1J90A

Crystal structure of drosophila deoxyribonucleoside kinase
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
195
structure length
195
Chain Sequence
TQPFTVLIEGNIGSGKTTYLNHFEKYKNDICLLTEPVEKWRNVNGVNLLELMYKDPKKWAMPFQSYVTLTMLQSHTAPTNKKLKIMERSIFSARYCFVENMRRNGSLEQGMYNTLEEWYKFIEESIHVQADLIIYLRTSPEVAYERIRQRARSEESCVPLKYLQELHELHEDWLIHQRRPQSCKVLVLDADLNLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for substrate specificities of cellular deoxyribonucleoside kinases.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transferase
molecule keywords Deoxyribonucleoside kinase
total genus 74
structure length 195
sequence length 195
chains with identical sequence B
ec nomenclature ec 2.7.1.145: Deoxynucleoside kinase.
pdb deposition date 2001-05-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1j90A00
1Q1BA 4XTRA 1DO0A 4Q03A 3SS8A 2E87A 1ETUA 2E9SA 3RSLA 3ND9A 2HJVA 2ZRNA 4Q9IA 2CLDX 4FCVA 3U44B 1FUUA 2BM0A 2WJJA 3PV0A 1UM8A 3NC1C 3EZ2A 4BLTA 3KXLA 4B3GA 3V00A 2N1BA 3TW4A 1UBFA 5JLJA 2ERYA 4OI0A 3SJBA 2IHYA 1CXZA 1KI7A 5EE5B 4D0NA 2YWFA 4LI0A 4URUR 2NOAA 3KJIA 1XZQA 2BBOA 4RFVA 3RS4A 4YMUA 5K8IA 5FOVA 1OIXA 4CW7A 2ZROA 2GTPA 3VKGA 1GKYA 4Q18A 2P6NA 3PFIA 5C46F 1IY2A 5JFGA 4V0NA 4PSKA 3ZVMA 2ZYVX 3T12A 4FD2A 1GRRA 4C7OB 1Z6XA 3NTUA 4R9UC 4O0MA 4P4SB 1DOAA 1F3OA 3DKVA 2D7DA 2OO7A 2UZIR 2BC9A 3GFOA 1KMQA 3R7WB 3U7HB 3SBEA 1NLYA 3REFA 1G18A 1W4CA 1II0A 1KK1A 3GJ7A 3LFUA 3W9YA 4HUTA 2JLWA 4CEIA 1R8QA 4QFMA 1AZSC 1Z6AA 3CLVA 4WA7A 1AS2A 5K8UA 2I4IA 3ICQB 1TTTA 2DFKB 3QPWA 2BKEA 2IEZA 2NZ8A 1OKKD 4JT2A 4TYWA 2A7QA 2CEAA 3CO5A 2BCGY 3K0AB 2GESA 1J70A 1KZ7B 2W0SA 4P3YA 2BV3A 1U81A 1T8UA 4GBMA 1W4RA 5EE3A 4EPXA 4IVRA 3AKCA 4W7SA 1NI3A 4CEHA 4MYTA 3WBKA 3GJ5A 1F2UB 4KFTA 5FBWB 4MDFA 4LHWA 1R0ZA 1OIWA 1U9IC 1VYTA 1I4LD 1U9IA 1HQYE 1VIYA 2R2AA 4A0FA 4LC1A 2F43A 4LJ5A 4BUJA 4OHYA 1ZRHA 3EPKA 3CH4B 4KBFA 1U2RA 2GVZC 1X6VA 4OHVA 1FMJA 4C3ZA 1J99A 2FPKA 4BE7B 1TL7C 1AKYA 3THYB 3JVUA 4IHQA 5DISB 2QORA 3KFVA 1YRAA 1COWA 2ZJZA 1NP6A 3B6EA 1EFCA 3QBTA 4RD2A 4NKRA 2PJRA 1KMHB 2FV8A 2FFAA 4UXJA 2ZRCA 1W47A 2ORVA 4F4CA 3SFVA 2QY9A 1NIPA 1T3SA 1XF9A 2G3YA 2PZFA 2WMOB 4KV9A 4IDPA 1GL6A 2ZIAA 3PR1A 1FOEB 1JAHA 4O25A 4DSTA 1XZPA 4DLSA 1OKKA 4N0DA 4N1AA 4TT3A 2OG2A 1D2NA 3QKSA 4S2EA 3FGNA 2F3TA 4JLOA 3ADCA 1A5TA 1D9ZA 4RKFA 5HCIA 3VNUA 1N5LA 4TLDA 5BQ5A 3GLHB 3U4QA 2NO6A 1W49A 4Q4JB 2C04A 4A0GA 2W2TA 2VIIA 2H16A 4DRZA 5FTMA 1OLOA 2ZR0A 1VKJA 1J8YF 2WWYA 1AZTA 2B8WA 4IFBA 1E9CA 1A7JA 2IYZA 2IYSA 2C77A 5F98A 2QBYB 2J46A 4A0RA 1E0SA 1P2TA 2VQSA 3TJZA 1KIMA 1VMAA 3BB4A 4AC9A 2IBMA 1W36C 1OFUX 1Z2AA 1WXQA 4M8NE 4EQ6A 3EX7C 3L8YA 2L0XA 4F4IA 4URZR 1C1YA 2AX4A 2B6HA 3OEHA 1UEJA 3MRSA 1E1RA 3I61A 2IWRA 2YZ2A 2D2FA 1G41A 2VP5A 3VU9B 2XJ4A 2BWJA 2YWGA 1JR3E 4BFSA 4CRWB 5GVSA 1TQ6A 2EU8A 1GTVA 1VIAA 2OCYC 4US0R 1XPOA 3RABA 3WY9A 3ZIAD 4EPTA 5L3QA 3O8CA 3EA0A 3G0HA 3C5CA 1L8QA 5DSZA 3R8CA 5TV2A 1IN4A 1KI9A 4GP6A 1ZD1A 3WMGA 1UKZA 4LRWA 2GCNA 1E3MA 4MKGA 2FPLA 3U3KA 3GQBA 5KPJA 3KB1A 4TTQA 3CRW1 3PEYA 4FMDB 4IVQA 2O8FB 3NVAA 5FOWA 4C2TA 2JAQA 4UNSA 3VR6A 2XTNA 3EG5A 1EK0A 4M0LA 5E7MA 4TSFD 2KJQA 2Z43A 3AQ4A 2OHFA 5G53C 1VDZA 1JECA 2B92A 2Q3MA 3GJ0A 4DCNA 3K70D 3U44A 5LBIA 1WMSA 4IXNA 3A4MA 2OBLA 2ZJ5A 2K5UA 5CYPA 2F9MA 2FGJA 1N6OA 4HEJA 4JJZA 3LLMA 5KHOC 4ASUD 1B0UA 2AKYA 2WVJA 2KBFA 5EP1A 2V1UA 1P60A 4HSEA 4FCWA 1SZPA 2JGNA 3W3ZB 1E99A 3OIYA 1GKIA 3PITA 1XTRA 1CJKC 3X1WA 1XDBA 1M74A 1S0UA 2AK2A 2WJVA 4D2IA 5G41A 2ZR9A 2OSBA 4HUQB 4OBEA 4TYQA 3FWYA 4EUNA 2E1RA 1YHNA 5GJBA 4X8OA 4PAQA 5JWHA 3CKLA 2HF9A 4Q5IA 3QXHA 2IYLD 4OK5A 1E2QA 1G20E 4DEYA 5CIQA 5KYKA 2C5LA 2WV9A 1UFQA 3ZIAA 5FBVB 2QNRA 2EWVA 1EESA 1ZNXA 2H57A 1N6NA 1XXHA 3X1YA 3TAUA 2WWGA 2BOVA 5AJXA 2HEIA 3EC2A 5B30A 4AKHA 4DCTA 1MR3F 2PH1A 3I1FA 4CVNA 2FEOA 3N5CA 5DIFA 3GMTA 1KZGB 4NZYA 5JWRA 2JJ1D 2X2FA 1TEXA 1RIFA 1XD8A 3VMFA 3PUZA 5EP4A 1NJGA 2FSFA 3IPXA 5J5CA 2Q6TA 4FMCF 1HUQA 3CF6R 3ZLJA 4M1TA 4HB4A 3SBDA 2C8VA 2KI5A 4KBGA 3TSWA 4B2PA 2ZRJA 2ZRHA 2GF9A 1NNEA 1IBRA 2AR7A 3THOA 4IDHA 3GFPA 5TMPA 2C9OA 2PEZA 2ZI5A 3M0EA 1GZSA 2IUSA 4TLCA 2VSXA 1GDDA 4ERNA 1FPMA 2GZAA 5AUOB 1ZIOA 3U3RA 5IHPA 3FMOB 2J45A 2F55A 3ASYA 1VCIA 5KPDA 1M1YE 4LK2A 5HKKD 2GBLA 2AXNA 4AYXA 1YE8A 3I8SA 3LH5A 4V0KA 1XD9A 2IW3A 2WKRA 4PC2A 4OI1A 3THYA 2Q3FA 3TMKA 3HYRA 2Q9BA 2O8DA 4W9MC 1X8KA 3KB2A 4RZ3A 4RJLA 3TNFA 4U7DA 1E2GA 1HQCA 1U8AA 3BGWA 2Q3HA 1XCGB 4M21A 2XNDA 1XCPA 1WB9A 3P4XA 4B35A 3UXMA 4MGIR 4A2QA 4YMVA 2AN9A 4G5QA 5CJPA 2BJVA 3NH9A 5KDDA 1GM5A 2DB3A 1UAAA 3VNVA 2XTZA 1G64A 2ZJ8A 3NEJA 4EKDA 2D74A 1NJFA 3F3YA 4MH0R 2PMKA 4BFTA 3QIAA 5J4YA 1KJWA 4JT4A 1Q12A 3DL0A 1SKQA 2HYIC 3IPYA 2RMKA 2HDNB 1M34E 1XB2A 5FPSA 5BYKA 3LW8A 4L8GA 4KCGA 4MRPA 2CK3D 1MT0A 3SDZA 1P5ZB 3HU2A 1ZNYA 3QG1A 4TL8A 2W2VA 3ZZUA 1EFHA 1E0JA 1R2QA 1W36B 1BOFA 2FGKA 4OQMA 5JCZA 4GOXA 1N6RA 4C0BA 4Z54A 1A4RA 1L7VC 3R9IA 2NMVA 4GDFA 1U8YA 4QXAA 3RC3A 5FPKA 2J5XA 2CBZA 2KE5A 4C7OA 1M7HA 3B78A 2OEPA 1UBCA 4PO9A 4I1OA 2W58A 2IHBA 1SHKA 2BJWA 3FHOA 1QF9A 4OQNA 1YZKA 1P9WA 2ZI3A 2ZXUA 1TQ4A 3D31A 5EQTA 5J4LA 5GJCA 2XOKD 2IUUA 1XTQA 4Q9LA 2QE7D 4US2R 5KNCA 4GSYA 4RD0A 5K8LA 3RRZA 2ZTSA 3VKHA 1W2HA 4LBYA 4C0AC 2IXEA 3EXAA 3O8DA 4KJZA 5H8WA 2R44A 2H18A 3AGQA 2IS6A 1NN0A 4TLAA 2R6DA 2LKCA 2IYWA 5LD2B 1AS0A 4GMXA 2YC2C 3TLXA 1KOFA 5HR5A 2WPDD 3ZVLA 3RS3A 2WJYA 4BZQA 1GRNA 1CR1A 1IHUA 4LV6A 1DPFA 1O3YA 3ND8A 1DAFA 1HH4A 1IQPA 4XVQA 1J7KA 1TADA 4EFLA 3L0OA 4Q1DA 1KMHA 3PQCA 2EFHB 1XMSA 2XZLA 3PXGA 2XB4A 4JYBA 1Z06A 1OFIA 1UBEA 2OUKA 4OYHA 4QGHA 3RS0A 1EFRD 2N42A 3NBXX 1E2NA 1RYFA 5EE0A 3B5JA 4KFRA 4XVUA 4YXWD 3KQKA 2EFGA 4WW0A 4BLOA 3KQUA 1E9RA 2ZR7A 3DM9B 3LY5A 4QBGB 1Q22A 3BBPA 3AVYA 1GSIA 5CK4A 1G21E 2Z4RA 2RGGA 1JJVA 2G6BA 3QQ5A 4B6EA 1Q21A 4KITB 1DS6A 4K46A 1KI6B 2OLJA 4M9QA 1IY1A 4MGKR 4BECA 2ZUCA 3HU3A 5BYJA 3CB4A 2VEDA 4TMVA 1N6LA 3IILA 1ZUIA 721PA 1XXHE 1BKDR 2ANBA 2JIZA 1G8YA 4JLBA 5B57C 1UADA 4XSHA 3T61A 1Z83A 3CRMA 3K0AA 2CE7A 2OXRA 2CNWA 2RH5A 1XPRA 2VA8A 3VFDA 5LB2A 1F48A 3LX8A 3W90A 5FTNA 1XMVA 2EQBA 1E2KA 3BJIC 4WXRA 1LB1B 2DWOA 4LJAA 1E1QD 4N3NA 2Q9AA 521PA 4PZYA 4TQUS 2B8TA 1XEXB 1UDWA 2AD1A 2WWHA 2FEMA 4M9SA 4DKXA 8OHMA 4D26A 4P0TA 2J0QA 4KLZA 4O3MA 3CPHA 2VHCA 4NL4H 3K09A 2FSIA 3IDQA 1KI4A 2QAGB 4OL0A 3ASZA 3AEZA 4V0MA 5L3QB 1FX0B 1P6XA 2YNMA 4HDCA 4R98A 3NHAA 3TQFA 2BKUA 4BZPA 3KTAA 2OESA 4OHZA 2ZYWX 3B9QA 3Q72A 2C9CA 1Z47A 4Y0VA 1N6IA 1K8RA 2ZRAA 2FSHA 3WNBA 3QPUA 1JEEA 3HR8A 4LYJA 2EYQA 1NVXQ 1TPZA 4XOIA 1G5RA 1OXVA 3V9PA 5E7IA 3VKWA 4V0LA 3E5HA 2GCOB 1PZNA 3ECCA 4B3XA 1XRJA 5CDFE 2CLCX 4YMSA 1OV4A 5L3RA 4C0QC 4R2IA 4PHTA 4LBZA 2CCJA 3UG7A 4UNNA 1SXJA 4TL7A 4A8JC 4PO1A 1OJLA 4HI0E 4TLEA 4IVPA 4LJ6A 4EPVA 2GRJA 2X19A 2H92A 3EAQA 1ZAKA 3B85A 3EIEA 3W8RA 1RRCA 2DFTA 3KX2A 2OM2A 1G7SA 3IO5A 1RPZA 4QGGA 3ETLA 4JYCA 4QNMA 4EPYA 4LX0A 4P32A 2JLUA 4A36A 4HZUB 4NBSA 2CLSA 2XNDD 1MABB 4EAQA 2ODEA 1OIVA 4HB3A 3GLFA 1G291 1R0WA 1UEIA 3K0FB 2ODWA 4EFNA 1VCMA 3FKSD 2FG5A 1CTQA 5DHAA 3ZQ6A 4PXAA 4G1UC 4LCBA 3TSZA 5FR2A 5LPNA 2UKDA 4TSFA 1IONA 2AK3A 1NVVR 3L82B 2GK6A 3CRRA 3EPJA 2H8KA 4N0EA 1CR0A 1RE0A 3BH6A 4PPNA 2FJUA 1GNQA 1G7RA 1AGPA 2ZSDA 3GLFE 2ODNA 4GPTA 4DLUA 3UMSA 5GADl 2YJTD 3B2EA 1CBUA 3A37A 2IEYA 3ZH9B 1M6NA 3KKQA 1L2TA 5CIWA 1KSHA 3M1IA 2FWRA 2F1RA 2HLDA 4XSGA 1E2LA 2D06A 1XMIA 3C4JA 1TX4B 1FW6A 3LWNA 4F38A 2ZE7A 2W2XA 1JBKA 5KU1A 3IBYA 2XSZD 2ECKA 4BFWA 5JHHB 1LVGA 2WSMA 3LVQE 4G5GA 1QHIA 5KNBA 1TEVA 3GJ4A 2RGEA 1Q3TA 4Z8YA 3I62A 2IXGA 2QM7A 4I4LA 3AH8A 1SVIA 1JJ7A 5H70A 3ZVNA 1GUAA 5HTKA 1FL9A 5TDHA 4ZKDA 1N6KA 2W83A 3G82C 3FE2A 2G1KA 1U8ZA 2QM8A 1DEKA 2AHOA 3GEIA 4RFSB 2JDIA 5UKDA 3FVQA 5B64A 4PTLA 1G3UA 1NVVQ 4ZI2A 4MRSA 1Z8FA 1CRQA 4YDHB 3K0EA 2ZI4A 5TY0A 3W5JA 2C9YA 2QAGC 1Y3AA 2F3RA 3CNOA 2KB0A 3IKJA 3T5DA 1PUIA 3F0TA 5JBQA 2ZU6A 3HR7A 1CR2A 2IYQA 3A1WA 4C4PA 3QXCA 2R9VA 3B1ZA 3AVPA 4GL2A 4HDQB 4RSGA 4JIMA 3RS7A 1GIAA 1RRPA 1U99A 2PZEA 4PPFA 4RCYA 1T6NA 1G3MA 1P61B 3CR7A 2NZJA 1FTNA 2GETA 1E0KA 4EDHA 4JVNA 2RCNA 1KDTA 5EP3A 4Z1MD 5IK2A 3FOZA 1S4QA 4LHZA 1OXXK 2DFLA 5DGXA 3TR5A 1KI1A 2GJSA 3OIWA 3VR1A 1ESNA 421PA 2ZVQX 1LW7A 1E2FA 1GFIA 2IL1A 2IYRA 3W34A 1Z07A 3LA6A 1P72A 5JRJA 3IIKA 5EJEA 5JS7A 4PPQA 2OLKA 4LJ9A 4K81B 3SOPA 1DAKA 1KY2A 1VECA 1SULA 3NG1A 1TF2A 3QE0A 4KVGA 3LAWA 1EFTA 2A30A 2CNWD 1IXZA 1R6BX 4FINA 1IXSB 1H8HD 4NE2A 5KSOA 3QKTA 2Y8EA 3TSOA 1JNYA 2HT1A 5JJKA 1J90A 1JR3A 2VP2A 3I5XA 2W00A 3SQWA 2A5DA 3Q9LA 1Z0JA 4QKQA 4TL6A 4KXFB 4A9AA 1M7BA 1MO4A 3GLGB 1U94A 3TUZC 2ZJBA 1L4YA 3D8BA 2OAQ1 3KKPA 4LOAA 1HT1E 2WICA 3T35A 2C03A 4KYIB 2VO1A 3UG6A 3C16C 4ZDIA 2YV5A 3HPQA 4RD4A 4JL6A 4WVFA 2WSSD 2A5YB 2RGNC 3A4NA 3GLHE 4KYUA 1P7CA 3NH6A 3PEUA 4LBWA 3KXIA 1R5NA 3SHWA 5FBLB 1Q1QA 4BQSA 4TN1A 2R6AA 1ZIPA 4DEXA 2GXAA 1EFRA 1YU9A 3CRVA 4ON9A 4U00A 3RRNA 5GVRA 4DSNA 4HLCA 2QL6A 2V9PA 4LWZA 4X8HA 1E69A 3AKEA 1NMZA 1M8PA 2N46A 2VHTA 2WOJA 1X8JA 2WZQA 2Q21A 1M7GA 5CM8B 4IEIA 2P2LA 2G0TA 2JA1A 2R6FA 2RB4A 3BFXA 2AXPA 2YWEA 821PA 1WQ1R 2KWIA 4DLVA 3NDBB 5E4FA 3C15C 3A1TA 4D80A 1JR6A 3PUWA 4QC2A 1MO5A 1CJTC 1OXUA 4TT3D 4KHZA 1G5TA 3H1TA 4Q21A 4DDVA 3LVRE 2ZVPX 4JKYA 1D8TA 3GD7A 1F60A 3I3SR 3K0CA 1CU1A 4KSCA 3ZJYA 3EWAA 5FOSA 4DCSA 5HKKA 2OFOA 1S9HA 2P5SA 3S1AB 3P32A 2ZRMA 1KK3A 1MO6A 4EIWA 2ZI6A 3RS2A 4FW9A 2CL7X 1COWD 4NCJA 3B8HA 1KYIA 5D3MA 5HZHA 3WRXC 3CX6A 5CLQA 3UANA 2WIAA 4C2UA 1Z28A 2JLZA 1AQYA 3B7GA 2GF0A 2WM9B 3GLGA 3GEHA 3Q7QA 3REGA 1QHNA 4ZCMA 1N5JA 4TQAA 1JXMA 2UZ3A 3ADKA 4UNPA 2WPDA 2ZYTX 5SZHB 4DHEA 3TAHA 3AVWA 4KI0A 2C95A 1RZ3A 2VH5R 5SZJA 1OXSC 1E2EA 4WAUA 2G83A 1YVDA 4KVAA 3QKUA 4QG7A 2JJ1A 2IS4A 4PO8A 4URVR 1Z29A 2WHXA 2QEQA 2QMUA 4Q01A 3KZ1E 4Q1EA 3GJXC 5FBQB 4NYJR 4C0JA 2P67A 4GOKA 3A1SA 6Q21A 4AG5A 2REXB 1A2BA 2BHRA 2WWXA 3QBVA 5EE1A 3U7FB 4BLPA 5JSZA 1EFUA 1ZNWA 2JJ8A 1Z2CA 1HA3A 3TGPA 4RY2A 1GKUB 1JR3D 1KO1A 1IY0A 5D3QA 4DB2A 1ZCAA 2MMCA 2IC5A 2CDNA 3MD0A 2IYUA 4NCKA 4B75A 5C4GB 2V8OA 3ADDA 3SNHA 1SQ5A 1ZM7A 3VAAA 2V6IA 5BN3A 2YYZA 1SKYB 3P1JA 1JQJC 4F91B 1LTQA 1Y63A 3AVQA 4YMWA 2QBYA 1Z22A 3A36A 1Z0IA 4QJ3A 2G1JA 1BYUA 2C78A 2JDID 2IA5A 1KSGA 3PUYA 4A1FA 3CBQA 3DMDA 4OJQA 3K9GA 4MQBA 4A2PA 2V3CC 3X1XA 2AWOA 2QMOA 2DY1A 3AP3A 1P75A 4HZIA 1ZMXA 5FOUA 3LXXA 3HU1A 1LS1A 1P9RA 2PBRA 1CF4A 1W0JA 4A6XA 3H2YA 4URWR 2ZSFA 2FU5C 4D0GA 5KSYA 1NKTA 3QKRA 4D25A 3MJHA 1S3SA 2ORWA 4Q7LA 4QJ5A 2B7CA 4ZDJA 5C1BA 2RGCA 5L3SA 2J87A 1E9FA 4XIGS 1RFLA 3GCGA 4TZ6A 3K0CC 4M9XA 5IDVA 1Z6YA 4CZ2A 1SVKA 1NN3A 3HP1A 1KDRA 3JVVA 2WOOA 2NO7A 4ZO4A 2J0UA 4XH9B 4S35A 3CRQA 1KSJA 4XWOA 1Z0AA 1N2CE 2FFQA 3VX3A 1T3HA 1Q1EA 2QSYA 4ESHA 4NTZA 4ACAA 3DO6A 4Z51A 3KKMA 1G3IA 1NF3A 1G19A 4MUAA 1ZW6A 2VTKA 5DNYB 5IT5A 3LV8A 4U5XA 1G6OA 1PLJA 1IOZA 1YR6A 3QOFA 4RD1A 4ZPXA 1OYYA 3NWJA 3SI7A 2QZ4A 1PJRA 4AYTA 4F4JA 2ZAOA 1PVOA 2CVFA 3TQCA 3H0KA 3ZD7A 1N5KA 2MSCB 3T34A 2F1IA 1GNPA 3BD9A 1FP6A 3SEAA 4NYJQ 3TK1A 3V4RA 5KO2A 1E2PA 3IHWA 4Q4AB 1W48A 3LRPA 2BM1A 2D4HA 4G5SA 4QBHA 2JLYA 2GXUA 3VR5A 4BFUA 3L0PA 5EE9A 1NBMA 4L5BA 3OEHD 2J0UB 1ZD9A 1ZC3A 2X8AA 1ZU4A 1GILA 1GOTA 4PC7A 4C9BA 4ACBA 5IK2D 1RJ9B 5DN6A 1I2DA 1CIPA 2IUTA 4YONB 4DLWA 4HATA 1OXTA 3DOEA 3HPRA 2DWPA 4DJTA 1TNDA 2AFHE 4MYHA 2Z5FA 4O2RA 1KAOA 2RAPA 3NDPA 2FFHA 3GJ6A 5CDFA 3EARA 1IN7A 4TTRA 2OAP1 3CX7A 5KUTA 5L8VA 4B6FA 5JMTA 1R10A 2OZEA 1G9XA 2XZPA 5FTJA 4BRUA 1ZYUA 3SYKA 1SHZA 2W6ID 3C14C 5E95A 1XMJA 5JWOA 3KUDA 1G6HA 4NH0A 1V43A 2FNAA 4P33A 3U2QA 4ZI3A 2VRWA 2YWHA 3IO3A 2QN6A 3GEEA 1SXJB 2I3BA 1ONBA 2PLRA 3IQXA 1UDXA 2ZS9A 3DPUA 3TVTA 4X8LA 1F2TB 4B3FX 2J7KA 5AK0A 3X1ZA 2H5EA 1VYVA 2P0EA 2OFWA 1GNRA 4EPRA 2GCOA 1GWNA 1TU4A 1QBKC 2OFXA 5EXTA 2A2ZA 4V03A 4DBLC 1OHHD 1NLZA 4IOMA 3PEVA 3I73A 4ZIRB 4QM7A 2BEKA 4POAA 1XD2A 4QGFA 4OI2A 1PV4A 1YQTA 2ANCA 3LXRA 1W1WA 3OIVA 2VPPA 4DDUA 1DAGA 1S1CA 5AUNB 4TYNA 2NQ2C 4B76A 4RZUA 3SU8A 2BDTA 2HLDD 3BH7A 2HUPA 2CHVA 2WKPA 2XX3A 4YDSA 5BN4A 3CNNA 3FMIA 1YZLA 2RGAA 1ZUHA 3ZS8A 1I4TD 3QVUA 4Q4HA 2D7CA 2BMDA 2SHKA 5KNDA 3AM1A 2IF2A 2QPAA 5FI0B 3O8BA 4BLSA 2O0HA 5J47A 4Q19A 2I1VB 1CJUC 4C30A 3TKLA 4NP6A 5L3VA 3QF4B 1Z08A 4GOJA 4QJ4A 1XNJA 1WBDA 5J4HA 3BC1A 621PA 2R8RA 3MWJA 3UMFA 4Q1AA 2ZREA 3GFTA 5LD2C 3X2SA 5E3HA 4D81A 2ZM5A 4EJSB 2EFEB 1YR7A 5AR1A 1IM2A 3FKSA 1U90A 3LBHA 4JVMA 1QG4A 5JHGB 5DLQC 3GLIB 2QSZA 4R7ZA 3ZZTA 1R4AA 1LV7A 5B2ZA 4TYYA 3CH5A 1DADA 2HJGA 2GVDC 3BB3A 4Q4LA 3PJRA 4L4UA 1OB5A 2ODBA 2HXSA 3U4QB 2BVNA 2EYUA 4PFSA 2PX3A 4B47A 3IIMA 5FPHA 1ZM4A 4MGZR 4NU0A 4BGDA 3OHMA 4IDNA 1I2MA 3ZD6A 1N3BA 4JL8A 3QSYA 1KK2A 2J1LA 2YKGA 2JJ2D 5HE9A 1NLFA 5AWFC 3FKQA 1CS4C 1LF0A 2VP4A 3FB4A 1AIPA 2DWQA 1G8PA 3BH0A 2RGXA 2YHSA 5DI9A 2Z4SA 3RHFA 2ZU0C 2J59A 1DAEA 2DR3A 1U0JA 4OJKA 4US1R 4LV5B 4GNKA 5FL7D 3AUYA 2GJ9A 3A1VA 4XD7D 2NPFA 5K8TA 1Q44A 4LHVA 2QA5A 5J40A 2R62A 4NYIQ 3WP0A 3RC8A 4JSYA 4JSTA 3VR3A 3NIBA 3WXMA 3QXSA 1IN8A 2O8EA 5IF9A 4KU4A 2I1QA 4WIAA 2O52A 1YKSA 4AURA 3LD9A 2NGRA 3T1QA 3QKRB 1Z3IX 2V1XA 1VHTA 5FPTA 1D2MA 2X2EA 4DLRA 1OT3A 4C0KA 3BAFA 2O8CA 4FN5A 2CK3A 2VP9A 2EVWX 3VTKA 4JLAA 2J41A 3ZQJA 2AWNA 3ZDQA 3IIJA 3EA5A 1NY6A 4L9SA 1W46A 3WNCA 2V55B 2GZDA 5EXPA 2RGNA 4DCUA 2P3SA 3E2IA 3KKNA 3DHWC 4KFUA 3I92A 2JJ2A 2HXYA 4GFDA 2FMXA 2VL7A 1Q3HA 2UVQA 1XJQA 1G8FA 1J2JA 2D3WA 2ZSAA 2PL3A 2ZAMA 4KODA 4MITA 4B3CA 2QE7A 2JCSA 1XP8A 3U61B 3AVOA 4IW3B 3RYTC 1GITA 2IYXA 2ZE5A 1MABA 5EZ5A 5G3YA 3U6KA 3GLFB 1E2MA 5F2EA 1NG9A 2CHQA 3LO5A 4ZKEA 3R20A 3BFKA 1CJMA 1NSTA 1WDTA 3I8XA 4IFEA 4LBVA 1G8HA 3H86A 4HAZA 4I99A 4E03A 3K09C 1W5TA 1IN6A 1HE8B 3IHLA 5FL7A 2W6IA 3KJEA 2A5FA 5C4MA 1KSFX 3B9PA 3WNDA 5AJZA 4DLZA 1O87A 4DCVA 1IJEA 4JLMA 1YRBA 4TMKA 1LS6A 4ILEA 1IAQA 2QP9X 3BERA 5CM9C 4ZIRA 3VQTA 1UBGA 2R6GA 4HLUC 2XXAA 4B44A 3RS5A 2ZE6A 1DARA 4IJMA 4B3BA 3FFAA 4XWKA 1R0YA 4Q7MB 4BFVA 4URXR 2J3EA 4C0LA 5DHFA 4DT1A 3IQWA 1X86B 3EZFA 4M1WA 3EC1A 3S1AA 3VHLB 4AKIA 4HAWA 2Z0MA 2XAUA 3B13B 1FX0A 3VR4A 4MYCA 2QAGA 3QEOA 4ARZB 4M22A 2B7BA 3JZMA 4A6PA 4ZCIA 1OE0A 1F6BA 2J7PD 1KGDA 4FXPA 4YC7A 3ADBA 1OH8A 1OHHA 2XOKA 1OFTA 221PA 2WJIA 3IBGA 4PSAA 1H8ED 1MO3A 1W4BA 3OEEA 1KK0A 1OFHA 4NCNA 4PANA 2GJ8A 4MUBA 4BPBA 2ZS7A 3Q5EA 1XJ0A 3DDCA 5CB6A 2A3RA 4CEJB 4JLPA 2DFNA 4JBWA 5F9FA 3MAAC 1IN5A 2F9LA 3P27A 4BLQA 3UWKA 5JECA 2C2HA 2D2EA 4LUCA 4MDEA 3WMEA 3U3JA 5JEDA 1VCOA 3UPUA 2V4ZA 1G1MA 4B48A 1SVSA 2CVHA 3FMPB 4RZXA 4EJSA 4LPSA 1XJCA 5EP2A 2QUZA 3DOFA 4Q4AA 4ESVA 1PUJA 1P73A 3C5HA 1YR9A 3RWMB 2QGZA 3GLIE 1P4SA 4Q1BA 4CEJA 1TF7A 4XWAA 2DHRA 4PR0A 1EX7A 5FBRB 3GJ3A 1QHYA 4TL9A 4HYYA 4Q02A 1RRGA 1AKEA 4BASA 1XTIA 5FOXA 5E7JA 3VX4A 2QTHA 2HCJB 3W3AA 3UKDA 4Q1FA 1OH5A 1ZM3A 1OPXA 1RC8A 1T0JB 3T1VA 5DI3A 3QY0A 1FFHA 2CHGA 1YZGA 1CULC 2JASA 3MGCA 3AKYA 3THWB 1TAGA 3FFBA 1RVDA 4QHSA 3UIEA 4ARZA 3R9XA 3I72A 3MG9A 2ERXA 2H7VA 3B1WA 4GRAA 4PC6A 4PPGA 1T9HA 4QBIA 1P62B 4DT1B 2P6RA 5EUMA 2WWWA 3AVXA 3B1YA 3MWKA 1E9BA 1XU4A 3DVLA 2EFCB 3FHCB 3C7KA 4HB0A 4PHHA 3CNLA 2XXAB 4OHXA 5CITA 1BO6A 1XD2B 2QG6A 2A78A 3OEED 4PQYA 4QM6A 3PUXA 2ZRGA 3Q3JB 4TMWA 1NRJB 1E98A 2JLQA 2G88A 1LY1A 1W36D 3SE0A 3LW7A 4M53A 1J8MF 1E2JA 4FI3C 1TQ2A 4IXMA 4G0NA 4OQFA 4AI6A 1KAGA 3KDSE 2PX0A 1P9NA 4OK6A 4M1YA 5B58C 1G8GA 1MRSA 4LGMA 2ONJA 1KI3A 3THWA 2A5JA 3RRMA 1VG1A 1Z0FA 4V0ME 4B2IA 2YOFA 4UXHA 4TMTA 3A58B 3MCAA 2G9NA 2PLFA 1II8B 1ZP6A 1W0JD 2ZUDA 5JCPA 3AVVA 1E9EA 4D4JA 4LZZA 1N0WA 3LX5A 2CMKA 4R71A 1E9SA 2JLXA 4TMXA 1XEXA 1WF3A 3THXA 3K53A 4E22A 4B32A 2QT0A 3OIUA 1U0LA 4WXPA 1B23P 1UKVY 1VG0B 2QRNA 4NYIR 4RZ2A 4UNQA 3NXSA 5P21A 4D6PA 3WHLA 3WYGA 2JIZD 3RLFA 3U3OA 1E2DA 2KSQA 3K9NA 2GXQA 4YMTA 1BS1A 2ATXA 4Q7JB 2RKOA 3RVBA 1LFDB 1E0AA 4PC1A 2GZHA 1GVNB 3KXKA 1AA9A 3EW9A 1XEWX 2NIPA 1KDOA 3Q5DA 1WA5A 3WP1B 2GHIA 4W5WA 3BB1A 4CT5A 2IYYA 4ZV4A 4QL3A 1FP7A 1ZNZA 3KJHA 5AJWA 3U3MA 2EW1A 1KI6A 3CF0A 3IUYA 4AG6A 2O8DB 2PCLA 2QPOA 4Q7KA 1DTSA 2VSFA 1W44A 3I4LA 2QROA 3OFND 2W6JA 5HE8A 3RNLA 2ZJ2A 2JLRA 4AKEA 1BMFA 2O8EB 1KY3A 3MLEA 3P26A 2XB2A 3T06B 1QHGA 4JKIA 4M1KA 1NKSA 1R5OA 3TIFA 4JLNA 2WJGA 3FTQA 2PMDA 5DE3A 3TE6A 1QRAA 5LDDC 2ZUBA 2VHJA 1ZUNB 3WHKA 2GILA 2AFIE 3TUJC 5FTLA 1HY3A 4URYR 3L43A 3EPLA 4TTPA 5AJYA 3I32A 3RSOA 1AQUA 1S3GA 2OCAA 5L3SB 4LYFA 4NMMA 3AF0A 4MRVA 2F7SA 1QVAA 4MRRA 2OV2A 1QVRA 1VHLA 1T91A 1ZM9A 3CUEF 3R8FA 2PCJA 1X3SA 2IF0A 4MGYR 1GL7A 2GJKA 3B1XA 4O2LA 2R6CA 2NO9A 3U6BA 1DG1G 1ZD8A 1GAJA 4PSVA 1YZUA 4Q66C 3CWQA 1W4AA 2J7PA 5FUYA 4HAVA 3PIRA 121PA 2QGNA 1AS3A 1QHXA 1T5IA 1AJEA 1HURA 1KNXA 5CJ2A 4Q9JA 5DYGA 3GLIA 4M1MA 5FFMA 3ZVRA 1AN0A 4OKSA 1E4YA 3SFZA 3HYTA 1NVUQ 4AIIA 3GP8A 4CGZA 3QF4A 1I4DD 1P2SA 1OYWA 1E6CA 3MSXA 4LY6A 3A6PC 2AD5A 2GEVA 2ZETA 3EZ9A 4BFYA 2IS1A 3Q7PA 3O8RA 1EWRA 2QENA 4QHYA 4AWXA 3UWOA 1GG2A 2VF8A 1S96A 1ANKA 4JLKA 2V6JA 3D3QA 4B73A 4FWTA 2G0NA 2GEUA 3EZ6A 5FPYA 3H84A 4M9ZA 1E96A 2LKDA 1TQDA 2GXSA 3EZ7A 4PHFA 3PUVA 1KO4A 1D6JA 4A2WA 3VR2A 3KQHA 4DWJA 3K9HA 5A4JA 1U98A 1TUEA 4CT4B 2PT7A 2PEYA 5DI3B 4JL5A 2WWFA 3EPHA 1L4UA 1SVLA 2LCFA 2BBSA 3U60B 3LQRA 3CZQA 1NN1A 3LBIA 2A5GA 1P2VA 2JEOA 4DB4A 3QUSA 3QJYA 4GZMA 1CR4A 4B74A 1R7RA 3KFXA 4U02A 5D3MB 3X1DA 4DSOA 1PLLA 2QQEA 2F6RA 3TR0A 4UJ3A 4DVGA 2XITA 1QG2A 1H8HA 4RKEA 3O47A 2HT6A 4DLTA 1M2OB 2ZE8A 3J81k 3GJ8A 4A8JA 4D4LA 1VYUA 4GP7A 4PC3A 1ELOA 2VP0A 4PQFA 5EZ6B 2VHQA 4D4KA 1RW4A 4ABYA 3T15A 3R9WA 1WBBA 4LPKA 3VHXA 4ITRC 2FX3A 5EUQB 4W5JA 3HJNA 2IYVA 1GP2A 1JPNA 4HAUA 1UPTA 2VSOA 2WSSA 5JRZA 4NYMR 4WBSA 1TF5A 1Q1ZA 5CB8A 1N0VC 3C41J 3KL4A 4QOSA 4L15A 2BBTA 4WZ6A 1K5GA 4IEEA 5FR1A 2REOA 1EGAA 3SZRA 1A2KC 3MMPA 4XTCS 4IKEA 3UMRA 2J0SA 5JJLA 3DEFA 1RJ9A 3DKPA 2P6UA 1N25A 4XD7A 1BYIA 1UF9A 3LQQA 3FMFA 3DMNA 4D4MA 1EG7A 4HDOB 4P4UA 2NPIA 1T0HB 3WBJA 4FIDA 4MYUA 1FZQA 4A8JB 2B21A 4FMBB 2CJWA 3LDAA 4DSUA 2CL0X 5G3ZA 5EXSA 2AL7A 2RGDA 3QPVA 2ZS8A 1E2IA 3WMFA 4LHYA 2VLIA 4RVCA 3B1VA 5TXGA 4PZLA 3RWOA 1DG3A 5CLLA 4HUQA 3K1JA 4Q1CA 4DDWA 1H65A 5KSPA 1ZU5A 3OFNA 4AK9A 1XPUA 3KUCA 4BRWA 1NN5A 5DN6D 4KFSA 4ASUA 2J0VA 2REBA 5HZKA 4FMDF 2D62A 2ZRKA 2YINC 4HB2A 4I1VA 5AJVB 4DXAA 1WP9A 3N2IA 4WZAE 4IRUB 3OE7A 3NBZC 4M2LA 3K70B 4GMDA 1FQJA 1XEWY 4WZBE 3UK6A 4B2LA 5BW8A 3ICEA 2GA8A 2PT5A 3MWYW 4QBFA 2XGJA 1Z6GA 3CIOA 3LBNA 2QQ0A 4G5RA 3ZGXA 1W7AA 4B33A 1NSFA 1NY5A 1SGWA 1Z0KA 4CYMA 2BBWA 3THXB 4DDTA 2QI9C 1G17A 3UATA 4D82A 2BMJA 2X77A 2NO0A 1E4VA 1S1MA 1F2TA 1MKYA 1X8LA 3EASA 4LYAA 4R2HA 1T8TA 3TW8B 4A0HA 3GLGE 1NG1A 4PZZA 2OE2A 2IX3A 4NCHA 1XTJA 1DAHA 1F2UA 1NVWQ 4MKFA 2VP6A 2QP3A 3TVDA 4CEHB 2WAYA 5F9HA 3QEJA 1H8EA 4M1SA 3NC0C 2P65A 4G3XA 3T1TA 2ZRBA 2Z6VA 3IEUA 4Q48A 3I5YA 3D7MA 1G4UR 3L0IB 1OSNA 5DYIA 1DBSA 5IRCD 2CL6X 2ZI9A 4RCZA 2WMNB 5A5GA 2ZI7A 5J4VA 1QHSA 1TU3A 3PVSA 1YJ5A 1EXMA 3CF2A 4E5UA 2DYKA 2XTMA 1Q20A 3MWLA 4YLGA 1ZINA 5SZKB 3VU9A 5JSZB 4QRHA 2G77B 1F5NA 4NDZA 1E79D 3Q85A 4KLNA 4QGAA 2BCJQ 1Z0DA 3W6OA 2FF7A 2Q9CA 4BFXA 1DO2A 3LLUA 5TARA 2WJHA 3R7WA 2H17A 3AB3A 1VG8A 4JZKA 2RHMA 2XEXA 1HTWA 3OAAA 5C2JB 2BMFA 2GEDA 5ELXA 4BZXA 2J9RA 3K0SA 2JATA 2CCGA 1HV8A 2HF8A 2MSDB 2WKQA 2ZQ5A 4IOLA 3BRWD 1QZXA 2FFBA 4UKDA 1GL9B 4EJSC 3G5UA 3TUIC 5DO9A 3QENA 4A82A 2ZSBA 3DZDA 2O8CB 2Z83A 3F8TA 1R5BA 4NONA 3L0SA 4BWYA 4EFMA 3AF4A 1ESMA 3BWDD 3QXXA 2FA9A 4LDJA 3CX8A 4UNRA 1SVMA 4TLBA 1PLKA 3BE4A 3RAPR 2OILA 4Q4JA 4X8MA 1TUIA 4M1OA 1T4GA 3KJGA 4I1UA 1JALA 4BEBA 1KDPA 4LJ8A 2YOGA 3DM5A 1OF1A 2O5VA 2QU8A 2ZJYA 1A1VA 2CXXA 3M6AA 3W6PA 2IT1A 2HCBA 1E9AA 3IEVA 1CJVC 3SJCA 3L8ZA 2WWIA 2X1VA 1YZQA 1AK2A 1P2UA 2FN4A 3HWSA 2ZRDA 3ZZ0A 4C0HA 1ZC4A 2GK7A 4L16A 3ZYCA 2GKSA 2IWHA 4ZCLA 4JS0A 4Q9HA 2BIFA 1JQLB 4LSGA 2FZLA 2QMEA 3KKOA 1E1QA 1SVOA 1SXJD 2ORIA 2IK8A 4II7A 3SJAA 4DUGA 1JEDA 2JLSA 1FQKA 1JAIA 2FDCA 2GBLC 2V7QD 3CONA 2P5TB 4PQRA 4CDGA 4LV8B 3BS4A 2IXFA 1EWQA 5SZIA 3CM0A 1W0KD 2PJZA 2ZRIA 1II8A 1UKYA 4D0LB 2IS2A 1CLUA 1W5SA 4OI4A 4YQFA 4OQXA 4DZZA 3SN6A 4WOPA 3DZ8A 1Z6TA 2FSGA 3PCRB 1KJZA 4JMPA 1AM4D 1MH1A 4MKIA 1E32A 4FCTA 4FMCB 5H68A 2MSEB 4NPHA 3OESA 3U5ZB 4TZ0A 1KKMA 3AF2A 4IDOA 1NMXA 2OCPA 1DAIA 3CR8A 4MRNA 4KO8A 1IJFA 1XBTA 4PAOA 4P4TA 1DVRA 2ZRFA 2ZRLA 4OK3A 4C0SA 4UXIA 1D5CA 5EXXA 2O8FA 1XTSA 2WAXA 3CPJB 1G16A 3P4YA 4XJXA 4ZDWA 3FDIA 1DAMA 1S8FA 3H4MA 2DPXA 5JI3E 4JLDA 5FI1B 3BFVA 3IGFA 3JZAA 4DIDA 3AP1A 1XWIA 1ZJ6A 1Z5ZA 4UQOA 3FHTA 5KTYA 2ASEA 4B34A 1KI8A 1MV5A 3M4YA 1LF5A 2EFDB 2QRZA 1US8B 3QI2A 1YZTA 2Q0HA 5KDOA 1WCV1 1LNZA 4HLQB 3WYAA 1E2HA 4JLJA 3FPAA 2ZSEA 1NIJA 3EIQA 5DH9A 2VF7A 3NEYA 2QPTA 2ZPTX 3E1SA 4XVRA 4IOJA 3SJZA 1OW3B 4YXWA 2EWWA 1D9XA 2CE2X 3NHBA 3K70C 1HE1C 4BLRA 5BN5A 4EQ6B 1W0KA 1QHHB 3C8UA 4JLVA 4LJ4A 2DBYA 2GWHA 4F7WA 5G40A 1DELA 3U7GA 1ZCBA 3BORA 3EIHA 1CEEA 3ZS9A 1N6HA 3BK7A 5FOTA 3W5IA 4DUGD 2GNOA 2WTUA 3TBKA 5BWMA 1FMLA 2QTVB 2F1JA 3CW2A 4A92A 3AVTA 3K8YA 1KJYA 4G5OA 4H1VA 3AVUA 5FL3A 1KKLA 4AD8A 3KQNA 3PENA 1VCNA 2YOHA 3BIFA 2H1LA 1G7CA 1OB2A 1XCMA 3CPEA 1R0XA 1G3QA 4JBXA 4V0OA 4PX9A 3FYHA 3SYNA 1FNNA 3QKSB 4Z1MA 3AGPA 4H1UA 2O0JA 4MA4A 4Z8XA 3OZXA 2XZOA 1BMFD 4JVLA 2GCPA 1SXJE 1RRFA 3PG5A 2W6JD 2O8BA 4IDQA 1DE0A 4FWIB 1FTSA 1FNMA 3SHFA 4CIDA 3N2EA 3P20A 4QNRA 3E70C 1ZVQA 5CYOA 1K6MA 2HV8A 2XJ9A 3AUXA 4HAYA 4GI7A 1WE2A 1KO8A 2TMKA 3RRYA 3WYFA 1N0UA 2C98A 2MMGA 2NO1A 1G4AE 2WBLC 1JB1A 2GAOA 3QXJA 3AF1A 4CF7A 1UJ2A 1HEIA 4Y0AA 4UJ5A 1K5DA 5TB5A 4DIEA 2AKAB 5BXQC 3GLHA 3T1OA 2FZ4A 4KAXA 1D2EA 1VG9B 3OAAD 1VTKA 2OCBA 3CWZA 1KNQA 4RD6A 1S9DA 3SC3A 3B60A 4GZLA 3SQXA 5AUPB 3TRFA 4P31A 5TVKA 4DC9A 2ZEJA 1E79A 3ONWA 3Q8XB 1ZM2A 2ATVA 3AKDA 5J4KA 1XTKA 1CP2A 1JI0A 1RKBA 1T5LA 1GRQA 2NG1A 3K9LA 2ZITA 3AP2A 4G01B 2F1HA 2RGBA 3QVVA 4V02A 1OH7A 2PZGA 1NL3A 2O8BB 4F92B 2OXCA 5F3WB 1C4OA 1KO7A 2HYDA 1ODFA 2LWIA 4F93B 2BEJA 1ZBDA 1T3LA 1FUKA 4B3DA 4HAXA 5KDLA 1II9A 1XFAA 1NMYA 4HZUA 5H1YA 3QF7A 4CEIB 3CZPA 5AUQA 1U0HC 2FOLA 3K0FA 4Q4HB 1KI2A 2F43B 5JZVA 1G5PA 3GPLA 2BMEA 2ZANA 4HLUA 5GJVC 3MUFA 4OQLA 5FH9A 4A15A 4KSBA 3SR0A 3RDPA 4BFZA 2QMHA 2ZJOA 2WIBA 4IOKA 1NBME 4Q9KA 2ZRPA 2ZYUX 2VYFA 1Z63A 2YC4C 2NTYC 4I1SA 2O0KA 5HCNA 1R8SA 1HT2E 5ANRB 2FE4A 1S2MA 2ONKA 3U7EB 1E9DA 4E07A 2V7QA 4LJYA 4NHOA 4P4SA 4JJKA 5FTKA 5A0FA 3NKVA 4DLXA 4NYMQ 2RHDA 1QHHA 4DLYA 2OBMA 5JI2E 4A4DA 4PAMA 2YVUA 1MRNA 1KTVA 3OE7D 1Q0UA 4L9WA 3B82A 3N70A 2V54A 1CRPA 1JPJA 2ZJAA 4LJ7A 1E1RD 1SKYE 3W8NA 4LC0A 1KO5A 5KOYA 1TMKA 1KHTA 1IXRC 4B71A 1US8A 2OT3B 3A4LA 4M4SA 4RFSA 1VPLA 3W6NA 4AYWA 3KTAB 5C18A 4TMZA 3L2OB 4AKGA 4ZDKA 1XEFA 5M04A 2C96A 1A82A 3A1UA 1HYQA 4EPWA 1AGRA 4OHWA 5FUWA 4NCIA 3LNCA 3MFYA 1CKEA 3PEWA 1YR8A 4PHGA 4W5HA 2DCUA 1UKEA 1OH6A 3BOSA 5LB4A 4I81A 1N5IA 3AV0B 4BEJA 4QHTA 1MOZA 5CK5A 1SXJC 1P3JA 1X1RA 1E94E 3D6TB 3HDTA 4E09A 5FUXA 1EX6A 3WRYC 5GJWC 2QTFA 2W0MA 2FPMA 3EWSA 1BIFA 4B43A 4AY2A 1C9KA 1XXHB 1JXOA 2KBEA 4Q00A 3AF3A 3BXZA 2R65A 2CJWB 3MJRA 1RYHA 3QG5A 3OF5A 2FH5B 3T5GA 2QP4A 3F5FA 5JJIA 1QDEA 4JBYA 1W2GA 4HLDA 4JVSB 4H9GA 5HPYB 1NBMD 2IYTA 2CCKA 1SVWA 1BH2A 2C99A 2XNSA 2OBNA 2VBCA 4LYHA 4GT1A 1X1SA 1V5WA 4TWZA 1Q57A 2XSZA 5JEEA 3NBYC 1G3RA 3NBFA 4LHXA 4Q47A 4RD3A 3KQLA 4MKHA 2VHUA 1YZNA 3SYLA 2QAJA 1G7TA 2QT1A 3V4FA 3QNUA 2A9KA 1XX6A 3RANA 5JS8A 2GDJA 4TYPA 2GAAA 4J0QA 1WRBA 2GJAA 4K8OA 5FUVA 2JLVA 1N6PA 3A8TA 3TH5A 4TQ9A 5KSZA
chains in the Genus database with same CATH superfamily
1DO0A 1WULS 3BZUA 4Q3NA 1SCUB 2WJ6A 5JBIA 3NYRA 3M1AA 4G0ZA 3AEKB 3RSLA 3ND9A 2HJVA 1AHIA 4Q9IA 5DM0A 1UDRA 1FUUA 1PQWA 2Q0XA 1HQDA 3JASA 3FLBA 3Q6IA 4I14A 4D3DA 4BLTA 3STUA 3HJCA 4TXMA 2IV3A 1CUGA 2ERYA 3KVVA 4YCMA 1V1RA 1PVVA 3DHNA 2BFAA 2C7PA 4WCFC 3FSGA 4D0NA 4D8YA 5JSHA 3H3JA 4X7RA 1YQUA 3RRFA 1EVYA 1WKCA 5KKCA 3TDMA 4LF8B 2ID8A 2XUIA 3OOWA 4RFVA 2XDAA 1F2DA 1HGXA 3RS4A 2XB9A 4Y2JA 3OT1A 4Y2YA 4TV8B 4JNKA 5I51A 3T1YB 2EP7A 1DTEA 4LOHA 2GTPA 3GX1A 2PUJA 4Q18A 4IMRA 4BUZA 3FFWA 1IY2A 3IB6A 2ZYVX 4GPAA 2IHVA 1RAAA 1SCNE 1JDPA 2CY0A 4HEA1 2J4FA 2GN1A 4ZU3A 2YFQA 3IAAA 1AT1A 1W25A 2XIQA 3KZMA 4QPDA 4R9UC 4O0MA 4PLVA 2C61A 4D5EA 3RYFB 1HQKA 4QUEA 3DE6X 1DOAA 5I3ZA 1QC5B 2ZULA 3OQIB 1OREA 4EF5A 5AKJA 3SBXA 4YJ3B 1MJGA 3UQZA 3KFLA 5DBOA 3ZLVA 1G8AA 5L7YA 1P0CA 2XUOA 4OHBA 1KMQA 2GFQA 3QEMB 3U7HB 2VAWA 4MICA 3SBEA 3Q2IA 1KYVA 1NLYA 4RAOA 3V6LA 1PL6A 3LFUA 1JG3A 1II0A 1KK1A 3QYFA 1V3UA 1ZO8A 2GO7A 2NPOA 1R8QA 4MROA 1AZSC 4AO6A 2EQAA 3HA2A 1T34A 4CEIA 3H5VA 3ORFA 1KMNA 4PFQA 4WA7A 3RO7A 3TCNA 2I4IA 1L7RA 4EVSA 5K8UA 2VDNB 4KR3A 4BVHA 2WD9A 2DFKB 2IEZA 1DZIA 1LU9A 1USWA 4RE5A 5LP6C 3HB4X 3LWBA 5B4VA 1OKKD 5LOVB 1XGKA 4R3NA 3CO5A 4TYWA 1QAOA 1L4LA 1T25A 2DUJA 3HY4A 2W0SA 4TUYF 5F64A 4C4OA 4AN0A 1JG2A 2BV3A 1PJCA 4X97A 1W4RA 4G67A 4P7KA 2NT4A 4KQWA 3PQ4A 4BU0A 3AY7A 5LYJF 1ZMRA 1LDEA 1DKQA 1PQUA 4CEHA 1BE8A 1F2UB 2QHXA 1W73A 4G85A 3P5SA 1MAWA 3H2IA 1BA2A 1K8QA 2B1QA 4UM5A 1K0FA 1ST3A 2A4MA 2ZWAA 3LCVB 1BEUB 4EI9A 3R23A 2YMLA 4JP8A 4Z3DA 4QLAA 1UH5A 1V3TA 1U9IA 1VIYA 2G07A 2R2AA 3C8DA 4G5FA 1IH8A 2F43A 3QRWA 5H82A 5AI4A 4BUJA 5I9LA 4OHYA 4YGYA 3VPXA 3B6MA 5CPBA 1IBMB 2BZ1A 3O31A 2OV6A 1TL7C 1ULUA 5BUZA 1DKUA 5D3ZA 2QORA 3CG0A 1YIOA 1YRAA 3DLAA 3KFVA 1SMKA 1XA3A 2WLSA 1COWA 2ZJZA 4U7HA 5HG0A 1K27A 1EFCA 2YZKA 3B6EA 4AUKA 4NKRA 5AH0A 4UPVA 1YS6A 1JYFA 4Z9BA 4L6IA 3VHRA 2FFAA 1QE0A 3OLVA 4IUBS 3ZN2A 3BWEA 4G1BA 4QRIA 5GGXA 2YV4A 1EJ2A 4JGBA 1PS0A 2G3YA 2WMOB 4MV3A 5GY7A 4HNRA 3CW8X 4IDPA 1VL2A 3IQEA 4EJ0A 2DKFA 1FOEB 4EQZA 2GT1A 4DSTA 1OFUA 5C7IO 3SC2B 5DM70 1L4NA 6GPBA 4N1AA 3NO4A 1TQHA 2OG2A 2P91A 1D2NA 1Y6ZA 4MLCA 4XQEA 1VMKA 2NO5A 3QKSA 1FTGA 1NV8A 3HI4A 3LDUA 1Z0ZA 3PDHA 4NV0A 4S2EA 1KP9A 3U19A 3ADCA 3VNUA 3WGKA 1P80A 4GQBA 1N5LA 4XQCA 4L6CA 2NO6A 3U4QA 5J2TB 4EUEA 2C04A 4XFKA 1NX9A 2VIIA 4FQ5A 4CETA 5K45A 1VFPA 5LXTF 3SS7X 1JI3A 4I36A 2WWYA 1WMDA 1T2UA 1UBOS 3VSAA 2B8WA 2B94A 3RUDA 3E82A 3JQAA 2IYZA 2O3UA 3D5EA 1ZK0A 1PGPA 4JEMA 1YS9A 5TMDA 5ALFA 2QBYB 4A0RA 5B1HA 1VMAA 1W36C 1O94D 1FP4A 1GG5A 1L1RA 1YV9A 2IBMA 2M32A 3BRCA 3IPLA 3M83A 3QLJA 3R41A 4IX1A 3SXUB 4JQZA 3L8YA 4D9BA 1DIBA 2L0XA 3DAHA 3QELA 1SEPA 2P79A 4L3WA 3W04A 1WKVA 4F4IA 1L7BA 2HCFA 4G89A 2AX4A 4MEBA 3ZPXA 4UAUA 3OEHA 3AOGA 2BFCB 5HDBB 4L5YA 1LK7A 1AUVA 2Q5OA 4MQMA 4XOUA 2IWRA 3I61A 4UTRA 1KVTA 4QPJC 2AVNA 2VP5A 2ABWA 1WIWA 4XGRA 4LRTB 3HK2A 5ICEA 4XRRA 3KJZA 1AY0A 3PR3A 4UBJA 5GVSA 5EEGA 1VIAA 3OX4A 4P86A 1XPOA 3G2QA 1EM6A 3G7UA 3LYAA 4G0VA 3FAKA 4C3VA 3VDRA 3O8CA 1CZOA 2E48A 3C5CA 3EA0A 3G0HA 3D0KA 3R8CA 1W8IA 2QM0A 5TV2A 2O54A 5DHPA 1UKZA 4LRWA 3K94A 1WXWA 3WJ2A 5F4ZA 2GCNA 3LOQA 3VTZA 4MKGA 1M2VA 1E3MA 1H1LB 1Z4IA 2FPLA 3GQBA 1GZUA 4DYVA 5KPJA 4UEKA 5A5VA 5J58A 1EDBA 2MHCA 3CRW1 1UUFA 3H3FA 4LGVA 4E4RA 3TLGA 4IVQA 2C4VA 5FOWA 5DCLA 2XCOA 3K72B 3MOGA 3N9IA 4X95A 2OC9A 4J1NA 1PX2A 1NQXA 3UKJA 3RUHA 2PYDA 1JDBB 2J6HA 1SXHA 4QXOA 4EM6A 3EN0A 5E7MA 3RQIA 2GM5A 2KJQA 4L2IA 3PGJA 4B3SB 5G53C 1R50A 3DVSX 4J0DA 5KYVA 1DHTA 5ALTA 3J80A 5AO9A 2HA6A 1ZK4A 2UVDA 3RIGA 5K3DA 3GJ0A 5FNVA 4DCNA 4WXYB 5J23A 3K70D 3U44A 3T9FA 3NHFA 4TVOA 4EGJA 5JAPA 1XOIA 4RTPA 3AM4A 1KDZA 4B3TB 2FGJA 4HEJA 2Q0QA 3PCXA 4ASUD 1B0UA 1BX0A 2KBFA 3D64A 1BHQ1 1NV9A 3BMOB 5EP1A 1KDYA 1YAHA 4AB1A 1J1ZA 2G4CA 1GTRA 3RGWS 4B09A 3UTDA 4FHCA 1F8XA 4LXXA 3W3ZB 2WZCA 1N4AA 2QR3A 3DNFA 3L84A 2GNAA 3WHIA 1CETA 5BWOA 3QVTA 3OIYA 4G0PA 5I48A 4U9UA 4ZVOA 3PITA 1XTRA 1CJKC 5K4AA 4NE9A 2AK2A 3HR4A 1Z4PX 2FN7A 3F6CA 4RXUA 2JFUA 5G41A 1UOEA 5TJ9A 4CCYA 3FWYA 4WLVA 4MVJA 1KFBB 4PAQA 3UMVA 4YJGB 1GQQA 2QG4A 4WEQA 1Z36A 2IYLD 5EI5A 5CB4B 1PL7A 2HSJA 3NUZA 4OXYA 4RNDB 1E2QA 1NOJA 5CIQA 5E4JA 3T9BA 2C5LA 2BSAA 2WV9A 2OCXA 3E84A 3NT5A 4ISCA 2GEBA 1DUIA 2QNRA 4MVJH 4OM8A 3V8BA 3ZIAA 4F8JA 3OF3A 2GBFA 4HL6A 2JAWA 3NHWA 3HB9A 2A8YA 1IEVA 2E7ZA 1P1RA 2FWMX 2GPYA 2IOHA 2O1EA 3H9EO 1Y9DA 1JF8A 4BNMA 4DCTA 5B30A 2PH1A 4KWEA 4XDYA 4CIAA 5BUCA 1Z34A 1RXYA 4R54A 3PYLA 4HR7A 2C1XA 2O4CA 1DT5A 1B41A 1RR6A 4X0EA 2JJ1D 2X2FA 1SPBS 3ZK8A 1WCIA 3QV2A 4R31A 3UAOA 1TMOA 3ECAA 5IT0A 3RAFC 5EP4A 3IPXA 3USES 5J5CA 2C2XA 1IM5A 2Q6TA 1W1IA 3GRUA 3ZU2A 4F5DA 3ZLJA 1PEAA 3AEQA 2X6TA 3WLRA 3OZDA 1P4AA 3LP5A 4HB4A 5DSTA 3RS8A 1ZJ5A 1SBNE 2NWQA 3PNBA 2ZRJA 1V4NA 2GF9A 1H2XA 2O2YA 4X24A 4YAOA 5AXDA 1NNEA 3CKMA 2AR7A 1UCFA 4H6VA 3D54D 3THOA 3C1OA 1V16A 1NXTA 3GFPA 3NBQA 4DSZA 2JCYA 3M0EA 5TMPA 3C5WP 2IZ6A 1GGKA 1KAHA 2GZAA 5AUOB 5JROA 4I9UA 2CLEB 5F73A 4YUWA 3ASYA 3TD6A 2O0LA 3HDJA 4LK2A 5HKKD 5LMCA 1ZITA 1KRWA 3GMDA 4J03A 1Y5LA 4AYXA 3GUVA 1YE8A 4V0KA 1XD9A 2WKRA 4U7WA 1M2NA 1L8AA 2A84A 3OJWA 3E3NA 3QVSA 3HYRA 3W9UA 2YYAA 5ENDA 4W9MC 3HCWA 1PFQA 4ZK6A 2E2WA 1OA0A 4LMBA 4U39A 1U8AA 1R74A 3HE3A 4M21A 1MEOA 3GPDG 4DGSA 1N2CB 1WB9A 2O3JA 1R1DA 2UUOA 3M6WA 4REMA 3V8PA 3ZNQA 3FZNA 1XDZA 1NBAA 3UXMA 1D8AA 4MGIR 4RV5A 4ECEA 1PR2A 3KWJA 2PFKA 1I32A 1YOVA 3IMGA 3L7YA 3NH9A 4OYLA 3L6CA 4AJKA 4BCBA 1SIUA 3OEWA 5B7PA 2WAOA 4CM7A 4RPJA 4JOBA 4AT1A 1IY8A 4YWHA 2YNMC 3EODA 2VK1A 5IG2A 1F8YA 4CKBA 2G36A 8ADHA 2DERA 5U4XA 1CUEA 2W6QA 1QU2A 3ETCA 4FLMA 4NXNB 1M1UA 2GZMA 4J9VA 2HDNB 4ZGWA 1XB2A 2OCLA 2VK2A 5FPSA 3N0WA 1UZLA 4CTNA 1XZ8A 1FFWA 2CK3D 1MT0A 3C7DB 3GCDA 2DCMA 4KKXB 4MRPA 2VOEA 4RS3A 4FOLA 2WTAA 4U3JA 1U1IA 3D5QA 4POOA 1BOFA 2XRYA 3GGPA 4J0HA 2FR0A 1G5FA 5DX1A 1QTQA 1V16B 3ABIA 4WTOA 1KOLA 1L4EA 1Y9ZA 3WA6A 1U8YA 3CGGA 4QXAA 1EFKA 1T6XA 2HPAA 4YJ3A 1WVGA 4J91A 4YWJA 3V80A 1WS6A 4JI7B 4IGAA 3NIWA 1A5BB 1M8JA 3OU2A 3RFFA 1QONA 4CQMA 2IHBA 5AESA 3NYIA 4OQNA 2DLDA 1T8PA 3I2IA 4GVLA 3QLTA 5HRUA 5FWYB 3T3PB 4US2R 1P8AA 1XTQA 3BCUA 1H2HA 1QO9A 2Q3JA 4Q9LA 5FHQA 5K8LA 2XPCA 2VVTA 2ZTSA 1GQYA 3ZZ1A 3VKHA 3CKKA 3TI7A 1A9OA 1DAPA 5BNWA 5KC9A 2QE6A 2QYOA 3D3JA 4K9OA 4KJZA 4C4XA 3QPDA 2ZZKA 4ZXPA 4TLAA 2C0QA 5LYYA 4BNTA 1ZKMA 2XTAA 3G49A 5MFPA 3KQTA 2CXPA 2IYWA 1TRHA 4AJEA 4DAOA 4FEEA 3HEAA 4MQLA 3UB3A 3D3NA 3HP4A 1E1DA 3L18A 4YRQA 3RS3A 3RTAA 4BZQA 1K6IA 2IYEA 2ZW9A 1CR1A 1Q7BA 1DPFA 1QCCA 1RI2A 3E7WA 1SD1A 3T0GA 5TS2A 2YDXA 4EFLA 4Q1DA 4CDMA 2VKQA 4IJQA 4DM4A 2FPGA 1XMSA 2KLBA 4HNAA 4BDTA 4DANA 2Q1XA 1XK6A 1KVRA 2XB4A 3LQ2A 3LG2A 4OYHA 1P8JA 2A0XA 3RS0A 4XQGA 2QZ9A 5EY5B 1F8GA 2N42A 3K96A 2AG6A 3H11B 1I3KA 1FNCA 1RYFA 3NBXX 4XVUA 1VMDA 3B5JA 3T5PA 2JG3A 4Z9FA 2EFGA 3MUEA 3KQUA 3IUQA 3A31A 2D2VA 4DTIA 1GXSB 4QBGB 2DUWA 3OI7A 3A9SA 3QUBA 1WZUA 4GZ5A 3PXCX 1GSIA 1RC1A 4LWQA 1G21E 5EINA 1H6AA 1ZN8A 1JJVA 1MTOA 1QFJA 1VB3A 3C6XA 2VPQA 3KYCB 4Z0TA 4ZEMA 3MCWA 4M9QA 4BAGA 2W2NA 4J07A 1S4MA 3SJUA 3U31A 4BOYA 2N75A 1H4VB 2O7QA 4RA6B 2QJRA 2BUAA 2X1HA 2P9HA 1SZCA 1GEEA 3KD2A 1HDIA 1ZUIA 4TMVA 4XGIA 1K5PA 3SYRA 4J94A 3UJBA 4B46A 3C7CB 4XSHA 2BEWA 1JFFB 3CRMA 2WJ3A 3JPYA 3QUAA 2HU8A 2GZRA 4IJ6A 2AF3C 1O8BA 1YDHA 3U56A 4LHEA 1J5PA 2VA8A 4WCVA 3SZGA 1XPRA 2FPRA 3AETB 4MR7A 3FCCA 1JH9A 3R76A 4JUDX 3K9WA 4EB3A 2WP0A 1USIA 1ZA2A 1E2KA 3QW2A 3BPSA 1UDBA 2DWOA 1E1QD 1UFKA 1NW6A 3VBCA 2PRSA 1MB2A 4PZYA 521PA 4LVUA 2R60A 2B8TA 1U6KA 1V35A 4CG0A 3C3AA 3NGLA 3LDFA 1T3GA 1TB4A 1GUBA 4DKXA 1TZMA 2J0QA 4KLZA 1W88B 4LE0A 1S2GA 2WVAA 4IXTA 3K09A 4NL4H 4QTXA 3N6XA 4GBJA 4L0QA 3VGPA 4YRKA 4KZKA 1H9BA 2XD4A 4D4GA 3G85A 1P6XA 3TQFA 3ZD8A 4BZPA 5BNZA 2OESA 3LT1A 1BXGA 4N3BA 3I45A 1I8TA 5LWHA 3KE9A 1GARA 3KSZO 1AMUA 4BNVA 3HR8A 1WZEA 3TQTA 1OI2A 4ENQA 1KEPA 5LYJA 3I9OA 4AP6A 1IUPA 1YHYA 1XQ6A 4HDSB 3EUFA 3MTEA 4KBYA 3RVKA 1YDWA 4FB4A 2V0GA 3NHRA 3R7NA 2OCGA 4GE0A 5D1HA 5AKGA 3VKWA 1FFDA 3WBFA 2JD0A 1VHQA 2XA1A 1H0RA 1R88A 1E3TA 1UFRA 2CLCX 5L3RA 1Z7BA 2PQ2A 1KQPA 1NTRA 3RSZA 1P29A 3AESB 3WGNA 1XJ5A 5CDYA 1FLDA 1L3IA 3UT0A 5I9BA 4L73A 1FRZA 3A3KA 4A8JC 1J2UA 4EG8A 2FUEA 3G5MA 2P2ZA 1LLFA 1OJLA 2JAXA 4TLEA 4ZQBA 5JXJA 2WFZA 2GRJA 1HWYA 1XVLA 2H92A 2HA7A 3JAWA 4FYPA 1CC1S 3TYXA 1MB3A 1ZAKA 1ISHA 3FTCA 1DQNA 2ECOA 1PKXA 3W8RA 5ICMA 2C7OA 1ZVVA 3WR5A 2EJCA 2WB4A 1JKXA 2EKDA 2G1AA 4JYCA 4XEHA 5LLSA 1PT5A 3H2ZA 4G1CA 4P32A 5THQA 1FPQA 4RA9A 4AIRA 3UUGA 3UH1A 2I4TA 4WCDA 4HB3A 4ARBA 1U2SA 1G291 2I78A 2CFOA 4C2BA 2GCGA 3R77A 4QE3A 4EFNA 1NW8A 3QLUA 5GGYA 3R3SA 2UZ4A 1CUUA 3TPCA 5KVQA 4I6GA 3O84A 4QNNA 5FR2A 2NU6A 1AU9A 2AK3A 2WWRA 4KMSA 5CA1A 5AW0A 1NNSA 4ODIA 1LBEA 5SV2A 2AJCA 3KV1A 5BSEA 3NHYA 2O2HA 1Z25A 2ACKA 1GNQA 3PHLA 3VU0A 1K98A 4OH1A 4WOKA 1C0LA 3ZOKA 4DMKA 1HYEA 4YUAA 3MJ4A 1PQPA 4S1TA 1UWLA 1XTPA 2O3TA 4GPTA 4ANFA 2YJTD 2A14A 3B2EA 4DL9A 5AYVA 1BDBA 3M81A 4BS9A 2PKQO 4GRIA 4R2JA 2V7UA 2CUZA 5FTWA 1NYRA 1Z0SA 3IV7A 1LEHA 2WU1A 4HWRA 5IABA 2HLDA 4QOGA 4XSGA 1JTVA 5F51A 1E2LA 3DXFA 2D8AA 1W5BA 1O96A 2DQZA 1XMIA 2DQYA 1QE3A 3C4JA 2C00A 2Q4RA 4XR4A 2I87A 3ZWXA 4ZVTA 3FUUA 3LWNA 5KNBD 2ZE7A 4EA7A 3IBYA 4BFWA 1KWKA 3UJAA 1SCDA 3DUWA 4G5GA 2UDPA 2JFQA 4GWGA 4CMEC 3E1KA 3O8NA 1IZ0A 4YUYA 2DUNA 4XUDA 5KNBA 3SOZA 3I62A 3DYIA 3OFJA 4Z8YA 3ZHZA 3GYBA 4G9GA 4QUAA 3ZVNA 2J85A 5K1ZA 2CUNA 2PO7A 4B4WA 3T7SA 1N2EA 2R4TA 5TDHA 4QDUA 2UAGA 4BX3A 4IDDA 1BDJA 3ES9A 1K3TA 3C43A 3PP8A 1NW7A 5UKDA 5B64A 3TZEA 1P1JA 4C03A 1Y4AE 4ZI2A 3TQIA 3IBFA 3WWPA 1X39A 5C5CA 1P5JA 4BNDA 1B6GA 3S2ZA 5AVTA 3QX9A 4J2HA 4AX4A 4EABA 1Z8FA 2A5LA 3ABQB 5G1NA 1O97D 2A4KA 4WRRA 2FW7A 2F64A 2ZI4A 1R0KA 3GA0A 3QFHA 4K6HA 5SY4A 2XWQA 3UHAA 2D5BA 2F3RA 4LOJA 3CNOA 5HJEA 3T5DA 3F0TA 1C5KA 1NOIA 1U9CA 3ZEIA 2IY8A 4MW1A 3T5TA 1N2BA 5I4BA 3RYFA 5H81A 4C4PA 2VLBA 4G81A 1YNSA 1BGWA 3KCNA 1E4EB 1R8YA 3L6DA 5LU9A 2WFLB 4GL2A 1W75A 2FUKA 1U99A 5DHQA 1DBVO 1HDCA 3CR7A 2SCUA 3I1JA 1U6IA 4NEGA 1Y3IA 1FTNA 3AESA 2P8SA 4WJZA 1C8LA 4M8KA 5BNFA 5AT1A 3WWEA 4AZWA 4AMYA 3GUZA 4EDHA 2B69A 3LO8A 4F6RA 5IK2A 3ICCA 1ZIDA 2XLCA 4NBVA 1S4QA 2P9ZA 3OSZA 3OQPA 5CXSA 3F71A 1W0CA 4ZQGA 3GB9A 1BCRA 5K51A 3TR5A 2GJSA 2X9LA 3VR1A 3GLVA 4HWPA 4TTAA 4ZCPA 2FW9A 3M8KA 2VBIA 1SZJG 1UPAA 4Y2VA 1Z07A 3UJ9A 5LYJB 2YL2A 4PYQA 4AFNA 4EOGA 2QXYA 3I2GA 3N86A 3U48A 1DPGA 1M54A 5EJEA 5JS7A 5K09A 1RWQA 2OLKA 2LIPA 1B16A 1LPMA 4LJ9A 3FRIA 3JWGA 4PYKA 2NM0A 3PNOA 3HN6A 1DAKA 4MLZA 1VECA 1QDUA 1SULA 3LUPA 3QE0A 3V3TA 3N8IA 2A30A 2CNWD 1UXHA 1IXZA 3EMKA 1VFNA 3IUSA 5HIJA 4XW2A 3UV6A 2WLTA 3TSOA 5KTTA 2AVDA 2PY6A 3BMCA 3EXEB 4FFBB 1JR3A 1Y0BA 1SVUA 2W2QA 4M0PA 1GUYA 2E89A 1VE1A 3AIMA 1L7OA 1QH1A 1KE2A 3RCBA 3I5XA 5HKBA 2YUIA 5JTTA 1JHPA 2A5DA 3OOHA 4R83A 4QKQA 1E9VA 3PB3A 3I0NA 3TUZC 2X8BA 2OUIA 3D8BA 3V3KA 2QOEA 3WB9A 1HT1E 3QEKA 1P1HA 3H18A 5DTJA 2PD3A 4KYIB 4YROA 4BEVA 4R5HA 1SUEA 4DRXB 2PMWB 4YCBA 3LPDA 5TC4A 2XGOA 2RE8A 2YV5A 5KVSA 1R18A 2CFSA 4B83A 2A5YB 3OEYA 1ODCA 1DDOA 1P7CA 3NH6A 3PEUA 1XZLA 5G02A 1Q1QA 3KETA 4DEXA 5CM2Z 1C3OB 2MT9A 1EFRA 1J9GA 3C4VA 5FBHA 1FRFS 3SKXA 3UOGA 1EEXB 5GVRA 2C59A 3EAFA 1KMIY 2OQRA 4JLSA 1THMA 2QX9A 1ZGGA 3ZDXB 2BMAA 4X7PA 3V2GA 2V9PA 3KYCA 1GCOA 4LWZA 4WNAA 1VKRA 4ZOBA 2V6BA 5ERXA 4U6SA 3AKEA 1M8PA 3JD4A 4MQ4A 5I7UA 4AZ0A 4INAA 2VHTA 4OEHA 5DV9A 3VVBA 1GXSA 2Z2ZA 5AW2A 2JA1A 3LBFA 3RUEA 2R6FA 2HQ1A 1NVMB 2RB4A 4EUNA 3KOUA 2YWEA 1S7CA 4DLVA 1NNUA 2YV1A 4TWAA 4DA7A 1EVKA 3C15C 5FWXB 2VUSA 5JUWA 1JT2A 1WUHS 2IDZA 3A1TA 4MS4A 5AIAA 4QQKA 3WOHA 3Q7SA 4TL8A 5C1BA 4BV3A 4Z5XA 1GGEA 3B7WA 1IZ9A 1X9GA 4KHZA 4W8GA 1P9LA 4RF2A 5ALPA 3H1TA 4KQFA 4Q21A 3MGGA 4UBMA 1J25A 1CLEA 3D7SA 2CB0A 2B2NA 3I3SR 3K0CA 3L6EA 3NNNA 4LXQA 4UVEA 4ZZ3A 3SVTA 4NG5A 3CNHA 4MV5A 2ISQA 1X2EA 1S9HA 3F98A 4D3FA 5HKKA 4NBUA 4U2FA 4C88A 1X3LA 1XDSA 4JR0A 2QV0A 1D7OA 6REQA 4KDRA 1VP9A 1LCIA 1PEKE 3D2BA 4UPDA 4HDKB 1SC3A 5BSTA 1E92A 5C5DA 5B6PA 2IV2X 5HZHA 2GBPA 2R7AA 3HO6A 4FSXA 3DEIA 1WR8A 1Z28A 3SFTA 1X1EA 2QVYX 3O94A 5EWMA 3D8HA 4L0DA 2X4GA 3OO1A 3GEHA 1V7CA 2HWWA 1ZHHA 1LA2A 4MIOA 1XQYA 5DWVA 1N5JA 4BKQA 5TQVA 4F4UA 4FVTA 4UNPA 3OCCA 5I3CA 1VE9A 1SN7A 3Q9UA 2B34A 4XYGA 4ZYUA 2C95A 1RZ3A 3O2JA 2XMPA 1EUCB 4EHBA 4AZ3B 1E2EA 4XB2A 3U3XA 4X65B 2O5CA 3E9ZA 2HH9A 1FQOA 5CFQA 1WEHA 3UEOA 2YICA 1O95A 3HBNA 4B4DA 2QMUA 4XB6B 4ND8B 4PGAA 4QU0A 1BE6A 4ZO9A 3GJXC 1F8UA 5FBQB 2Z09A 1CP3A 3R7DA 4YJHB 3W5UA 3DJYA 3A4IA 5K3FB 4R2MA 2BHRA 5EE1A 3C3BA 4HXEB 1RXSA 1ZK2A 2UYYA 2GCIA 2WYVA 2B98A 3TGPA 1V5FA 3C98A 2MJLA 5B55A 4ZEWA 5T7BA 5D3QA 1CIVA 4PQEA 4E13A 4IV5A 2V5VA 2FVYA 4NCKA 4DV3B 2AC2A 2Q1SA 2XRFA 4WKCA 5DZSA 4B75A 5C4GB 2CV2A 3PVZA 5REQB 1IYZA 1CUFA 2OGWA 1SQ5A 3K7EA 3SYTA 3EHEA 3DONA 5JH7A 4RSHA 4Y6RA 4R8MA 4IIXA 4F91B 3KYDB 3OJLA 3V48A 3AVQA 4YMWA 3EDCA 1G0OA 4F5ZA 5BRAA 4KO4S 3R7SA 1WPQA 3ELDA 3N2NA 2R1VB 4C43A 1K92A 2G1JA 3ZKWA 2C78A 4EBFA 4AY4A 3F4KA 3PUYA 4A1FA 3DMDA 3D1VA 3U80A 3JVIA 4OJQA 4C4ZA 4WMLA 1K6JA 1S2DA 4A2PA 2YQ5A 2B36A 1T2EA 4G1FA 5FX2A 2IEIA 5JYBA 4HZIA 3CLSC 2JLCA 3LC1O 1HRKA 3GA5A 1FFCA 3HU1A 1XTTA 1NF9A 2LZ0A 3DFIA 4G37A 5B7GA 1R64A 1E3SA 1W0JA 1Y5NA 2UZ1A 1TDJA 3DZFA 3G2KA 3IE0A 4P08A 4L8LA 1AGXA 3DCNA 4Q3BA 3HJTA 3RTBA 4DDKA 2LTAA 1S3SA 1U5AA 2ORWA 2ZIFA 2B7CA 3DR5A 1YMUA 3DW3X 2RGCA 4QJ5A 5TX7A 1E9FA 1EVLA 3GCGA 3OE5A 4FHEA 1AMNA 2C97A 4TZ6A 2W6MA 4M9XA 1X0XA 1HZZA 2D0PB 1F4LA 4J29A 3SVZA 3HJRA 3HZOA 4MOWA 2GA9A 5PNTA 3FSGD 1KDRA 2YJ3A 3EVFA 4HDMB 3BK2A 2CYCA 3JVEA 1MXFA 2JGIA 2XUKA 4INOA 2ZJ1A 2AR9A 4XH9B 3W2FA 1BOOA 4S35A 5FLYA 1KSJA 3A1NA 4XWOA 1T3HA 3KVRA 2WE7A 4ER0A 1FNDA 2E4UA 2AT1A 2RIPA 2X40A 5ILOA 1B4DA 1NF3A 1G19A 1TIKA 3F2VA 4MUAA 2Z2XA 1B42A 1LLQA 1WCIB 1XZHA 2M6SA 3O1JC 3BN3A 3M49A 2GPWA 3A6FA 1G6OA 4TXLA 2L69A 3RQSA 3QOFA 1SWWA 1W35A 4B2YA 4IUDS 3AO0B 4AYTA 4F4JA 1KYXA 1WL8A 3DV0B 1VI6A 1UC5B 4J4HA 4ZT7A 2RHLA 4E70A 2A58A 2IP1A 4L78A 4IIVA 4GM1A 2F1IA 3BD9A 4TX1A 1FP6A 3SEAA 4EUSA 1E2PA 2G5GX 3IHWA 3LYHA 1W48A 2GX6A 4M37A 4WZZA 5HOQA 2D4HA 3BWYA 2QKYA 3A3OA 1YCFA 2VJMB 3G0BA 1NMEA 1NRWA 2HCTA 2QRUA 2XNCA 3NIGB 3P9NA 5CFLA 1NBMA 3TLCA 4L5BA 1QYDA 3OEHD 4LRUA 4Y2UA 1ZD9A 4UDYX 1L6IA 2H4XA 1WF6A 1ZC3A 4ZODA 3CLUD 4KWCA 1GILA 1XIVA 2XBUA 1RJ9B 2UUBB 2C54A 3RSFA 5IJ9A 4YONB 4KKVA 3RC1A 1OXTA 3FNHA 2DWPA 5T67A 3ZBPA 4C76A 2DLNA 3RUFA 5BWNA 1EVJA 4UTNA 5JNVA 2I4OA 2RAPA 1F17A 1V9CA 3H2JA 4R40A 3ZE0B 5BW5A 5IW8A 4K05A 4NJOA 5EJAA 4C4SA 3NW9A 1COZA 4G8CA 3CX7A 3BHIA 3EVTA 3G89A 2A88A 1XRRA 2YS7A 4N47A 1A27A 3BMOA 2OZEA 1G9XA 5FTJA 3ZV5A 4FEGA 4WXEA 1ZYUA 1NUPA 4DLAA 1GPNA 2P9JA 2W6ID 4I4TA 3C14C 5E95A 5JO0A 4UUNA 1XMJA 1BXKA 5CVTA 1YIDA 5G1PA 1YZ3A 1V43A 2CVQA 4R69A 4CLRB 1VLLA 1ZH0A 2VRWA 4CG3A 5HGXA 2IS4A 4GPZA 1L9XA 3DTTA 4L8FA 6LDHA 1KVUA 4ZO8A 2BGGA 4XYBA 2IZ1A 1TECE 1KH2A 1Z2NX 3IQXA 2PLRA 4OCZA 2J09A 3TTSA 3TVTA 3KUXA 4O08A 1RYDA 3HKBB 4BX9A 1F2TB 2NW6A 4DF3A 5AK0A 4MQEA 3X1ZA 4ENSA 5K99A 3K70B 2W93A 2XW6A 4JB3A 2VDVE 3CEMA 2DULA 4WZAA 4TKUA 3K5PA 4BQPA 3HCNA 2IEAA 3LHDA 1XZKA 4RH3A 4V03A 3OUUA 1WHTA 5ESRA 3I73A 4U4AA 4MDHA 4DG5A 3HACA 2IY7A 4POAA 3KAKA 1PGNA 4QLOA 4DPKA 2VZ9A 4RTSA 2BGUA 4RV9A 4RPKA 4PEVA 3MJCA 1FCJA 3EQ2A 5EMHA 4EZIA 4LF7B 3T3OA 2GD2A 5KYUB 4DDUA 4HG2A 1YASA 4ITVA 3OX3A 3SU8A 4GU5A 3E27A 1ORVA 1X1DA 2WKPA 4RQTA 1EQAA 4FD3A 1DIRA 3ZS8A 1I4TD 1DXYA 1JIVA 1JLHA 5LQNA 1YO6A 3G2LA 3C7TA 3IURA 5KNDA 2ZIZA 3VOSA 1NHWA 2IF2A 4LOIA 3TI9A 2AI3A 2O0HA 2I67A 2X4IA 4KQ6A 1XZFA 4KPUA 1Y1SA 4TTIA 4WT7A 4C30A 3STWA 2Q2QA 3TKLA 5L3VA 2Z5LA 3QF4B 1Z08A 5ECGC 5DIZA 3ZJ4A 1DRVA 2VYND 4YP6A 1QX4A 3H9QA 2C92A 3ABSB 2LBPA 4BBAA 1PL8A 4TMFA 4DG8A 5ARBA 1YS7A 3FNGA 2ZREA 2WHPA 3LHSA 4D9CA 4EJSB 2VTBA 4TS1A 3DBRA 4KXLA 5AR1A 1N32B 2VUUA 3KT3A 3FKSA 1VYHA 1U90A 4DSAA 3U09A 3QYPA 4FGZA 5KWVA 3A1EA 5K8VA 1R4NB 3FVWA 4LNUA 5K8JB 2OCDA 4JHXA 4ER6A 3OUZA 1T4CB 5I8PA 2NZVG 2GLXA 5B2ZA 1RXVA 4TYYA 3R6WA 5FV4A 3BA6A 3K15A 2YBEA 1SURA 1DWPA 1OB5A 2ODBA 4KE8A 3U4QB 4PFSA 1O5OA 1EAYA 3U1TA 3DUFB 3IIMA 1ZM4A 4L4XA 4KK3A 4EF6A 4M49A 5AXAA 5DISB 2FWAA 4EG5A 2PGAA 2PSSA 5K7SA 1VHWA 1N0HA 2J1LA 2YKGA 1L0BA 2I54A 4HUJA 3C3YA 3SPXA 3R40A 5IJ0B 1GGHA 2Y1KA 4OVKA 1CS4C 1MB0A 2VP4A 3FB4A 2RH8A 2CHUA 3I6ZA 4HEQA 4WZBA 3UJ8A 4CM4B 3TVYA 2YHSA 3WAGA 4K2HA 1YU6A 2ZU0C 5DK4A 2J59A 1BQEA 4AP5A 2X22A 1X7DA 1ISSA 1U0JA 2VSYA 4OJKA 4RHEA 2VT3A 4US1R 1N2ZA 4EG6A 1JL3A 2NPFA 5JS2A 4ZHSA 5G4LA 3WP0A 1O7JA 3IC5A 4JSYA 1JSZA 1AKVA 1PW7A 1W52X 3NIBA 4PLWA 4RQBA 4UUMA 1WB6A 4FBMA 4HBZA 3WIUA 4IVNA 3ENNA 3SX2A 1YKSA 2BUCA 4UASA 4AURA 3FROA 3E0XA 5I4CA 3LD9A 4Q3LA 1F06A 2NGRA 2YIVX 1Z8NA 5LZ8A 1QV9A 1FU7A 4I4TF 1PIWA 4EJ2A 2VNIA 5EYPB 4C7XA 3L04A 2HJRA 2G28A 3E5NA 3A6LA 1D2MA 2B2XA 2H4ZA 4I1IA 1OT3A 4O63O 5FPTA 3W77A 1J8DA 4FGLA 3X1MA 1YQQA 4CJXA 4CM5A 4E2XA 2YHBA 1ZR4A 4BE9A 3KHSA 4V0QA 1RQXA 2EVWX 3TLAA 4B3JA 4DMRA 2X5OA 2QD4A 4JLAA 3ZQJA 5L6MB 2AWNA 3ZDQA 3EA5A 1NY6A 1VPTA 1XT6A 2F1OA 2P35A 3GUUA 2XYQA 4NICA 4CKXA 3WNVA 3I9FA 2NUBA 1VPWA 1AC5A 2BR4A 3GXBA 3NOXA 2P3SA 3LK7A 3KKNA 3DHWC 4KFUA 1H0SA 3GELA 3I92A 3ORRA 5E3IA 2JJ2A 2HXYA 3S70A 4HGOA 2ZXFA 1P5RA 1Q3HA 2BTEA 4G5YA 1M66A 3D43A 1MAVA 3D2AA 4HEHA 1A98A 3LCUA 2Z8XA 4JUFA 4OHKA 1FJ2A 4FYHA 1YR1A 4KODA 4R0MA 4P84A 3JU3A 4KB5A 3ZLBA 2FRXA 1XP8A 1FJGB 1WDKA 3TTVA 4IW3B 3PZRA 3H8JA 2GN2A 2ZE5A 5G3YA 3U6KA 3CVVA 3ESQA 1E2MA 1KQFA 2CHQA 3FVVA 1NG9A 4HN9A 1EQ2A 3VDNB 2DWUA 5EIBD 1TYDE 3TXAA 3BFKA 2O06A 4HWGA 4MO9A 4MV8A 1NGSA 1CJMA 1NSTA 3I8XA 3KPUA 4LBVA 3IAS6 4R68A 1CCWA 3CXRA 1JP7A 4HAZA 4E03A 1TYBE 4KH1A 3SC6A 1DC8A 1B14A 2JZNA 2Q6KA 4MZDA 4CCAA 1HZZC 3RIMA 4CM8B 1EAMA 1IN6A 1HE8B 1IMJA 2OO5A 2H29A 2P5YA 4L4ZA 1CY0A 5C4MA 4IIGA 1QQAA 1J07A 1QZZA 1Y80A 4CHTA 1O87A 3OQJA 3C1AA 2IU0A 4JLMA 3L02A 3HHPA 1C8VB 1EE9A 3PDUA 1W5FA 1HLFA 2XKAA 3I0ZA 1C81A 1IAQA 1XU9A 3KAJA 2H4FA 3HHEA