2OCDA

Crystal structure of l-asparaginase i from vibrio cholerae o1 biovar eltor str. n16961
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
336
structure length
328
Chain Sequence
ARKHIYIAYTGGTIGMKKSDPVAGFMEKQLASMPEFHRPEMPLFTIHEYDPLMDSSDMTPADWQLIADDIAANYDKYDGFVILHGTDTMAYTASALSFMFENLGKPVIVTGSQIPLADLRSDGQANLLNALHVAANYPINEVTLFFNNRLMRGNRSRKSHADGFSAFSSPNLPPLLEAGINIELSTNVKVDEKPSGEFKVNPITPQPIGVITMYPGISHEVIRNTLLQPVNAMILLTFGVGNAPQNPELLAQLKAASERGVIVVNLTQCLAGKVNMGGCALADAGVISGYDMTPEAALAKLHYLLSQNLSYEEVKAKMQQVLRGEMTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords L-asparaginase I
publication title Crystal structure of L-asparaginase I from Vibrio cholerae O1 biovar eltor str. N16961
rcsb
source organism Vibrio cholerae
total genus 89
structure length 328
sequence length 336
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00710 Asparaginase Asparaginase, N-terminal
A PF17763 Asparaginase_C Glutaminase/Asparaginase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.40 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ocdA02
3.40.50.1170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold L-asparaginase, N-terminal domain 2ocdA01
5DNCA 2WLTA 3PGA1 3NTXA 1JJAA 2P2DA 4Q0MA 2P2NA 1HFKA 1WLSA 2HIMA 5DNDA 2OCDA 4ECAA 2D6FA 5HW0A 4PGAA 4RA9A 1O7JA 1WSAA 4R8KA 2JK0A 5I48A 1HG0A 4RA9B 3ECAA 4R8LA 2HLNA 5CBPA 5DNEA 5K4HA 1ZCFA 5K3OA 5CBPB 1HFJA 2GVNA 2WT4A 1HO3A 1IHDA 1DJOA 1HG1A 1NNSA 1JSLA 1ZQ1A 3NXKA 5K4GA 1AGXA 4NJEA 1JAZA 4RA6A 5F52A 5I3ZA 5K45A 1HFWA 1JSRA 4NJEB 4RA6B 1DJPA 5I4BA 1WNFA
chains in the Genus database with same CATH superfamily
2C59A 4A8JC 2B2XA 2IYTA 2YWDA 2P35A 1HFKA 3BORA 2PRZA 1Y7LA 3OTGA 2PT9A 4P3YA 4CV0A 1M6HA 2ST1A 5EVJA 1AK1A 3R20A 1SBYA 3FH0A 3HVIA 3M6IA 3QX7A 1FL9A 1DUSA 3RS7A 1GTG1 4KX3A 2ZB8A 4HDSA 4J7CA 4D98A 4HWPA 2CV2A 2ODQA 2WVGA 2VDNB 3V4ZA 1DOHA 1E2DA 1KMNA 1O96A 3W5AA 4WZBE 1TIKA 2HO4A 1RHUA 2YFHA 3R3VA 2DWPA 5ARCA 1E2LA 3S27A 1NMQA 3AJ9A 3DDZX 3KJEA 4UJ3A 2RH8A 5FKJA 5JXIA 1R4MB 3Q7TA 4YDHB 1NUAA 1A9RA 1D0SA 2PFKA 5C1DA 4MCHA 4U7WA 1A7AA 1Y7IA 5A05A 2IS4A 4HR7A 1WZ2A 2COEA 5T5QA 7YASA 1O6ZA 3IXQA 3RTAA 2VNSA 4ZAXA 3M2PA 4I4TA 5LQKA 4PFSA 1ZYUA 3H1AA 5ADHA 4XOUA 1RKBA 5H80A 4YPFA 3R4VA 3X43A 3U44B 3DP9A 3HV2A 1GEEA 3I1YA 4MP6A 3OE1A 3HYCA 5LSAA 2AX4A 3N6XA 4BE7B 4PC3A 4EHFA 1MZPA 1CY7A 4YUVA 4D9MA 2HREA 1YJAA 1B93A 4HGNA 3ETHA 4I5EA 1DMSA 4KK4A 5JAOA 1PYGA 1DAKA 2A9QA 1OV6A 3MWKA 4PG6A 2IPMA 2W4MA 4NEQA 5A6SA 1O9HA 2Y9MB 4JA2A 5ENVA 1FFXB 1KAQA 5F52A 1R6UA 4M9QA 3RAJA 1GLNA 3QLVA 5BSUA 3WIOA 3V32A 1YQDA 3GLHE 4C0SA 5AW4A 3X1YA 3EGXA 4ZVVA 4J1NA 3TUIC 4B6EA 1XA4A 1YFZA 4MIEA 1SKQA 4BP3A 4BUZA 4ZGBA 2I2DA 3HKBB 4A5OA 1I9CA 2ZKIA 4AJEA 1Y4DE 1T35A 3NHYA 2EQ5A 2R7LA 3WGZA 1I2ZA 1Q0RA 2HRCA 2VTDA 4PPGA 1N0VC 3CA8A 1GQSA 1JLSA 3FZQA 1IB0A 4QIHA 3SKXA 3TWOA 3DE1X 2Z98A 2DT5A 3EXIA 1P5ZB 4GQAA 4X1IA 4PSVA 2YRXA 1KZGB 2XODA 5DCWA 4PTYA 2J41A 1E3QA 5FPHA 3VFDA 2BZGA 2JDID 2QPAA 3ADPA 4FW9A 4OXNA 3T9BA 4DCUA 3K1ZA 1CUUA 1Y80A 2AOUB 2VPWA 1ZK2A 2FPKA 3BXPA 2KX7A 3ND5A 1LLCA 4MDEA 1RBYA 1SM4A 1RYYA 2AYYA 1W6RA 3F8TA 2O57A 3W04A 4MVJP 2HMTA 1C7FA 2N9UA 1GPNA 5CLIA 4K86A 3DV0B 1GKUB 3A11A 2EFDB 4DRZA 2QP3A 1M8FA 2FG7C 3T3GA 5FWNA 4WNAA 2EHJA 2HUPA 2QTGA 3B7PA 2PKQP 2NVWA 2VK4A 2P75A 4ZCSA 1MPXA 1ZM3A 2NACA 2V7EA 4IWNA 4ZVMA 1E5QA 1L7XA 2VTEA 1N2ZA 1ZRNA 2WKRA 2WMYA 2WWFA 4P81A 1AY0A 4PX5A 2W2KA 4YGYA 1J1IA 3FPKA 4YJGA 4OLBA 3AVUA 4I9NA 5FI0B 3QE0A 1T13A 1G6Q1 2VRBA 4OUKX 4DIEA 1Q50A 4HQFA 4URHA 4PC6A 1SHLA 1ST2A 2O8VA 3FSRA 4HEJA 2I55A 4Y2HA 2HB6A 3D54D 4RZQA 4BVBA 2DH6A 1MZVA 1S2OA 4NS4A 1J8FA 1QG4A 2Y1LA 3A04A 4XI9A 4YK7A 2L17A 3V4OA 3DL4A 1WXGA 2XCIA 1SC1A 2R8RA 3E22B 3LKZA 2CYCA 4M8IA 4YJ2F 5TMEA 5HW0A 3UHOA 5A5FA 3ERCA 1I6MA 1GTVA 1E1KA 2B4QA 1Z6QA 4ZRDA 2VJDA 5LDDC 3M6VA 1T6NA 2Q5OA 1G64A 4JAVC 3U9LA 3USZA 1WZUA 2PV0A 4JBLA 4NZPA 3NONA 3FTFA 1ZIPA 4YFVA 1SOAA 5JAUA 4HDRB 1JJIA 1CUCA 4OAPA 3UZUA 2LVBA 1X1TA 3HWX1 4IEIA 3V97A 1H4VB 4E5DA 4ZQBA 4B6FA 2RGXA 4F38A 1G21A 3E84A 2EZ9A 4PRZA 2CUTA 4R1LA 1W30A 1ZG3A 2IGTA 3HDGA 1Z07A 2Q6TA 1A04A 1L7BA 4IIGA 1ZCJA 4LECA 2ZDHA 3PU6A 2J09A 2VP6A 2FXIA 3Q72A 1Z68A 4XDGA 4ZT7A 2IEGA 4RZUA 3BFJA 4YRZA 2PT6A 5IRCD 3F6CA 1P1CA 3DTVA 3K0FB 2ZS8A 3X1DA 3MGGA 3PFIA 3I8OA 3ESXA 3OMXA 3KYJB 4CMAA 4BMOB 1NQOA 3W34A 1E7QA 1C3XA 1HDZA 1XDUA 2Z8YA 1SBQA 3KWMA 4TGLA 1YZUA 3O2JA 1YK1A 1P7WA 1QE5A 1IBMB 2YXBA 5TF0A 2P69A 3JATA 2VDUE 5LB2A 5SZHB 2YUTA 5IT4A 5JFGA 2OAEA 3JAKB 5AI9A 3HVUA 5LA6A 4QTZA 4COOA 5CDSA 3LJKA 3O2QB 1H3EA 1QWSA 4GO1A 4CRWB 2GFQA 3EY4A 2QTLA 5EIOA 2Z6QA 3EXFA 1Z4PX 1ZMXA 4IP0A 2X86A 1R6TA 1E3WB 3C5HA 4DLSA 1TAUA 4FZRA 5FBQB 4X45A 1E5XA 3M4YA 3HGMA 2ACVA 2BJWA 2PS1A 1SIWA 4OYRA 4WRRA 2PE5A 1KBQA 3RADC 2FPOA 1SVMA 1GUBA 1CQXA 2CNBA 4OKSA 1W36B 2FEXA 1KIFA 5B1HA 4ASUD 3TTSA 3FETA 4X94A 1JNYA 4CI0B 4ZVOA 1OWNA 2OO5C 3DDOA 3PWTA 4W5QA 2XDWA 3RKUA 3ED5A 1CS4C 1P80A 3PNVA 4WTOA 3UXEA 5LKRA 4GNKA 3JYNA 4JBWA 1HT2E 5HGJA 2A6PA 2WHYA 1DTWA 4PLYA 2B0JA 3OKFA 5DSXA 2Z04A 1LDGA 3QSYA 1M5TA 2O6LA 1Z0KA 3IEIA 1T2UA 5DSZA 1GPUA 2QJFA 1QDEA 2WJPA 4UEWA 4BO1A 1O5TA 1FP4A 4A92A 5I7VA 4KRGA 4DDTA 4REMA 5MFZA 5CP8A 4L22A 4JYCA 2JRLA 4L8WB 1Q3KA 5COBA 3ZCXA 1IUNA 1NG1A 4JI4B 1TECE 3DOIA 4EFLA 2HH9A 4E31A 4EL5A 3DOEA 5LQAA 1RFLA 4NMWA 3UK2A 1HXHA 1TMYA 5B2ZA 2Y0CA 2VHXA 3KNZA 3A6HA 1E6LA 3A3NA 4G1FA 2JKYA 5HF9A 3OD1A 2NPIA 4LQCA 1ZNWA 4LPSA 3M81A 5ALMA 1OE0A 4WXPA 6ADHA 4CW7A 3H3JA 4Z7OB 3HADA 1CUVA 1FX0B 3I01M 4DNFA 3SK0A 2Z8XA 5T3YA 2PJRA 3DZFA 1RMQA 5AK3A 2CMGA 1EFPB 1RM5A 2R00A 5CK5A 3CNBA 5JPCA 2GXUA 3EARA 5ICCA 4FOOA 4Y6QA 2BFDA 3AKDA 3OFNA 1NSFA 4IR7A 3QVLA 3RAFC 3HDTA 1V43A 2D1SA 3IPLA 3LTEA 3OLQA 4R40A 5JD6A 1NA5A 1RJEA 1JJ7A 2XIQA 4YAEA 4ESEA 3EWAA 4HT3B 1DWUA 3AJEA 3DLBA 1G291 3VVBA 1P0IA 2O8NA 2OSVA 3GAFA 2CL0X 3B9PA 5HA5A 1Y7HA 4Q19A 3KU4A 2F8MA 4U0KA 1KK2A 1NMYA 4Q3OA 1KH3A 3ESBA 5ITVA 1TO1E 2P77A 2CLCX 5BQFA 2PLRA 1G4UR 1T91A 2QLBA 4ZDKA 2BCEA 3Q6NA 3ZZ1A 1P77A 2BIFA 2H6EA 2BGNA 3P9IA 4DXDA 4IRXA 1PV1A 2P3OA 3R0JA 2NXWA 4S3MA 5DLEA 3SJUA 4DJJA 5FBWB 3GEHA 3SIXA 3S7TA 4MWEA 3G0CA 2IEDA 3QPWA 4FGZA 3TNYA 4ARBA 2QMYA 4ND6A 3ZGOA 1XKQA 5CVEA 2HBQA 4RKQA 1IJFA 4EY3A 4P82A 3D31A 5IK2A 3V42A 3U39A 3VPBA 1L5HB 3PCRB 3ASUA 4LK3A 2QV7A 2V3VA 2J4DA 1UT6A 4EYEA 3CEJA 2WJZB 5H7XA 5M5BA 1YFLA 4QPCA 3NRJA 1BQ4A 4ER3A 4ZO4A 3FWPA 4LBVA 5DYNA 5C4MA 4D9BA 4NCHA 4ZAWA 1Z47A 4DUGD 1I33A 2EFEB 1VLQA 3CNOA 1R8QA 3KTOA 3PNSA 4FFBA 1IZ8A 5G2OA 4TKVA 2DR0A 5EI5A 4H3SA 2VHUA 3W3AA 4MYSA 1YGYA 2QY6A 1Z7YA 3CVWA 1WSWA 3NCHA 2VA8A 2BCJQ 4HPWA 4N7BA 1AHPA 3ROTA 4BBZA 4D9EA 2ZPUA 4PAWA 1UBCA 4GR5A 2P67A 3OD5A 2C4MA 4DSZA 1SBHA 3P2YA 3DDUA 3VYRB 2VG8A 4K5QA 3UTDA 1OFTA 1VLHA 2P2GA 4LRWA 1W8DA 3PKIA 4K6OA 5A02A 1WQ3A 2W4QA 4NYMR 5J2TF 1W75A 3PR2B 2WJGA 4F9TA 3PI7A 3U4CA 4LZWA 2AH5A 4FFNA 3WK7A 1OH5A 1Z34A 3OPYA 1KI4A 1VHQA 3LE8A 3O5AA 1T8SA 3GC6A 4X1YB 2BL4A 2ZYGA 5AKIA 4YXWA 2Q99A 1SKUA 4GBGA 1IMJA 3DXXA 4JKYA 4B4OA 2QD5A 4FYHA 4PO8A 3UBTA 4AG3A 3KR9A 5F9HA 5KNLA 3JR3A 3NTXA 2OK7A 3B1KA 4IMIB 1GN8A 3GLGE 1KYTA 1MF7A 1T36B 3C1TA 3KKKA 3P4YA 4HUJA 2C1XA 3EAQA 5EXXA 3RVMA 1GAXA 3BE8A 3UWPA 4ZT6A 4DADA 3SE0A 1YQTA 2ZUDA 3GFBA 3R8CA 3VPDA 2CLEB 2WVAA 4FHEA 4ZI7F 4ZTUB 5PGMA 2KSQA 3F6SA 4NVRA 2Z09A 1ETUA 3ZHRA 4P7FA 3G49A 1DQPA 2JFZA 1ZQ1A 4UZSA 5AM0A 5E6SB 4Y6LA 5C1BA 1ABBA 4X65B 2PZBA 2VIIA 3LZDA 5JSUA 1CLEA 3PT9A 3LCCA 2D7JA 2DF8A 2VK2A 3IAEA 1ZSYA 1TT5A 4DRYA 4LCJA 1ORDA 4B4UA 4RQUA 5ALSA 2GZ2A 2B34A 3F78A 2H31A 4Q1CA 4DA8A 1FOEB 3AUFA 3I2FA 3NNSA 1ZKDA 2OV2A 2DBQA 5LUAA 4MWOA 3GT0A 3SSMA 4FCCA 3CB2A 3QX9A 2OOSA 3EVFA 4RSGA 4D8VA 4OU4A 3NTOA 4UD6A 1DHRA 1QF7A 2WF9A 3OTHA 3O8NA 5BO5A 3CZAA 4QXQA 3JVVA 4IGAA 1JHPA 1PEDA 3ZQ4A 2N1MA 4K40A 4PZLA 5DRTA 5FNVB 1SC4A 2I2WA 3ZKWA 1EVKA 4A8JA 3TGWA 2VJKA 5I4CA 4EW2A 3SQWA 4O4JB 1IM5A 1O5OA 2F00A 5I7HA 1DLIA 2QZ9A 4RFLA 3UG6A 3VKVA 4M38A 3MWDB 2HUNA 4HH4A 2ZJ2A 1TMKA 2I8AA 4C22A 2XUFA 4Z49A 2DUNA 2VYNA 3UC9A 4B3TB 3D2BA 3Q5EA 3GPCA 1AKYA 2YCLA 1JVNA 3VV3A 3TZKA 3IA2A 3AHFA 3EMBA 4MWDA 4C7KA 1MHPA 1T3HA 1TKAA 2XR1A 5MN5A 3OE5A 1N6HA 5LMCA 2BFEB 3THWB 1GTMA 1W9MA 3CLVA 3ET5A 4XGIA 1KDZA 4XUGB 4BO5A 3IMKA 1VLMA 4NZMA 2HLDA 2EGGA 4PLPA 3DO6A 2G17A 4NZYA 5IP5A 2C4KA 4DANA 1I4TD 3ZHBA 4XXHA 4NABA 3AETB 3F9IA 3OI7A 2RG7A 4CODB 1VMKA 3RVNA 8GPBA 3FG9A 4D02A 4DDUA 2R44A 4CKWA 1LVGA 2XDYA 4MMYB 2RGBA 3QK7A 1CS0A 2F2TA 3EXHB 3QRWA 1TEZA 3E35A 4G0YA 3VC1A 5BRJA 4Y6GB 3KFVA 1NLYA 1BMQA 1TU4A 3GVHA 3CCBA 3HBNA 1M6VB 2F7SA 4N5LA 4XTCS 1UKCA 3GFTA 1ZVMA 3ONDA 4Q9JA 1W5TA 5DWDA 1M67A 5IARA 4LDZA 4EI8A 4YMUA 3BMNA 3WYDA 5B3JC 3LC0A 2H4FA 4C7BA 3C5VA 4NS1A 4G8BA 4TLEA 5BR7A 2Q5CA 1MX9A 2ZB3A 4GKAA 4BY9E 3T12A 3CUTA 1Z5ZA 4G37A 2JIOA 3AP3A 3K1AB 4J3FA 4IX1A 3RW9A 3VAZA 5FYDA 4YMVA 1J6UA 1Y81A 1APBA 1M75A 1IPHA 4GMHA 3ZZNA 1WHTB 3U56A 1TUEA 3H5RA 1FMFA 2ZQZA 3WE7A 4EHIA 2HRBA 3WLPA 3OEEA 1SXQA 4IZ6A 2NTJA 2PO7A 2QVZX 1Q0ZA 4QJIA 4DG5A 1IQ0A 3DL0A 2W6JA 4OL9A 1NVXQ 5AIAA 5CDFA 1EFRD 1U2RA 2V7PA 3IP8A 3SEFA 1AQJA 3OM0A 4I19A 1ZI9A 1DX6A 1FSZA 3NRBA 3NTQA 1P4SA 1IN7A 1QBKC 3IQDB 4EDFA 2AFHB 2HI0A 1XAGA 2H5EA 2AEMA 3O1IC 5GM2A 1Z15A 2I8LA 4MR9A 4EJ0A 4EUKA 5ILOA 3L8CA 5EAIA 1GARA 2A8YA 2OWDA 3QGMA 3EF3A 1JDSA 4CT5A 4B6GA 1WDTA 1RWVA 1UC5B 3U26A 4MR7A 1N2OA 3L6OO 4AJPA 5GZ1A 3IP5A 1GSIA 1UIMA 5FWXA 2B6HA 1W5BA 3MS7A 2X76A 3MBOA 1UZAA 2CLHB 4MCIA 4C0AC 3HWRA 5JY1A 2ZRNA 5GV8A 1Q22A 3G5UA 5LYJB 3I04M 3H2YA 1G20A 1VL6A 1K5DA 1QC5A 1O8BA 2V9PA 3BXHA 3C7KA 3BQ9A 5CURA 5F35A 3RWOA 7MHTA 5FV4A 1QX3A 1LPPA 3V4PB 1U65A 3I6ZA 5ED0A 1ADFA 1SKYB 2IZ1A 3C3XA 3NXKA 4IYRA 4BLUA 3OP1A 5ICSA 5D3MA 3SR4A 4RV5A 2QVBA 4G0PA 5MGNA 2H9AA 1W4AA 1P7YA 3ES9A 4DIKA 1E9SA 1JEJA 5GONB 1O9BA 3S1SA 2QF7A 2CWWA 1IQUA 2Q3DA 4MGYR 2AHRA 2H1OA 1V11A 2FLWA 3V80A 3ECSA 3H4IA 1ML3A 3R6WA 3WAGA 1L4BA 5BPFA 3ISTA 2Q0QA 1RR6A 2ZI7A 2W0SA 3TVTA 4DM7A 4DVGA 2VKQA 2VO1A 2CLIB 1XZMA 3GN1A 1T1EA 4UVIA 3S6JA 3H5OA 3O21A 3ZC3A 4AURA 1NF2A 1MO3A 2C2MA 4PG7A 5TEWA 4MI6A 4E7OA 3PNMA 1L6RA 4FDVA 4LY0A 4EIWA 2XQGA 1A5SB 1W4RA 4KPUB 2CF6A 2FI1A 2MINA 4NBNA 3C3YA 4KRXA 1QRDA 2O0LA 3UT6A 2J48A 5EUCA 5CYFA 1J06A 2W8ZA 4EGFA 1UF9A 5IM4F 1S2GA 4HN9A 2DJIA 2NUTA 4DR2B 3IDZA 2IPNA 3LPNA 4WZAA 4BLTA 5KSYA 3KELA 3DLIA 3JZAA 2W90A 2H51A 2XWQA 4IQFA 4L85A 4MDYA 4MXDA 3D3WB 1YJXA 1YTLA 1U8FO 4J4BA 4LYHA 3U4DA 1F51E 3WKAA 1I4DD 3ZHXA 4XEUA 3WDMA 1PHPA 4ZT2A 5H3HA 3SBDA 1JEYA 1L5YA 2UZ4A 2DKFA 3QELA 4HXFB 4UHCA 2W6NA 1H4TA 5HR5A 1QLWA 2CGEA 2WWRA 5LBTA 3TAUA 2XB8A 1CEEA 2I5PO 2VUTA 3HY4A 4CE6A 2FCAA 2YBDA 4B4KA 1W1WA 3A06A 4N5NA 3C4VA 5ADWA 1JFFA 1MB2A 4UMDA 3WWEA 1XX6A 3O3CA 2HSDA 2KYRA 1LA2A 1ABFA 2CHVA 2YDYA 4GSYA 5F77A 4JELA 1RCUA 3HGTA 5CT9A 1MT0A 2R25B 4PGMA 4LTNA 4O2AB 3QF4B 2CXHA 2HO5A 5J63A 3NJ8A 4MW2A 4C7OA 2CWDA 1KI6B 2HRQA 3ZWYA 2HADA 1ECCA 4J49A 5JQGB 1VE7A 1HQYE 1QH0A 2DHQA 3P0IA 2X3UA 4LZPA 3T7KA 4KQCA 2A35A 5EG5A 3BSWA 4EENA 1E3MA 3WL4A 2KI5A 1F20A 1NVKA 4QFBA 3UO8B 4DMGA 3KUUA 3I23A 3UA4A 1IHDA 4CKYA 2BRUA 4JASB 1IQRA 1HMPA 3HI6A 1TEHA 2QENA 4I36A 1GU1A 4X24A 5LOVF 5F4ZA 1GGFA 1L7AA 2VJMB 4R1OA 2JIBA 3VU9B 4FSHA 2C4HA 4WOBA 1P74A 1ZWKA 2FEOA 3G68A 4GMDA 1Z18A 3IUBA 2O0KA 3ND8A 1C4XA 7REQA 2VSOA 1TKRA 1V96A 2BHRA 2P2DA 3REQA 1RXWA 1A9SA 3JQ8B 4PE5B 4R9SA 5CIYA 1DKPA 3G82C 3H9CA 4F1KA 4HB2A 4S35A 3C3DA 1BHQ1 3H97A 1KKUA 2HIHA 4RTNA 2IZ0A 2AI1A 3AU9A 3E9YA 1N3IA 3AVXA 2PAFA 1POWA 4R7TA 1KJNA 2QDXA 2FPIB 4CQLA 3VPFA 1SBCA 3JWEA 1TT7A 3DTYA 4LKRA 2J32A 2VZLA 4A8HA 3BF8A 4EB3A 3R6DA 3DDWA 1U1CA 3O03A 4I46A 5T64A 4KXXA 2X9LA 4YV0A 1U2ZA 2RB5A 2BKXA 2QY9A 5LD2B 1NQAO 3AFMA 1DC3A 4GP9A 1O58A 5FLKA 4QOIA 1OC2A 3IQWA 1HYQA 3SR0A 3WA6A 2X7JA 2IHVA 2ZE5A 3WRVA 4YUZA 4Z4IA 1J2UA 3ZU6A 4U9IS 3WXBA 1JLLA 2J9FA 2NVUA 3KDSE 4CMIA 4PAGA 4DM4A 3K0SA 3Q5GA 3Q7SA 4EKNB 3BA1A 4D8YA 1RAAA 4D9JA 2Z08A 1Z6XA 2HHHB 2CNKA 3S2ZA 1P9WA 1I3NA 1EJ2A 3NTVA 2QTWB 4GL4A 4F84A 4J9UE 5IEJA 2BBWA 2CEAA 2HGZA 3N9IA 3PHCA 4MVCA 2FG6C 3VO2A 4BVAA 1C2TA 2VYVA 1I94B 5BMVB 2FZCA 1J2TA 2GO7A 3STWA 2EFYA 3QXXA 4LFCB 3GEIA 3G2JA 5FJJA 3H99A 5FUVA 1Z63A 3V4VB 5HQTA 2P30A 2BF4A 4YCBA 3JQPA 3PG5A 3AEQA 2O2JA 3ONVA 3ZE9A 1Z2EA 2I3ZA 2Q8PA 3BD8A 3I0NA 5CH3A 1TQ2A 3AG5A 4J07A 3PJFA 2Y2UA 4HVLA 5C7OO 5EKTA 2ATEA 3A9CA 2NV2B 3GN2A 5DMHA 5ITZB 3KWLA 3DO8A 3VX4A 3X2SA 2GCNA 3EE6A 1KDYA 4AY6A 1F2VA 2HCRA 1FNDA 5JSKA 1FYVA 3VU3A 4HL6A 2PD6A 2YIMA 5JOQA 2FG5A 4MKZA 3P0FA 4IIUA 4WFIA 1ADBA 2DZDA 2FN8A 2Q2WA 1VI2A 4AZVA 1E0KA 3V4LA 1EUCA 4NJMB 4QQNA 4KG7A 2HIAA 3I0ZA 5HE9A 4ZGGA 1S1MA 1Y9JA 2JFPA 5FTLA 1C1HA 1MX3A 3L4JA 3P9NA 4MVXA 3VPHA 4GXQA 2A4MA 2OCLA 5D01A 2H2HA 4HNAB 1NXPA 5DNYB 2C7VA 3ORYA 4IW3B 3ROXA 2EFHB 1LWOA 4CM3A 2BCGY 2NO1A 4WINA 4Q4CA 2N42A 1E99A 3L8FA 4E5MA 1KAOA 3U4MA 3VUFA 1XZPA 4RPIA 1XB2A 1WB6A 1GUDA 1BCSB 1ULUA 1QHHA 1BJRE 2ZU0C 2Y77A 4U00A 1TMOA 4Z8YA 2XOXA 3P9SA 5BSRA 3WQBA 3W5SA 5EHNA 5CT8A 4RS4A 4EHJA 5I7RA 5JCPA 1DCFA 5IC4A 1VJ1A 2XGGA 4UHBA 4V1CB 3RUAA 1MVOA 4RVFA 4D44A 5KTTA 4V0NA 4ALKA 2G5PA 4G25A 4UTRA 5J23A 3R3ZA 5TMPA 3FMGA 1P91A 1U6KA 1DT5A 4Q9KA 4UCQA 4BLSA 4RWZA 2BGWA 1XCBA 4CTOA 1N77A 3IBGA 1GDTA 3B53X 1P7PA 1R0BA 4YYEA 4B33A 1LXCA 2FSIA 2PNJA 2VFAA 2WTUA 1N4DA 3JQAB 4UHFA 4B3DA 2IEAA 2QR5A 4JI5B 1OXKB 3PNOA 3I9MA 1DKQA 3R3YA 4NH4A 3GLSA 1JR6A 1L3IA 3GW8A 3K2EA 1T6ZA 2HCJB 3D0QA 3V3KA 4FJ1A 1U0OC 3W78A 4B7XA 3CPHA 4LY9A 1UJ5A 5HZGA 1AKWA 2DQSA 5B3AA 4AI6A 1RMTA 1Y6JA 1L3CA 3T95A 5H4GA 1A1SA 1LDEA 3L79A 4X8LA 5KQSA 2CZQA 4TZTA 3DMGA 2QJOA 3PHIA 4BE4A 2O8FB 4Z51A 5BR1A 2AN1A 5T8KA 3WGYA 1X2EA 5ITWA 2MSDB 4RHTA 3W4IA 3MJRA 2NU6B 2AF4C 1ARZA 3IUSA 1J42A 3IV9A 3P2MA 4R81A 4ZJYA 1QH8B 1FFHA 1SCAA 1QH1B 3FI9A 1RE1A 4U6NA 3ZOKA 4EY7A 4G1UC 5FAXA 4H6PA 4Y9RA 1KARA 5SZIA 1G8MA 3GK3A 4KQKA 3BG5A 3WJ2A 4EHAA 1WKBA 2FP4B 5TV2A 4MTCA 4ME6A 3L0ZA 2H4HA 1XKLA 4UJ5A 1K6EA 4GD3Q 4WASA 2O7QA 4IFBA 5HDQA 1SKAA 1Q57A 3D4IA 2J46A 5C0OE 3V8VA 4UZFA 4JJAA 3UMVA 2CFCA 1R12A 1V26A 5EC8A 2RE8A 5BN4A 3HLTA 1UWVA 3L1UA 4XLLA 2YWBA 2BFFA 1M33A 3TLKA 1KYIA 4MP3A 2ZTHA 1V5EA 2WWVD 1WXEA 2WC1A 5KOHA 2G6TA 4YJHB 5AXBA 3SOPA 2PAAA 4NXMB 4TSFA 3ZGXA 1KP2A 3L7BA 1CNMA 2X0DA 4MAFA 1I30A 2PL5A 2PS9A 3NTUA 4NBLA 4XARA 2VK8A 4LJSA 2GJ4A 1W93A 4ZARA 4UVEA 3AJ8A 1XEFA 4QPDA 4Z2YA 2RGWA 3HA5A 4UQLA 3NKFA 9GPBA 4UHJA 1N6RA 1OV4A 3D1VA 1TUBA 1ZGZA 4D8TA 2CXUA 3G13A 1W25A 3OQNA 4NJOA 2IP2A 4YO7A 2Q9BA 5JROA 1MIHA 3FMIA 3A1WA 4FBLA 2BDEA 5L4SA 1VDMA 2RGAA 4LWQA 1Z25A 1T34A 1Y8RB 5CBPB 5AOCA 3AL3A 1MTOA 1XZJA 3H2ZA 3IBCA 4LVOA 3E18A 4A23A 2RAVA 5JH7F 1YL5A 3LX6A 4AP6A 4OSOA 4EEZA 2BEUA 3OZGA 4FZJA 1JIKA 1F6DA 1LLUA 3CZQA 3CNQS 2VDRB 5EZYB 2ORVA 2TRSB 4RQBA 1ZK1A 1KEWA 1HYGA 2C4TA 4ZAVA 3ZHUA 1UBKS 2HSGA 3IQIX 4KXNA 4IXWA 5EJGA 2WYHA 4JUDX 1KY4A 4EGAA 2E87A 1QIMA 3ZZUA 1MB0A 1RXYA 5ER9A 5AK5A 5J47A 4N8EA 5CFQA 4MVJI 5HMLA 4U2DA 3HB1A 1FFAA 1DIOB 5TGZA 4I81A 4AKEA 2B9VA 5G1NA 1N57A 4DY6A 3GAZA 4LNHA 1O77A 1Z5UA 1ZD4A 1ZN9A 2OLJA 2PL3A 3I39X 4MRMB 4J7UA 1FFYA 3TVYA 1KI8A 2RGNA 4C4YA 3NYIA 3FYTA 4JQYA 4CDMA 3JAMA 2X8JA 1IZ9A 2BR4A 3CZ4A 4PRLA 1OSNA 2RI6A 1ZK3A 4NECA 3ZNOA 3FDXA 4NMHA 4ZVNA 2V4MA 4QFDA 3UT5A 3L18A 1XL1A 1HE1C 4K26A 3ZXXA 1GQ2A 1ZDMA 1QJ4A 1JV2B 2PJZA 3IILA 4CKBB 4YRKA 1JMKC 1DSSG 2XUZA 3NBUA 3PPXA 4WNYA 3NASA 4JL6A 4E5UA 4LHZA 3S2EA 2FP3A 1K7SN 4XWTA 1H2RS 5CX1B 2JLVA 4DSTA 4MVWA 2YMQA 3IUNA 1PNQA 1Z5WA 2FPWA 1NX6A 2XE8A 3F6YA 3FMPB 1V6AA 5HDBB 1K3TA 1VCMA 4HYTA 4XJXA 3STYA 2BFCA 3T61A 3YASA 4TLCA 2V5VA 1Z2NX 3CLRD 4BIMA 1YZNA 5ITZA 3K30A 4J0FA 1I10A 2GK4A 3E2PA 3B6IA 4HPJB 1R9NA 2YHIA 5EYPA 1IN5A 1LJLA 1QYXA 1U90A 6REQA 5DOVA 2Q3FA 4F72A 2PXHA 5TRTA 5E4YA 1E1CA 2FPPA 4LV8B 4RXUA 4BGIA 4I55A 1JFRA 1R0CA 1Y3BE 2XZDA 2BKAA 4K03A 5C1OA 1MO2A 3FWKA 1SKBA 3I2JA 3MWFA 2M1XA 2I1VB 1RKVA 2QHXA 1MNAA 4MEAA 5K6RA 4NFYA 1IFXA 2BEVA 4INPA 4KFCA 3NS7A 5AOAA 4DLLA 5AVSA 2R11A 3MAAC 3L40A 3QUBA 4GLBA 4B7UA 1EUDA 1X7ZA 3LRPA 5GJCA 2VQSA 4F46A 3IEUA 4E22A 2FJUA 1NL3A 1Z38A 2X0JA 3O0TA 3VHQA 4BWVA 3FCXA 4Y2RA 5KJCA 1P6QA 3DFFA 3TTUA 2Q2OA 3E5NA 4JBXA 1VIDA 3MELA 1IXSB 3DE2X 3EIEA 4G8DA 3E1GA 4IIJA 4BS9A 3HNPA 3K5HA 4YRSA 3UJNA 1KR5A 4LWZA 2AMJA 3MVEA 3CZ9A 1UJMA 5CVVA 4YONB 4QKQA 3QUAA 3CHYA 1BS9A 1AA9A 5ES3A 1IOVA 1EE9A 3CWQA 4QRDA 4AXXA 4D3ZA 4UFPA 5E9WA 3AEZA 3M1AA 3PB3A 2G9VA 5GVSA 2OV1A 4PTLA 1B4DA 1G16A 1UM8A 3NEAA 1CR6A 3P5SA 4TWRA 3RNLA 1OGJA 2ID8A 1X1QA 3AFIA 1QGOA 3B9QA 3VMMA 2X0RA 3TSYA 3LK6A 4D97A 3Q0TA 4JFAA 3AKEA 4LMAA 1H1TA 1N3YA 1RYHA 3U7EB 3NQ41 1YB6A 3COPA 3K0AB 3LCUA 3PR1A 2PKQO 4MGZR 2I22A 5CFMA 3RVJA 3I3SR 2VNIA 1XNHA 5JI3E 1XA0A 2P7HA 2QQEA 1ZGCA 2QLNA 3EVNA 3GFOA 1WHSA 3RNOA 3F5MA 5GZ6A 4JVLA 5BWMA 1AF4A 1KYVA 1QV7A 3C5WP 1XDSA 4YP0A 4JFRA 4YRCA 5D3ZA 4MJ7A 4BGDA 5TLSA 1ECGA 4CU2A 4EJFA 5IAAA 1E1YA 3KIPA 3CUKA 4KQJA 1VMEA 8AT1A 4OJYA 4WCVA 1GR0A 1J2JA 1RABA 3FWHA 4HAUA 5F2KA 4ZVTA 5KYWB 3PTZA 2G0NA 2DTXA 3M9XA 1Y1SA 4H4DA 2YJTD 1EMDA 3L0BA 1Q0PA 5CHYA 5J59A 1VSQA 1AUOA 1KAGA 2ET6A 2X5OA 2HJGA 1IRIA 1ZNQO 1X0VA 1M54A 2GERA 5AI4A 1RM3A 3W2GA 4IHKA 1XCGB 2EAUA 4UREA 1DX9A 5F76A 3LU1A 4LTDA 3VR3D 4UBNA 2JLQA 4ZHQA 1X7WB 2B30A 2W0MA 3DL7A 3IDQA 3K0KA 4TTJA 1GDHA 5K45A 3TXAA 2BKUA 1NQ5A 1EVQA 1E7SA 4NY1A 1VRVA 2DPLA 3OIGA 2W6IA 3OLXA 2CF5A 1L5FA 1GJRA 1MAWA 1Q0HA 4UMFA 5THXA 1QG2A 1A0OA 1DAGA 1T9CA 2UZ0A 4FVTA 3VC3A 3OSZA 4FZ3A 3QJYA 4Q9AA 1LF5A 2DVMA 2JD1A 4W63A 2CCJA 5LQMA 2A7XA 1HKHA 3DMNA 3ITEA 4R8VA 2VJBA 2HCTA 2LD4A 3FPFA 3II6X 3DUWA 1F48A 2XY4A 1Y6ZA 3EGVA 3ST7A 1B00A 5JQWA 1A7KA 1I6KA 1OIWA 1DTEA 2EIXA 3L6CA 3FUWA 2I6FA 2QVLA 3GWZA 4XPZA 5E0OA 1U9IA 1HG1A 2CXXA 6NULA 4W9NC 4PX2A 5ICEA 2ONYA 3GJRA 4HGYA 5I9NA 5DO9A 3LOPA 3ZY2A 3CGGA 3UA3A 3T7TA 5TX7A 2QRVA 5IMBA 1W5SA 4MRSA 4PC1A 5J43A 4FI3C 1N36B 1SQGA 1A50B 2D06A 1FUEA 4PYNA 2RGEA 1KO8A 3ER6A 3IPCA 3LBAA 4KUGA 4XIIA 2X41A 4KSBA 1KQPA 3KPWA 2P2NA 1W581 2QX7A 1QZZA 3OA2A 4N7RA 3FNFA 4ROSA 3TLBA 4BO2A 2LCIA 2FSVC 2Q4TA 2QRJA 2YOGA 1L5WA 4X0EA 1SMKA 2LBPA 3IAM1 5BOSA 2GXAA 2EV9A 2WSSA 1FBNA 3VOBA 2PS3A 3V5NA 2F3QA 4ID9A 4KHPB 4CTMA 3CXUA 4IKPA 3G02A 4JYBA 3CLRC 1FU8A 3HMQA 3V4RA 3DEKA 4YI5A 3OT1A 3VOTA 2V6IA 2A9VA 2A88A 1AU9A 5L3QB 1C9DB 4Y2VA 4DDKA 1N6KA 4LOIA 1RE0A 4M7PA 4OBEA 4U2BA 5K2OA 1MLDA 1NUUA 3ZHOA 2RJ3A 3L6BA 2DY0A 4TLBA 4XDYA 3ADDA 3VISA 2YY6A 3BGOS 1JHYA 5CFRA 2SCUA 5FEUA 3C70A 3KAPA 4EA7A 4Y67A 2FWIA 1AS2A 1C0KA 4QEKA 5LMZA 4J16C 2RK4A 2P5UA 3V48A 4RX1A 4S1NA 4GFDA 3S3TA 5JXGA 2EFJA 4YRMA 4RZ2A 1KZ6A 3LLVA 5HK9A 1C29B 4RO0A 2P6RA 2X6TA 3DAGA 4RF5A 4RD0A 4CHGA 2FZEA 3CVYA 1NLFA 5DLQC 3ICVA 5B57C 4C30A 2LWIA 1U94A 1QGDA 4KPFC 3SDBA 5B58T 1JYSA 3KHTA 1JAXA 1EFTA 1UBLS 4G0WA 4K2AA 4I6GA 4XB6B 3EJ6A 4E94A 1QP0A 1ZUHA 1RWBA 3EW7A 3AM3A 4DPMA 4JY7A 5C35A 2ZP1A 3ENVA 3I28A 2W98A 4IHQA 1XMXA 2DYKA 2HQSA 1SXJE 1YKSA 3U5ZB 1ZJ4A 1CFJA 2HQOA 4DR6B 1XJWA 4DWVA 1EFVA 5BWOA 1KZ4A 4F96A 1BVHA 4H17A 1SA0B 4D8UA 4IDHA 4N41A 4HH0A 3UJHA 2R84A 3PVCA 4J1TA 2I7CA 2ZJ7A 3FRHA 2MSLA 1G0OA 5GJVC 4YJ2B 2PCLA 4J0DA 1I7SB 3OZBA 4V2IA 3VYUB 5BVGB 1SEVA 2B8NA 3TW8A 5HJ5A 4WIAA 4DV4B 5JV5A 4S2EA 1VJ5A 2RARA 2XB6A 2ZR9A 1ZZEA 2FE4A 3F5DA 3KBBA 3PRHA 2JGDA 4R1PA 2QRHA 2BLNA 3G5LA 3SIPA 3N7TA 7ABPA 4FIDA 3UMMA 3G17A 2PKRA 5CXSA 1K0FA 2XE7A 3HDQA 1P9NA 2D0PB 1X8KA 2VRCA 3GLFA 4FMBB 4G9GA 1KS2A 4QGHA 3OG9A 5EXEA 1AZLA 2B36A 2P3QA 1IBKB 4XFJA 1YAJA 1ECFA 4J7AA 4MZXA 3FOCA 3WNCA 1JA1A 1ZESA 4H7DA 1P1RA 1HEYA 1CE8B 1LI7A 1NV9A 1SPBS 4H9GA 3ZDZB 4FB5A 1R18A 3L7KA 1DB3A 3RLIA 4KE8A 3EVZA 2YQ4A 5JLAA 2R1ZA 1BOFA 4QJ5A 3FDZA 4TVKA 1HORA 3SDSA 4CM9A 4QOHA 5K7SA 1UBGA 5A3SA 1RRCA 2PUCA 1L1QA 2O1WA 4HNGA 3UJ9A 4MH0R 4PCAA 1G38A 3U7FB 3OTWA 2D13A 1YC2A 2EL7A 4OQEA 4B7ZA 4UTPA 5K0GA 1AVTA 4RGVA 1E8DA 1M1ZA 2O4CA 3SJZA 3H6HA 2AN3A 2ONKA 1XT6A 1Z6GA 1LPAB 2EFCB 2IYWA 1UXOA 4D0RA 2NTNA 3GJTA 1ZM7A 4FDTA 4GBMA 4KLCA 4PO3X 1EZZA 1NLUA 5AKZA 3PC2A 5SY9A 4MV4A 4EWLA 3P2EA 3B89A 2UDPA 3K9GA 2DBYA 4HF7A 4M9SA 2CVQA 2YV2A 3DNFA 1U5BA 2Y1WA 3Q7RA 4D8WA 5JSZA 2XUOA 2NVBA 1MO5A 1JILA 1M6WA 1Z2PX 3KPVA 4IXMA 3TR0A 5L3SA 2VRWA 3PQ8A 4R3NA 4IDCA 3EVTA 3F6BX 3FX2A 1MQ9A 4U02A 3L7DA 3JR7A 4FT4A 2LP4Y 4OG2A 1UP6A 1W0JD 1VLJA 2WD9A 1IULA 4HQRA 4P4NA 2AJTA 3NANA 5KMGB 2XBUA 2I2CA 2PLNA 3Q41A 1YNOA 3PP8A 3P9RA 1UPTA 3QV2A 4RENA 3W2HA 5C3MA 4I55F 3RYHA 1TUGA 1KJ8A 3EMDA 4UPVA 2H1CA 4CV2A 5B2EA 1DCKA 1NAHA 3U7IA 3EIXA 1E2NA 1S96A 3H5AA 3R9XB 4I4IA 4GNRA 5ER6A 4ZCPA 5BW5A 5KB3A 1FF9A 5BSEA 4FUTA 4FFSA 3TLMA 4E5PA 3N75A 3BWVA 3N2LA 3QFFA 1KE2A 5FTKA 3ECCA 2IIPA 2VDJA 3QTBA 4MS3B 1EJ6A 2J7PA 3S1LA 1CVLA 4A1FA 4MWGA 4RGQA 3HP1A 4JH0A 5FA5A 4BQRA 4Z54A 5K0EA 4CV1A 2ZSIA 1SCJA 3L4KA 3ZWNA 4GMXA 4QPNA 1T15A 4REQA 4TMFA 1KBOA 3RGWS 1HOXA 2WIKA 1QGUB 3HJRA 3IDAA 3OX3A 3UOWA 4YMTA 4RZXA 1UT8A 2D2VA 4LJ8A 3RWMB 3IKVA 1GVNB 4WBXC 4CM6A 2PR2A 5BV7A 4LX8A 2PX8A 4UEKA 4BECA 2AKAB 2DWUA 2XOKD 3N7UA 2BI4A 5A3JA 2XDQA 4PCUA 1SBNE 5DRYA 5CM2Z 3UEOA 3CZRA 1QRRA 4XWKA 4RW0A 3TRJA 1MC8A 4A10A 2JGRA 2YBEA 1XPRA 1B16A 3PF8A 4DNXA 4CIWA 2I3AA 4BKQA 1BXZA 1LNZA 1DUVG 4R7GA 3VTAA 3FHTA 2CE2X 2VOEA 2Y1DA 3NAMA 1E1NA 1V9LA 1ZHFA 3UV7A 1VA5A 1UDAA 5JMWA 1A4RA 4Y0NA 4KR3A 5TQ2A 1H5QA 3GX1A 3E9CA 2B5OA 1F4PA 2FHSA 4L28A 1BXGB 3AI3A 3D1LA 1XQXA 4MS4B 4EW1A 4YGXB 3EC2A 5FNZA 1XPOA 2E5WA 1KU6A 1KFKB 2QRNA 4X7BA 3EZFA 4FGSA 3RB8A 2JJ1D 1F8YA 1GYPA 3JD3A 2V1XA 3W5BA 4BCCA 1BAPA 4OM7A 2B5WA 1FW8A 5JAIA 2V6JA 3RJMA 2FU5C 4AKHA 1MXHA 4MW6A 4K8RB 2PUJA 1S2DA 4FX2A 2ZYHA 2PQ0A 3AF4A 4JYMA 5B37A 1RQNA 2GETA 3JYQA 3DFKA 1AA6A 1PSDA 2W2LD 5C3UA 4X97A 3OEYA 1RRPA 4KZPA 4HDSB 4KYVA 1RP1A 1AGXA 1O96B 2VHQA 3HNOA 4K6CA 1X87A 1V2HE 5I5GA 1BDJA 4BX3A 3CM0A 1JEYB 4Q3BA 3FZGA 4NG4A 2N0SA 4YIHA 3HNRA 3ORHA 1OH8A 1LBIA 3OX4A 3P9CA 1ELOA 3R0IA 4QC2A 1E3DA 4RK6A 1XN4A 4PXAA 3U40A 2Z6AA 3UY4A 1KVQA 1BHSA 1VHJA 1NASA 3G88A 2AMYA 3B5EA 5DBIA 2B25A 2NN3C 3V9PA 4URXR 2ZUWA 2V59A 1HFEL 2V7XA 4MW7A 4NZZA 4OJNA 1ANKA 3AUXA 4HZUA 5DE3A 4DCVA 4I4TB 3MGCA 4RCVA 3AXTA 3A3KA 3PV0A 3OPQA 4X6LA 4F5EA 1A1VA 4LRQA 1SHTX 1U2QA 3OO1A 2QG4A 4IQ8A 4M76B 1BA3A 3FAKA 1CJSA 3INGA 4W1QA 3L3BA 3QW4B 1EWRA 1PNRA 2DC1A 5J58A 2VDVE 3QWFA 3TQRA 3Q7PA 5AUQA 5A6SB 1HZZC 3EHEA 3PNYA 5HBRA 5LYYA 2I67A 5DGIA 3SBXA 4JI8B 4DQDA 4P7KA 4Z3OA 2ORED 3QY9A 3KDAA 3IP9A 3EGXB 4G3XA 3UKJA 1T24A 4YBRA 4FCWA 5LQUA 3QEOA 3DD5A 2GCIA 2BKLA 2ZR7A 1WUIS 3KOXA 3LX8A 3R5XA 4RGYA 5DM0A 1VTKA 3GA0A 3H8SA 3WOHA 1E69A 3ASYA 4HS9A 1FDVA 2GTHA 3ECAA 4ZYVA 1B0PA 1V47A 2Q45A 3BTSA 3GGOA 1MEJA 1NM5C 1E1QD 2G88A 1BMTA 1Q21A 3M89A 3N76A 1H9BA 2UUPA 4ZGWA 1P4JA 3OVMA 2JF0A 1PNOA 4OSPA 5JAQA 1V45E 2C4UA 3RGGA 3EXIB 1QG0A 1KMHA 3WHKA 2QXYA 4X1IB 4FW8A 4MYDA 4QGGA 4J29A 3MFQA 3MXTA 2WYOA 3G5TA 3PSAA 4LJ5A 3JD2A 4DC0A 2BSQA 3CCCA 4EHKA 2WKSA 3RIEA 1YWGO 5DP2A 3EGEA 2RAFA 2HIMA 3KCNA 3ESRA 1GPLA 3CR7A 2YZ7A 3H1PA 4D74A 1E6UA 2JIMA 1U3FA 3ED1A 1T9HA 3IT0A 3QVSA 3WTCA 1AN0A 3QNMA 4OXKA 1SXJD 4WNAB 1QXSA 4ZWNA 4AJIA 1N2CB 2X42A 2QI9F 4J91A 4AS2A 2ZDGA 2J3EA 5TQJA 1CVRA 1NBMA 4FHZA 1QIKA 4ACAA 1KFJB 1FDOA 1NNLA 1CDOA 2W2KB 1RW4A 4O3FA 4R1NA 4YJGB 1QFJA 4X8HA 5TB5A 3EZ2A 3N1UA 1D1TA 1KI7A 4CMEC 1XMIA 1AE1A 2QVCA 1LNSA 3JSXA 4RXMA 3B60A 5ISMA 3FPCA 3IAAA 3KALA 4LGYA 3U19A 3G9TA 3QVKA 4M1EA 2JKVA 5J2UA 2BI7A 3WS7A 1DIHA 1ZU4A 1G66A 2WNSA 1Z5VA 4PYQA 4TT3A 2EJBA 1X8XA 3MGAA 1LX6A 4AN0A 2WF6A 2Q4EA 1T6XA 3I62A 1OBFO 4YP7A 1CUZA 3CF4A 2C4VA 1EVIA 3CRZA 2YWXA 3UC5A 3UUFA 1TYDE 4NBWA 4XZ3A 1W6UA 4MJXA 2KHZA 3LYUA 1ULZA 5HQJA 4Z53A 3FPAA 3S2YA 4R84A 2J0UA 4A16A 5KHLB 3IVXA 3MPOA 2B1JA 5JXWA 3P0JA 3SXJA 4Z9FA 5CUQA 4R0MA 3R0XA 3VNSA 2H92A 4EMUA 5F7JA 1ZGAA 3BQMB 3VAAA 1FRQA 1GLGA 1Z2AA 5F9FA 1Z13A 3A4MA 5HJ2A 4M22A 4BEBA 4F9EA 1K88A 4KI0A 1AHIA 1GWNA 2XKJE 3TSZA 1E2EA 2V6BA 3B5JA 4FP9A 2WAMA 1ISJA 4W82A 4ENQA 1G21B 4PO9A 4RHFA 2RD2A 4KYIB 2FQ1A 3WIEA 4KSCA 1KDTA 4OFWA 2CY0A 4FKZA 3THYA 3BIOA 1XALA 1QG6A 3M6XA 4CN9A 4OXIA 3CTPA 3Q9LA 1JQDA 4GS5A 1FDIA 3IOMA 3DTVB 4CEJA 3O1HB 1HYHA 3DE4X 4WJZA 5BNIA 4OI0A 1U8XX 4ARAA 5T4HA 5DV9A 2Y0DA 2WYVA 4RJKA 5CB8A 1O4WA 3T1VA 3E4DA 3T7DA 1UBSB 4CLRA 1H6DA 3H8WA 2DFVA 1A97A 4FX5A 2I2FA 4KXMA 1VKOA 4CDNA 2IHZA 3AK4A 4TL7A 1I13A 1P17A 3JATB 1HDOA 2RH9B 1XRRA 4TTRA 4O63O 5LA6B 1XA3A 5DSTA 4KITB 1D2EA 3D0OA 1Q17A 4TXLA 1CP2A 4BYGA 4D0SA 2ACEA 4CBVA 2FUEA 2R6AA 3C6BA 5BPHA 3LUAA 5ECGC 2R5FA 3OHMA 3PQ7A 3EXFB 3BX1A 4HEQA 5K6AC 1DAFA 2P27A 4WLEA 1X1EA 2JZNA 3NOOA 2CUKA 2JEYA 1XDDA 3MJSA 3H3XA 2C8VA 1MB9A 3ZN2A 4F71A 1EK5A 2GI4A 1OFVA 3N0VA 5L4NA 2WWYA 5I7FA 2MSEB 3T94A 2VHEA 4RPGA 3C0KA 4MGEA 1G5HA 1NR1A 1UBFA 2WJIA 3BE4A 1B73A 1VHTA 2H1LA 3NBQA 3RVOA 4I1PA 3ZIDA 4YAFA 1YIDA 4XQEA 3FCAA 3S1AA 1EWVA 3RYIA 4D42A 3FLBA 3EASA 4M0KA 3ASZA 3VSBA 2Z5FA 2FK8A 2WHQA 5ETJA 4MROA 4AKSA 1R0YA 1DTWB 2XI4A 3GPLA 2QD4A 3K6RA 4BN4A 4E14A 1QZUA 3U7HB 2A0YA 2A92A 5F51A 4L72A 2XITA 3LT2A 2OFOA 5I48A 3ETDA 2ZRFA 4MRRA 3PBKA 1VBNA 3TOSA 1FP4B 5HM8A 2XD9A 2C29D 1I8TA 2HTEA 2V8BA 4KAJA 3DF9A 2FR8C 1F12A 4AYTA 2B3TA 1VE5A 2JB9A 3DJFA 4D6XA 5B4TA 1JEQA 4CNQA 2BH9A 2IT1A 1Y82A 4RA6A 1CD5A 5B7PA 3HLYA 3JSAA 4RORA 3A4NA 5AVZA 1H6CA 4RFSA 3T52A 1P0PA 1YONA 3AILA 2XNSA 1R6DA 1TPZA 5AKXA 2HOQA 1INLA 1JKJA 3PL5A 4TWIA 1NF8A 1T29A 3KYDA 3QPDA 4J16A 1JEDA 2QLJA 4QTTB 2ZUSA 3PD0A 4Q7QA 4XJSA 4F1JA 1JLHA 1HR0B 1XKTA 3WKEA 1T6BY 1X14A 1FFBA 3HUDA 3LNTA 3R6TA 3TINA 5F64A 2ZAIA 3IQHX 3G79A 5JATA 3NVAA 3H2BA 1E0AA 3T4EA 1SXJC 1X3LA 1OLUA 2JH3A 4ALLA 1SQ0A 4RK7A 3DHVA 4DLYA 4N3GA 4Q9DA 4MVJA 5IS2A 4QWWA 2ID9A 1NVFA 3LDAA 4HD8A 1SIOA 1ZCZA 2EEPA 3FI0A 3ZDDA 1OLOA 3ILSA 4RV9A 2BFDB 2DSTA 3WMRA 4Z3KA 4PVDA 1P39A 1P1BA 5KZMB 1U0BB 1XIVA 2VQFB 1ZIXA 4X64B 1K9SA 2ECFA 1OI4A 5LQJA 1Q6YA 2EC5A 3SMVA 4B47A 3IAHA 2W6CX 4QGAA 3T0IA 4P53A 5ES4B 1E63A 2DLCX 3K8OE 1ISFA 4RIIA 1YQGA 2BI8A 4MUAA 3ELBA 4P80A 4CLHA 2PL9A 2BM1A 1R10A 2WNIA 2GPAA 1IRXA 3OE7A 2WD8A 4BEWA 3HSKA 1FJXA 2GFIA 1TGYA 2JLUA 1G2OA 3IODA 3IMCA 4MQ5A 4AJ4A 3UK6A 2PRIA 2PMEA 2C7RA 1ZVJA 3P9PA 3L8HA 1IY2A 4ZO6A 3L1VA 4HNUA 2LUOA 4UM9B 5HRUA 4KNYA 4EFMA 3C8MA 5ECDA 1HMYA 1Y5MA 1UFKA 2JFYA 2WJVA 3O8LA 5JDIA 3NBZC 2ONCA 2QZZA 3KV1A 1EESA 1VPVA 3R3HA 5KNCA 4GI3A 1UKVY 3WGKA 4NYMQ 2G9QA 3ZDQA 4R5HA 3KYBA 2AOWA 4JJFA 4BMVA 2PYDA 3BF7A 3SM3A 4ZVPA 1XQWA 4EGQA 2DSNA 1UJCA 4H3KB 3BFPA 5DEOA 4FFBB 1B43A 5HXAA 2VPPA 4TKVB 2WJ3A 5C9ZA 2YMPA 2AYXA 4M8KA 1GFSA 1V39A 3HZOA 3Q6IA 4GP7A 4OU5A 4F56A 3FSGA 1F9EA 4YJFA 1XTVA 2GBGA 1ZLYA 3FBGA 3IMGA 5CDGA 5KDOA 3I5YA 3QZUA 4MNTA 4GYYA 3LSYA 1NONA 1K86A 4Q4DA 2J3JA 2DAPA 2IYPA 3PT5A 1WSBA 4YJ3A 1SOWA 1KSJA 1YRQA 3N59A 2EF0A 1CY8A 1XZQA 5ERGB 3KZMA 4DIOA 5JWRA 4Y6SA 1EG7A 1DRUA 2ZSKA 1ZHOA 9LDTA 2RKBA 4TVOA 3WL8A 1AB6A 2NTEA 1FRNA 4H1WA 1B74A 1E4OA 1NVVQ 3ZE1B 4I8IA 4UUMA 4NPCA 1E2HA 2YQ5A 1P7CA 3L1HA 5ALPA 4X41A 2J5BA 1RIFA 1AT1A 3HV0A 3OPYB 3A26A 4IUDS 3VJKA 3WXMA 4E08A 4RMJA 3TLJA 1JIUA 3IULA 4QNRA 3E9DA 3IO5A 3O9MA 5AXDA 1FS5A 1E6WA 3H1FA 3KJQA 1V9CA 3FW1A 2IH2A 1D8TA 2IQIA 3MILA 5L7YA 3QLUA 5FWYA 2JAQA 1E9FA 2ODWA 4NZOA 5T6MA 4RK0A 1UXIA 3EDMA 1WUTA 4CYMA 5JNUA 2IU3A 3MOGA 3S55A 2HBZA 3S2FA 5KSZA 4Q3AA 4BP1A 1ZD3A 2ORWA 2OQIA 2KS6A 5AI6A 3G6KA 4CT0A 1W36D 3AF6A 2BT4A 1B0UA 4YMGA 2LKCA 4AMVA 4ALJA 4EFDA 3FMOB 1P60A 3M1YA 4PQYA 5B1DA 4B3FX 3Q9SA 4F7WA 5FIUA 3DMHA 1E1LA 4GR9A 3ZJTA 1DTSA 4DC9A 2YH2A 4PICA 2BEWA 2ANCA 2NZ2A 4ETNA 3THYB 3U4IA 4YJKA 1N1DA 2VOJA 3KJGA 4RL6A 1AJEA 2FVXA 2ZBUA 2OV3A 3GUYA 4CJXA 4BFYA 1TT5B 9LDBA 2PD4A 1Z4NA 3GU3A 1YBHA 5HCNA 4S0XA 4J8PA 3TTXA 4OREX 2IOYA 4I8DA 3LWNA 3CEHA 3T4XA 1RHMA 1UCFA 2Y2VA 3D8HA 3DVRX 3I34X 3WAKA 3C4JA 1WNTA 2GN2A 1NSYA 2OORA 4UUOA 4BX9A 2EP8A 3DEIA 1RWNA 3M34A 1JG2A 1HKUA 3CX4A 1U7XA 4LK2A 3MA0A 1JXMA 3M2TA 1GKIA 2Q29A 4GICA 2JCXA 5EZ5A 5KDLA 3Q4GA 1XZBA 4AG6A 1GUAA 4E2ZA 2NO6A 4TS3A 2C99A 4PFJA 2VS1A 1Y9DA 2G36A 1IEVA 4FN5A 2H4WA 1I4OA 1XZ8A 2I8CA 1NXTA 2NZYA 1YH3A 4UE3S 1DO2A 3VV2A 1OYWA 1IZ0A 3CF2A 3MYRA 4IHJA 1BW9A 3IAFA 4M1YA 3DKKA 3GLIE 5FPSA 2XBLA 4JX8A 4EGJA 4ZU3A 5EMJA 4LOHA 3PCXA 4TTIA 1VG1A 2EJVA 5KVQA 4KR9A 1Q14A 1K8YB 1Z0UA 2AA3A 1ML4A 2VNJA 4HRAA 4IZHA 4MHOA 3E9QA 2AFHE 2A3NA 4K9QA 3GMSA 5L6MB 1CZUA 3EVGA 3QY0A 3M6UA 4Q7KA 3CX6A 4E11A 1A7JA 3NWEA 3EK2A 4L75A 5TEVA 1CSEE 2CXRA 1Z16A 1G3MA 4QPZA 1MDFA 4MV9A 5BT8A 4RXTA 4D0GA 3CN9A 4EF6A 1Z26A 5LR6A 1N1MA 2B21A 3AR7A 3R77A 1X1RA 1J8DA 3LNCA 5NULA 1FMTA 3WV4A 1YCGA 2IYNA 3KXKA 3ZS8A 1ODCA 2XQJA 3LT4A 2Z3VA 4CKWB 3R0ZA 5JMTA 3EA5A 3A37A 1CS0B 4XVQA 1NW5A 4GZMA 4DQVA 4ZXPA 1U2GC 1SKYE 1UJBA 3HQ4O 2QRUA 4F86A 2AWNA 4WUTA 3L93A 4KQEA 5AT1A 3I9JA 1IUOA 4QUAA 3G0IA 1QYRA 3E5MA 5CVDA 4UFOA 4KQHA 4M0FA 2G1KA 1KVRA 4LYJA 3BMNB 1MORA 4FNAA 2GFHA 1CWUA 1GRNA 1OTYA 3CURA 2YWRA 3KYCA 1WXXA 4ENRA 2NV0A 3U60B 2ZUEA 2WU0A 2FEPA 4Z2AA 2NM0A 5HIIA 5CAEA 3EF1A 3EXEA 3JQ7A 5AESA 2ZLBA 3EH2A 1A9YA 3NWOA 3V1KA 5IAJA 4IIDA 3T9FA 4L5BA 1TOAA 2W42A 2ZSAA 1N2GA 2BDUA 2EF1A 2FR0A 2OZEA 3O3MB 1DXYA 2Q50A 4YPOA 4ZICA 2ZI3A 2Y99A 2ZW9A 4LZOA 4ZU6X 3R7DA 5DBEX 1LTHR 2ZETA 3L7IA 4BXOA 5JJIA 1KEPA 2CL7X 5C37A 3HO1A 2EVWX 3CKYA 1LPOA 1XKXA 2F48A 2H85A 4DWOA 4EJMA 4RJTA 1Z37A 5JXHA 4JQCA 1ODTC 3BFKA 2QSUA 1MAUA 3GEEA 4TPKA 1T4GA 5A7GA 4DCPA 1DAPA 4Y2PA 3OH8A 3L5KA 4FYXA 4QOEA 1KGSA 4N1AA 4QHYA 4II2A 1VI6A 4KR6A 1AGNA 3H18A 4YRQA 2WW8A 2X5JO 4WOCA 3HUEA 5COQA 5K4AA 1XWFA 4MR9B 4OAQA 4Y0VA 5DM4A 3JQEA 3WRYC 3ZWCA 2E21A 1N5KA 3NWJA 4P4SA 5H4HA 5CB4F 1JP7A 4CKEA 4JXXA 4XPIA 3GB9A 3GELA 2HMYB 4GVXA 1E4EA 1FFCA 1HEIA 5K99A 4MR7B 3MF4A 1TCUA 5A3VA 3CT4A 5FWXB 2X1VA 3AB7A 4HOYA 3WWCA 3IJRA 3AL2A 1A9OA 1EK0A 5DBGA 4MVJF 1W36C 2J5XA 1G20B 2YV4A 1QC5B 1S8FA 2WIBA 2EZTA 1ZY2A 3E5HA 1U6JA 1J20A 4RD4A 4TMXA 5DNVA 1ETHA 3ZWWA 5IKEA 5K3EA 3UV6A 3ONWA 1R0SA 3BT7A 2IHTA 3SHTA 2GPBA 4G41A 4JX9A 5D3MB 1US8A 4LNAA 1SXIA 1PGNA 4KBGA 1K8QA 2FAXA 4AS3A 1WX1A 1CRQA 2TS1A 1YZHA 2YWEA 4FFRA 1V11B 1SY7A 3STXA 3EGWA 4A0GA 3T0GA 1SU6A 1I7DA 1GA4A 2HU7A 2EKDA 1ESZA 1PVVA 4NFHA 1XZGA 3SR3A 4MI1A 3H5WA 5ALEA 5JNSA 2XSZD 2Z56A 4LZZA 1WBJB 2XUIA 1BE0A 3M3PA 3MQFA 4MX8A 1ZBQA 1W2GA 2NW6A 2MINB 1EBUA 3SZGA 3ANNA 1QB7A 1I3MA 3H4VA 3VSAA 4NSNA 3BGSA 2GEBA 5J5VA 1A5ZA 5CXXA 4A8TA 3Q2IA 3WYCA 4JYZA 4XVHA 5KVAA 1PFUA 2NUTB 3EMKA 4KE6A 1FDSA 5CX4A 2MR6A 1E94E 4GG1A 4ZQCB 2XHZA 1A95A 4PG8A 4WZAB 1SXHA 2O4UX 3ZTTA 1HLPA 3MM4A 1W44A 2IJGX 2BFOA 3QOFA 1ZMOA 3URMA 1P9LA 2RB4A 3UJDA 2NVOA 7AT1A 2VJNA 1TRKA 3DAYA 3E23A 3TLAA 3NDBB 2W2LA 4B0PA 4L5CA 1DAOA 4M21A 5HF8A 1Z4LA 2IXFA 2ZJFA 4LEIA 4LISA 4TYWA 1AZTA 2EJWA 2NNLD 1EB9A 3QELB 4G5YA 4KPGA 3B36A 1IC6A 1CDDA 3C3KA 4G84A 3SLKA 5K3BA 3IT3A 5EKSA 1ZD1A 3JQQA 3AF5A 4CIXA 2OAQ1 4B4DA 1A9TA 1ISMA 3IL2A 3TOVA 10MHA 1JFFB 2DU8A 4RLFA 1H66A 5EWMA 5JS7A 1NATA 3DZ8A 3Q3VA 2ZTVA 4GZ6A 3KVOA 4HQOA 4OYHA 2NGRA 4PIPA 4OD0A 1TM3E 2O48X 2WA1A 3IAXA 2C7QA 4US1R 1XDBA 4FFMA 1HPLA 1YS6A 1TW2A 3NGXA 1A8UA 4XYLA 3RQIA 1CPYA 1GCOA 4C7OB 1KEUA 4UU7A 1OLSA 3M49A 4IO1A 4YYZA 2X23A 3PGKA 5F1OA 3IB6A 5HZMA 1VPDA 3U62A 1K5HA 3PQ3A 3GRPA 3IOEA 3B9RA 1BDHA 2BKEA 2VUIB 4Y1GA 1J1UA 3OF2A 2R7AA 3RS0A 4ALNA 5I3CA 2B78A 4FD2A 4IDAA 5DYGA 4BFXA 5CFNA 3MN1A 3PEVA 3GJYA 4JVOA 4P86A 3TMAA 1K7YA 2H08A 2QR3A 1X19A 1NXXA 3ZD8A 1PGQA 1YBFA 2GNAA 2PH1A 3I09A 5AHXA 4DCMA 7REQB 3FF4A 3JYOA 3REQB 3VR6H 1IXYA 4Q1FA 4V02A 2CV0A 5IM5A 1NMXA 1B3RA 2YXDA 4JUCA 3OU2A 2RBGA 5JDCA 5K3CA 3T5MA 1UJ2A 4IGEA 4ER7A 4CQLB 1MPTA 4HK4A 4YP1A 4RIHA 3V4FA 4IDEA 4IDGA 4LV5B 3OCXA 2AKYA 3FNRA 1ZHHA 2HHCA 5A7FA 3KOYA 3UNXA 2ROQA 4L4RA 5AR1A 2OHFA 1JHQA 4X54A 5B7NA 3GJ8A 3A27A 1P2FA 1MEEA 1K8RA 4EPRA 2FUKA 2UYOA 1JLLB 2J9FB 4HSEA 2NVUB 3ZWPA 1GVHA 4CMIB 5A0VA 1Z6PA 4WBSA 5BW4A 4AMBA 2NADA 4MDHA 1EVEA 2XYQA 3TJMA 3EEOA 1VGVA 1CBUA 3C6XA 1RXEA 4DMHA 3HXQA 1SGWA 2I03A 1YS4A 2IHJA 4HN4B 1WZEA 2QXUA 4GYWA 1I7QB 3QA9A 1VFPA 2JGFA 4XFDA 1R7RA 4RH3A 4Y1FA 3LP8A 2QUBA 3VSEA 1XTJA 4JLPA 1W59A 3K9LA 1L7DA 1PK9A 2D74A 2RGUA 3CX3A 4MQEA 1OGIA 1M34A 2PGAA 1ESDA 3BKWA 4IHJF 4L9AA 4GDMA 4XB1A 1HL3A 3QXJA 4IO0A 5G0VA 3AEQB 4BNIA 3N58A 5D84A 5B3LA 5JVDA 5LZ4A 4G4GA 4JP8A 2B7LA 4KP7A 3JQ6A 5GINE 1QGED 1E5VA 4U3JA 1K6XA 5GM1A 1FLDA 3VMFA 4QGBA 1JDTA 2Q3CA 4FMCB 2OLKA 1XZEA 4FR0A 1OMOA 2CVZA 3ZE0B 1Z8DA 4HNQA 2A0WA 4Z4GA 1UFRA 4F3RA 1JN0A 3RIGA 5IF9A 1YXMA 4M9ZA 1LTKA 1PR4A 4LOLA 1C14A 1MO6A 1N92A 2ZWMA 3S8MA 3TOXA 2AFIA 4PAQA 4UCFA 3LUPA 1Y5LA 5LU8A 1Q0QA 3N8DA 5C8YF 1EM8A 1EUCB 2OCKA 1QNLA 1PNVA 2GILA 4EG0A 1EE1A 3UWOA 2ANBA 2PGXA 2RI0A 3CPSA 3DFZA 3FD8A 3HCEA 3S2SA 3G9ZA 5H81A 2QU8A 3A9VA 3BE6A 1GCGA 1YQWA 2GJKA 5C8VA 2CBXA 3QNUA 3B20A 5KQPA 4LWPA 2HYIC 3FYHA 2REBA 1CR1A 2YWGA 2ZE6A 3WL7A 1SUAA 2B0CA 3M82A 3MOIA 1MQ8B 2GZAA 1HLFA 2OQ2A 3BWMA 5ECWA 4JJKA 3WLJA 2VH5R 4D81A 4DV3B 1PFVA 1ODLA 2O07A 4OQDA 3ZU3A 3ZDFA 2AFVA 3F3YA 1YGPA 1QHHB 2QRMA 2QM7A 1PO7A 1L8AA 4NBRA 1M0SA 2X40A 4ENTA 4C6SA 1E32A 1UXKA 3FDIA 5H9WA 1TYBE 3T5DA 3W6OA 2ZI5A 3VNRA 1WZIA 4HTAA 4LSWA 5AICA 2HPVA 3P96A 4A0RA 1E6MA 4B46A 3U49A 4R31A 4TSRA 3TL6A 1M10A 5MDHA 2O8DB 5DBHX 4LRSB 1U28C 5TT1A 4QBFA 2V4ZA 1U9ZA 4V0RA 2OBXA 2A30A 3AQ4A 4YCNA 3BVPA 2OHVA 4EW3A 5JI2E 1CYDA 2WIAA 5EIAA 1OB5A 4J0KA 1N0IA 4OMCA 1TCBA 2K2QB 2W4IA 1V8FA 5IJ9A 2NSYA 3PJDA 4TMZA 4M37A 4ZPXA 1QQAA 3UT0A 2O5EA 4WLUA 5A1TA 5E6UA 2P0EA 2V6FA 4DVJA 3VJRA 4UXIA 3RHFA 4HDOB 4D4LA 1LSSA 4UTZA 3KOMA 1H6BA 1BN7A 4MUKA 1BWQA 4XWYA 5FF9A 1QZ3A 3A28A 3JQBC 5KKNB 1P2UA 2H1VA 5AVWA 1YA6A 1FTNA 3DNMA 1WOYA 1GILA 5IJ0A 4CZ2A 1TE2A 1F4LA 1QQTA 4IXNA 3RVPA 3X1JA 4B7CA 3FOFC 2O54A 1TJ4A 2DT8A 4DNOA 1ZSNA 5IVDA 1Q1AA 2X0NA 1N6LA 4J76A 4A2PA 2P6OA 2BBOA 2R62A 1V8ZA 4KZKA 2C00A 4MRVA 5C8ZA 4F3KA 4N5HX 2CVPA 3EXHC 4OIFA 2J31A 5JJBA 4NCAA 4IM7A 1BS1A 4ALMA 3EIUA 3HYRA 1JHAA 1YA8A 1IPFA 4TV8F 2RHBA 4DR4B 1D8AA 3LC7O 2CDBA 4R0NA 4MKIA 3LHIA 4R2LA 4HGOA 4FZVA 5IWCA 1PJAA 6YASA 1GZSA 1V8OA 2OKGA 4WKNA 5IZCC 2E4UA 5CPFA 1XEAA 2QP9X 3MJ4A 1BMDA 3L4BC 1WKVA 4MGHA 3EVBA 4EEXA 1JDJA 2AXNA 2G77B 4JP5A 5DHFA 1DQZA 3G6WA 4AO8A 1O6GA 1FNBA 5BN4B 4KVAA 4KQ6A 1UDRA 2BFFB 4CM7A 1C5KA 4JBHA 5CLQA 3B6JA 1NMEA 2EL9A 4DREA 3BKXA 4IVRA 5KOHB 4Z4EA 2WTXA 1E9DA 3ZVMA 4IFEA 5EPOA 5TDHA 3AM1A 5AWFC 4RSRA 1PR1A 1RQ2A 5SZJA 1C9NA 1N0WA 1R0KA 2IPAB 2PGOA 1JG1A 1ZOPA 1N5IA 3HBMA 3M6MD 1V5GA 3TBFA 3L46A 5MHTA 4HWRA 1XD2A 2V7QA 2F4NA 1TUBB 4PC7A 2JLYA 2JIQA 5KTYA 3P26A 4XD7D 4BNZA 2ZRQA 2GD6A 1H8EA 4WE3A 1F7UA 2E89A 2XF8A 3BZUA 3C8ZA 1ZUNB 4QDJA 4WY5A 4ZP1A 3UAGA 4C4RA 2ZWAA 3QITA 2I6UA 2DGDA 1FTQA 3LPLA 5EP2A 1KWGA 1NC1A 3IESA 4UAVA 5BSGA 1WXHA 4FWIB 3NV7A 3RBAA 1H8HA 4KH0A 2EU8A 2PUBA 2AJDA 1E9EA 2BEUB 3PHLA 2ZWPA 2C4NA 1RPNA 5CLGA 1EVYA 3P20A 2XCOA 1EWKA 1OYYA 2G8LA 3P0HA 3AFGA 4G0OA 3VH3A 1VG0B 3I2IA 1S3GA 4B87A 1BMFD 2Q21A 1W94A 5ENDA 5KSPA 3PEEA 1BRMA 1NBIA 4GYKA 3LQYA 4B5LA 4KMRA 5JZVA 4WWHA 3TDMA 4B44A 1RLUA 4KFRA 4O2LA 4GKBA 3IP3A 3AOEC 1OPRA 4ZT5A 3H65A 2ZVJA 5JYDA 5A3QA 3ZBQA 2I4IA 3HP4A 4G5RA 1NUPA 3IALA 2Y1EA 2X77A 1QANA 2BJVA 4IHAA 3RLFA 2X8JB 1E4YA 1RHRA 5AJXA 5DT9A 4WZBA 1IYZA 4J3JA 3DQQA 5BWCA 4GPEA 2XGSA 3HJHA 5BQPA 5DI9A 1NXOA 3UT5B 1LBTA 2R4UA 2QGFA 4IH9A 1W48A 2UU9B 4NYJQ 3WLSA 5TQ0A 1XAHA 1PJSA 3IQFA 3DMPA 3JD4A 4Q3KA 3G8AA 3LDHA 5CTJA 1C0EA 1R8JA 1U2SA 2QTAA 4GOXA 4FUQA 4GM0A 4MWBA 3REFA 1I2BA 3RKRA 3PTAA 1KRWA 5EIBD 5DX0A 1GAQA 2C42A 1JHUA 3C74A 3BDVA 1VYTA 1SRQA 4DV2B 1QM5A 1UBTS 3COYA 3WV5A 2FW8A 4A82A 4A2QA 4BMNA 4BV8A 1W76A 3PQ4A 4IJVA 3HXOA 1RIIA 4E30A 4HAOA 2FZLA 3B48A 4GLLA 4GGMX 5HUQA 1SNYA 2BFCB 3C97A 1PFQA 4D3XA 3ZJUA 1BWRA 2EG5A 4Y3UA 3UPUA 4WCFC 5BVHA 3VHRA 1RCTE 3OWHA 3PPWA 1UBNA 4MGKR 2FSGA 2YHIB 5EYPB 4Z4CA 1KKLA 1Y3AA 3DXZA 1U1DA 1YS2X 1LNQA 3HDHA 4H59A 4N7MA 4X63A 5D6OA 3TCXB 4L4SA 3ZXSA 1A2QA 4CF6A 1Y33E 4DMMA 3DZIA 2CXQA 6REQB 3PNKA 4OBBA 1E1CB 2FPPB 5TSDA 1XUOA 4I55B 1JB9A 1ODJA 4PU0A 3ZVNA 3PICA 1GPKA 4GW3A 2X2OA 3PIIA 4M1QA 2YINC 2ZI6A 2ZVQX 2Z1MA 4CIYA 1BU8A 2BEVB 4ZT4A 1L8XA 4LHWA 1WB9A 4QGFA 3GUCA 2O05A 1LRKA 4LYEA 1EUDB 1X7ZB 3DR3A 4BV9A 1NUQA 1E8NA 4D43A 3SLGA 3S28A 2BM0A 3RS3A 2O6HA 5C53B 1NW7A 4MCJA 2IBTA 4Q1DA 2DUMA 3UFXA 1H0SA 1QB8A 2HN9A 4IIJB 4WXYB 4DSAA 3D0RA 4HGQA 1LDBA 1W9HA 4NOMA 4IINA 2XE6A 1DX4A 3JQAD 3C7DB 3D7LA 1SAYA 3F47A 1P2BA 1IVSA 2ZBFA 4E2XA 1Y5IA 2RBEA 1N2IA 1G7RA 1L7NA 2EYUA 1VP3A 2WJHA 2LR0A 4NH0A 2V6MA 3ZQKA 2ZYVX 2I99A 3PC8C 4DV5B 2F3SA 4KL8S 1KK0A 4BVJA 1VBFA 3ZVRA 5AXAA 4PYMA 4BC1A 1DIGA 2H0AA 2P9GA 1PG2A 1E20A 3MEQA 1MHTA 2Q5QA 1R15A 4JDUA 3LZ6A 5JTUA 1C80A 5JS1A 1RADA 1R8YA 4P3OA 3KQPA 1RMYA 3CX7A 1JZQA 3L8YA 1PD1A 4JB8A 5JVDF 5FBHA 3QPCA 2ISCA 2FX2A 2JFNA 5JCJD 5DYTA 1WHSB 1QKIA 3QG1A 4AUKA 4DQUA 4UVGA 2SKDA 5ULLA 3WLNA 3V1UA 1NW8A 2GJAA 1T5DX 3HZHA 4CIVA 1PVOA 3TRHA 2C0PA 2ZIUB 1P2GA 1QK4A 1TFRA 1HE4A 1YOVA 1ZGGA 4PR0A 1EJ0A 2Z2ZA 1OAOC 2D1FA 1TJ5A 2GPJA 4KO4S 5G3YA 2AXQA 5T67A 1L9KA 2FWNA 1UDXA 4XB2A 4NXNB 1PRYA 1VYHA 2B1RA 1MB3A 3IO3A 2RK6A 3LVFO 3TZCA 1N9GA 4DKJA 5LD2C 1U1FA 1DP4A 1OBVA 1IG3A 1TQDA 4N54A 3DZCA 3UB3A 2QRLA 4AWXA 4ZHQB 4YA6A 3PYLA 5H5JA 5JS6A 1M1NA 3UENA 8ADHA 2RHRA 4N0PA 1STOA 2WM2A 1QQ5A 4AJKA 1C7QA 5FUQA 1SCQA 2XZLA 2Q1UA 3GZNA 4GOMD 1IOLA 5DNAA 1WIWA 1F5NA 3V34A 2PSSA 4DHEA 1PZMA 4Q39A 4RD1A 1TJNA 3P97A 1T5SA 5C18A 5JAZA 5IULC 1P6XA 2J9RA 13PKA 1LLFA 2OUKA 3B6EA 3NG1A 3VC7A 1I36A 4I1IA 2DTDA 2Z5GA 4G4JA 4LMPA 4NTZA 521PA 5JTTA 1E92A 4JC4A 4KO1S 4G56A 2GM5A 3OZ7A 5JY6A 4QHTA 1FIUA 2NU7A 4C5CA 4K0RA 4IH1A 1DO8A 3HKDA 4JLKA 4V0ME 1JDUA 4XX1A 1Z22A 2X15A 4K87A 3MD9A 1X6VA 1U0GA 4HNSA 3GNTA 4S1TA 3WZMA 4B80A 1T8WA 2GM9A 4QXPA 2HV8A 1YBVA 5CA0F 4O2BA 2QRVB 1PJ2A 2ZFUA 3SKVA 3FHOA 1EIZA 2FMHA 2I4LA 2XA2A 2VPXA 2ZBGA 1E64A 2EIHA 3RAGA 3RTGA 3LHSA 3WGHA 3WWZA 2IDMA 2JGAA 3DZHA 1JHZA 1T9ZA 1V95A 5ALLA 1S8OA 4DLTA 5KTOA 1Q2XA 4OX9B 5EIBC 1ZD2P 3T9CA 3G23A 5BOSB 3BJEA 3Q8LA 1KY5A 1XVAA 2HSZA 2XTJA 3HJBA 3WGUA 2ZCUA 4QTYA 1GR1A 4TV9A 5E3IA 1PJBA 2QTFA 2VP4A 3NPMA 3U80A 4DKXA 1U8TA 4CKCA 1RKUA 2C20A 3RVBA 3W3AH 1ZM9A 3NGMA 3OT1B 5JECA 2D0OB 3DAFA 2C3UA 5E38A 1GZUA 1RPTA 3EGOA 1AMOA 2VHWA 4RM3A 3V6MA 2XB2A 3IAM6 2GF9A 4GMKA 1SCIA 4LDQA 4WAUA 4XWWA 5HCUA 1N2EA 3KQYA 2DQYA 2PLFA 3PUJA 5ELMA 2SCUB 3D6FA 3DDSA 2Q41A 2WF7A 3FHLA 3RWBA 4M99A 1ZNXA 3MK31 5BN3A 1V1MA 5IKOA 4ZZ3A 3JD1A 3UAOA 4M83A 4CLXA 3F9RA 3TD6A 2HDHA 2YCBA 3A70A 5DK6A 3FPJA 3U3XA 3VPXA 1CQWA 3BSYA 3GDGA 4JUAA 5G0TA 4A8JB 4R3UC 1HO3A 1D6MA 1K2VN 2AEFA 2OWEA 3PRJA 3OJEA 4M3NA 1VJTA 3OC0A 5JANA 2BHNA 1HBJA 2NYRA 2BPOA 3HO6A 4H1HA 2YV5A 3DHEA 4RTLA 5AVJA 3TZBA 3Q2KA 1Z8HA 4JP3A 2BM9A 2GESA 2Q49A 1GLVA 3E15A 4LE1A 1LRJA 4Y6RA 2PUEA 4M88A 1AUVA 3KLNA 2IPLA 1D0VA 3L92A 5G4KA 3WGJA 5CJJA 4YV7A 4XQGA 1QU3A 2HMSA 1I3CA 1ULSA 5A4DA 1TM5E 1E2GA 2WOJA 3QVXA 1EFVB 1XN1A 1MV8A 2MSKA 2WI8A 4G1BA 1FXWA 5AVVA 2V1UA 4HNRA 1LDNA 3RAEC 1NP3A 1W49A 3RVRA 2ZRJA 4MKRA 3RI3A 3ZCUA 4DARA 4E3WA 2R6ZA 4ZCIA 4HX2A 3RKSA 2XTNA 1A96A 1ESEA 4F9FA 1F2TA 3HCBA 3KOOA 5ALYA 4W7SA 4IXTA 1IG0A 3GZTB 4N0EA 4OF4A 2D8MA 1X74A 3DAPA 3KEGA 1H23A 1DBRA 1ZOOA 3NHSA 3KXDA 4NP6A 4L5JA 1IHYA 1ZK4A 2I7VA 1RJ9A 3C3CA 3NAGA 2ZJ3A 4O0MA 2GF2A 5FOTA 2JGDB 3WYGA 2IS1A 4DJ5X 4HO1X 5FL7A 5KC8A 5F33A 3OZDA 3GLFB 5DCUA 4L57A 3RVDA 4GMFA 3T15A 1ZJJA 2XHEA 5SYMA 4WW0A 1I6LA 2B94A 4KQGA 4TL9A 4EY4A 2ZU6A 4RS3A 2XJ4A 1JBEA 1T26A 2IDZA 2W00A 3M70A 3R0VA 4GKVA 3SMQA 3VR5H 4Q4AA 1M1UA 3I01A 4DQLA 3MCWA 2GZ1A 4LAFA 3ZV6A 4HATA 4M7RA 1XNJA 3PK0A 4EJ6A 4KX5A 2VCEA 3FDZB 3AWIA 5KJ6A 2UUBB 3HEAA 2WY2D 2R1UA 3UJPA 2YIVX 1ZOSA 5AK6A 2RHHA 3FPHA 1ZA2A 4HLUC 1L7RA 2J59A 2PX0A 2XQFA 1SFRA 2EKLA 3KVVA 4TWBA 5KTSA 3OU6A 5JD3A 4V0QA 1JTFA 1GPH1 6GPBA 4RKRA 1N6NA 1Z5OA 5F3WB 2ZITA 3UW1A 1E77A 1Z88A 3L7JA 1UK7A 4UNNA 1U5BB 1FPMA 2W6OA 1PV2A 1Y3DE 4PYOA 2AR0A 3HFSA 5JSZB 3QEBZ 4AB1A 2AUMA 4JKOA 1U8YA 1D9XA 4GZLA 4RPJA 3X3HA 4DMFA 3FFTA 3H9JA 5L3SB 1NVMB 1XMVA 3JPWA 4BFCA 3HCRA 5KU1A 1A5BB 1MVLA 3JY6A 3ICPA 5GV7A 5LQNA 2WM9B 3UHFA 5FR1A 5KX5F 3MT7A 4YQZA 4JC0A 4FBMA 3LKBA 5G02A 3PEUA 2OHHA 2WLTA 3WVNA 3RYHB 1C0IA 4FOTA 3OCYA 5ADVA 4YCJA 3A9UA 1CF4A 2A33A 1TIPA 1PBTA 3GJQA 1CIPA 3C45A 1K6IA 3N8KA 1K5GA 4YLGA 1M8JA 2A7QA 4I0WB 3V1TC 4TL6A 2QMEA 2WG0A 3CW8X 3WMXA 4G0VA 5AI5A 1GY8A 4F21A 5H3CA 2VQDA 1H9CA 1G4HA 4JJZA 2ZE8A 2M98A 1CRPA 4UEQA 4WD3A 1GCAA 3N28A 5U4QA 4WBNF 2N3ZA 4QUEA 4AN1A 1VE6A 2YW9A 3T5TA 1PJQA 1T0BA 4LRTB 4REQB 1YE5A 4RVSA 5AW5A 2NP7A 1ZVKA 3I1JA 2QX4A 4NBVA 4BHTA 4XRGA 3WL5A 2AYZA 4WFKA 3AF0A 3LPMA 1JFLA 1YQXA 3I83A 4LXUA 3PXDA 4BLPA 4DW8A 1TZJA 2F55A 3LCMA 3NTLA 3E61A 2ZSFA 2QN7A 2Q3MA 3EUAA 4R2KA 4EUNA 1C4KA 1WULS 2JANA 4HWGA 2IU0A 3ZHTA 2OCYC 2XDQB 3WC4A 2VC2B 1WXDA 1H4QA 3V1LA 3WLLA 3ZXUB 2D5IA 2Q46A 2W70A 4RDXA 3LF1A 1Y1LA 1NW3A 3CZ5A 1EVLA 1GA6A 4YECA 3QWBA 2IPOA 5MN6A 3OMLA 3JWGA 1NJSA 4EG6A 2VSQA 3K0EA 1QHEA 2VDOB 3PFBA 4S24A 2DXIA 4IMRA 1OXVA 4ES6A 5TQ2B 1P0CA 3RC1A 4ZTZB 3O0DA 2A84A 2H1WA 2G1PA 1TM1E 2JGJA 4FQ7A 5H59A 2WTBA 5EHZA 2ESRA 5K3FA 3ZV4A 1HNNA 2P68A 4UXHA 4J1QA 2PSHA 3QHPA 4IJ5A 4H08A 4YCDA 2I2AA 5HIJA 2PJDA 2XAUA 3D3EA 4NL4H 1BXKA 3DDHA 2HPHA 2POCA 4EG5A 4EGSA 5EJ6A 2PQ2A 3RO7A 1JFVA 1WMBA 2EKPA 1ESCA 1T3TA 2GZSA 2JHAA 3FNGA 3VDMA 4BBPA 1JDZA 2WR8A 4D8XA 1JAYA 4Z6KA 5I9BA 4I5DA 1AG9A 3DC7A 3FOZA 2QMUA 4DEXA 2YJNA 2FSSA 3GNSA 2QM8A 3I6QA 4BE9A 4PXSA 3NALA 2AN9A 5CGZA 5DX1A 3F73A 5LMUB 3UYLA 4WL0A 3PIDA 4QRHA 3CJQA 3T4UA 2R1TA 1X1BA 2HA4A 3DW3X 3L05A 4FLMA 3S29A 4OP3A 2FW1A 2NWQA 2QW1A 2ISSD 1KP3A 4OKNA 4X8MA 4YUAA 2ILTA 2H4YA 3KKPA