1J90A

Crystal structure of drosophila deoxyribonucleoside kinase
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
195
structure length
195
Chain Sequence
TQPFTVLIEGNIGSGKTTYLNHFEKYKNDICLLTEPVEKWRNVNGVNLLELMYKDPKKWAMPFQSYVTLTMLQSHTAPTNKKLKIMERSIFSARYCFVENMRRNGSLEQGMYNTLEEWYKFIEESIHVQADLIIYLRTSPEVAYERIRQRARSEESCVPLKYLQELHELHEDWLIHQRRPQSCKVLVLDADLNLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Deoxyribonucleoside kinase
publication title Structural basis for substrate specificities of cellular deoxyribonucleoside kinases.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transferase
total genus 74
structure length 195
sequence length 195
chains with identical sequence B
ec nomenclature ec 2.7.1.145: Deoxynucleoside kinase.
pdb deposition date 2001-05-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1j90A00
4FCTA 4NP6A 4JIMA 1U0HC 4PHFA 3RS7A 5FPKA 1TF7A 4ASUD 3KKQA 4EAQA 2C9OA 4B32A 4LJYA 2X2FA 4KI0A 5UKDA 2X19A 2K5UA 1U8ZA 1ZD1A 4ZDIA 4FMDB 3NBYC 5FL7D 1Z6TA 3QG5A 1P9WA 2BMFA 2VTKA 4JKIA 2QZ4A 3GJ8A 1IHUA 1L7VC 1US8A 1YRBA 2P5TB 1JEEA 2Q9BA 4XWAA 2YWHA 3QF4B 5J40A 4AK9A 3TAUA 5BW8A 4D4MA 2C2HA 3ZZTA 4HATA 2WKPA 2O8BB 4TMXA 1G8PA 3MUFA 4MGKR 1BH2A 1CJTC 1II8A 3EC2A 2OV2A 1ZCAA 3IIMA 4B75A 8OHMA 5FL7A 1ZU5A 5AUNB 2XAUA 4KLZA 4ITRC 1MH1A 2HT6A 3R9WA 1LF5A 4UXJA 3TK1A 3RRZA 3PUVA 2AKAB 1Z07A 2RB4A 1HURA 2WOOA 5BQ5A 4Q01A 1W47A 2LKCA 1TQ2A 2NZ8A 4BFVA 4QBGB 3REFA 3ZDQA 1BOFA 1H8HD 3PV0A 4BZXA 1FFHA 5JJIA 2O0KA 4P4SB 4BZQA 3LLUA 5C1BA 3VU9B 3JVVA 2QG6A 4LYFA 2ZU0C 2QRNA 1R6BX 1D9XA 4E03A 1LNZA 4OI2A 1E0JA 1OKKD 2IXEA 2QAJA 4JBXA 1VTKA 3GMTA 2FZLA 4Q19A 1CR1A 2NGRA 2ZJYA 1H8HA 3KB2A 4G01B 3L43A 4LYJA 2GNOA 3IGFA 5AJZA 2CHVA 4DIDA 1TX4B 4EPVA 4AWXA 2LCFA 1EESA 2DY1A 2JLVA 1GZSA 1FX0B 2OCBA 2VRWA 3U61B 1HQCA 4YDSA 3AF2A 3V4RA 1GKIA 4PPGA 3IDQA 3SOPA 3REGA 1YU9A 4U02A 3NH9A 3RRMA 1DAIA 4CF7A 4HAYA 4LHVA 5IRCD 3HP1A 4O25A 3C8UA 3B82A 3C41J 2G83A 5JRJA 5H8WA 1M34E 3TJZA 4CT4B 1XFAA 3ADDA 1Z8FA 5JLJA 1R5BA 4XSGA 2OM2A 1KJZA 5DO9A 3CO5A 5JCPA 3AM1A 2RGXA 3S1AB 1G41A 1VG0B 4JBWA 5TARA 3U3KA 5IHPA 5SZKB 1ONBA 1YVDA 2B7CA 4MRVA 4C0JA 2ZUCA 4A0GA 3W34A 3ND9A 2J3EA 3EIHA 5AR1A 3HJNA 3RVBA 1Z2CA 2J45A 3B1ZA 3G5UA 1I4LD 2CK3A 3OE7A 4WOPA 3SEAA 4D80A 3EWAA 4Q7LA 1Z63A 5F98A 5K8IA 1N2CE 3W6PA 1NY6A 2XNSA 2F1HA 2BCJQ 2ZVQX 3LV8A 4TYWA 3FKSD 4DLWA 2FZ4A 4B76A 4H1VA 2ZPTX 2O8EB 1XEWY 4KVAA 4D2IA 1VHLA 3HYRA 2XTMA 4DSNA 5J47A 5JS7A 2IX3A 3U5ZB 1R0WA 4AKGA 5CK5A 1TEVA 4G5SA 5CJ2A 3RYTC 2ODNA 3HU3A 1NN5A 3AVTA 3R9XA 2ZJ8A 4D26A 2Q21A 1J7KA 1P5ZB 1JBKA 1E79D 1R0YA 4G5OA 2ZJOA 2ZS7A 4WZ6A 4M1MA 3RHFA 4M1SA 1G4AE 1UBGA 4MA4A 1NBMA 4Y0AA 2IWRA 1QRAA 4EFLA 3A4NA 3CRMA 3ZYCA 4V0LA 1E32A 1OH5A 1XPOA 3GLHA 4YMUA 2FSFA 4B2IA 1XMJA 1IXRC 4ESHA 4BFWA 1E79A 2WWIA 4IDHA 3AKCA 4Q21A 1GM5A 5KOYA 5BN3A 2QPAA 4PAQA 1XTJA 3RRYA 4IOLA 5EE3A 5BN5A 4UQOA 4LBWA 4PC7A 4RCZA 4TLEA 5JJKA 5G3ZA 2ZR0A 2VHQA 4FN5A 2D2FA 4Q4HB 4Z51A 3T1QA 1H8ED 2W58A 1MO5A 2QTVB 3MG9A 4RFSB 4B43A 2VHUA 4JYCA 4BUJA 3LRPA 2AXNA 3FE2A 4RD3A 1G8FA 3FHTA 4CEJB 3ZZ0A 3C15C 3D7MA 3Q5DA 4BEJA 4BRWA 3EPJA 4ON9A 1IN8A 1GRRA 3NBFA 3U7GA 1DE0A 3LW8A 5J4YA 2GF9A 2V1XA 1UBEA 1RYHA 3GCGA 4RD0A 1OH8A 5DHAA 1ZIOA 1F2UB 3I62A 1U0LA 4BFYA 2ZRFA 4QBFA 2XZOA 2C8VA 3DHWC 2P3SA 1LTQA 2RKOA 4QGAA 4X8LA 4LSGA 4MRPA 2F1IA 4CDGA 3TSZA 4MKHA 1IBRA 1TF5A 2DYKA 2NIPA 2IL1A 2QPOA 2VHTA 4MYUA 3BJIC 3TR5A 1NSTA 2KBEA 2QP4A 3X1DA 5JMTA 4TQ9A 4NCIA 2VP9A 3QKSA 5CK4A 5DN6D 2QE7A 4LHXA 2QBYA 3K70B 1UBFA 2DHRA 2ZRCA 2PJZA 3CX6A 2A3RA 4A2WA 2W00A 3NC1C 1G6OA 1E2JA 4LJ9A 4Q1FA 3P27A 1QDEA 5AUOB 2B7BA 4B2PA 2VIIA 1R5NA 2ZRBA 4PAMA 4AD8A 5EXSA 4ACAA 1CULC 1S8FA 5DN6A 1Z5ZA 1F3OA 4QBIA 3GLIE 2O8DA 4JLJA 3K0FB 2C98A 2OHFA 4KFTA 3NBXX 4JLPA 4C0BA 5GADl 5LDDC 4LYHA 3M4YA 2GHIA 2EYUA 4GZLA 3QG1A 5KSPA 1DO2A 3B1XA 3M0EA 1LS1A 1TUEA 4ACBA 5HCNA 2VP2A 4LI0A 4F91B 4TLCA 2QAGA 5TMPA 1GG2A 2QI9C 2DB3A 2CNWD 4BE7B 2ZE7A 1M7GA 4TQUS 2CE2X 1YZNA 4JVSB 1YZGA 1KYIA 2DFNA 1TEXA 1G7SA 4B47A 2OESA 1N6PA 1KI2A 4LV6A 5LD2B 2CCJA 2JJ8A 1YKSA 1XTRA 3T5DA 3Q85A 4CEIA 3VNUA 2CNWA 1XCGB 1E1QA 4R98A 3SDZA 1MO3A 1W48A 3TMKA 3L0PA 1VYVA 3IKJA 4B71A 4GT1A 5GVRA 3THWB 2FF7A 4XD7A 4DIEA 1ELOA 2L0XA 2Q0HA 4YLGA 1I2DA 2ZI7A 3X1ZA 4JBYA 2FJUA 4AI6A 4NPHA 4HZUA 2ZJ5A 2HXYA 3MCAA 1PUIA 5DI3B 1E94E 1IOZA 3TLXA 1X8JA 4GP6A 4JVNA 3RS3A 3T1OA 1VIAA 4M21A 5K8TA 3R20A 2C5LA 1W2HA 5B64A 3U7FB 5HPYB 4NYIQ 1KDRA 3QVVA 4TMTA 3BB1A 3RANA 4URYR 2FPLA 1Z0FA 2IC5A 1R10A 3CPHA 4AKEA 1N3BA 2WJHA 4DLXA 2R6FA 1AKEA 4C2TA 3WNCA 2OEPA 4C0KA 4LJ5A 3PEWA 3THOA 4US0R 1U8AA 1P9RA 1Q12A 1OXTA 5JEEA 2G1JA 2YC2C 1XXHE 4EQ6A 3LA6A 5J4KA 2XSZA 4EIWA 1OFTA 2ZI9A 4ILEA 2J0QA 1GKUB 2X77A 1E2QA 2HYIC 4XTRA 1W49A 4LYAA 4CIDA 3JVUA 1YR6A 1EWRA 2VP0A 1KK0A 2WWGA 2REXB 3WYGA 1UDXA 2QQ0A 1Z28A 1BYIA 1BMFD 2RGNA 1RE0A 2QGNA 5C46F 3D31A 5G3YA 2FSGA 1D2EA 3LNCA 3OESA 4UNQA 1NY5A 4ZO4A 3BFVA 1R8SA 3U4QB 2W0MA 5CIWA 2YKGA 221PA 3F0TA 2CLSA 4LBYA 4NCHA 2IYXA 2V54A 2BKEA 2ZYVX 4HDCA 4DCSA 2NG1A 5HKKD 2CL7X 1P72A 2GXQA 2CCGA 4MYCA 2WV9A 3F8TA 2WJVA 1OT3A 1SKQA 1Z83A 3QPUA 1N0UA 2HJVA 3M6AA 1DTSA 1TU3A 3LXRA 2HLDD 3JZAA 5HKKA 2J87A 2GBLC 3SYLA 1RC8A 2I1QA 2W2TA 4L9WA 1CTQA 5L3QB 1N6LA 1QHYA 3DVLA 3FOZA 2VF7A 1GL7A 1XZQA 2OCYC 5J4VA 5FI1B 4W7SA 1AQYA 1ZD9A 2XNDA 2OBLA 1PVOA 4ZCMA 1OH6A 1EX7A 1KIMA 1ZUIA 1RKBA 4LHYA 3WYFA 1XCMA 4HUTA 3PUXA 3L0SA 5FUXA 4NYMQ 1OIVA 4YQFA 2ZJ2A 2GJAA 1GRNA 1X6VA 3NHBA 3U44B 3A1VA 3KQUA 3CM0A 4B33A 1JNYA 2B8WA 2QNRA 3B1WA 4D81A 2J0UB 1VDZA 2CLCX 4TMKA 4C7OA 2BVNA 2OSBA 1YZLA 2OAQ1 1U99A 4S35A 4FI3C 1AIPA 4DZZA 1RJ9A 1IN4A 4DB2A 4M9ZA 5SZJA 3FVQA 2WSSA 4KODA 3VQTA 5AUPB 4P33A 1E1RD 2YHSA 1BKDR 1G8GA 1JI0A 2F43A 1QG4A 2XX3A 4BWYA 4EKDA 3GLFB 2PLFA 3FB4A 3AF4A 3IPYA 5DE3A 1Q21A 2FA9A 1U98A 3RABA 3A4MA 1AGPA 1KJYA 5EZ5A 5L8VA 4BEBA 1TL7C 5KUTA 3ONWA 1UKYA 4PANA 1KO8A 1UEIA 4BECA 2ZRNA 1OB5A 4OHVA 4BLTA 4XTCS 1P2TA 2ZRHA 4P4UA 4DUGA 1I2MA 1QZXA 4ZCIA 5EJEA 1A82A 1S4QA 2YC4C 1R2QA 1ZNXA 3Q5EA 2FGKA 4GOXA 4MUBA 4Q1BA 3X1WA 2VYFA 4DLUA 1NSFA 4PQYA 1TMKA 3KQHA 5KDOA 4HB0A 4KITB 1MABA 2QMHA 1AKYA 2O8BA 1DG3A 5IF9A 3FMPB 3D6TB 1T4GA 2AD1A 4EPYA 4TLDA 4JS0A 2OE2A 2KSQA 2X2EA 3W90A 2FSHA 4UNSA 2GAAA 3NC0C 1DAKA 2VP6A 3SQWA 3Q7QA 2FX3A 4PSVA 4MRSA 2P6NA 5GJWC 2AD5A 2YOHA 3AP3A 3TW8B 5L3SA 4OQMA 4ZI2A 4M9XA 2VO1A 4RSGA 3DL0A 4Q1EA 2F55A 1SHZA 3UPUA 2YYZA 4Q7KA 2DWOA 1KI7A 2RCNA 5AJYA 4RZXA 4B34A 4ZIRB 2BV3A 1SVWA 5BWMA 1P4SA 2FWRA 3B9PA 2BC9A 1ZMXA 4EUNA 1RZ3A 5EZ6B 2PEZA 4PC6A 5FPHA 3FMOB 3EZ2A 1AS3A 3CX7A 3ETLA 2EQBA 3NEYA 4JLOA 5KDDA 1NBME 3OZXA 1M6NA 3BORA 3U3RA 2OO7A 2F1RA 4R9UC 3MMPA 1E9BA 1AZSC 5CJPA 3WY9A 4S2EA 2ZI3A 4FCVA 1VCOA 1WB9A 4URVR 3GLHE 3N2EA 2WAYA 1NVUQ 4DSOA 1NJFA 1IJFA 4PC3A 5K8LA 2WPDD 3KJIA 3AGQA 3UG7A 3ICQB 1XJCA 1EK0A 2GZDA 3MGCA 1P61B 3QPWA 4GOJA 2Q3FA 4MGYR 1LFDB 4GNKA 3LO5A 4BASA 3B85A 2BMDA 4JJKA 5AWFC 1FP6A 5IDVA 2JLUA 1EG7A 1KNQA 3GLGE 1T91A 3L82B 4CEHA 2AK2A 4IEIA 1UAAA 1CS4C 1D8TA 2QT1A 4HAUA 2J1LA 2IA5A 3NIBA 3VHLB 1P6XA 1ZU4A 3S1AA 4C3ZA 4GBMA 4OI1A 3I32A 1KKLA 1NMXA 1LW7A 2R44A 1YHNA 3G82C 3WNDA 3BFKA 3K0AA 1GL6A 1WMSA 2QU8A 1IY1A 1KI6B 1S3GA 4DSTA 1OH7A 3AVVA 1Z0IA 1R7RA 2QSZA 3RLFA 2O52A 1HUQA 3K53A 1GRQA 4LRWA 5JBQA 3FYHA 4GPTA 5AJVB 1FPMA 2W83A 5JI3E 1KY3A 4URXR 3IO5A 4GI7A 5AJXA 1N5IA 3LFUA 1IY2A 1KNXA 2QM7A 4AYWA 1UBCA 1G3QA 2GCOA 5IT5A 3TUZC 1LS6A 2YWGA 1NN3A 2WWXA 4KAXA 1X86B 4BFXA 4OI0A 3FFAA 2BKUA 1KDPA 2OUKA 1KHTA 3GJ6A 4R2HA 2V1UA 2IEYA 2ODBA 1T3SA 4PC2A 4HAZA 3SU8A 2MSDB 3M1IA 1W0JA 1Z2AA 1G5TA 1E9SA 5DGXA 3ADKA 5E4FA 3SR0A 1E0AA 3AF1A 4TT3D 2GWHA 4OKSA 3SN6A 1CR4A 4CW7A 1UM8A 3FPAA 3AEZA 1N5KA 4C9BA 2LKDA 1PLJA 4IVQA 2FPKA 2FFAA 3UKDA 1V5WA 3AUYA 4DEYA 4IXNA 5CDFE 2PMKA 2IS1A 2HXSA 4B73A 1YRAA 2GJKA 4EJSC 2ODEA 5JEDA 3EARA 2OZEA 3LWNA 4PPFA 5FR2A 3ZJYA 1O87A 5FOXA 2RAPA 2HF8A 4WW0A 1JJVA 3THYA 1FUUA 1U81A 5KDLA 1G1MA 4M22A 4R2IA 1XPRA 2JLSA 1FTSA 2QM8A 4NCJA 2YINC 1JEDA 4RD2A 5M04A 1XTKA 5KPJA 4DKXA 1EFHA 1U9IC 3OEHA 1E9RA 1I4TD 4KBGA 2XXAB 4LWZA 2EWVA 2ZETA 2GCNA 2ZJZA 4N0EA 2OXRA 2FH5B 4HDQB 3CIOA 2LWIA 3HR8A 3MJHA 1KMQA 3LLMA 1D2NA 3SZRA 1HV8A 4V0KA 2DFLA 3QKRA 4JLAA 3DZDA 1M7BA 4Q02A 2XB4A 1CKEA 4A82A 2WKQA 1F2TB 4GFDA 4M0LA 1TPZA 2R6AA 2CJWA 3BH6A 3I3SR 4HLUA 4QGGA 5CLQA 2GZHA 2IYYA 4MKFA 3OF5A 4BPBA 2VBCA 1SXJC 2RGAA 4II7A 4MITA 521PA 4ABYA 3T61A 1V43A 4XSHA 3U3JA 3CW2A 2N1BA 2QTHA 2ZE6A 5EP3A 3KXIA 3K70C 4IW3B 1NP6A 1AQUA 4D0GA 1E9FA 3V4FA 4LHWA 3TVDA 4C4PA 1VECA 3GJ5A 4URUR 5EXXA 4IDNA 4A15A 3DMDA 2Y8EA 2JDIA 3TKLA 1OYYA 2RGDA 4LDJA 4W5JA 4KFSA 1W36B 5JSZB 3PFIA 1R0ZA 4CT5A 1TTTA 4Q5IA 3AP1A 4C0SA 2OAP1 2VSOA 2GXSA 1W4BA 3C5HA 3SFZA 3VX3A 1DAHA 1E9CA 1TQ4A 2CVFA 1ZJ6A 3CNOA 3HPRA 4DCNA 2ZYTX 1S3SA 3DZ8A 3EA5A 2FFHA 4QFMA 3BOSA 5FTKA 3CH5A 4UXHA 3ZQ6A 2AK3A 2JLZA 1GILA 2GXUA 1UEJA 4EPXA 2ZSAA 2O8FA 1CU1A 3OIWA 1OFIA 1X8KA 2ZE5A 3K1JA 4GSYA 1W2GA 4Q9JA 3UMRA 4D0LB 5LB2A 5LD2C 3Q8XB 5JCZA 4NTZA 4Q4LA 1ZNYA 3D3QA 3EIEA 3KDSE 5HTKA 4A8JB 3KXKA 4LBVA 1UADA 3BGWA 5KYKA 3BH7A 2GCPA 3W5JA 3FMFA 1P3JA 2YVUA 2O8CB 2QMUA 2P6UA 1TQDA 1EGAA 2MSEB 2ZSEA 1G3MA 4MRNA 4B35A 2WMOB 4JKYA 3SQXA 2GVZC 3AQ4A 2UVQA 4DHEA 4AG5A 4RFVA 2V3CC 2IEZA 5ANRB 2GILA 4DLRA 3R8FA 1VYUA 1N6KA 5A4JA 3PEUA 3CF2A 3OE7D 2CK3D 4NZYA 5HR5A 3KQLA 4IHQA 4G5GA 4Q9KA 1IXZA 1Q22A 4V0OA 2XTZA 4DCVA 4HUQA 2H92A 5HZKA 2EFHB 1VCNA 4LX0A 4U00A 1GNQA 4IVPA 1KKMA 1XD9A 5DLQC 4BLPA 4KU4A 1J2JA 3VR3A 3BD9A 3CR8A 2ZRKA 5B57C 2CDNA 3FMIA 1XDBA 5J5CA 2J9RA 4B3BA 2BBWA 2ZAMA 4I1UA 5EXTA 3CR7A 1PLKA 2A2ZA 3LW7A 4KCGA 1FQJA 5FR1A 4A4DA 2ZIAA 1E2GA 3QIAA 2WIAA 4D6PA 2IYTA 4RVCA 4M1YA 1KMHB 4UKDA 2A78A 1RVDA 4I1SA 3UWOA 4NYIR 1U94A 3K0SA 3QXHA 4B48A 3LBHA 3CRW1 4I4LA 2RHMA 1ZIPA 5FOTA 5FPYA 1W44A 2IYWA 2R6DA 4UXIA 5FPSA 2R8RA 1RIFA 1NBMD 1D2MA 1QG2A 4WXRA 4MGZR 1T8TA 4C0LA 1IN5A 3Q9LA 3DOFA 3BIFA 1P2SA 3CWZA 3B6EA 3QF7A 1E2FA 2HEIA 3KB1A 4IFEA 4RZUA 5CB6A 1GFIA 4CRWB 4A6PA 3THXA 5FTNA 2Z0MA 3LQQA 4JJZA 4G1UC 4JLMA 3KQNA 1ZNZA 4DCTA 2JLWA 3RWOA 2GESA 3QXSA 5HCIA 2GK7A 3MWJA 1NN1A 1XEXA 2G88A 4PX9A 4W5HA 1MT0A 2OLKA 3AVYA 4TL7A 5L3RA 4NL4H 3BWDD 3CKLA 5CM9C 4KLNA 4QRHA 3SC3A 1AS2A 1SVSA 1OHHA 4DXAA 821PA 4XJXA 3IHWA 1KDOA 2R2AA 2C95A 2QSYA 3AH8A 5FTMA 2JGNA 2ORVA 3TSWA 3PEVA 2WOJA 1NVWQ 4IOJA 1XEWX 2OXCA 1IY0A 4EJSB 1I4DD 1ZM9A 4WA7A 3K09C 4ZKDA 2JLQA 2VQSA 3KFVA 1WE2A 2D3WA 3HYTA 2O5VA 1ZM2A 2ZR9A 2ZUDA 3C4JA 4L8GA 3GLGA 5IK2A 3B1VA 1ZNWA 4HLDA 3UMSA 1D6JA 1TUIA 3N2IA 3NEJA 3R7WA 3TE6A 3VR5A 5FOWA 1R5OA 3EW9A 1P7CA 1OF1A 1XJQA 4MH0R 3BE4A 1ZRHA 4A2QA 1OW3B 4PPNA 1W4CA 4F4IA 1JQLB 1PUJA 4A92A 5JFGA 1QHHA 1U2RA 4DJTA 2ZR7A 5EE5B 3LXXA 1XXHB 3QPVA 4J0QA 4E5UA 2XEXA 1QF9A 3PJRA 2ZITA 3EZ7A 2WWYA 2ODWA 2QE7D 2QORA 4QGFA 4D4LA 4A36A 3ZVLA 1E3MA 1KO1A 1AJEA 3WBJA 2MMGA 4Q4AB 4V03A 4IFBA 3HU2A 1VPLA 1UFQA 1GP2A 4ZV4A 5LPNA 1GKYA 1QHIA 3LQRA 1SXJB 4HB3A 1R0XA 2DFKB 2QA5A 1X3SA 2IHBA 2KWIA 4Q00A 5C2JB 2WTUA 4ARZA 4NYMR 2J7KA 2PJRA 5BN4A 2VHJA 1VKJA 1CJUC 2R9VA 2QUZA 1XD2A 1KGDA 2IXFA 1H65A 1DO0A 1US8B 1XU4A 4ZPXA 1VCMA 5E95A 4B3FX 5FL3A 2IUSA 3GFPA 1KK2A 3TAHA 4OHXA 3PUZA 3CF0A 3GLFA 4ZDJA 3SJCA 4TYPA 4TLAA 1II8B 2IUUA 3H4MA 3T1VA 2ZSDA 5GJBA 1CXZA 2CMKA 1FZQA 2PH1A 3MLEA 5CDFA 3WNBA 5B2ZA 2PZEA 1GWNA 2C04A 3QQ5A 4C30A 3T34A 3ZVRA 5CITA 2KBFA 2GEUA 2JJ1D 4M53A 1MKYA 4A0HA 3WYAA 4X8HA 2C9CA 1E99A 3A1UA 2HDNB 2OCAA 3HU1A 3LX8A 3UWKA 2GZAA 5CYOA 2RH5A 2QENA 1SHKA 4B3GA 1E1QD 2QROA 4PPQA 4TYQA 5JJLA 1XWIA 2B92A 4Q9LA 1TADA 1EFCA 4XD7D 1W46A 4C0QC 4W5WA 5EE0A 4OQLA 2JJ1A 3RS4A 4Z8YA 1XMVA 5DHFA 4QHSA 1MR3F 3PR1A 2QT0A 1F60A 2WJGA 3VMFA 3QBTA 5JWRA 4PHHA 2BEKA 4EDHA 1G7RA 3H0KA 4OJKA 2EWWA 1GL9B 4CZ2A 2P2LA 1Z08A 2GJ9A 3VR4A 2ZYUX 1BS1A 1KK1A 4D25A 3PENA 2AX4A 2G0NA 2V8OA 5B30A 3OIYA 4PSKA 5CIQA 2ZS8A 1WF3A 3U7EB 1E69A 2ZI5A 4I99A 3RNLA 1YZTA 4IDQA 1YZKA 4DEXA 4GL2A 4LC1A 2AHOA 3GEIA 5DYGA 2FOLA 5GJVC 2PBRA 4JSYA 2ZI4A 2PCJA 4A9AA 1BYUA 4PO1A 4X8OA 1N0WA 4GMXA 2A9KA 2GVDC 2IS2A 2XSZD 3TRFA 4NMMA 4URWR 5DIFA 2WKRA 2ZRIA 1HE8B 4NHOA 5BYJA 3AVWA 2C99A 2IYRA 2PX3A 4IKEA 1X1RA 4QJ5A 4OHYA 3SFVA 1DVRA 4PZYA 5E7MA 5CM8B 1J90A 3K9HA 4YMTA 3VHXA 1S96A 5FTLA 3U6KA 1N25A 1Q57A 4IJMA 4JLDA 3PEYA 2W2VA 1VG9B 2HCBA 2G77B 1YE8A 1G5PA 3IO3A 4DLVA 1OXVA 1T0JB 1T8UA 2W2XA 2QPTA 1IM2A 3F3YA 5FFMA 1S1CA 2NO7A 3I5YA 2GDJA 1G9XA 2JEOA 2ZU6A 3TBKA 3EASA 2AN9A 4P4TA 4TSFA 4GRAA 1NRJB 4I1VA 1XPUA 1DAEA 2ORIA 1SVIA 2ZRLA 1LB1B 4B3CA 4DLSA 4N1AA 3FHCB 1G6HA 3SJBA 5CB8A 1E9EA 2ASEA 3A8TA 3AB3A 3TUJC 4HI0E 2ATXA 1JECA 2XJ4A 4YONB 3WMGA 1FL9A 1ZP6A 3RSOA 3WMFA 1KAGA 4DT1B 2AWNA 4F38A 2N46A 3QVUA 3LX5A 4M1OA 1S9HA 4K8OA 2DBYA 3GD7A 3PQCA 1P2VA 2NPFA 5FH9A 2Q9AA 4JYBA 4LBZA 4A0FA 2XNDD 3GLHB 3EZFA 4KO8A 4YMSA 4PZZA 3QBVA 5E3HA 5CYPA 2O0JA 1MOZA 1NJGA 4Q48A 4M9SA 3ZS8A 1G21E 1PV4A 4IRUB 4QBHA 4Q03A 3CONA 1S9DA 4UNRA 4C0HA 2J59A 4W9MC 1ODFA 1JXMA 1OFHA 2W6JA 5HE8A 2H17A 4IVRA 1HY3A 3EWSA 2CHGA 2DPXA 2EFGA 3NDBB 3KTAB 3CB4A 1QVAA 4FMBB 1GOTA 4LCBA 1GITA 3UIEA 2WSSD 3KJEA 4HAXA 3CPEA 4WBSA 4AC9A 1RW4A 3KXLA 4OJQA 4DSUA 3V9PA 1COWD 4A6XA 4OQXA 4LJAA 1G4UR 1DBSA 3I72A 5JWHA 1UJ2A 2ZVPX 4A0RA 1SKYE 2PT7A 3W6NA 1RRGA 3TGPA 4OHWA 4M1TA 2A5GA 4FINA 1HQYE 4DUGD 1COWA 4JL6A 1GNRA 1DADA 4EFNA 3SNHA 5FBVB 4NDZA 3ADCA 1NVVQ 4I81A 1ZM7A 1QHXA 1JPNA 2Z83A 2F9MA 4X8MA 4XVRA 3B5JA 1N0VC 1DARA 1AN0A 1IXSB 1ZM3A 4FMCB 4LV5B 4FW9A 1QHSA 4TZ0A 3QKSB 4KV9A 4HAVA 1WQ1R 2FE4A 4PAOA 2QBYB 1KI1A 1XJ0A 4JT4A 3TQCA 5FBQB 2OLJA 4O3MA 1JAHA 2MSCB 2ZS9A 4E07A 4RKEA 3CRVA 4LGMA 2I4IA 3IBGA 4GP7A 3RS2A 3PG5A 1HYQA 3QF4A 1UKZA 3CX8A 4MQBA 2ZROA 1AZTA 5FOUA 4DWJA 3UXMA 2O8DB 1G64A 1IONA 3DMNA 3ICEA 1G8YA 3N5CA 2WHXA 1W36C 721PA 1KO4A 2GEVA 3I61A 4AKHA 3LY5A 4KJZA 1JAIA 4NCKA 5EP4A 2P5SA 3W3ZB 2QAGB 4DDTA 3CZQA 3QY0A 1G16A 3K0CC 1YJ5A 3NWJA 2A5YB 2V7QA 3EZ6A 4EFMA 4P4SA 1X8LA 4PFSA 2ZRAA 3RDPA 3C14C 3GJ7A 3VU9A 4JLVA 3L8YA 1CRPA 3GP8A 2W6ID 3OEEA 3EPHA 3SJAA 2OFWA 2A5DA 4F93B 2CVHA 2CCKA 4ESVA 4OYHA 2J5XA 3L8ZA 2BBOA 2HF9A 3CPJB 2ZRGA 1OLOA 4CEIB 4KSCA 4Z8XA 1T5IA 3EAQA 3ECCA 4KSBA 1G17A 4LZZA 4A8JC 5FBLB 2A7QA 4G5RA 5JECA 1Z22A 3HPQA 4LJ7A 3W6OA 1F5NA 4TQAA 4Z1MA 2C9YA 2W6IA 3DEFA 5BYKA 3W9YA 4PZLA 4O2RA 4HZUB 1HE1C 2NO0A 1FX0A 1GAJA 1U90A 2JIZA 4LK2A 4YXWA 2OBNA 1EFRD 4N3NA 4B3DA 2FFBA 4G0NA 4TL8A 5A5GA 1GSIA 2AL7A 3C16C 4QC2A 4KHZA 1P75A 2O8CA 1XEFA 4RD4A 5KU1A 4HZIA 1G18A 1GDDA 4WAUA 3JZMA 1GNPA 1XX6A 3L0OA 1KO7A 3OFNA 3QKTA 4NCNA 2B21A 4B74A 3QNUA 1UDWA 1G8HA 5FBRB 1ETUA 4NYJQ 2ERYA 4JLKA 4DDUA 4QKQA 1EFRA 3T5GA 2JA1A 1PZNA 2I1VB 2SHKA 2NQ2C 2R6CA 2GRJA 1G3UA 3KUCA 1XD8A 1FMLA 3B2EA 3GEHA 4FXPA 4KBFA 4ERNA 4ZI3A 1E0KA 4DCUA 4F92B 2HJGA 4H9GA 1LV7A 1SULA 2IBMA 4RY2A 3RC8A 2G0TA 3VR1A 4L16A 2H57A 1LVGA 3P4XA 4EQ6B 2BHRA 1T3LA 1ZUNB 4RD6A 4POAA 1J70A 1XBTA 2E1RA 2QMOA 2ZJBA 4QG7A 3DM5A 1DOAA 4ZKEA 2IYLD 1CJKC 1N5LA 1P9NA 1YR9A 2VF8A 2YNMA 3OAAA 1HT1E 5EE1A 1E4VA 4HB2A 4UNNA 1W0JD 1NMYA 3Q7PA 1KI3A 3A1SA 2IS6A 5C4MA 1DPFA 3LVRE 2XB2A 2O8EA 4Q1CA 1HTWA 1S0UA 4BFSA 4LHZA 2ONKA 1Q1EA 3BB4A 2ZM5A 5KTYA 4PHGA 2YOFA 5C18A 4C0AC 2BMJA 1QHGA 4US1R 3R8CA 6Q21A 1S2MA 4LPSA 3U6BA 3IPXA 2NPIA 3A58B 4QM7A 3BRWD 2XZLA 3P1JA 5P21A 4GOKA 3WBKA 1M7HA 4URZR 1K6MA 4OBEA 2QY9A 3GLFE 2KB0A 2CL6X 4CYMA 3P4YA 5HE9A 4FWTA 2Q9CA 4JVLA 1IJEA 4KVGA 1JR3A 1OFUX 2C03A 2FNAA 3C7KA 4Q7JB 4L15A 3I92A 1KSGA 1XTIA 2R6GA 3OEHD 4JL8A 2IXGA 5TY0A 4RZ3A 2HUPA 3LBNA 4QHYA 4JMPA 1EWQA 1TU4A 2IYZA 2IT1A 5EQTA 1QHNA 1Z6GA 2ZJAA 2QRZA 4PSAA 1W5TA 1Z6AA 2VP5A 621PA 1RFLA 1AA9A 2HYDA 1IN6A 4MGIR 4B2LA 4TMZA 4Q4HA 2RGCA 3VAAA 4OI4A 2JLYA 2IS4A 2P0EA 4RFSA 4LJ4A 4DC9A 2UKDA 2NZJA 3KFXA 1MRSA 2R62A 3LDAA 3B7GA 4QNMA 3QUSA 3W8NA 3WHLA 2ZTSA 3A36A 3WHKA 3U7HB 4CEJA 1JPJA 2F9LA 4JL5A 4GMDA 1U9IA 4Z54A 4KYIB 2E87A 1Z3IX 5H68A 4C7OB 4AKIA 4OK5A 1OJLA 4G5QA 1Z47A 1CR0A 1M8PA 3AKEA 1F2UA 3RSLA 1RJ9B 3BK7A 3T35A 2JLXA 3TNFA 4QJ3A 3WRXC 4OK6A 3MJRA 2JCSA 3LD9A 4UJ5A 3PIRA 1SZPA 4TYYA 1MV5A 4NE2A 5FUWA 2EU8A 121PA 1YR8A 1NN0A 3WMEA 2B8TA 1EXMA 2JDID 2IF0A 3BBPA 1DELA 4LV8B 1R4AA 2KI5A 3QI2A 4RCYA 1KSFX 1SXJA 2ZE8A 3CLVA 5AK0A 5L3VA 3TVTA 1XMSA 3OHMA 1IN7A 1A5TA 1G5RA 1HEIA 3AVQA 2GJSA 2I3BA 3BB3A 3ZIAD 3NG1A 3R9IA 4DDVA 3NHAA 5B58C 3AP2A 3T12A 1WBBA 1C1YA 4TL6A 3HWSA 1A1VA 2WJYA 1DEKA 3KKMA 4FD2A 2ZUBA 4TLBA 2BJVA 4LY6A 2J7PD 1G20E 1MABB 1RRFA 2AXPA 2HV8A 2NO9A 2ECKA 4ASUA 5J4LA 3GJXC 3X1XA 2FG5A 3KL4A 1E2NA 3P20A 2OFXA 1HA3A 2DCUA 5FOSA 3QXCA 3ZIAA 3U3MA 3K0FA 4AY2A 1Z6XA 5CLLA 3TQFA 4HEJA 4R7ZA 2DWQA 1OXUA 3AVXA 5L3SB 1NKSA 2J7PA 2IHYA 3ADBA 2X1VA 1ANKA 4IDPA 4KFRA 2GAOA 1Q1ZA 2FFQA 2XZPA 2V6IA 4XH9B 1FP7A 1CF4A 3GPLA 4DBLC 3BAFA 3EC1A 4HDOB 1IAQA 3I8XA 4LJ8A 4B44A 1VMAA 1GIAA 2KJQA 3MWLA 5FUVA 3U60B 4D4KA 3MSXA 1NL3A 4MYHA 4RZ2A 4M1KA 3VKHA 1A7JA 4EPRA 1JR6A 2BJWA 2VLIA 2F6RA 2FSIA 4NH0A 3CRQA 4V0NA 5JZVA 3O8CA 3THWA 2JJ2D 5AJWA 2C96A 3KQKA 1W7AA 1OKKA 2RGGA 5DI3A 4GDFA 4XIGS 5D3MB 5DI9A 3B78A 4AURA 5DNYB 4V0MA 3ZVNA 1NKTA 4L4UA 1VG1A 2F7SA 2Z5FA 1A4RA 3BXZA 1ZINA 3ZH9B 2BWJA 3VX4A 1OXXK 4CEHB 1DS6A 2JJ2A 4Q4JB 4WIAA 4WZAE 3EZ9A 3AVPA 3FWYA 3GJ0A 3GLIB 2XJ9A 1Z0AA 4Q1AA 4M4SA 2XGJA 1KI8A 1NI3A 3CNLA 3VNVA 4Y0VA 2ATVA 2WWWA 4TWZA 4BQSA 2J0SA 3P32A 4NONA 4WXPA 4TYNA 3K0AB 3GJ4A 2IYSA 4RJLA 1ZW6A 3WRYC 2BOVA 2FN4A 1CEEA 4NKRA 5D3QA 4PXAA 4AYTA 1A2BA 3FHOA 5KPDA 3IIJA 2OCPA 1WRBA 3HDTA 2J46A 4HLCA 4B6EA 3NXSA 1G19A 4XVQA 1JQJC 3A1WA 1OHHD 2PLRA 3G0HA 2F3RA 4FIDA 3ZD6A 2ZI6A 2GCOB 2PT5A 1E9DA 2ZXUA 2MMCA 1T9HA 3LBIA 1SVOA 1OXSC 3KJGA 2FU5C 4FMCF 3FFBA 4P0TA 1U0JA 4AYXA 4K46A 2IYUA 4DLYA 3C5CA 4BFZA 2O0HA 3K0EA 4L9SA 5IK2D 3EG5A 3U4QA 2ANBA 3ZVMA 3GFOA 2DWPA 2Q3MA 5LB4A 5F3WB 1L2TA 2ZANA 3FKSA 2V6JA 4JZKA 3QE0A 4DT1A 1E2PA 1YZQA 2BCGY 2P67A 4NU0A 1BIFA 1DG1G 3BC1A 3WXMA 1Z0JA 1UKVY 4LUCA 4PC1A 2R65A 1NIPA 1Z6YA 1N6RA 1WA5A 2AFIE 4KYUA 4BGDA 4QM6A 2ZREA 1FOEB 3K09A 2FV8A 1XP8A 1XMIA 3GQBA 1E98A 1Q1BA 2NO1A 1II0A 3THYB 2FGJA 4QXAA 2CE7A 1GUAA 5L3QA 3U3OA 5TDHA 1BO6A 2GXAA 1P62B 1JJ7A 3V00A 3MRSA 2D7DA 4F7WA 3KTAA 2RMKA 3NKVA 3QXJA 1MRNA 1U8YA 2BDTA 2H7VA 1AM4D 3W3AA 2WICA 1FNNA 3QSYA 2D06A 1L4UA 5EXPA 2VEDA 1CP2A 1WP9A 2YOGA 3FGNA 3SI7A 3QKRB 2DR3A 3U44A 3HR7A 4PO9A 4BLRA 3AGPA 1T6NA 2WIBA 1W1WA 2ZSFA 1YR7A 1H8EA 1E2HA 2J0UA 4EPTA 2ZAOA 3SBDA 2CJWB 3O8BA 4C2UA 3EPLA 3EXAA 2EFEB 2Z43A 4DB4A 3K9GA 3BH0A 3IEVA 3TSOA 3TR0A 3B8HA 3PUYA 5GJCA 4BLQA 2VSXA 3VKWA 2V55B 1SVLA 2WWHA 4XOIA 3KX2A 3SJZA 1Z29A 4LOAA 1Q44A 1DAMA 1J8MF 3LH5A 5KHOC 1X1SA 2WMNB 4Q66C 5FOVA 2G6BA 2QMEA 4IEEA 4A1FA 3EPKA 2BM1A 2OG2A 4BFUA 1T5LA 3AKDA 2RHDA 1AGRA 1FNMA 2HCJB 2UZ3A 3KKNA 5EP1A 4JLNA 1RPZA 4YMVA 3KKPA 2VP4A 2ZRPA 1KDTA 1OPXA 1NVVR 2GETA 2REOA 1RYFA 4D4JA 1PJRA 3MWYW 1Z0KA 1B23P 5G41A 2WJIA 1UF9A 3QEOA 5JS8A 1GTVA 1K5DA 3ZGXA 2BBTA 3ASYA 4N0DA 2GEDA 4PQFA 3RWMB 2VHCA 3O47A 2DFTA 3CUEF 4M2LA 4G3XA 3AV0B 4P31A 2YJTD 4AG6A 4U7DA 4JSTA 5JRZA 2QAGC 2AWOA 2QTFA 4TTQA 3CH4B 4Q9IA 5FBWB 1W5SA 3DKPA 1P60A 2H5EA 3MWKA 2O8FB 1AS0A 1ZM4A 5TB5A 4XWOA 1C4OA 3NDPA 2Q6TA 4MDEA 3AVUA 3IUYA 4P3YA 1DAGA 4IXMA 2JLRA 4OQFA 2PEYA 1E2DA 4YC7A 3I73A 2QP3A 3E2IA 4ZIRA 5LBIA 2OILA 3UMFA 1SVMA 2EFDB 3A37A 3AF3A 1SKYB 2EYQA 3EIQA 4DLTA 5FTJA 5HZHA 3T06B 2GA8A 1P73A 1KZGB 4A2PA 3P26A 1E2MA 3TW4A 5EE9A 1ESMA 3ZD7A 1JR3E 3FTQA 1P2UA 3I5XA 1HH4A 2ZQ5A 4IDOA 2VH5R 2GF0A 4BLSA 4DDWA 4KFUA 4Q18A 1XTSA 1ZC3A 1CJVC 3DO6A 4O0MA 1XF9A 3EA0A 1TF2A 3RC3A 3TH5A 1OE0A 1XB2A 4HUQB 3LVQE 1ZC4A 3I8SA 1KI4A 3IILA 4DVGA 5EUMA 4OQNA 2FDCA 2PCLA 3OIVA 5J4HA 2OT3B 4EPWA 4TSFD 4K81B 2WVJA 2GK6A 2ZEJA 1OB2A 2PL3A 3H2YA 4QGHA 4BRUA 3NH6A 3CBQA 3KUDA 2JASA 1B0UA 3L0IB 3B13B 2IWHA 1NMZA 1E6CA 1KO5A 3ND8A 3TUIC 4TZ6A 4BZPA 3MFYA 3DKVA 1Y3AA 1VHTA 3I4LA 2G3YA 1CJMA 5KNBA 1Q20A 1CBUA 2F1JA 3ASZA 4NYJR 1KI6A 4M8NE 1CRQA 4FCWA 3KZ1E 3MAAC 1II9A 1N6HA 2ORWA 2FEMA 4MYTA 2RGNC 4HLQB 1TAGA 4FWIB 3THXB 1KSHA 5G40A 2NMVA 1YQTA 5H1YA 1M2OB 3VTKA 2IW3A 1SXJE 4M1WA 1EFUA 5K8UA 1XEXB 2W6JD 1T0HB 3CRRA 1OV4A 2QGZA 4I1OA 4HSEA 2GKSA 1A2KC 1VIYA 2D62A 2PZFA 4TMVA 1M74A 2YV5A 5KO2A 4M9QA 4FMDF 1DAFA 4TL9A 5KSZA 3QXXA 3X2SA 3MD0A 1OYWA 3VR6A 2WM9B 1BMFA 1L8QA 2J0VA 3H1TA 4D82A 2IF2A 3Q72A 4WVFA 4XVUA 3VR2A 5A0FA 2GBLA 3IIKA 3E5HA 2XOKD 2Q3HA 2OBMA 4MUAA 3GLGB 2CBZA 5F2EA 3R7WB 2ZRMA 4Q1DA 3DOEA 4F4CA 4CGZA 1N6IA 4BFTA 2XITA 1ZAKA 4O2LA 2QEQA 3RRNA 3SHWA 3EX7C 1WXQA 3GJ3A 4H1UA 4WZBE 2BM0A 3FDIA 4YDHB 1ZUHA 2FEOA 3BERA 4Q47A 4U5XA 3IQWA 1EFTA 3E1SA 1QHHB 4LJ6A 1XZPA 3FKQA 5KNCA 5AUQA 2XOKA 4KXFB 4OHZA 2B6HA 2CLDX 3L2OB 4IOMA 2FPMA 1LY1A 3E70C 2HLDA 4E09A 5JWOA 2XXAA 1FW6A 3KJHA 1ZD8A 1Q0UA 1MO6A 3B1YA 5ELXA 4PTLA 4US2R 2C77A 1L4YA 1KZ7B 1KY2A 2CL0X 2TMKA 2WAXA 1K8RA 5FUYA 3X1YA 2PMDA 2WBLC 1FUKA 1JB1A 1Y63A 1E4YA 1NIJA 1F2TA 4ARZB 1Z0DA 1W0KD 1G7CA 2QQEA 1D9ZA 3ZLJA 4D0NA 1K5GA 4MKGA 5BXQC 1HT2E 1UPTA 1XD2B 2JAQA 4JVMA 4TMWA 3DM9B 4V0ME 3O8DA 5C4GB 2NOAA 1XCPA 1N6NA 2A5FA 2Z4RA 5DYIA 4Q7MB 1W0KA 3B9QA 3J81k 1W36D 2H16A 2V7QD 3SYNA 2BMEA 2H8KA 2J41A 1F48A 1ZBDA 2FMXA 3BFXA 1E1RA 3OEED 4QJ4A 3AUXA 1AK2A 3W8RA 1UKEA 3OIUA 4OK3A 5SZIA 4AIIA 3ZS9A 2Z4SA 3UG6A 4GZMA 5F9HA 4TTPA 5EP2A 1VYTA 1YZUA 4QNRA 3TIFA 3DDCA 4LC0A 1QVRA 5JSZA 1NLFA 1XNJA 4E22A 4RKFA 2VA8A 4TTRA 1KK3A 3CNNA 1MO4A 3UK6A 4Z1MD 1G3RA 3K0CA 1FQKA 1XRJA 2VPPA 3PITA 2JIZD 3IQXA 1J8YF 4YXWD 2GJ8A 3AKYA 2C78A 1S1MA 4P32A 1GVNB 1JALA 3H86A 2ZRJA 4ZDKA 2ERXA 1WBDA 2EVWX 2P65A 3Q3JB 5DISB 2H1LA 1XTQA 3NVAA 3ZZUA 1J99A 1E2IA 2V4ZA 3OFND 1ESNA 3UATA 3K9NA 5TVKA 4XWKA 4OL0A 2EFCB 2EW1A 2JATA 4A8JA 1NVXQ 4Q9HA 3K8YA 3F5FA 5KSYA 1TQ6A 3IHLA 4NBSA 4TN1A 1NG1A 3A4LA 4JT2A 1NLZA 1ZVQA 2D7CA 1OSNA 1F6BA 3CF6R 3I1FA 2D4HA 3SE0A 1FMJA 2W0SA 4YMWA 2AKYA 1W4AA 1R8QA 4B6FA 1E2KA 4MKIA 3QENA 4CVNA 2VSFA 3GEEA 1ZYUA 2F3TA 3LAWA 5EUQB 3ZQJA 1KTVA 3OAAD 2QP9X 4ZDWA 4JLBA 1OIXA 2G1KA 3QKUA 2WWFA 4QOSA 5D3MA 2PX0A 3SBEA 1SQ5A 1SGWA 1E96A 2X8AA 2YWFA 5TXGA 4UNPA 2QN6A 4UJ3A 1WCV1 5FPTA 2AFHE 2BBSA 1Z06A 2WPDA 2YZ2A 4Q4JA 1T3HA 1KOFA 4RD1A 2CHQA 1Q3HA 3GLIA 1NF3A 2BEJA 2CEAA 3WP0A 1KMHA 1IQPA 1M1YE 3SS8A 3QJYA 5DH9A 3K9LA 1N5JA 4HYYA 2A30A 3AVOA 4LPKA 4DLZA 1CR2A 1FTNA 2G9NA 1G7TA 2WZQA 2E9SA 2RGBA 5G53C 2IK8A 1CIPA 3A1TA 1JR3D 2D2EA 2IYQA 3DPUA 3T15A 3WP1B 4PO8A 3A6PC 1JXOA 2A5JA 5TV2A 3GFTA 5GVSA 1C9KA 1PLLA 2ZRDA 2REBA 3IBYA 2VL7A 5F9FA 2XTNA 3SYKA 2IYVA 1E0SA 2AR7A 4HB4A 4ZCLA 5H70A 3PXGA 4R71A 3RAPR 3T1TA 2WSMA 3IEUA 2HT1A 5KNDA 3NTUA 2ZSBA 1KSJA 5SZHB 3QEJA 5JHHB 1NLYA 2RGEA 421PA 2NTYC 2D74A 1NG9A 3O8RA 4F4JA 2CXXA 3AF0A 4EJSA 1Q1QA 1TNDA 2H18A 4PR0A 1D5CA 2GTPA 3CWQA 4MRRA 2V9PA 2ONJA 2UZIR 2NO6A 4DRZA 1E2LA 3D8BA 3VKGA 1KJWA 3VFDA 1W4RA 2OFOA 4IOKA 2N42A 1KI9A 1SVKA 1CLUA 2YWEA 2Z6VA 3RS0A 4TT3A 3UANA 5E7IA 2WJJA 3W5IA 1OIWA 1RRCA 3PVSA 2ANCA 1LF0A 1ZCBA 3H84A 1G291 1N6OA 5KSOA 4PHTA 1Q3TA 1E9AA 3SHFA 4B3XA 3NBZC 4HAWA 3PCRB 3B60A 3CZPA 3QOFA 4BLOA 3BS4A 1EX6A 2KE5A 1SXJD 1XXHA 4MDFA 2IUTA 2ZYWX 5FI0B 4V02A 3U2QA 4L5BA 1WDTA 5DSZA 1G3IA 3KKOA 5JI2E 3PUWA 4PQRA 2P6RA 3N70A 1QBKC 5E7JA 1VG8A 1E2EA 1KAOA 4QL3A 3K70D 1O3YA 2F43B 4QHTA 4HLUC 2PZGA 3RS5A 1NNEA 4Q4AA 5JHGB 1RRPA 2QL6A 1VCIA 2BIFA
chains in the Genus database with same CATH superfamily
4BNXA 1RSZA 4NP6A 1U0HC 3RS7A 5DBEX 1THGA 5DULA 3FI9A 3JAKA 4EAQA 3GY0A 4LJYA 4MEBA 2GPBA 2X19A 4AMUA 4YRMA 1TJ5A 2K5UA 3RTBA 1FYDA 1U8ZA 1QVWA 3DVAB 4P84A 4OGGA 1QB8A 1P9WA 4E2FA 1QHFA 1D4ZA 3TX2A 4CL0A 3CVUA 3UJ6A 1YOVB 4HQLA 5DCUA 3EXHA 2HRDA 1DIGA 1C9NA 2F48A 1T9KA 2C2HA 1F0KA 3MUFA 3FA2A 4UC0A 4L8YA 1K66A 3PC4A 1JMYA 2CT8A 2OV2A 3UBMA 4BX0A 1GV0A 5FL7A 1HOTA 2XAUA 1KAEA 2AFIB 4EL5A 4R8LA 2HT6A 4DYDA 3X43A 1LF5A 1ESZA 4LSMA 4EF5A 5ITWA 2FUG6 2WOOA 2FSSA 2YYAA 1GEEA 3I6ZA 1ESDA 2WJWA 1LVHA 2LKCA 4AROA 3HVRA 3WMRA 3FPLA 1E5VA 3LU1A 4BFVA 2B83A 3PQ8A 4P83A 4QYIB 3ZDQA 2RI6A 1DEOA 3WADA 2CLHB 4P6VF 1DZ3A 1NTRA 4KX5A 5JJIA 1H2FA 2OHJA 3KEFA 3LLUA 3QZUA 2HFKA 4WESA 1OU0A 5A1JA 2K87A 2ZBDA 1OI3A 3EDRA 3M5PA 1PFWA 4U8GA 1WMAA 4QPZA 2YUIA 5E6UA 3IT1A 2Y2UA 5FJJA 3OCWA 2A0FA 5B3JA 1D09A 4CDNA 1PS0A 3R7SA 1N5DA 1ST3A 4Q19A 1H8HA 4HH0A 3BZWA 4UDOA 3UXHA 1Z2PX 4Y9TA 2NPOA 3FNEA 2H5IA 2WD8A 4LYJA 4CJXA 4DMKA 5KTMA 3H8SA 1QGYA 4KRFA 2CHVA 1H2XA 1LJ8A 4KPUA 3HCRA 4PLTA 5HFNA 2LCFA 5BR8B 2NUPA 5F2NA 3DO5A 1NWHA 4K40A 1K6EA 3L4KA 2XTJA 1HQCA 4EO7A 1GR1A 1VI6A 1CHNA 1HG0A 1W96A 3AF2A 3V4RA 2NP7A 4ETMA 2QU7A 1CG6A 5F1OA 3REGA 3HJCA 3KEMA 3NH9A 4XPIA 3FFXA 1FYWA 2Y99A 3M6UA 4HAYA 4LHVA 5CTJA 5GM1A 3HZHA 3C41J 1EJBA 2FR1A 2Y93A 1AGNA 2G83A 2K4MA 2Z3VA 3GRCA 4R51A 3WFJA 3SQMA 3L7JA 1M34E 3WB0A 1JDJA 4JUCA 5KKCA 5LQSA 2OENG 3K5IA 1CYEA 4CM4B 1AKWA 1CQXA 1ADGA 4C6TB 2J9GA 2EKQA 1QIDA 3CO5A 4G0WA 1KAMA 3CIFA 3DZHA 4BNFA 3FGPA 1QZTA 2PD6A 2GEJA 1VG0B 2BGLA 2YZNA 4QSMA 1MAUA 4CIBA 3G7UA 3RVOA 4BRZA 3U3KA 1WEKA 4NE7A 4UOZA 5LXTF 2PMBA 3P0RA 1P5HA 1WM1A 1YVDA 4GGMX 1G5QA 1YFJA 1ZOLA 2OBYA 3W34A 4EY7A 3ND9A 4GLFA 5AR1A 4A5OA 5CDSA 4W5NA 3WHIA 2VJMA 3HJNA 3WRVA 4I2NA 3WKCA 1MX3A 2W93A 1Z63A 5F98A 1N2CE 2NSDA 3FBWA 3PIIA 4KHPB 1NW5A 1UPBA 3NO4A 2UZAA 2BCJQ 3NAMA 5EWLB 2NU7B 3PDIA 4FNOA 5E6RA 4QPCA 3P45A 4XDGA 4DLWA 1XZIA 2EJVA 2EJCA 3OQBA 3PPXA 4N7BA 3SEZA 3U0VA 1XEWY 2O8EB 1K63A 3L6DA 5DFAA 4ZV9A 4A0QA 4DSNA 3S2EA 2XTMA 3O7WA 5D1NA 2I4LA 5DTJA 4MR7A 2IX3A 3U5ZB 4AKGA 1TEVA 4PF1A 3HU3A 3SXUB 3WLEA 5B2EA 3AVTA 5LOVA 4D26A 2Q21A 1J7KA 4XM0A 1P5ZB 3REQA 4AUMA 5IXJA 4X62B 3SDBA 2BMWA 2B36A 2YIMA 1IZ9A 2ZJ1A 1N57A 3KYDA 1R0YA 2FCAA 4WNCA 3RFCA 4OUDB 3GHHA 5F5XA 4XX0A 4G5OA 5DM1A 4M1MA 4RSMA 1G4AE 5IAGA 4MHSA 4DR5B 4CCYB 3RT9A 2CFTA 3JYPA 3G8CA 4JBHA 5HS6A 5I7AA 3SMQA 2UXBB 3QPBA 3IVAA 5BSGA 4OIFA 1ETHA 3EGXB 1OH5A 4PBTA 1XPOA 4YMUA 2FSFA 2CFCA 2YBEA 3HS3A 5IBQA 3UGTA 4ESHA 1JDNA 3LUFA 1PEDA 1T0IA 3FAZA 4HEA6 3RC1A 1GM5A 3OP1A 1WCIB 3UK7A 3C70A 2YV1A 1A8UA 2MU1A 4EEXA 3ZE0B 5BN5A 2DQSA 1SOUA 4UQOA 4K5QA 3D64A 1IU9A 2O3TA 2V7EA 3IDZA 4H4EA 3RFFA 5K8CA 2ZR0A 3C8HA 4FN5A 3G9XA 2W58A 1E8DA 4RFSB 4D98A 1TQHA 1ZS9A 5BURA 1JIVA 4UVHA 1DQRA 4OYYA 1U4OA 2MDTA 4JYCA 4MS3B 4QX6A 4TRRA 3KWFA 4GS5A 3IV6A 2PDAA 1JEJA 3BF7A 1G8FA 2R1ZA 3GF4A 4NEGA 3UGKA 4FZ3A 3H5VA 3ZZ0A 3D7MA 3EPJA 2NSHA 1QE0A 2P41A 4MPRA 4ON9A 2IYNA 5DK6A 3LP6A 3NBFA 4BZZA 1Y5RA 3LW8A 3U7GA 4YDQA 3ENKA 2NT4A 3A11A 3QQPA 5LP6B 3AUSA 1FFCA 4UVIA 1GZUA 5TSDA 1F2UB 3I62A 2H29A 4JB8A 4KO2S 4L28A 4ZT6A 3RU9A 3SAJA 4INOA 1NJSA 4R1NA 4QBFA 3ZY6A 5DB4A 2XZOA 2C8VA 1YFZA 4G4SO 2DKNA 2CXTA 5D7BA 4ZOCA 1EE2A 4X8LA 3HXLA 3S8MA 4YRKA 2ADMA 4EJ0A 3V7UA 2JIDA 2ORED 2DY0A 1O5IA 3B7WA 5JD6A 4CG1A 2DYKA 3GVCA 4LEIA 2QTTA 1VHJA 3I39X 2QPOA 4NDAA 2B2XA 2KBEA 2PUWA 4GQAA 1V5GA 4DHWA 1TT5A 1U5AA 4G2TA 5A3RA 2B2CA 2VP9A 5IUNC 2JGIA 4ER0A 4C89A 3QHQA 2QBYA 1SUBA 4PONA 1PBNA 3AJDA 3CX6A 4YJ2A 4X00A 5F5NA 3KO8A 4FSXA 4GPZA 3NC1C 1NQ5A 1E2JA 4QODA 4YJ3F 1QDEA 1RS0A 1W4ZA 3D4PA 3ITNA 3LUAA 3N2ZB 1OAKA 1QAQA 2H07A 1XV5A 2AG5A 1IIRA 2CZQA 5E7QA 2YV2A 1S02A 4H35A 4E2ZA 2HHCA 5ER6A 1S8FA 2B4RO 1P1KA 3C7CB 5DN6A 3P9PA 4I55F 3UJCA 3K9BA 4LDPA 5DM0A 4CKEB 3GLIE 1I7NA 1MTOA 2OHFA 2ZB3A 3H19A 3JXEA 3NBXX 4C0BA 3RCBA 1RXSA 3QNMA 2B4KA 4H31A 3ROEA 5BV7A 4HTFA 3N0RA 1P7WA 1N0HA 3L07A 1LS1A 1TUEA 3K8OE 2AF4C 3LQ1A 2QAGA 4H7IA 1JA1A 5JNLA 4E1VA 1SBHA 1TJNA 2VT7A 4IPTA 4JCCA 4YRSA 3OQOA 1JYFA 3AEUB 4FNAA 1M7GA 1Q0LA 2OTCA 3JAWA 3JPYA 4IZIA 4JVSB 5EKXA 2I5PO 5CD1A 2JAXA 2J48A 4XVHA 2BI7A 4E5KA 4K0RA 2DFNA 3DMRA 3MUNA 2OHXA 4IIJB 5ILQA 5JPIA 5TQVA 3VC7A 5LVAA 1KI2A 2BUBA 3ZWWA 2CCJA 4RDCA 1BEEA 1D7OA 2EW8A 1CRLA 2OKGA 1YKSA 3E9MA 1I5EA 3OP4A 3T5DA 2JGEA 2JGKA 4DG8A 3QU9A 2X22A 3M5WA 5EI5A 3I6YA 3RU7A 3JR7A 3GRUA 2QN2A 2ZDHA 4L8WB 5I5GA 6PFKA 3NHPA 1M8FA 4XGKA 5DM2A 5GVRA 3EXIA 1ELOA 3OF3A 2Y1DA 4AI6A 1T9DA 4P5EA 3RSQA 4HZUA 3MCAA 5DX8A 5DI3B 1F8GA 4JVNA 2QZZA 4GP6A 2I7VA 1XQYA 4I9HA 4XE5A 4UDXX 3TRHA 1U0BB 3R20A 2C5LA 3ORYA 1W2HA 4KVFA 4TWRA 3U7FB 1KDRA 4RQAA 3QVVA 4C29A 3BB1A 1VPWA 1JHVA 3RSZA 4QUDA 1FMTA 2FPLA 1WTCA 2O5RA 4YP5A 3ZJUA 3Q8MA 4AKEA 1L5YA 1V1MB 3DJFA 3I83A 3WB2A 2HBRA 2ODAA 4KXLA 1PK7A 3IP7A 2DHDA 4CNBA 3J7AC 4XM2A 4C2TA 4FYWA 2WJ3A 3WOVA 1PWXA 1B3BA 4C0KA 3H7AA 1XZFA 5LU9A 4U6SA 1UJNA 5D3KA 4BMPB 3IP1A 4FDTA 1KOGA 1VJDA 2B3DA 2BDEA 3MGKA 1OLSB 1ULUA 4M1ZA 4BKUA 1P9RA 3G9ZA 3DS8A 3O4RA 5LQMA 3IE1A 1Y1PA 5AKLA 2YC2C 2FRXA 4PGGA 5HKAA 2BZSA 2IVZA 3I1JA 4EIWA 2PX8A 1VB3A 2ZI9A 3NIFB 3DE5X 4ILEA 1GKUB 1TMOA 4Y1FA 3UWMA 4UM7A 1E2QA 4XTRA 2VI5A 1RLTA 1WW2A 4ZEWA 2VJNA 1BQEA 3QVLA 2WWGA 4NESA 4OO3A 3RW9A 1KBQA 2TSYB 1TCCA 1AB6A 3BWEA 3WYGA 2QQ0A 4WNIA 4DQUA 1E5XA 3F6CA 4PCLA 4CN9A 2V3WA 4UBOA 2PK3A 3NM5A 4LVUA 5DU2A 3IXLA 2OB2A 4ZI5A 4DIKA 5AW0A 5G3YA 3GRRA 1CFZA 1ZD5A 2ERCA 1DCFA 4B45A 3R7DA 1E7WA 1UDBA 2OD2A 3BG5A 4REMA 3DSRA 4KQMA 2GBCA 3EGIA 3CH7A 3OJEA 3UQYS 1KAQA 2BKEA 2ZYVX 4GWKA 1TUBB 4LMBA 5C8DA 4ZYXA 1MX5A 2XVXA 4JC8A 3M4JA 1FS5A 2Y1FA 3DO8A 2CCGA 4QT0A 3F8TA 5AXDA 5LLTA 4HN4B 2WJVA 4EG1A 1CQWA 2EHDA 5GV7A 1Z83A 1M34A 5LKAA 3FYUC 3UHOA 1TO6A 1OA0A 3M49A 5ENZA 2CJXA 3A6LA 4FYXA 1M5RA 2FN9A 1AHPA 4O4JF 2AN3A 2Q6IA 2Y05A 1O6ZA 1TIPA 3LUJA 4UTOA 2OOKA 3JZAA 5TMEA 3TQSA 2J87A 4OH7A 1RRVA 2R11A 3NBQA 3D8UA 3TRJA 2I1QA 3CVOA 4L9WA 1NVAA 5CEFA 3G1UA 5L3QB 4ZCRA 2Y2VA 4QTTB 4UZFA 3AEXA 3GAMA 1XZQA 5CXUA 3K71B 3HUEA 4XLLA 1O0BA 4UEJA 1PFGA 1ZJJA 2PUEA 1AQYA 1ZD9A 5AK6A 1U6KA 3K1AA 4GKKB 1Y4AE 2AFHB 1ZUIA 2PUTA 4PYQA 4HUTA 3HHEA 1DCMA 5AKJA 4P5DA 5FUXA 3PNVA 2WYOA 1OIVA 1PVVA 3ZWCA 2ZJ2A 1PT7A 1IJKA 1GA1A 3VHQA 2XQVA 2Q0SA 5K0FA 1XL0A 1MPXA 1QRUA 2DEUA 1GLGA 1U2DA 3VR5H 3DE7X 1DNPA 3AONB 2QNRA 1XOIA 3B1WA 3UJ9A 3O0DA 3C5WP 3PEFA 2VK1A 3SM3A 1MVNA 2EZUA 2GDZA 1ZIYA 3U9LA 1U99A 3C7DB 4S35A 1XAJA 2HRRA 4J0KA 1RJ9A 3CXUA 2O2ZA 1VBMA 5AUPB 2WSSA 2GPAA 1TD1A 1ZI9A 2AEMA 4OF4A 5TJ9A 5I8ZA 2A9OA 3Q0IA 1JH9A 1BKDR 3Q3EA 1DC3A 3I9NA 4MQEB 1HZJA 1QZ3A 3UB3A 3ZXIA 5BNTA 4BU1A 3FB4A 4RZSA 2ATCA 4UAUA 4JQOA 5KS2A 4QUBA 3RABA 1KJYA 4R7TA 1KIFA 2K6GA 1X14A 5EZYA 5KHAA 3SD7A 2HRZA 3P9CA 4BZWA 2EZTA 4BEBA 1X80B 1H2BA 3ONWA 4CMAA 1UFRA 1KO8A 1ORTA 4IUCS 1IN1A 3OZ7A 2DJIA 4TS9A 3NGMA 4BLTA 4E70A 1QYCA 2O7VA 4EUEA 4N49A 1S4QA 4Q9AA 2O14A 4RDIA 2ZKIA 3Q5EA 2ADOA 1IVSA 4DLUA 2GGSA 3KR1A 1HTTA 1P1JA 1CY4A 3KQHA 3VI3B 5KDOA 1NT4A 4HB0A 5JVDB 1FUEA 2VCEA 4D1YA 2FMIA 4KITB 4B40A 4LF5B 2QL7A 1XRLA 1DKLA 3FMPB 1OX5A 1T4GA 2AD1A 2JH9A 3EEBA 4MKRA 2QQGA 4MGEA 4D8WA 4GKJB 2OE2A 1VJGA 3PX3A 1RLOA 1W59A 2BEUA 2V03A 4UNSA 3IAM6 1I1QB 2VP6A 5ECWA 4MRSA 2WDZA 1S8NA 3VYSB 2YOHA 2QTCA 3F8SA 5A5FA 3HB1A 2J3LA 1JI3A 1CUWA 2A1IA 5F73A 3W9UA 5C8YF 1V3QE 3L4BC 1MHPA 2X0JA 2IEBA 3EIUA 2FDXA 2AHRA 2WT8A 3QVGA 4RSGA 4EVQA 3AERA 5ED4A 5KMGA 2H4WA 3UPUA 2EBUA 3ZLJA 2P62A 2W2LA 1U65A 4ZK2A 2BC9A 1MTZA 1V9SA 1E59A 2P4UA 4M87A 1EPUA 2A1TS 2XEDA 1LPPA 3QEKA 1OWLA 3FMOB 2WHRA 4CMGA 4YRGA 2PAAA 1GN8A 1AS3A 1GZ3A 3B3GA 5K8UA 2NVOA 4LQLA 1TXGA 1A8QA 2YIJA 2NP6A 4HH4A 4ZO7A 3ITDA 3BORA 3FZNA 1AZSC 5CJPA 2E5LB 3R5JA 4FCVA 8GPBA 2JRLA 3GXOA 1N0IA 4FBMA 2WAYA 2YUTA 2C4NA 1NJFA 1U4NA 3UMJA 1WPGA 1OZGA 3OLWA 5CFQA 3NI2A 3RC2A 2R8OA 1UC8A 4NK5A 3UG7A 3ICQB 4ZU1X 1H0HA 1NDHA 4FU0A 4RPCA 2C5GA 2VYCA 2NNLD 4QDJA 3NTVA 3AR2A 2ODTX 2SKDA 2X6TA 3OY7A 3LUHA 4UTXA 2B1JA 4GNKA 4ZJPA 1SXPA 1LA2A 3OFSA 4JJKA 4RY0A 4WCDA 2IEDA 1CYDA 2VJBA 3SKYA 2ZZNA 1ZWKA 3GZJA 3RVKA 1EG7A 1U7TA 1HDXA 1T91A 3SX0A 4OB7A 2FZVA 3GLGE 1GDHA 2XMSA 1Q77A 1HMYA 3A6EA 4OA8A 3FPCA 4B0PA 1KJ8A 2IZ0A 3GDFA 1FQOA 3SQDA 4AJHA 2ACWA 4QTXA 3H9BA 4C3ZA 1ICIA 3K9QO 4GBMA 3V3TA 4KAAA 1KKLA 1Z12A 3FNBA 5EKSA 5HP4A 4C14A 5H3CA 1CUJA 3HGTA 1GL6A 2BP7A 2QU8A 2BGTA 3OQHA 4L3OA 3HKCA 1U31A 2EW2A 4RWEA 4PG7A 1IJBA 4XDZA 4DSTA 1OH7A 1EXDA 4AQDA 5B58T 5I9IA 3FLBA 3K53A 1GPJA 1LI7A 5KNDD 4GPTA 1YA8A 2BUAA 1ZLXA 3CR3C 5AJVB 1ECGA 4ALLA 3ZCQA 1KY3A 2WIDA 5CFLA 5A5EA 1N5IA 1SUDA 2XI4A 4HL6A 1NXOA 3GU3A 3B1JA 1G3QA 1UBNA 5C37A 4FR0A 2YWGA 4BFXA 4B3IA 4OI0A 5CU7A 3GT0A 1N2EA 4AICA 3K9WA 3GJ6A 3SCZA 1Q16A 5G02A 2BFAA 3MQFA 2IEYA 4Z1OA 1GXSB 3DWGA 4JELA 2D1SA 2H1CA 3EXFA 2J9FA 3RAGA 3M1IA 3Q3CA 1Z2AA 4Z9AA 1E9SA 2QUJA 3ADKA 5E4FA 2OY0A 5KNCH 1I36A 4Z2AA 3C87A 2XT9A 1U1FA 4CW7A 3WA7A 3TAXA 4K6OA 4FR2A 3RVQA 4ZGGA 2ZM6B 2G1PA 3AEZA 5HFJA 3W79A 1Z73A 3Q7TA 1U2ZA 1VBNA 2I2BA 1PLJA 4IVQA 5T8KC 2PV7A 1SG0A 1Z74A 2FPKA 3GGPA 1NUSA 1V5WA 1K06A 3X2FA 1FFYA 1HT0A 2BR5A 1U3CA 1YBFA 4MVCA 4WZAB 2IE0A 2GJKA 1RBZA 3NHZA 4KI7A 2VUSA 4MV7A 1UPFA 1YL6A 4ZEVA 3QP9A 3EGVA 4LMAA 4RMNA 4GI5A 4PPFA 4JKOA 1LBQA 1NBIA 2HF8A 4KKXB 2OGUA 2IZ5A 1DOHA 4J91A 1T4CB 5I01A 1ZN7A 1DINA 2JRCA 4R2IA 1DJPA 1F5SA 4AM8A 1DBVO 2GPSA 2YIVX 4PVDA 4B3RB 2YINC 4YRLA 3Q7IA 3JD3A 1X0VA 3ZWYA 5M04A 1XHEA 3KWLA 3BDVA 4DKXA 1ZL0A 4EATA 1EFHA 4JVLA 1RCTE 4GECA 3SYMA 1LDMA 1TMYA 2Y1EA 4E1AA 4K0KB 3MYRA 3NEAA 1VJ5A 5J5AA 2WV7A 3VKVA 2FH5B 4LXUA 5K0CA 2M6SA 4HQRA 3LLMA 2A67A 4YMIA 2ZVDA 3LY7A 3SMVA 3AV3A 4F5EA 1MOPA 4AULA 2DFLA 2XHEA 3WRXA 3RAFC 2I3AA 2PX6A 2XB4A 1CKEA 3D3EA 2WKQA 3A4VA 1F2TB 4H60A 2H31A 1KRWA 1NW8A 4OMUA 4MW5A 1M6VB 3T0FA 3NC4A 4DM3A 2CJWA 2PMCA 1W75A 4IJQA 1A9YA 1B8PA 2Z30A 5ENDA 5CLQA 3Q0TA 4J8PA 1RABA 4V0RA 4JASB 3EZYA 1GU1A 4DAEA 2E5FA 2POCA 3TZEA 4BL5A 2VT2A 1E92A 2VUHB 1I9CA 3T61A 2QSUA 3BD8A 4EKIA 2H1VA 1DB3A 4IM7A 3ZHUA 5AK4A 5J2UA 2DUUA 2FPRA 4XLZA 4CIWA 2VUIB 1G55A 4R84A 5EP3A 1JLLB 3KXIA 4G09A 2AI1A 2QUKA 5ECDA 1I3MA 2R7MA 2DMRA 1V6SA 1VMEA 1I1OA 2GN8A 3TVDA 4HNVA 2CVZA 4MAFA 2ZRQA 1UDRA 1SOMA 4NG4A 4URUR 5EXXA 2ZTHA 5HZGA 1CY8A 1JB9A 1I30A 5TF0A 4YR7A 1OYYA 1DX4A 2I3GA 3L8GA 2QJFA 4KFSA 5IBCA 5JSZB 1W36B 1D5WA 3I2IA 4EOGA 4CT5A 3CZCA 2AOWA 1WJGA 5HHTA 1DXOA 3TFOA 2OAP1 4YS6A 3R09A 3JQBA 5DCLA 5JYEA 1XAGA 3ZOKA 2CXPA 3PNQA 1W4BA 2HRCA 3SFZA 1DAHA 3VX3A 1K7SN 3ZQKA 1BXZA 1SH7A 1ZJ6A 3IMFA 4KQ2A 3C8MA 1GU0A 4L6AA 3NETA 2H85A 5KU7A 2QJOA 5EC8A 4XVCA 1VE5A 3BIWA 4FDUA 1U2TA 3C1OA 4UVDA 1BOOA 4HWSA 1YB5A 5AVKA 2JLZA 2GXUA 3NFYA 3AY7A 1CUAA 2B94A 1EVYA 1XTUA 3FUCA 4GPBA 3GPCA 2SNIE 3H9EO 4G8BA 2IXBA 4UD2A 3U1TA 2RI1A 1RHKA 4D0LB 5LD2C 5AW7A 4UUPA 3Q8XB 3HZZA 8LDHA 2ZT6A 1BWSA 1JUDA 3EIEA 4YMLA 5IWAB 3KXKA 1ITZA 1UADA 3EGDA 2I7TA 3FROA 1EGQA 3FWPA 4FFLA 2O2SA 2WA2A 3FMFA 1P3JA 2RD2A 2FYTA 3BCHA 2D1QA 4BVHA 2ONZA 1EWTA 1GG8A 1MFPA 4B35A 5A9SA 1I5RA 4RZQA 1QUEA 4JKYA 3SNKA 3T9BA 1U0FA 3AQ4A 4DHEA 3FDFA 4AG5A 2V3CC 4MEJA 3DOUA 4Y2JA 5ANRB 2EBWA 3R8FA 1VYUA 1PT8A 1N6KA 1RMYA 3F90A 4XXHA 5EMJA 3NP9A 2OHGA 1DU4A 1RWXA 3CF2A 4MROA 3EDMA 4NZYA 3LF1A 4Q9KA 2CV1A 1U28C 1IXZA 2ZSKA 2XE4A 3KTFA 3VZSA 1FP4B 2QTAA 2PNFA 3CZ4A 4QFBA 5HZKA 3G5TA 1CNFA 1VCNA 2NZ2A 3DMGA 2XA1A 4IVPA 4OGWA 3CG0A 3N86A 3I58A 1DJQA 5CG2A 1P77A 1PK8A 3A0RB 2NYRA 1PS8A 3UYLA 2MYTA 3BD9A 3CR8A 2HDHA 4Y2YA 5B57C 2Q3LA 3HTXA 3FMIA 4YCDA 2PY6A 3VO2A 4YCLA 3IEMA 3SF8B 5EXTA 4YACA 3W9SA 3IUPA 1PLKA 4A4DA 1AO3A 4C4AA 4B84A 3QIAA 4ZOLB 2WIAA 4GYWA 2WHQA 2HPZA 3U3ZA 3L1JA 5DLYA 1E3SA 3QYJA 4I1SA 1DQZA 4B7CA 3U09A 4NYIR 4EI8A 4J16A 3LZCA 5ALSA 1RQLA 4I4LA 5FOTA 1WETA 1I7PA 2XE8A 3EUAA 3UJAA 3ZV7A 4FR5A 5DTIA 5FPSA 3DTNA 4OJNA 4KTTE 1BRTA 2LCIA 3Q88A 5E8RA 4POOA 4B1FA 5JQGB 3DBLB 3N2KA 2FZWA 4MGZR 2LV8A 2D0IA 3PFGA 3Q9LA 1YB7A 3OX4A 5TMDA 3QF7A 3BTOA 2NZYA 3I2KA 3KB1A 2FMKA 4FGLA 4L4RA 2A9VA 4IGFA 3FTNA 3V8RA 1TLFA 4L27A 5A62A 1F1BA 4D8VA 2Z5VA 3ZC3A 5FTNA 2Z0MA 3H1BA 1ZI8A 3LQQA 2C0CA 3HJRA 4P22A 3H5AA 4ME6A 5AXAA 1V1RA 1PRYA 4X90A 5I4BA 4X95A 2F64A 2GK7A 2HHAA 1NN1A 2FHSA 3MWJA 1VGQA 1XEXA 1CQPA 1YR2A 2OLKA 3HB0A 4ZTBA 4EJMA 4Y2TA 4IIGA 5L3RA 4C01A 4NL4H 2GFQA 3BWDD 1KEEB 2UZ1A 3KG2A 4GOMD 4IILA 1L5MA 2IZ1A 2Q6LA 3ICOA 3NU1A 4JXKA 4KGVA 1ATIA 4OFWA 4BB0A 5B3KA 821PA 2F8SA 2C95A 3R8XA 2JGNA 1AKRA 4XGNA 5BNWA 3SQOA 1NVWQ 1ZN9A 4IIXA 4B4VA 1XEWX 1ZG3A 1IY0A 2OXCA 3GEDA 1DFGA 2V7BA 2JCVA 2N0SA 2PL9A 3DBHA 2GK4A 3QV2A 4WOKA 4DNFA 1X19A 4Y9DA 1CIJA 2P9ZA 5FTWA 2VT6A 3OD5A 3GO4A 2IUFA 3K1TA 3PNLA 3T7DA 3UNXA 3MOSA 4QOHA 1MA0A 4J2OA 2Q2VA 3C4JA 3IT3A 4L8GA 3B1VA 5JZSA 3GRKA 3GLGA 2BGRA 3WGUA 1EFPA 1LQUA 2GAIA 3ER6A 1ZRHA 5JOQA 5K4GA 3KSBC 4UEWA 3IR7A 4ZT3A 1LDNA 2GN0A 1E1DA 4MDYA 4EUKA 1RYYA 4F4IA 1QHHA 3DONA 4BVEA 3Q8LA 4TV8A 1X87A 4DJTA 2ZR7A 4NCXA 2OGZA 3OQ1A 2FJPA 5EE5B 4CLRB 4YJHA 4ENVA 3LXXA 4JDPA 1XXHB 3PPVA 4E5UA 2CC2A 2FWIA 2JEZA 1QF9A 3KSDO 1WVMA 2Q3EA 5HIMA 1QYIA 4KUGA 4ZVMA 3KQWA 4WKOA 4YR9A 3EVGA 3L4JA 4J0JA 4A36A 3I53A 5CHEA 1Z7YA 4YPVA 3ESXA 1F0NA 4Y6QA 1HL3A 1AJEA 1DUIA 1YI8A 1LC3A 4CQLA 3FMVA 1VPLA 5LPNA 3BEDA 3HY6A 4AP5A 2I7CA 1AKUA 1E3WA 3E81A 2HN9A 4HBGA 1JHYA 5KVSA 3GWZA 3MM4A 1MEJA 2IHBA 2QA5A 2KWIA 3QNWA 5DHTA 1K3UB 2PIDA 1QM5A 2QRGA 3PD7A 4C4ZA 2C84A 1XU9A 1KZYC 1GUZA 5CNKA 5BN4A 1ADBA 5B7QA 1VKJA 1CJUC 2ECOA 3FWHA 3KZXA 2JIQA 2QUZA 1DV1A 1KGDA 3K20A 4OOFA 4DLAA 4QSHA 1US8B 4XYEA 1Z82A 2Y9MB 1M2NA 4UTRA 4ZCTA 1BU5A 1BXRB 3IVXA 3GFPA 5I5EA 4P38A 1KAHA 3PT9A 4MUMA 4CV3A 1SUCA 5MFPA 4ZYUA 1II8B 1GZ6A 2P2YA 4R01A 3AVUA 1FVHA 3ZOZA 3UFXB 2ZSDA 5GJBA 4OYRA 1GAWA 3L49A 3MLEA 1NQTA 1OXKB 1JN0A 3ORFA 3Q40A 4G9GA 4C3OB 1DC8A 2C04A 4JP5A 5CXSA 2FB9A 3ZVRA 1NVGA 5FBZA 1Q50A 4P3PA 3I4FA 3B52X 1MKYA 4X8HA 4M6WB 1E99A 3MB8A 2CNLA 2XE6A 4OAQA 4IFTA 5JNWA 2OCAA 1Q7CA 3LX8A 5CT5A 1UK9A 2GZAA 2RH5A 1EINA 1SHKA 3HVKA 3I8OA 2FXVA 1LPBB 2QROA 3KR0A 4EB3A 1XWIA 3LIPA 4DVJA 4ESOA 5JJLA 3HNPA 1L7RA 4XD7D 3PVCA 2DXIA 1CZNA 1Y4DE 2WSLA 1YULA 2JJ1A 2VNIA 4GR4A 4OQLA 4S1PA 3T4PA 3TDMA 3ZI0A 3SHTA 2Y66A 1BE6A 2F17A 3O4GA 2YHIA 1QPGA 3VMFA 3KXPA 1DRUA 1G7RA 2FP4B 3H0KA 4OJKA 2GN2A 3MTIA 4X1KA 4CZ2A 4L0DA 1G0OA 9LDBA 2IZZA 2DECA 1PEKE 5FHRA 4ECAA 5L7TA 2JI7A 2FPSA 4GNRA 5KWVA 4D25A 1T4MA 3E15A 3ZWDA 4E30A 1VHWA 2ZS8A 2RHCA 2ZT5A 3H2BA 3U16A 3U3DA 4I99A 4BO0A 5EIEA 3RNLA 3OX2A 4IDQA 4DEXA 4GZ5A 3SEQA 2QJWA 2YWDA 1I33A 1J97A 3ZV4A 4OP1A 1RHJA 5F7JA 3RJ9A 3RUHA 3UICA 2FOLA 5GJVC 3P9ZA 2ZI4A 4XQEA 2B4TO 2PCJA 2YXLA 4A9AA 1IEWA 3L7MA 1FW8A 4GMXA 5L7WA 4FEGA 4MGHA 1KDYA 3B3QA 3IJPA 1OBCA 4MUYA 4CETA 4CTNA 1HE8B 5AVQA 5JNUA 3BTUA 5HOQA 4GICA 5DRTA 1G6KA 5BYJA 3D7SA 2FPIA 2JFUA 1XE3A 3SFVA 4UUNA 5KQRA 3DE3X 5E7MA 4D74A 4EYGA 3WJ7A 1C1HA 2WMYA 4O5AA 5FTLA 5T57A 4ROTA 2A0WA 5AKHA 3MLAA 4RHYA 5A05A 2ZFUA 4L9AA 1EXNA 2QYTA 2VYNA 1JKIA 1YE8A 1ZJ5A 2Y0DA 3IO3A 3IRUA 3TLJA 3VPXA 1OXVA 1T0JB 4DLVA 2QPTA 4F1KA 3B3FA 4JMLA 3ZCUA 4KREA 1CUUA 2NYVA 2QWXA 2JGDB 1E9VA 1S1CA 3JASA 3E3OA 3JYOA 4F2WA 3PRHA 4DV3B 1YC5A 3MGAA 1EFVB 2Q5CA 2ZU6A 1Y1QA 3EPPA 4HY3A 3D4IA 4TSFA 1RHUA 4ND8B 3SC4A 1Q1GA 2YBDA 1GFWA 3KYIB 2YHBA 4IDBA 1D4OA 3EXG1 4I08A 1QXSA 2XUFA 1LPSA 3MTQA 4XR9A 1USUA 3JQDA 3FHCB 2X3YA 1ZN8A 3ZZNA 5A5VA 3R75A 5I6DA 2B99A 1DX6A 2WFMA 3OFVA 4R1PA 2BR3A 5A3VA 2NXEA 2PQ0A 1BXKA 3AB3A 3D3WB 3OWHA 3SJBA 1NA5A 3TUJC 3TNJA 4A8PA 1ZRMA 1VC2A 2GN1A 3FPHA 3D43A 3USZA 3NIGB 4YONB 2FX5A 2IYEA 2WPNA 2OK7A 2GCIA 3QTBA 4P93A 2WUFA 4RABA 5FO0A 2QL5A 1N1DA 1AD2A 3F9RA 4RLQA 1KBZA 3ZDCA 3GFFA 4CLHA 4MUXA 5KX5F 2F4VB 1WR8A 2BD0A 2DBYA 2L18A 3UT5A 4GBED 2XNDD 2BISA 2YFQA 4ETNA 3C3AA 4PZCA 1HKHA 2I3DA 4EKEA 4YCNA 1ZR2A 5E3HA 4PZZA 4Y6SA 5BN3B 1FA9A 4YRTA 3VRHA 1MOZA 4Q48A 2DQZA 3CLHA 1JX6A 1MGPA 2XYQA 4IRUB 5AK5A 3RFVA 4DA4A 1PV4A 3QKIA 1JSCA 1N2XA 4C0HA 3V8NA 1M5TA 1EM6A 2V7UA 1EVLA 4ZVQA 2O23A 3KYJB 4A27A 2H17A 3AFOA 1HY3A 3G8BA 4C1NA 2DPXA 1L4MA 1FC0A 3DE1X 4FZJA 2GN6A 3HVHA 2EKBA 2YV3A 2W98A 3KTAB 4JJ4A 1J5PA 4OFBA 4ZD6A 3GH3A 1HDIA 4LOKA 1M73E 1MCZA 4LCBA 1PR9A 3OE4A 1RBMA 1T1GA 1C9EA 2W4IA 3PHJA 4FUQA 3T8YA 4JI0B 3HJBA 1JXAA 2UYHA 3CRZA 3KJEA 3KPJA 1WW3A 3C6KA 2GAJA 1M1YB 1I9GA 5IVIA 4M1QA 1IMJA 4F9GA 3F6YA 4B8WA 1COWD 5FKJA 1PGOA 4DSUA 2HMSA 1HNXB 1ONNA 2NVBA 5K9ZA 2WF9A 5IVKA 4JGGA 1XKQA 4NRDA 1KVQA 3I2HA 1Z15A 1T8RA 2LE0A 4KLAA 4WBXC 2O1WA 1SKYE 4ZARA 3W6NA 1RRGA 4A0RA 4OHWA 4A8TA 1CETA 4FINA 3U48A 5JS6A 1B2RA 1TKAA 3GPIA 2H1RA 1QNFA 1HM5A 2R84A 2V5AA 2X86A 4M0UA 1GNRA 1T8PA 3K4QA 1DADA 3P2EA 3IP3A 4NDZA 4IJ5A 1IXKA 2X3UA 5IYZA 1JPNA 2Z83A 4X8MA 3A9UA 3B5JA 1DARA 1ZM3A 1IXSB 2IYFA 1V9LA 3QKSB 3QFCA 4J76A 4KV9A 1XGKA 5IM4A 2DR2A 1XJ0A 1TGVA 3F3KA 4JT4A 3RC9A 6YASA 1TB4A 5HDBB 4K6GA 2OLJA 3TN7A 1UANA 1WZIA 3DVAA 2MSCB 3ZQ4A 1QTRA 5DNCA 2JFOA 1QYXA 3HFSA 4KTVE 1YOVA 4QDXA 4GR9A 1PJ8A 4HXGA 2G80A 1O95A 3OZTA 3V4ZA 2AB0A 4MQBA 4L73A 4FQ5A 3K9FC 3AIMA 5B6JA 4LZNA 3ND5A 4DWJA 2GJ4A 3GLRA 3IMCA 1G64A 1IONA 1XVAA 3ANYB 4BMYA 3B3JA 1TU0A 1G8YA 3RRFA 1SPXA 4MOWA 5ERYA 1KO4A 2AFIA 4UFOA 5LUBA 1LNQA 5JG7A 2CWDA 3IC5A 4CE6A 5F3DA 2Q50A 3BSWA 5KTNA 5GONB 4PV7A 1JFVA 2HMAA 3CZQA 4BBPA 2EP7A 3C6BA 3D0KA 3I9V1 4QYIA 4BWFB 3KOXA 2V7QA 3OY2A 4A23A 5CLJA 2HAEA 1EP1B 1OGYA 3GJ7A 3JATB 5K03A 4JLVA 4LOIA 3EEOA 2XMQA 2F3SA 4FXOA 4PXYA 2C29D 2W6ID 3ILSA 5G4LA 3SJAA 3TI9A 4MWDA 1DWPA 3GP8A 1K6XA 1VRVA 4DCGA 3PTZA 5JAHA 2LBPA 3CPJB 1QGDA 4F9EA 1VM6A 3HN7A 4L4SA 2WYWA 4KSCA 3ECCA 1YBVA 1B6TA 1DIAA 2IP4A 3NTXA 5KC8A 3U4QB 4A8JC 2J3IA 4CKWB 3A4YA 4MVJP 3HPQA 1L3CA 3W6OA 3G1TA 1N7GA 1F5NA 2MINB 3GGJA 3LPCA 4HX9A 4Z1MA 4DXHA 4QLBA 2PVCA 4PZLA 3CU5A 2P9GA 2NO0A 5CURA 4GMFA 2IODA 3C6XA 4BMSA 2VJPA 4YXWA 5TEVA 2OBNA 2VRCA 4JIGA 4JQSA 5A5GA 3QLEA 1M0TA 1NF8A 2AL7A 2XOXA 2GEKA 3BUSA 4IWXA 4QC2A 3RSSA 3T5TA 3IVCA 1YDGA 4HFMA 4KHZA 2O59A <