1J90A

Crystal structure of drosophila deoxyribonucleoside kinase
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
195
structure length
195
Chain Sequence
TQPFTVLIEGNIGSGKTTYLNHFEKYKNDICLLTEPVEKWRNVNGVNLLELMYKDPKKWAMPFQSYVTLTMLQSHTAPTNKKLKIMERSIFSARYCFVENMRRNGSLEQGMYNTLEEWYKFIEESIHVQADLIIYLRTSPEVAYERIRQRARSEESCVPLKYLQELHELHEDWLIHQRRPQSCKVLVLDADLNLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for substrate specificities of cellular deoxyribonucleoside kinases.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transferase
molecule keywords Deoxyribonucleoside kinase
total genus 74
structure length 195
sequence length 195
chains with identical sequence B
ec nomenclature ec 2.7.1.145: Deoxynucleoside kinase.
pdb deposition date 2001-05-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1j90A00
2C5LA 5SZKB 4E09A 1ESNA 2AK2A 2YV5A 4KI0A 3VR1A 3SJAA 3OHMA 4TYYA 3SQWA 2J0UA 3RS7A 4A0GA 3PEWA 1NSFA 1XZQA 4D6PA 1GG2A 3ZD6A 1QHSA 3ZZTA 1CIPA 5FPHA 1Q22A 5FOUA 1AJEA 3Q7QA 1YZGA 3U6BA 3FPAA 4G5QA 1N6PA 2DFKB 3T15A 2PZEA 4RY2A 2OT3B 2W2TA 3ADKA 5EE1A 2RMKA 4QNRA 2GK7A 4ACBA 2YZ2A 4DCUA 2KBFA 2BWJA 1ZRHA 2QGNA 4GPTA 1W0KA 3SOPA 2P65A 1DAMA 3ZVNA 2V1XA 4PX9A 4DCSA 3A37A 2GKSA 2IS2A 1TEXA 4ARZB 4TMXA 1N5KA 5B64A 1HUQA 1OKKD 5JEEA 5DSZA 2IA5A 4OI1A 1JR3E 3B1YA 4EKDA 2D62A 5FBLB 2FZ4A 5EUQB 5DI3B 4DB2A 2IHBA 3LVQE 1S9HA 3NXSA 3E70C 2J9RA 3AUXA 2HYDA 1Z6XA 5AUOB 3R9XA 2QGZA 1MRSA 2RGEA 4UNNA 1YQTA 2REOA 4ERNA 5DHAA 1E99A 2O8CA 4HAWA 2GAAA 4KFTA 2YVUA 4TZ0A 1XZPA 1G8HA 5FL7A 1DAEA 3TBKA 1E96A 1Z07A 2XTMA 4BPBA 2W83A 1Z2AA 1JXMA 1M34E 4Q47A 5GJVC 1NSTA 4GNKA 2PJZA 2WWGA 1F60A 4C0HA 1LV7A 5JJLA 2ZI9A 4B33A 3I73A 2ZRGA 2QORA 2F9LA 2VLIA 4LHYA 1GM5A 4FCVA 2BBWA 1Z83A 1SQ5A 4CVNA 1JPNA 4CF7A 2WTUA 3VU9A 2ZR9A 1GKUB 4H1VA 1M6NA 1XX6A 3ICQB 3L8ZA 4TSFA 1KJZA 4KAXA 1XD8A 4PC3A 4DIDA 2GWHA 4K46A 4Q9LA 3AP1A 4Q48A 1U9IA 2V1UA 3BE4A 3CZQA 4I99A 3VKGA 4M1WA 2ERYA 4CEJB 1W5TA 5C18A 4WIAA 1D2EA 2WSMA 3GQBA 5LB2A 2NO7A 1RYFA 4P4SA 2BVNA 3TKLA 1BMFA 4B3GA 1E2FA 1LS1A 2P5TB 5CB8A 1FTNA 4E03A 2N1BA 2ODNA 2QPAA 3KJIA 4Q9IA 1I4DD 2BMEA 2G88A 4LJ4A 1ETUA 5CLLA 4Z1MA 3ZVRA 4QL3A 3UMSA 3THYA 4JMPA 1XJQA 4MA4A 1RKBA 2BJWA 5CITA 4C0KA 1DG3A 1MT0A 1N6HA 3IEUA 4OK6A 1W1WA 4NKRA 4US0R 3W9YA 1C9KA 2QQ0A 2V4ZA 4OQMA 5FUWA 5C2JB 3VKHA 4CIDA 3MMPA 1KO7A 1KI1A 1W0JD 1CJVC 4DCVA 5J4KA 3U44A 2WKPA 4QC2A 4DDTA 4D81A 5FTMA 1KTVA 3OESA 3C16C 1BYUA 2ZUCA 4I1OA 4B3XA 2OFOA 2EQBA 3CO5A 2A5FA 1FW6A 5J4VA 2E87A 4AYWA 1IN6A 3QI2A 3BH0A 1JEEA 3RS4A 2DFNA 3DKVA 2GEVA 2NZJA 1PLLA 2ZVQX 3N2EA 1ZBDA 4W5WA 4C9BA 1HT1E 2RGNA 1A1VA 1F2UA 3AM1A 4UXIA 2HT1A 4PQRA 3VAAA 4A82A 4JJKA 2BKEA 2NG1A 4B3BA 1DAIA 3A6PC 2D06A 2FSIA 1NLZA 2WSSA 2AR7A 2XTNA 1XRJA 1JECA 2F3RA 3CBQA 1V5WA 4JLAA 3MWKA 3MFYA 3T06B 4IJMA 4F7WA 2XSZD 3QBVA 3RSOA 3I8XA 1GL7A 1Z29A 1ZM2A 2KSQA 2WMOB 1GTVA 3HWSA 3M0EA 4M1MA 2J1LA 1YRBA 2VP2A 3TUJC 5EE3A 2OCBA 5C1BA 1F5NA 2SHKA 3K8YA 2QMHA 5DH9A 3RC8A 2GXUA 1S0UA 5AJXA 2HCJB 2QNRA 2W58A 4AYXA 4OQFA 4Q1BA 3GJ6A 3QIAA 3MSXA 1TMKA 2B8WA 1IY1A 3R7WB 5HKKA 1BKDR 4A36A 2VP4A 3CR8A 1YHNA 2FPMA 1NIPA 4OQXA 3HR7A 2PEZA 1KK3A 4EUNA 3BAFA 3QXXA 5IRCD 2PBRA 2A2ZA 2ZRDA 3HYTA 1KI8A 1T4GA 4TLBA 1RVDA 2ORWA 1UKEA 2P5SA 1EG7A 2PEYA 3OEED 4IHQA 3UATA 2B92A 1I2DA 2LKCA 4IVQA 4MUBA 4HZUB 4TYPA 2DR3A 2QZ4A 2BM0A 4KLNA 1VCNA 4LJ6A 1JR3A 2W6ID 4M9SA 4US1R 4F92B 4XSHA 3FOZA 4XVQA 3TUIC 3NG1A 3L0IB 1Z0IA 4GI7A 4R7ZA 2ZI4A 4XSGA 3W8NA 4M21A 4RFVA 1ZD1A 4PC2A 1E2MA 2O8BB 4IDQA 3GLIA 2R6GA 1KO4A 4B43A 1E1RD 4ZI3A 3TH5A 5LDDC 3AEZA 4B73A 2HXSA 2IYQA 1YJ5A 2EFCB 4L8GA 1BS1A 2IYYA 3KTAB 1E4YA 2D2FA 2XOKD 3K0CC 4NONA 2BMJA 2QMEA 4TTQA 1US8A 1A7JA 2ZYWX 2F1JA 4QGHA 2ZETA 3AVQA 2BMDA 3LXXA 2GJKA 1S96A 3ICEA 2FA9A 3RRMA 1G7RA 1KI3A 2MSCB 3A1SA 2XZOA 3IBGA 1TUIA 1VCOA 1R2QA 2PMKA 3BD9A 2GCPA 2VHTA 4PQFA 3HDTA 4FINA 3MLEA 2ZE8A 3EIHA 3U3MA 4B6EA 2H16A 5H1YA 3I4LA 1UADA 4B2PA 1CTQA 2Q6TA 1QVAA 4TSFD 5KSPA 3H86A 4DSOA 1E9AA 1GUAA 3NTUA 4U00A 1UBEA 2QQEA 1E2JA 1OXTA 4QNMA 4MRVA 5EE9A 4KXFB 4EPTA 5FPTA 3OZXA 3K0CA 3Q72A 1WBBA 3CWQA 3ADDA 1G8GA 3RRNA 3VR2A 1E94E 1ZAKA 3CF2A 1IXSB 5DE3A 3K9LA 1OFIA 1Z0AA 2Q3FA 3NWJA 4PHFA 5EP2A 1JJVA 2F3TA 3NH9A 4OI2A 3JZAA 5FOVA 3BJIC 3X1DA 3GLFB 2C04A 1YE8A 2IEYA 2IUSA 3L0SA 1VIYA 2ZJ5A 1YVDA 2QRZA 4TT3D 4BFVA 1FMLA 5JJIA 1HV8A 1Q44A 2FFHA 3A8TA 4BRWA 4I1UA 1LF0A 3GFPA 4JLNA 3L43A 1B23P 4O0MA 1CU1A 4A6XA 1XMSA 2WJHA 2RGCA 1G3RA 1W0JA 2ZITA 4LSGA 5FR1A 3TAHA 1TL7C 4ACAA 2P6UA 3LRPA 1MO6A 3D6TB 3ASZA 4PQYA 3P26A 2O8EA 1XTQA 2NZ8A 4URVR 5KNCA 3B78A 4TWZA 4B44A 2F1RA 1YRAA 2Q0HA 4BLSA 4D2IA 5CDFE 1GP2A 4Q18A 3IHLA 3TUZC 4Q7KA 1SKYE 3TVTA 1G20E 4EJSA 1U8YA 2ZAMA 1UPTA 1G17A 4A1FA 5HE9A 3PQCA 1HE8B 2JATA 3JVUA 2IWRA 1HH4A 1ONBA 2QEQA 1IY2A 3BXZA 1U8ZA 4LYJA 3ZS9A 2QTFA 2REBA 4HZUA 4LBVA 1H8HA 3OE7D 1H65A 1ZC3A 2WSSD 2WWIA 2ZUBA 1VIAA 5HZHA 5FBRB 4NYJR 4KJZA 3OEHD 2IUUA 4AY2A 3E1SA 1NVXQ 2LKDA 1UJ2A 1W2GA 1UBGA 4NTZA 2ZE7A 1W36D 3AVVA 2B8TA 1SKQA 3SI7A 1TPZA 1VG9B 2GBLA 2J7KA 2VO1A 2CHQA 3VKWA 2CDNA 3CNLA 1IY0A 3AV0B 3W3AA 5HKKD 4LHWA 2BBOA 3K09C 4ZPXA 1ZMXA 3LVRE 4TL6A 3U7FB 1IONA 2WAXA 5EXPA 2UZIR 421PA 3W8RA 2J41A 4Q1EA 1C4OA 4GP6A 4LK2A 3NVAA 2CE7A 1MOZA 2QPTA 4LDJA 1J2JA 3MGCA 2WKQA 4B48A 4ASUA 3BWDD 4WBSA 1EESA 1P62B 2OCAA 1KI4A 2ZTSA 1CJMA 3CR7A 1X8LA 3KTAA 4P33A 1SXJC 1RW4A 2GCOB 2P67A 2ZRCA 4MUAA 1QVRA 3FE2A 4AKHA 3PENA 2V6IA 1GILA 3AVTA 3CZPA 4EDHA 3TK1A 5KUTA 2BC9A 3BIFA 3AB3A 2OM2A 2CJWA 2IS1A 1HYQA 3PXGA 1S1MA 2FFAA 2QTHA 5GADl 3G0HA 1EGAA 4AWXA 2ZRIA 3C5CA 2A9KA 4KO8A 3QKRB 3FTQA 1LB1B 4TYQA 1E1RA 3PEVA 1Q1BA 2FF7A 1VHLA 2CNWA 2XGJA 1L8QA 1OXSC 4F38A 4FCTA 5CK4A 4MITA 1JAHA 4XOIA 2HV8A 2OBNA 1GWNA 1J7KA 4TMZA 1C1YA 1P9WA 3AVPA 3L82B 4QHSA 5FOWA 1G291 3X1ZA 3ZDQA 4CDGA 2C99A 2C2HA 3L2OB 2GTPA 1DELA 1EWRA 3R9IA 4PZLA 2FPKA 1PJRA 2IX3A 2QM7A 4G5GA 4DCNA 3B7GA 4M4SA 1RJ9B 4DLXA 5D3MA 1OH6A 4I1SA 1N0UA 3QENA 3EZ6A 4NYIR 1KI9A 4S2EA 4RZ2A 4C0SA 1J70A 3QG5A 2R6CA 3U3KA 2QPOA 4KVAA 2NOAA 2QAGA 1RIFA 2P3SA 4LJ9A 1O3YA 1SVMA 2YWFA 1KI7A 4B2IA 1J8MF 2AXPA 1S1CA 5KTYA 3DOFA 3K09A 3SEAA 5FTKA 2JDID 3O8RA 4Q9HA 4ESVA 4MGIR 5CYPA 1XXHA 2IWHA 3T1OA 5TARA 4D4JA 4HB0A 3THWA 5EXTA 3CF0A 4GFDA 5SZIA 4UKDA 1OXUA 3QE0A 1KY3A 1UAAA 2BEJA 4B71A 5H68A 3D8BA 5FH9A 3U61B 2NQ2C 4JLJA 1Z3IX 4UXJA 1TQ4A 2IYWA 4FN5A 5HZKA 2HYIC 2P2LA 3O47A 1GL6A 5KSYA 2RB4A 3A4MA 4JVSB 1XB2A 4WZ6A 2IXGA 5E95A 1Q57A 2AN9A 4GOJA 1U0JA 1OLOA 4OK3A 2WIAA 2VRWA 5KDLA 1N6IA 1E98A 4IFEA 3K53A 4B3FX 1KI2A 4D4MA 5KOYA 2Z43A 2VA8A 5FTNA 3FDIA 3SJZA 1PV4A 5LBIA 1G8PA 1NI3A 2H92A 2LWIA 5FBQB 3VR6A 2N46A 4M2LA 1N0VC 4KLZA 2XX3A 2AD1A 4JLDA 4UJ3A 1P9NA 2FX3A 3RNLA 3KX2A 1FMJA 1FUKA 1XD2A 2ZRHA 2BOVA 5EUMA 2F1IA 1AGRA 1E9CA 3QKUA 2E1RA 2IYSA 1MO4A 2EW1A 3IUYA 2ZRJA 4JLOA 2ZANA 3FMPB 4HZIA 3DOEA 2DFLA 4CEHA 3QF4A 4M1KA 3U6KA 1G8FA 3Q5EA 1T8TA 2HCBA 1RPZA 3TIFA 3ZIAA 4GMXA 4PC7A 4YDSA 5CJPA 4CT4B 1AA9A 2HF9A 2JLSA 1IN7A 2R8RA 4M8NE 3EXAA 2O8FA 1P6XA 4QBIA 2JLQA 4NYMQ 3ZZUA 2QAJA 5FUVA 3E2IA 4TYNA 1AQUA 2CLDX 4NCHA 2ONKA 3WNDA 2N42A 5EQTA 1ZC4A 3PITA 3S1AB 1KI6A 4DJTA 3ADBA 5LD2C 3SQXA 4E22A 4PZYA 4C30A 4POAA 1IHUA 2XNDD 4OHVA 3EA0A 4JYCA 4D26A 2J0VA 5AJYA 5JZVA 1ZD9A 1ZCBA 4L4UA 2PX0A 2H17A 3OE7A 1XMIA 4Q03A 4LY6A 3RHFA 4TYWA 4HATA 3LV8A 4A15A 3CPEA 2OILA 4BEJA 4IDHA 4EQ6A 1FP6A 2J7PD 1NLYA 2PZFA 3A1TA 5HCNA 4DSTA 4V0ME 4DDVA 1XPRA 5EP1A 3R7WA 3SYKA 3PJRA 3T12A 3I92A 3SJCA 3LO5A 4BGDA 4Y0AA 3R9WA 2DWOA 1AIPA 1Z0JA 4IDNA 4I1VA 4NL4H 3KUCA 2FV8A 3I62A 1YR6A 4BZQA 1FPMA 2ZROA 2Z6VA 4BASA 3CH4B 4V02A 5AR1A 3C15C 3O8DA 3ADCA 1P2SA 2PCJA 5DLQC 1MO5A 4CW7A 2RCNA 1WA5A 3W5IA 1G16A 3QF7A 4ASUD 3VX3A 1F6BA 3LX8A 1NG9A 2D7DA 2R6FA 5DI3A 2QP4A 5J47A 2C9OA 2R9VA 2JLRA 3B60A 4HI0E 5J4YA 5FBVB 4LYFA 2DHRA 4PAMA 3DL0A 3RRZA 1MABA 2UVQA 1K8RA 1KYIA 4R2HA 2Z5FA 1H8ED 1P72A 5JEDA 1NJGA 1KO1A 4EPXA 2V9PA 1KGDA 4MKGA 1N5LA 5EP3A 1LW7A 2FNAA 2IBMA 1CLUA 3KB2A 2XB4A 2MSDB 5J4HA 3SBEA 3A58B 2CLSA 1W4AA 2GJAA 3CKLA 3QKSB 4RZ3A 1I2MA 4MRSA 5TDHA 2ZXUA 4MKFA 4G5SA 2ATXA 3R8FA 2JJ8A 1JQJC 2A5DA 3N5CA 4LJ5A 1E0SA 1GNPA 2GZHA 4ZO4A 4YONB 3ZD7A 3AF4A 4P3YA 2WZQA 2FN4A 1JB1A 3MAAC 5KNDA 3FKSD 4GP7A 4DXAA 2HF8A 2IS6A 3MJRA 1E0KA 2RGAA 5E7IA 1P3JA 2JJ1D 1OXXK 1XCMA 5JMTA 621PA 3GCGA 3WMGA 4YLGA 3CRQA 5JI2E 2NO9A 3IBYA 4LYHA 2PZGA 3UMRA 1KZ7B 2QP3A 2IYVA 3AUYA 2GF9A 5A4JA 5B58C 3K0AA 4TL7A 4A2PA 1G21E 2JDIA 2R2AA 4X8LA 3KQHA 2IF2A 2CXXA 1DOAA 1FP7A 2R65A 4KFSA 4A0HA 3GLGB 3UG7A 1OH5A 3QY0A 2X8AA 2IXFA 4TQUS 1W47A 3CX6A 1RFLA 5FTJA 1AGPA 4KV9A 3OAAD 2HLDA 3WP0A 2CK3D 1TF5A 2J87A 2G0TA 3EPKA 4BQSA 2QSZA 4XWOA 2ZIAA 5H8WA 2NMVA 4Q1DA 3CRW1 1WCV1 3EA5A 4LHZA 3PG5A 4ZI2A 3SU8A 4PFSA 3X1YA 1XJCA 3GJ0A 4NPHA 4PO9A 5AUQA 2IEZA 1N6NA 4A2QA 3M4YA 4FCWA 3RRYA 4JS0A 4L16A 4F91B 1LVGA 4JBYA 1UFQA 3AVUA 4BZXA 4QBGB 3DEFA 5HCIA 1Z63A 1KDTA 4NYMR 3ASYA 4CGZA 2ZYUX 4V0KA 1GNQA 2V3CC 3CM0A 2GRJA 1LTQA 1QHGA 3JZMA 5B57C 1ZCAA 4XVRA 1NY6A 2BCJQ 3ZLJA 3BH7A 1NKSA 5P21A 2H5EA 3WBJA 2BJVA 1II8A 3KFVA 4G1UC 4HAYA 2V55B 3IEVA 1EFTA 4JKYA 1RRPA 4MYTA 3AVYA 2RH5A 5CIQA 1OFUX 2OBLA 3QPUA 3ZIAD 2BMFA 4AD8A 2IT1A 3GLHE 3C8UA 2H8KA 4ITRC 4QGGA 4JL6A 4EFMA 1D2MA 4LHXA 1M7BA 2CBZA 2UKDA 4JLBA 4TZ6A 3REGA 4AKEA 1Q12A 4HEJA 1G4UR 2GZAA 3BC1A 5JSZB 3EWAA 1M7GA 4U02A 2A5YB 1KO5A 3HPRA 2VP6A 1R0WA 1W4BA 1RZ3A 1SVOA 3B5JA 3KKNA 3I1FA 5TXGA 2VP0A 3VTKA 1YZKA 3X1WA 1NRJB 4EPWA 2GEUA 1FOEB 4BFWA 1Q3TA 1UKZA 4G0NA 4QFMA 2JLZA 2PCLA 2W6JD 2ZRKA 4PPFA 4E5UA 1CEEA 4TL9A 3QJYA 4Q1CA 3P20A 1AS3A 4MH0R 5EP4A 3CX8A 4DUGA 3HR8A 2WJJA 1VG1A 4N0EA 5EJEA 1R0YA 3SE0A 4D0LB 1U81A 3RWOA 2VTKA 4UXHA 1R10A 2BV3A 4NBSA 1TEVA 5AK0A 3IGFA 2JLUA 4GOXA 3SDZA 3O8CA 1SXJE 1TNDA 1KMHB 4MDEA 6Q21A 5DHFA 3D7MA 3V00A 1E79A 2OFXA 3H2YA 3PIRA 3UPUA 3V4RA 1Q1QA 4IOLA 2Z83A 4Q4AB 4C0QC 3MJHA 1B0UA 1Y63A 3QBTA 1U98A 1W7AA 1KI6B 1Z6AA 5ELXA 1X8KA 3MWJA 1JXOA 2JJ2A 5FUYA 1O87A 3KB1A 3K1JA 1CF4A 1SZPA 2FDCA 2RGDA 4PHTA 3D3QA 3QXJA 5F3WB 2YWHA 4KFRA 2WIBA 2BM1A 2O0HA 2BKUA 1OYWA 2W2XA 2ZJZA 3CLVA 4JBWA 4D0GA 3NBXX 2EWWA 3GJ8A 1QHHA 3LFUA 4XIGS 4KHZA 1FNNA 2ZJBA 2CL7X 4PSAA 2WM9B 2C98A 3EW9A 3SC3A 3MWYW 1IM2A 2GILA 5KDOA 4HLQB 1VECA 4YXWA 3NDPA 1NKTA 3T35A 4LV8B 2WHXA 3CONA 4US2R 3X1XA 2QUZA 2NPFA 3ZGXA 3T5DA 3K9NA 1G3IA 2QRNA 1SXJA 3QXHA 2EFDB 4EAQA 3T1VA 1E0AA 3B82A 1HT2E 1R8QA 4TTRA 4PAQA 2GAOA 3BFKA 1HQCA 4MYUA 3U60B 1W4CA 2PT7A 2H7VA 2ORIA 3FKSA 4OQNA 4NYJQ 2ZJ2A 5IDVA 4EFNA 5CLQA 4OJKA 4CEIB 2XZPA 4M9ZA 1M1YE 5TY0A 1CR2A 4A6PA 1KMHA 1Z0FA 3TAUA 1OB2A 1L2TA 2JJ1A 2GJ9A 1G1MA 3GFOA 1JNYA 4PC1A 3L0OA 3FWYA 4LGMA 1P7CA 3GJ5A 3TR0A 1GDDA 5DYGA 2ZEJA 5GJBA 1FX0A 1SVKA 1T8UA 3HP1A 1EFCA 1GKIA 4IXNA 2WOJA 1P60A 2EFHB 3SYNA 2F55A 1XBTA 2ZAOA 3LNCA 3A1VA 3TW4A 1DAFA 5JCPA 5FL7D 4WVFA 5KU1A 3U7HB 4PHGA 1KZGB 3UIEA 2R62A 4JJZA 5EXSA 1E2EA 2PLRA 5JRJA 2IYRA 2QT0A 3QQ5A 1VG0B 4HB3A 4QJ3A 4MRNA 3KJGA 1VHTA 2HLDD 2AX4A 3FMOB 3REFA 1WQ1R 1NJFA 2AWNA 3H4MA 3T61A 1T91A 4C3ZA 2UZ3A 2ZS8A 4V0LA 2WBLC 1RJ9A 1UDWA 2FZLA 2XJ4A 3N70A 5JSZA 4QOSA 2QG6A 4QBHA 5L3VA 2BBSA 3TGPA 4XH9B 2H1LA 2J0SA 1TTTA 4GL2A 1E0JA 2KB0A 3KJHA 5IHPA 1DTSA 5TMPA 2QENA 3F3YA 3QPWA 4YQFA 1KK1A 1SVIA 1GZSA 3WHLA 4UNPA 1ZUIA 1WXQA 5IK2A 1LFDB 5L3QA 4DB4A 5JECA 3LQQA 3VNUA 1GFIA 2FSHA 5CK5A 1II0A 2NO0A 1XTJA 3NC1C 2Q21A 3B1WA 2VSFA 3B6EA 4PPNA 1NBMA 3HU2A 3ND9A 3X2SA 1TUEA 4DLZA 5J4LA 4PANA 3V4FA 4ZDKA 1U2RA 3K70D 1ZD8A 1U94A 3QG1A 4HAXA 2EFGA 1QG2A 3U3JA 4CYMA 5CYOA 2O8DA 4YC7A 4XD7A 3TR5A 3RDPA 2D74A 1IN4A 3K0FB 2VPPA 2ZE5A 5JLJA 4MGYR 4NYIQ 4Q1AA 3W6PA 4A2WA 2RHDA 2IYZA 5KO2A 2F6RA 4HLUA 1II9A 2VSOA 1NVVR 4HUQB 1FFHA 1P2VA 3PUYA 3RABA 3PUZA 5CM9C 4JLPA 1P9RA 2WWHA 4TL8A 1IBRA 3ZVMA 2ZR0A 4HLUC 1T0HB 4NHOA 2HEIA 4BLRA 4HLDA 3WRYC 1EWQA 3UXMA 2WKRA 4IFBA 3DM9B 4LI0A 2KI5A 4OK5A 1TQ6A 2RGNC 4CZ2A 3PUWA 3A4LA 3TVDA 2C77A 4JBXA 3K9GA 3Q5DA 1KJYA 4IXMA 5G40A 1P4SA 1KNQA 1ZYUA 1XEXB 4Q7LA 3R8CA 2CEAA 1ZIOA 3BERA 2D7CA 1ESMA 4PTLA 3NIBA 4GOKA 1E79D 1ZM3A 2O5VA 3Q3JB 1XTKA 2WWXA 4XTCS 4DLVA 3BB4A 2Q9AA 3LQRA 4B35A 2QM8A 3KKQA 2JJ2D 3K0EA 3KJEA 3NH6A 1E4VA 4YDHB 4M9QA 1T3HA 2RGXA 3U7GA 1R0ZA 4B47A 1GRNA 4C0BA 4JSYA 2CJWB 3NDBB 4GDFA 1FL9A 1XTIA 1OIVA 1DO2A 3EIEA 4HDOB 4LJ8A 2DPXA 5KSZA 4L9WA 2JCSA 1G7SA 3KQUA 5KHOC 2ZVPX 3U5ZB 3C14C 4PR0A 1AN0A 4JIMA 1K5DA 4BRUA 4Q4LA 3W5JA 2WJVA 4PC6A 2EWVA 2ZRFA 3C5HA 3LLUA 4I81A 4JLVA 4YXWD 4GMDA 3T34A 3TSOA 1NF3A 2XXAA 3G82C 4RCYA 4K81B 1CRQA 1D8TA 3KFXA 4AYTA 4KODA 1X8JA 2FEOA 3HPQA 3RSLA 3MG9A 2QU8A 3M6AA 1SXJD 3FKQA 3WYAA 1AQYA 2J59A 2FU5C 4LBWA 2ZI6A 1R5NA 1D6JA 3P1JA 4QRHA 3SZRA 1JR3D 3VU9B 1S2MA 3QUSA 3VR5A 1KDOA 3NKVA 4URUR 5CB6A 4DLRA 2JGNA 2PH1A 1NLFA 2WICA 3EZ2A 4XTRA 5G41A 1F2UB 2JASA 3BS4A 1AM4D 4M53A 1KY2A 1TF7A 2GNOA 1G3UA 4B75A 4U7DA 4YMSA 4ESHA 1WRBA 3A4NA 1Z22A 2O8DB 4Q4JB 1N3BA 3IO5A 3NBFA 5TB5A 2XOKA 1E9DA 3AF0A 4YMTA 1TQ2A 2EYQA 1GRRA 1KKLA 1HE1C 2ZRMA 4BUJA 3K0FA 1XMJA 4V0NA 1Q3HA 2ZYTX 5G3YA 3SJBA 2BDTA 2QMOA 1HQYE 1IOZA 4IOJA 2XXAB 2VQSA 3GLHA 3CUEF 3I32A 4OJQA 1X3SA 1XD9A 4Q4HA 2ZU0C 5EE5B 2ZSFA 1UBCA 2NO1A 5FPSA 1JJ7A 2G3YA 2MMGA 3CPJB 4O3MA 4NCJA 4IEEA 1GNRA 1U8AA 3QF4B 5A5GA 3B9QA 3F0TA 4Q7MB 2WWWA 4CEHB 5DIFA 1P75A 3IDQA 2X77A 3FYHA 2WAYA 3LAWA 1W48A 4URZR 3UWOA 1W4RA 1YZUA 4OQLA 4W5HA 5FPKA 4HAUA 4EJSB 4OKSA 1G8YA 3EC2A 2FSGA 4Q02A 4Q19A 2IK8A 2B7CA 2GZDA 2FWRA 5DNYB 3K70C 3TE6A 5K8TA 3PCRB 1N6OA 3GD7A 2G9NA 3U4QB 5JJKA 1VCMA 5AJWA 3O8BA 1S9DA 1VTKA 4MDFA 1MV5A 4HUQA 5E4FA 1NBMD 2VF8A 1CS4C 1OSNA 1YZTA 2BEKA 2OAQ1 3P4YA 3AH8A 3VNVA 5HPYB 2GDJA 2ZRNA 1XEXA 4DLYA 5JI3E 3AP3A 2CCJA 2JLXA 3DM5A 1GIAA 2OBMA 4PXAA 3UMFA 5F98A 5HE8A 4B6FA 1W5SA 3EC1A 5CIWA 2V54A 4R98A 4BLPA 1OPXA 3CRVA 1JPJA 4XD7D 4AC9A 4ZCIA 4OHXA 1F2TA 4IW3B 4EPRA 3B13B 1Y3AA 1AK2A 2G77B 1EX6A 1E1QA 2XEXA 3H84A 1Q21A 4BFYA 3B8HA 4LV6A 4DC9A 3EARA 1KSHA 3PVSA 3GLGA 2RAPA 4URYR 1NIJA 3ETLA 1N25A 2NTYC 4N1AA 1SULA 5BW8A 3DPUA 4P4SB 3I61A 2ZJ8A 2TMKA 3WXMA 4AKIA 4WW0A 2X1VA 3H1TA 4LUCA 1RYHA 4BE7B 5GVRA 3TLXA 4A0FA 4O2RA 3F5FA 3CB4A 4DRZA 3U3RA 1Q1EA 3SS8A 1NN5A 5BN3A 3QKSA 3VFDA 5JWOA 4KFUA 1YKSA 1BOFA 1OFHA 2J46A 3ECCA 2QP9X 4BFZA 4D25A 3AQ4A 3PFIA 5L3QB 1XEFA 1CBUA 1SXJB 821PA 1II8B 3BFXA 4FMDF 1DPFA 1Z0KA 2GHIA 1H8HD 1MR3F 4QGAA 1E3MA 1M74A 1ZJ6A 2CE2X 1HA3A 3I72A 1L4UA 2NGRA 2GXQA 3OEHA 4HYYA 1J99A 2DY1A 3IPYA 3IIJA 3KQNA 3LWNA 5JFGA 2YHSA 3B1XA 2ODBA 2XB2A 5AWFC 1G5TA 3GEIA 2IL1A 4NMMA 3Q7PA 4R2IA 2O8CB 4OBEA 4ON9A 1RRGA 2VIIA 1LS6A 2JLYA 1D9ZA 1P2UA 2FMXA 3WNBA 2VEDA 5C46F 3EX7C 1XWIA 2K5UA 2ZRBA 2GA8A 2Z4SA 4LZZA 3OFNA 1WF3A 1JR6A 1P73A 1CXZA 1E9FA 1T3LA 1OT3A 4JKIA 5JHHB 4Q4AA 4FI3C 4Q4JA 1KSJA 4PPGA 2YC4C 1ELOA 2GESA 2CMKA 3GLIE 1BIFA 2ODWA 1G3QA 2QROA 2X2FA 1Z47A 5BYJA 4ZV4A 1OKKA 2IYLD 5A0FA 1VYTA 1KAGA 4AG6A 1XTRA 2XZLA 4NCIA 2Q3HA 1SHKA 3UKDA 1WP9A 3CW2A 5CDFA 1IXZA 2A5GA 1Z6TA 2RGBA 2QY9A 3RS3A 5FPYA 3B2EA 3LBNA 5CJ2A 3KKOA 5FUXA 2VHJA 4NP6A 3W34A 4BFTA 4GSYA 1BO6A 1XFAA 2Q9CA 3FVQA 1P5ZB 3SR0A 3DHWC 2Z4RA 4ZKEA 2NIPA 1R5OA 1NVVQ 1M7HA 1XEWX 1A2KC 1DEKA 3L8YA 5K8IA 2IYUA 2VP9A 3QNUA 3L0PA 3BFVA 1KNXA 1LF5A 3OIUA 1F3OA 1CR0A 3FFAA 2F43A 3GJ3A 2J45A 5BQ5A 4M22A 1MRNA 3D31A 1ZVQA 5KYKA 1L4YA 3TW8B 1XJ0A 3IHWA 4Z8YA 4DWJA 5JWRA 2G1JA 2VH5R 1FNMA 1L7VC 2CCKA 2O52A 1EFHA 1E69A 4Q21A 2QBYA 3QKRA 3I5YA 1NBME 1IAQA 1U90A 4DLWA 4MRRA 2X2EA 3TQCA 1F2TB 1YZNA 2DB3A 4ZKDA 1MABB 3KQLA 4RD6A 3K70B 4FW9A 1BYIA 4GRAA 2I1QA 2IHYA 5SZJA 5GJCA 2ZSEA 1HEIA 3THXB 1X1RA 4LOAA 3BORA 4MGKR 1VDZA 4MKHA 4DSUA 3H0KA 1VYVA 3GLIB 2CL6X 2O8EB 2ORVA 1E2DA 2FH5B 1JQLB 1IJEA 3IQXA 3LBIA 5FL3A 5FOTA 2HJGA 1KAOA 5F2EA 3ZQ6A 2OG2A 5JWHA 3KQKA 4RJLA 4JVMA 4XVUA 3I3SR 4TLCA 2DWPA 1QHYA 3LD9A 1Z08A 2WWFA 3NBYC 4IDOA 1WB9A 1GVNB 1UEIA 4OHZA 3GEHA 2ZJYA 4DDWA 3TNFA 4LV5B 4LPSA 4PSKA 3CNNA 4V0OA 1R0XA 2Q9BA 5JHGB 1W2HA 2C95A 1FX0B 4Z1MD 2OXCA 5JBQA 2KE5A 4P31A 2VF7A 3W6NA 3C41J 3Q9LA 2WJGA 3KKMA 4DLSA 3MWLA 1ZM9A 1UBFA 3EAQA 4DKXA 3TRFA 1NMXA 3ONWA 4TLDA 3PR1A 1YZLA 4TTPA 1ZUNB 1G6HA 1QZXA 1UKVY 2OO7A 5AUNB 4DIEA 1F48A 1FQJA 2RHMA 4A9AA 4TMVA 4UJ5A 3GMTA 3LA6A 2BCGY 5SZHB 2GF0A 3WHKA 5L8VA 1Q1ZA 5FI1B 5LPNA 2B7BA 2J0UB 3SBDA 4Z8XA 4WXRA 2ZUDA 2XAUA 2OCYC 2YNMA 1TQDA 2FE4A 2VHUA 2X19A 1QHXA 2A5JA 4EPVA 2BIFA 3A36A 2I1VB 4P4TA 3WMFA 3KXIA 1FQKA 2YKGA 4JVLA 1JALA 1IXRC 2R44A 4OL0A 2ZE6A 3JVVA 1FZQA 2G83A 3K9HA 1QDEA 3FMIA 1PLJA 2HT6A 4LBYA 3ZYCA 3CWZA 4IDPA 1P61B 1E2NA 2O8BA 2ZPTX 1T5LA 4AKGA 1E2HA 2QTVB 1DVRA 3EASA 1E9RA 1VMAA 1Z2CA 3NEYA 1NVUQ 4B74A 5JRZA 5FTLA 3DZDA 4RZXA 5H70A 1QHHB 1TADA 4AIIA 2GJ8A 3PEYA 1JAIA 3QVVA 1KSFX 3AGQA 4FIDA 1AZTA 1Z6YA 3IPXA 1QRAA 2IUTA 4HLCA 2GXSA 5LB4A 1NN3A 4ZCMA 3C7KA 3EZ7A 3UK6A 3U3OA 4BFXA 2QBYB 2AKYA 4B3CA 4DLTA 4RKFA 3SFZA 1X1SA 4DDUA 5IT5A 3OFND 2CL0X 2RGGA 4KBFA 3IIMA 3VHLB 2C03A 4LCBA 1KKMA 1M2OB 2P0EA 3AVXA 2WJYA 3OEEA 1Z06A 2OXRA 2KWIA 2AXNA 4B76A 2YJTD 2ZS7A 3THOA 2ODEA 1XTSA 3TJZA 1P2TA 2OUKA 2W6IA 2VYFA 4QXAA 1TAGA 2ZSDA 5DN6D 1OH8A 3A1WA 3DVLA 4X8MA 2IC5A 5DI9A 4M1OA 3W90A 3EG5A 3CX7A 4KVGA 3CF6R 4H1UA 1MO3A 4C0LA 2AFHE 1TX4B 1KDRA 1N5IA 2GVZC 3BBPA 3IIKA 2R6DA 4II7A 4CT5A 1CP2A 1LY1A 3VR4A 3MRSA 2WOOA 1D9XA 4YMVA 2ZRPA 1RRCA 2BHRA 3AKYA 5FOXA 2PL3A 4Z51A 5BWMA 3ZZ0A 1PVOA 5GJWC 3B9PA 121PA 3SHFA 3VX4A 2IXEA 4LYAA 3G5UA 1OIXA 3T1TA 4GZLA 1J8YF 4LJYA 4BZPA 2W0MA 1ANKA 3CRMA 2V7QD 2CVFA 3NEJA 4LJAA 4WAUA 2HDNB 5DGXA 3FHOA 3EZ9A 1G7TA 3WNCA 2PJRA 1R7RA 3N2IA 4BEBA 4L5BA 2G0NA 3QEOA 1SKYB 4F4IA 1UEJA 4PSVA 1W36C 1T9HA 2GEDA 4D80A 1GSIA 1DS6A 2JAQA 2EU8A 5HTKA 2CHGA 3ZQJA 3DMNA 1ZNZA 3ZVLA 5CM8B 5E7MA 1DAHA 4TQAA 4RD3A 2I4IA 4ZDIA 2DWQA 4HAZA 4DT1A 2QAGC 2OLKA 3DMDA 4P32A 4RVCA 2YINC 1U0LA 2JEOA 4RZUA 2I3BA 1V43A 4QHYA 4ZDJA 1RE0A 2HXYA 2QT1A 4URXR 4FMCB 2ZRAA 1U0HC 4EPYA 1EFUA 5TV2A 3ZJYA 1E9BA 1XPUA 3RS0A 4DEYA 4UNRA 1G3MA 1NNEA 3GLHB 2JIZA 4Q4HB 1KOFA 2REXB 2OEPA 4MRPA 3T5GA 1CJTC 1FTSA 2Q3MA 4TQ9A 1QF9A 4X8OA 5JS7A 2FG5A 4TT3A 3P32A 4FWTA 1NG1A 4AURA 5KPDA 4NU0A 1DARA 4TN1A 4UNQA 4XWKA 1YZQA 4QGFA 3EPLA 3IQWA 5C4GB 2KBEA 3LBHA 4NCKA 3TMKA 4EJSC 3AKEA 1UF9A 1NN1A 4RKEA 5KDDA 4D82A 4OI4A 2ZREA 4A8JA 1QHIA 2AKAB 4IOMA 1I4TD 4JSTA 2MSEB 2ZI5A 3QEJA 4NE2A 4CEJA 4JVNA 5DYIA 1CKEA 2YOHA 2P6RA 1KO8A 4MGZR 2A78A 3CNOA 3IKJA 1D5CA 1YR8A 3J81k 3FGNA 2F1HA 3LH5A 4Y0VA 1DE0A 1XCGB 3Q85A 4HSEA 1EXMA 4QJ4A 4C7OB 4X8HA 3GEEA 3RS2A 4IEIA 2YOGA 2QL6A 3CRRA 2ERXA 2XNSA 4KSBA 4KBGA 3OIYA 2B6HA 3P4XA 3RWMB 4B32A 4DEXA 4V03A 5J5CA 2ONJA 2WV9A 1XF9A 3HU3A 3DKPA 1SHZA 4LC1A 3LLMA 2C78A 2C9CA 4HB4A 3F8TA 4JL8A 1VCIA 1XD2B 1Z5ZA 4TMTA 5BN4A 3V9PA 1MKYA 3U7EB 2AFIE 5JCZA 5G3ZA 3EIQA 3UANA 3AKCA 3SFVA 4AI6A 2C9YA 4ARZA 2WJIA 3W3ZB 1KHTA 4NH0A 5D3QA 1UKYA 1W49A 1KDPA 4GZMA 2WVJA 4PPQA 1WDTA 1S3SA 2ANBA 2FPLA 2DBYA 4RFSB 4C4PA 4K8OA 2D3WA 1W44A 4QG7A 4L9SA 2A3RA 2QN6A 4NCNA 4NDZA 3QXCA 5D3MB 1S8FA 1M8PA 4O2LA 1CULC 3THWB 4FMDB 4FWIB 3RANA 3EZFA 4Q9JA 2D4HA 2C96A 4PO1A 1U9IC 4JZKA 2FGJA 1XCPA 1IJFA 2O0JA 3FHTA 4A0RA 1N6LA 5DO9A 4V0MA 3PUXA 1EFRA 2IS4A 3GJ7A 2F9MA 5DN6A 1YU9A 2FFBA 1G5PA 4ILEA 3S1AA 2VL7A 4R9UC 4IOKA 3BOSA 2AHOA 4P0TA 1PLKA 1XPOA 1Q20A 3BRWD 5K8LA 2J3EA 1ZP6A 4FXPA 4HUTA 2WPDD 4C2TA 4PO8A 1GITA 1ZNXA 3I8SA 1OE0A 2ZJAA 1OFTA 1R5BA 2CNWD 5G53C 5FR2A 4OYHA 4C2UA 1A5TA 2FSFA 5KPJA 2NO6A 4OI0A 3PV0A 1SVWA 4LRWA 4RD2A 1UDXA 2OE2A 2EFEB 1LNZA 1N6KA 2GJSA 2OV2A 4HB2A 1W46A 4WZAE 2V7QA 4Q00A 1COWD 1KIMA 3NC0C 5E3HA 1PUIA 4EIWA 1HURA 2EVWX 1N5JA 2O0KA 3THXA 4KSCA 4RFSA 1E6CA 1DAGA 1A82A 3GPLA 1SVLA 1OB5A 2ZRLA 4LC0A 5J40A 1KMQA 1Q0UA 3IO3A 4PAOA 4F4CA 1OH7A 1X86B 2QSYA 2XJ9A 4DSNA 1SGWA 3AGPA 3B1ZA 4AG5A 1WE2A 5B2ZA 3MCAA 4AK9A 3U44B 5F9HA 5C4MA 3KUDA 4F4JA 1X6VA 4A8JB 1JI0A 4C7OA 1ZM4A 3CPHA 1VG8A 4HAVA 2PLFA 1XMVA 2ZS9A 2W00A 1KJWA 3ZH9B 2H18A 1KK2A 2EYUA 4C0AC 2JIZD 3GLFE 4DBLC 2WMNB 4B2LA 1E9EA 1WMSA 4EQ6B 5JS8A 4D4LA 1AZSC 3BK7A 4WXPA 2W0SA 3CIOA 3EPJA 4ZCLA 4ZDWA 1IN5A 3SHWA 3KZ1E 1VPLA 2IYXA 4G5RA 2F43B 4A92A 1PUJA 1T0JB 4N3NA 5BYKA 3NHBA 3AP2A 1XXHB 4Q66C 5EXXA 5IK2D 3UG6A 2D2EA 221PA 5L3RA 2IYTA 5AJZA 3DZ8A 4FMCF 1HY3A 2OCPA 2H57A 5UKDA 3NBZC 4PZZA 5AUPB 2QAGB 1W36B 4FD2A 3BH6A 4TLAA 1UM8A 2ZSBA 4JLMA 5HR5A 1OXVA 3U4QA 1OIWA 1OJLA 1PZNA 1Z28A 4R71A 3DO6A 4B34A 1E2IA 1R8SA 1OHHD 8OHMA 3SYLA 5LD2B 3Q8XB 3WYGA 1DO0A 1T5IA 1TF2A 3T1QA 2G6BA 2VHQA 2IF0A 5TVKA 4Q1FA 1J90A 3P27A 4BWYA 4M1YA 2VP5A 1NMZA 4QM6A 3HYRA 1E2LA 3TSZA 3B85A 3QPVA 3EWSA 4XWAA 3E5HA 2XNDA 5FI0B 1XP8A 4A8JC 2CLCX 1ZU5A 2PT5A 3FMFA 3SN6A 4A4DA 4Q5IA 3ND8A 1E32A 3WP1B 1DBSA 2IW3A 3UWKA 5KSOA 4EFLA 1HTWA 1ZNYA 2YWEA 2ZM5A 1N2CE 2E9SA 1KK0A 1N6RA 1CRPA 2J7PA 3RS5A 3WY9A 2CCGA 1NL3A 3QSYA 2L0XA 3SNHA 1AS0A 3FB4A 4IKEA 1K6MA 1Z8FA 4LJ7A 1TU3A 1KSGA 4MQBA 1JBKA 2J0QA 2OZEA 3B1VA 3AF3A 2ZI7A 2GBLC 3AVOA 4JT4A 1DG1G 1GL9B 4QM7A 1D2NA 3OF5A 1BH2A 4N0DA 2FFQA 3I5XA 2GCNA 2WWYA 1ZNWA 3WBKA 1E2KA 5BXQC 2OHFA 1CJKC 1XNJA 3WMEA 3KXLA 4JL5A 1G41A 2QE7D 2A7QA 4M1TA 1US8B 2CHVA 3QXSA 4Q9KA 3VR3A 2FOLA 2FEMA 5IF9A 3WYFA 3TQFA 1OYYA 1K5GA 3GJXC 1EFRD 4U5XA 3VMFA 1AS2A 1H8EA 2AK3A 3KDSE 4ABYA 2HJVA 1U99A 3HU1A 3A1UA 2JLWA 2AL7A 2RKOA 3OIWA 3NHAA 2F7SA 2WPDA 3RYTC 4BFUA 5FBWB 3LX5A 4PHHA 1W0KD 4W9MC 5AJVB 4M9XA 2OESA 1NP6A 4G3XA 4G5OA 4RD1A 2ANCA 2PX3A 1Z0DA 4I4LA 4NZYA 3BGWA 4P4UA 1ODFA 2NPIA 1FUUA 3W6OA 2ZU6A 4JT2A 1E9SA 3GP8A 2V6JA 2QA5A 1VYUA 3VQTA 5ANRB 2HUPA 1ZU4A 3TSWA 5F9FA 2VSXA 1COWA 4W7SA 1G18A 2ZR7A 3LW7A 2AWOA 3LY5A 4LWZA 4QBFA 2LCFA 2OLJA 1GRQA 3AF1A 5K8UA 2G1KA 2GXAA 2GCOA 1E2PA 2GK6A 3KXKA 4L15A 2V8OA 2GVDC 2YYZA 4IVPA 5FFMA 4MYHA 5EE0A 2Z0MA 1R6BX 3RVBA 1EX7A 2JA1A 3BB1A 4IRUB 3THYB 5BN5A 2B21A 4DCTA 1A2BA 4Q01A 3K0SA 2VBCA 4H9GA 3MUFA 2GETA 4KITB 1SVSA 4C0JA 4E07A 2JLVA 5L3SB 2DFTA 4GT1A 4BLQA 4XJXA 1G4AE 3OAAA 3U2QA 2OAP1 1Z6GA 2CK3A 3BB3A 2QMUA 4KYUA 1S4QA 3LXRA 4OHYA 2BBTA 4RD4A 1YR7A 1ZUHA 1ZINA 3IILA 3ZS8A 1EK0A 2Y8EA 3AF2A 5GVSA 3DDCA 4JLKA 1IQPA 1A4RA 4TMWA 4WA7A 2W2VA 4FMBB 1G19A 1RRFA 4MKIA 2XTZA 1AKEA 1R4AA 1CR4A 4G01B 1S3GA 1OW3B 2PMDA 3C4JA 4TMKA 4DVGA 1VKJA 4O25A 4RCZA 3LDAA 3K0AB 3PEUA 4D0NA 4YMWA 2DCUA 4BFSA 3RC3A 3FHCB 4UNSA 2ZQ5A 4QHTA 1IN8A 2R6AA 3PUVA 4W5JA 2YC2C 2ZJOA 4ZIRA 2C8VA 1BMFD 4BLOA 1XU4A 3GFTA 4RD0A 5DISB 1E2GA 4KU4A 1NY5A 2O8FB 3M1IA 3MD0A 3LW8A 5L3SA 1ZIPA 1CJUC 3KKPA 5B30A 1GKYA 3KL4A 3RAPR 1RC8A 2AD5A 1G6OA 4HDCA 4D4KA 4DHEA 4GBMA 2P6NA 1OHHA 2A30A 3VHXA 1NVWQ 4DLUA 4WZBE 1DAKA 3GLGE 4DT1B 4BECA 4HDQB 4LHVA 1I4LD 1G64A 1E1QD 4JYBA 3QKTA 2QI9C 1OV4A 4KYIB 4DZZA 3GJ4A 4B3DA 4YMUA 1CR1A 4RSGA 4BLTA 4URWR 1NN0A 1T3SA 3QVUA 5E7JA 3AVWA 4OHWA 4Z54A 2J5XA 3CH5A 1WBDA 4IVRA 2ZI3A 3HJNA 2W6JA 4KCGA 4TLEA 1OF1A 2FJUA 4F93B 2OFWA 1GAJA 4MYCA 3GLFA 4M1SA 2VHCA 2XITA 4ZIRB 4DUGD 3QOFA 4CRWB 1AKYA 4WOPA 3AKDA 1XEWY 2OSBA 4LX0A 2DYKA 5M04A 2ECKA 1G9XA 4J0QA 1MH1A 1QG4A 4QJ5A 1T6NA 1ZW6A 2ASEA 1JEDA 2YWGA 4LPKA 5KNBA 5EZ5A 3EPHA 1G5RA 3RLFA 2FGKA 3WRXC 2YOFA 2MMCA 1DADA 4UQOA 721PA 4LBZA 3FFBA 1GOTA 5EZ6B 1N0WA 5FOSA 1QHNA 1XXHE 2KJQA 2ZSAA 2CVHA 3OIVA 4Q7JB 1YR9A 2ATVA 1E2QA 4M0LA 2ZYVX 2XSZA 4CEIA 4QKQA 1QBKC 1G7CA 1TU4A 1XDBA 2QE7A 4S35A 521PA 1NMYA 1ZM7A 3R20A
chains in the Genus database with same CATH superfamily
2C5LA 2OP1A 4WVLA 2AK2A 2YV5A 1Y1QA 1E8DA 2PGNA 3KLBA 4KI0A 3OHMA 1AMOA 2EV9A 4F4FA 2OGWA 2J0UA 3RS7A 2GD2A 5LR6A 1X74A 2WF9A 3EWIA 3OQVA 3KHKA 4QBTA 2WZBA 1CIPA 5FPHA 1VB5A 1WEHA 4MX8A 1Q22A 5H9VA 1XR3A 4KR9A 3M4NA 4DN6A 5B55A 5K6RA 3TGLA 1VSVA 3IEMA 2DFKB 3COWA 5ARBA 3FBWA 4JIGA 3GHHA 3QU4A 5JXIA 2AR9A 5G2OA 4JOBA 1XVVA 4R1OA 2JD0A 1MBZA 2QGNA 3CLTD 1QYCA 1W0KA 3I1IA 3KHSA 4KUEA 1HNNA 2O48X 4LRQA 1FSZA 4DCSA 4LK3A 3A37A 2QTVA 2O2HA 3EGXA 4DQDA 5DSZA 4XE5A 2IA5A 2Q8PA 3ESCA 4OI1A 3B1YA 4EKDA 1LVHA 2DP4E 1WMBA 1PJTA 5TMEA 1ENZA 2H51A 1E3EA 2A9OA 1L7NA 3QEMA 2H1CA 3LT0A 1VP3A 1VHWA 1U7TA 4QWWA 4HGNA 4RTKA 4ID3A 1Z6XA 1J09A 2DKFA 3DE4X 5FNVF 3UJ6A 2JAXA 3IQZA 4BO1A 5AUOB 3RNOA 2BGTA 2RBKA 2P40A 4CODB 2QI9F 2YZGA 2B4KA 4CIVA 3NIFB 5EKTA 4HAWA 1L7BA 3ZHTA 3LUHA 1Y42X 4EATA 2QX8A 2YVUA 2XQGA 3LF2A 1GZ5A 1XCJA 2WDZA 1E9VA 1F8GA 4HQ6A 5FL7A 1GUZA 1NR1A 4QYSA 5HIIA 1E96A 3I4FA 3JW8A 4YAUA 2W83A 3OZUA 2IYAA 3QMVA 1TCBA 2PMCA 4HS4A 3H65A 1NSTA 3HKDA 3RI3A 1T8RA 3INTA 1F60A 4MQFB 3BXHA 1Y9JA 5A1TA 4YRCA 1CV2A 1C0PA 2F9LA 3W1VA 2FPGA 3OP1A 4ZZ2A 3RS9A 3ZV6A 3J81A 1ZD4A 2Q1YA 1WDMA 4DGSA 1QR2A 2ZAYA 4U8GA 4HDMB 5AKZA 5JS2A 1GKUB 3G9QA 2ZKIA 1IVYA 2E7ZA 1ADGA 4Y2YA 3D64A 3U9SA 3MAJA 4EF5A 2GWHA 1PNTA 3ETHA 1SQ0A 1ZHOA 3QHQA 4AJKA 2IEIA 4PZ9A 3BE4A 4GZ3A 2DQYA 2HRBA 4I99A 4C76A 4CKBB 3VKGA 1XZKA 3IQGX 4A73A 4ZOEA 2DH5A 3FNFA 3PE4A 1KAQA 4YQYA 1X38A 1WHTB 1C2YA 1VJGA 1E2FA 1GNVA 2PZ8A 2XF2A 4OMDA 2ZJ6A 3FHJA 1Z4JA 3NT4A 2JGLA 2H5JA 1HG0A 1W581 3RTGA 5JC8A 4MPPA 2YJ4A 2G88A 2X76A 5BMOA 4DOMA 4EPVA 2ZM6B 1Z4KA 1DQRA 3GFSA 3MUEA 1ETUA 5CLLA 4I6JA 2H5IA 4C7BA 3L4EA 1W4LA 1U1EA 3TOVA 2QJRA 3D7KA 4YRPA 1XJQA 3G8YA 3KP1A 4QXQA 1W29A 1T26A 1GHTA 3EVZA 1NW3A 1MT0A 4GMHA 3GAMA 5D5QA 4OK6A 1W1WA 5CBPB 4NKRA 4NJEB 3BZWA 4NFHA 4OQMA 5C2JB 4G67A 4L3WA 1S2IA 2FPIB 3VKHA 1KO7A 1ADJA 1KI1A 1V7ZA 1X7GA 2BEVA 3W06A 3RV3A 3DQPA 5B6PA 2WKPA 4UHDA 4U2KA 2WIFA 1HGXA 1MAAA 1W4ZA 1M6EX 2XRYA 3O4RA 3R5TA 4MS1A 5GMOA 5BNFA 4ZIRA 1QIGA 5FTMA 1CUDA 1EXWA 1OFVA 3HY4A 2CXPA 4EJ6A 3T5AA 5HK8A 4B3XA 2HBRA 2D8AA 1JHOA 2OFOA 4J75A 4QUKA 1WKBA 4C7KA 5BQFA 1REQA 3U4MA 2JBWA 4U7FA 2YNMD 3QI2A 1JEEA 3HUDA 2VJQA 2QV0A 2YYYA 2ZT5A 3IAM1 3L7MA 5EKDA 4COOA 5LLTA 3G9UA 1SNYA 2Y1CA 4DA6A 4M8LA 3U56A 5DNDA 5G4LA 1ZBDA 5J5VA 3H2IA 4C9BA 2L2QA 3WK4A 3FYUC 4BVEA 5KHLB 1LDYA 2R5FA 2RGNA 4QEDA 5K1ZA 1F2UA 1ZL2A 2BLLA 2P35A 4FIZA 1LEHA 2EP5A 3ODPA 3UWPA 4PYMA 4G5HA 3VAAA 4JJKA 3TEMA 4ZO9A 1CUUA 4O4LB 2FSIA 3B89A 2F3RA 2XYQA 3MFYA 5ADVA 3WLLA 4F7WA 1UBUS 1KHHA 3RODA 5EERA 3ZLVA 4DG8A 1I7LA 3RSOA 1RHMA 1Q0SA 8AT1A 3NHJA 1F4LA 1GTVA 1WSAA 4CKXA 2VJDA 3M0EA 1T13A 2DQZA 1QTRA 2EGHA 2J1LA 3C5VA 3NCTA 4U7JA 2OCBA 3TUJC 4DC0A 1F5NA 3VJMA 1ISMA 3K8YA 1TW2A 5ALLA 1W0CA 5DH9A 2GXUA 3OA0A 1XRLA 1S0UA 5HQ3B 2BFWA 5ISMA 2JBHA 1NX9A 5BRAA 3CUKA 1I80A 5A6SB 3MSXA 1BKDR 2YVLA 3WHIA 2GBPA 3BICA 3CR8A 2BFCA 2MINB 1YHNA 2ZBDA 3CFYA 3DP7A 1M0WA 3EAFA 3OP4A 3U9LA 4KK3A 3W04A 5C52B 4ZQFA 5DKFA 1HKHA 1PN3A 3FIJA 3Q3HA 3V7FA 2DBQA 2PBRA 2FR0A 4LTMA 3E03A 3HYTA 3ZY6A 1T4GA 4H7JA 2ORWA 4EABA 1G6Q1 4K5QA 4G1BA 4IH1A 1V25A 3OEED 4MVJP 3EGDB 2PUWA 4IVQA 2GFQA 2I3GA 1O2DA 1U3GA 2XV1A 5BPFA 4CLOA 4JI3B 3BE8A 2C59A 4TYPA 1CUGA 1PSZA 1W6UA 4D0RA 1RKVA 1VCNA 1JR3A 1PJSA 2W6ID 4L1KA 3FOZA 4XSHA 5CNJA 2HHCA 4ZGGA 2ZBEA 1CZHA 5DDIP 4JI2B 5DW0A 3L0IB 1M34A 3QKIA 4GI7A 2DPHA 3SWWA 1N1MA 2B78A 3EPRA 4JJFA 5CFPA 3FX2A 3UWDA 2O8BB 5E6UB 2D1TA 1KO4A 4WX2B 4B43A 3IALA 4YV1A 4PZDA 4YWJA 3TZHA 4BIIA 3AEZA 3ME5A 5CH5A 1ZSVA 3L0BA 2BAGA 3WGKA 1OXMA 1WDWB 5EJMA 3BFJA 5AHOA 2IYYA 2AC4A 3KSZO 4PLPA 5ITWA 4RVDA 2ROQA 1R15A 5HUJA 4HDNB 2OTCA 1QFYA 3NYIA 3FSGD 3PFFA 2VHXA 4M83A 3TOCA 1U3TA 1JFRA 1RBZA 2ZETA 3KJQA 5JAPA 1HRDA 1PWXA 5L4SA 2FA9A 4X41A 4OXNA 3F9CA 3W9SA 3A1SA 3ANMA 1ZVVA 1E1CA 1VCOA 1Z68A 1W96A 3PYMA 4M8SA 2PMKA 2X0DA 4PQFA 5LFAA 4FINA 3MLEA 1K66A 1NVAA 4B6EA 3GT3A 3LYHA 5H1YA 4J2OA 1UADA 1CTQA 2OO5A 2LDBA 2Q6TA 3PNSA 3ZN2A 5BSEA 5CX1A 5IM4A 4P3PA 3CMMA 5JAMA 1UPXA 1KZ6A 3GT7A 3RU9A 1A9TA 3D4LA 3FBTA 3TTXA 1AKQA 3V3TA 2QQEA 3C7CB 3HZRA 1OXTA 1T4DA 1VLLA 3I0MA 3NPMA 3P9ZA 4KXFB 5DIZA 3H6GA 2Y0PA 5AO9A 2R6JA 1ND6A 1QGDA 2C5SA 4ZI7F 5CDYA 5ICGA 2UYYA 1E94E 2PTHA 3K9LA 1L5VA 2O3TA 1Z0AA 2J3KA 2PV7A 1I24A 3L5OA 4D9CA 4PHFA 2EF0A 1OASA 1JJVA 2G7ZA 5JSFA 1Y1RA 3L8CA 4PXSA 3X1DA 3CN9A 1EEXB 4GGPA 1YE8A 2IEYA 1KMCA 5EIFA 1MG0A 4DZTA 5F1YA 5B2EA 1NBEA 1TFUA 1H6DA 4TT3D 2G9QA 3HY6A 3H9QA 5C5DA 3J7AC 1Q44A 3B7PA 1XCOA 1J4AA 2VJPA 1YHYA 3A8TA 3GT0A 4GPZA 1Q19A 1EVJA 4BRWA 4DRXA 1LF0A 4JLNA 3UMCA 4UTOA 3I23A 1XMSA 3JS5A 5BN4B 1G3RA 1W0JA 5EMJA 1ZOPA 4QFBA 3KLMX 2NU8A 4MB0A 4E5VA 5HBGA 3ZXUB 1Y0BA 1F6WA 1IZ9A 2Q45A 2W2LA 1TL7C 3C4QA 2P6UA 3HCPA 4WLOA 1PDOA 4MIYA 3LRPA 4YAIA 1MX5A 4TV9A 3QV1A 3RSFA 1MO6A 4CM5A 2C0QA 3ASZA 1G20A 5J23A 2ZDQA 4IILA 1KVTA 4X7RA 3V8MA 4FGJA 1P5JA 4C0XA 1RXCA 3R6LA 4URVR 2Q0HA 1YRAA 1ZSYA 4WEQA 1QRTA 4NECA 4BFCA 1V3QE 4NBWA 1J1ZA 1GP2A 4Q18A 3IHLA 4QFCA 4CWAA 4R1MA 1SKYE 3TVTA 1BJKA 1L9KA 2QNBA 1Y7HA 4CV0A 1KA9H 2EATA 4GLLA 2NO5A 3BXGA 5HE9A 1HE8B 3W2HA 1V16B 1VHDA 2Z8YA 3HB4X 4M87A 3O21A 4RTQA 5A3RA 1XHEA 1T34A 1F4PA 4IJWA 3U17A 2AMYA 1IXYA 1ICIA 3BXZA 4RK1A 1H0RA 2FR8C 2Z04A 3P19A 1H8HA 2XA2A 1U3DA 1L7MA 2G06A 2ZUBA 4X1IA 4MP6A 4L02A 3ZDBA 4HC4A 3K2IA 2JH9A 3OEHD 3ZV5A 3LQKA 1UPUA 1OFGA 5KMGB 2LKDA 3QVXA 5F2OA 1UJ2A 1W2GA 1S6YA 1UBGA 2FETA 4NTZA 2Q5OA 4YP5A 1DWUA 4G0UA 2X8WA 1KYQA 4FHZA 2B8TA 1VL0A 3B51X 2J7KA 2VO1A 1S2OA 2CHQA 2O6LA 3HI6A 4PWYA 2G9RA 4ZC8A 5HIMA 2NV6A 5BWNA 2AN5A 3FDFA 3AV0B 3LP8A 3W3AA 4YLEA 3VTFA 4RKRA 2BBOA 5F1OA 3B6KA 421PA 5A7GA 5GP1A 3W8RA 3VDRA 2R68A 1C4OA 3KLPX 3I6ZA 5E4JA 1MOZA 5AKXA 1R8JA 2QPTA 2R8EA 3IEXA 2ZJ0A 4OVKA 3PRHA 1U0SY 3K0KA 2WKQA 1AH2A 3N28A 3EFBA 4B9AA 2EERA 5CXXA 2ZTSA 1CJMA 4EYEA 5CFNA 1X8LA 2Y6UA 3VPAA 5A9SB 4P33A 4I4NA 4BNMA 4OHKA 1XG5A 3D8UA 4Z0NA 1YJQA 3NHSA 2CWWA 1UODA 2V7TA 3FE2A 1E62A 3NR2A 5JASA 3RVNA 2XBUA 3T4UA 4YUAA 3AVTA 4X24A 1JDVA 3BIFA 2RI1A 3HJCA 1L3IA 4FLMA 3ULKA 2XKKA 2Z58A 3GGJA 4DARA 5GADl 4E46A 1THGA 1Q50A 1XPJA 2ZRIA 4KO8A 5T64A 2BI7A 1XMPA 2W4IA 4TYQA 3CEHA 1A9SA 1FFEA 3PEVA 4HRVA 3W6ZA 3CE9A 2CNWA 3F47A 3AHJA 4RM3A 4MITA 1C0LA 4P84A 1J7KA 2Q41A 1GQ2A 2ESRA 3HJGA 3ZDQA 1L1QA 3KWMA 2B6NA 1HOXA 3L2OB 1KRWA 4IYRA 1D8AA 2FPKA 1FBNA 1L4EA 4RL4A 2IX3A 2HHHB 4M4SA 1T5SA 2FMIA 3QPBA 1PJZA 3PNLA 4YCAA 5KWEA 4S2EA 3STXA 3EZ6A 1KI9A 4RZ2A 1LJ8A 1SXQA 1J70A 2PUJA 3C6YA 2PE5A 2C7VA 3SIXA 3T3HA 4KVAA 4B5LA 4LJ9A 1SBHA 3W5CA 4UU1A 5BNWA 5JAOA 3EY9A 1K5HA 4B2IA 1EBFA 3KZXA 4KYTA 4E30A 3FUXA 4Z53A 3VSAA 3ZGNA 4FXOA 1CY4A 2IPNA 3OOYA 2XYPA 4MGIR 4Q9HA 2OD2A 2Q0SA 5TARA 4U2EA 4GFDA 2F8MA 4GOOD 4MYRA 4QOJA 3HDJA 1GU1A 1OA1A 3BL6A 2VQ6A 2AQ8A 1H69A 2PO5A 3U4AA 1QLHA 2NQ2C 1ZJJA 1Z3IX 4UXJA 4FN5A 2GBGA 1CRLA 2P2LA 1TT5B 5DTIA 4BNDB 3D4OA 3DUWA 3AEYA 3QX8A 2X5JO 3PUIA 2P0AA 1W88A 1EEHA 1AVTA 1ZLYA 3QSGA 1RABA 4DWWA 3GMDA 4ZV9A 7MHTA 5GQSA 1QDUA 4HWKA 3KEMA 4NDAA 1NI4A 4YEDA 3L0DA 5KDLA 5AVZA 5HW0A 5LKAA 4BKMA 1KRXA 2EL7A 4BO6A 1L5HB 1IPFA 5LP6F 2OCKA 3I01M 2JF0A 1P1CA 4DG5A 1H23A 1VSBA 1ZXXA 2JIQA 1DUSA 3SJZA 1PV4A 3MBKA 1Z4OA 3HEMA 1SBQA 3FR7A 2HDOA 4M2LA 7GPBA 1SXHA 4J29A 3OMXA 1E7SA 3RNLA 2Q3CA 1WPQA 4DJJA 5EJ8A 4ONEA 1IEQA 1UDAA 2BOVA 2IYSA 4LZOA 5KB3A 3IUYA 2ZRJA 5LQKA 5AI9A 2HPVA 3P5BA 4IIDA 1XNGA 2NYAA 2XMBA 1CQJA 3FMPB 3TRKA 2IH4A 4KQJA 1IZYA 2DFLA 1GT91 3QF4A 2Z2JA 2QVGA 3U6KA 1J00A 4P34A 4F21A 1B6SA 1NQ5A 4YHHB 1P91A 4H2DA 4K6HA 4YDSA 3QX3A 4E5MA 5ALYA 1T0PA 4DDKA 5JAZA 1E6EA 3DE6X 3AONB 5HJ5A 1KYTA 3HKCA 1PW7A 2HIAA 1P6XA 2JLQA 3AHEA 1YNSA 1QGAA 3LMKA 3TLEA 3E2IA 3LPMA 2VR1A 1XZMA 2PY6A 3KOWA 3OQMA 4ZHQF 1AQUA 1EJ2A 1V6AA 4G8BA 2ONKA 3WNDA 1Z17A 4CKZA 1DDOA 3O8OA 1KI6A 3O3CA 4M3NA 5AKYA 3SQXA 2WU0A 2QD4A 3MW8A 4OGGA 1K7FB 4XQ9A 5HIKA 4PZYA 2BM8A 2VTDA 3OZSA 4POAA 3UCFA 4OHVA 4JYCA 1OROA 2J0VA 2PO7A 4JXKA 4QPZA 5TS3A 3JU3A 4PZEA 4YJ3B 4BNNA 1N8SA 2CJPA 3FPLA 4Q03A 5T8KA 2IHTA 4TYWA 1NU8A 2IUEA 1EB8A 2CFCA 3ZYZA 2QD1A 4G65A 3O4HA 3U26A 1FP6A 1C1XB 3A1TA 4R1PA 4MJ3A 4DSTA 4V0ME 3ORFA 3N59A 4Z9AA 4BZZA 1DDIA 1CQPA 3I92A 4M0CA 1F17A 1AIPA 3PWTA 1RZVA 3L8EA 3OM0A 1ZOIA 3PRYA 4QD3A 2LRHA 3PWSA 4C87A 1FJHA 1YR6A 1PHPA 4IXWA 4KE9A 2ZROA 2Z6VA 4BB6A 4E94A 1Z45A 4HNVA 3N8IA 1WCYA 3HI4A 1AKNA 2X7JA 3C15C 1WNTA 4PBTA 3ROKA 4BVJA 2OV4A 3K71B 2PCJA 3HXKA 3MUOA 2X58A 1MO5A 2JFHA 1TLLA 2JGMA 1EINA 2JI6A 2Q0XA 2RCNA 3RRXA 4JXXA 4P35A 3W5IA 3QF7A 3OIFA 3PZBA 2V98A 1MB4A 1P7VA 3ZY3A 3RKRA 2EZ9A 4C29A 2G76A 2QG9A 3UTCA 2DULA 5DI3A 1MLDA 4YMUA 5E6RA 2QN7A 2R9VA 5J4YA 4N7BA 5FBVB 3DZKA 4LYFA 3ROXA 2AFHB 4XPIB 1HMYA 4ZT6A 2GEFA 3RRZA 4GX0A 1DSSG 2OENG 4DIUA 1KYIA 1SJ9A 4EX7A 2Z5FA 2HMTA 3E35A 2HQRA 2VK2A 1P72A 2HY7A 1NJGA 5I7RA 1GG5A 2HB6A 5JEDA 4KQ2A 2CXUA 1KGDA 5JZSA 1N5LA 1LW7A 1CLUA 3JWEA 4M54A 5TVGA 5C1PA 3O7MA 5J4HA 2XNKA 3BF8A 1R8YA 4K28A 3SBEA 4BO2A 2CLSA 4AZWA 2O2DA 4UMVA 3DMTA 4HH1A 4MKFA 1UDBA 2OZLA 4HRYA 3GGGA 3WSTA 1TYEB 1UMCB 2GPYA 2A5DA 4LJ5A 4RHEA 5KYGA 1Q95A 4ZO4A 4V0RA 1CNFA 4P3YA 4GLBA 3HVJA 5JD5A 3U19A 5KNDA 3JX9A 4IJ5A 1R3DA 2VI5A 2HF8A 2IS6A 2A0XA 3GUYA 1XZHA 3T5MA 4WBNB 1AD2A 4UPDA 5L40A 1H1TA 5ALOA 1I2BA 1XCMA 1U2TA 4KRYA 1IPHA 1UBSB 2A1IA 4P4NA 5LBTA 2ST1A 3URMA 3IBYA 2QW0X 1TEZA 1XKLA 2NYVA 4JBNA 3VSCA 3AUYA 4XDZA 1UMKA 4EB0A 3K0AA 4A2PA 5J2TB 1RJWA 4LF7B 1NQOA 3HL4A 3KTOA 3BTUA 2CXXA 1DOAA 1ZZGA 4MUIA 4Y98A 3T9BA 3TLBA 4MKZA 5EUCA 2LTAA 1YS1X 2GBCA 3UG7A 2JFYA 4U6SA 3NWPA 4CPDA 3PR3A 3QY0A 5JNVA 1OH5A 2IXFA 4DR2B 3V4OA 3CZMA 3KR2A 4ZVQA 4QGBA 2SNIE 3B7WA 2DFPA 4EHJA 4UTNA 5ED0A 3WP0A 3HYCA 1MPTA 1NOIA 1WUTA 2DRIA 4BQSA 4XWOA 4RZIA 4NI5A 4Q1DA 3CRW1 2P2DA 3CLKA 3EA5A 1HZZC 5COBA 2H1WA 3M82A 4ZI2A 3DDOA 4PFSA 5EXDA 2HOQA 3GJ0A 4NPHA 4QXPA 3CLRD 2WT4A 4FCWA 5D6NA 4PO3X 3OEWA 4L16A 3H83A 3WKDA 3BT7A 4K6KA 4EHDA 3DCJA 4EO9A 4DCCA 3AVUA 3GPIA 3JAWA 4O29A 2XE8A 1Z63A 3W9UA 1Z75A 4DAOA 4V0KA 2J3MA 2XUJA 5HUQA 3I39X 4KMSA 2YUIA 2Q29A 3CM0A 3EXG1 2FUG1 5B57C 2Z2KA 1HBJA 1YZHA 4XVRA 4W1SA 5TMDA 3GH3A 1M75A 4HQOA 2K2QB 1Y7TA 4G37A 3KFVA 3D0KA 3IE2A 4EG8A 1U2DC 1XLTC 3T7CA 2V55B 4LXGA 1K4YA 1HX7A 1B2RA 5CIQA 1VE1A 3ZXXA 1OFUX 4OSOA 4DS3A 2IHNA 5EZSA 4UZEA 3SXJA 3TIXB 3GLHE 3M9XA 2HO5A 1PGJA 3EDRA 4M36A 2V7WA 3P9NA 2CBZA 1TCUA 2W22A 5JSHA 4JLBA 3WYCA 1XAIA 2RIRA 3H9GA 4LY3A 4HEJA 4F72A 1RTTA 1WEKA 2V9CA 3BC1A 3HQ4O 1Z4PX 5H7XA 5BSHA 4H17A 1BWRA 1M33A 3HPRA 2VP6A 5KHAA 1W4BA 3Q5GA 4BQNA 1JZSA 3GG9A 3H5RA 3QMPA 1VJ5A 3LRTA 2VP0A 4IG9A 1F2VA 5TXGA 3TXYA 3KCQA 2GEUA 5CGZA 1FOEB 4YH1A 1N9GA 4F6LA 2B4QA 1UKZA 3MOGA 4GM1A 1NC3A 1T2NA 3IP5A 4TL9A 3AIIA 3QJYA 4RPGA 2JFZA 4RF5A 4X1YA 1EWTA 3ZQUA 4H7KA 3DZHA 3F74A 3I2KA 1NAIA 4NG4A 4E5PA 5EJEA 1M5RA 4YRLA 4GI1A 4QRIA 2MYPA 4ARVA 3KHUA 2SKDA 3W2TA 1R10A 3TQQA 4LY9A 3IGFA 1NJ5A 3BG5A 3S5UA 4GOXA 3UHAA 4AS2A 2JLUA 4IUCS 3O8CA 4KAFA 1RWWA 1JDJA 2C3MA 4HPXB 6Q21A 1VJCA 1KH2A 3PIRA 4MWSA 2XHZA 3L7YA 1QTIA 1FFYA 4GLOA 3WIUA 3MJHA 3FCUB 3O91A 3LKVA 3E6AA 4MVJE 5CDHA 1U98A 1KYZA 3W77A 1Z6AA 4BN4A 5ELXA 4RHXA 3MWJA 2JJ2A 1O87A 5CIYA 4FE7A 1NUPA 1B8UA 3M1YA 3TNLA 1ZL0A 3OKPA 3FTEA 3I6IA 4UCXA 3IERA 4L22A 5F3WB 3IUSA 5BYAA 4N0QA 2YWHA 4KFRA 1JHAA 5JE8A 4ZEOA 4LRSB 4OBXA 2BKUA 2XUFA 1SCKA 5CVTA 1TMYA 2W2XA 4E0BA 3HKEA 1O97D 2O1EA 1BGVA 2GKOA 4JR1A 3SXPA 4D0GA 1JH8A 2ABWA 3GA0A 3HXTA 2CBXA 2EWWA 2OGTA 4IY1A 4MVWA 5ICSA 4L28A 4EY6A 2GQ0A 1G2IA 4X9XA 1FNNA 4UBOA 2C98A 4J0EA 4YFYA 4H3KB 3TZKA 3GVCA 1Q0ZA 3HCCA 3H9JA 3I2FA 2GCEA 3IJPA 1SQGA 5T41A 1PZEA 4HLQB 1Y33E 2VF4X 3FDZA 1UM9B 2O7QA 1SZCA 2GRUA 2V03A 3CONA 1O77A 4GYKA 5F23A 3TG2A 3BA6A 4KQGA 5J2TA 2NPFA 5EMLA 2P11A 3I1JA 2VJAA 3QFCA 4Z86A 1U11A 3TBHA 4N4AA 5FIUA 1E0AA 3B82A 3EEYA 3ET4A 4GYJA 1R8QA 1PV1A 5A05A 1O57A 2IFTA 5GGYA 4MYUA 2J67A 3RGWS 2Y4NA 2I65A 4FILA 1SC3A 5IDVA 4EFNA 1V2GA 3EA4A 3QYAA 4OJKA 5IULC 2P79A 3QPDA 2ZWVA 3AYXB 3LJKA 1QFMA 1KMHA 2VH2A 3LP6A 3P5SA 1L2TA 4FP9A 3ZG6A 1OZAA 1L5NA 1JNYA 3SQDA 1B8PA 4QG3A 3OJLA 2FMKA 1P7CA 1X7YB 3GJ5A 1RZRA 2HA3A 4Y2VA 2ZEJA 5JG7A 5DMHA 3M5DA 1SVKA 1T8UA 1EFCA 1GKIA 2GFIA 2ENWA 4FHEA 1L4HA 4IXNA 5LSAA 1P60A 1XDGA 2YXBA 3LCMA 4KH1A 3TW4A 4MWBA 3TSCA 1CRWG 4LDQA 4TXJA 4KTVE 5FL7D 3UJ3X 2OC9A 4DFDA 4E33A 5KU1A 4PHGA 2YV2A 1OX4B 2R62A 4JJZA 3KKZA 3VTAA 1BDIA 4EITA 4F3YA 5CA0F 2YHUA 5JRJA 3QQ5A 2ZYAA 4E5NA 4HB3A 3LPCA 4QJ3A 2VPXA 1VHTA 2RKWA 3D8TA 2F9FA 4ZU3A 3TYXA 2LVBA 1HFJA 2QT9A 3ILXA 2BI8A 2G5TA 2ZRQA 2ZS8A 3OCZA 1Z7WA 3AHIA 3BJRA 2XE7A 3AINA 3JWHA 4PGFA 1TMOA 1BMTA 3OU6A 3MVEA 5AD1A 1RJ9A 2IHVA 2I4OA 3O8OB 1NXSA 1GGEA 1Q3KA 5EHXA 2HK8A 4O2BB 1QKJA 2AOTB 2QG6A 1RC0A 1YJAA 3KYJB 2YHBA 4GZ6A 3ONFA 5L3VA 4ZZ0A 2H1LA 3OUUA 1KZ9A 1J9EA 2VBFA 3LKDA 5I7AA 2AOVA 3OE5A 1G42A 1TTTA 1O1YA 4GL2A 4XX0B 3KJHA 4C3OB 3H11B 4NBNA 4RTJA 4RMIA 4WLEA 2GZSA 2WAAA 3PJEA 1NPYA 3QPWA 1KK1A 4QTTB 5E1BA 2EZ4A 4BJ5A 4CQNA 4ODIA 4WESB 5FBHA 2XLBA 5IK2A 5JECA 3LQQA 5HF5A 4Z3KA 5BV2P 2V4UA 2PBFA 2Q5FA 3RT1A 5CK5A 1II0A 2ZWMA 2IEDA 3NRBA 5CURA 1HI9A 3ZWWA 3TLJA 3B6EA 2YMQA 3B1WA 3L6RA 4HVLA 1NBMA 1R37A 3HU2A 3Q7SA 5GZ3A 3FUCA 3H5NA 1IH8A 1U2RA 3K70D 4E15A 3VGPA 4HAXA 3FNQA 1ZSNA 3U3JA 1K3UB 3KBOA 1NJSA 1V5GA 4RCVA 2O8DA 1HRKA 1SU8A 2WYVA 1R0LA 3CB2A 2JH8A 3D0OA 3HJRA 5H82A 2O7RA 4IQFA 4Y6SA 3G89A 3O75A 3TR5A 2D74A 3FCSB 1DT5A 4ZJUA 4Y6OA 5BSTA 4ECEA 2PT6A 1QRSA 4MGYR 4NYIQ 4Q1AA 3ENWA 3F8SA 2IZ6A 2I2FA 4IJVA 2FYTA 4LMPA 3H16A 4FHDA 4H18A 4HLUA 1II9A 3KNZA 4HUQB 1FFHA 2ZGVA 4Y6RA 4PCVA 1H3EA 2NADA 2J6BA 2HK9A 2C7QA 2OV8A 3O2SB 3ZVMA 4HLUC 2PGOA 4TYMA 1M10A 5LM3A 3ZEIA 5LQJA 1R16A 4BLRA 5C18A 4JMLA 3UXMA 4IFBA 5K6AA 3DM9B 1A8IA 2VHYA 3ZNQA 1U3FA 1OGJA 2FWPA 2XW6A 3R0ZA 5EHNA 2C77A 2BHSA 4KQ9A 4OHCA 1KJYA 2C9BA 4FOSA 1R4MB 3TFQA 4IXMA 3E05A 4KQMA 1LUAA 2ZB3A 1EDOA 3LPNA 2QMQA 2IEGA 3R8CA 2BFAA 5J2UA 3GROA 2YDYA 3BERA 4J0DA 2D7CA 4PINA 4PTLA 4BUCA 1QG0A 2AUTA 1T5BA 1EQAA 1E7WA 1C7JA 1Z7BA 2ZIWB 1DJPA 1T36A 3EXHB 4BVBA 2BELA 4ZCRA 1BOOA 1EAMA 5CCXA 2RCYA 5C8YB 3ESXA 3PYXA 2OORC 4PICA 2YN4A 3QIVA 4WFKA 1UC9A 4IIHA 4PVDA 2E4ZA 4UHKA 4WCDA 2QM8A 1NT4A 3A3NA 4HBGA 5CNKA 3JR3A 4IQ0A 1MW9X 4N5LA 4REQA 1XO1A 2RGXA 3L05A 1F1BA 1R0ZA 3TFOA 4C20A 4EJ0A 3R0VA 1ZGAA 1K68A 1OUMA 2A7XA 1TGYA 3G1TA 4MQEA 1FL9A 4UM9D 5A7HA 1YWGO 1RC1A 1SCQA 2O2GA 3PJDA 4KG7A 4L9WA 2YXPX 1M2FA 3PD1A 2JCSA 2O3QA 4D6XA 3UAYA 2FN8A 3KQUA 1MEEA 4PR0A 1TTQB 1KPGA 2AOXA 5AESA 4BRUA 3W5JA 5HFNA 3T3GA 3NYQA 1ST3A 4U7TB 1KE2A 4YXWD 2HU8A 1U1IA 4GMDA 1R50A 2XXAA 4ZO8A 4YPFA 3RIGA 1CRQA 3UWMA 2B1QA 1UBKS 4KODA 3DB2A 3WLKX 2FEOA 2Q4DA 3RSLA 4C5BA 4R2MA 4KXWA 4RNCA 2EZTA 3M6AA 1FZTA 4G5FA 1C1XA 1D5WA 5DCYA 4EBBA 2EKLA 5LU8A 3P9SA 5I5EA 3KEGA 1JR3D 1LW6E 5C8YF 1S2MA 3VR5A 2XKJE 3JQAB 2I7DA 2K87A 3NKVA 1WSBA 1TT5A 4BNDA 3IE1A 1KR2A 1YR2A 2WICA 4WJLA 2W48A 3DTNA 5G41A 2I6SA 1FJXA 5A0TA 3RRJA 1JXQA 1L5FA 2QRMA 1QGUA 2JASA 2VDLB 3VPFA 4DY6A 3GFQA 2W9XA 4QODA 2FI1A 1TF7A 3AL2A 1JEAA 1NVFA 1G3UA 4TWBA 3LSYA 2IV2X 4W5QA 4U7DA 1MPXA 3ZHBA 3GDWA 3OOSA 1A9ZA 1ST2A 1CERA 1JKIA 2R7KA 2XOXA 3ABZA 4Q4JB 1PSWA 2WM3A 3BTOA 5JMPA 3JD0A 4BXOB 3ZW7A 5CXQA 2DQ4A 2ECQA 2EIHA 2O14A 3G5LA 1HE1C 2PAAA 3PXXA 3K0FA 2QB5A 3MQ2A 3UHOA 4OMFG 1XNRB 2QMOA 1V8ZA 1IOZA 4KPUA 3FFWA 1WW8A 2X9LA 4OJQA 4GHWA 4EY5A 5HOEA 4XWYA 2ZU0C 2ZSFA 2NO1A 1FUEA 3N8KA 5FPSA 1JJ7A 2G3YA 3CPJB 4BTVA 3GVPA 5CVEA 3PEEA 2MDTA 4NCJA 5CG2A 2HRDA 1WBJB 1WHSA 5CNIA 3B9QA 2C0PA 1ODKA 2EG9A 1ZGJA 2VK4A 2WWWA 2W2KA 4M99A 4Q7MB 2XCRB 1MTOA 2WVGA 3A4TA 3ONEA 3OPNA 4G89A 3CLHA 4IMPA 1YZVA 1RE1A 1W48A 3GPCA 4LZLA 5BQPA 1FMCA 4W5HA 4K9PA 4C0WA 2YUTA 3N3AC 4OKSA 2ZSJA 3BN3A 3EC2A 2C4MA 4Q02A 3WZMA 5JDIC 3EFOB 2B7CA 3ILYA 3CVJA 3SZGA 2VPTA 3TE6A 1N5RA 1PR2A 3IUPA 2HMVA 4MO9A 5FA6A 3BSFA 2CKMA 2E4YA 1PAUA 3VR4H 3G88A 3E8MA 4GZ5A 1FU8A 2H31A 3E1GA 3O8BA 3OOJA 2F90A 3EIUA 3VYVA 1S7GA 4A03A 1CYEA 1EVLA 2VF8A 3KPVA 4KK4A 1OSNA 5DXJA 2OAQ1 3FMVA 2YWRA 5HPYB 2ZRNA 3AHFA 4CF4A 4LNUA 5JI3E 4UUAA 3GPBA 1FYFA 5TQ0A 1WW3A 2OBMA 1J9ZA 4FLEA 4MW1A 3EC1A 3KFLA 4RKYA 5CIWA 2GGSA 2CMHA 1KVQA 3BMOA 4LXUA 4P7GA 2E4XA 3F67A 1OPXA 3CRVA 4XD7D 4J7CA 4AJ2A 2GK3A 5EWJA 1ZGGA 1F2TA 4IW3B 2DWCA 3Q7TA 3CX3A 1FX1A 5ILQA 3DE7X 1TMGE 1Y3AA 2ON6A 3EDOA 3QITA 1WUIS 1OLUA 1QSGA 2G77B 2I6GA 2Y1OA 1ADFA 3C74A 2GK4A 3B8HA 4U4AA 5LZ8A 3LWDA 3IKLA 2HJ9A 4BKPA 3STTA 4AXXA 2IH5A 4PN3A 3LQYA 4YUXA 5KVCA 1NIJA 3HA2A 2O20A 3ZWNA 3LZDA 2HU7A 1K92A 4EZIA 1KFKB 5DRTA 3TZLA 3IAS6 3DPUA 2VZ9A 4P4SB 3TLZA 5EUBA 3GCWA 1XZDA 4JJ4A 1RLOA 2W8BB 4LMBA 4RF4A 1P1BA 4R4JA 4WW0A 3JV7A 2X1VA 4KGVA 4LUCA 1N2HA 4F97A 2PPVA 3ZJUA 1XROA 4R3WA 5IF3A 2WIDA 1JGTA 2VCHA 1MHTA 2A1UA 4MS3A 1SH7A 5LMZA 1EXDA 3CB4A 1Q1EA 3WGTA 1NN5A 4RHYA 3QKSA 1FJ2A 3E9CA 4KFUA 1BOFA 3P9RA 3PXEA 3ZE1B 4D3YA 2QP9X 1YMVA 4BFZA 4D25A 1JMKC 4CLRB 1OI2A 3EWNA 1CBUA 1LWNA 1X1DA 3P8ZA 4OQPA 5DCWA 3JASB 5COQA 3RBZA 4REOA 1YASA 1W85B 1PNVA 3U39A 821PA 1Z0KA 1ISSA 2E37A 1H8HD 1T2EA 1M74A 3E3NA 1KZ1A 4CHTA 2CE2X 2NQ8A 4KMMA 1C41A 4H4EA 3L6DA 3G02A 4H3VA 4ZU1X 1JLKA 3I72A 4J49A 1L4UA 3B3JA 1MB3A 3OEHA 3CEMA 4MP8A 1J99A 4IV0A 2VDPB 1EP1B 5CH8A 3IIJA 3U40A 1DKMA 5M34A 2QK4A 4MULA 3O8NA 4F6RB 2ODBA 5LIRA 4G5XA 2D7DA 1VIMA 2XB2A 3WLAA 3DUFA 2DUNA 4WCVA 1BU8A 4D8WA 2RJ3A 2GHQA 5J2UF 3CGWA 3N2ZB 1RRGA 3GAAA 1P9LA 4J0JA 2JLYA 4WK0B 4Y0NA 2EX4A 4Q12A 3WNBA 1XWWA 3EX7C 3EEOA 2ZRBA 4UBMA 2C31A 2GA8A 4NE9A 4BKUA 1UINA 3ENZA 5IFLA 2H5LA 3KAKA 3MTJA 4LMAA 2N1MA 3LFHA 4KW7A 5CX1B 3HBNA 3H5AA 4JKIA 1MAWA 3K5HA 2YY5A 4WFJA 1ISPA 1YO6A 3GLIE 1GEEA 2CMKA 2VXCA 2VQFB 2XUQA 1DT3A 1UZLA 1E1CB 1XDUA 2IYLD 2B4AA 2Q07A 2MIIA 3JQDA 4NCIA 2Q3HA 2AE2A 4YJ2B 2NU9B 5L9AA 1J25A 2FG7C 4AT1A 1KQFA 2NSDA 4O08A 1BEUB 2F4NA 3K4QA 3N53A 2F8LA 4K9RA 4ZALA 4WZAA 4R84A 3T5CA 1ES9A 2VPZA 4XFJA 5CXUA 3KKOA 3W2IA 1ZBQA 3WYEA 4ALNA 1P45A 2PVPA 2IBTA