DEXA 2P5TB 4QGFA 2C96A 2YV5A 3ADKA 3CX8A 1IM2A 3MGCA 4TYYA 2RGNA 4WZBE 2J46A 1JPNA 1EFRA 5DHAA 1LTQA 1UBEA 3FHCB 4ZCIA 2V9PA 2YINC 3CX7A 1KNXA 5EXXA 3NVAA 4ACAA 4CEJB 1XXHB 4EPTA 3VKGA 1KI1A 1UKYA 3BRWD 3TW8B 4C0HA 1NJGA 5L3QB 4MDFA 4I1OA 1S9HA 2XXAB 1G8HA 3NDBB 2CEAA 3L0OA 2ZITA 1XP8A 3AH8A 2WIAA 5H68A 3A4MA 1D8TA 2ERYA 4V02A 3EPLA 2PLFA 1UBGA 1KGDA 2YKGA 2NO6A 4FMDB 1FX0B 4Q02A 5HE9A 2AHOA 3TSZA 4YQFA 5F98A 1Q20A 2IF2A 2ZETA 2VLIA 2ZJOA 1N25A 4UXJA 3GFPA 2WBLC 3VKWA 2ZSEA 3DMDA 2X1VA 1NLFA 1OLOA 4MDEA 6Q21A 4AI6A 3KTAA 3EIHA 3SBEA 2JATA 1ZIOA 5JHGB 4BWYA 5FI0B 5L3SB 3KB2A 1BOFA 2BVNA 2F3TA 5SZHB 3CLVA 2CHVA 2I1VB 3LAWA 4PPNA 1DPFA 2OCBA 3NH9A 2QMHA 2QP3A 2R6DA 1OXTA 3QIAA 4TYNA 3U4QA 1M7BA 5DI3A 1NN5A 1PLKA 4DKXA 4UKDA 2H8KA 1O87A 4DUGD 3PUWA 1LW7A 2FSHA 1S8FA 2Q0HA 4A92A 1CLUA 1MH1A 5LD2C 4RZ3A 2IYYA 2JASA 3IHLA 4B33A 5FOTA 3ONWA 4EQ6A 5J4HA 4TQ9A 1G7SA 2J7KA 4WBSA 1RYFA 2F1HA 3QJYA 3U3MA 3W6OA 1E6CA 1KI4A 1KDPA 4Q1DA 2ZPTX 1ZNYA 1J90A 2WHXA 4UNRA 1EG7A 3X1XA 1YJ5A 4GL2A 3NC0C 3OESA 2Z43A 2VHUA 1OHHD 4DSOA 4TLDA 4DCUA 2F43B 4ZDKA 4UQOA 1KOFA 1Q22A 3IPYA 3GD7A 3U5ZB 1ZD8A 1T91A 2GBLA 2CXXA 5H8WA 1SVSA 1VECA 1Z0DA 4BEJA 1Z29A 3K0FB 3Q5DA 1OIXA 1SVIA 1RJ9A 1XXHA 4M21A 3AKEA 1R8QA 4UXIA 2ZR0A 1AZTA 2AFIE 1JQJC 5HKKD 4OHYA 1KJWA 1IN4A 1JECA 3WMFA 4QBHA 2XXAA 4URUR 3AUYA 3C4JA 4LK2A 1G4UR 1Z8FA 3O8RA 1RW4A 1ZP6A 4EUNA 2IXEA 2Z4SA 3I8SA 1E2NA 1XXHE 1OW3B 3WBKA 2KWIA 2A2ZA 4OBEA 4DLWA 1TF2A 4KLNA 4RD1A 4Q9HA 3MJHA 4US2R 2HYIC 1OKKA 2FFAA 5FH9A 1YQTA 2F6RA 3THWB 2V3CC 1W0KD 2IYSA 3FKSD 2GEUA 3ZVRA 4DXAA 4TLBA 1KSGA 3PQCA 1CR2A 2H7VA 4EPVA 2ODWA 4QHYA 5SZKB 3A1VA 3ZZ0A 2CJWB 1CBUA 2Q6TA 2DR3A 2JJ1D 4PC1A 5KDOA 4DRZA 2YNMA 1A2BA 4KODA 1E9BA 3EPKA 4NTZA 1J99A 3X1DA 1G7TA 1UM8A 5BQ5A 1Z47A 2JLWA 3BOSA 1TEVA 1VCOA 5GVRA 1PUJA 2FPKA 2G1JA 4I1UA 4IOJA 4PAOA 4DB2A 2C04A 3OFND 4NE2A 4A9AA 1CP2A 2IUUA 3ZDQA 3FGNA 3FE2A 3RWMB 3PUXA 2ZI9A 2Q3MA 2A7QA 1A1VA 1ESMA 3WNBA 2FMXA 1TQ2A 2W6JD 2ZRGA 3QG5A 3PITA 3NTUA 2VYFA 4PPQA 1JI0A 4IOMA 4KFSA 3R8FA 1N2CE 1Q3TA 2GXSA 1OJLA 1ZRHA 2FOLA 3TSOA 1TMKA 2IUTA 4JLBA 4ON9A 3WHLA 1II9A 1R5BA 1KYIA 4B43A 2FN4A 4II7A 2PLRA 3I32A 4JLJA 3VX4A 5JBQA 4D0NA 3SE0A 5E4FA 2W58A 4OI1A 1A2KC 3CR8A 1RC8A 5KOYA 3L82B 1F2UA 1DAHA 3EXAA 4Q48A 1QG2A 1XX6A 3ETLA 1F48A 2Q3HA 5TVKA 2FZLA 2Y8EA 1NVWQ 3VFDA 3W34A 3K0FA 1T5LA 1TNDA 3C41J 3U6KA 1MV5A 1Q1QA 3SFZA 1Q1BA 4BRUA 3THYB 2MMCA 3PUZA 1Z0AA 2A5YB 2E1RA 1XMIA 3QEJA 3SS8A 4MRNA 1AS2A 1XMVA 3K09A 4G5GA 4DLXA 1SVKA 1E94E 1YZGA 4B75A 2BM1A 1Q12A 4Y0AA 3P27A 2ZAOA 2ZVQX 4RCYA 5FR2A 3IEVA 1YZLA 4HAZA 2O5VA 5EUMA 3ZIAD 1HE1C 1AGPA 2ZRFA 3I73A 4DT1B 4LRWA 2YHSA 5DE3A 3WNCA 1ETUA 1JR3E 2BBOA 1W4RA 2C98A 5DYGA 3TW4A 1RVDA 3B9QA 1OE0A 3K9GA 4LHYA 5EP2A 8OHMA 3R7WB 3QSYA 2IYWA 1MR3F 5FOUA 3TAUA 1ZCBA 1JR3D 3GLIE 1EX7A 1F3OA 4RD0A 4WA7A 2G9NA 2CBZA 2WWYA 5AR1A 1Q21A 1GFIA 2MSCB 4PZZA 2IYQA 4AKIA 2JLQA 2GILA 4IW3B 2CJWA 2QMEA 4PHFA 5KTYA 1N6NA 5JCPA 1LS6A 3I92A 2QGNA 3ND8A 4BLSA 3B6EA 1NVXQ 1TEXA 2QTFA 2GWHA 1CJTC 2QQ0A 2F3RA 1RKBA 5CB8A 4R2HA 1XCMA 2WIBA 4AYTA 5FUYA 2WKPA 3RS3A 3EG5A 3TQCA 3OIUA 3BORA 5AUPB 3AP2A 4GMDA 4OHXA 2IYLD 1VMAA 4FWIB 5DSZA 3W5IA 2IX3A 3PEWA 3U7FB 2G0TA 2O8BB 2RGXA 4FCTA 1HEIA 2IYXA 3DO6A 3EZ7A 3NKVA 4LCBA 1CR0A 1SXJA 2F1RA 2H92A 5BYKA 3A8TA 1X3SA 3OAAA 1BIFA 2ZE5A 4PHGA 2DFLA 1ZUIA 1ZIPA 2ZEJA 2WWWA 5FPYA 5JSZA 2HLDD 3R8CA 3CZPA 2BDTA 2ZR7A 4G5OA 2IEYA 4JLNA 4XWKA 2OFOA 2IXFA 2QL6A 1JEEA 3OIYA 1IN6A 3DZDA 1N0VC 3REGA 3FHTA 4UJ5A 2ZJBA 4AY2A 2GAAA 1QHNA 1ZM7A 2HF9A 2XOKD 5FTNA 1W48A 3THXB 4JKIA 4PC7A 1DELA 3MLEA 1OXXK 2OZEA 1C1YA 3CH5A 4ZCLA 4DLZA 3LH5A 2BWJA 4KSBA 5TMPA 3B2EA 5CDFE 1G6HA 1HURA 3L8YA 5AWFC 3EZ6A 1X86B 2NO7A 3LBIA 3OE7A 3RSOA 1Q57A 4IDQA 2FF7A 3GJXC 2BOVA 4WZAE 3QF7A 1Z3IX 4G5SA 4S35A 1OFHA 4UNQA 4D0GA 2EVWX 4FD2A 2QZ4A 4GBMA 3THYA 2EFCB 4PSVA 1M7GA 1P72A 1U0HC 1TF5A 1YU9A 5JZVA 1C4OA 2ANCA 1G291 3I61A 2PZGA 3DDCA 1CR1A 3E70C 4WVFA 5ANRB 2BKUA 3QKRB 2AFHE 1PV4A 3CPHA 4US1R 2VA8A 5B2ZA 3CF0A 4Q1EA 3EZ9A 3HU1A 5C4GB 1Z08A 3GJ4A 4X8LA 4HATA 4AYWA 3VKHA 2ZUBA 3KFVA 2GBLC 2YYZA 4URXR 2R8RA 1ZAKA 2GEVA 4LUCA 4RKFA 5DISB 1OXUA 2FEOA 1IQPA 1RRPA 4DLSA 5IRCD 1MKYA 2D2FA 2Q9BA 4EPXA 4WW0A 4PQFA 1EK0A 2QAGB 3P26A 2J0SA 5KSOA 1W4AA 4DLUA 4D26A 3M4YA 1T8TA 3B85A 1P9NA 2VP2A 4WXPA 3VR6A 3QQ5A 3LQQA 4M22A 5HCNA 2F1JA 3C15C 2HJVA 1ZNWA 3LNCA 3B9PA 4AIIA 1IAQA 1XEXB 1JALA 2AD5A 1QHXA 2QE7D 5HTKA 4TSFD 1YR9A 1E2DA 4Z8YA 3FTQA 4ESVA 3EIEA 1XMSA 1CEEA 3GLGB 1SKQA 2NTYC 3BBPA 4FINA 1E2QA 4TMXA 3AV0B 1UKZA 5DLQC 5EXPA 3KKPA 3K1JA 4JJKA 1XZQA 4NYJQ 3LY5A 4FMBB 2O8BA 4YMVA 4MYHA 2GJ8A 4C30A 3HU2A 4A2PA 4XTRA 2IBMA 2W6IA 4LJAA 2OUKA 4R7ZA 4L9WA 4IEEA 1N6HA 3U44B 4C7OB 3N2IA 4IVQA 1DG3A 1ZU5A 1S3SA 3IO5A 3Q3JB 3V00A 3PXGA 2NOAA 2CCJA 4M0LA 3SHWA 3KKNA 3BB1A 5TARA 1NKSA 3GFOA 3P20A 2ZYVX 3B1YA 1XRJA 1Z0KA 3ZQJA 2D74A 2EFDB 3K0CA 3K9HA 2BEKA 4DIDA 1N3BA 2GZDA 4Q66C 4KITB 3KDSE 3RS7A 5IK2D 5AJYA 4PC6A 4O3MA 1JEDA 4TZ0A 4L16A 1FMLA 2RGGA 5KUTA 4LJ7A 1GRNA 4ARZA 4D4JA 1K5DA 1OYYA 3BERA 1COWD 3BGWA 1NMXA 2ORWA 3A4LA 1F2TB 2X8AA 5FBQB 1WBDA 1VHTA 3MUFA 2WJJA 3TUJC 4QM6A 5JWOA 3H0KA 1KJZA 2XJ9A 2V1XA 1H8ED 2GA8A 3MWYW 1E4VA 4PO1A 2OXCA 4E07A 3A1TA 1R4AA 1RFLA 5FTMA 1IN7A 1W0JA 1NSFA 4N0DA 2IK8A 3GEHA 3GCGA 5DYIA 2QM7A 1E1RD 4BEBA 2ZU0C 2HDNB 4Z51A 1TADA 2ODEA 5AJWA 1KK1A 1GIAA 4RFVA 3SBDA 2GZHA 1XTRA 5JCZA 4DWJA 4FMCB 3A1UA 1OXVA 1KK3A 1YZQA 4RD6A 1X6VA 3TLXA 5G41A 1GOTA 2D62A 3AKDA 2OXRA 3EWSA 3LW8A 1KHTA 2BEJA 4HUQA 2R9VA 1GILA 1WF3A 3Q85A 2AXNA 5SZIA 2EW1A 2XZLA 2XNDD 3SYNA 1NVVQ 4GNKA 2YOFA 1U0LA 4Q47A 5IDVA 1AK2A 1IBRA 4YDHB 4QM7A 2WSSD 1OH7A 2ZS8A 3CKLA 2ZRLA 4LDJA 4LBVA 4F92B 2VP6A 4R98A 2KBEA 3RC3A 1WE2A 2GDJA 1P6XA 1HH4A 2GJSA 1XEWY 3MD0A 4AURA 2IA5A 2CHQA 1U90A 1UDWA 2OLKA 3BS4A 5HR5A 4TTRA 3P4XA 2PT7A 5CK4A 3CONA 3GLGE 3RS4A 4Q5IA 4A0HA 3A37A 4C9BA 1AS3A 4JVNA 3VHLB 1XJQA 3AF3A 2CL6X 4PC3A 5JJLA 3MAAC 4M9SA 4PR0A 3ZYCA 1E9CA 5DN6D 2BV3A 2R2AA 1VG1A 3BFKA 2PCLA 3JVUA 1G3MA 2QSZA 1CXZA 4WZ6A 1R0ZA 2CHGA 4NH0A 1E2IA 2XEXA 1BO6A 2NO0A 2Z6VA 2ZUCA 3QVVA 2QY9A 3CRVA 3FMOB 1SXJC 5FTKA 3RRZA 2R6CA 2DWQA 2CCGA 2J3EA 4XD7A 1W49A 3LX5A 5JWRA 2P2LA 1RIFA 2OG2A 3IEUA 3AF4A 3T5DA 5TDHA 5CM9C 1U8AA 1YHNA 1ZD1A 4Q7JB 4U7DA 2NPIA 4BFVA 3VQTA 1LS1A 1DEKA 1M74A 3RLFA 3L2OB 3SFVA 3AVYA 1OF1A 1AKEA 1G7CA 3O8DA 4JMPA 3GLFA 1F2TA 3AVOA 3EW9A 4PO8A 4AK9A 4N0EA 4D4MA 1SVMA 4B48A 3LX8A 2QRZA 1N6KA 1ODFA 2AL7A 1W4BA 4LJ5A 2P65A 3BD9A 4XD7D 2BJVA 1WMSA 2R6FA 2I3BA 4AG5A 4NYIR 3ZGXA 4HB2A 3B82A 3M0EA 4A0RA 3WBJA 3LVQE 3GEEA 2A3RA 2ZI6A 1KO7A 4PC2A 4LHWA 4HDQB 1Z2CA 4CGZA 3EZFA 5CJPA 5UKDA 3U6BA 1UF9A 3AF0A 1WCV1 4HEJA 3EC2A 2D2EA 4LBWA 3QPVA 3OIVA 5K8IA 2ZQ5A 2CMKA 1HY3A 1Z6TA 2A5GA 3NBZC 1W5SA 4TYWA 4EJSA 4CZ2A 3QXSA 1XJ0A 5SZJA 4MITA 5KYKA 1WBBA 1XD8A 2G3YA 1N5JA 2ECKA 1KTVA 1FTNA 1ZW6A 1NSTA 2G0NA 5D3MA 4Q4LA 3I62A 2RMKA 4DSNA 2J7PA 2QPTA 2JDIA 4PHTA 4PZLA 3TR0A 1ZM9A 1IOZA 1DOAA 1IY1A 4QG7A 2KB0A 1XJCA 1MABB 2GTPA 4HUTA 5EQTA 4KFRA 2WV9A 2WM9B 1KI8A 2DFTA 3ECCA 3N2EA 4M9QA 3VU9B 3ZS9A 4ZI3A 2H17A 2QMUA 4E09A 4M1YA 3SR0A 4A2WA 1LF0A 4W5HA 1N5KA 4RFSB 1F60A 2WTUA 4V0ME 4Q03A 4O25A 1P5ZB 2RGCA 1YKSA 1S1MA 3SU8A 2LWIA 2WPDD 3A58B 1NBME 1E9FA 2CK3A 1XPUA 3IILA 4HLUC 4A4DA 5JI2E 1PLLA 1FFHA 1MO4A 2AKAB 2ZJ8A 1RRCA 3S1AA 3V4FA 1E2KA 2FJUA 2JIZD 3R20A 5E7IA 5EXSA 1NBMD 2PEZA 2PT5A 3CX6A 4LYFA 1CULC 2O0HA 1Z0IA 2QSYA 2ZUDA 2CLSA 3RDPA 5EZ5A 4E5UA 1BKDR 3LVRE 3EA0A 4OK5A 3TSWA 1E0JA 4EIWA 1MRSA 2IF0A 1DVRA 2A5DA 1KIMA 1XCPA 1WDTA 3KJGA 1K6MA 2VEDA 3LBNA 3NBFA 3KQKA 2OM2A 1K8RA 3X1WA 5JS7A 4NZYA 2FA9A 3K70C 2CK3D 2GK6A 1JJVA 1VKJA 4CVNA 1NIPA 1E9RA 5FUVA 4Q21A 1SGWA 2ZJ5A 3K0CC 3AP1A 5DGXA 4BLPA 2QBYB 4PANA 121PA 1AKYA 1E32A 4DUGA 2BCGY 2FEMA 2VHQA 3IBYA 2NG1A 4Z8XA 3RVBA 4BECA 1FZQA 1XFAA 4LV5B 3QI2A 2BMEA 4KVAA 4IOLA 4RD3A 5M04A 4B2IA 1L8QA 1ZVQA 1NN0A 2LCFA 2OAQ1 4C0SA 2ZM5A 1E98A 1AM4D 1P9RA 4GRAA 2O8EA 4G0NA 1C9KA 3VTKA 2RGDA 5B58C 2WKRA 3JVVA 4Q7LA 4MKIA 4TL7A 2ODBA 3F3YA 2W00A 5LPNA 4GDFA 2OCYC 1LF5A 1VYTA 3SYLA 1OHHA 4OI2A 4Q1CA 3CRW1 3ND9A 1ELOA 2WKQA 2GF0A 1XMJA 2BJWA 4OKSA 4OQXA 4ILEA 2HV8A 1GDDA 2Q3FA 1W47A 1E4YA 3LLMA 4OL0A 221PA 5FOSA 1E2EA 1MABA 3JZAA 4R9UC 1A4RA 1Z28A 4ASUD 1BYIA 1JBKA 2A30A 3BB3A 4K8OA 3E2IA 2AWOA 3SJAA 1KO1A 4C0KA 1T8UA 2PEYA 2VP5A 4WOPA 3I3SR 2GJ9A 5HZHA 5HKKA 3LA6A 4TL6A 1DARA 2ZRDA 4BGDA 5GJWC 1ZUNB 3HPRA 1D5CA 1DO2A 2W83A 2WZQA 4IKEA 3FVQA 3B7GA 4JYBA 4RD2A 4RY2A 1X8LA 4RZUA 2O8CB
chains in the Genus database with same CATH superfamily
1PNOA 2DHCA 3CU5A 3TINA 4V3BA 5IJ0A 1JP7A 1Q2XA 5E6RB 3T5CA 5KDDA 3CW2A 1RWVA 5A02A 1DQZA 1UWVA 3BH0A 4AWBA 2RGEA 3CNHA 5EP3A 3GEDA 1H6CA 1XWIA 2FI1A 4L75A 1K3TA 3B1FA 1P7WA 2BFOA 3PD0A 1W0KA 3QSGA 1I0LA 1R0RE 1KU6A 1LTHR 1P18A 4H0FA 4UZFA 2HQOA 3JWJA 4X8HA 3DTNA 3ZDFA 3O38A 4RK4A 1RFGE 3NO4A 5EJ9A 1MCZA 3E22B 1KO5A 1W5FA 1N0WA 1YS9A 2PTGA 5FWXA 3WZMA 1YBHA 1F8FA 2Q41A 1G8FA 1C9JA 3L0PA 4YNBA 1GPUA 2P9HA 1Y8QB 1A9ZA 4FSXA 3TL2A 4WCFB 3WYFA 5EVJA 4B9EA 1UFRA 1FDRA 3OZUA 2XCLA 3FUUA 4RETA 4KIWA 1ZM3A 2QBYA 1IWBB 2LVBA 3R6DA 3SC4A 1MAHA 1D03A 2C9BA 4I1RA 1NF2A 2BDEA 1SA0A 3N8GA 4QNRA 3VYTB 1BDHA 4PZCA 1HFWA 4EY7A 2Y1GA 1E8DA 3KB8A 8GPBA 2X1HA 1QFSA 3LO5A 4Z4FA 4S2UA 2NT3A 2AT1A 2ZYTX 3K0SA 1CS4C 3OIGA 1SZPA 2V5UA 4PXAA 2OE2A 2W2VA 1N1DA 5L3SA 3WGKA 4LZZA 2VDWB 2MU1A 2LZ0A 4RTPA 1YTUA 4U9HS 1WTAA 5IJXA 1MFZA 4ESHA 1YK0A 2VEOA 4NBRA 1QB8A 2HNAA 2BEWB 5EHGA 1Q0UA 1RWBA 1VL1A 4Q01A 1HDGO 4RWZA 1BHJA 3JQAD 5KSZA 2Q1YA 2Z83A 4FU0A 2BBTA 3IKTA 3EARA 2HCJB 3PYXA 4XKJA 4DEYA 1H2EA 2HX1A 3GO4A 3LUJA 5U9CA 3P9RA 1EG2A 4KE8A 2ATVA 1LJ8A 3SJUA 4NZNA 3U48A 5K6AA 3AXSA 2HQRA 4JSTA 1YR1A 3BA1A 1KYQA 2BHNA 3A11A 4N3BA 3T3DA 1P5FA 2GZ2A 1JG2A 1P1IA 4RQAA 4X66B 1FFAA 2FMHA 5DEIA 2HPVA 2O6LA 5B30A 1W88A 3HEBA 3QXXA 3ZY4A 1L4UA 4KE7A 4R3NA 5KHOC 3BG5A 5HSGA 1ENZA 2AIRA 3BH7A 1BC5A 3L40A 1V2HE 1WCXA 1JQ3A 3DFUA 3KYJB 1VHLA 2FP4A 2IH2A 4U00A 4RGVA 1YB2A 2ZGVA 3ITEA 3FYUC 4BZQA 1VBKA 1V7QA 1U1FA 1P39A 3NXSA 4WZAB 3D8UA 3COYA 5E1OA 821PA 3PFNA 3PQ6A 4R1NA 1G4HA 1DG9A 4K9OA 4XD2A 4BLRA 2D0DA 1SQ0A 3N2KB 1YR8A 2QLJA 3VO9A 4D96A 3OM9A 1OXBB 2COKA 3HA7A 3ZIAA 3AMVA 2ACVA 2G5TA 3E9QA 2RIRA 4LJSA 3P45A 3L7NA 3BWBA 2QTHA 3NWPA 2HA0A 4NC9A 1ZISA 4B2YA 2CV1A 1CVIA 2WIKA 2SKDA 1UOOA 3LPCA 3WGMA 3DXZA 3RJ5A 4M0KA 2DR2A 4JL5A 2KYRA 1XZNA 3L43A 4URYR 3OWXA 4DILA 1T8YA 2UYQA 3FLBA 4IIJB 3ZUGA 1E92A 2VSYA 1QV9A 6YASA 5IT9A 3OQMA 4B5KA 5AXAA 2O50A 3K0AA 1R8YA 4LVNA 2JD1A 1GUBA 1TUEA 3PC7A 4KQJA 2C5GA 4XVRA 1HL7A 2OCAA 3ROFA 4JUCA 4L9SA 2OV3A 4BO2A 1RP1A 4TS1A 3LDUA 5FEUA 1UM9B 1SVNA 1DTSA 1E3DA 2X41A 2WYIA 4KIJA 5K8CA 5DM60 2XQJA 3AIMA 3AZPA 1EVJA 1VI6A 2XF2A 3M4JA 1R74A 3IR6A 2GB4A 3SX2A 4ZCTA 3KVOA 2A9VA 4Y6QA 1XLUA 4QOSA 4QBIA 2QR5A 5JD3A 4FEGA 1STOA 4ARCA 1E79D 2D8AA 2NSHA 1FE8A 1M54A 5AHOA 3AG5A 3RQIA 1QIHA 1W6RA 4QTXA 2UVPB 3KOWA 5KCMA 3Q3EA 1T6YA 1EVLA 2JRLA 3THWA 1RZRD 4AKHA 2OHOA 3VHXA 5K99A 1T4BA 3ZV7A 1OWOA 4S2EA 3DGFC 1FUIA 4CEIB 1LQUA 3OETA 3N53A 4BVLA 3CIOA 3RG2A 1ULZA 1YOBA 2CNWD 4MVJG 2FGJA 4KO3S 4TV9F 1E9AA 2ZYWX 3PDUA 4LWZA 3T3PB 4F45A 3TXXA 2ZUEA 1NVMB 1QPBA 1FCJA 2Q7OE 1NVBA 2HLDA 3O2SB 2NU7B 3V3KA 6ADHA 5JYBA 1VIVA 4EG8A 2XBMA 4EL0A 4LZWA 4A8JA 3L7CA 1RI1A 3PGJA 4J16A 4C0BA 1I0ZA 3ZD9A 5GINE 4EMUA 1W8DA 3UWKA 4M37A 2ZE8A 3HBAA 2NZ8A 3ZGNA 2GCEA 2XOKA 3PA6A 4RHFA 3TN7A 2QPOA 4JA2A 3OECA 3LBHA 2P69A 4IDNA 3EBPA 2WB2A 1WCIB 2J09A 1XTTA 4FJ1A 5DLPA 3ETEA 4CM1A 2FGKA 4XQEA 2AQ8A 1L5WA 4NFLA 4CKBA 2BFBA 2WU1A 2W0SA 2VFAA 1KE2A 4LOIA 1VIMA 3C85A 2PO7A 1RQXA 3M1AA 2FW6A 2RG1A 3USZA 5HIAA 2XGOA 2H2GA 4WKNA 5G0VA 4IF4A 4G0QA 5AHRA 4YAUA 1D9XA 1KH1A 1GZUA 3P4YA 1T8WA 2BHRA 4BV8A 2NUPA 5HP4A 4N3NA 3LF1A 5J2UB 1U2RA 4DLPA 4DOMA 3WGYA 3IOEA 4LXTA 2W2QA 5E3IA 4XVCA 2IBSA 1SBQA 4NBUA 4E3WA 4G5HA 5DHUA 5A2GA 2AG5A 2E9SA 4KSCA 1LVGA 3IPCA 3OZRA 2LR0A 4H27A 4RPJA 4P84A 5EJEA 1GUFA 1UJ4A 3DC2A 1PLJA 4GXNA 4IUBS 4Y1RA 4MUBA 3HNPA 1SKMA 2CJXA 5JOQA 2HI0A 2YJZA 3CLUC 4DJDC 3U7GA 4PVDA 3H1FA 5FUWA 3RODA 3S1LA 2QSUA 1QHYA 1K63A 3IFSA 2VP9A 5JRZA 4MQEA 3FOFC 3H65A 4MNTA 1GT6A 4Z7NB 3OZAA 3N86A 4IXNA 4MQFA 1YB5A 1LBQA 2VYVA 2ZTSA 1V3QE 1JA0A 3FBGA 4NE9A 4UAUA 4JA0A 3GCDA 4BNWA 1JGTA 4TSFA 1VHDA 2PZBA 3KYDB 1QP8A 2X5XA 1TK3A 4HAXA 3P0HA 1EWRA 5HCIA 2HR1A 3K8QA 5FJIA 1FFYA 1JR2A 2FPUA 4FXPA 4OGGA 3B7WA 4PLYA 4I8DA 4MB6A 4ZV7A 3RU7A 1E2FA 2HMVA 5TXGA 3H8WA 1W9MA 3SMQA 3HYCA 2ZIXA 3NM4A 5DNDA 4F6LA 4FW9A 1RP7A 4C3VA 5BW5A 5JAMA 3ZVKA 3KR9A 3ERCA 3OWOA 4PLCA 1OFUX 1QC5A 3AR4A 5E6UB 5T6BA 3OZGA 1NMYA 4QL3A 1QOQB 3Q72A 4GRIA 1Z33A 3RT7A 2WTBA 1JWLA 4RE6A 2HWYA 3GZNB 1KP3A 4V0QA 3R7SA 4G65A 2OQ2A 5HX7A 5JH7F 3O4RA 3HMQA 2CJYA 3RUAA 2OD7A 1UJ5A 3IOCA 1RWKA 3DVRX 3RIYA 4AUMA 1ZM4A 2J1LA 4XIFA 4JGGA 3U49A 1H4VB 2R7MA 1NW5A 2HKIA 3WJAA 3CZQA 2G4LA 3G1WA 3FPHA 1H0RA 3R0XA 4P54A 1LPSA 1FDSA 3PC8A 4G8CA 4I4IA 5JQGB 3OQJA 3AXTA 2WQZA 4B44A 1S2DA 1M6VB 1UPTA 2AMLA 3VC7A 2FHSA 4CV1A 6GPBA 2ZVPX 1J0EA 3GJ5A 3K30A 1YR2A 4YO8A 4LV6A 4XDZA 5ALSA 3AZQA 5IC5A 2O4CA 5TX7A 2CXQA 2Q2OA 3CXRA 4PWZA 5FA6A 2QYSA 1YR7A 2BFFB 2AK3A 2HIGA 5IK2A 2DERA 1XRMA 4LFBB 4M0UA 4YAEA 4B7AA 4MW9A 3AU9A 3ONNA 2ZSBA 3R6TA 1TMYA 4NDZA 3Q41A 1BCRA 3AM5A 4JYMA 1WSAA 3FZGA 5J23A 2I2XB 4IRUB 3U1VA 3RPEA 4LJ6A 3M3HA 4YRPA 2NU9B 4NSNA 4TXHA 1GNLA 2PUVA 1BRTA 4I81A 3WBFA 4UFOA 1JEYA 4H1VA 1U7PA 4MS1B 4XDGA 4NXNB 1USWA 2PH1A 4PLZA 2R6ZA 4RKYA 4YO7A 3RAJA 4BNYA 1QWOA 2WAXA 1NBAA 4YJFA 5CFRA 1GEGA 5C3MA 3THXA 2WMOB 1PK8A 2KS6A 3KKEA 1ZJZA 3WYCA 3LBAA 3U4DA 4TT8A 4DCNA 2WD7B 5DPMA 1ST2A 5E0KB 4B6EA 1NUTA 3TEFA 2Z2KA 5M34A 1SXGA 4U9UA 1SUEA 1ZGHA 4C3ZA 3QYPA 3AUXA 2GAFA 4KQWA 5IVPA 1A7KA 2FN7A 2C2GA 2VDOB 4GX2A 4KXUA 5F3DA 1NQ5A 1YTLA 2H1SA 1UBSB 2OPHA 2M32A 1U65A 2RGBA 1TPYA 2AMFA 2Z3ZA 3F5DA 1SCAA 5KNCA 4E03A 4LNUB 3R3ZA 3BJRA 3CSDA 3DDZX 3RASA 1NLZA 1HT2E 2F00A 3EISA 5FHRA 1ID1A 3WJ2A 3Q8XB 1JEQA 2DOKA 1BDBA 2OL4A 2DHRA 3Q6NA 2HWWA 3LMKA 3ZJYA 3VSAA 1WKVA 1N3LA 4GLOA 1HUQA 2D0IA 9LDBA 5BSKA 4G09A 2V1UA 2H52A 1YF3A 1XXLA 1HFJA 1WRBA 2XNDA 4OQPA 5IF3A 4O4LF 3TLAA 2AWNA 2GD2A 4CQJA 4DLLA 1CB0A 1KI3A 2UYGA 4FYHA 3G6WA 1YZTA 4KPUA 1Q7TA 4YJKA 1T5TA 3DKKA 2QD5A 2YJTD 3IVGA 3R23A 5ALEA 4DA8A 5HKOA 2IL1A 1JAZA 5E4TA 3LFHA 1IEXA 4X54A 4HQ0A 1QDEA 4CI9A 2DT8A 4FGJA 5ALHA 1B8PA 4R1OA 3I5XA 4CKWB 4RVDA 3GCZA 3U81A 3RSFA 3KELA 3ZNNA 3IBTA 3IMEA 1BW9B 1UXOA 3O8BA 3BEDA 2KJQA 3VTFA 5CDTA 1G0OA 2XV1A 4LJRA 1JXAA 1RLTA 4YAJA 4IWNA 4OI4A 3UOWA 2J30A 3B1WA 4OGLA 2JJ2D 4KPGA 4YP1A 1N2JA 1H2BA 2NU8A 4C7MA 4E33A 5B4VA 4WZZA 1TL7C 1EA5A 4IJ5A 3ZEIA 3KKMA 2BBSA 3QVSA 4B7ZA 4G1CA 2NUTB 3FJYA 1PVDA 4EG7A 5LU9A 3LC2O 4E7PA 4WECA 3T7JA 1K68A 1YI1A 3BHMA 3U7HB 3FBWA 4WBXC 1G5RA 1S8OA 4KREA 1GNTA 3HJUA 4BO0A 3OLWA 5BYJA 2I1QA 3VKUA 4LF4B 1D0VA 1Q0ZA 1UXKA 1YL5A 4DMHA 5KTPA 4PSKA 3GEPA 1SQ5A 4OQYA 1AUOA 1RYMA 3IDQA 4DSUA 3U44A 3DMTA 2QP9X 4TT3D 5F5XA 1G41A 3FHLA 2JLVA 3HKCB 4LOKA 1HTTA 4OBXA 3GK3A 2CYBA 3LUGA 2HMSA 3JYLA 3LCJA 1WG8A 1A7JA 3TSYA 1H22A 2PLAA 2O0JA 3N3AC 1GSAA 3UG7A 1X1RA 2Q5EA 4IUYA 1DX4A 3AKZA 2R44A 3HXMA 3BDIA 1EESA 1J4AA 1GTVA 4EW1A 2HCTA 3D4LA 1XD2A 4L28A 3WWEA 1XZMA 2QVGA 2ZRJA 2ZQYA 4EYOA 2B2XA 4EF5A 2IDZA 4OPMA 3EEBA 1G55A 5JMTA 1QHHB 1XL0A 2N0SA 2GFIA 3F7TA 2BTQB 3L8ZA 4ROSA 4MJXA 2JFNA 4OKNA 3ZW8A 1GCUA 1FL9A 2XNHA 1CUEA 4G8DA 4OATA 5LBIA 4U6SA 2FR0A 4BFUA 1MHPA 4JP5A 4A0FA 1WETA 3QBJA 1KKMA 4B17A 1D2CA 1KZ1A 2O6HA 3ZUPA 2VQ3A 1QIKA 2PTHA 4BNFA 5CB4F 1E18A 1R3DA 1W30A 3KSDO 1YOVA 2BGJA 2GGSA 5TSDA 2WICA 3DOCA 2QJTA 1WR8A 5H02A 3OPYA 2G6BA 1XZAA 3H1TA 5TQVA 3BWDD 1F0YA 1FMCA 1THZA 1GO2A 1SB9A 4ZTBA 4CCYA 1WXQA 3FTFA 4DIOA 2I6FA 3IX7A 1O89A 2RI1A 4K9DA 4OJKA 3D7KA 2FSUA 2CSXA 4D43A 1XALA 2WV7A 1SMKA 1PJ4A 4WX2B 3E0XA 1RXCA 2FSFA 2NUAA 2QX7A 3K2IA 3JQQA 3IBSA 5KNBA 1GPYA 1P0PA 5BSMA 3ZEAA 5GJCA 2PD3A 4MIEA 1THTA 1O58A 2IPMA 3MIIA 2NVUA 2RJNA 5IM4A 4B3CA 1T1GA 1W46A 2Q3CA 1G6Q1 1Q50A 2EZ4A 2O2JA 3NAMA 4FYWA 1WBJB 1XQXA 2NNLD 2QVLA 1O95D 2H2IA 3A70A 3D02A 4R8LA 5TMDA 3IDSA 4MLCA 6ABPA 8AT1A 3IEIA 2UUBB 2FZWA 5G3YA 2M6KA 1SUCA 1G60A 1N1EA 1Z75A 2ZJYA 3OOWA 4N0MA 5CX1B 4AO6A 4WD3A 3V4OA 2OV6A 4JT4A 2KW5A 3S8MA 3Q9LA 2GO1A 3QUBA 3NC1C 2EL7A 4LG1A 4KI0A 5DM2A 3RKSA 1RE0A 4TMTA 1PW7A 2FG6C 3QP9A 1PNVA 3DMHA 1K0UA 1SG0A 1SC1A 4PNZA 3LFTA 3X2SA 3GVIA 1QQ5A 3HWX1 4JIMA 1NDUA 3L07A 4KKXB 3G2LA 2IHYA 5BNWA 3W8NA 1QTIA 2B9EA 2EW8A 2F3PA 5JAZA 3RIXA 1GQYA 3H05A 1QZUA 1TM7E 3EN0A 5CLJA 4IDOA 2VUUA 1Y1PA 4L6CA 3Q1LA 3S68A 3U3RA 3UJHA 3M9XA 4O1IA 3JQ9A 4QUGA 4M3NA 2AYXA 3PA8A 2XMZA 2Z95A 4YMUA 2DYKA 1C1XA 1ENYA 1H8HA 2H5JA 4HAIA 1GJRA 4XEHA 5AVWA 5IEJA 1PU2A 3TI9A 1Z4MA 1ATIA 4KPFC 1ZMTA 3EPPA 4KXNA 1CQWA 1K3FA 1Y48E 5GVSA 1JRLA 5J4LA 1IUKA 1X70A 4WT7A 4FQ5A 1P91A 1B0UA 1SNYA 2ZB3A 4JP8A 3AL2A 4TROA 5JISA 4IMIB 1U7HA 1A9OA 2HK9A 1ZN2A 1I3CA 2IUEA 1U81A 1GITA 3DEFA 3OZCA 2DUUA 4NCHA 4GBED 4QUBA 5B37A 4JR1A 3GEMA 4IOKA 3GFSA 4I4LA 5CLLA 5AKIA 1Y81A 1VE5A 1KEPA 2PCJA 2QN8A 3N7AA 1ZHOA 3V48A 2O06A 5U4QA 1I6KA 4Z53A 2WIFA 1XDUA 4QU9A 5FL7D 1CRQA 3RNLA 1SHTX 1BE8A 3DZHA 2F9LA 3NJRA 5EIWA 4EHIA 5LJIA 1S0UA 5FAXA 5EEHA 5LQJA 2QLLA 1SG9A 2A33A 5C7IO 2REQA 2Y2VA 3DBLA 3IAUA 5IYZB 3D4NA 1KDRA 2F9FA 3Q11A 1M2VA 4DJJA 2RGAA 4Q7QA 3G0BA 4A0GA 1NV8A 1DX9A 4FT4A 2C0CA 1FNDA 4DJTA 2G25A 1A8UA 4MYDA 4TYQA 5EERA 2WY2D 3WLQA 3OKFA 3LYUA 4C7XA 5HF6A 5EUQB 4F5EA 3AY3A 1ZEJA 1D2EA 3K20A 2HZ7A 4HADA 1OV4A 1HYBA 2PXHA 3PSAA 4KQMA 4QOEA 3OE5A 3BFPA 4G36A 4NARA 3UAYA 1EFRD 4I2NA 1YGPA 3RYTC 3EMVA 4EUHA 2VRCA 3DTTA 2MR6A 3IT2A 5IANA 4BFTA 1MW8X 3O93A 3U3OA 4JC0A 5I48A 2F7SA 2GXUA 3C3AA 3TLJA 4BX3A 4NS1A 2QAGC 2BSQA 1E2GA 4GPD1 5IH7A 2JS7A 5EMMA 5REQA 2BMFA 5FOWA 4GGMX 5EVCA 4BO7A 1WXIA 1X9IA 5LYJB 5DCLA 2OGUA 3ZBTA 1JT9A 3DUWA 4A23A 5DVZA 4UEQA 2M1XA 5E7JA 1XDGA 4RFSA 3H11A 3KTFA 3M1IA 4MUIA 1WMDA 5JTUA 4MRMA 4MUAA 4URZR 1EVEA 1FS6A 4IIJF 1Z34A 1NJFA 2QRUA 3JWIA 1TF7A 1SPXA 2HQSA 1U0JA 4S0ZA 4WXHA 4TTPA 4DBZA 4PQGA 4Q24A 5GM1A 1I9CA 2A1UB 5KVCA 2OCPA 3HVRA 1UQRA 5DRYA 5ICGA 2QM0A 3LS2A 4HDMA 1MO6A 2WR8A 4X8MA 4UUOA 3BIJA 5B7NA 1S02A 2X13A 2WFZA 8ADHA 4HSGA 1QLHA 1VHWA 4TMFA 1K97A 1H65A 5K51A 5IM5A 4V1CB 2IVZA 1I7QB 3SG0A 1JHMA 1EINA 2F90A 4B4UA 2PGLA 1Z8HA 2BMDA 4YT2A 2C5LA 2R1ZA 5KWVA 3AK4A 3S2GA 3L0DA 4Z6KA 4QREA 3E8MA 4IS3A 3T9AA 3TMKA 2C9CA 4KLCA 2B0JA 2ZT7A 1Q7GA 1GPH1 3HC7A 1H3NA 3AERA 3TRFA 1EZ1A 1SEPA 2YWEA 1FYDA 4AKSA 5CFQA 1H85A 3CRRA 1R0BA 1B42A 2Q2NA 3RSLA 1AA9A 1U9CA 3JARA 1NFRA 1ZGBA 4UE3S 2OGWA 4B34A 4CR8A 2I7CA 3MUEA 1B8UA 4D02A 4UMDA 4IX1A 1M6WA 4HNHA 3GNQA 1PSWA 4YBZA 5KWJA 1NULA 2A78A 4KO2S 3ZHSA 5IHPA 1H1LA 3JQAA 4U7HA 3U61B 1NBIA 5JMWA 3K4HA 3H5WA 2G7ZA 3HVIA 1BMQA 1JKIA 4MR8B 4P92A 2PKYX 2ZRKA 3JQGB 1JLSA 1DOZA 1IHDA 2WMYA 2DT5A 2BKAA 1N7JA 2QW8A 1KAGA 1L5KA 4BGVA 5A62A 3DBIA 1Z2OX 5G2OA 4H2DA 5E95A 1YVUA 2JEZA 3RF7A 3GIWA 4EL5A 1XZGA 2C4WA 1LPMA 3Q7QA 4H0NA 4MQ4A 1Y5IA 1KAHA 2MSEB 1U0NA 3L3BA 2GM3A 2IC5A 3PDIB 4AD8A 2QYTA 5JR3A 4B46A 3QENA 3RADC 2ZLBA 1T2NA 2PX3A 2C7OA 3HLYA 1U3UA 1ULHA 4JL6A 3ZLVA 2YWJA 1E2BA 1Z13A 3ROTA 4Q9KA 5ARBA 2REXB 1UJNA 3NIFB 4JC8A 5JCOA 3GLHA 3FSGD 1CT9A 3EXHC 3JD0A 4NPHA 4XAQA 3ZCSA 5LC1A 2JZNA 2VHCA 1U5AA 4BN0A 1Z6ZA 3NHYA 4CYMA 3C3JA 5J2UF 3GVHA 4GM0A 1O6BA 4L8GA 4IVPA 3K7EA 1CUJA 1JWAB 1XCOA 1GV1A 3ENNA 4B4OA 2QZ9A 1OTYA 3IIMA 1ORVA 5DWVA 1FU4A 3RUFA 5TT0A 4XYGA 1VG8A 5L3ZA 2ATIA 3CCFA 5F7XA 2YR0A 4KRXA 1TJPB 1Y80A 4L5BA 1J8YF 2W22A 4F5ZA 2Q0XA 5GQSA 1AUQA 1ORRA 5JU6A 1H2FA 1RADA 4WL0A 4ZAFA 1YWGO 4WRRA 2OYRA 1WXDA 5ECGC 4ETNA 1E2HA 1Y1TA 3DMGA 3IEPA 4KCGA 3IRVA 2ZUWA 3T3EA 4B3HA 4QGHA 3REFA 2H2WA 3RSQA 4UQPA 1YVRA 3I9V1 3LOUA 4WLNA 1GKYA 5J9FA 5F9HA 1UFQA 5COQA 4D9KA 1A5AB 1K7SN 3LUCA 5EIXA 1F6DA 4RPKA 2PX2A 4JCOA 3MXOA 5E6RA 4LJ4A 2Z6AA 2P35A 4N39A 2ZR8A 4F3YA 5HRUA 3PJDA 2VHJA 2FW8A 1QH1A 3KFXA 1E79A 3QEKA 2YNMD 3IURA 2JFFA 3CCBA 2QHXA 3G0CA 1B1AA 1O96B 4NHOA 3ZWOA 3CF2A 3CMMA 2DH5A 2YICA 3PRYA 3QU4A 3UA4A 3ZGVA 1TAGA 1PYOA 4MO9A 4XB2A 3DULA 4UU0A 1RZRA 1QGED 2J0VA 2XITA 1BU5A 1BWPA 2D06A 3L7JA 3OUZA 2G4CA 2FX3A 2H4FA 3AHIA 5ILGA 3FMIA 4M1KA 1DQPA 1G59A 5CYPA 4GX1A 5DIFA 4P5EA 1WKCA 3N8HA 2CNWA 4HX2A 1ZJ4A 2TMDA 4LECA 5JYEA 1T3TA 3LJKA 4V03A 4ZAYA 4YPOA 4ZJUA 4MULA 2WNHA 2WTMA 3K0KA 1WCWA 1CLEA 1VGQA 1Y8QA 2GKGA 4LOLA 2O2YA 4FXOA 1E4EB 2DPXA 2QR2A 3PGXA 4WCFA 3WOHA 2DJ5A 5C8ZA 4YVFA 1B73A 1X80B 5HZKA 1FMJA 4IO0A 1J0CA 3D8SA 5CIYA 1JPUA 2XUAA 3GLGE 1Q0TA 4ZVSA 3RVDA 3WMRA 2AN4A 2MMGA 3E05A 3NCHA 4I7EA 4OYHA 1LCIA 1V1MA 1SIBE 3G0OA 2Y66A 3GDOA 4TKUB 4DCGA 4Z3OA 3SIWA 1IDN1 1MPTA 4IF6A 1C9DB 1BXZA 1S2GA 2HBQA 3DCJA 5K6TA 4HTAA 1NNUA 3NM5A 1RM5A 4Y98A 1QK5A 4A91A 1MDBA 3F6CA 4M76B 4EDHA 5HUJA 4YROA 4NMWA 3TO5A 3OTQA 1RRMA 1PBNA 4EUEA 1DKOA 4ALLA 5F2OA 4QYSA 2ZB7A 1XZ8A 2XWQA 3K16A 4UZSA 1KDOA 4YDRA 2X23A 2W6NA 3O9MA 2AUNA 1KERA 2XNSA 2PMDA 2VNSA 1I1HA 4G26A 4AMGA 3UWDA 3AEKA 2N3ZA 3RFUA 5AKLA 1PL0A 2AEFA 2W4MA 1ECJA 5JS8A 1CJBA 1JB1A 4L07A 2XUIA 3ZH9B 2JFPA 4U2BA 2FWJA 5CIQA 1YR6A 2WABA 5B5SA 1GA6A 4OHZA 1K8ZB 4QTYA 1JDBC 3QVMA 1IHXA 1SQFA 3BUSA 1FFXB 3CRMA 2PUEA 3VR6H 3HJHA 4HNRA 2IDMA 3IVAA 3UV6A 4AJNA 1L6RA 3Q4GA 5EI5A 1NR1A 4H35A 3TRDA 3R1IA 3WAGA 1RAHA 1NW8A 4QQKA 3H9QA 1E2LA 1WUJS 3WIUA 4Q9LA 1W85B 4XYBA 3CZ9A 3EDQA 4IWXA 4J6EA 4HVLA 2QU7A 3JASB 4N3AA 2X86A 3G2KA 1CJVC 1CU1A 2AEMA 2P91A 3ZHOA 1UODA 1QSGA 4R1LA 4G63A 1MA3A 1OZGA 2P2YA 2VO1A 2C99A 2XRFA 3ASZA 1KEZA 5GV7A 2GPTA 5EE1A 2XB2A 2QN6A 3TTVA 2JAUA 2VDNB 3E27A 3E2PA 4W82A 4N7MA 2DQKA 4YRJA 2QT0A 4LFCB 3F8TA 2C29D 3N58A 1XDDA 1V8ZA 1RWMA 4WN9B 3L1UA 4MKXA 1HDCA 1Z7BA 4DMMA 2DWOA 1IQ0A 2IYTA 2F3SA 4QSMA 1RAIA 2MCFA 3I2IA 1CSEE 4ZVMA 4Y2UA 4ODIA 4HYYA 1PJSA 3RV4A 1KJYA 1UM9A 1OLUB 2BR4A 5G0TA 5AM3A 4NFHA 3ES9A 2B1IA 5I51A 1PDWA 3FROA 3JAKA 1ISJA 5C32A 3MTEA 4AVYA 3A1FA 3P97A 2P4EA 1T9GS 3DCYA 5JDCC 4DLTA 1UBLS 3W4JA 4MMXB 4OB7A 3I9V6 3PKIA 3L92A 4BTLA 2ZB2A 3SDBA 1GZ5A 3GNTA 1DE0A 3OIWA 4WBNF 2J9YB 2QX6A 2UVPA 4X71A 2XTZA 5CURA 3PC3A 1KK2A 5LZ5A 3TJRA 4ARZB 2YCBA 4PS1A 4XFDA 2AXPA 7ABPA 1O5TA 4PSCA 2ZI4A 3AF1A 2YX1A 1PK9A 4EJ0A 1TLLA 3A1EA 2Z8XA 3UCXA 1RRKA 1AJEA 1II8B 2YMQA 4KR7A 5B1EA 2EP7A 4H7PA 1I3KA 1E2UA 5K6RA 5DBGA 1BKYA 2GHIA 4JBXA 5AK0A 1CCWA 5H9WA 4GMGA 2X7JA 4FDLA 4D79A 5BN3B 4Z5XA 4N5NA 1ISFA 2BFWA 2B69A 2HMAA 1M2KA 2Z4TA 5CDGA 3GEBA 4HSEA 3H9CA 3DAOA 1C7QA 4HT3B 4DDTA 1OUMA 5D84A 1XE3A 1GRQA 1V1RB 4CR6A 4OLFA 2NU7A 3BE5A 4EKNB 2Z3WA 2XCSB 2FW7A 2I5PO 1XHLA 3F1KA 2WF7A 4QGAA 4X20A 1X8JA 1J33A 4ZDIA 3LHIA 4V39A 3ZDCA 2ZAMA 2AZTA 2WAYA 4QPCA 5BNTA 3DZCA 1VTKA 2RC5A 3P9ZA 3WP1B 3F78A 5A5GA 2ZBPA 2IDKA 3HVUA 4KPEC 3GRKA 1D6NA 2H59A 3Q9UA 4V2UA 1LNQA 1O97D 4C3OB 4UPEA 3AEUA 4NCBA 1Q6YA 4V0KA 2VF5X 4MHSA 3T61A 4F6CA 2QB5A 2OAP1 1ZBDA 1T25A 1ZINA 2HSEA 5CK5A 4EEZA 4IGEA 1BNCA 3KVRA 1G5TA 4KE9A 4R2LA 3Q3GE 1M1YB 2K87A 2XNJA 1GV0A 3FMPB 4HGOA 2QSJA 4QVGA 4HF7A 1KZ7B 1LC3A 1CJSA 1NDHA 1N0UA 4BO6A 4C4AA 5B4TA 3C3XA 1BN6A 3SR3A 4ARAA 1E3MA 1E7MA 4I99A 3O8QB 3QY9A 2ZVDA 1Z5UA 2P0YA 1UXIA 3ADOA 3BL6A 2IYUA 4AZWA 4TLAA 4CLDA 1XV5A 3I6IA 4BC1A 4D82A 5K09A 2WF5A 3A3NA 1R4ZA 2UYYA 3ZD7A 4AG6A 1Q74A 3AJ9A 5A0FA 1KK0A 3DT8A 3G8DA 1RBYA 1LEHA 1PAUA 3GFRA 4RIEA 3U4HA 4YV2A 4OHMA 2RH5A 4MGHA 4RVCA 1Q0SA 1JAHA 4D4KA 3SVTA 2O5CA 2FSVA 1UKBA 2DPMA 2QTTA 1MFPA 2MWMA 3KKQA 4GGOA 1D2AA 4N54A 5AJZA 2YS6A 4NLLA 4ARBA 3B2QA 2YWCA 3V1UA 1RTTA 3LPNA 4B6GA 1DKMA 1NMZA 2IH5A 1RI2A 1XKQA 1YRYE 4NEHB 4EAQA 2VNHA 1KY5A 2FSGA 3BMNB 4AY6A 3CT6A 4LAFA 3E15A 4ZOLB 1FK8A 3DLIA 1JSRA 3CLSC 2OAEA 3GGDA 5CEEA 3B5JA 2AZDA 2WUGA 3C8MA 2O3TA 4BKUA 4I36A 4UVEA 2P4QA 2PVSA 1DINA 5E9AA 4BX9A 1GARA 1M83A 2W6ID 1MG0A 3PUVA 4EGFA 3FGOA 3ORRA 1RWXA 2JJ2A 3MWKA 5CGQB 2E1PA 1SKYB 1DBVO 1PBTA 3ZBPA 2YV4A 5JTTA 4YQZA 3GT4A 4ZIRB 5M29A 1R7RA 4DR2B 2WWGA 2WWFA 1RHJA 3MLAA 3R3WA 4M8NE 4YR9A 2X8WA 3DQZA 1T3LA 1U8XX 4BRZA 2O3UA 9LDTA 3TOXA 1G20B 2C20A 1HRDA 4YUZA 3GZNA 1Q0RA 2O7QA 3TNFA 2BN4A 1E9EA 1BJTA 5GZ3A 2Z1DA 3DEJA 3T06B 1OJ7A 1N3YA 2B2NA 1ZC3A 2PZ8A 4PBRA 3PUJA 4ZQGA 3VNVA 2JI7A 4LMBA 2QJRA 4W9MC 2RHCA 3DYIA 2OFWA 4JLDA 3TDKA 1EE1A 3HUEA 2M6LA 5KTKA 2Q3EA 5JQGA 1KJJA 2PA0A 4JDPA 1M6VA 3LKVA 3D9QX 5FBRB 1WB9A 2JBAB 2IYVA 4AKTA 4BNZA 1NLYA 5I4IA 2PKEA 4EY8A 4F11A 1U8FO 1YUBA 4B84A 4Z2AA 2V96A 1C1DB 4J0EA 2DAPA 2X3UA 4HY3A 1CW2B 2WE8A 1RU3A 4EI8A 2R6AA 2BFFA 2WUVA 3CVJA 2JGNA 1VM6A 4RGBA 3CNBA 3F46A 3FYUB 1P75A 3TQFA 1NV9A 2JFBA 1P6UA 4CG0A 1DB3A 2FFRA 2ZT5A 1GCIA 2BZ1A 4HP8A 4J0HA 1WDKA 2RBEA 4OLJA 4QBFA 4YCMA 1WLYA 4J4TA 3ILXA 3OT1A 1W0JD 4DHEA 2NU9A 5HKAA 3HYRA 1Z7YA 3FNHA 1ZOIA 3PYLA 4J7UA 4KX5A 3MWLA 4MS1A 1QZXA 1U4OA 1DAOA 1F3LA 1PG5A 2QW0X 4Q9JA 4V0OA 1P7YA 2DRIA 3OUTA 5F4BA 1E96A 2CD7A 3OBIA 2ANBA 5BV7A 1VE3A 1JSXA 5LMCA 4DDUA 3QKTA 5DMXA 1S4MA 2F17A 1I6WA 2CE7A 3O0TA 4LY6A 4BAZA 1PEYA 4JJGA 1T6NA 3VDMA 2WD7A 1NMQA 2VCYA 4ZEXA 1MU0A 1J6UA 2EZTA 3F5QA 1AO3A 4D9NA 1V0JA 4Z0HO 1ACMA 3AHDA 4I1PA 1E6MA 4RMNA 3S4YA 1I7LA 2H3HA 4ETIA 4E5VA 5EAIA 3KIPA 3RYIB 3GUUA 1V41E 3NALA 3ZJ4A 5F7JA 4DWVA 5FCDA 2J6CA 1K4KA 3ZLUA 4L72A 4BZXA 1O8BA 3OTHA 1OU0A 4Q00A 3S1AB 4EVSA 4KPYA 3QMVA 4D8YA 5I9NA 2R6GA 2ALJA 3LK6A 4FFDA 3H84A 4LHVA 3SC2B 2UDPA 4G37A 4YJHB 1ILEA 3FNFA 1TJ5A 1G66A 1L4HA 2N47A 3VHRA 1AD2A 2F1IA 4HLCA 4UHDA 4C0WA 2AH5A 4NECA 5DSTA 5ESWA 1OXMA 1TT7A 3ZVMA 3I04M 3ZCXA 1VP3A 2ZREA 3OO0A 1O95A 5A3SA 4B8ZA 1KZYC 2IQ5A 2PUTA 1YDGA 5BR8B 5JWHA 1RM3A 2YWGA 5A6SB 4H0CA 1E63A 1NVUQ 2I03A 3LQRA 2GYYA 5CJ2A 3TFOA 2HPZA 4ND4A 2C2HA 2G77B 2E4XA 2Q4OA 3IDOA 3NUGA 1EUDB 4A6PA 1R3UA 1X42A 4R6XA 4ER0A 2XMRA 1C29B 3PE4A 4XJVA 2IV2X 1R0CA 1G8KA 1G8GA 1R5JA 2R00A 2DBRA 3AVUA 1HMYA 3HJNA 4RCZA 5GADl 1E5QA 4CKWA 2CDNA 4F4DA 1GA4A 3H5OA 4II3A 5AJXA 5IBRA 4OV6B 4AX8A 3DL7A 4F0JA 4DIFA 4B31A 4G5QA 1BW9A 5IW8A 3T3NA 2OBLA 4FDTA 5CT5A 2YN0A 4DF3A 1RM4A 2Y76A 3R7DA 2Q4EA 3RC7A 3KDAA 3N05A 4EKEA 1KARA 1OX5A 4OGWA 4Z0TA 5IVDA 4ZOQI 1FW6A 1NKTA 3QFHA 3GLFE 2XYPA 2RHBA 4N01A 3K94A 3WAKA 1ORWA 7REQA 4CM7A 1OXSC 5LQKA 5HHTA 4JBIA 3SQWA 1YVPA 2VVTA 3KUDA 1U0GA 3AI7A 2J6IA 2HYDA 4A3SA 2GAIA 2F2TA 4CIDA 1WPXA 4D42A 5FBLB 3WXMA 3G02A 3QKWA 2OXTA 1YMQA 3LSTA 4NEQA 3OCUA 5DI3B 3E8XA 1WQ3A 3LVFO 1GAEO 3IDAA 2RKOA 5E1DA 4N65A 1IN5A 4B79A 4DV0B 3GJ8A 1LPBB 4EG4A 1COZA 2JA2A 2OSBA 2WKSA 3HKCA 1Z2PX 5DO9A 3Q88A 4MH0R 4AP6A 4RU1A 4TS3A 3H2ZA 2ZXUA 3RFTA 2MYUA 5HKBA 2JH8A