1J90A

Crystal structure of drosophila deoxyribonucleoside kinase
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
195
structure length
195
Chain Sequence
TQPFTVLIEGNIGSGKTTYLNHFEKYKNDICLLTEPVEKWRNVNGVNLLELMYKDPKKWAMPFQSYVTLTMLQSHTAPTNKKLKIMERSIFSARYCFVENMRRNGSLEQGMYNTLEEWYKFIEESIHVQADLIIYLRTSPEVAYERIRQRARSEESCVPLKYLQELHELHEDWLIHQRRPQSCKVLVLDADLNLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Deoxyribonucleoside kinase
publication title Structural basis for substrate specificities of cellular deoxyribonucleoside kinases.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 74
structure length 195
sequence length 195
chains with identical sequence B
ec nomenclature ec 2.7.1.145: Deoxynucleoside kinase.
pdb deposition date 2001-05-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1j90A00
1XMIA 3K0AA 3AP2A 1V43A 2ZI7A 3CB4A 1KI6A 1GAJA 3A1UA 4KITB 1OB2A 2WWGA 2OE2A 1WE2A 4TQUS 1R4AA 1W47A 4BLSA 2ZRFA 1H8HA 1G4UR 3OE7A 4LGMA 5CITA 1MV5A 1ZNZA 4AKIA 1EWRA 3EG5A 2GILA 2V54A 2VF8A 3VR1A 1ZMXA 2XNDA 4GPTA 3W9YA 4H1UA 3ZZTA 2QPTA 3ONWA 5L3SA 2AD5A 2JLQA 4M1SA 4RJLA 4LYFA 3U7EB 1LFDB 2KJQA 2NZ8A 3NBXX 4D81A 1KMQA 4EPXA 2IXGA 2QY9A 1YR7A 4NZYA 1E0SA 2Q21A 2YZ2A 4OK5A 4MYTA 4NPHA 3VKWA 3FHTA 1A1VA 1JJ7A 4C9BA 5IDVA 5J4LA 1ZNYA 2WZQA 1H65A 221PA 5KSYA 5A0FA 3PUWA 3KKQA 2AWNA 4OQXA 2FF7A 4C0HA 2YWEA 1N6IA 3AEZA 3S1AA 2ZS8A 3D7MA 1NG1A 2KB0A 1Q1QA 4IVPA 2REOA 4PR0A 4ZDJA 4JLNA 4LHVA 3GLFA 3L82B 3U44B 1X1SA 2VHTA 5BQ5A 1UKYA 2D06A 3GP8A 4TYQA 4BEBA 1EX6A 2J7PA 2CXXA 1RRPA 2C99A 4EPTA 2DPXA 3L2OB 3Q5EA 2GDJA 4HDOB 3CZQA 1SVLA 1FMJA 2WWIA 3L8YA 3SNHA 4JLBA 2IW3A 3LXXA 3KFXA 2XTNA 3CRMA 4NCJA 4CW7A 4TYWA 4I1OA 1MRNA 2SHKA 2IS6A 1E2JA 2VO1A 3CPJB 1XEFA 3IBYA 4DUGA 2ODEA 4PO9A 4D4LA 4EFNA 2OV2A 3R9WA 4PPNA 2Z83A 4LYJA 1II8B 2HYIC 3KFVA 2O0JA 2AR7A 3ZD6A 5F98A 1GFIA 3A1SA 3GJ5A 3NBYC 2FOLA 3LBIA 1NLZA 3AVQA 2DBYA 2ECKA 3CLVA 5JJKA 1KJYA 1UAAA 2FGJA 4TLCA 5FOSA 1P9NA 1F6BA 4ASUD 1ELOA 2EW1A 3B6EA 3I62A 3B7GA 1LF0A 2FSIA 2AKYA 1XF9A 4EDHA 4EAQA 3KJGA 2WOJA 3CX7A 3DMDA 3K8YA 5H8WA 3FMFA 1XMVA 3UXMA 5LB4A 1HTWA 4DSTA 2GETA 4V0MA 3THWB 4Q00A 4RSGA 3H84A 3CR7A 1W36C 3ZYCA 2WVJA 1OPXA 5TXGA 3DOEA 4X8HA 4TLEA 4QG7A 2GAOA 2EFGA 2CBZA 4V0LA 1YR9A 5TY0A 4WOPA 4TMWA 4C0AC 2OXCA 3JVUA 4OI1A 2XZLA 1NG9A 5KU1A 3RABA 4KBGA 1UBFA 4IFEA 4TLAA 5FUYA 3THYB 3EASA 4TZ6A 4MQBA 2HF9A 2QE7A 1BYUA 3I32A 2VP6A 1P73A 1N6KA 4B74A 1IY2A 3PEYA 4PXAA 2WSSA 3B1ZA 4DLWA 3JZAA 1MO4A 4BLTA 1SHZA 1I4DD 2G1KA 4LY6A 1KZ7B 2RGBA 3RVBA 4B75A 3GEEA 1P9RA 1UEJA 2CLSA 2ZSDA 3U7FB 2VP2A 5EE0A 3UMRA 4KHZA 3M4YA 4M53A 4BE7B 3PITA 3SQXA 2QL6A 1OLOA 4URWR 1JQLB 3OZXA 4BFUA 2QG6A 1D6JA 3Q9LA 5M04A 2Q3MA 5ANRB 3AVUA 1MRSA 5TB5A 3TQCA 4RD2A 1ZM4A 3BFVA 4RY2A 4IOKA 4ABYA 4PZZA 4WXPA 2JLRA 2WJJA 2KSQA 5E4FA 2ZE7A 1J90A 3OEED 5EUMA 5FTMA 2C9OA 1HT1E 3LV8A 4KBFA 421PA 2QPOA 4KLZA 2A5YB 4HUQA 1OH8A 1KI8A 2KWIA 1OF1A 1XJCA 1KDRA 2ZYWX 2O0KA 1U81A 4NL4H 2Q3FA 4Q4HA 5KSPA 621PA 4RKEA 3KKMA 1WRBA 2AX4A 3PUXA 3WYFA 1U98A 2YOHA 4XSGA 3UIEA 5C1BA 1E0KA 2R6GA 4QFMA 4P33A 2EWWA 2CK3A 5FL7D 4QHYA 1Z6TA 4PHHA 2AK2A 4GNKA 4C3ZA 5F9FA 1E2DA 5DYIA 1ZM9A 4IXMA 4F4IA 2UZ3A 1NSTA 4QM6A 2IWHA 4WZBE 2GEDA 4BLOA 1SXJD 5FBQB 2W2VA 1NY6A 2JDID 3NTUA 4PQFA 1US8B 721PA 4ESVA 4P32A 3ASYA 4L16A 3IBGA 1KGDA 2ZRPA 4V0NA 2NPFA 1U8ZA 5C2JB 1X3SA 2P5SA 4URYR 2AXPA 4MRVA 3B13B 3AVTA 3GJ0A 4GOJA 1OXXK 5JECA 3IPXA 2QTHA 3LRPA 1II0A 4OQNA 3VHXA 4MGKR 4PQYA 1S1MA 3NH6A 3Q8XB 4Q21A 4F38A 4XTCS 2D4HA 4Q1EA 2G0NA 5H1YA 1G3QA 3VNUA 3WXMA 1RJ9B 4Q47A 1OFTA 3C5HA 1F2TA 3B5JA 4NYIR 4JJZA 4Q1CA 1T3SA 2DB3A 4XVUA 1W48A 2P67A 2RGDA 1GTVA 3U3KA 1ODFA 4AK9A 2FDCA 3MLEA 4IKEA 3LNCA 1NMYA 1QG2A 2ZR9A 2OM2A 4ESHA 3A37A 2ZRLA 4Q03A 4F91B 4LJ9A 1R6BX 1KY3A 1M8PA 2NO0A 1MABA 2QQEA 4LUCA 1WQ1R 4OHVA 2FX3A 3K70C 3AVXA 2CLCX 2F43B 2RGCA 4EIWA 5CJ2A 2RMKA 1P72A 2H7VA 1AA9A 3IILA 5LD2C 2RGEA 3KTAB 1Z47A 5FTJA 2DHRA 4EJSA 3ND9A 4TTQA 5FBVB 3U5ZB 5FR1A 3HP1A 1QHHA 1W36B 3OIUA 2NZJA 4ARZB 1X8JA 5EQTA 5J4YA 3KQUA 1IY0A 1TQDA 3QSYA 5FH9A 1XBTA 4N3NA 5JSZA 2BJVA 2VF7A 1TQ6A 1VECA 2IBMA 2VLIA 4WXRA 5DI3B 3MRSA 3VQTA 4KCGA 5EUQB 3SU8A 1D2NA 1DARA 4JYCA 1I4TD 1XXHB 2CL6X 1CR1A 5IF9A 2HLDD 4XIGS 4LBZA 3ZH9B 5EJEA 1G5TA 2IHYA 3A58B 3UG7A 3CX6A 3K9NA 1MR3F 1COWD 2XZOA 3K0FA 1XJ0A 4DIDA 5JJLA 3FPAA 2VH5R 2QP4A 5FUWA 1R5BA 2W6ID 3AKDA 4A6XA 4LV8B 4HUTA 4JBWA 1Z22A 1Q1BA 4KU4A 5JEEA 3QF4B 3MD0A 1T4GA 2OUKA 3EZ7A 1R0XA 4KV9A 1NMZA 1F2UB 2HEIA 1E4VA 3EZ6A 3REGA 3K53A 3TSZA 4WZ6A 2HT6A 4QGHA 2IYYA 1EESA 1BMFA 2W2TA 1TMKA 3FVQA 3W6PA 3I5YA 4ZCIA 1JEEA 1I2MA 3ZLJA 2G9NA 3RAPR 1C4OA 2X19A 4OJQA 3EX7C 1SKYB 2OFOA 3B8HA 3WBKA 4YDSA 2OO7A 2QT0A 5HKKD 3FMOB 4Q48A 1G8FA 1DOAA 1Z0JA 1E2MA 2QM8A 3GJ3A 4Q1BA 2B8WA 1JXMA 2IYUA 2UKDA 1DEKA 1IHUA 4KYIB 1JR6A 1SQ5A 3GPLA 3N5CA 2CNWD 3B82A 2QBYA 3KB1A 1JI0A 3W3AA 1XD9A 1GUAA 1FTSA 1G3IA 2F9MA 1IONA 2JIZD 3HPRA 1NBMA 3EIQA 4ZV4A 3DEFA 3K9LA 5DLQC 3AVYA 5FPYA 2C95A 2CLDX 2GA8A 2D3WA 4Q4AA 2QMUA 4DRZA 1AZTA 1TQ4A 1U99A 4IRUB 1R5OA 5AUNB 4D0LB 1IJEA 1Z6AA 3PCRB 4DCUA 1NRJB 2XB4A 2IT1A 4JLMA 5BW8A 1G3MA 1OFIA 4LBWA 2H1LA 4B3FX 1VG9B 1W2HA 3RSLA 3QKUA 4B3GA 5EZ6B 3EPJA 3U7HB 3ADCA 3CRQA 4HZUA 2GEUA 5HCNA 3M1IA 1L8QA 1N5IA 3IHWA 6Q21A 5KO2A 4V0KA 1SXJA 2AFHE 1KDTA 3QKRA 1JR3D 3QG5A 1XRJA 2NO7A 2E9SA 4LJ5A 1N25A 3HPQA 1ESMA 1E79A 2CHQA 5IT5A 2OCYC 3O8BA 2VHQA 4Q9JA 4TT3A 3W5JA 1IOZA 3IO5A 5KHOC 2O8FB 3QXSA 3W3ZB 1AQYA 1M2OB 3BORA 3D3QA 2ZS7A 4CT5A 1IN5A 2WPDD 3HU3A 2IS4A 4FMDF 4GI7A 1LTQA 1E2IA 1U9IA 4OBEA 1N6HA 3P32A 4BFSA 4O3MA 4NCHA 1E4YA 5LB2A 2ANCA 5SZJA 1E2FA 4GP6A 5CDFA 5JS7A 3PG5A 4G5QA 4LK2A 4DLTA 4A4DA 4LJ7A 3SOPA 3GLFE 3TUZC 3PJRA 4XSHA 1CULC 3AKEA 4YONB 5JWRA 1GWNA 1FPMA 1P4SA 2J9RA 5EE3A 1KTVA 3UMSA 5EP4A 5BN4A 1YQTA 4A0HA 4XWKA 3C8UA 2QAJA 1SGWA 4UNQA 1EGAA 4QHTA 5FI0B 2XTZA 1R2QA 3ZJYA 2B8TA 1TADA 2MSCB 4R2IA 3CWQA 3K70B 4Q7KA 5G3ZA 5TARA 3WNCA 3DO6A 3MCAA 4GSYA 5J4VA 5LD2B 2OCAA 4Q1FA 1U0HC 2WWYA 3GLHE 1DO2A 5EP1A 4JVSB 1BH2A 5EXTA 1QHGA 2JJ2A 3CF2A 4OQFA 4KO8A 2A9KA 2PZEA 1K5GA 3B1WA 3UWOA 3K0CA 1T8UA 3KDSE 3TVTA 1ZU5A 1P6XA 3MWKA 4TYYA 2H8KA 2FSFA 3ZVNA 1H8HD 1G7TA 1E9CA 1VCIA 1E6CA 3WRYC 3DVLA 2QENA 2F55A 1E9SA 5DIFA 1KSHA 3CX8A 4M9ZA 4M1KA 3U61B 2XNDD 1EWQA 1FTNA 2CE7A 2ZI3A 3EAQA 3RS2A 3IUYA 1JAIA 4C2TA 1P61B 1Q20A 4L9WA 1OXVA 4B33A 3OF5A 2J0UB 3CNNA 1JXOA 4CDGA 5C18A 3FDIA 1JEDA 4D0NA 1NIPA 3AH8A 3LY5A 2A2ZA 4U02A 4EPVA 3QBTA 3B2EA 5A4JA 2ZI4A 2ZRMA 5DYGA 1WB9A 2PH1A 3AUXA 4PO8A 1LS1A 1PLLA 3G5UA 4TTPA 2ZJAA 1II8A 2V55B 4DEXA 4KSCA 3B1VA 1JJVA 4F4JA 2RAPA 1XTJA 3RWOA 2VIIA 4LWZA 2WJGA 1G6HA 4OQLA 4YMWA 2D2FA 5GJWC 4B48A 4QBIA 3TKLA 2QQ0A 4LOAA 4WZAE 3WP0A 1IXZA 3O8DA 4RZXA 2IA5A 2IEYA 4KFSA 2JEOA 1JQJC 1RFLA 1TF5A 3OESA 1FNNA 4G5RA 2PX3A 3NXSA 1G8GA 3N2EA 4X8OA 3I4LA 2J7PD 1XTKA 2R62A 3K1JA 4Z8XA 1KO1A 3FHOA 3W90A 5CYOA 3TUJC 2BOVA 2ZANA 4EQ6A 1QHYA 3CH4B 2BBSA 3I3SR 5CYPA 2NO9A 1G41A 5E7IA 2AHOA 1AKEA 4NYMR 4RZ2A 5L8VA 3ZD7A 4DUGD 2BC9A 3KUCA 2Q9CA 1W4RA 1VG8A 1W46A 2R65A 2VSXA 4XWAA 5JRZA 3NBFA 2RGGA 4GDFA 4AC9A 2FEOA 4H9GA 1TNDA 3THYA 1ZM7A 3E70C 2YC4C 2XZPA 3GEHA 3LQQA 4M22A 3EZ9A 4PPGA 4JMPA 2MSDB 1R0ZA 2J0QA 3C14C 1S1CA 2OLKA 2DYKA 4RD4A 4DLXA 2MSEB 1W0JA 3W6NA 4US2R 4O2RA 2IYVA 5EZ5A 2RB4A 1N6PA 1LF5A 2VL7A 4MRNA 4RFVA 1B0UA 2O8DB 5AUPB 1SZPA 4W5WA 1UKVY 5CM8B 2ZROA 4ZIRA 2QRNA 1JR3A 3LH5A 3WMGA 1OFHA 1E1QA 3VKGA 2JAQA 1KK3A 3U3JA 2XNSA 3B1YA 1NP6A 2QNRA 2V7QA 2IEZA 4KFUA 1YZQA 4W5JA 3K09A 3D6TB 4HZIA 3ZDQA 1IQPA 1ETUA 2DR3A 2IWRA 5CB8A 4NU0A 4IDPA 4FW9A 4UNNA 5LPNA 4MUBA 3FGNA 2IHBA 1VTKA 3BK7A 1M7BA 4B44A 3OIVA 1VYVA 2O8CB 1LW7A 2C98A 2E87A 3LX8A 3N70A 4Z8YA 4D2IA 2J0VA 5DI9A 1YE8A 4UXJA 4DEYA 2PMKA 5JEDA 4JIMA 1AQUA 2AXNA 3EPKA 1HQCA 1NVXQ 2QE7D 4TLBA 4CEIB 3KKNA 2O8BB 1NSFA 2FFQA 5FOUA 1KI9A 3GQBA 3QENA 1OYWA 1ONBA 2ANBA 3KZ1E 4NYJR 1KMHB 1E9FA 2GJKA 3BFKA 3EC1A 2WSSD 2PEYA 1NI3A 1E69A 3MGCA 1AS0A 2G88A 2WJHA 4YQFA 3IDQA 1TUIA 4S2EA 2Q0HA 3IIMA 1DAFA 3QY0A 1G291 4LBVA 4OHYA 4G01B 2C9YA 5AJYA 2IF2A 1TEXA 4AI6A 4MITA 4QHSA 2P2LA 1BYIA 3WHKA 1DELA 4KXFB 2BEJA 1ZW6A 1RRGA 3PR1A 4I81A 2KE5A 1NVVR 1US8A 2V9PA 1NLFA 3W8RA 1UDXA 1Y3AA 3R7WA 2IS2A 5GVSA 1W44A 3OAAA 5GJVC 4CEJB 5KDLA 2QAGA 1AS3A 1T9HA 4FMCF 2F1JA 3Q85A 1XEWY 1ESNA 4B3CA 5FPSA 3GLGA 1VYUA 3CBQA 2QMEA 5D3MB 4CRWB 4Q18A 4AKEA 3QVUA 4Q4JB 1R10A 4K8OA 3FOZA 1IAQA 5FBLB 1FFHA 2GAAA 2QTFA 4GZLA 4N0EA 3LO5A 3LX5A 2CK3D 3TW8B 3KJEA 5HZHA 3HR7A 1E96A 2A30A 5FTKA 3VR6A 2YWGA 3L0PA 3KQKA 3D31A 4C7OA 2ZAOA 1IN6A 1QF9A 1VG1A 1YKSA 1NY5A 5F3WB 3MSXA 3AVVA 2J59A 1TEVA 4E03A 2PCJA 5HZKA 3K0EA 1YZGA 2ZSEA 3T1QA 2D2EA 1X8KA 1M1YE 2WM9B 2XSZA 3EWSA 1HYQA 2ZI9A 3FB4A 1YZUA 4P4UA 4WIAA 3QIAA 3I61A 1F48A 1WDTA 5FUVA 5JBQA 3RC3A 4E22A 1JECA 3RHFA 1Q1ZA 4OI4A 1ZNWA 4B47A 3NC1C 1E98A 4P31A 3WY9A 1TU3A 3LXRA 2R44A 3MAAC 5DH9A 1RYFA 4B3XA 1KO4A 4MKGA 2ZRBA 2Q6TA 2KBFA 4MDFA 3ICQB 3KXLA 2P0EA 2AFIE 3BAFA 3GFTA 4TYPA 2ZE5A 4GFDA 2JJ1A 2HUPA 4OI0A 4BEJA 1JNYA 1HE8B 3H1TA 4PANA 1EXMA 4AD8A 4WBSA 4B2LA 4KI0A 3U6BA 4HAVA 3L0SA 2QP3A 4JLVA 3BC1A 3MFYA 1VCOA 4HI0E 2W0MA 1Z83A 2QPAA 5DO9A 3X1YA 1G6OA 1Z0DA 3VMFA 3PXGA 2V6JA 3SE0A 1S9DA 2CMKA 1NBME 3Q72A 4MRPA 2L0XA 4G5GA 4ITRC 3P1JA 3OFNA 5EXXA 2ORWA 3VU9B 3EC2A 1JAHA 1PVOA 3THXA 4FWTA 3FMPB 1XMSA 4XTRA 2YKGA 2BM0A 1AZSC 3SYNA 1LVGA 5KNBA 2ZJZA 1E9AA 3QXXA 4UNRA 3QVVA 2XJ9A 1F2UA 2QROA 3BH0A 3VHLB 1ZUHA 1SVSA 1M6NA 4RD6A 1RRFA 4DLVA 4Y0AA 4JJKA 1IN4A 1N6RA 3EARA 4BLRA 1YVDA 2NGRA 1X8LA 1OW3B 4QNMA 5E3HA 3WBJA 2FJUA 4DSNA 1IXSB 1XCGB 2VTKA 2FWRA 3VTKA 3AV0B 1FZQA 4NBSA 1M34E 3SQWA 1WP9A 3X1DA 5JWHA 2GTPA 2Q9BA 2IUTA 4US0R 1XZQA 5FPKA 5SZHB 1GRNA 2ZRGA 1SXJE 2QGNA 1PUIA 2ZUBA 5JCZA 1Q57A 2OZEA 5CK4A 3CNLA 2V1XA 1Z63A 4HEJA 3GJ8A 1GILA 1U2RA 3RRYA 1KKMA 3P26A 2FMXA 4A8JC 3SBDA 1PV4A 2FN4A 4O0MA 2FH5B 1HQYE 4CGZA 5KTYA 2YINC 2MMCA 1PZNA 4ZDKA 5HR5A 4FMDB 1TF2A 3WNBA 1PLJA 4B3BA 3MJHA 1KO5A 2WAYA 4BFYA 1N5KA 4TMZA 1W7AA 2FGKA 1CJMA 1YR8A 1J70A 3AKCA 3SN6A 3MG9A 5CDFE 1WBDA 5JI3E 2CHGA 3E1SA 1P7CA 2WWXA 4Q9LA 4TLDA 3EZ2A 4YDHB 3LVRE 3DDCA 5EE1A 4Q66C 3QKSB 3VFDA 4ZI2A 1BMFD 1FQJA 3VR5A 4B76A 2JLWA 2XXAB 3LAWA 4NCIA 3BWDD 2GBLC 5FI1B 3LW8A 4EKDA 2GEVA 1NN5A 4U7DA 4CEHA 4Q7MB 2A5DA 1OXSC 2IC5A 5JMTA 3RRNA 4BFZA 1XMJA 1XTSA 2GCNA 5AK0A 4D82A 1ZP6A 1ZUNB 4Q9IA 1CR0A 3HYTA 5JJIA 5AJWA 4P4SA 1KK1A 1HT2E 1FUUA 2JJ8A 1MOZA 2V4ZA 3KX2A 4BRUA 1GNRA 4A1FA 1SULA 4DLZA 4DDWA 5BN5A 5JLJA 1W49A 1NBMD 4DCNA 4GL2A 1P60A 1RC8A 3VX3A 4HLQB 2ZYVX 4BPBA 1ZYUA 4OQMA 2IYWA 3KQNA 1YZNA 5F2EA 1E3MA 4LHWA 2YJTD 4PTLA 3AF3A 2A5GA 2ZAMA 4ZCMA 2ZUDA 2KBEA 4DDVA 1E2GA 2HJVA 2RGAA 1ZD9A 1MH1A 2BBOA 3WRXC 1KDPA 1FX0A 1KZGB 4YMUA 4L8GA 3B9QA 3B85A 2P3SA 4LV5B 1OKKA 1DAGA 4B35A 1X6VA 1R7RA 4LJAA 3KKOA 3VNVA 1VCNA 1G8HA 4QGGA 2WSMA 5J47A 3ZS9A 3IHLA 2OBMA 2CHVA 1Z5ZA 2VP9A 3KXIA 3SFZA 1CIPA 1PLKA 3P20A 3PEWA 1E79D 5DGXA 2H17A 4TT3D 2BHRA 1GRRA 4JL6A 3SDZA 2GNOA 2QGZA 2XJ4A 3FHCB 2GCOB 4JLJA 5HCIA 2VP4A 1VPLA 2ZJ5A 3PVSA 1TUEA 1XX6A 4II7A 4AKGA 4TTRA 2W00A 2F7SA 2GJ9A 3QF7A 1VHLA 2PX0A 3IGFA 1XD2B 1H8ED 3K0AB 2PEZA 1PUJA 2C78A 1DG3A 1W4BA 3BBPA 1M7GA 1KI6B 3CF0A 1XCMA 4RFSB 3CR8A 1J99A 2GKSA 3QPVA 4E07A 1ZD8A 1G19A 2C03A 4NONA 3HR8A 2G6BA 2O8EA 2NIPA 4RCYA 4EPWA 3TQFA 2D7DA 2ZE8A 3DZDA 1D2EA 4KFTA 1E94E 5L3SB 3BS4A 2JCSA 3LBHA 4A82A 2YWFA 4LJ8A 4DLYA 2OT3B 2ZJBA 1G7RA 4C4PA 5JRJA 1NVWQ 2FPLA 4DVGA 2WJVA 5TMPA 2GZHA 2ZVQX 4IW3B 2ZETA 5J4KA 2JJ2D 3BGWA 2ZM5A 4M9QA 1LV7A 1KAGA 1YR6A 3TIFA 5JHHB 5CJPA 3AVPA 5K8LA 1G16A 3WMFA 1S3GA 4L5BA 4DC9A 1QRAA 3U2QA 3U4QA 1XNJA 1ZRHA 4OHWA 4A6PA 1UPTA 3AVOA 1D9ZA 5KUTA 3ZIAD 2ZIAA 5P21A 1E32A 4A8JB 3I8XA 1CJKC 1AK2A 4IHQA 1JR3E 1E2LA 2NPIA 4LCBA 1DE0A 3S1AB 1LNZA 1Z6XA 2QORA 4LX0A 3TLXA 3GLFB 5UKDA 4L9SA 3O8CA 1NLYA 2EVWX 4DB4A 4J0QA 5GJCA 3QOFA 1TL7C 3NDPA 4YXWA 5IRCD 3MJRA 3I1FA 2JASA 3SYLA 4YMTA 1XTRA 2REXB 4LDJA 5E7MA 4NP6A 4HAZA 3U3RA 1CEEA 4BWYA 3RS7A 3I72A 3MWYW 3PFIA 2CJWB 4ZO4A 5DNYB 3EPLA 1RYHA 1W4AA 2DFKB 4LPKA 4NKRA 3ECCA 4X8LA 4GRAA 2FE4A 2RGNA 4IDNA 4LBYA 1E9RA 1DVRA 4QL3A 3BB1A 4QJ4A 2EYUA 3EIHA 1GNQA 5G40A 2B7BA 1GNPA 1SVWA 4LC1A 3GLHB 3Q3JB 4Q4LA 3VKHA 4DXAA 2FSHA 5JCPA 3HU2A 2ZSAA 2JLVA 3DOFA 1Z6GA 4URUR 1GL9B 4DHEA 5GADl 1Z6YA 1AM4D 1MKYA 4QXAA 1NF3A 1X1RA 2F1HA 4R7ZA 2WOOA 4MRSA 1UKZA 3ND8A 2YNMA 5TVKA 2PL3A 4DT1A 1RPZA 5HE8A 5AUQA 3REFA 2G77B 2VRWA 4UJ5A 4XJXA 1NNEA 5HE9A 4ZKEA 2P65A 1P3JA 2WJYA 1AGPA 4V02A 1ZIPA 4AYTA 2NMVA 3L8ZA 1XB2A 1Q3HA 1G1MA 1EG7A 1JPJA 1CJUC 2QP9X 4OK6A 4Q9HA 2P6RA 3CF6R 3KJIA 2R8RA 2O8BA 3GLGE 3RS0A 5L3QA 2IYSA 4JVMA 4ZCLA 3A1VA 2PT7A 1CRPA 4UXHA 1KMHA 1W0JD 3VR4A 5A5GA 2OG2A 4PSAA 4PSKA 2C96A 4V0OA 4P4TA 1ZINA 1SVMA 3FTQA 4M2LA 1KSGA 3U6KA 1WCV1 2CE2X 1FMLA 1Z3IX 4M0LA 3BH6A 4IOJA 1U0LA 1NVUQ 2QU8A 4PO1A 4IVRA 1EFRD 1R8QA 2J5XA 2YHSA 2Z5FA 4IEEA 1E1QD 4LI0A 1U0JA 4QC2A 3A4LA 3BD9A 2VA8A 1G3RA 2V7QD 3M0EA 4DDTA 2GF0A 1SVIA 3UK6A 2ZRHA 1DTSA 4B34A 2CEAA 3IIJA 3PUZA 2G83A 4L15A 4B43A 3AF0A 3QEJA 5DHFA 2OBNA 4Z54A 2LCFA 4DDUA 1TX4B 3HYRA 3OEHA 1WBBA 1R5NA 3W34A 1H8EA 2ZYTX 4B6EA 2F3RA 1Q22A 4MGZR 1SVOA 2BBWA 5KSOA 2ATVA 1C1YA 1KI2A 2W0SA 1XWIA 2X2FA 3ZQJA 4PZYA 4HATA 3LFUA 3R20A 4URXR 1E2NA 4Q4JA 3PEVA 2XTMA 4JBXA 3ZVMA 2DY1A 4JLAA 4HUQB 1DADA 2LWIA 2IL1A 4JKIA 1FOEB 5IK2D 2V1UA 2W6JD 1A2KC 2OAQ1 4B32A 3K9GA 4Q4HB 821PA 1OXTA 3BB3A 1ZNXA 4TMXA 2CL0X 2PZGA 1AJEA 4PHFA 1UADA 2BKEA 1GL7A 3IIKA 4N1AA 1ZCAA 2WIBA 4IOLA 3SR0A 2A5FA 2NG1A 1VIAA 3DMNA 1E2PA 1T0JB 2W58A 1KYIA 4TSFD 2ZJYA 2OFXA 4XD7A 3OAAD 2QI9C 4A0GA 2CCKA 2R6AA 2CCJA 4C0LA 5B58C 2GESA 4GBMA 3ADBA 3U44A 1SXJC 2PCLA 3EW9A 3NIBA 1OT3A 2I1QA 4L4UA 2XITA 4HAYA 3ZIAA 4BGDA 5J4HA 5KYKA 3NC0C 1A82A 2FPKA 4HLCA 4DJTA 2JLUA 2C2HA 1J8YF 1VDZA 1CR4A 4V0ME 3P27A 4MYCA 1EFCA 5JZVA 3TSOA 2PLRA 1GSIA 2GXAA 3GEIA 1U9IC 2ZSFA 1NJGA 2PJRA 4MKFA 4BFWA 1KO8A 1CRQA 2ZI5A 2BMEA 1F60A 4BUJA 3RLFA 1KDOA 5L3VA 3J81k 2EQBA 2FA9A 4F93B 5LDDC 2FPMA 5CIWA 1DAKA 3LW7A 3QEOA 1P2TA 1T5LA 4HB0A 3GLIB 1FW6A 1W2GA 2XSZD 3BOSA 1DBSA 1IM2A 1LY1A 3TAUA 4QRHA 2OXRA 2E1RA 3L0IB 5J40A 2WMOB 3OIWA 3RS5A 4NDZA 2V8OA 3NH9A 3SI7A 1JBKA 1RKBA 2JLZA 2QZ4A 4OHXA 2H92A 4Q5IA 2ZRKA 1QBKC 4EFLA 4QOSA 4QKQA 3BXZA 2C8VA 4D80A 3ETLA 3T5GA 4ACBA 1W36D 3THWA 3QG1A 2VHCA 5FOTA 2JJ1D 4H1VA 4EJSB 2VYFA 3SJZA 2Z43A 2PT5A 4HSEA 1FP7A 1KI7A 1QHHB 1ZIOA 3TSWA 3RWMB 3K0CC 5FTLA 1P2VA 4A2QA 2DWPA 2P6NA 1RRCA 4GT1A 5JSZB 4HAUA 4BFTA 1OB5A 3QBVA 5DN6A 4NYJQ 1G4AE 2GVZC 4NH0A 2FFAA 2KI5A 1ZU4A 1TF7A 2J87A 3BB4A 1OHHA 4AG5A 4ERNA 3OFND 1N0WA 4AG6A 2BMJA 2C77A 1GIAA 2ZVPX 2YOFA 5KPJA 2B6HA 3KB2A 1ZD1A 1FQKA 4A15A 3K0FB 4POAA 1YRBA 1N0UA 1W0KA 1UDWA 4MA4A 4PC7A 4PPFA 5BXQC 1W4CA 3QKSA 3LQRA 4D25A 4IXNA 2XXAA 4IDOA 3PENA 1RZ3A 2VP5A 5FR2A 1EFRA 2C04A 4HLUC 3DM5A 1G18A 4O25A 1OJLA 1N6NA 2HCJB 3RNLA 4HB4A 4QGFA 2WKPA 4CZ2A 3ICEA 3U3OA 5K8IA 2EU8A 2G0TA 4PFSA 5H68A 3UWKA 1CJVC 1ZM3A 2YOGA 3THOA 1XTQA 4KSBA 2R2AA 2UVQA 4WW0A 2D74A 2WKRA 3IQWA 1UFQA 3B78A 3ZZUA 1A5TA 1R0YA 2VSOA 1W5SA 1GDDA 5KSZA 3V4RA 5FBWB 4RZUA 5FBRB 4WA7A 2Q3HA 5CLLA 4XWOA 2Z4RA 4FWIB 2IYRA 3NEYA 1MO6A 2QBYB 1TPZA 2AKAB 2RHDA 3U3MA 1E2HA 2WV9A 3CW2A 2X8AA 2YYZA 3I8SA 4LHXA 1GZSA 2QT1A 3WHLA 3MUFA 4KLNA 3DL0A 4IOMA 2OEPA 3CO5A 4JT2A 4QBHA 4Q4AB 3TMKA 1F5NA 4JYBA 1QDEA 3IEUA 3QI2A 3K9HA 4JL8A 5IK2A 3G0HA 2W6JA 5KDOA 1Z0FA 4U00A 3RDPA 2GHIA 2X1VA 3SJBA 4D4KA 1N5LA 3TH5A 3CH5A 4Q1DA 4C0SA 2G3YA 2F6RA 1T5IA 2ZRCA 2GJAA 1LB1B 2OBLA 4NE2A 1OE0A 4R9UC 3UATA 3AQ4A 3GJ4A 4HZUB 5C4MA 5KNCA 2WMNB 3OHMA 5FFMA 3H4MA 4TSFA 3ZVRA 4FCVA 1WXQA 5TDHA 3X2SA 4PAQA 1SXJB 4M9XA 2F1RA 2BIFA 3QKRB 2DWQA 5EE9A 3GFOA 1QHIA 3IO3A 3QE0A 4JLOA 5BWMA 1E9EA 3FKSA 2IXFA 1GM5A 1A2BA 5AJXA 3L43A 1S96A 1T91A 4K46A 4LJ6A 1RJ9A 1RVDA 5JFGA 2HCBA 1Z06A 3K09C 3MWLA 4O2LA 3GJ7A 4RFSA 1XEWX 4M21A 2VHJA 5B57C 4BZXA 1X86B 2FFHA 4LV6A 1GKUB 3NG1A 4BZQA 4URVR 1KJZA 1XEXB 1OKKD 1R8SA 1DPFA 5K8UA 5KPDA 2RCNA 3GCGA 3LVQE 2IUSA 2JA1A 3TR5A 1W1WA 2X2EA 4RD3A 2PLFA 2J46A 1UBEA 1GG2A 2H18A 3I92A 1ZVQA 4DLSA 3K70D 5E7JA 1CBUA 2Q9AA 3WNDA 4DZZA 3BFXA 3VR3A 1IXRC 2F43A 1EK0A 2ZR0A 5B64A 1QHSA 4RD1A 2B21A 1A4RA 4B6FA 3KTAA 1XD8A 1UBGA 4C0KA 2QTVB 4A36A 4BLPA 4KVAA 2ZJ8A 1T0HB 1E9DA 2B7CA 3G82C 4RVCA 2D7CA 4ARZA 4K81B 3A1WA 2IXEA 4QBFA 1EX7A 4BQSA 4HYYA 1E1RA 1QVAA 4N0DA 1Q44A 4FCTA 3AF2A 1HA3A 3O47A 1L4UA 4G0NA 4V03A 2ZSBA 5DI3A 4A8JA 4BECA 2K5UA 1KNXA 1CP2A 2EFDB 4JS0A 4TL7A 4I1VA 1XXHA 4CF7A 4UNSA 3T5DA 1HH4A 2DWOA 5EXPA 1KKLA 1UBCA 2QAGC 3D8BA 2AL7A 2D62A 4GP7A 1J2JA 1RE0A 4FINA 2VBCA 3FE2A 1P2UA 1XPRA 2Y8EA 2ZU6A 2OAP1 2BMFA 4HLDA 3QF4A 2CJWA 4RZ3A 3A6PC 4JZKA 3T15A 3AM1A 2XOKA 2FNAA 4TL8A 2XX3A 1Q12A 5FOWA 3QPWA 4OJKA 4FIDA 4MYHA 4CVNA 2VP0A 2GXSA 2GBLA 5SZIA 3CRW1 2IYQA 3GLHA 3PUYA 2BDTA 4W9MC 4QJ3A 5KDDA 1HUQA 1VG0B 1N0VC 2OHFA 3VR2A 3AGPA 1G7SA 5EP3A 2J7KA 3N2IA 1XTIA 2H57A 4D0GA 2QM7A 1SKQA 3RRMA 1XZPA 3CONA 4FI3C 4C0JA 5C4GB 2GJ8A 4PC2A 2ZI6A 2J1LA 2ZREA 4PX9A 1JPNA 3C4JA 2FEMA 1XJQA 2GXQA 3UG6A 1UM8A 1QVRA 3X1ZA 4NHOA 1HURA 4JLDA 3DKVA 4PC3A 2JLSA 2YV5A 2VQSA 2BVNA 4IEIA 2HYDA 2DFTA 3DM9B 4YXWD 1ZM2A 2WIAA 4PC1A 4AIIA 1ZAKA 4FN5A 4EPRA 4DSOA 3QJYA 2V6IA 3PQCA 2EFEB 1KY2A 2N1BA 2ZS9A 4FCWA 1K6MA 2PMDA 2P5TB 4EQ6B 1VHTA 1ZJ6A 1KK2A 2HF8A 2NTYC 2GXUA 3CKLA 3TR0A 1Z07A 3P4XA 1C9KA 3NWJA 2DFLA 4JSTA 4KYUA 1T6NA 1ZCBA 3A36A 4FMBB 2Z0MA 5AR1A 3Q7PA 4QBGB 5IHPA 1D9XA 5L3RA 3DHWC 4DIEA 1OV4A 1S9HA 4LSGA 4ON9A 1S4QA 4Z1MA 4LHZA 1V5WA 4EUNA 4TL9A 4DB2A 1G8YA 3I5XA 3JVVA 4YMSA 3T12A 4C2UA 2WTUA 2BKUA 4HB3A 4XVQA 2GK7A 3LD9A 3NHAA 2FV8A 1II9A 1VYTA 4D4JA 3KKPA 5J5CA 3WYGA 3E2IA 2NQ2C 4M1TA 3CZPA 5FTNA 1I4LD 3CNOA 4W7SA 5LBIA 2O8FA 1HE1C 2OLJA 3EA5A 4ZIRB 3RC8A 5BYJA 2QUZA 1KNQA 2GVDC 5KOYA 3CIOA 1GRQA 4GMXA 1NJFA 1UF9A 1KI1A 1QHNA 4GOKA 4LYAA 4LJYA 3U7GA 2VHUA 1R0WA 4NYIQ 1JB1A 2WJIA 3PEUA 1OIXA 1XPUA 1GKYA 1GL6A 3C5CA 4A2WA 2EFCB 2W83A 4JL5A 1GKIA 1EFTA 4JLPA 1IBRA 1T3LA 2O0HA 4WVFA 2FSGA 2PZFA 2ZXUA 1DAIA 2ZU0C 3GD7A 1TQ2A 2AN9A 3T1VA 121PA 3RSOA 3NDBB 1FP6A 1XP8A 4TQ9A 2CVFA 1OIWA 2CL7X 2H16A 2ZITA 2GCPA 4PAMA 1P2SA 4KAXA 5FOXA 1TU4A 4Q1AA 2HXSA 1G20E 4TQAA 3A4NA 2HXYA 2RHMA 1RW4A 3CRVA 4S35A 1CKEA 4JVNA 3TVDA 1G3UA 1Q3TA 3B60A 4FXPA 5FPTA 2VEDA 3NBZC 4DBLC 5D3QA 1G8PA 2ATXA 4WAUA 2IS1A 4PC6A 3FFAA 1OSNA 4DKXA 1O87A 4A0RA 4TMKA 1KHTA 1VCMA 2DFNA 5KNDA 2W2XA 4P3YA 1E0JA 2J45A 4ZI3A 3OEHD 4OI2A 1G21E 2JATA 4YLGA 5G53C 4R98A 2YVUA 5BYKA 3JZMA 3AVWA 3ZQ6A 3PV0A 2UZIR 3VX4A 4MH0R 3R7WB 3TAHA 4KVGA 3TUIC 4R2HA 1MO3A 1J7KA 1TAGA 1UEIA 4MYUA 2QAGB 3SFVA 4DLRA 5SZKB 4DCVA 2J0UA 3T1TA 4M1YA 3GLGB 1T3HA 2XB2A 1AKYA 1YZLA 3NEJA 3TRFA 3H2YA 3EXAA 4OKSA 2NO1A 2IUUA 1SVKA 2XEXA 3A8TA 1Y63A 3TGPA 3MMPA 1G7CA 2ZRAA 4G5OA 1NMXA 1IN8A 1M74A 3SS8A 1Q1EA 5CB6A 1BIFA 3CPEA 4IDHA 3V00A 4B73A 1ZUIA 4AY2A 2GZDA 4F7WA 5FPHA 4LPSA 3TE6A 3FMIA 4LZZA 3GLIA 1Z2CA 1NKTA 4C7OB 2F9LA 1CXZA 2ZE6A 3R8FA 3GJ6A 3NHBA 1E2KA 1OFUX 4XD7D 2JLXA 4M4SA 4W5HA 3W8NA 4AYWA 3FFBA 4I4LA 1N6OA 2OCBA 4ILEA 1YRAA 4DWJA 2V3CC 4B3DA 3RS4A 4B71A 1D8TA 4DSUA 4HAWA 4M1WA 4KODA 2R9VA 3VAAA 2ODBA 4ASUA 3R8CA 1NN0A 4JBYA 2N46A 1HY3A 4QJ5A 2O52A 1S0UA 4CYMA 2ODNA 1QG4A 2ZTSA 4QM7A 1P75A 1RIFA 2R6FA 2BCGY 2A3RA 4C0BA 3EA0A 4NTZA 1Z08A 2OILA 2OCPA 2YC2C 3C15C 5B2ZA 2BJWA 1T8TA 1CLUA 2ZRIA 1E2EA 4BFVA 3H86A 3F0TA 2OSBA 1M7HA 4C30A 2NOAA 2AWOA 2WAXA 1AN0A 3QKTA 3AP1A 4M1OA 1AGRA 1Q21A 5CM9C 1AIPA 4XOIA 4ZPXA 3QUSA 3EIEA 1KI3A 1Q0UA 3F5FA 1VMAA 1K8RA 2O8DA 3IEVA 1CTQA 2GRJA 4JLKA 3THXB 3AF1A 1Z29A 4AWXA 1TTTA 1BS1A 3RS3A 3AKYA 2RH5A 4Q7LA 1CF4A 2ONKA 1FNMA 3U60B 1WMSA 2VSFA 3EZFA 1CS4C 1GP2A 1BO6A 2F1IA 4FD2A 5CK5A 2XAUA 3CRRA 3KL4A 4TWZA 3IPYA 4Q7JB 4LYHA 4EJSC 3I73A 1FUKA 2P6UA 4LC0A 2JGNA 4TMTA 3FWYA 2O8CA 2IYTA 2LKDA 4ZKDA 5ELXA 2DCUA 5DN6D 3LBNA 1CU1A 3KQLA 2GJSA 2YWHA 4FMCB 1L4YA 1OHHD 4NCKA 1VIYA 5EE5B 3BH7A 3E5HA 4DLUA 5HPYB 4CEIA 2IX3A 4XVRA 3AB3A 3M6AA 1OYYA 1YZKA 3OEEA 1QZXA 4HDCA 5AWFC 5GVRA 3SZRA 1OH5A 4TN1A 2FU5C 3KJHA 3DZ8A 3CWZA 3GFPA 5FOVA 1ZC4A 2C9CA 4OK3A 4ZDWA 1W0KD 3X1XA 1MT0A 1IJFA 5C46F 1JALA 2IYZA 1OH7A 1E0AA 2ZRNA 1WF3A 2BWJA 1XDBA 1IN7A 1IY1A 4JT4A 2IK8A 2Z4SA 5CIQA 3T61A 5JI2E 4IDQA 4UNPA 5G3YA 4CT4B 2WWWA 5H70A 3UKDA 5TV2A 2O5VA 3UPUA 2GZAA 3LLMA 4A9AA 1EFUA 3QXHA 1NL3A 2BEKA 5FL7A 5FUXA 2RGNC 4LRWA 2OFWA 2WBLC 1GVNB 2GK6A 4Q19A 1GOTA 2EFHB 1YU9A 3FKQA 3P4YA 3R9IA 3T35A 4OHZA 4CEHB 1DAEA 5JWOA 4CEJA 3AF4A 2JDIA 3C7KA 2IYLD 5EXSA 1XFAA 4BLQA 1E9BA 2AD1A 3KXKA 3OIYA 3IKJA 4P4SB 1KO7A 2R6CA 4R71A 5D3MA 3H0KA 2GWHA 1YJ5A 1ANKA 2LKCA 5FL3A 2ZRDA 4JVLA 1QHXA 5BN3A 4JSYA 4XH9B 1YZTA 1BKDR 2QA5A 3PIRA 4LHYA 2IYXA 4Y0VA 4IVQA 1NN1A 4ZDIA 3WMEA 1XEXA 4C0QC 3SEAA 2X77A 4M8NE 4D26A 2ZQ5A 4IFBA 1XXHE 2ERYA 2J41A 1Z0KA 1DO0A 4EFMA 2GF9A 1I2DA 2ZRJA 1FX0B 1L2TA 3BIFA 5AJZA 4YMVA 3LDAA 2FZ4A 3C41J 1AS2A 1KJWA 3DKPA 1OIVA 1PJRA 2OESA 3V9PA 3HU1A 3K0SA 4HDQB 1CJTC 2A7QA 1LS6A 4DCSA 1G17A 3LA6A 4TMVA 3W5IA 1FL9A 1ZBDA 3LWNA 4D6PA 5DSZA 1P5ZB 3B1XA 3C16C 3FKSD 4URZR 4MKHA 1N5JA 1VKJA 2PJZA 3X1WA 4B2PA 3SYKA 3TK1A 2I1VB 2ZEJA 4BFXA 4CIDA 4AURA 1KAOA 1SKYE 4GZMA 4NYMQ 2Z6VA 4PSVA 2H5EA 3UMFA 2AK3A 4A0FA 2ZUCA 3QXJA 2HJGA 1U90A 4RD0A 4UJ3A 2G1JA 4RCZA 3ASZA 2A78A 3SJCA 1HEIA 3OE7D 1UJ2A 2BCJQ 3IQXA 1BOFA 4I99A 4OYHA 4MGYR 1G5RA 4PHTA 4EPYA 1S3SA 1GITA 1F2TB 1SHKA 1G64A 1XU4A 4E5UA 4DCTA 4KFRA 3QNUA 4MRRA 3QXCA 1N2CE 5CLQA 4A92A 3VU9A 3W6OA 3EPHA 4M9SA 4Z51A 2HLDA 4I1UA 3ZZ0A 1DG1G 3NKVA 5DHAA 2O8EB 3HJNA 4YC7A 1COWA 2BBTA 5DE3A 1K5DA 2I3BA 2W6IA 1F3OA 1WA5A 3KUDA 2QRZA 1MABB 4TYNA 2JLYA 2CVHA 5AUOB 1OH6A 2C5LA 4UKDA 4HLUA 4F92B 2HV8A 5B30A 3SBEA 1KK0A 4G5SA 4B2IA 1NN3A 3T1OA 5JS8A 2B92A 3A4MA 1E1RD 2RKOA 4D4MA 1O3YA 4KJZA 4ACAA 3SJAA 1B23P 1E2QA 1L7VC 3T34A 4PPQA 2J0SA 3BJIC 1KI4A 3ZS8A 1S2MA 3Q7QA 4M1MA 4OL0A 4TL6A 2FG5A 2QN6A 4F4CA 2A5JA 2IF0A 3ADKA 3U4QB 5HKKA 1NIJA 1U8AA 4I1SA 2WHXA 1CR2A 2RGXA 2ZJOA 5DISB 3CM0A 1XPOA 1KSJA 4HB2A 5AJVB 3AP3A 5E95A 2CNWA 4E09A 2R6DA 1P9WA 4BASA 2HT1A 3F8TA 3LLUA 5EP2A 1N6LA 2ONJA 2JIZA 2ORIA 2WKQA 3WYAA 4NCNA 1G9XA 1N3BA 2BV3A 2XOKD 3FYHA 4GOXA 8OHMA 3BERA 4UQOA 4US1R 2REBA 2CCGA 3AGQA 4BZPA 2N42A 1J8MF 2QMOA 3O8RA 4LJ4A 2QEQA 1NVVQ 3NVAA 1ZC3A 3T06B 2F3TA 4Q02A 3SHFA 4PZLA 3WP1B 2WWFA 4X8MA 3SHWA 2CDNA 3HWSA 3KQHA 4PAOA 1P62B 3ZGXA 1Z0AA 1DAHA 3TJZA 4MKIA 1KIMA 1W5TA 4RKFA 3ZVLA 1Z2AA 1EFHA 1G5PA 3L0OA 5G41A 3Q5DA 4AYXA 2BMDA 3QQ5A 1KOFA 2VPPA 3A1TA 3RYTC 2WWHA 1DAMA 3F3YA 4QGAA 3QPUA 5HTKA 3TNFA 3SC3A 5GJBA 2BM1A 4AKHA 1E99A 2EWVA 2ERXA 1D5CA 1A7JA 2EYQA 4IJMA 521PA 3CPHA 1HV8A 5JHGB 1NKSA 5F9HA 2FFBA 4PHGA 2QSYA 4G3XA 4DT1B 2QMHA 2WPDA 3MWJA 4P0TA 1Z28A 3ADDA 1MO5A 4U5XA 4A2PA 3TW4A 1UKEA 1Z8FA 3BE4A 3DPUA 3UANA 5K8TA 4PQRA 1D2MA 3PUVA 4MUAA 3RRZA 4Z1MD 2HDNB 2J3EA 2WICA 3B9PA 1U8YA 1DS6A 2XGJA 4MDEA 2ZR7A 4Q01A 3GJXC 1U94A 2ZPTX 3RANA 2I4IA 3BRWD 3GMTA 5L3QB 4GMDA 4QNRA 1Z0IA 1OXUA 4JKYA 2ZYUX 2PBRA 3EWAA 2NO6A 4G1UC 2QSZA 1XCPA 3CUEF 4MGIR 3R9XA 2FZLA 2TMKA 2ORVA 2ODWA 4TZ0A 1KSFX 2GCOA 4UXIA 3TBKA 1S8FA 4Q9KA 2ASEA 4BRWA 3HDTA 3GLIE 1YHNA 4NMMA 3V4FA 3AUYA 2ZJ2A 4HAXA 1XD2A 2MMGA
chains in the Genus database with same CATH superfamily
2I2XB 1XMIA 3K0AA 1C8KA 2OORA 1GAJA 4N3BA 1OB2A 4KITB 1EAYA 1VPEA 2OE2A 3RK1A 4TQUS 1C3EA 3AUFA 1ORWA 1W47A 4S0ZA 3SE7A 4AZ0A 4QZVA 4Y9SA 3H3FA 5ECGC 2ZRFA 5K51A 4BN4A 3UT5B 6REQB 2AJ8A 1G4UR 5J2TA 2IDKA 4LGMA 1SAYA 3HS3A 4C7BA 1BCSA 2GILA 3BULA 3FCEA 3L7CA 4GVLA 1QDUA 5I5EA 5KYXA 3ABIA 3VR1A 1ZMXA 4CTNA 1QH9A 3OOYA 3X3HA 4GPTA 5JOQA 4HDMB 2FDRA 4FHDA 5TLSA 1UMCA 3ILVA 3K94A 5IYZF 2Q8QA 3ONWA 4H35A 4AUMA 3MVEA 1XA0A 4YRBA 2O1XA 4FXOA 3BXGA 4MW1A 4WK0B 1QYRA 2KJQA 3GA7A 3K30A 1DSSG 2NZ8A 3LP8A 4ZXFA 4YP6A 1T1SA 3HVIA 2HXGA 1LBQA 4RIHA 4NZYA 1ZQ1A 1E0SA 2RCYA 3NMUF 3KQWA 3GH3A 3IFSA 4FILA 4OK5A 5AOVA 1UXJA 1H2XA 4YO7A 1P4JA 2DY0A 3FHTA 3KWJA 1GAEO 1QCDA 2B0CA 3OMXA 5AM0A 1R3UA 5HRCA 4CODB 2QUKA 4ZWNA 2PLAA 5KQPA 3U56A 1F4LA 1XZAA 1H65A 4M36A 4MVCA 4UEOA 5A0FA 5K3BA 3T35A 1Q91A 2AWNA 4L2IB 1HE2A 4OQXA 4A1OA 4FM9A 2Z3ZA 3NPMA 4IO1A 3WL7A 3ZE9A 1X1BA 3GWGA 4UBKA 1N6IA 3ENVA 3T4XA 2GR9A 4Q9AA 3IBCA 1DQPA 3AF5A 4YEDA 5IKMA 4IVPA 3BK1A 4L8LA 1TO2E 5IDQA 1SR8A 1PQ4A 2O20A 4OH7A 5L6LB 2XWSA 1R88A 1P0QA 1H9BA 3GG2A 2HU5A 4GM0A 2JGFA 1Q0SA 2D5CA 4XGRA 3BDIA 3ZI4A 1L7EA 2J7PA 2WIJA 3L6RA 1RRPA 1YL7A 2C99A 2OCDA 4G0ZA 3GFBA 3VC2A 2IPXA 5D5HA 3ZDYB 1K6JA 2DQZA 3BDVA 4ZJUA 3KC2A 3QFTA 1TCCA 1FMJA 2WWIA 3HRHA 1YONA 3TSAA 2VS1A 1G20B 2ID9A 3LXXA 5CVUA 4KL8S 4NCJA 1L7BA 3OO0A 3VXKA 4DDHA 1FNDA 5ELLA 2IOHA 4TYWA 3DMHA 2Q2OA 1P5FA 2I78A 1O96B 2YJ6A 1PT6A 2PXAA 1XEFA 3OQOA 4D4LA 1K2VN 4YCBA 3VZDA 5LQJA 1II8B 2HYIC 1G9SA 1CFZA 1ZFNA 1WSBA 2O0JA 4MWBA 4TSRA 2VC2B 3ZD6A 4RK6A 3GJ5A 4FYKA 1EP2B 2DTEA 4BEVA 1S8NA 4YCMA 5HTOA 4M83A 3HRKA 2GZ2A 2DBYA 2REQA 4MLPA 4D3SA 4PRKA 1KJYA 2WPNA 5IBPA 2A59A 1UAAA 3LUJA 1QP8A 1G21B 2Q5JA 5I51A 1O89A 1P9NA 1OZAA 1SZDA 1ELOA 4ASUD 2PZJA 3B6EA 3SQMA 4AO7A 1RYNA 3C0KA 5JNTA 2XQFA 1V5GA 2BFCB 5ENDA 1AHNA 3HCBA 4FDUA 4R2XA 1PR3A 5K0TA 3FMFA 3KJXA 4HAOA 4WNIA 3CLUD 3UXMA 2E1PA 3IH5A 2GETA 1JSZA 4K9LA 5T8KA 5JMOA 4Q00A 3AX6A 3H84A 4LISA 1USKA 3GH1A 1RAGA 3ZYCA 3PRJA 4YCNA 2Z9CA 2BFFA 1UDBA 2MYPA 3PC8A 4QG7A 2J9GA 5TY0A 2PRYA 1A97A 3SS9X 2OXCA 4N5NA 4BRZA 4OI1A 5F52A 2PWAA 2XZLA 1JVNA 4MV1A 3IEXA 4HLNA 2WJ3A 3R77A 4NXMB 2I9KA 4QOGA 4IFEA 4TLAA 4CKBA 1U1GA 1YTLA 2QVGA 3DTVD 3EASA 5DHUA 4UARA 1HETA 3I2GA 1NW4A 3C43A 1PV4A 4KO3S 3I32A 5HJ5A 1N6KA 1DP4A 1IY2A 1T6ZA 3CUYA 3W1VA 5AXCA 4UEJA 3TL6A 5FO0A 2H48A 5IM4F 1GZ6A 3B1ZA 5DBGA 1IUKA 3PD7A 1SHZA 2PVCA 3RVBA 2VKQA 3D6HA 4P0QB 3A3NA 2G7MC 1OI2A 5KVVA 1ADGA 1P9RA 2CLSA 2ZSDA 2NN3C 5B3JA 2AMFA 2VP2A 3TOSA 4RTPA 1X1EA 2FN7A 3RT1A 1PRYA 3UMRA 2GA9A 2KX7A 2C84A 2RI0A 1UPCA 3M4YA 4BE7B 1G60A 2QL6A 1THGA 3H2BA 1OLOA 1JQLB 1SZJG 1C9DB 3AL0C 1DDIA 3D8RA 1DZ3A 3K0KA 5F4ZA 4DCMA 5M04A 1NXQA 5DTJA 4CQMB 3C1UA 5TB5A 1Z8NA 1LVHA 4EFKA 4ZOBA 3BFVA 4R69A 1NXPA 4DMKA 1HX7A 3N8DA 1M2KA 4IV8A 4GI1A 2YIVX 3ZE8A 5I7FA 1W93A 5HSGA 2EBFX 5EUMA 4X0EA 5KOJA 2WU3A 3R7NA 3CY6A 1RHMA 4UUPA 3LOQA 1JHVA 3R1IA 4X61A 2D2VA 3ZTYA 1RWOA 4CM7A 3X1MA 2G4VA 1OH8A 1UOEA 3NHPA 2KWIA 3W4KA 5KWIA 2F8TA 4QYSA 1XJCA 3CH7A 2E3JA 4B4VA 4HZGA 1V2HE 4DLLA 3TIGA 1B6RA 1JXAA 1KETA 4V2UA 3UPTA 621PA 1ISGA 4Y2QA 1CQPA 3RFVA 3G13A 4HRAA 5DYTA 3LHDA 3T7IA 2ZJ0A 3OT1B 1DKLA 3OH8A 4K88A 3WYFA 4HDSA 5CNJA 4WSOA 2EWWA 3PDWA 2W43A 4RACA 3U7QA 1Z6TA 4L75A 2EIXA 4JUIA 4PHHA 2R1ZA 1QKJA 1LDGA 5D6NA 1AQIA 1E2DA 5TS3A 4IO0A 5KTOA 5I3ZA 2HPVA 4TTVA 1ZM9A 2ZW9A 3MIZA 1NLUA 4JDPA 2IWHA 4YV2A 2ISSD 1NFQA 2GEDA 3JQRA 4EG7A 2W2VA 4CM4A 1NY6A 3NTUA 2B61A 4G0PA 3KYCA 4PQFA 4Y1EA 4DV6B 2WRZA 4ESVA 4I6EA 3S70A 4AM8A 4P32A 3V32A 4KO1S 3T5AA 5DHTA 1B0AA 1T4BA 3IBGA 2PMWB 1YFJA 2BH2A 2NPFA 1VRWA 4U7PB 1D3AA 2AW3A 2P5SA 3AWIA 2AXPA 3ZY2A 1NBHA 2HADA 4W8HA 3VHQA 4PBSA 3B13B 3QHAA 3WB2A 3KHSA 4GOJA 5FWYB 2OZVA 5JECA 2QTHA 1Z88A 5LLSA 2ZBFA 3LRPA 4OB6A 4M0DA 3VHXA 5EKUA 3BTOA 4IMRA 1Z5PA 4F38A 3OD1A 1YASA 1J39A 2D4HA 3VNUA 5AXDA 4F6LA 2BTEA 1VXOA 2GGSA 4TT8A 3LQFA 3SZUA 3WA6A 1UMDB 4E3WA 3JQ7A 1F2TA 3GJSA 4H18A 1I24A 4QPDA 3QLUA 5FF9A 5JC8A 2ACEA 3Q0EA 1NUSA 3COPA 9ABPA 4HNAA 3JQFA 3G0CA 4Y2PA 3P2IA 1W48A 1XSEA 2P67A 4NICA 4QASA 1ODFA 4AK9A 3MINA 4Y98A 3LNCA 1K8YB 2II6A 2ZR9A 2OM2A 2FZVA 3PI6A 2PSSA 2JIQA 3UAYA 2QWXA 2ZRLA 4IXDA 4Q03A 4ABTA 1JQ5A 4IIDA 4LJ9A 4Q3OA 5AM2A 2J3KA 1M8PA 4R01A 1MABA 2QVLA 3AG5A 1UMBA 4W1RA 4L6CA 3V4LA 3AETA 4H77A 4CIAA 4LF7B 1WQ1R 3TWOA 1E5XA 3UK7A 2QI9F 3NHUA 1ZJ4A 1VSQA 3MHPA 4TZTA 1IG3A 1XYVA 4D42A 5LMCA 3RTGA 1I7QB 5C8VA 3FBWA 1TXGA 3OPQA 3KTAB 4MAMA 4HY3A 4JUBA 2DHRA 4JEIA 3SSAA 4TTQA 4COKA 9MHTA 1VE6A 3FUUA 4BVJA 1IHXA 2XYGA 5FR1A 3IB6A 4IHAA 1ZITA 3CUUA 3LUKA 3D4BA 4B46A 1I32A 1QHHA 2O07A 3BFPA 3MFQA 5AKKA 3IUMA 4G4JA 1X8JA 1UJ4A 5J4YA 3LUCA 1TQDA 4DNQA 3QSYA 1STOA 5NULA 1X0XA 1T1IA 4JJEA 4DJAA 3O2NA 1XN4A 3ANNA 2AHRA 3PWSA 2BSXA 2B20A 4KCGA 4GRIA 4I1RA 3JQBC 1X1TA 4NOKA 4RE6A 5JD4A 2HKIA 3DG9A 3MJVA 2BEUB 2C4KA 1IOVA 4XIGS 4L4YA 3RVDA 3SSNA 3UYKA 3ZH9B 2NUTA 2XIJA 2X0NA 3AERA 4YRQA 1TYBE 1P17A 4ZYYA 3D7RA 3DTVA 5EJAA 3I2JA 3U0BA 2B3DA 2Z95A 3KEQA 1QIDA 4CMCA 5IXJA 1QTQA 1M1YA 1O9HA 4LV8B 2IODA 2FCAA 1TPYA 2JVJA 3K35A 1LLFA 1QFSA 1UJ6A 2OP1A 2X7HA 3X1KA 1OLUB 3L05A 4LWOA 4OGLA 3TAXA 1V41E 4IRXA 1E4VA 3ZGZA 4WX2B 1HEYA 3TSZA 1WUJS 1UL1X 4HX9A 3RTDA 3IERA 3H4IA 1TMKA 3BE5A 3ONEA 1AVTA 1PZEA 1IPHA 3DWGA 3GFSA 3PTLA 1XL0A 3NXKA 2AFRA 1C4OA 1FMCA 1IN1A 1P19A 2AFIA 3BWXA 3PGVA 1J8DA 5F73A 1RQRA 4BP3A 3JWEA 2ZAGA 3U16A 4WE3A 5HKKD 4KR3A 2ZAIA 4ETNA 4Q48A 4PQEA 4WMLA 4BO8A 1DOAA 2A92A 1E2MA 1EVYA 3GJ3A 1DXHA 3KB8A 1JXMA 3OM1A 2IYUA 4E0BA 4EKIA 1IHUA 3M5WA 3GPLA 4F5EA 2CNWD 5HKLA 5KC8A 3O9MA 2EJTA 1CS0A 3AHIA 4AN1A 1L9XA 2ZIFA 4QFBA 1FTSA 4JHLA 4ZCQA 3EIQA 2JGJA 2GARA 3O2JA 5DLQC 2IP2A 2ZB3A 5H3CA 1EBFA 1IEVA 1JKJB 1QXSA 2AEJA 2GA8A 4Q4AA 1KIAA 1UP6A 1JLHA 1WIWA 4IJ6A 5JD6A 3QEAZ 1KEZA 1Y4AE 1U99A 1OAOC 1C1DB 4IRUB 2WU1A 1XLTC 2DE0X 5ALEA 1MC5A 3NIDB 1Z6AA 1OGIA 4DCUA 3FR7A 2QN9A 4LBWA 1SOWA 4J0EA 2H1LA 5DF1A 4YBZA 4EBBA 2O7NA 1QO0D 1VG9B 1W2HA 3AWDA 1BVHA 3GGDA 4N12A 1T5SA 3IR5A 3NOXA 4HWSA 5EZ6B 3ZZ1A 1SFRA 1C81A 4B3GA 3EPJA 3VDMA 1X13A 3WMXA 2IXTA 1M34A 3DDZX 3RTCA 3GCDA 4NG4A 3ZQ4A 1Z5UA 4D4GA 1PHRA 1Z34A 4PLTA 5AVUA 1ECFA 4GR5A 4ND8A 4Z99A 5EKXA 4RS3A 3M1IA 1G5QA 3OE1A 2QX7A 4QUBA 5KO2A 4V0KA 2HF7A 3EXHC 2FUKA 2D2IA 1ZICA 4O4HA 4XPIA 3GRYA 1JDSA 3QPDA 3QKRA 3P45A 1OA1A 1P74A 2E9SA 2YDXA 4LJ5A 4Y9TA 4MGHA 1ESMA 1N8NA 2CHQA 2LW7A 1P1FA 4M0FA 4OLJA 3O8BA 1ZVKA 2VHQA 4TT3A 1BDMA 2FOIA 5AKGA 1RKXA 2XOXA 3NJ8A 3ZHQA 1QC5B 3KPJA 1Q17A 5AI8A 1NJSA 1XI2A 2F90A 2WPDD 3HU3A 2IS4A 2BKAA 1LTQA 2I80A 1TLLA 2QJWA 1N6HA 4O3MA 4E5SA 5LZ7A 2F17A 2UAGA 4NCHA 1CB7A 2E5LB 1H3FA 5I5GA 3TX6A 4NE7A 4Z3KA 6AT1A 4LK2A 4LJ7A 1FTQA 3OJXA 3C3PA 5HBRA 5LOVB 4GI2A 2OUIA 3D3JA 4XSHA 3HB5X 4F2DA 1WO8A 1X74A 3A9WA 3JALB 4D3YA 4YV7A 3QLJA 1W88B 4QDZA 2IYEA 4P83A 5KC9A 2P3QA 5JC1A 3MMSA 1GWNA 2D5BA 2J9RA 4JY7A 3VO8A 2JJQA 4I3GA 2IPAB 4QREA 3VPGA 3GGJA 4O02B 4A0HA 3COZA 4LRUA 1ULBA 4ZOEA 4NIMA 2BGKA 1GGVA 4M0KA 5TPZA 3OF2A 1HDRA 1D1TA 2B8TA 2PUBA 2ZBRA 2ECQA 1FB5A 3HA2A 3EOZA 2FEKA 2JIDA 3MQFA 4MAAA 2ES4A 4M46A 3DO6A 2JFHA 4Q1VA 3ZWYA 4RMIA 4ETWA 1QU2A 2XOEA 4Q1FA 2WWYA 2G1AA 3GLHE 2HHHB 1MB3A 4FFDA 3QVGB 5EXTA 1ZLXA 3MS7A 4XLLA 2V98A 4I55A 4EB6B 4BO3A 1YD7A 1JT2A 2A9KA 1A95A 3B1WA 3KTOA 3KDSE 3MGAA 5H3HA 3TVTA 4TYYA 1P6XA 4F71A 2H8KA 1EA7A 3K5PA 4DRXA 1G7TA 1E9CA 3WRYC 3AVUA 2XA1A 1I51A 4XQGA 2VYVD 3HH8A 3U13A 1KQNA 2AQ8A 1HL7A 4UU8A 5DIFA 2XH8A 5LNK6 3I05A 3CX8A 3UXYA 1C8VB 5EIAA 3U61B 1FP4A 2XNDD 3MWDA 4MVJP 3KD3A 5CHEA 4D9MA 1ISHA 1W19A 4NU6A 4I9UA 3EAQA 1IE3A 1IFXA 4ALMA 4F60A 1JAIA 1SOAA 4J9UE 3ZWCA 1OXVA 3MSCA 3BZWA 4B33A 2GPWA 3KJNA 1NZJA 4NX2A 5DWVA 2VG8A 1JXOA 5EA2A 4HNVA 3LPAA 3OCCA 2VUIB 3FDIA 5AESA 3DDNA 1NIPA 3R3HA 2V9CA 5FBZA 3HVRA 2WP0A 3NIGB 4G8DA 4RQBA 4XUGB 3UJDA 1AY0A 1S5PA 3B2EA 4ZA2A 3AEYA 4CBVA 4ENPA 5A4JA 3QTLA 4FFBB 4P7BA 2QRJA 4PO8A 4QUKA 4GMGA 1MX9A 2DR0A 2YQZA 2NPOA 4MO2A 4PONA 4KSCA 2ATCA 4F4JA 5JNSA 2H59A 1QCCA 1Z5GA 2YVAA 4OAPA 2POCA 1D2GA 5FLKA 4LXTA 4KO2S 4R5HA 1IPFA 2J07A 3WLMA 5JDIC 4BE4A 2IA5A 3CVXA 1FUEA 1UDRA 3ODPA 1WBJB 4V24A 1JQJC 1RFLA 1QSGA 1JHMA 3WIVA 4C7JA 4X8OA 4G5RA 1CNMA 2IY8A 4KOAA 3S2FA 4CV1A 1VPTA 4R41A 3MJTA 1DQZA 4OJNA 3FUVA 2J09A 1EX9A 2F4NA 1XXLA 3SGLA 2WB4A 1UR5A 2RHCA 5CYOA 3AKZA 1FP1D 2ZANA 1VSBA 2OV8A 4UFNA 4EQ6A 1YQQA 3CH4B 1FLNA 2XMCA 5CYPA 3ESQA 3TTTA 1G41A 5DXAA 1IMOA 1AKEA 2YMQA 4NYMR 3T99A 3TSYA 4BNUA 5TVGA 3ZD7A 4O8CA 1W4RA 4V1CI 1S3IA 4FQ7A 2RGGA 5BMVB 3LKZA 1MAAA 1NXWA 2FEOA 1KRHA 2VDWB 3CE9A 3FZNA 3I9KA 3PXXA 4XGNA 4A3SA 4AB1A 5IG2A 3N8IA 3LQQA 4OHFA 1NNUA 3NETA 3NHMA 3QH4A 1H1LA 1CK4A 4MZDA 3FFWA 3NYRA 5JV5A 4IV5A 3JD2A 4OQQA 1LK5A 3K6KA 4EX6A 2G6TA 5IH7A 2QJOA 2B69A 2MSEB 5EWLB 2YN4A 1VKRA 2IUYA 1LF5A 3M5CA 4FI3F 5AUPB 4W5WA 3IRVA 4ZP1A 1TW3A 5BQPA 3LH5A 4YUXA 5EGSA 4V0QA 5A7HA 4BNXA 1OFHA 3WAKA 2JAQA 3U3JA 5CA0F 1JJIA 2DWCA 2C3MA 4LA4A 1Q74A 2AA3A 4RXTA 3MJ4A 2CV2A 2WDZA 2CV1A 4IHJB 1Z7BA 2HJRA 1DBQA 1YZQA 2IEZA 2J0EA 4HZIA 1C8BA 4O2BA 3AFMA 1ETUA 5HMMA 3ZDQA 2Y6UA 4MS4B 3H4VA 4RTMA 5BVGA 4OG2A 4YP1A 4B87A 1I36A 3NGLA 1LDEA 4MUBA 3S1SA 1QGUA 4WNAB 3OIVA 2ZT5A 3E1KA 2C98A 4MB0A 4FZ5A 3K1AB 4K1LA 4X20B 4E14A 4Z8YA 1UBSB 1Z33A 2YL2A 1TYCA 2EZ9A 1GG5A 2C2ZA 3CQ9A 4KE6A 2PMKA 3V6MA 3F6YA 5D00A 5B1DA 4JP8A 3FYUA 3CISA 1NOIA 1AQUA 4QU5A 2W70A 1N7HA 1NVXQ 4CEIB 2AE1A 3R40A 2FFQA 5FOUA 2QRQA 4MKZA 3GQBA 1OYWA 5K0JA 2PJDA 4C5BA 2GJKA 2NZUG 4P3XA 4UTOA 3BFKA 3I9NA 3EC1A 2B1JA 3LDGA 1W5EA 2PEYA 3HA3A 3WFZA 1H6DA 3NTOA 3PXUA 2PQ2A 2PQ0A 4MR8B 3VKVA 4ZYUA 2YZGA 2R8ZA 3M4JA 5A03A 1G291 3C3KA 4CLOA 1PIWA 3JPWA 4G0YA 4NEHB 4UUNA 1IZZA 4Q7QA 3I5AA 4LKRA 2XODA 4AI6A 4MITA 1V1MB 4KTVE 1D1PA 4XFJA 3WHKA 1V7CA 2I2AA 3OICA 3A4IA 4EK9A 2JD1A 1ZH4A 5HBGA 2XRFA 1C7ZA 4JEHA 4QYIA 1NVKA 4EY8A 3PR1A 4QDXA 3URKA 4BAUA 4IFIA 5KVAA 2IZOA 4QYTA 4ARBA 3UA3A 1F6WA 1RM3A 4ALNA 4U2BA 5THXA 1DLJA 4TV9B 4OQYA 3IIEA 2FVYA 1W44A 3IUJA 2XDQA 1QX4A 2FWIA 1YACA 2KLBA 2QAGA 1A50B 1FFAA 3I9OA 3Q85A 5TPWA 1XEWY 1ZMTA 1ESNA 4B3CA 3GLGA 4FU0A 3L49A 1JG1A 3B2NA 4B17A 3CBQA 4I9NA 5IXYA 3WAGA 3HXMA 4CRWB 2VHYA 4FNGA 2A9JA 3BMNA 4Q18A 5HFJA 4AKEA 3QVUA 4EW1A 2A33A 1R10A 3PPXA 2MHCA 3RVRA 3WX0A 3HB4X 4K8OA 5AK4A 4C4SA 3O2SB 2V7WA 3OKPA 4KP7A 3QW4B 1PWHA 4ZV9A 4GLBA 4JYAB 1Z38A 5JJBA 5FBLB 1FFHA 2GAAA 2DKFA 4YJ3A 2Y66A 3UCFA 4YP5A 5LM3A 2ZDQA 4N0EA 1BWQA 4RA9B 3EY4A 1PZXA 2CK3D 1PL8A 2O6LA 3G2IA 3KJEA 4L5CA 5D01A 3TW8B 3X43A 5JASA 5JYBA 1E96A 1G6Q1 4RCVA 2PX2A 5ERYA 1UJ5A 3KQKA 4C7OA 3DOCA 4MW7A 3EXIB 1N75A 2CLFB 1H4TA 2L2QA 1VG1A 1YKSA 5F3WB 4HDKA 1ZG3A 2BRUC 5LQCA 3DAOA 4GQIA 5C1DA 3RAJA 3T1QA 1PG5A 1YIAA 3RARA 3IT3A 3U1VA 2D2EA 3VMMA 4P4UA 4HVLA 4ZCPA 3TL2A 5BNTA 2Z56A 1YZUA 3Q10A 1BWSA 2XVAA 4H59A 4UCFA 3SMVA 3MC1A 1BU5A 2VDMB 3RC3A 4B4OA 4PG8A 3CH6A 4RSRA 2A0XA 1PS9A 3ASUA 3N0VA 3R5JA 4P31A 2H65A 3WY9A 5A4IS 1TU3A 4HTAA 2R44A 2Y2UA 4Y1RA 4ZAWA 1RYFA 4MKGA 3OZAA 5B6PA 2Q6TA 2Z2KA 3HA7A 3P5BA 3EVZA 2IH2A 3RBZA 4YHHB 3BAFA 3T3IA 3GFTA 2JJ1A 1J6UA 1THMA 3DEYX 4RMGA 2EATA 4PANA 1HE8B 5DK6A 5K3SA 1Q16A 3ZU2A 3I6YA 4M76B 4B2LA 2Q5EA 4JNKA 3U6BA 2C5HA 1NGSA 4HAVA 3L0SA 4NMLA 2QP3A 4JLVA 4HI0E 1VCOA 1YA4A 2GFQA 2CWDA 2XUPA 2QPAA 3DHNA 3BKWA 4P7KA 4RESA 5DO9A 3X1YA 3OX3A 1G6OA 3QA3E 5CX1A 1JLLA 4BO9A 5I7WA 4WERA 1J7JA 3R7SA 3PHLA 4JUDX 1HKHA 1E5QA 3H9UA 4PLHA 4TWJA 3OFNA 5IVHA 2QR2A 4RJKA 1RABA 5B7NA 1PVOA 3AEKB 3JD1A 3QX9A 4C6RA 3THXA 3FMPB 1XMSA 3FPSA 4TRNA 4HT3B 1AZSC 4FFVA 3SYNA 1LVGA 1Y80A 3L6OO 2ZJZA 3ABRB 4JX8A 5D1NA 1GKLA 4PNEA 1EUCB 3QVVA 1NBIA 1U8CB 2QROA 3BH0A 4MYRA 3VHLB 5K6TA 4RD6A 3CA8A 1RRFA 2ETXA 2XUAA 2RGWA 3JAWA 1YCHA 1RM4A 1IN4A 1PEDA 4QT4A 3IAM6 4Y2XA 2JHPA 2G4CA 1CQZA 1IHPA 4DSNA 2COEA 2ZTVA 1ZA1A 2W5UA 3AHCA 4Q9DA 2FWRA 1LPMA 1FZQA 1QYIA 3JASB 3I01A 1WP9A 1IRIA 5JWHA 3INRA 2SCUA 3BGIA 1YRWA 2Z04A 4O2AB 2E4YA 5TT0A 1XZQA 5TF0A 5SZHB 4D46A 1EDBA 4UHHA 2XVXA 2BJHA 1WETA 4XASA 4KMOA 2QGNA 2ZUBA 3UBMA 3OQNA 2V1XA 4D45A 2EEZA 2CVPA 1NUPA 1PR0A 2JAXA 3PPVA 2PU7A 3UT0A 3K5WA 4ER7A 3QKIA 3SBDA 1WZUA 2ZJ3A 4UBJA 1GQSA 4WGFA 3D4OA 4AF7A 2PHZA 2V96A 4CQNA 4AJKA 1PF7E 4UU1A 3GW8A 5BOSA 2VUSA 3PDIA 4ZO9A 3WS7A 3DCJA 1GCIA 1GQRA 2WKSA 1PLJA 3DT9A 1I5OA 4YQEA 4B3BA 4EARA 4UTNA 1OOEA 2YHUA 1KO5A 2FWBA 2V7XA 4RPHA 1W7AA 4G1FA 1DBWA 1ZK4A 1UIRA 3N28A 5CDFE 1KP2A 4DR5B 3GMSA 4E88A 5EFZA 5TS2A 4RTKA 1G2QA 2P6PA 3EZ2A 5A3RA 1FX1A 4YDHB 5LXTB 2VT2A 4CM8B 2GTIA 5EE1A 1UBTS 4WQMA 3QKSB 3VFDA 1PNOA 1YJAA 2R7NA 3VR5A 4B76A 4EMBA 3DGEC 3IQDB 1RACA 2I3GA 3NOVA 3L5OA 1HE5A 2R8YA 1Y5RA 4U7DA 4CEHA 4KQXA 2HHJA 5EFOA 2BEVA 2IC5A 3RO7A 5JMTA 4BFZA 2QLJA 4X1OA 1D6NA 2H2HA 1WB6A 1XMJA 4K6MA 5DBIA 4RMHA 4B5LA 4Q9IA 4Z4HA 5KS2A 2I76A 4QSMA 3T3HA 2D8MA 2DQKA 2M1ZA 3QE2A 4YAIA 4XQEA 2JJ8A 1MOZA 3FYSA 3VR5H 1J2YA 4WY2A 4A1FA 5IT4A 3CEHA 3SWWA 3GHYA 1ZLYA 3N5KA 3Q3VA 5CG1A 1T15A 1W49A 1NBMD 2NVWA 2R7KA 3MK31 3ORSA 3SICE 1DHTA 1XYGA 2FP4B 2Y1GA 4HLQB 2R6HA 2ZYVX 2QOEA 3QXGA 3T8YA 1J9ZA 3IVAA 4D5EA 5LP6F 2IYWA 4R3NA 1DRUA 3BXHA 1YZNA 2F3PA 4J4BA 4BNTA 1HDXA 1RXCA 1PKEA 2AOVA 1TLTA 2KW5A 1XZKA 4H7JA 1LI4A 4TM8A 2PT6A 1HC7A 2ZTLA 1E5LA 3ZJTA 3V4OA 2G5TA 4FNMA 3WRVA 4DDVA 4DJEC 1UM9A 2HO5A 2CNDA 2O3UA 2RGAA 4JD5A 3LK7A 4R83A 2ODTX 3TOXA 6ABPA 2PR2A 2YMPA 3C6KA 3K0HA 3NHRA 4G2TA 4L8GA 4MXDA 2JAPA 3B85A 2P3SA 3USES 3N2YA 1OKKA 1DAGA 3FD8A 1QGDA 1WUHS 3NFRA 3ONDA 4JGGA 4OMFG 4REQA 1UXGA 1X6VA 2WHEA 5CT6A 2H4FA 4LJAA 1YVRA 1G2PA 3VNVA 1SMKA 1E4EA 2GO1A 3MB5A 3H2GA 2VK4A 3MYYA 3KAPA 1UC5B 4EZBA 2VP9A 2WE8A 3SFZA 2C20A 1CIPA 4XA8A 1T9CA 2AX3A 4PV7A 4XIIA 3PEWA 2PSHA 1UWCA 5LUBA 5IJZA 2I2WA 4B3JA 2XCQA 1CC1S 3C6QA 3LPNA 3LSYA 2BFPA 2ETVA 3ND6A 1YL6A 4JHXA 1F2VA 2QGZA 2XJ4A 5FCDA 4J7UA 1V6CA 1VPLA 2VP4A 2ZJ5A 3BL8A 4OB8A 1N34B 4OXXA 2ZFUA 3LUFA 5DJ5A 2G4LA 1FU7A 2PX0A 1DUSA 3RC9A 4INAA 3ROZA 4RF3A 1I33A 1M8KA 4EKGA 2RBKA 2AZXA 1M7GA 5C8YA 1XRRA 1B14A 1G5HA 3CR8A 3D6MA 3SEFA 1J99A 3GFVA 2AUNA 2OC4A 2ECOA 2PSDA 3JQBA 4W99A 3WKEA 1AUOA 2QL7A 2Q5FA 4K05A 5LIPA 3CNQS 3QVJA 4BWFB 4E07A 4FGUA 3S2ZA 3IVRA 1C7RA 4EG4A 3HR8A 2UVPB 3AOGA 2OENG 5L6MB 4W6QA 2J32A 3ED5A 1EFPB 3Q9NA 3U19A 3RU3A 1AGNA 3DAHA 1H2FA 2C3OA 2J08A 3BKXA 3TQFA 1I0ZA 3IAEA 4AF8A 1FVHA 3G23A 5JQGA 2M1XA 1CETA 2JBWA 4F6RA 1U04A 1P77A 4GDMA 3DV9A 3SBXA 2W2NA 5HF5A 2VNSA 3KKLA 1P6QA 2Q4BA 2YV1A 2FPLA 3NWEA 1QFZA 4BNVA 2AFHB 3DKKA 1T8YA 4NJMB 1FRQA 1GGNA 1YZFA 2JGAA 1PEYA 2R86A 2ZVQX 3ABQB 4G1EB 3DE1X 1H5NA 2JJ2D 3BGWA 4OU4A 1ORDA 4ODIA 5FBHA 2VTBA 2PMEA 4D8XA 1LV7A 4LRTB 1T26A 4XB6B 1T5DX 3TIFA 2NO5A 4QUDA 3W4IA 1I7NA 5CJPA 4UTRA 1YB1A 3AVPA 5K8LA 3QOWA 4UZSA 3ZE7A 4FN4A 2UYYA 5EYPB 2FMTA 1S3GA 3OOSA 3N07A 7MDHA 3GGCA 4A6PA 2H2FA 1NW8A 2R8XA 3GUZA 4BP1A 2OAGA 4OHUA 3GRUA 4HUJA 4J0CA 4AUKA 4BCBA 3S1AB 1JR3E 1OFUA 2HSDA 4ZVNA 4PO3X 1LNZA 5IN5A 3UK1A 1ZJZA 4ENTA 1BEZA 2HHCA 4YMLA 4QU8A 4L9SA 4I4TB 5CVTA 3AEQB 3UWPA 2V0GA 1LTKA 4I3HA 4CN9A 5LQRA 1SC4A 1XZJA 1DFIA 1DWOA 1SC6A 1V7QA 3AJEA 3MJRA 1UODA 1XLTA 4G67A 1JVBA 2REXB 3OQBA 3QFHA 4LC9A 5E7MA 3VOSA 4BQIA 1QK4A 4EKYA 4LF8B 3BT7A 4OHBA 4XOUA 1EAMA 3I72A 1EDZA 3K92A 4XCVA 3RS7A 5CLGA 3WZMA 4EUSA 1TD9A 2CJWB 1CY7A 3Q2KA 2Q0SA 3WLIA 3DXYA 4CETA 2AMJA 2FR8A 1MF7A 1N9ZA 4OP3A 3UO8B 2VXOA 4C7VA 5I45A 4F5ZA 1H6AA 2WA2A 4F4UA 4GRAA 1DVRA 4P3OA 4QL3A 4H4DA 2E37A 1NX6A 2HBZA 4WVLA 5G40A 3WGIA 1GNPA 1SVWA 4Q4LA 1JQBA 4YMGA 1OC2A 2HREA 5JCPA 5DBOA 1ID8A 2ZSAA 1L5HB 3EXHA 3S28A 2JLVA 3JRNA 4XCXA 3FPLA 3K4QA 2Q07A 4WKGA 3KLNA 1F7VA 5CVJA 3VPSA 3BRSA 4DHEA 2VHXA 4C3VA 5TQ2B 3GO4A 3HN6A 3C8DA 4PLCA 4QXAA 5K05A 1JSXA 4G07A 3L40A 3PR3A 4QYWA 2J9FA 1T9DA 1V71A 4O4JF 4HBGA 4MQEA 2QRHA 4ZVKA 3KOMA 1O5TA 3F90A 5EUCA 5BPHA 3LRTA 4PYLA 5JTTA 5AW1A 1HDEA 3B3QA 2H52A 3FZEA 4DT1A 1RPZA 3W7BA 2G77B 4R2KA 4X00A 3E3OA 2CSUA 1UPXA 4WFQA 4BAZA 1NNEA 4ZKEA 1WXFA 4ICIA 1LWNA 5FTWA 4O1IA 2MSLA 1KP9A 2WDPA 3R4VA 4ZVLA 5CW2A 2ZAYA 2NMVA 4D8TA 1WXDA 1JDBB 2PO5A 3UJ8A 1S6YA 2ZJ6A 3RYIB 3QELA 3ZWPA 2Q0XA 1AKWA 4B83A 1H05A 3GNTA 5IC4A 1MUUA 2C4WA 3FNRA 5BWLA 5I7RA 2PT7A 2H1HA 1KMHA 1W0JD 3VR4A 2OG2A 4PSAA 3WWYA 3HYCA 5CM2Z 4I9GA 2GN8A 4P4TA 5F2OA 3KETA 3FTQA 1D4ZA 1WMEA 2GNPA 5JNLA 2DPYA 1EM8A 3BGVA 4M0LA 2RBGA 4BJ5A 1L5WA 4PN3A 3GT4A 4TVKA 1EFRD 1R8QA 2Z5FA 5JSHA 1E1QD 4LI0A 2HSZA 1D0IA 1WG8A 1E1LA 2VA8A 2CXUA 4GX1A 4B2YA 2X14A 2O3TA 3UK6A 4F3YA 3VR4H 3AJ8A 3PJFA 1IDOA 3CB2A 1DTSA 4CV3A 2B0JA 3H5WA 1OFVA 1W85B 4GGPA 1QU3A 2B5WA 2G83A 1JEOA 2M9MA 4WBNF 1RTTA 4B43A 3AF0A 3T9EA 1IEWA 5ALXA 2BGUA 2IZ1A 3GGSA 5A7FA 2OBNA 4ND5A 5LBTA 6CHYA 1TYEB 4Z4IA 4CU5A 4NXNB 1R5NA 3BD7A 3DQZA 2HNKA 2RG1A 3JVIA 4FHZA 3RIEA 16PKA 1MC8A 1Q22A 1RPAA 2X3YA 2NSDA 3Q6NA 1BMDA 4D8YA 4EI2A 2NUPB 2YFKA 4FEAA 1C1YA 1EUDA 4R7TA 1V5FA 1XWIA 2X3FA 4CT0A 1TGYA 1NUQA 3VSAA 3N1UA 4X91A 3GD5A 3R20A 4JBXA 4B85A 1TVCA 2G8LA 2OR3A 4PRYA 4ZICA 4XUDA 2PGAA 3T7AA 4AS3A 3V2IA 3PQ7A 4C2BA 4B9AA 4IM7A 4Q4HB 4YJHA 5FHRA 2I7VA 821PA 1ZHOA 5EZQA 1OXTA 2VEOA 1HQDA 2NXEA 3EHEA 4DPMA 1TO6A 1U2ZA 2CL0X 2HQRA 3HO6A 3FVVA 1R0SA 4D57A 4DJJA 3ID6C 3Q40A 3ZV3A 2CD9A 1ZCAA 1PL0A 4QA9A 4IOLA 2A5FA 1BOOA 2DHEA 1J0DA 4L95C 1D6SA 4AZWA 4DTCA 1PJTA 3FWKA 3AY7A 5JH7F 1Z5OA 3KS9A 4FDLA 4LNAA 4QXOA 1S3FA 4RFLA 2QI9C 1ZOPA 2CCKA 3KBBA 1EVZA 4JBIA 3V80A 5B58C 1Y8ZA 3DNFA 4R51A 3U44A 3KR2A 2TMDA 1EXNA 5JAQA 4PGHA 3PHIA 2WUWE 3NUQA 2WU0A 3AM5A 3NC0C 1GARA 4KRGA 1Y1PA 4DJTA 2JI8A 3BHJA 3ANYB 3RYCA 1J8YF 1VDZA 3NKLA 1OX6A 2A1UA 3P27A 4V0ME 1BE6A 3SJUA 2PLRA 4PZDA 3UXEA 1EX1A 3GGGA 2CD7A 4EGSA 4TRMA 4C14A 3G1UA 2ZSFA 1NJGA 4XARA 5FHQA 1KO8A 3HBAA 1BQ4A 1ODCA 5B1YA 1CIJA 5EJGA 1XMOB 1E20A 1XVVA 3ETDA 4NJEA 1C2YA 4QWMA 4ZQEA 1Y7LA 2OMKA 4M1ZA 3B1JA 5ICFA 3GGPA 4MWTA 4DA9A 4CXMA 1MC4A 4MUYA 3RUFA 1LI7A 2B82A 5LDDC 2MWMA 4CG0A 1DAKA 4PG7A 4EJ2A 1T5LA 1W2GA 3PUHA 2XSZD 4ENRA 3S99A 1DBSA 2B35A 2QTRA 5E7QA