2OCDA

Crystal structure of l-asparaginase i from vibrio cholerae o1 biovar eltor str. n16961
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
336
structure length
328
Chain Sequence
b'ARKHIYIAYTGGTIGMKKSDPVAGFMEKQLASMPEFHRPEMPLFTIHEYDPLMDSSDMTPADWQLIADDIAANYDKYDGFVILHGTDTMAYTASALSFMFENLGKPVIVTGSQIPLADLRSDGQANLLNALHVAANYPINEVTLFFNNRLMRGNRSRKSHADGFSAFSSPNLPPLLEAGINIELSTNVKVDEKPSGEFKVNPITPQPIGVITMYPGISHEVIRNTLLQPVNAMILLTFGVGNAPQNPELLAQLKAASERGVIVVNLTQCLAGKVNMGGCALADAGVISGYDMTPEAALAKLHYLLSQNLSYEEVKAKMQQVLRGEMTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-asparaginase I
publication title Crystal structure of L-asparaginase I from Vibrio cholerae O1 biovar eltor str. N16961
rcsb
source organism Vibrio cholerae
molecule tags Hydrolase
total genus 89
structure length 328
sequence length 336
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00710 Asparaginase Asparaginase, N-terminal
A PF17763 Asparaginase_C Glutaminase/Asparaginase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.40 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2ocdA02
3.40.50.1170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold L-asparaginase, N-terminal domain 2ocdA01
4R8LA 4RA6B 1WNFA 1HO3A 1JAZA 2HLNA 4ECAA 5I48A 5K4GA 5K3OA 5DNCA 2WLTA 4NJEA 3PGA1 5I4BA 2D6FA 2GVNA 1DJOA 1HFJA 5DNDA 2JK0A 1HG0A 1HFKA 5HW0A 2P2DA 1DJPA 1O7JA 1AGXA 1HG1A 5K4HA 5CBPA 4NJEB 4RA9A 2WT4A 1IHDA 3NXKA 1ZQ1A 1WSAA 4RA6A 5I3ZA 1NNSA 4Q0MA 1JSLA 3ECAA 4R8KA 2P2NA 4PGAA 1JJAA 5CBPB 2HIMA 4RA9B 5K45A 1WLSA 1ZCFA 5F52A 2OCDA 1JSRA 3NTXA 1HFWA 5DNEA
chains in the Genus database with same CATH superfamily
1JQBA 1JIJA 3H2JA 5FOTA 3IPRA 2Z04A 5LQUA 2M6RA 4PR3A 4PRLA 1QO0A 1KJIA 1OASA 2FLWA 4DEYA 5C32A 1WBBA 3AUKA 1VYVA 1OFIA 3D0OA 1CRPA 1QHIA 3TAUA 4PC6A 1YXMA 2ZYIA 2XE4A 1LPPA 2HPAA 2LRHA 4G0YA 4KVFA 4UFNA 2RKWA 3IILA 3ICQB 4FHDA 3E81A 4IKEA 2G06A 1PKXA 3G2PA 4YJHA 2UUPA 1EFKA 2ZIAA 2W6OA 3G2MA 3JQEA 3Q98A 4AECA 3E4DA 3KVNA 5LC1A 2AR7A 1KDVA 1ZGGA 3S2SA 2GARA 4XWGA 3G5AA 3NHRA 3D3WB 4MVJP 4XWWA 4KO8A 3REFA 2UXCB 2VAXA 3LC7O 3K4HA 4RWEA 1YDMA 2GN8A 3RRMA 3U61B 3PQEA 1V7ZA 2YBEA 3OPMA 3UJNA 1W5BA 1RRMA 3A3PA 4FI3C 1WUYA 4IZIA 4K9RA 3Q3EA 1Z7EA 5C4GB 4QKQA 3WTBA 4O2BF 5D5HA 3LK7A 4LXGA 2B99A 4IVNA 4W5OA 4JJAA 4FJ0A 1IZYA 3GNQA 3KZXA 3OJFA 5FA8A 2OAQ1 4TUYB 2OCIA 4HGOA 3O47A 2HRZA 5CR9A 1GFIA 3HCBA 1F38A 4ZN6A 3F9RA 3TZKA 1ZR2A 4M0PA 1J23A 3NAMA 2HW8A 1UM9A 1XFDA 5ALGA 1GGEA 1AXRA 3ZDEA 2DY1A 4XWYA 4DNFA 1AJEA 1F2TB 1Y37A 1GUFA 1SVIA 1W5SA 1ACJA 2QZZA 2P8JA 1E9EA 2QT9A 3VSEA 4B71A 1KEKA 5CXSA 3M83A 4F11A 1CDEA 3H5IA 2CXQA 3A26A 1W52X 4TYMA 1MC8A 1PG5A 2CCGA 3EEFA 5CXUA 2PX3A 2OL4A 3ONFA 4RZQA 3VR6D 1J90A 3EGDB 1E5DA 1FVOA 1JTVA 2BRUA 1I1QB 2E4VA 3BN3A 1O8BA 3RRFA 3L6CA 4DFDA 1DKUA 1G42A 1DJPA 2AVDA 5C34B 4KH1A 3S29A 2BN4A 1Y9JA 2G1PA 2XJ4A 4CQJA 4DA6A 1TTPB 1KH1A 3F96A 3NCHA 2WBLC 3PV0A 1KH2A 4WBNB 5CEFA 2VT6A 2GXUA 1HE1C 3IODA 2Z6UA 4YECA 1AKTA 1TIKA 5KYYA 3U4IA 1TI7A 5AW2A 3CZ4A 2ID9A 3BJRA 4R6XA 5EQJB 4EQ6A 5LZ4A 1Q2XA 2Q27A 3ZDXB 4TKVB 4RHXA 3JALB 4E7OA 4C14A 4ZKEA 4OHYA 5M7EA 3BFKA 2WLSA 3EGCA 121PA 2B94A 4B6RA 4JA0A 3QEMA 1FOEB 2VLBA 1DJOA 1JHXA 2OZEA 1VBFA 1HFKA 2Y2UA 4HG2A 1J1IA 1ZUHA 2VUHB 2WKSA 4P4UA 1EFPB 1PEKE 2D2FA 3NT2A 3RANA 2Q4OA 4FCTA 2NU7A 1UC5B 1D1SA 5HILA 5GJWC 1GIAA 1FRNA 3JQAB 3IPAA 5DI9A 3SQXA 2CL6X 2R6JA 4N01A 5CHYA 4MQUA 3SSMA 1TJYA 3X1WA 1X9GA 3TZLA 3EISA 4E2YA 3QJGA 1KS9A 1P39A 1CWUA 2K7ZA 3GRVA 3QWBA 3K31A 5IW8A 5JQGF 4Y0NA 5KX5F 1E3JA 3GUUA 1ZJ4A 2AJBA 4JBHA 1Y6JA 3U39A 4BV9A 4DIUA 2CUNA 1KC3A 1MPXA 3QKSB 3FTNA 1T8RA 1AUXA 3DBLB 3FJOA 1ZZGA 3ZD9A 5BN3B 5AVYA 1VZ2A 1F2UB 2J6BA 1O58A 4FZVA 4URHA 4XAQA 3QENA 4M7RA 2IXEA 2IZOA 4O4JA 4JI4B 5I9TA 4M0KA 5AVJA 4PGFA 4G4SO 3VPXA 3HKEA 4NMHA 1OB5A 1OBOA 3RKSA 2Q4TA 3OZVA 4PO3X 5K8VA 3GHHA 1GU1A 4W1QA 4XI9A 3M1IA 4DCNA 1MIHA 5C51B 3LQ1A 1CQWA 2V5AA 1TC1A 1TJ3A 2QVYX 4LN1A 3W8RA 2Q8PA 5MFPA 3B1FA 1L4EA 2F3TA 3I2GA 4OLHA 3SMVA 4HVLA 1N5JA 2I1WA 2ZYHA 2ZJ4A 4RF4A 2GLUA 2C83A 1VFPA 1ZUWA 2V54A 4P4GA 1V1RA 5EMHA 1YHNA 3TFQA 2B34A 4NC9A 4JC0A 3RNLA 4RNDB 3SJ7A 3D81A 2I1QA 3H4VA 1FNCA 2ONYA 2Y76A 1JKFA 2EYUA 3DW3X 4I1RA 5IBCA 4HSGA 4ZHQB 1Q0RA 1FK8A 1YULA 2EKBA 2QQFA 4E2ZA 3G9UA 1CPYA 3CNHA 4U5QA 4J1SA 3HU5A 3I34X 4RZ2A 3I8XA 4A8JC 1J70A 4MINA 3NQ41 1DELA 3LDUA 4QELA 1NNLA 1YIOA 2OSBA 3AJ8A 3O1JC 2VK8A 3S70A 3L07A 4G9GA 3AB8A 4Q39A 4MQEB 3EQ6A 3SHQA 3BGSA 5AK0A 5EWJA 4S0XA 5B1DA 1T43A 5C5DA 1JALA 4I14A 1YS6A 3QEJA 1SHJA 5FULA 1GAJA 1F9EA 1T9GR 4IDEA 1U94A 5CX1B 3HBLA 1NQXA 1X80A 3DTTA 3D1VA 4ZT4A 2FWAA 1T1JA 4G86A 4HS4A 4PXAA 4B3SB 4BIIA 3UK7A 1ISIA 1DJNA 3S5JA 2P9GA 3QPDA 4V1CI 4UC0A 4DPLA 1Y7IA 2X5OA 1Z5ZA 2NYAA 1MVNA 4LHSA 4V0SA 4IH1A 4UUOA 1IBCA 1AKRA 2Y2VA 5EMMA 2C57A 621PA 4CF6A 1CS0B 1LX7A 3AUTA 3O9MA 4LCEA 4TWJA 4JOBA 2C5BA 2UYGA 3PX2A 1II0A 3P20A 2CL7X 4NCKA 3FE2A 2YMMA 1P29A 4LY6A 4EH1A 1RSZA 2BHLA 5EPEA 5JJBA 1GPWB 2ZYWX 3OM1A 4RVSA 5BWBA 4KPUB 4EF4A 3ROZA 1X38A 1CY6A 3IQEA 3UWKA 2ZWOA 3VHRA 1P4RA 3H6KA 3P27A 3BFVA 1EP3B 1JPNA 2IF2A 3ZV7A 1BG6A 1WOYA 1XQ1A 1ZCJA 5EZYA 3CO0S 4BNIA 2YHUA 5K09A 2BEVA 1G4AE 3GEHA 4BN5A 2OC9A 4F86A 1EX1A 1G0OA 3GJ8A 3P94A 2I7XA 3HY4A 1SM4A 4HMOA 5CFRA 3PDWA 2R48A 2Q3BA 4MYCA 4YMSA 2LCFA 4BNYA 4V1CB 2XWPA 2QL9A 3O0DA 5JXHA 2HM7A 4KP7A 4E5PA 2BGWA 3FWHA 1GJRA 1UFKA 4BNLA 3C97A 2DR0A 3ZWDA 4JUCA 5DNYB 2QTCA 2YINC 1FP6A 1NONA 3G17A 3KV1A 3PGKA 2JCYA 1T2NA 3N2EA 1CB0A 1XNJA 2YNMA 3QGMA 5DT2A 5DLEA 3H04A 2CLEB 5F51A 3L6OO 2B1IA 4M1QA 1QF6A 4C6TA 4CN9A 1QP4A 3FY4A 3K09A 2KQUA 2FRDA 1EH5A 1R8SA 3VDMA 1P1IA 3WOHA 1P1HA 2AXNA 4U7FA 3DLIA 4DRYA 3EPRA 1NVAA 1OV6A 3IP1A 4LYJA 3IP9A 5CITA 1Z29A 2ONKA 5J5VA 2YRXA 3LCRA 1Z3CA 1OA1A 3MK31 3ZV3A 2IP2A 2Z30A 1V7CA 1Z56C 1BGVA 5K3CA 5KCMA 3K9FC 3UG7A 1N9KA 3AEUA 3RYHB 4IIEA 3SS7X 3LUJA 1QYDA 3B3AA 1UM8A 3KQTA 4CDRA 3KWLA 2YHIA 5TSDA 4DV1B 1E0AA 1C4KA 3OQIA 4M83A 4ALKA 3IUJA 1T2DA 3LWNA 1D2MA 4XFJA 4YAUA 3THWB 3GQBA 4KLAA 1Y8QA 3NHMA 2CVQA 4DC9A 3QXGA 3DBOB 2C92A 4Q18A 4AYTA 2C03A 1DL5A 2JFBA 3QKTA 4K3VA 4XEUA 2ZE8A 3KB1A 5TQ0B 1SD5A 2GBGA 3TBHA 4BFYA 3F6SA 2FJ0A 2PIAA 3O3CA 3R7SA 5CVDA 1M2KA 1O6BA 2FFBA 2GCEA 5I3CA 1HOTA 5CRIA 1TAQA 4GE3A 1Q84A 3FR7A 3P71T 2GHIA 4C6HA 1UKEA 3TNJA 3OE5A 3CXUA 1IUOA 4OHXA 1DIGA 4MVCA 3RSLA 1UMBB 1CNEA 4X1IB 3MTEA 2V3CC 3AEYA 4KWCA 4YUZA 5HZGA 3EVAA 1KY3A 2CBZA 3COVA 3DT9A 1DJLA 1G5PA 4I1UA 1IDN1 4N8EA 3TBKA 4ODIA 9ABPA 2PTGA 2R97A 1EKXA 1E6KA 2H0RA 4NG4A 4JHLA 3JPYA 4OVKA 4WKNA 4B2PA 3RUEA 3V8BA 4YMTA 5K7SA 1U1DA 2WYHA 3BEDA 2DSTA 1OF1A 2O5VA 1GP2A 3IEXA 3MT8A 4HP8A 4DB4A 3KT0A 1Y33E 2X2OA 1RE0A 2PGDA 3K0FA 3OHMA 1U9YA 2BMJA 5JHHB 3DZJA 1ZLYA 5L7WA 4PYLA 4YRTA 1Z0FA 3BKXA 1ZUIA 3MWJA 3ORYA 4IGIA 2WIKA 4C4ZA 3RRBA 4JJEA 1F6DA 2JLCA 4OYYA 4RZSA 3EIXA 3PX3A 4EB8A 4PVDA 1YACA 4BMCA 1V1MB 4IX9A 4ZGGA 1HO3A 2XA2A 3L5OA 4LCBA 3D6HA 4RY0A 4UEKA 1IWOA 4AZTA 3EF1A 4XYGA 1R9MA 3A6FA 1SOWA 1GFZA 4UPVA 1AA6A 5A4MS 1GITA 1H8EA 2DFKB 1IBKB 1EFUA 1F8YA 4WJLA 4H18A 1XKXA 3NBXX 4MP3A 5SV2A 1QAOA 3OP1A 4QDKA 4HDRB 3NV9A 3K6KA 4LDQA 1GSOA 4OV6B 3KE9A 2V97A 4I8IA 5LYJB 2HHAA 1QP8A 2XBMA 5A1JA 4Z4QA 4XPIB 4HDKA 5FUXA 4B4WA 3NTOA 1IJKA 5LOVA 1R8XA 3A1VA 1RLUA 3GUZA 1V8ZA 1LDBA 4MUMA 3KL4A 5WRFA 1NASA 3UJAA 4R2HA 4C30A 3M6XA 2JLSA 3TPFA 4L5CA 1EUCA 2HU5A 2VJPA 3EIEA 4RLSA 4EGCB 1CQIB 2ORVA 2BEUA 4P82A 3WLPA 1XXHE 1QHXA 3F9IA 4ZK6A 1E1RD 1W46A 1H65A 2BFEA 1NVEA 4Y2XA 1AKNA 1ZSVA 5KYUA 3UGTA 3ZW9A 1C3XA 5THKA 1K92A 2PZAA 4FR2A 4NI5A 2QLLA 1EIZA 3FA2A 1KKLA 1LK7A 3H3XA 1Z08A 2RI1A 5GJCA 3OTWA 3PKJA 4P2BA 5DTIA 2R1UA 4WUVA 2QRVA 2R2GA 5ICSA 4HI0E 4Z99A 3QVTA 3H9UA 2XOKD 3VU9A 3BF7A 2BGIA 2Z4TA 4I5FA 1WCXA 1XO1A 4Q6BA 1D4OA 2WNSA 1TU4A 5COBA 4LQCA 3HNPA 5CPFA 5B3JA 5HS4A 2L69A 1TVCA 5B3JC 1CQJB 1W1WA 4J94A 2WF8A 3CYFA 4G9EA 5EWMA 3IQZA 2I4MA 1GPLA 3CUSA 1EFCA 3GROA 4EVQA 4HS9A 3I6BA 4JBIA 5GONB 1ADYA 4MNTA 2JJ8A 1PZHA 3OBBA 3TLAA 1RKVA 3AF0A 3G89A 2HK6A 3PDIA 4PNPA 4XVRA 3OLWA 2V7EA 5DLQC 3TNFA 2HO5A 2Q29A 5A2GA 5KTKA 5H80A 3TLXA 2H11A 1I32A 5EAIA 1C7IA 4TWAA 4OU4A 2OYRA 2GB4A 4BYGA 4NHEA 4WEOA 3SS8A 3LHSA 4D0GA 5JAPA 3THXA 5AHWA 1QK4A 1XTSA 2EFHB 1XF9A 1D8TA 2Z6AA 3HWRA 4C3UA 4JT4A 3QVOA 4CQNA 1XAGA 5LFAA 5B3KA 2FHSA 2OHXA 3BE5A 2WD7B 2PL5A 4ENUA 1ZOIA 1DEOA 1M74A 2WM2A 4KODA 3GPDG 1XTUA 1W30A 4BVFA 1GZ3A 5C1IA 4HNUA 1E7RA 4J8PA 4OP3A 3WP0A 1DP4A 1DO8A 4I5DA 3L7YA 1AGXA 1KGSA 3JQ9A 3JX9A 2FPMA 2GT1A 3OPYI 2DX7A 3FRIA 1HDGO 3JQ9C 2OM2A 2PGAA 1AY0A 2IZ1A 2Q28A 3CISA 4INAA 4LI0A 4QRIA 4RK0A 3QVKA 4BN4A 1WDMA 3GVIA 5ALTA 1QE0A 4A0FA 4BNTA 4BZWA 4WEQA 2YMPA 5C53B 4RTKA 1PNQA 1ZK1A 4FT4A 4YJDA 1FMFA 2BZSA 1UKVY 3P2MA 4GEGA 5GZ3A 2AG0A 3BM5A 3ELUA 4MRPA 2PUJA 3K8ZA 3WWZA 3LVBA 4CG0A 7ABPA 2BSAA 1U5BA 1MH1A 4RU1A 5HKOA 2GZ3A 4HPJB 1WXFA 2DR3A 3AR3A 2KJQA 1SXIA 4YRNA 1BWQA 3E8XA 3N05A 5JH7F 1X3SA 5IVKA 3L41A 2VJQA 1X1BA 3PK0A 4LXTA 4RMNA 4Q82A 5HUQA 5IXSA 3IXLA 4CDGA 1OC4A 2H00A 2HJSA 1Z07A 4H3KB 1K8RA 5T6BA 1NVUQ 3FYUA 3KUCA 3ZJVA 3RSGA 2XMZA 3J81A 3SY8A 3EPKA 1XZKA 2Q41A 1QYIA 4MGIR 4W8OA 2BGKA 2ZB7A 3X1XA 2V7QD 2BZGA 3KKOA 4WX2B 1H2FA 2PS1A 3OPYB 1R5OA 4CIVA 2H59A 2VKTA 3JD4A 2H5EA 3LPAA 4L5AA 4Y9DA 2K7FA 1MJGA 3SJCA 4EOGA 3TTWA 1HR0B 2C3YA 2GVDC 4CR7A 3C24A 1K4MA 3PJEA 3F74A 4I7EA 2Y9PB 1F4LA 2GJ4A 2GJ8A 1M6WA 3AJDA 1GLNA 3GBPA 4ZT2A 1VHJA 3I53A 1UT8A 2VFAA 2Z2XA 3ND9A 3SFVA 2C7PA 4L16A 3QYPA 4FSDA 3RS7A 2CK3D 4X1KB 3QELB 2F59A 3F2VA 1GEEA 5IT9A 1R0CA 3ELDA 3IEIA 4OBEA 1K3TA 5DE3A 4A15A 3C4JA 2HEIA 2O54A 2QTRA 4HAIA 5TMBA 3BOSA 3OCVA 3K0EA 5K0LA 3PLAE 4RABA 4W1SA 4RETA 2QX6A 1K8ZB 2ZBRA 1Y3DE 3PDUA 3PR2B 1Z4IA 2J0QA 1ZUNA 2I6XA 2JARA 3MM4A 5K4AA 3ZD6A 1EQUA 1BWSA 4MV5A 4LAFA 5LQRA 4NZOA 1NIJA 2FJPA 3N0WA 3QNUA 3NOXA 4UAVA 5KSPA 3MELA 2ORWA 2X7XA 3AWDA 4TTPA 4LRQA 1JFFA 1KQOA 1RRKA 2V7VA 3B8HA 3VQTA 3WGNA 5LZ9A 3MYRA 4Z53A 4O29A 4X6UA 3OT1A 1BVRA 4G26A 1M7GA 1A9PA 1XRLA 4HYYA 4RQUA 3EG9A 3RW9A 2R65A 2SKEA 2GCPA 4Y0VA 2J0SA 1OX4B 1PYDA 1WA5A 2YV4A 1CDDA 4PAOA 3R23A 4P3NA 5A4AA 4L2IB 2X4IA 3WYDA 3D64A 2ZVQX 1PJAA 1Q92A 2DSNA 2HJVA 1UMCA 4Z54A 2OGZA 4RHFA 2IH5A 1ACMA 1LEHA 1D5WA 2GWRA 3HA5A 2VSFA 1ORIA 3FKSD 1DXYA 1HDZA 3GJXC 4Y8VA 3WAKA 1W94A 3MQ2A 5CXXA 2V7XA 2Z09A 3B36A 4WAUA 4A82A 1G98A 1U2DA 4RZXA 3T41A 3R3UA 4MYRA 4YMWA 4QVIA 4U2CA 4UNQA 2GK4A 1U2DC 3AF3A 2NG1A 4XGRA 2A9VA 2DT5A 1JSZA 1VPTA 4EO4A 3S1AB 3PFIA 1CLEA 5ALDA 4ZI7F 1V1JA 2O7NA 4KGDA 4GUDA 4J29A 4PXSA 4C4OA 3O2QB 3DE5X 4P84A 4PG7A 4MB2A 1C5KA 4HDOB 4RE5A 4MUNA 2ZYGA 3ZHRA 5GTDA 4TMFA 1PD0A 3NXKA 2GUGA 1MO6A 1T2UA 3AQ4A 1GUDA 2RK4A 1B8PA 5CVEA 4QDZA 4ID3A 3WYNA 1NI3A 1IBRA 4O1IA 3NAQA 2IU0A 2HZ7A 3WGLA 1WMBA 2GRAA 3D7SA 4IJ6A 3BWBA 3L8GA 2ICAA 1SO8A 3QW2A 1PZXA 4B7UA 1NR5A 4DAEA 4IIXA 4JYPA 3U2QA 5DNDA 3U37A 1EXVA 4YQFA 1SWWA 1W5FA 4XIGS 4YJ2F 5EIHA 3BZUA 3TLJA 3SF0A 3WYEA 3V32A 5JQGA 5KX5A 3F7NA 3HJUA 5A0FA 3H8WA 4RY9A 2R1ZA 2BF4A 2YZGA 3MGKA 5TS3A 3ZHQA 1FX1A 4HATA 5C18A 4UEWA 3UCEA 1N2BA 4IHJF 2E48A 5F2KA 3WYCA 2NV2B 5A4IS 3W3ZB 4FFVA 4UCFA 3HCEA 1XMJA 4PZUA 7AT1A 1FZTA 2TMKA 2WUEA 5SYAA 3ZQUA 1CV2A 3ZJ5A 5AM0A 2FN4A 1QBKC 5KVCA 1PJ8A 1YRBA 1C4OA 3EFOA 4F2DA 3ONVA 1KDOA 4Y6PA 3TZQA 3H11A 4CQMB 1HWYA 4D0SA 1VIDA 2X0FA 1Q44A 1IXRC 4ITRC 2FAXA 2KHZA 3BMNA 3D7KA 1XXHA 1NW7A 4KR0A 3LUBA 5B37A 2ZUCA 3KYBA 3PIDA 4W1PA 3RHSA 5K5EA 1BZYA 4MKIA 4WCFB 5KWEA 4B31A 3WIBA 2X1VA 3QITA 2CXXA 4JLBA 5B1YA 4FQ8A 5EG5A 4EIWA 2ZI7A 2QX9A 4X0EA 1UEIA 3HDVA 2B0JA 4RFVA 4BMNA 1U31A 2RGCA 4BQEA 2DQYA 3GA0A 5HZKA 3BWEA 2Q4DA 2XEXA 1XYVA 2XAAA 4WT7A 4ID9A 4JROA 4DJFC 1BOOA 4M9CA 3O3MB 3PRHA 3AHGA 5JECA 4MROA 4NLLA 1TZMA 2LCQA 3GRKA 4H59A 2GD6A 2XUFA 4JU9A 1RXYA 1YUBA 1JG1A 2IYRA 5CGQB 2AUMA 5IZ4A 1HOXA 3L02A 3WWCA 2I8AA 3Q7SA 3HO1A 2R8PA 1A2KC 1HETA 3OOJA 3FPFA 5BOSA 5BUQA 2IH4A 4W5WA 4MTCA 5I8WA 1IK6A 1E8DA 2PZEA 3ZWAA 1CR2A 2C7GA 4JJIA 4J7UA 4KIFA 4J03A 4XDGA 2GHRA 4G8DA 5J1SB 1G8SA 1PV4A 1HTWA 4EYKA 2CLCX 3GGPA 2X9VA 4EKYA 2QRLA 3D8TA 2FMFA 4F46A 3PE6A 4GMKA 1I4TD 1VKRA 4RL4A 1N57A 2BMVA 3EASA 1AHNA 1X7GA 3IP8A 3EZNA 4BNDA 2HT1A 3HXLA 4HAXA 4NS4A 1RE1A 5HA5A 3TIIA 4UVDA 4QODA 2RONA 3S27A 3QEBZ 1E9CA 4ZO7A 3SZRA 2IHVA 3I2KA 3EX7C 4Q7KA 2R5FA 5DGTA 4BB9A 1V8BA 1J22A 1V96A 2C1EA 4R3UC 3ZKWA 4KN6A 5JNWA 2WVJA 3GVPA 4MW6A 2HIHA 4IWNA 3M82A 4WN9B 3VKHA 3IQGX 3KU4A 1WD7A 1UDBA 3C8MA 3JQGA 1N2EA 2QJWA 2XNHA 3KOYA 2XMSA 5H3LA 3NHBA 3ZIAD 3KO8A 4ARZA 2D0IA 2YXLA 1GG2A 5BN5B 3D8BA 4IZHA 1U3FA 2PBFA 3KJFA 4GH5A 1ISRA 2EDAA 3SZOA 1JFTA 1LFDB 3REOA 1DZ3A 1G63A 3L7CA 1G8PA 2Q2WA 1MHTA 5JCPA 3R0XA 2NU8A 2YCBA 3RTCA 1XQXA 4B3FX 4XD2A 5EJ6A 3MAJA 3HYSA 2QRKA 1YNOA 2A1IA 2W2KA 4B6QA 2G88A 4BNWA 4B5KA 1R0XA 1VB5A 2WMOB 3MS7A 4GSKA 3MQFA 4DJTA 3L8YA 3F78A 2BFAA 4R1TA 5HTKA 3SQLA 3Q10A 4NE7A 5PGMA 1PT5A 1J1ZA 3LHIA 3CEJA 2IYEA 4KC0A 1HA3A 2MT9A 3HN2A 2BFWA 5CFZA 3FLMA 2YVLA 4PLGA 2ORED 2R86A 2CSUA 2M6KA 1VE9A 2JKVA 3SC4A 1Q7RA 1WP9A 1B6TA 2LZ0A 1G1MA 2WHXA 3AINA 5JXIA 1DTEA 1PR9A 1BH2A 2FX2A 2HMVA 4MRNA 4OAQA 4Q16A 4YMIA 3ACDA 4L8GA 4K03A 4BVBA 3IFSA 1QIKA 2QN6A 2RBGA 2G1UA 2ZRFA 3IOMA 3OTQA 5I5GA 1SKAA 1TEZA 5ES4B 2VG8A 1QQAA 1NN5A 3PNLA 4H9GA 4I50B 1TJ4A 1P4AA 2HCRA 3Q7EA 4NMWA 3NETA 5IF3A 1SGWA 4OU5A 3VH2A 4I4TB 4TS3A 3O74A 4LWOA 2VVTA 1OFUA 5CJJA 2C0QA 1LK5A 4II3A 1N3YA 2O1EA 5JFTA 4W8GA 1TQHA 3O1IC 3SDSA 1DHRA 1WKCA 1XZGA 2NYUA 4P4LA 1HDOA 2PFGA 3WHIA 5MHTA 4LCJA 2W8ZA 4WY5A 3ZHSA 3A4VA 1J00A 4XVQA 2A8YA 3PC2A 5HMLA 1TLFA 1HSZA 2QPLA 3A9TA 3DKIA 4FNGA 1KSGA 5HQ3A 4CMJA 2EC5A 1OYOA 3N70A 3NOQA 3MUNA 4R2IA 4NCIA 1XLTA 3F4KA 3DGEC 2OKGA 2Y6VA 1M6VB 2GFQA 1BHJA 2XZTA 4DMCA 4EG7A 1N0VC 1OH6A 1B6SA 2AFHE 1HYBA 4Q4HA 5JWHA 2WQ6A 3O03A 4O4HA 3SYLA 1OXVA 4L57A 4YRKA 1LDYA 1ESCA 1X77A 1NQWA 2R3SA 4O2AB 4TS9A 3ZDRA 6YASA 2PMFA 2Q5OA 3PXAA 2CDCA 2WUVA 4J4HA 2XITA 3TI9A 5I01A 4JI3B 1PNRA 3P2KA 5DN9A 1IU9A 1W5EA 1KPHA 4FEYA 1R50A 5K0TA 5EQTA 1IM5A 4UARA 2OCDA 2GFHA 4G4SP 4V0OA 1XN4A 4ZZIA 3GPIA 5CB4B 2FW0A 3HJCA 4WIAA 5HF8A 5CX4A 4RTSA 2OOSA 1URPA 1DAKA 1S0UA 1T5OA 1P44A 2ZUUA 2EZ9A 3C1OA 1E3DA 2YL2A 3I0MA 1WXHA 3GD7A 4KK4A 5C5EA 5G40A 2QM0A 2P6RA 3EZLA 3IMGA 2E85A 3ACCA 4MB6A 1LLFA 3BBPA 3EXAA 1M34B 2WJJA 4FFBA 4WHMA 4XDHA 1C1DA 1T0IA 2HQRA 2ETVA 1H93A 2IYZA 2HZBA 4XEHA 5CK5A 4X1OA 3K0HA 5KU7A 1JU9A 3PU6A 4PINA 5ECDA 1C9DB 5C7YA 5KSWB 4HUTA 1B41A 3H16A 3SZMA 3GMIA 1UXIA 2JJ2A 2WRZA 1SG9A 3OX2A 2KB0A 3H1TA 3U4CA 1XMVA 3L4KA 4RQTA 3DTVD 4UU8A 3A1NA 4MV1A 2XUOA 1U02A 1IWBB 3AF5A 4F4DA 2LR0A 4A36A 3EQZA 1TX4B 3U40A 3M9WA 4BX2A 2J5KA 3F5MA 3LPDA 3UMSA 3EPHA 1YQUA 3KU1A 2E6KA 5KNDA 4WOJA 4EG0A 1W49A 2AHRA 4QBTA 1DUSA 3VR4H 1CUVA 4GVPA 5LP6B 4NYJQ 4ONEA 3ONDA 3VHXA 3KJQA 3U3MA 1LZLA 5IXYA 2ROQA 4ZVTA 1EWKA 1Z13A 2DWUA 4B3JA 1QCDA 3PEFA 5B2EA 1OYWA 2R62A 4Z3KA 4ADSG 3ORHA 5CVVA 1ZN9A 2IXBA 2FWRA 4G25A 4BO3A 4ZPXA 4TKMA 3EC7A 2FGJA 2PSEA 3OX1A 3WYAA 2H1OA 1XKQA 2YVUA 1T5DX 4V3CA 1ZCFA 2ZW9A 3E3OA 1UJBA 1JBEA 4NYIQ 2C07A 2VAWA 4QUHA 3ZBUA 1G21B 2PUGA 3UOAB 5HRAA 3EODA 2PD4A 3JQ7A 5AI8A 1T1SA 4G1EB 3UHPA 5CFPA 2PQ6A 1DRJA 2CXNA 2E5FA 2OV4A 3FOBA 4ZVVA 3TW0A 5HXAA 2PA3A 4ROSA 4FZRA 4H7JA 1CDOA 3OX3A 3TD2A 1TEXA 4JI1B 2VHWA 4RANA 5CEJA 1T2EA 2BF7A 2QGNA 2NVUA 4TXHA 3TQSA 3TLCA 2QB5A 5DLDA 1SRRA 1ADBA 4RHCA 3L8MA 2WB2A 4KPYA 2O5EA 3ADDA 1FRZA 3MAAC 3SFTA 4C7JA 4ZJUA 4D9CA 3F3YA 2EXXA 2ZBGA 3G13A 3C6MA 1MA0A 1C0LA 1QS0A 2J3QA 2G83A 3MJDA 1SG6A 2JHFA 3VKFA 4F1WA 4EY8A 5IZCC 1TVMA 3OKPA 4LK2A 3GF4A 3E5RA 5JTTA 1NT4A 2O2EA 4ZMRA 5JNVA 1I5EA 1ZM3A 2WHPA 4OHMA 1O8CA 2B2NA 3X1DA 4M89A 2PVPA 4Q7MB 4BO0A 5I4IA 3HYRA 2XUHA 1COZA 1SZPA 4GLLA 1W0KA 1JHUA 4NJEB 1H4QA 3W9UA 2OQIA 4EAAA 1OBVA 1BMFA 2OCAA 3DVLA 5JEDA 2FEXA 1VL5A 1C14A 1K7EB 3IO5A 4AMVA 3KVOA 4IMRA 4JJ8A 2GN1A 4AF8A 3GLIA 1E4OA 3F8TA 3VR4D 1XRSB 2Z6QA 3PJGA 1T8TA 2JFQA 3ZGVA 1HZZA 1Y3AA 3QOFA 3AM4A 4Q9DA 2XR1A 5EEHA 3TOCA 5EKDA 3GBSA 1ZWLA 3H1FA 3T3GA 1DAOA 2OB1A 3P7MA 1KSHA 2HLNA 4GZ3A 2CZCA 3KQMA 1TUBB 2ZBQA 3MJFA 3ODPA 2YNMD 5FWAA 1M76A 1EZ4A 1V45E 1U3TA 5IHPA 3E22A 3E0QA 3GRCA 5BNFA 1JF8A 1OB2A 4TKUB 4ZEOA 2WKWA 1SB9A 1SVLA 1ZXBA 5JH7A 4OXYA 1JYFA 1FYWA 1QSGA 3JQBA 4QGFA 4R1OA 3H05A 1CE8B 1X1DA 1E2LA 2COEA 3BDVA 1PJ4A 1UK9A 3IP5A 4Q0MA 4JI6B 5J3JA 2SICE 1IHOA 2VPYA 4OHWA 4BMVA 5FD8A 1GPDG 3CVJA 4IJWA 4CIXA 3W2GA 4MLDA 2YYZA 4FMCF 2Q2QA 1NC3A 1RJEA 3JQQA 3LCVB 3KAKA 1U3DA 4QXOA 1B8UA 5FUMA 4K81B 2AC2A 4EW6A 3BXGA 1FE8A 2XB9A 4Q02A 4BO1A 2FQXA 1IJFA 4Y2PA 4YYZA 3QBVA 5L3ZA 1GNQA 1J8VA 5KQMA 4QPJC 4RDCA 4RVHA 2BDEA 4OPMA 5LDGA 3TCNA 4RGVA 1I9CA 4BRSA 3NBFA 5FTWA 3P0JA 1FVFA 5B58T 4D8TA 2RHCA 3RRXA 1I3CA 2GXQA 3OU7A 1O96B 3T34A 3LFHA 4Z0HO 5FPPA 1SA0B 2JVIA 5DWVA 1YOBA 2HSDA 2OB2A 4R5MA 4G0XA 1JZQA 1PWYE 3MWEA 1NY5A 4UE2A 1OILA 1GNPA 2YDXA 4WBSA 1I3OA 5E7MA 5BVHA 4OJNA 1JLLB 3EE6A 2IHBA 1IBSA 1VKNA 1YDGA 4JUFA 4Q37A 5SYNA 3BGWA 5TPZD 2K6GA 2JD1A 4B3CA 3SYTA 4J6EA 4KNVA 3UA4A 5BR7A 1U7WA 4OLFA 2BW0A 4I1VA 2O14A 1D3AA 1J9EA 1RI5A 2GK3A 3T1QA 3MJEA 4PLWA 1B0PA 3PVZA 2I9PA 4GYYA 4HF7A 4CT4B 4DRZA 2AF4C 2BFFA 2BUBA 2ZGVA 2ZZKA 1HF3A 1IXSB 3DTYA 5FNVB 1YVPA 4AZSA 4BB6A 4NOLA 4NZMA 1SUAA 2IFTA 3P2OA 2EX0A 3BGVA 5AVOA 3VVBA 2QX7A 2X41A 3EN0A 1HURA 2YUIA 3AKEA 4B7ZA 5DM1A 3HO8A 4LQDA 2H9IA 1ZI9A 4PG5A 5GWXA 5ENDA 2I2FA 1YU9A 3MW8A 4FQ5A 4NFYA 2R6DA 2IH2A 3PHIA 4UPEA 2PFKA 3CZ9A 4BQFA 1KXJA 1CP2A 4M49A 3GH1A 1RJ9B 2LD4A 1KEZA 1PVDA 4DUPA 4XIIA 5FXMA 5BO5A 3IBSA 2X9NA 3HBAA 4FFMA 3N2IA 3EVCA 4GC5A 4MX8A 5IU6A 5JSZA 4YCLA 4QTXA 2CJFA 2BGTA 1LV8A 1BFDA 4TMTA 1YJQA 4AJJA 5HYVA 3NVMB 1RI4A 3TSCA 4DC1A 4ZVOA 3PX7A 1W2GA 2FQYA 3IALA 1BMTA 4L07A 3WG9A 3I4FA 5CMLA 3AIIA 2B8NA 3PGLA 2QMEA 4R6WA 1PJRA 3BSFA 4IG4A 1H2RS 1L3IA 1M1UA 1NXWA 1ZOOA 2QRGA 2VUTA 2WV7A 3QU7A 4FGKA 2GPJA 4LMPA 4LYEA 4YQZA 3UJ8A 4ZI7A 1E64A 4DQLA 4QM6A 5A9TA 3NWBA 1RQGA 3K4QA 5CGZA 2XF8A 1V4BA 1WLSA 4EX6A 1LUAA 3CHYA 3VUFA 3I1JA 2XECA 2J1LA 3ZDAA 1TDJA 2WDPA 3QOXA 1QDEA 5U4QA 4Z1MD 4AS2A 1QGAA 2LVBA 3H2KA 1D1QA 1JEYA 1H1TA 2BTQB 1P1CA 1QX3A 3IAHA 2C8KA 2ACWA 4JZYA 2MIIA 3HZRA 1D04A 2J4CA 2HNKA 3JR3A 3F47A 1BS2A 3H5AA 3IH5A 1RWBA 4B6GA 5C46F 5IT0A 3PFNA 2I65A 4LJ6A 4YJ2A 1K66A 1NQAO 1M2VA 3LA8A 5EHQA 5BRNA 3IQXA 4C6RA 4Z5XA 4L3OA 4CL0A 4R51A 3VSBA 4DMHA 1MZPA 4JBGA 5A02A 3QPVA 4CKWB 4IMPA 1U8FO 1WXQA 3D6JA 1L7EA 4DUYB 1ESDA 2TSYB 4M9SA 3T99A 4WLEA 1E3SA 2DP4E 2XYQA 3IUNA 3KQNA 1ZBDA 2YMLA 5CT4A 3G82C 3RU2A 1AXEA 4WLFA 1I2MA 2ISQA 2C2ZA 3UMMA 4J0QA 1KAOA 1Z4KA 2H2IA 4Q1VA 1W5TA 4QGHA 3SHVA 4MVWA 5KHOC 4IX1A 1Y8RB 2RHJA 3FPBA 1D2CA 1W87A 1CEXA 1A5SB 3C5WP 2W37A 3G8CA 1WXEA 5J2UB 1WDLA 4IV8A 1YVRA 2FZGA 4Q47A 5BWMA 1GR0A 2JLQA 2IOFK 2Q50A 1W35A 1DXQA 2WTEA 2QWXA 4DCPA 5HVNA 3FBWA 1KJQA 3B2NA 1TC2A 1WDWB 1B26A 5B30A 1BWRA 1FJXA 1NRJB 1WIWA 2LV8A 5EYPA 4F3TA 1QIFA 2WAXA 2NUPA 3IMCA 3USZA 2WA1A 4C04A 1KORA 2BFBA 5IK2D 1VSQA 2ZJ7A 3O82A 2ZR0A 2Y0EA 1OGIA 3QK7A 1C0EA 4MI9A 3E7FA 5AMXA 3UJDA 3KBBA 1MB2A 5EP2A 3RSSA 4P2GA 4ZARA 4MJ7A 1ZNZA 2FWIA 4XA8A 1JT2A 3DPIA 3IB3A 3WLRA 1F06A 4S3MA 1GTJ1 4JUBA 1R5BA 4GI2A 1MQ9A 2P78A 2PLFA 1SIBE 1NVVQ 1NVFA 3FNBA 4JT8A 3RAFC 1BAPA 3CSDA 2RHLA 4KMOA 4LJAA 3WWDA 2IBSA 3ML1A 3V1MA 2C4TA 3VFDA 4DSUA 3DB2A 3KYIB 2NUTA 4LNHA 4PLPA 4A2QA 3R3JA 5EJ8A 5E4TA 2VYCA 4P08A 4EB6A 1XGKA 2Y4NA 5EIXA 1QFYA 3I2FA 2J6HA 2E0IA 4JLVA 2BHRA 4MUHA 3PLNA 3NCTA 4K6HA 2Z8ZA 1ISMA 4O1HA 3G7NA 1BX0A 3AHJA 1IN1A 3MEQA 1P1RA 5HG0A 1NVWQ 2B92A 3NVAA 1CY0A 1RPJA 4JVMA 2PXXA 4XQ0A 1YBAA 3KSUA 1BMDA 5BSEA 5AIBA 2EP8A 1QR6A 2TYSB 1BWPA 4DMRA 4F1JA 1HE4A 1VE6A 2QXUA 5EE9A 1JMKC 1GXSB 1VKJA 2JBWA 2WJ3A 1YUNA 3TUZC 1K5HA 3IELA 2WM8A 3T9BA 4C6SA 1YTLA 1NBWB 4FYXA 3CJQA 1KBZA 2VF7A 3QVWA 4CPDA 2FZLA 5CA0A 2D5LA 2DUMA 3C6YA 4GZ5A 821PA 5I4CA 3GG9A 3RJ5A 4H1WA 1RACA 4RV9A 4B84A 3PE4A 4PPGA 4HVCA 3R7BA 4XGKA 2G5GX 1Y1KE 2CLLB 4PRYA 4HYEA 3GFPA 3KG2A 3YASA 4ZU3A 1T5IA 2O19A 2PUWA 1R16A 2EJWA 3DL0A 1ZCAA 4MI6A 1PD1A 1MX3A 1IY9A 4OMUA 1CK4A 3SBEA 1Y80A 2WG1A 1RYDA 4CLOB 2DWQA 2OCLA 2FSGA 4RGYA 3ZCQA 1QANA 1W85A 1C0KA 2UZ1A 2PX5A 4WWHA 4HTAA 1FNMA 4ZVNA 4KAXA 4DUGA 4AKHA 4XJTA 1CJSA 1DJQA 4QARA 1KA9H 5KYXB 1ACLA 3GOQA 1G5HA 2C0CA 3G9TA 5D6NA 4J1QA 2XDQB 2HSWA 1IOZA 2JHAA 4N3CA 2B9VA 5L7TA 4TZ0A 1SWVA 3G2OA 1FLNA 4IJMA 4ZAYA 5HRUA 4FC7A 3GB9A 1Y6ZA 3OEYA 1JQJC 3IV6A 3OQ1A 3TN7A 2BHTA 3JZDA 3V4VB 4DSZA 3LHFA 1YQ9A 4ZQIA 3TH5A 2H2HA 3UXEA 1GTG1 3DZ8A 3HKDB 4ITVA 1MV8A 3MMPA 4P58A 5AICA 4LRXA 2O8DB 4GXNA 1UUFA 2OAGA 4RC9A 1PG2A 3F97A 3DAPA 4RPKA 3PPVA 2ZIXA 1E2BA 4DIMA 3LUHA 3CX6A 4C2UA 4QOSA 1NUUA 4G65A 5BYBA 1RWOA 4Q21A 2OHJA 2R4QA 4V0LA 2PO7A 4PYKA 3S2ZA 2D1YA 1ULZA 4OYHA 1YZYA 3A6JA 4ECAA 2GBLA 4F85A 4LHZA 4A8JB 3S4YA 3RBXA 5FFNA 2GBLC 5I9SA 3LTEA 1RRVA 2QP9X 3UAGA 3R0QA 1IUKA 1I0IA 2IZZA 2PVCA 3AERA 3TOXA 1WS6A 2B8TA 4YRRA 1I51A 3UXYA 4JR0A 3TL2A 1QFZA 2DFLA 3W05A 6REQB 5I9IA 1ZO8A 2FPUA 2ZSIA 3CW2A 3ISTA 1GY8A 3UV7A 3ZCSA 4IFBA 4TYNA 1TMYA 2E4XA 3WGQA 3V2HA 2H2WA 1FXWF 2ZYDA 4YIKA 3BMOA 3OZAA 3O90A 3OIWA 1G2QA 4IDDA 4ZO4A 2QZPA 2HKIA 1GKIA 4R9SA 4B32A 4GR5A 4INOA 2I62A 5JCJD 1QLWA 3UMJA 2G36A 5JNUA 1YB5A 2Q5IA 5M5BA 4X95A 2HPHA 3RFCA 1JXOA 4PQGA 3IAXA 1OXBB 3AOEA 2QSJA 2QTLA 3L1KA 5CDHA 4M1YA 3PTLA 3AOEC 3MINB 1XU9A 5CNMA 1DTSA 4HT3B 1VHWA 5L9AA 4MUKA 4HUQB 1N9GB 1ZXXA 2WMDA 1JRLA 2WSIA 3EMKA 2DQ4A 3AMVA 2F8MA 2QGZA 1LGYA 1OTXA 3GC6A 2I67A 4KWHA 3W34A 4BRZA 1Z4MA 2PYZA 2R60A 4GD3Q 4IHQA 1U04A 2GA9A 2H1LA 2FSUA 2P67A 2FQWA 2PKYX 5T8KA 4MQMA 4C0KA 3DLHA 1FFYA 1AGNA 5T8KC 1HY3A 2PLAA 3L79A 2P4HX 2CWDA 1FBNA 4UMFA 4WRRA 1XR3A 3RG2A 4AD8A 5CG1A 4MQ6A 2DFNA 2ZJFA 3RC7A 1MOSA 1WVMA 1Q0UA 1PLKA 2YC2C 1W4RA 1AN9A 1X8XA 3INNA 1AF7A 1QH8B 4W63A 4Z6KA 2BEVB 1QV9A 2YDYA 1RFLA 4GT1A 4LHEA 4P4SA 1SHZA 3REGA 1SCBA 2HJHA 3E82A 3LP5A 1GWNA 4RQAA 3VISA 1N32B 3L7MA 3HRIA 4EF5A 3WHLA 2QTWB 1KI8A 5AP9A 4TL8A 4YP1A 3ZCPA 3OHSX 4CQLA 1QV7A 3Q7TA 4CMGA 1RLMA 3IEKA 1RHRA 2NYVA 4LEIA 3IC5A 3GEGA 1JGTA 1VLZA 4P31A 1M1YB 5JVDB 1XQ6A 2SKDA 1B43A 1ZGJA 3LXMA 5AWFC 3ZGNA 2QX8A 3WI7A 1RP7A 1SAYA 4MS3B 3JZAA 3FOEC 5G1PA 4ZDIA 4F91B 1KZ1A 4WLNA 1YGYA 1CZRA 3V4OA 2MYNA 1E1MA 1JWAB 3AIMA 2JFUA 1DRKA 2P5YA 2QR5A 1XNGA 3QF4A 1RQPA 3QMPA 1UP7A 1SIWA 4RVDA 5GPBA 1Q7BA 4PSVA 4GG1A 4FGUA 3BFJA 4BE7B 3DPUA 4D7AA 1L7OA 1N2XA 1STOA 2HLDA 3FLEA 3NP9A 4FE4A 1VFNA 4ZO8A 3FMGA 2GCOB 3DFMA 5JI3E 4LX0A 2BI8A 3OZSA 4QO8A 1HLGA 2HRBA 4HFNA 4UCQA 4QJIA 3DAGA 5KTMA 3VR5A 5DEOA 1AGRA 2DPLA 1JHVA 3T54A 3K1JA 3HGQA 3WXMA 4JLOA 1UJCA 3PUIA 1KI7A 2JATA 5J59A 3KB6A 4JIMA 4X6XA 3EA4A 5AVUA 2YV5A 4AO8A 2WFLA 3JQ6A 4FE3A 3E9NA 3GLSA 4ER6A 5KQLA 2IPAB 1NF2A 1B16A 3ZXYA 8ABPA 2NP6A 4ZEVA 2IU3A 4MGKR 1XDGA 2VHUA 3I72A 1QIJA 4I08A 4N0EA 5G4KA 2OQVA 1VCMA 3KJNA 4MMZB 3DZDA 3GU3A 5AOBA 1ULBA 4D4IA 3E1SA 3FHLA 3S40A 4MKFA 4TTIA 4YI5A 5DO9A 4LBVA 1GTVA 3W2HA 2B69A 4LGMA 5MF6A 1TF7A 1C8LA 1G3RA 1TZKA 2QW1A 3WSTA 4MV3A 4TYWA 2QUBA 4TLBA 4EJMA 4TGLA 2O0MA 4GR9A 3OEHA 2JFVA 5JCZA 4MGEA 1V3QE 1YDHA 2EJTA 1V5GA 2Q2OA 1DADA 1EVQA 1LDMA 4G24A 4K40A 4JYMA 5FFFA 4LNAA 4O8ZA 4XTRA 3I4LA 3RBAA 3S44A 1O6GA 3V1KA 2PGIA 3WA6A 3BMQA 1R3UA 3RIHA 1VJDA 4YV7A 3GLHB 4NESA 3F6YA 1H85A 2CCJA 3EXHA 5COQA 2XXAA 4J1TC 4J49A 1I0ZA 4WCDA 1ZRSA 2MJLA 3EXHC 4KMSA 4AY5A 1YZGA 1Q2UA 3KYDB 4BLRA 5BRAA 1IH8A 1U80A 2DT8A 3A4NA 3IV9A 2B8JA 2Q45A 1BHSA 3LSTA 4MK4A 4O2LA 4O4IA 3UENA 1YRQA 1CZHA 1TPZA 2BM9A 1NPTO 4KMRA 3VZDA 4HH4A 5K3FA 4EEXA 1GG5A 2RGXA 5B1IA 3IX7A 2R6ZA 3L6EA 2ZE6A 3ZTWA 1C4WA 4BDSA 1U7DA 2QIPA 1SVOA 1R27A 4FHFA 3SZ3A 1HYGA 4MRMB 5IYZF 1QXSA 3K9WA 3ZWKA 3CE6A 4LF6B 1MF7A 4Q3NA 4ZDKA 1E3MA 1NR7A 1SCQA 2GF0A 3G8DA 1R6TA 2JAOA 4MRSA 4X6YA 1M10A 3TIGA 1MR3F 3L0OA 1V5FA 1VJ5A 3OURA 4I46A 4DA4A 3OMWA 3MJVA 2OAEA 5LNK1 7REQB 3PRJA 1NZFA 3W5HA 3DHEA 1CHNA 4Q1BA 4AWAA 4OBXA 8ADHA 2C99A 1L4KA 3V7NA 1OLXA 1L7DA 2VP6A 1NU6A 4QBKA 1HNZB 2MINB 2R87A 3IMKA 3LYLA 4CTMA 4DCMA 2ANCA 1Y5MA 4J9VA 2I2XB 4UTXA 2DWPA 1A27A 2XCUA 3T1NA 2OFPA 5KNCA 1MN6A 3KSAC 4I3GA 1U63A 3OLCX 4M9UA 4ZAWA 3L0ZA 3QIVA 4FX2A 3ZK9A 2R1TB 1A7JA 3IQWA 4LXUA 3X1KA 5IUNC 3QFHA 4H7HA 1HSOA 1QH1A 3AGPA 4B9AA 1TD9A 2AX4A 1CVRA 1ZN2A 2VPTA 2CHQA 3FB4A 1Y8ZA 1RPZA 3HVRA 1TYEB 5NULA 1DXHA 3LPMA 3RWMB 3RVLA 1NQ5A 4ISCA 1NDHA 3KPWA 4FR5A 4OO3A 3ODGA 2B25A 2G8LA 2NAPA 4OMFG 4A7PA 3QI7A 4Z4IA 3R40A 3TRFA 1S2IA 1CRZA 1KOLA 3UT5B 5CDYA 2IIVA 3IRVA 4L95C 1Q50A 3LW8A 3FM9A 2XCRB 2EFDB 1LSJA 2YZ7A 3ETJA 5FBVB 5JCXA 4HXGA 3AEKB 3ETDA 2CYBA 3SC3A 2IVFA 1BDBA 4JCCA 2OOKA 1W5AA 3OJCA 2P2ZA 3DHYA 3QUTA 3AW9A 4K9KA 1TK9A 4WJKB 2Q62A 5EP4A 2JFOA 2D6FA 2Q07A 4XVCA 4PTYA 2JGEA 2V4UA 2A9RA 1EE1A 1O57A 3BCHA 3LPLA 3QA3E 4QUAA 2PRIA 2W6MA 1VHLA 1LB1B 2W6ID 4G4GA 4XLLA 1I6KA 1OOEA 4NV1A 3RYIA 4EKNB 5FUQA 5CVTA 4QU5A 1V3UA 3PUWA 3R0ZA 1C9YA 1KH3A 4IMIB 4RELA 3PF8A 4DM4A 2VS1A 2OP1A 1KO1A 2V3WA 2B4KA 4DF3A 4JT2A 1D0VA 2HCFA 3AONB 4MS1B 2EKPA 2JJ2D 1GV0A 2I6GA 3M9XA 1Z2EA 2Q0XA 3FAZA 2P3OA 2YIJA 1GDTA 3PEUA 3SBOA 4C4AA 3I2IA 4G5SA 1YL7A 1PWEA 3QF7A 4Y2UA 1J07A 4O0MA 1KXZA 4HC4A 4E11A 1SU8A 1KAQA 2AEFA 4HPWA 3NASA 4CKBB 4KQMA 4CMHA 2EG9A 4HH1A 3R3VA 4OY3A 4AQYB 2JK0A 5KNDD 2BKLA 2IBTA 2AKYA 3O8QB 4DIOA 4FM9A 1AGYA 2EATA 4DLBA 4C21A 1EMDA 4N1AA 4X65B 1SZCA 3KFLA 4C08A 1RCFA 3FTDA 4QOJA 4BLPA 5CUQA 4F3NA 3CLSD 2WUDA 1A9OA 3R7WB 1UBFA 3HYNA 1MXFA 2VTKA 4Q3EA 4U9UA 5E1OA 4JYCA 5CLJA 4PO9A 1WXDA 1XLWA 4LVNA 4OH7A 4ED9A 3N0XA 3JAWB 4OHCA 1SCAA 5EGNA 2OHOA 3BICA 4RPCA 2IU6A 1Q7TA 5LR6A 2FPGB 4HDCA 2O3TA 3HG7A 1Z0UA 3D6VA 3K05A 3U60B 4QYMA 3ITDA 3OKFA 5ER9A 1ULHA 3FNRA 1CUJA 4IDQA 2JFGA 3UUGA 2WAAA 3K0AB 4G09A 2N0SA 2ZJBA 1GL3A 1XUOA 4I5EA 6ADHA 1V6SA 3UXMA 5AVQA 1QG2A 2GKGA 1YTUA 2DFDA 3HU3A 3BSYA 3DMYA 2UZ3A 4MKZA 2P9EA 1KY2A 1WSDA 1LF0A 2Z0MA 3PLRA 1DWPA 1MBZA 4O2BB 1J2YA 1NT2A 4KBFA 2EKQA 2FUG1 4AY2A 4ZYYA 2VDMB 1Q0PA 1VTKA 4I8XA 3Q7PA 4OHKA 1LY1A 3K1YA 2ZP1A 3PVSA 5JHGB 4OAPA 4NZNA 1RHJA 1UBCA 5CH5A 3TQIA 4XASA 3ZWOA 3OTGA 2XQIA 5ELMA 2PKXA 1FFWA 2OE2A 3VSCA 1TT5A 3Q7RA 3TNDA 2FVYA 1D7AA 4JXKA 4X20A 3SSAA 3K9LA 2YYSA 3HFRA 4KG7A 1RR6A 3Q87B 4M54A 4URUR 2H8GA 1EX9A 3KQHA 1FBTA 1I4OA 3P9ZA 1W0KD 3T7KA 1A2QA 2ZB3A 1D9XA 4AN4A 2IYAA 1WD5A 2V98A 3JWJA 3TLGA 4CCWA 1O54A 3KXDA 1EK5A 1WCIB 5A3SA 3E53A 3FTFA 4F2PA 3B6IA 3GWGA 4FD3A 1G60A 2P9FA 3HCRA 3NONA 3JWGA 2W11A 3G3EA 1NP3A 5K1ZA 4OQDA 1MJ5A 5REQB 4X64B 1X0XA 3DXFA 1QUEA 5DHQA 4BNFA 1KJ8A 3WK7A 4OREX 2PMWB 4O5AA 4M4SA 3ISVA 2IEDA 2FW6A 1D0IA 1PR4A 4F6RA 4FB5A 1FMLA 1PI3A 2VDWB 1TOAA 2M6LA 3IUEA 5J43A 1YRAA 2VP2A 2IYLD 5TQ2B 3T9FA 3WKEA 1C0PA 3GPLA 3IAM1 4M88A 4NKRA 4RIGA 2I7DA 1WULS 1A4IA 5J2TF 1OU4A 1SBTA 2B78A 2FI1A 5L45A 3HUUA 4UTPA 1XA3A 2Y68A 3SAJA 4E1VA 1KFJB 2IUSA 3DV0B 2RCNA 2ERXA 3HB9A 4HLDA 4G2TA 4HADA 2RCYA 5IBPA 5AW8A 5LMZA 2YXPX 3THSA 3FTEA 1XD9A 3Q5EA 4IGFA 4YPOA 4B4KA 5TIIA 4F3KA 3Q8LA 4DT1A 1ZMBA 1FDVA 2WFAA 3R7AA 2EGGA 3GUVA 1SZDA 4P32A 2A78A 1HGXA 4ZT3A 5HWSA 2QUKA 2BJHA 4AF7A 2H2FA 2PYIA 2FETA 3MTIA 2ODEA 4HEJA 2D8AA 2FNAA 4I5GA 5BMVF 3UMYA 5FWXB 1QTIA 1X7DA 2JI9A 2QTMA 2X58A 4FOSA 4IEIA 1QWOA 4OQEA 4DV7B 1P73A 2C82A 2O0HA 1F12A 4GP6A 1CEYA 1GQQA 3GLQA 4CLRB 2ZAYA 2PZKA 3A3KA 4YPVA 4WNAB 2WQ7A 1R0RE 2GX6A 4MV9A 4R8MA 3WE7A 4AB1A 5IC5A 3TR0A 1JA9A 2W4QA 1K2VN 2FPWA 1E6EA 2JGDA 3N2KA 2YV2A 2Z4SA 3JVDA 4F5EA 4I55B 3C3XA 4NICA 2K87A 1W47A 3BD7A 4NTZA 1WZIA 4D8WA 5CB8A 1IVSA 1CU1A 1KU0A 3K1AA 1A9XB 3A6HA 3CNNA 5COAA 4CV2A 1X7YA 3ZGLA 3NB0A 4JITA 1SVMA 3LGSA 3T7EA 1NZJA 3L3BA 2F7SA 1PLJA 2B8WA 1MABA 1Z0KA 1N6HA 3W78A 1Y7TA 3NEPX 1WZUA 1KI4A 2FK7A 4C1BA 2PKQO 3INRA 3ELBA 3N5KA 3TE6A 2NXWA 3DDCA 2HH9A 3KXPA 3EGXB 3QPAA 5H1YA 1ONBA 1RMQA 3PNSA 2FN8A 3DZGA 2AG8A 2ACVA 4B3DA 1EAYA 3IUSA 3GCWA 4WFJA 3DUWA 3IA7A 5AD1A 5B2FA 2VRWA 1GCGA 1WETA 2ZIZA 3DFUA 3FVRA 5FO0A 4J91A 4PWZA 5AK5A 1N3BA 4K6MA 2D2EA 1AKWA 1OWMA 4BU1A 3WB9A 2OBMA 2AFIB 3E15A 5B1EA 3K9GA 1R10A 3GLGA 1OZAA 2OHIA 5DYTA 2WWHA 1V95A 4C88A 3J80A 4M9RA 3L0PA 4YRJA 4ENTA 1EZ1A 3H6GA 3VZRA 4TTSA 3SX2A 5CNKA 5BSKA 2O7QA 4MGYR 4RVUA 1JSLA 1SC1A 1NNUA 3AKYA 1Y63A 5DYGA 1NSFA 2UAGA 4B6PA 5BW5A 2WU1A 4YDHB 4E46A 2OECA 3F6EX 2VTVA 2AC4A 2VP3A 1NJFA 3GJ4A 1SBQA 5AXBA 5BWNA 1Z6YA 3L40A 1L5KA 3H19A 1NF8A 2O9JA 3DXYA 4FNMA 2ID7A 4KYIB 1FU8A 2PXCA 3E8SA 3L05A 3UHOA 4E4TA 4DOMA 1I1NA 3A9WA 1X8JA 3DVQX 3EWNA 1N8SA 5D01A 3RVKA 1GQYA 1W6UA 2X23A 2RJOA 4LWZA 1OU0A 5CXQA 4MGHA 5M29A 3RODA 2H3HA 3KTAA 1WQ4A 3ZBTA 4TSFA 4HJRA 2YQ5A 4RMJA 1VJGA 1NN3A 2EX4A 3OE7A 2YR0A 1K4KA 4YN3A 5LJLA 4PY2A 2DCUA 3T06B 4Z4HA 5HKKA 1FUYB 4TLEA 3CLTC 1FDWA 1U2QA 4W4TA 4BO5A 3B3JA 5KYWB 1E3EA 1B74A 1PZFA 3O8LA 1FFSA 4WH0A 3W6ZA 3GDHA 2A1UB 3VMFA 1TYAE 5EWLA 4F7DA 3CRQA 4ARZB 3KUUA 1U1IA 5D87A 5BUCA 3I8OA 4KR2A 1NUPA 3NDPA 4HNQA 2X0KA 3TUJC 3GI1A 3TK1A 1J2JA 4A16A 1PP4A 3ETLA 4EZIA 3M3HA 1BA2A 1KI1A 2VK4A 4DR4B 2P68A 2X4LA 2FA9A 1JEQA 1Y98A 3L5KA 4FFOA 2ZSFA 4G8JA 4PCVA 4R2WA 4DDKA 5B57C 1OCEA 2F64A 1GNSA 5DFAA 4C2TA 3LT0A 4BLOA 3JYLA 1W4LA 1ZVJA 3A4IA 4EA9A 1N4DA 4ZCMA 3F5QA 4IJVA 4HTFB 2DFTA 3EDOA 4KDEA 4BNZA 1U6IA 2PO5A 3ZU4A 3ADBA 3NC1C 2I2CA 1I13A 1V4VA 2ZTLA 1OVMA 1YZLA 3ME5A 2XEDA 4WXRA 1E6MA 4EY7A 3B82A 1ZRMA 4ZYXA 4CTJA 1WZ2A 4E5UA 4FCVA 1XZDA 1T0PA 3EXG2 3KQQA 2AZXA 1PK9A 1JUDA 2OG2A 3TNLA 4XSHA 3PITA 3IBCA 5K8JB 3SYKA 3LZDA 4JBWA 4TUYF 4KXLA 4ZJZA 3VR0A 2VTBA 4RA6A 4QHSA 1FQKA 1GNVA 4IVQA 5F7OA 3R8FA 4BLVA 2RIPA 1K86A 2CHEA 2Y3IA 1U98A 2P2CA 3A05A 4F4JA 4NWIA 2PIDA 3NDIA 4PLHA 3OD1A 4NSNA 1SUPA 2W7TA 2AT1A 2ZUWA 5ALXA 2QTVB 3H9EO 3N8NA 5K3EA 2BDUA 3TR5A 1T6YA 3PXBA 3RFFA 1Z5OA 4HVTA 1HYQA 3WV5A 4D96A 4BEVA 4GQIA 3JQFA 3BFPA 1R4MA 3V1NA 1OXKB 3MWDB 3A9CA 4Z9YA 3JQFC 2PX8A 4D56A 2BAGA 1JEDA 1YB2A 1J21A 1JQEA 4GLOA 4X1YA 1OAOA 4E03A 4EG5A 2GHTA 4AJLA 3TW8B 3ORFA 4QAQA 1OAOC 4DJEC 2YWJA 2SECE 3EVEA 1GL7A 2PTHA 2WDZA 2FZ4A 4CMCA 1LPAB 2JZNA 1YAHA 5KWSA 4XX0A 5DJ5A 2UVDA 3WNQA 1AQNA 4QDOA 2NTVA 4BKUA 2XRFA 1GUYA 2ZIVB 1AHPA 4WBNF 1E3IA 4RJJA 1CUEA 1CHDA 1IHDA 2PNFA 4LE2A 2C84A 2XT0A 3U9SA 4Z2AA 2JLUA 1NLMA 2I9KA 2D0DA 1G59A 1BO6A 1YS7A 1UPFA 1WF3A 4PFJA 4GFDA 2QUAA 4NV0A 1S3IA 2QM3A 3ESAA 5JS6A 3JZFA 5HFAA 1I2DA 1G2IA 1QPBA 2CW5A 4LGYA 2G70A 2P6OA 3UH1A 4HNRA 4WNIA 4JV5B 4ACAA 1J9ZA 1E9DA 2KYRA 2NQTA 4OFZA 3FSJX 2ZUEA 3A27A 3O8OA 1QLHA 3O4HA 2F1KA 4U9HS 4HFRA 1GPNA 3RFVA 3AVTA 3VDXA 3AKDA 3G5LA 3VXKA 4DUGD 1KMHA 2EF0A 1J8DA 1B0UA 3GJ5A 5LB2A 4X3PA 3TQQA 4CVNA 4D4KA 4KBGA 2AFVA 2FFRA 2R8YA 2YFKA 4M36A 4Y1EA 1SCJA 3NTLA 1OUMA 1ODJA 2JKZA 2OHHA 1RLTA 2I34A 2LGJA 2XQVA 1AKUA 3DOJA 5LZ7A 5PNTA 4B3BA 4DLAA 1MVLA 1FYXA 1OZ0A 5IN4A 5LDDC 1CR6A 1ZW1A 2OFOA 3VO8A 5A9SB 1IPEA 5AT1A 3PWZA 1NQVA 2PZLA 3F1KA 4S1TA 9MHTA 3WSVA 5F4ZA 4RMIA 3M4XA 3TTUA 4C4PA 1GRCA 1UWCA 3TJZA 2BFDA 1KEWA 2R1VA 2X8AA 4XUGB 1ABEA 5AVSA 4NU6A 4RZIA 1II8B 1YGPA 3WIOA 4LYDA 4MVJG 1VCNA 2VDLB 4FYJA 3KYJB 1AM4D 1RQNA 3O75A 3U1VA 4C7KA 3F0TA 1JG6A 2RC5A 3EZ6A 4EVIA 4YMVA 4RK7A 3A3NA 3HCFA 1OH7A 4LISA 1H3FA 2FMXA 2GNOA 4IUYA 4MKGA 5IWAB 4D3XA 1X2BA 4IDHA 4L28A 1NF3A 2QD1A 1PYGA 2J67A 2OLEA 2PKEA 5TXGA 4TMXA 2OXFA 4AY3A 3R9KA 1ZKDA 5AHKA 1T34A 4L8FA 4P7BA 1RQ7A 3VO2A 1HRDA 3L7OA 2VI5A 1NPYA 4F5ZA 2XDAA 3O38A 2FOLA 4IIYA 3KSMA 2PJZA 4R84A 4U4AA 2MSDB 1T8YA 4YC7A 1DV2A 4TSKA 3MWFA 3D7RA 3PJFA 2VIIA 3SM9A 3GP5A 4PX5A 4QX6A 1XWIA 5I5EA 4M8NE 2WF9A 3EF0A 4IZ6A 3U3JA 3OZGA 2VAVA 3DWGA 1UBJS 1IL0A 3HLKA 2TMDA 2OUKA 4FEAA 5TPWB 4RULA 3G1WA 3EEIA 1PU2A 1RTTA 1AKMA 3GPBA 3U17A 3ESRA 2B4RO 2X2EA 3A1TA 3Q72A 2I6SA 5HOEA 4WI1A 3FSGA 4M8IA 1YMVA 1KIAA 4R9NA 1GPUA 2C96A 2OCXA 1P4HA 3AOGA 2WZQA 4CKYA 5IDXA 2VUUA 4FVTA 1KQNA 3AL3A 2GEUA 2Z2ZA 1RYYA 4Q4DA 1LBHA 2NZVG 2XA9A 3QVJA 1GR1A 1H2ZA 1MVOA 1E6LA 1K3UB 2O7VA 4G4JA 4MA4A 4DIFA 2QD3A 1DBWA 1M8FA 2VWGA 1SUEA 2DTXA 1G4UR 1Y3CE 2PL1A 2XVZA 3R5KA 3EQ9A 1XCGB 1IAQA 2OLKA 3IPCA 3CU5A 4M53A 5HS6A 4E70A 5AW1A 4MLCA 5CVJA 1JA0A 2AGVA 1CULC 1PZMA 3N2YA 4YX9A 4CCSA 3BMXA 5JNTA 3C5HA 1E3WB 3I05A 3TLYA 3UQZA 3KSRA 1LJ8A 2R8XA 2VPZA 4TL9A 4ZIRB 3OX4A 1RC0A 4RLHA 3H8JA 1VRVA 1WHSA 5A5VA 2Z6VA 2R7LA 4JAVC 3SHOA 5A5GA 1UFQA 1UT6A 1OVGA 5I7VA 1SHLA 3FVWA 3N74A 4IDFA 5FDFA 3IJEB 4NBNA 1AVTA 3OLZA 3TEJA 2XUJA 1W25A 2DRIA 3K6JA 5JSYA 3ZGOA 1DI0A 3SC2A 1Y4UA 4NBKA 1GGVA 3PDJA 1BJKA 5I8ZA 4CFZA 3G8BA 5KC9A 3U6KA 2PM8A 2WVGA 4ZQEA 5K3SA 3B6KA 2ZAGA 3D0RA 3T3OA 1TZ2A 3OQBA 1BHQ1 1DARA 1Z75A 2QTZA 1D2EA 1FUEA 3A9SA 4U8GA 2QOEA 4LOJA 4N5NA 1TK3A 3WDSA 3EBOA 5CT5A 1FDSA 4AM8A 3PNVA 4HNHA 4H1VA 4CKCB 1SRQA 4HKTA 3KALA 5FF9A 3U1TA 2X5JO 3QKRA 3EOAI 1K06A 1X3LA 4KIGA 1M8JA 2RBEA 1E89A 3VR5D 5ICFA 3UIEA 3FUCA 3HKCB 3M6UA 3TG2A 3W3AH 4L8WB 3IUQA 3CQ9A 2V55B 4J0IA 1BHO1 4JLUA 2UZAA 1TEHA 5B4VA 1E58A 3BHJA 3MIZA 2HRDA 3ADCA 4CIBA 4LDPA 2QU7A 3I9FA 4WGFA 4JJZA 1KRXA 2I4IA 3BE8A 2ENWA 2QORA 3MT7A 3QJ5A 2W70A 1SBHA 4YCSA 4E1BA 5HIAA 1JKJA 4V03A 4R2XA 3PGVA 3S2FA 5J58A 3EPLA 1V6AA 1ZW6A 3WRYA 4GECA 1HNXB 1HTBA 4PGHA 5TF0A 5JT1A 1WHTB 4YT5A 3WRYC 2PR7A 1EFVA 5L6MB 1MG5A 4G8BA 4L6CA 1PF7E 3GGSA 1RAEA 5TMDA 1H2EA 3DXZA 1LPNA 4FFRA 1P0FA 1PV1A 2E87A 3CF6R 3HV2A 1SXJA 3ZZ1A 4CEJB 1V2HE 2DWCA 3WK4A 4LF7B 3BK7A 2W6ZA 3FUVA 2O8CA 1SXJC 4ZT5A 4DRXA 1P61B 4GW3A 2F3UA 3UH0A 3I61A 2REXB 1BFUA 2BPOA 4JGGA 3V2IA 3E9DA 4QT0A 1YMQA 4WL0A 5ENZA 3A6GA 3O4RA 1PDOA 1ZGCA 2IZ5A 1QDUA 1MEJA 2PT6A 3ICPA 4YDRA 1Z5UA 3IVGA 1CLUA 3P4YA 1UMDB 4Q05A 5T4FA 3IPYA 1UEJA 4OG2A 4PBRA 1U0SY 4JJGA 3ICVA 3WLKX 4LGCA 1WJGA 4RTLA 1N8KA 4GPZA 1G8FA 5J4VA 3GT0A 1EG7A 4RD1A 4MO2A 4TVOA 1Z4PX 4FBMA 1PR3A 1T35A 1TKBA 1RWVA 1UK7A 2GEBA 2R8EA 5EIOA 3ZQJA 4CT0A 4GPAA 3U4QA 1NKVA 2AQHA 3P9SA 5D85A 1RWMA 1UKYA 1GGJA 2W93A 2ZB4A 5B2ZA 5KOIA 1W7AA 4BCBA 2HI0A 4PZAA 5K05A 4JELA 2GJKA 1F8FA 4K9DA 3VKWA 2MMCA 2PT9A 2HA5A 1N7IA 4PZYA 2B5WA 3A1CA 4QOFA 4BZZA 4MR7B 1AURA 4CKZA 4CMBA 3DDWA 1RZUA 1ZJJA 3O9VA 2JFHA 3E35A 3TUIC 1PGPA 2FPIA 4XGNA 5GAJA 3W3AD 5IF9A 4BO8A 2ZSDA 3EVBA 4MR9B 5BT8A 1BXRB 2GEFA 5FUBA 3F7MA 3N75A 5CCDA 1YVDA 1IQRA 3O2NA 4YJFA 5FRDA 4BCDA 3D6MA 4G0WA 2E5WA 2FEAA 2I3GA 2PU7A 3PB3A 5IX8A 2HNAA 1DAIA 3KZVA 2YOHA 3H13A 5BXQC 4RPGA 1LRJA 2AOXA 1J4AA 3UTDA 3K70D 2PAFA 3BCSA 2A0XA 3LPCA 1LBSA 5FV4A 3AWIA 1R0KA 3H97A 4KQ6A 5BMVA 2NO0A 1G7SA 4ENRA 4HWTA 4X7RA 5ALUA 1R88A 2WD8A 5DSXA 5KIAA 1M2FA 1MAHA 2QAGB 1ZFNA 4U7TB 2NUAB 4YRZA 3RF6A 2AB0A 2JCGA 2PWPA 2DHEA 2JL1A 2DE0X 4U7HA 2O0JA 5LYJF 1Z6QA 1UJ4A 1EJBA 1VE7A 3NBUA 5FYQA 4Q66C 1SCUA 2NV0A 4IHJB 2YICA 3LUGA 2MHCA 1VMKA 3LF2A 5DU2A 2KW5A 3HU2A 1W19A 3FZQA 4DCCA 4PF1A 3N0RA 4X8MA 3ABZA 3TCKA 4BJ1A 5EHZA 1PNOA 2QN3A 2Z5FA 5TMPA 2OBNA 1B0ZA 2ETXA 4Q4AA 4GI7A 3WK9A 1ZL0A 6GPBA 3FNEA 3W6PA 1K89A 1CUYA 1P0QA 3Q4GA 3RGWS 3B51X 3LWDA 3CF0A 3MCTA 4OL0A 5AKZA 3EK2A 2ZRPA 4JJFA 4HQ6A 2DBVO 3IP3A 1Z8HA 2C95A 3L01A 5L3SA 4OD0A 2P1DA 4DMKA 1VMEA 2DECA 4MULA 4WDQA 3WNCA 5FA6A 2FUKA 1ND6A 1CYEA 1JR6A 1QFSA 4Z51A 4E94A 3ZHTA 4TTQA 3CWZA 2YOGA 1MEOA 1PJ3A 3PT9A 4MVJM 4C0HA 3RARA 2QPAA 1Y9ZA 2HREA 2Y1EA 2ZYVX 2AEEA 2POQX 3D6UA 4MV4A 1YQXA 3THYA 1I4LD 3CLRC 3HHEA 3PICA 4PSDA 5KPJA 2OV1A 2Y93A 5HRCA 2BD0A 1MLDA 3E9QA 4LDJA 3M2TA 3NX4A 1EU1A 3GCDA 3W2IA 5EE5B 2A5GA 3RLIA 3UPUA 3IAS1 2RG7A 2GPAA 1JPVA 1P9WA 4F45A 3C3PA 3J7AC 1P7VA 2XLBA 1DRWA 3P4UA 2Q7XA 1Q1NA 3ETHA 2IY7A 4XLTA 4ZT7A 5FL7A 3SOZA 1UBNA 1QVRA 3OEED 4Z7QB 4NE2A 1E96A 1NI4B 3NNDA 3DLPX 1JFRA 1L5WA 1O95C 1BW9B 2D7JA 1DDGA 1TF2A 3DHVA 4NU5A 5ALLA 3NTUA 3OTIA 2AG1A 1JI3A 3SR4A 1NVMB 2HMSA 4HGQA 2ZYTX 1RYEA 1VL1A 2AQ8A 5CJ2A 3MOSA 3M5PA 3CH7A 3LLUA 2OPHA 1FYEA 4OSPA 1JS1X 1UBTS 3EUEA 1OLUB 2CZGA 2C9MA 2PMBA 2I78A 2H6EA 5CFLA 5HBRA 4CDMA 2J3JA 2A5YB 2J9FB 2JIBA 3EZ7A 5LD2B 3P2JA 3KHKA 1Q95A 4TSRA 1LVHA 3VPFA 4PGMA 3W8DA 3FUTA 3I9V1 3VI4B 1RBYA 4KR7A 4LA4A 4PCUA 1H0KA 1EK2A 1ETHA 2CLSA 3DCIA 3NTXA 3B6EA 3JCZA 4I0WB 1AQYA 4II7A 4YO7A 3WNVA 3CEHA 4ARIA 4CEHB 1V3VA 4FT2A 3DNPA 4PLVA 1OH8A 5F7ZA 1KJ9A 4M60A 1RC8A 5E8JA 4URXR 4IIVA 3RTAA 4C2AA 4EG4A 3LOUA 3TYXA 2RB5A 2C2YA 1YR3A 3AHDA 4OLJA 2LXNA 1CFZA 5EHGA 4LSWA 3PQCA 3HCNA 3WJ2A 2VWHA 4YAKA 5A5FA 2PJRA 1TM7E 4RWZA 4EABA 3O21A 5F5XA 3TB6A 1K68A 2C3MA 3AG6A 1QB7A 4AWBA 3ICWA 1AZWA 2KBFA 3HB0A 3PQ7A 2UUAB 3WWYA 5L7YA 2AK3A 1DC7A 3D5QA 2ZAOA 3FCAA 3H9CA 3MFYA 4FUTA 4QUEA 1FW6A 2BH2A 3M5CA 1T3HA 4AQ7A 2IK8A 4MWZA 2PUAA 3A6PC 4NZ9A 3E4CA 2FJUA 4JB8A 1XQWA 3DLBA 3PKZA 1CRLA 1UDWA 3OOWA 4KU4A 2QEQA 1RAIA 3H9BA 4QLOA 3CKYA 5JY1A 3D3WA 1MQSA 3VU3A 3CZPA 4ZI3A 2XODA 4D4HA 2B1JA 4G41A 2X3FA 1IQPA 2FE1A 3HYTA 2Y1CA 3I04M 3ASVA 2FPKA 5CD9A 5KO2A 4B4VA 4AN1A 2WU4A 4JBYA 2QT0A 3RAGA 4M1SA 5JS7A 1RJDA 2COUA 1NJGA 2QMYA 1A95A 1KMIY 4A1FA 2AXPA 4YRBA 2AYXA 2L19A 4FC6A 4DJAA 2VJKA 4YHBA 2ZR7A 3B9PA 4JEMA 3EMVA 1CD5A 3DEZA 3TZCA 2XI4A 4BUZA 4D92A 4AI6A 1HL3A 4TUYA 3AR6A 5K99A 2GM3A 4OL9A 5TT0A 3ZS9A 3F2IA 5KKAA 1OI3A 1UIRA 3HH8A 4RVCA 1GLGA 4P3OA 1VLVA 16PKA 1BJRE 1U0RA 4M3NA 5ESXA 5IT5A 2Q5LA 3ZJ4A 2JVKA 2V0NA 4D9MA 1F2TA 5EIEA 4B6SA 1JX6A 1IIRA 4ETIA 3OU2A 4JODA 3RASA 1GQSA 3KR9A 3D2BA 1QWSA 3SQMA 3PZBA 4FKBA 2DGDA 5ALJA 4ARCA 4TROA 4UHEA 3IJRA 4OUDB 4KN9S 5AKLA 2E4WA 5FQNA 5AKKA 2WIJA 4G0PA 4ZOCA 5D5PA 5LZ8A 4LZPA 3I52A 2EZ4A 4GYKA 2G8NA 3AZPA 1HI9A 2AOUB 2L42A 3EGDA 2IC5A 4UMVA 2BV3A 2AJLI 2IPXA 2O0LA 5IAKA 1R7RA 3ZNNA 5B6IA 2A9FA 5F5NA 2HUNA 4QEDA 2I6UA 1PFQA 5G1OA 3VV2A 3BC1A 5G0WA 4QGGA 3HY6A 5EC8A 4GC9A 2EW2A 1WLYA 2H2AA 3FGZA 1TD1A 3TNYA 4WBNA 1CQZA 1FPMA 5KWJA 3W6NA 6AT1A 1YMUA 2XADA 1AQLA 3VU1A 5HW0A 5DX1A 1WUIS 3LLVA 2IA5A 3LVRE 1E5QA 1S4QA 3D4LA 3TDNA 3AUFA 3H84A 1UKAA 1L4BA 4GQAA 2J6IA 2XRYA 4TKVA 1CJCA 3JALA 2YMQA 1BQ4A 4ATNA 4OJTA 4KQHA 4B8ZA 3OZRA 3EUWA 2E89A 5BOVA 1X9IA 3VKGA 4XUCA 4ZC1A 4LYGA 5DN6A 1ZJZA 3ZXIA 1XJWA 1JYSA 2GESA 4RH0A 3UKJA 2PKQP 4LOLA 2RKBA 3OC6A 4BKMA 1JJ7A 2WNIA 4C1NA 4WVLA 1EFPA 3GFSA 4AMYA 2MMGA 3DMPA 3HWSA 4D44A 3R5SA 3SYMA 5BV1A 4FJ1A 3VTAA 4JJKA 4UM7A 2O8BA 1ZD5A 2MSEB 3A6DA 3DJYA 4ROTA 1THZA 3FPEA 3JQAA 4DTIA 1A4UA 1FVXA 1DIAA 4OX9B 2P9ZA 4R8VA 2WWXA 1FDIA 4DCJA 5C8YB 3Q8MA 3DE6X 2X8BA 1NXXA 5CYFA 3TAHA 1LF5A 5SZIA 4HLNA 5KUTA 3RS0A 3V97A 2YXDA 4AXBA 3WVNA 2VQDA 3B5JA 1P0IA 2IE0A 3KLNA 1MUUA 4R1LA 2AZ4A 2HU2A 2ZPTX 1QHGA 3I9KA 3H0KA 4G5OA 4PNEA 5BSFA 3FYDA 3QKSA 4IF4A 5BN3A 1JG2A 3DBLA 4QO7A 5IJXA 1ZG3A 1F2UA 2HY7A 1EQ2A 2P65A 1PJTA 2HMWA 1AZTA 2HIAA 1JLRA 1F0NA 1ZM2A 2XUPA 4FYVA 5EXTA 4D9HA 3INTA 5EZ6B 2X13A 2I03A 4PLFA 1AHHA 4M1WA 1GLVA 1IDOA 1O2DA 2C94A 4GO1A 3I1YA 5F21A 3DPSA 4F5WA 1R0BA 3BXOA 3MGAA 4UREA 4ZZ1A 1S89A 3U7GA 3M4ZA 1SKUA 2C04A 1G20B 4N9QA 1VXOA 2ODBA 4YCAA 1FF9A 2E6UX 1GGKA 1N8TA 1ZGZA 2C2BA 4FWIB 4HL6A 1KFKB 1UPCA 4K9PA 4XWTA 5ALSA 3SHWA 5KCZA 4DQ0A 2YV3A 4H35A 2ZUTA 3JVEA 3HFJA 4CUKA 3BIWA 4PGGA 1FS4A 3TQFA 2A9KA 2F2TA 3FPGA 4WLUA 1I4DD 1SOAA 1E5VA 2H0QA 3S3TA 1P62B 2XQKA 1UDCA 1ZVMA 3FI0A 1FVHA 2J5XA 4EW2A 1G55A 4M86A 5E4JA 3QVUA 2NU9B 5T57A 2I22A 2BCGY 4ZHQA 4FHEA 3P9KA 2H57A 3DE1X 1TW3A 1MOZA 4J3FA 1RD4A 1NE7A 2CKMA 2GAIA 3WKCA 2HA6A 3I0ZA 4Q9IA 1KTIA 2XH8A 1JHPA 3PNOA 4FOTA 5JMOA 3IDSA 1Q91A 1YBHA 2JGFA 4MCAA 1K2WA 2WIAA 4TSFD 4PLCA 4RJKA 2XCLA 3DR3A 4W82A 3AFNA 2DULA 2JH8A 2MU1A 3OE7D 3Q41A 4MQEA 5JCOA 2BEJA 3RQSA 1JKMA 4CTNA 2PS0A 5HKKD 1LDNA 5JCOC 1YB6A 4DGSA 5KQRA 1KEEA 2ZB2A 4OQPA 4LZWA 3HNOA 2DBZA 3O9ZA 3VBCA 4A0QA 3PD0A 5CX1A 1FL9A 1PHRA 2I6TA 4KPGA 2UYYA 4DQXA 2YWGA 1OMOA 5JY6A 3UC9A 1T4DA 3KQPA 1QOQB 1T5LA 3OZIA 4MUFA 4WKGA 1ULAA 3AR2A 3EXEB 3WBFA 4U8HA 1BVYF 5CYPA 1KETA 4D8VA 3C5EA 1ZOPA 4UDOA 4BBJA 4EBBA 1HMPA 2I1LA 3CVOA 3GEIA 1B73A 4LXQA 3U9LA 1CS0A 4JHXA 4ER7A 3LAWA 3EXIB 4EECA 1DWQA 4LJ5A 4I81A 4X00A 4PN3A 4IFIA 1E1QD 3IVAA 4BC1A 1JQ3A 3CKMA 1RRGA 2R00C 1C8BA 3PQ5A 3GUCA 4G37A 5BN4B 1KDZA 5L3QB 4KPUA 4OQFA 1QLJA 3K0BA 4RK5A 1FPQA 3VPCA 4D9FA 1KOFA 5TGDA 1IG0A 2GZDA 1T3LA 2ZS9A 1YZTA 2JJMA 2F6RA 3IPLA 1PR5A 1W581 2RGGA 1XRRA 2DZDA 4HAYA 2G17A 2JHPA 1T4CB 3KUKA 1L5SA 1QRUA 2YQZA 4DSTA 4D4MA 2CNNA 1QKIA 1N5IA 1D2GA 4KSBA 4V1CA 2D7CA 2V59A 2HO4A 1DBPA 3PE3A 1XKLA 4U6SA 3L0SA 4ZKDA 5KTNA 1RI1A 5JJCA 1GNLA 1XU4A 2AR9A 4UBOA 1ECCA 2OORA 4DXAA 6NULA 1DSSG 1X1QA 1NOJA 3HJBA 2OORC 3OJWA 2QZSA 1BYIA 1E6CA 2D1FA 3LU1A 1P17A 3QHAA 4LHVA 3PC8A 4A6DA 4UTRA 4JKYA 3G9ZA 2IUFA 2XHZA 2OA0A 2F00A 3FFAA 2NZXA 4BTEA 2X40A 3DL4A 1Z18A 2VDVE 3HSKA 4WD3A 4DLZA 1ZZEA 1E2PA 4S1PA 2RAPA 5F2NA 3DTVB 1JAYA 1GA1A 2IL1A 3GVCA 3LM8A 4F71A 2ZZMA 1NSYA 1EXWA 3TMAA 2I99A 4K28A 4XCVA 3FKJA 4M0EA 3RYHA 2Z83A 4KB5A 3SU8A 1T5BA 2VZEA 3ECSA 3P32A 1AMUA 4BL5A 5JMWA 1K88A 3UATA 1WQ3A 2XCIA 2P0EA 3QYFA 1ECBA 2VP9A 4S1VA 3THWA 3K1ZA 3L6DA 4ESVA 2PNJA 2QMOA 3IE0A 1FSZA 2XGGA 4GOMD 3D2CA 3G7UA 1G5TA 4HOYA 2AI1A 1R6AA 5AHOA 5F64A 1EGMB 4BFUA 5JTUA 1BROA 4TXNA 4O25A 5TQ0A 2FR8A 3HA3A 1RIIA 5NLLA 2R47A 4WACA 5JSQA 2FR8C 1W2HA 3DBHB 3IULA 4WKCA 5EHIA 4ZA2A 3RWBA 3U7JA 4LOIA 4ND4A 1QYRA 5BV2P 3UAYA 1Z39A 2IWHA 3A4LA 1FS6A 2YY5A 4YCBA 5EIWA 1KO7A 2I4OA 3GUYA 2QSYA 1GU0A 3HZZA 1UMBA 3K8YA 4X1IA 3JQRA 5EKXA 3F73A 2GMWA 1ZK0A 3A9VA 2MSLA 3D4PA 4JD5A 1QU3A 1O6ZA 2HQSA 3U09A 1B6GA 2BBWA 2XBUA 3BJZA 1QBGA 5I7FA 4KQCA 3QV2A 3UAVA 1NULA 1NKSA 4MQ5A 1V39A 5JAMA 1NMQA 1PVOA 1UQUA 1XNHA 1ODKA 1RHQA 3PFFA 4O2AF 1NNEA 5BSWA 3DOHA 3CLKA 3NEYA 3WC4A 3BCUA 2WVHA 1NIPA 2I4NA 2BYTA 4X92A 2WYUA 2I3DA 1RADA 2HUPA 1NVXQ 3CLVA 4Q1DA 4B9EA 4MH0R 3DEKA 4EATA 2HJ9A 3B1XA 3PG5A 4IQFA 3E6AA 1XI2A 2IHJA 3AB7A 1JG4A 2B21A 1NBMA 2VCHA 2Y0CA 1Y0BA 2CMGA 3BD8A 3JQ8B 4KXQA 2B0CA 3KX2A 5DB4A 1EFRA 4Y2VA 2WHYA 2ZSKA 1FJ2A 3HU1A 5JPDA 2ZJ3A 3EUFA 4I4NA 4DIBA 2P6UA 1FMCA 1V1MA 1KARA 1XVIA 1YBMA 1ZD4A