5BW8A

2.8 a crystal structure of a get3-get4-get5 intermediate complex from s.cerevisiae
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
349
structure length
320
Chain Sequence
b'TVEPNLHSLITSTTHKWIFVGGKGGVGKTTSSCSIAIQMALSQPNKQFLLISTDPAHNLSDAFGEKFGKDARKVTGMNNLSCMEIDPSAALKDMADLTGSIPGIDEALSFMEVMKHIKRQEQGEGETFDTVIFDTAPTGHTLRFLQLPNTLSKLLEKFGEITNKLGPMLNSFMGAGNVDISGKLNELKANVETIRQQFTDPDLTTFVCVCISEFLSLYETERLIQELISYDMDVNSIIVNQLLFAENDQEHNCKRCQARWKMQKKYLDQIDELYEDFHVVKMPLCAGEIRGLNNLTKFSQFLNKEYNPITDGKVIYELED'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATPase GET3
publication title Mechanism of Assembly of a Substrate Transfer Complex during Tail-anchored Protein Targeting.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain rm11-1a)
molecule tags Hydrolase/transport
total genus 110
structure length 320
sequence length 349
chains with identical sequence B
ec nomenclature ec 3.6.-.-:
pdb deposition date 2015-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02374 ArsA_ATPase Anion-transporting ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5bw8A00
2MSCB 1ANKA 4RFVA 4DLSA 1OW3B 2FEOA 2ZJYA 4Q48A 3IO3A 4WXRA 1BOFA 4B3BA 1JI0A 1M74A 3RS5A 4JLPA 3R8FA 4V02A 1XJ0A 1R7RA 2ZYUX 3PUXA 5AJWA 4DC9A 2GRJA 2PX0A 2XTMA 2ZJ8A 4QGAA 2GNOA 2VYFA 2JIZA 3RRZA 3QE0A 2O8FB 1JPJA 3T5GA 1FPMA 3R8CA 1HTWA 1M6NA 1P73A 4L4UA 1G5TA 1OT3A 5FBWB 1AS3A 2P5SA 1E9DA 1Q44A 2NGRA 1XD2A 4NTZA 2IF2A 3GLGA 1ZM2A 4TMTA 5GJCA 4I81A 4JBWA 4MGZR 3HR7A 4PC1A 4N0EA 3IO5A 4RCZA 1RRPA 1PV4A 1S2MA 2QRZA 3GEIA 2OBNA 2HUPA 2NG1A 2O8EB 2ZTSA 1SVLA 2QUZA 1DOAA 3AVTA 2UVQA 1GIAA 1WE2A 2XX3A 4ZDKA 2ZE7A 4P33A 4LYFA 2H92A 3H4MA 1XPOA 1ZUIA 3FMOB 4YONB 3T15A 3K0FB 1E2IA 1HV8A 1N5LA 2IT1A 3FKQA 1LY1A 4UJ5A 1S3GA 1OXXK 2ZE5A 4M9XA 4FD2A 4CEHB 3M1IA 4LYHA 4NCIA 4WW0A 3J81k 2MMGA 4Q19A 5JZVA 3LXRA 1JXMA 4JLDA 4L5BA 3IIJA 3CO5A 2X2FA 4V03A 4XSHA 5KSPA 4QGFA 4HUTA 2J46A 4QG7A 2YWHA 1SVOA 4C7OB 3EZ2A 1GITA 2NO6A 3M4YA 4TWZA 5E95A 3NH6A 4DSOA 1E1QD 2GF0A 2QGZA 5ANRB 2GBLA 2IUUA 3U6KA 2QROA 1F2UB 3SOPA 2WVJA 2WOJA 2JDIA 1ETUA 2AD5A 3KJEA 3FMPB 1FW6A 3L43A 4FWIB 3ZVLA 4A2PA 1ZAKA 2GXAA 1ESNA 3P20A 4FMDB 4US1R 2E9SA 3LBNA 1FTNA 1GG2A 3U60B 1KI8A 4XTCS 1HY3A 3I1FA 2RHDA 3LNCA 1OLOA 3QVUA 1CS4C 3X1ZA 1E99A 1MR3F 3AVQA 1RKBA 2XNSA 1SVKA 3I3SR 421PA 1UKVY 1XMSA 5DHAA 5AR1A 1W4AA 1FX0A 2GCPA 3BK7A 3N2IA 3P4XA 2FSFA 3IIMA 1PUIA 2W6JD 2DB3A 2HXSA 3G5UA 3IGFA 3EIEA 3SHWA 1W47A 1GFIA 1YHNA 1SHZA 2ZQ5A 2RAPA 2AKAB 2X1VA 5CM8B 1US8B 2EFEB 3ZQ6A 3FFAA 3GLHE 2WSMA 3DEFA 4FXPA 2F3RA 4P4TA 4Q1AA 4EJSB 3GJ4A 3KQNA 1KAGA 3EPLA 1PVOA 1ZNYA 4LJ7A 2IX3A 4ABYA 2QSZA 2F9MA 1KMHA 3KQHA 5ELXA 1BKDR 1J70A 2OSBA 3SYNA 2TMKA 1N6RA 5EE5B 4GZMA 3B9QA 3IEUA 3QKUA 4CT4B 1YE8A 3QPVA 1EFRD 1NLYA 4A2WA 1CRPA 4HEJA 3VTKA 4KITB 1MRNA 1IY0A 1KK2A 5HE9A 3EC2A 2B92A 1EFHA 5JWRA 2FGKA 1E32A 4DWJA 5GADl 2B6HA 2KBFA 3NBYC 1XMVA 5J5CA 2PJZA 3F8TA 2ZRNA 3QI2A 1D2EA 3R9IA 2FPMA 3TW8B 1ZP6A 4V0OA 2DFLA 3QPWA 2EWVA 1XBTA 4GOKA 1CIPA 5HPYB 4IVRA 3NG1A 3KKNA 1RC8A 1ZCBA 2PX3A 3LVRE 5JJIA 2ZSDA 3SEAA 2YVUA 1RRFA 4DSNA 1T91A 4PZZA 1L4UA 4U00A 2ZITA 1YZNA 3K0AA 4FINA 3ADCA 2ORVA 3CRVA 3EA5A 1NLZA 2ERXA 2IXFA 3QXCA 1E98A 1JB1A 4JSTA 1W0KD 2GJSA 3LO5A 5KO2A 2C98A 3ZVNA 2C2HA 3IKJA 4RKEA 2QMUA 4B32A 2VP9A 1E79D 5D3QA 3IDQA 2MSEB 1Z28A 2ZEJA 3PUYA 1R0WA 2IK8A 2ODWA 3TE6A 5KNDA 3K0CA 1G21E 3RC8A 1UBGA 4PO8A 1JPNA 3EWAA 1EXMA 1NF3A 2ZRJA 1EX7A 4K8OA 3RVBA 5B64A 3EX7C 3KUDA 3KL4A 1P75A 4C0HA 1JXOA 5J47A 2NPFA 2ZR0A 4EFNA 3A1TA 2F43A 2ORWA 2ZRPA 4YDHB 1Q21A 4LJ9A 2P5TB 1XXHB 4IOLA 1H8HD 5FUXA 4B33A 3GLIA 4NH0A 4IXNA 2FEMA 3IBGA 1YZTA 2AXPA 3SJBA 4LC0A 2DR3A 2YHSA 1XMJA 3B13B 3D8BA 1XD8A 1NVXQ 3RNLA 4ITRC 5L3RA 1S3SA 4GBMA 2GWHA 1Z2AA 2VBCA 2W6ID 2WHXA 2FU5C 2Z4RA 3GCGA 1E1QA 3FMFA 3IHWA 3L0OA 1N0WA 4ACAA 3UANA 1CLUA 1Q1ZA 2XNDD 3KKOA 1KK3A 4BLQA 1OXTA 4TQ9A 1U81A 4TMXA 4ZDIA 2QP9X 1KZGB 2BC9A 2QMHA 1Z06A 1WF3A 3TJZA 1KNXA 3L2OB 3CZPA 1T3LA 2D06A 1ZNWA 1P2UA 2CXXA 3B1WA 3T1OA 4B6FA 1KDTA 2BCGY 1G8YA 2AD1A 1BS1A 2AWNA 1KGDA 2OUKA 3CPEA 4G1UC 4KFTA 2ZJOA 4HI0E 3W5JA 4JZKA 4D82A 4HAYA 4EPXA 5TVKA 1XD2B 3C15C 3CX6A 4X8LA 5TXGA 4URVR 2QN6A 2O8CA 3GLGB 2QTFA 4MRVA 1O87A 3ECCA 1KKMA 3BH7A 2IC5A 2MSDB 3ZDQA 1HEIA 1GKUB 4CYMA 2ZUCA 5GVRA 1OB2A 5GJWC 2N46A 1X8KA 1EG7A 1KYIA 1GNRA 3SC3A 3WY9A 2O8BA 4PSAA 2C77A 1EFUA 2P3SA 3FYHA 3H2YA 3U2QA 2G0TA 3OAAD 1ZINA 3O8RA 1YJ5A 2GA8A 5EQTA 2Y8EA 1QF9A 4M1TA 4BFYA 2CJWA 2QQEA 2ZJ2A 3GLFA 4V0KA 1ZD1A 2DYKA 1W5TA 4MQBA 1EFRA 2AWOA 1FL9A 2XB4A 4ERNA 1NN1A 3EWSA 3JZAA 4NCHA 1CR1A 3QKSB 2PBRA 4AIIA 4JT4A 1A5TA 4FWTA 4PHHA 4NCJA 5KNBA 1YZKA 2OBMA 2Z0MA 4Z54A 3QXSA 3QVVA 3T1VA 2YJTD 1K6MA 1HT2E 3TQCA 4PAOA 1WDTA 5L3VA 3L0IB 5BYJA 3OESA 4O0MA 2QE7A 1KSGA 4C9BA 4LHVA 2BEKA 1T3SA 2XOKD 2ZRKA 1OYWA 4XD7D 2RGXA 1N6HA 1XNJA 4PANA 5CB8A 4Q4JA 3NH9A 4JVNA 4LHYA 2WJIA 3U3JA 3MCAA 1FMJA 4DEYA 4C3ZA 4R7ZA 4DVGA 1M34E 1M7BA 1RVDA 3QQ5A 3T61A 3ADKA 2NMVA 1W0KA 4NBSA 1CXZA 2WZQA 3TLXA 5HE8A 3N5CA 4OI0A 4RZ2A 5KSZA 4D2IA 1E79A 4KSCA 1Z0JA 1UJ2A 4O2LA 3HPRA 2ZSAA 4M9SA 1IXZA 2HF8A 1E2MA 3FFBA 5FTJA 3HWSA 3KKQA 3VKWA 5G41A 4C0JA 4RD1A 2VO1A 1W46A 3A1VA 3BBPA 3C5HA 2EYUA 2XJ9A 4HLCA 4B2IA 1CR2A 4DT1A 4FMDF 4R98A 3T1TA 2Q3FA 2VEDA 1VCNA 4K81B 1FUKA 1N2CE 2A78A 1AIPA 3AVPA 4US0R 1KMHB 1Z83A 4JL8A 2X8AA 4Z1MD 4POAA 1H8HA 2WWHA 4N0DA 1TU4A 3UPUA 4KVAA 1N6KA 4DCNA 3QSYA 2FOLA 4QBHA 3ETLA 1N5KA 4QJ4A 4QL3A 4Y0VA 3RC3A 3VNUA 1IONA 1YZUA 3EXAA 2W6IA 3OF5A 1LS6A 4J0QA 4DZZA 1WXQA 2P6UA 1KI4A 4F91B 1RIFA 3LRPA 1NMZA 4W5WA 4MUBA 4HUQB 3EIHA 1J8YF 4LK2A 4HB4A 2CCKA 2JJ1D 4D4LA 3RANA 1XCPA 1FNNA 3TQFA 2PEZA 2A3RA 1ZC4A 4DXAA 3TH5A 2J41A 2KWIA 3K0AB 1S96A 2Z83A 4Q21A 1ZM7A 2JA1A 4PSVA 5KUTA 2LCFA 1BYUA 2ZS9A 1A82A 2ZE6A 3WRXC 5J4KA 5FUYA 2EFGA 2V55B 3AKDA 3ZZUA 1GVNB 4TT3A 1HQYE 3MAAC 1VMAA 3U6BA 3RRYA 3VR3A 1Z0AA 1J2JA 5HTKA 1CTQA 2JLYA 5HCNA 4LJYA 3D6TB 3NEJA 1T0HB 3AP2A 4AKGA 5E3HA 4LDJA 1XCGB 3BFXA 3BE4A 1N5JA 4QM6A 2A9KA 4DLYA 1SXJC 2F43B 3Q3JB 3UMSA 4TLCA 3O47A 3RSLA 4CEHA 5JHHB 3GLIB 1R0YA 2JLVA 3I72A 4PR0A 4RD0A 1W36C 4MRPA 1JEDA 5C4GB 1KI1A 1Q20A 3L0SA 5HCIA 4M0LA 3SHFA 1N5IA 1YR8A 4Q1DA 3TUJC 4PO1A 2VH5R 4W5JA 4NZYA 5CM9C 2XXAB 4Q9IA 4PPNA 5KNCA 3I5XA 1W44A 5J4LA 1OF1A 3V4RA 1IXRC 3QBVA 1MH1A 4OI4A 1NLFA 2QT0A 3F3YA 3FDIA 5SZHB 2CCGA 5DNYB 1J99A 4YMVA 3E2IA 1AA9A 1W0JD 2XOKA 1T8UA 3M6AA 4XD7A 3CBQA 4FW9A 1T5LA 1KI9A 1NJGA 1G5PA 1B23P 2WSSA 4Z51A 1OV4A 4PSKA 1W4BA 3HP1A 2G83A 3WRYC 1KMQA 4DLUA 3P4YA 3MWLA 3REGA 5B30A 4AYWA 3ZVRA 4EPTA 4LBZA 1W48A 5CITA 2VHJA 4JLVA 4BPBA 4AK9A 3NEYA 4BECA 1Z6TA 3FHTA 2F1RA 3TUIC 1DADA 5GJVC 2HCJB 1DAFA 5AJZA 2JAQA 3GJXC 5FPSA 2W83A 4FI3C 5BQ5A 2AHOA 2O8CB 4BASA 1R4AA 3NBXX 1P6XA 4KXFB 2BCJQ 2WKPA 1XTSA 3PQCA 4N1AA 5EP1A 2H57A 4D6PA 4RVCA 2OHFA 3P26A 3X1WA 4PO9A 4RZUA 3Q9LA 5D3MA 2I1QA 1R8SA 2ZUBA 1Z8FA 1UDWA 3AF4A 4LYJA 2D2EA 3U7GA 4NYMQ 4DLVA 2B8TA 4HAVA 3N2EA 2C99A 3BB4A 4M1SA 3AUXA 3KUCA 3HJNA 4OQMA 2CMKA 5DISB 2WAXA 5LB4A 1S9HA 4Z1MA 3VKHA 1DAKA 1G7TA 1KO8A 2CJWB 3A4LA 4AI6A 2D7CA 3UIEA 2OLKA 4TL8A 1VYUA 4HAUA 3SBDA 1A7JA 4OK3A 1A2KC 3MJRA 2FFBA 5E7MA 3B9PA 1P9NA 4P4SA 2DBYA 4BRUA 3ZJYA 2O5VA 1N0VC 4LWZA 4EQ6A 2K5UA 4E07A 1VYTA 3I73A 5FOWA 2O0KA 3CF6R 3WNDA 1AJEA 1KI3A 1Z5ZA 3U7EB 4D0LB 1UBEA 4QBIA 5LD2B 2R6GA 4ON9A 3MJHA 4QJ5A 3SJAA 2W0SA 3B78A 3AKCA 4TQAA 1I2MA 2E1RA 3BOSA 1Q1BA 3K70B 2QAGA 3HU3A 4TN1A 3AGPA 4IDPA 2GXUA 2JJ1A 2H8KA 2J1LA 4A0RA 1G4AE 3BB3A 1TQ6A 2FPKA 4Q4JB 2IA5A 3EASA 3BFVA 1QVAA 1YQTA 1XEWY 3ZLJA 3WMFA 2QP3A 3RDPA 4N3NA 5HR5A 2IW3A 3LDAA 2OM2A 3DM9B 3VHXA 5IT5A 2IYXA 4BZQA 3PFIA 3E5HA 2EWWA 3BIFA 4XVRA 4JVSB 1E4VA 1SKYB 4LJAA 5JRZA 1G3UA 3BORA 4PZLA 4ZKDA 1XPUA 2YNMA 2BJWA 5M04A 2G6BA 4EKDA 2ZJBA 2ORIA 3RS3A 2GZDA 1Q3TA 2OFWA 2ZRFA 5E7IA 3TMKA 1ONBA 1G16A 621PA 1LV7A 1F5NA 1E0SA 1KIMA 2AR7A 2XITA 3BGWA 1EGAA 3A58B 1TUIA 4KI0A 3AQ4A 3RLFA 2O52A 4OK6A 1M7HA 3LX5A 4A8JC 2IS1A 5G3YA 3ICEA 4M1WA 1VG9B 2QT1A 3NIBA 2CE7A 1OXVA 2NQ2C 4Q7MB 4AKHA 4O25A 1NVVR 2H18A 2OG2A 2GCNA 4I1SA 2ZPTX 3WBKA 4XWKA 1Z3IX 1P9RA 1HQCA 2H7VA 2RHMA 3WNCA 1XEXA 4IOKA 4R9UC 4EPYA 1IM2A 2WPDA 1WRBA 1X8JA 4DUGD 4LHWA 1XTJA 4GMXA 5J4YA 4RCYA 2FDCA 3EAQA 2IUSA 4CZ2A 3FOZA 4C0QC 2FH5B 1GRNA 1IXSB 2IYTA 4RD6A 4URYR 2C9OA 4R2IA 2GHIA 5DIFA 4C0KA 3O8BA 4LYAA 4B3DA 4MRSA 4URXR 2WJVA 1RPZA 4V0LA 5CK5A 4A0FA 1IQPA 4KO8A 3RABA 4AURA 4KYUA 2JASA 2ZJZA 1ZD9A 2WAYA 3PEUA 1W0JA 3MMPA 5EZ5A 3FVQA 4Q00A 3AVXA 2JLWA 1S4QA 4OHZA 2QPTA 5EP4A 1LB1B 5KPDA 3UMFA 3I4LA 2IYZA 2MMCA 2C9CA 5IK2A 1KK1A 1P3JA 1ZUHA 4YDSA 4WOPA 4QGHA 1VYVA 4QHSA 2BM1A 1E0JA 4TZ0A 4KHZA 1GRQA 5F9FA 2R6FA 4OBEA 2CCJA 2Q0HA 3KB1A 2IS2A 3WMEA 4A0GA 5JBQA 4QOSA 1H8EA 1NY6A 4E09A 2ODNA 4L16A 1E2NA 3K09A 1PUJA 1AM4D 4CEIA 3CPJB 4GL2A 3CW2A 2PMKA 3ND8A 2CK3D 5IDVA 4HZUA 4DHEA 5K8TA 1F60A 1TL7C 1GM5A 4B73A 3DOFA 4A82A 5LB2A 1SXJE 1IBRA 1KTVA 4KODA 4DCVA 1VDZA 1OSNA 4HLUA 2P6RA 3REFA 4P0TA 3ZZ0A 2J59A 3ZZTA 4JIMA 1XWIA 1PLKA 4A0HA 3QKSA 5L3QA 3UG7A 4YXWA 1CKEA 3OE7D 2HT6A 4HLQB 2QRNA 4G5GA 4Q7LA 1Y3AA 1TEVA 2IEZA 3BERA 3VMFA 2FFQA 3BFKA 1XTRA 1U9IA 2G3YA 2BWJA 1AS0A 3ZD6A 5CIWA 2I1VB 2GESA 4H1UA 1VG1A 4GP6A 1Z6YA 3HPQA 4OHWA 4IHQA 5C2JB 1P62B 2IYQA 2G77B 2VRWA 3OIUA 1QZXA 1KDRA 3UATA 4I4LA 3TAHA 2IYLD 1LNZA 4CEJA 5KSYA 3I8SA 4NDZA 4JVMA 1OFUX 3PEYA 1XJQA 2XB2A 1OH6A 1Z0DA 4NU0A 3D31A 2GF9A 5FH9A 2FSHA 5JJKA 2WICA 4GT1A 2OV2A 5SZKB 1Q1QA 2QORA 1Z0KA 5EE1A 1OIVA 2CDNA 1NKSA 4MA4A 4PTLA 3W3ZB 3ASYA 2BV3A 1EFCA 4C0AC 4EFLA 3RS4A 4PC7A 2ZE8A 4P3YA 5JCZA 1MV5A 5H8WA 3C5CA 3K0EA 5TB5A 5TDHA 2H16A 1Q1EA 4LC1A 1E1RD 3A8TA 2Q9BA 3BXZA 4HAXA 2XTZA 1EFTA 5D3MB 4B3CA 5DSZA 4KFSA 5CLLA 4F93B 1JQLB 2W2TA 2ZRMA 4QNRA 4HZIA 1WMSA 1EX6A 2BDTA 2FFHA 2ERYA 1XP8A 2WKRA 4BLOA 2OBLA 1QHYA 2RH5A 2ZXUA 2FZLA 3GFTA 2YYZA 4W7SA 2C04A 1GRRA 3MUFA 1JQJC 4Y0AA 4G5SA 1OPXA 1E0AA 2H1LA 2HJVA 3UG6A 2FV8A 1XU4A 4DUGA 2CHQA 2CNWD 2YOHA 4P4SB 1PZNA 2G0NA 3ZH9B 1X86B 2VF7A 1L2TA 4EQ6B 4G3XA 3K0SA 1X8LA 4PZYA 3SN6A 2A5JA 2IYSA 1VHLA 3CLVA 2IHYA 2QE7D 3A1UA 1F3OA 2V9PA 3W34A 2PMDA 3PUVA 1E9SA 3BJIC 3K8YA 3K70D 1CR4A 1NJFA 3OIVA 4HUQA 4A4DA 2F7SA 1YVDA 1TF5A 2J0QA 2WKQA 1RW4A 2QAGB 3CH5A 3OEHA 4FMBB 4NPHA 4IEEA 5CDFE 3RS0A 4FN5A 5FI0B 1ESMA 3MWKA 4IDNA 1FTSA 4OQLA 4C2UA 2VSFA 2IEYA 2J0VA 5HZHA 3GJ7A 4HB2A 2V8OA 4D26A 4TL9A 1AQUA 3DMDA 3GEEA 1NIPA 4LPSA 4UQOA 1WA5A 1IY2A 1OIXA 1CP2A 2REXB 4NYIQ 3KJHA 721PA 3I5YA 2HT1A 3CX8A 4TMZA 5J4VA 5JI2E 4JLJA 5BYKA 2QSYA 3X1YA 3KQUA 2WJYA 3AH8A 1JR3E 1UPTA 1E69A 3VX3A 3SYLA 1DG1G 2CK3A 1Z6GA 3IPXA 3I8XA 3AV0B 3OHMA 5TV2A 3UKDA 4B2LA 4D0NA 3MG9A 3B85A 4RD2A 3EG5A 4G01B 3F0TA 4FCVA 3VAAA 1ZJ6A 1GKIA 2PLRA 2D7DA 4NL4H 3VR6A 4X8OA 2VP5A 1T8TA 1N25A 2C03A 4BFZA 1BO6A 3KKPA 1CJTC 2WIBA 2BMFA 4DLWA 1XEXB 4TTQA 4GFDA 3KDSE 1NN5A 3OIYA 3WYGA 1NRJB 3LAWA 3OE7A 4JLMA 2QM8A 2ZAMA 2XXAA 3AVWA 3LA6A 4MKFA 2V6IA 4OHYA 4YMWA 1J7KA 1E9AA 1S0UA 3T34A 2XZLA 3QF7A 2FSGA 2ZETA 4Q9HA 4DDWA 2QPAA 3HYTA 1FQJA 1GL7A 2FZ4A 2P67A 3CWQA 4L9SA 5EE0A 3P1JA 2NO0A 1MO5A 4D80A 1TADA 1ZIPA 4CW7A 4AG6A 3TSZA 2O0HA 3C41J 4TMKA 3TSWA 2KJQA 3SYKA 1P72A 2EU8A 4F4JA 1RYFA 3FE2A 3I32A 2F1HA 2V1UA 2JGNA 3Q5EA 5FR1A 4Q4LA 3VHLB 1JBKA 5B58C 3O8CA 1GZSA 2OAP1 2ATVA 4Q7JB 4QXAA 1TU3A 4DSTA 1TUEA 4M22A 1TNDA 2VL7A 4Q9KA 4X8MA 3GJ0A 4ASUD 1NKTA 1LVGA 3K9LA 4DB2A 4NP6A 4TQUS 1NVWQ 1D2MA 1E2FA 3THYA 5CLQA 1S1MA 4RD3A 3FB4A 3MLEA 4TT3D 4B3FX 2KI5A 2ECKA 3AVUA 3DDCA 4G5QA 4YQFA 1CR0A 1G18A 2RGNC 1JJ7A 4HLDA 3EPHA 1GSIA 4TMWA 1II9A 5G53C 4CEIB 1G3QA 1QHGA 4LJ8A 2N42A 4BFTA 5TARA 1R2QA 3CNOA 2FWRA 2DFNA 2P65A 2ODEA 1KSHA 5DN6D 1T9HA 2R6CA 4HZUB 1E1RA 2OILA 3VNVA 2J7KA 1V5WA 2P2LA 3TUZC 1NSFA 2BOVA 2ODBA 3PV0A 1GNQA 1CJUC 2ASEA 1LF0A 4ZPXA 2RMKA 2GAAA 4XSGA 4FCWA 4D4JA 3ZS9A 2EYQA 1UEIA 4D4MA 4DEXA 4C2TA 1QVRA 1EWRA 1MO4A 2FX3A 5BN3A 1D9ZA 1D6JA 3Q7QA 5L3QB 1IJEA 1Z07A 3B5JA 1RRGA 2PZFA 2CNWA 4JL6A 3U7HB 1NMYA 1LS1A 1G291 2A30A 1QHHA 3CNLA 2G1JA 2XZPA 4NHOA 4M1OA 1R5NA 5G3ZA 4B2PA 3FHOA 3QEOA 4V0NA 2OAQ1 4UNNA 1G5RA 2ATXA 1VG8A 1E9RA 4BE7B 3RHFA 1YZQA 1KDPA 2OFOA 2WWXA 2WSSD 5KHOC 1NL3A 1U99A 4A36A 3TK1A 1DARA 5K8LA 3KFXA 3UMRA 2ZRGA 4DIEA 2D3WA 1QG2A 4BWYA 2GXQA 3ZIAD 1WB9A 1AZTA 4TYQA 4XIGS 3B2EA 1BIFA 1U8YA 2QMOA 3BRWD 4GPTA 2CHGA 2VA8A 5HKKD 3L0PA 5FFMA 2KSQA 3ZVMA 1E2GA 4CEJB 1Z47A 5K8UA 2QGNA 4L15A 2GJ9A 3VR4A 1KSFX 5EP2A 3TIFA 1Z0FA 4HYYA 3VU9A 4D81A 1UF9A 4JBXA 2PZGA 3GLHA 4EAQA 4C30A 5H1YA 1VTKA 3T1QA 1P5ZB 2GJKA 1R5OA 1M7GA 2IBMA 2JJ2A 1M2OB 5EE9A 3CUEF 1NBME 2VHCA 4PAQA 3WYFA 2A2ZA 5FTKA 2GCOA 3MD0A 1DAMA 2GDJA 1V43A 1SZPA 4M9ZA 4NKRA 4GI7A 2PH1A 4BEBA 4LI0A 4EPVA 2OXRA 4BLPA 1W2GA 4Z8XA 2V7QD 3B7GA 4A6XA 1EWQA 1CJVC 1Z63A 3CX7A 5J4HA 3TW4A 2CVFA 4GOXA 1NG1A 4QNMA 4NYJQ 3NHAA 3P32A 2RKOA 4Q1BA 2GZHA 1QHNA 4LBYA 4A9AA 2HLDD 2ZS8A 1SHKA 1Z6XA 3CONA 3LY5A 5FPKA 5DI3A 4B34A 2R6AA 3BAFA 4Q1EA 2RCNA 3W6PA 1CEEA 3SBEA 3I62A 1NSTA 1G64A 2HEIA 1F6BA 5CDFA 2QY9A 1GNPA 1XPRA 1YR6A 2PEYA 3OZXA 3AKEA 2FN4A 4RSGA 3RYTC 4DBLC 3QY0A 3QNUA 2OLJA 3AKYA 2KB0A 2IS4A 3U3RA 4PQYA 4BLTA 5LPNA 5LDDC 2B21A 3LVQE 4OHVA 2VHTA 5BW8A 4BLRA 3TVDA 4V0ME 1G3RA 4ASUA 5B2ZA 3LW8A 4M53A 2NTYC 1F48A 3QEJA 1B0UA 2FGJA 4M9QA 4JT2A 3CRRA 5A4JA 1EESA 4PPFA 5AUQA 3PG5A 2HJGA 4PHFA 1P7CA 3AF2A 5A5GA 3PVSA 4MGIR 1T0JB 3KQKA 3CF2A 3H84A 3GPLA 2H17A 2ZRLA 3SR0A 4ESVA 5DH9A 3CRMA 1P4SA 4II7A 1J90A 4AD8A 3QG1A 3HU2A 1KKLA 1HE8B 1N6IA 2LWIA 5IRCD 4EIWA 4G5OA 1Z29A 3CB4A 4HDOB 1KK0A 5DN6A 2GXSA 3ZS8A 1A4RA 3RS2A 3S1AB 1HUQA 4TLDA 1ZU5A 1KSJA 2QQ0A 3BS4A 4PPQA 4QFMA 4IDHA 2V3CC 4DJTA 2ZR9A 2A5FA 4DDTA 5KSOA 1Z2CA 3WP0A 3I92A 4JL5A 2UZIR 4GNKA 3W9YA 2ZANA 4OQFA 3H1TA 4IKEA 4JJKA 2F1IA 2WPDD 1NG9A 2G1KA 2AX4A 4NYJR 2IL1A 2A5YB 3GLGE 1ZUNB 4BLSA 1QDEA 2JLSA 2IYUA 3DMNA 5KDDA 2HYDA 3GJ5A 3Q5DA 5CYPA 2F55A 1UAAA 2VLIA 3F5FA 1UBFA 1RFLA 3SJZA 2D74A 2IYYA 4EUNA 1J8MF 3LXXA 2Z4SA 2WJHA 1YRAA 3PEVA 1XTIA 3U3MA 1E9EA 1E3MA 2J45A 4DSUA 3A4NA 3HYRA 3AF3A 4JYCA 1QRAA 5E7JA 4DKXA 4I99A 4P31A 1G8FA 3UK6A 2DWOA 3ZIAA 2D4HA 5IK2D 1AZSC 1IN6A 3AGQA 5HKKA 2BIFA 2J5XA 1E2EA 1TAGA 3NVAA 4JS0A 3A6PC 2JLXA 1OYYA 3AUYA 3KB2A 1XCMA 4AYTA 3RRMA 2J9RA 4TL7A 1FMLA 3GMTA 1H8ED 3THYB 1XEFA 3SQWA 4Q4AA 1W1WA 2CL6X 1G7CA 3K9GA 4WIAA 1E2KA 1G8GA 1QHSA 4JMPA 4U7DA 4O2RA 2DHRA 4MRRA 1T6NA 1FP6A 4IOMA 2FF7A 1ZNZA 1W2HA 4MITA 4LBWA 3TNFA 2VTKA 5JRJA 1T4GA 1YU9A 2V7QA 1XTKA 4LHXA 4KFRA 1HH4A 4MGYR 4LSGA 8OHMA 1S9DA 3VFDA 3RAPR 4A1FA 2AN9A 1UBCA 3PEWA 1O3YA 2V6JA 4PC6A 3SFZA 1D9XA 2F9LA 1IHUA 4YXWD 4PQRA 3K9HA 4QBGB 2PT5A 1AGPA 3PENA 4ZDJA 4W5HA 4F7WA 2HLDA 3OFND 4CGZA 4MH0R 1EK0A 1SQ5A 4MUAA 4LUCA 2Q3HA 1ZIOA 3B1XA 2PL3A 1QHHB 2B8WA 3IEVA 3GFOA 1KJZA 1XX6A 4BGDA 1XB2A 1ZC3A 4DCSA 2WWGA 1CJKC 1XFAA 4LJ4A 4GRAA 5EXTA 1OIWA 2D2FA 2J3EA 3B1YA 3BH6A 1NIJA 3VKGA 4FMCF 4TSFD 1ZBDA 4I1VA 3K1JA 1IN4A 3AF0A 5AK0A 3ICQB 2RGAA 1OXUA 4PFSA 2YWEA 5FTMA 2J87A 3VQTA 1QHIA 2J0SA 2GK6A 2IXGA 1SVWA 4C0SA 3FGNA 2BBOA 4YMTA 1NVUQ 3LLUA 4CF7A 2ZYVX 4Q18A 1R6BX 3LBHA 3EC1A 5JJLA 3LW7A 1FQKA 5EUMA 2RGBA 6Q21A 4CVNA 1UDXA 3EARA 3HR8A 3VU9B 1NY5A 2YC2C 4F4CA 4TYWA 2JLQA 4UJ3A 5BN4A 3GLHB 2A5DA 1U8ZA 2WWFA 1LF5A 1G3MA 2VIIA 4K46A 2EW1A 1DBSA 4URWR 3DL0A 4AG5A 1GL6A 4H1VA 3H86A 1KOFA 3DO6A 4UXIA 3TKLA 1S8FA 3KZ1E 5TMPA 5KYKA 3U44A 1TEXA 5JI3E 4LRWA 2WMOB 2EFCB 3CPHA 3CNNA 4U02A 4NCNA 2GCOB 2FJUA 2ZREA 1II8A 2ZRCA 1C1YA 1UKZA 4CDGA 3U3KA 2FPLA 1PLLA 2R62A 1P9WA 2LKDA 1IN7A 1X1RA 2ZSFA 1MRSA 2Z6VA 4JVLA 4KCGA 4LGMA 3WHLA 1PJRA 1U90A 4IDOA 3C4JA 1YZLA 4B47A 4NYMR 1U0JA 1Z08A 2OXCA 2DY1A 5H68A 2YWFA 5C1BA 5F2EA 1UADA 4JLAA 1DPFA 4QC2A 5TY0A 1I4DD 5KDLA 2NZJA 4BUJA 1TQ4A 1XD9A 3JVUA 2ZI9A 3M0EA 2AFIE 2GEVA 3BH0A 4B44A 3VR5A 5DI3B 4BFXA 2B7BA 3OEED 4WA7A 4HSEA 4WAUA 4E22A 3A4MA 2I3BA 3A36A 2QENA 4Q9LA 2ZYWX 5G40A 4RY2A 1KDOA 2RGCA 2WOOA 3OEHD 1DTSA 1XMIA 1X3SA 2FNAA 3UXMA 4WXPA 1Q22A 1G3IA 4P4UA 3E1SA 5FTNA 4CIDA 4OKSA 3NBZC 4B6EA 4C4PA 3CWZA 2BMEA 3V4FA 2XSZD 3IBYA 2H5EA 3GFPA 5EP3A 1RZ3A 3AVOA 3CR7A 3QKRA 3MGCA 4A8JB 1QBKC 1N6NA 3QXHA 4ZCLA 2P6NA 4PAMA 3GEHA 1Z22A 5EUQB 2QBYB 1G7RA 4Q7KA 4IW3B 3DOEA 3TVTA 1OB5A 1M1YE 4ZCMA 4AYXA 3IILA 3LBIA 2XEXA 5CJ2A 2JLRA 4TYNA 3C14C 1IN8A 2C96A 4LZZA 3SI7A 3GJ6A 1XEWX 5DE3A 2VP0A 1G17A 1E0KA 1JNYA 3FMIA 2Q3MA 1COWD 4RFSA 3PUWA 3W8RA 4MKGA 3FHCB 3QUSA 2IWHA 4GMDA 4M21A 2SHKA 4R2HA 2W0MA 4QHTA 1Y63A 4HDCA 4NMMA 4TLAA 2DFKB 4UXHA 1U8AA 5AUPB 4U5XA 1GILA 2ZRHA 3HU1A 3OFNA 2BJVA 4FIDA 4WVFA 2F3TA 5P21A 3WBJA 821PA 4KSBA 2CBZA 3W6NA 1WQ1R 3DHWC 1E96A 1DAEA 2CL7X 3CKLA 3DVLA 1G20E 4EJSC 4LCBA 4ZV4A 5FPHA 3MSXA 2GJ8A 2OT3B 4HATA 3PIRA 1GAJA 4JLOA 4URZR 2V1XA 3D7MA 1G8PA 3LV8A 4TSFA 1DVRA 3U3OA 1W5SA 2WM9B 1P61B 2HV8A 2ZI5A 3CRW1 3LWNA 3BD9A 5AWFC 3GLFE 4TYYA 2RGNA 2W2XA 3C7KA 1MO3A 3FWYA 2PCLA 4KV9A 1VHTA 2J0UA 1ZYUA 4KLZA 1RJ9B 3K9NA 4B71A 4OHXA 2C8VA 1XTQA 5BXQC 4PX9A 3G0HA 4DLTA 5EZ6B 2YC4C 1ZD8A 2X2EA 3CM0A 1D2NA 2AXNA 2ZVPX 2ZAOA 3ZQJA 1SXJD 1E4YA 1VECA 4ARZB 4Q4AB 1I2DA 1KI2A 3NKVA 4NONA 1VCMA 4PXAA 1UM8A 1HURA 1N6LA 5C18A 3UWOA 2ZVQX 1W36D 1VIAA 1F2TA 2YV5A 2RGDA 4JBYA 3QXXA 2QAGC 4DDVA 3GD7A 3MRSA 4B43A 1WBDA 2YOGA 2ZI4A 2D62A 2Q6TA 4CT5A 1WCV1 3NTUA 1MKYA 4ZO4A 3B8HA 4PC2A 3BB1A 1L7VC 4MKHA 3DZ8A 5CK4A 3SZRA 5FI1B 1SKYE 1GKYA 4DLXA 1N0UA 1FZQA 4S35A 3QBTA 4MKIA 1ZM9A 2C95A 1XRJA 4R71A 3QXJA 2WWIA 3N70A 3SFVA 2UZ3A 3RSOA 2ZM5A 1OH7A 3FKSD 5DYIA 3ASZA 3OEEA 1KJYA 1FP7A 1G6OA 1W49A 2GAOA 3AB3A 4WZAE 4MYHA 5F9HA 2X77A 1A1VA 4ESHA 5KTYA 1UFQA 1AQYA 4BFWA 4TTRA 2O8DA 2OE2A 1SVSA 1ZCAA 1JECA 3IUYA 4GOJA 4Q01A 1BYIA 5AUOB 4W9MC 4EPRA 1IOZA 3THXA 5CIQA 1T5IA 5SZIA 4KVGA 3KXLA 5EXPA 4M1KA 5EJEA 2GKSA 3KQLA 4QGGA 2CE2X 4TYPA 2G88A 1P60A 4OJKA 4XWAA 1VG0B 2WJJA 2ZRIA 1OHHD 4XH9B 1HE1C 2ZR7A 2JEOA 3GP8A 1GUAA 4UNPA 2QTVB 3PUZA 4IVPA 4QBFA 2XSZA 4QJ3A 1TF2A 1C9KA 2HYIC 4NCKA 2BBSA 5C46F 4OI2A 5DYGA 1UKYA 3PXGA 1UEJA 4BFUA 4IFEA 3AM1A 1BH2A 3NC1C 1E9FA 2JJ2D 1GWNA 1G4UR 1KO7A 1OKKD 2XJ4A 1C4OA 3NXSA 4IDQA 4B76A 4HB3A 3KXIA 1XZPA 2YZ2A 5L3SA 4BZPA 4BFSA 1OFTA 3QOFA 2KBEA 2ZU6A 3S1AA 4B3XA 2LKCA 1U94A 4YLGA 1WBBA 1II8B 5KPJA 5GVSA 1IY1A 5EXSA 4B75A 1DE0A 1ZVQA 2GETA 3C8UA 3TR5A 2QEQA 5IF9A 3SQXA 121PA 1KZ7B 1COWA 4D25A 4MGKR 3D3QA 3QG5A 3WMGA 4B35A 2WIAA 4PPGA 3X2SA 2C5LA 1DAGA 3QF4A 4DCTA 1I4LD 4WZ6A 5B57C 3L8ZA 2AK3A 5JWHA 4DLRA 2IF0A 2CLCX 2WBLC 1XJCA 2ZROA 3B1ZA 1DEKA 2VP6A 3I61A 3K09C 3ADDA 2R6DA 3Q72A 1KY3A 3EZ6A 3E70C 3OIWA 3T35A 1AKYA 3A37A 4EDHA 2O0JA 5JEDA 4DLZA 5JSZA 4ZKEA 1R0ZA 4ZIRB 4M4SA 1P2TA 4OYHA 4Q1CA 3PJRA 5EXXA 4LJ6A 2GZAA 3IQWA 4IOJA 2DPXA 3ZGXA 3RWOA 3PCRB 4ZI3A 4HLUC 1MABA 3DPUA 4QM7A 3AVVA 2ZSEA 1DO2A 4KBGA 3KFVA 3H0KA 3R7WA 2C78A 5C4MA 3EZFA 1AS2A 2QL6A 1JR3D 4LJ5A 4RZ3A 1YRBA 2PJRA 3RS7A 2AK2A 2QI9C 5AJYA 2OCPA 2R44A 1TQDA 1L8QA 3T5DA 2DWQA 4TZ6A 1E9CA 1KNQA 1OJLA 4OQXA 1U9IC 2ZRBA 1SXJA 2UKDA 3QKRB 4PQFA 4NYIR 1IN5A 3MWJA 4A2QA 5FR2A 1P2VA 2GBLC 4YMSA 3VX4A 2YWGA 2Q9CA 1K5DA 1ZU4A 3A1WA 4Q47A 1KI6A 3BWDD 2GK7A 3EPKA 2QAJA 3QJYA 1GL9B 4GP7A 2BHRA 2IYWA 5KOYA 4F92B 4NE2A 3VR1A 3ADBA 3GJ8A 2WJGA 4FMCB 4ZI2A 4RKFA 2W6JA 3Q7PA 4QHYA 2DWPA 3QENA 1DO0A 4TL6A 2VQSA 1R10A 4RFSB 2GJAA 4UKDA 4JLKA 4LBVA 3W8NA 2Q21A 1ZM3A 1JAHA 2BMJA 3IHLA 2R65A 2BVNA 3AVYA 1IAQA 4ILEA 4UNSA 2OO7A 4L9WA 2VPPA 3QIAA 3FTQA 1L4YA 2Z5FA 3FKSA 2YKGA 5E4FA 3THWA 5L8VA 2OZEA 3EA0A 4D4KA 2QU8A 3P27A 5SZJA 4WBSA 2J7PD 3W5IA 1E2DA 4AWXA 5CJPA 1M8PA 3CF0A 2OESA 5CB6A 5JLJA 3L8YA 4EFMA 2GVZC 2X19A 2ZI7A 3IQXA 4DCUA 1GP2A 3SU8A 4QKQA 3EW9A 1OE0A 4M8NE 2QTHA 3CZQA 2OEPA 4AC9A 2ONKA 2FG5A 2L0XA 2ZJ5A 3DKPA 3LFUA 1OHHA 4LV5B 3U4QA 1X6VA 3JVVA 2BBWA 2J0UB 4KLNA 4TTPA 3A1SA 4O3MA 3ND9A 1G9XA 4Q4HA 4MRNA 3DZDA 5JFGA 2B7CA 2ANBA 2RGGA 1Q12A 1OKKA 4Q9JA 2EVWX 1MO6A 1H65A 5GJBA 2Z43A 2WMNB 1X1SA 2PZEA 3GQBA 3SDZA 1HYQA 2VHQA 1FUUA 1F2TB 4WZBE 1IJFA 2BM0A 2ZJAA 5J40A 2BBTA 1E2JA 2XTNA 3UWKA 1CJMA 2CL0X 4MDFA 1G8HA 4PHTA 4A6PA 3TGPA 1FX0B 4AKIA 4MYUA 1D5CA 4EPWA 1W7AA 2ZU0C 4KYIB 1ODFA 4Q1FA 1GTVA 4LPKA 4JSYA 3KTAA 3BC1A 2BEJA 3EZ7A 5FOUA 4TLEA 5JS8A 2XAUA 1LW7A 1U0LA 5FBQB 5DI9A 4LY6A 5DO9A 5CYOA 2PCJA 5FOVA 2IS6A 4M1MA 1G19A 3RWMB 5F98A 2ZSBA 1YR9A 2NOAA 4HAZA 4UXJA 3K0CC 5EE3A 3TAUA 4C0BA 3CR8A 2DCUA 2ONJA 2AFHE 2QMEA 1W4RA 3LQQA 3KXKA 1U98A 1G7SA 1KO4A 3FPAA 5FBLB 1NN3A 5FOXA 2O8DB 1KAOA 4MDEA 5DHFA 1GOTA 4C0LA 2EFDB 4DRZA 1OH5A 1W4CA 3DM5A 1XXHE 5HZKA 3WXMA 3THXB 221PA 2XGJA 2F1JA 4I1OA 4GDFA 2NO9A 1JALA 5FL7D 2W58A 2CEAA 1YZGA 1E2PA 2QP4A 4JLNA 3LLMA 4RZXA 4HDQB 1TTTA 3O8DA 3AF1A 2JLZA 1RE0A 1NBMD 2QM7A 1NMXA 1JAIA 1JR3A 1ELOA 1TPZA 1TQ2A 1ZRHA 2REBA 2XNDA 2Q9AA 3SE0A 1AK2A 3X1XA 5AJVB 4Q66C 4A8JA 5BWMA 4RD4A 1SKQA 4XOIA 2R8RA 4PHGA 1OH8A 4JYBA 2GVDC 1U0HC 4KFUA 2R9VA 2QBYA 2O8FA 5K8IA 2FA9A 4OQNA 2RB4A 2W2VA 3GJ3A 1G41A 5L3SB 3Q85A 4OJQA 1SULA 2P0EA 2R2AA 1S1CA 2NZ8A 3EPJA 2F6RA 4BQSA 3U7FB 1KHTA 1SGWA 1JEEA 2WWWA 1E94E 1JR6A 1G1MA 4X8HA 2PT7A 1NI3A 2JCSA 5DLQC 1E6CA 4LHZA 5UKDA 2O8EA 1RRCA 1OXSC 1DAIA 1XZQA 3W3AA 3WYAA 1KO1A 1PLJA 3QF4B 1BMFD 2PLFA 4HAWA 2NO1A 4P32A 4YMUA 1KJWA 3K0FA 3LX8A 1P2SA 2NIPA 2BMDA 3OAAA 4A92A 2EFHB 3R20A 4BRWA 3AEZA 1K5GA 1KY2A 2ZS7A 3AP3A 3ZD7A 3NC0C 1ZM4A 1TF7A 5FBRB 4ZDWA 3Q8XB 2ZRAA 2J7PA 3KKMA 1UKEA 2GTPA 2VF8A 5JS7A 2CVHA 5JSZB 3U61B 3U5ZB 3EZ9A 5KDOA 1VCOA 4BEJA 4XJXA 4C7OA 3ONWA 2AKYA 3PITA 1II0A 3MWYW 3PR1A 1MT0A 2JATA 1MABB 2YINC 5AJXA 5FOTA 1XDBA 3MFYA 3WHKA 4G0NA 2IXEA 3LH5A 3CRQA 1RJ9A 1NP6A 4TLBA 4Q03A 1F2UA 4IEIA 3R7WB 4ZCIA 4FCTA 2W00A 1E2HA 3ZYCA 2IHBA 4Q02A 5FPTA 3VR2A 2QZ4A 5A0FA 3NDPA 2ZUDA 4ARZA 4F4IA 3THOA 3NBFA 3TBKA 2N1BA 2VP2A 2AL7A 2DFTA 5LD2C 2QPOA 2JIZD 1SXJB 4XTRA 1DS6A 1HA3A 2C9YA 3KJGA 4UNQA 5JEEA 1DELA 3B60A 4AY2A 4Q5IA 4DIDA 1E9BA 4B74A 3K70C 4G5RA 1W36B 2IYVA 3V9PA 1NNEA 3IIKA 1KI6B 4S2EA 4M1YA 4XWOA 5JMTA 4MYTA 2JJ8A 1TX4B 1MOZA 4I1UA 4AKEA 2HCBA 4OI1A 1US8A 1YKSA 2ZIAA 4KBFA 1FFHA 2BKEA 3T06B 2GEDA 2REOA 4PC3A 4EJSA 2HXYA 4UNRA 2O8BB 3TSOA 4JJZA 5F3WB 2ZRDA 2VHUA 3AP1A 2G9NA 3SS8A 1A2BA 4HB0A 3WNBA 2WWYA 1NVVQ 4L8GA 1AN0A 1VKJA 4JKIA 2V54A 521PA 1R8QA 3B82A 4GSYA 4KU4A 2XZOA 1HT1E 1QHXA 5JCPA 3THWB 4F38A 2OCYC 2QNRA 4BFVA 2IUTA 4IXMA 1WP9A 4IRUB 3RRNA 3GLFB 4QRHA 1K8RA 2ZI6A 4TMVA 2FFAA 2CHVA 1FNMA 3NWJA 1I4TD 1VCIA 4XVUA 3LQRA 1RYHA 3NDBB 3CH4B 3DKVA 1U2RA 3KX2A 5FL7A 4GZLA 4JLBA 5FTLA 1GDDA 5IHPA 2VSOA 1Q3HA 2VP4A 3SJCA 2GEUA 5JECA 1D8TA 2OFXA 3NHBA 3U4QB 1NBMA 1JJVA 1R5BA 5JWOA 1NN0A 4DDUA 2HDNB 1ZNXA 2JDID 3TR0A 1YR7A 5FL3A 5FBVB 4US2R 5KU1A 3R9WA 1VPLA 2HF9A 1CF4A 2WTUA 4ACBA 4Q4HB 1ZMXA 1FOEB 5DGXA 4IFBA 3SNHA 2GILA 4E5UA 4IJMA 2NO7A 2QG6A 3HDTA 1Q0UA 4RJLA 4JKYA 3WP1B 1CRQA 2ANCA 4Z8YA 4IVQA 1CU1A 4OL0A 2A5GA 1QG4A 1TMKA 3U44B 1KO5A 2I4IA 5H70A 2CLDX 1OFIA 1Z0IA 3QKTA 1E2QA 3EIQA 1T3HA 5AUNB 3W6OA 5FOSA 3W90A 4KJZA 5LBIA 2EQBA 4BZXA 3QPUA 2ZI3A 3CIOA 2V4ZA 2ZYTX 3X1DA 3IPYA 4YC7A 2KE5A 4LV8B 3G82C 4CRWB 4E03A 3KTAB 3TRFA 4LOAA 3LD9A 1SVMA 1VIYA 2E87A 2CLSA 1R0XA 2QA5A 4D0GA 1OFHA 1KI7A 3KJIA 1N6PA 1BMFA 4B48A 4DB4A 4M2LA 1AKEA 4A15A 3B6EA 3V00A 5FUWA 4DT1B 4H9GA 2FE4A 2FSIA 1XXHA 1XF9A 1SVIA 5BN5A 3T12A 4B3GA 2VSXA 4OK5A 2FMXA 5FUVA 5JHGB 3R9XA 2OCBA 2IYRA 4URUR 4ZIRA 3K53A 1E2LA 1N6OA 1Z6AA 1Q57A 3L82B 4KAXA 2IWRA 1CBUA 4V0MA 4MYCA 1DG3A 2JLUA 2YOFA 1DAHA 1CULC 1N3BA 2BKUA 2RGEA 2A7QA 2NPIA 3GLIE 1ZW6A 1G6HA 2WV9A 3C16C 4XVQA 5FPYA 1LFDB 1LTQA 4LV6A 3B1VA 3JZMA 4LX0A 1AGRA 2OCAA
chains in the Genus database with same CATH superfamily
2MSCB 1ANKA 4YLYA 4RFVA 2A84A 4DLSA 3MFQA 2WWVD 5HYVA 4B3BA 2HWYA 1Z5UA 3RS5A 4I50A 1KBOA 3DLTA 4JLPA 3RUAA 4KLRA 4TM7A 4DCMA 4V02A 4DC9A 1ZA2A 2ZYUX 4UNIA 4PYOA 3OQNA 1L5VA 4EJFA 5CBPB 2Q1WA 1Q0QA 4PZDA 1KVSA 3NIGB 2JIZA 2O8FB 4MVXA 3O2SB 2YJGA 3H9JA 4O2BA 4EX6A 3AXTA 1TK3A 1P73A 3NQ41 3C5WP 1G5TA 2EF1A 3QBDA 4C6TA 3WQRA 1LQTA 3R7AA 1Z8DA 1XZAA 2Z58A 2P5SA 3DL7A 5JJCA 1BXGB 1BDBA 1E9DA 1NSYA 3QE2A 1RJGA 1UMBA 1XD2A 1XNRB 3HCPA 2VWGA 2LNDA 1FU7A 1ZM2A 4TMTA 1E5TA 3RF7A 4I81A 3D7KA 4JBWA 2R4QA 4EB0A 1XR3A 2J30A 4N0EA 1Z4IA 2CUKA 3O0DA 4BMCA 4XGNA 4RCZA 5BRJA 2G25A 1N2OA 1K63A 1RWOA 1Z4KA 4FWBA 3GEIA 2WLTA 2O8EB 1KGSA 1LQUA 2ZTSA 4UAVA 3L0DA 1DOAA 3FZGA 5D5PA 3VBCA 4H6PA 5IARA 5M2QA 5EZYF 1XA3A 3DMYA 2Q3LA 4ZREA 5K3CA 3SF0A 3WTCA 3I2YX 2A4KA 3WXBA 3LT1A 3LZDA 3T15A 3EPPA 1R0CA 2FPPB 2LV8A 1N5LA 1NW8A 2H2AA 2VJKA 2WJ4A 3RUFA 3WAKA 3TJRA 1J2EA 3HM2A 4FFBA 2IT1A 3QVWA 4QAJA 3VJKA 4PYNA 1LY1A 2ZE5A 1OXXK 2BGLA 4FD2A 1THZA 2AI3A 2H6EA 4Q19A 1I3NA 4R9NA 2GASA 3DMHA 4JLDA 3IIJA 4UHDA 4RTSA 3ZCUA 4ARCA 5HQTA 3HWX1 1DTEA 3IOYA 4ZHQA 3I9MA 2DQ4A 4B4KA 5GGXA 2E21A 1SVOA 1OV6A 1YL7A 4EEKA 4EBBA 3RYCB 2QSJA 2QVBA 2PTHA 4WX2B 2QJOA 4TWZA 1KEKA 4NEQA 4LECA 5C53B 3K6SA 4XJVA 4MB6A 3P9XA 2CXSA 1A5ZA 1RM5A 1CP3A 2HQSA 2NZYA 1UJ5A 1PYOA 2P35A 3COVA 3E18A 1PWXA 4R2JA 5LZ4A 1QP7A 2FUG1 2IUUA 5BYAA 4NE9A 1PQYA 3GP3A 2QROA 1HE2A 3DMTC 5CDSA 4I2NA 3SOPA 2XCSB 3OD5A 2XMQA 2JDIA 2BP7A 5I3CA 3ELUA 16PKA 2JIRA 1WNFA 4U5QA 1UK8A 4FWIB 4A2PA 4PXSA 1ZAKA 2UYOA 2GXAA 1ESNA 3P20A 2VDMB 4US1R 3LBNA 4RIGA 1FTNA 1WEHA 1QV9A 2VUSA 5L53A 3A14A 3L4BC 4X24A 1ISSA 2WE7A 3MMSA 4KXUA 3RFVA 1XZKA 5EHXA 3PQFA 1KEPA 4B2YA 3HYLA 3IJPA 2FP4B 4O8ZA 2XNSA 3RFUA 1SVKA 421PA 2VTVA 5CYGA 1DLJA 5HXAA 1H2EA 3IV9A 3BK7A 5CW1A 3WGYA 3ASUA 2WJ3A 5HOEA 4C14A 2ACVA 2Q0SA 3G5UA 1KMCA 3Q11A 3SHWA 3BHIA 5AHOA 4AXXA 1EWTA 2ZQ5A 1CHNA 4MCAA 4DWVA 3ZJUA 5ICCA 2X1VA 5LOVF 1PS8A 4YRNA 3ZQ6A 2HF2A 3UJNA 2JI4A 2F3RA 4UDOA 1MVLA 4Y6SA 1F17A 2IOFA 3GJ4A 4LGCA 5E6UA 1Y9EA 1YJCA 5AW5A 4CL0A 1MC8A 1DX9A 1YIAA 1YQ9A 4ABYA 1CZLA 3FKJA 3EZNA 3ETHA 1SXHA 1ML3A 5AVXA 2OO5A 1N6RA 5DM4A 3CYFA 4UW9A 3IEUA 4J2HA 3L49A 5LZ5A 5JALA 4IZIA 3G9TA 2JCGA 2OPBA 3VTKA 2I29A 1PKXA 3A31A 3DAFA 4KITB 1MRNA 4GR4A 2XYHA 3H1FA 4RF5A 3EC2A 5KB3A 2AS0A 3QPBA 2WJZB 3EVBA 2JFYA 3OP4A 4FGLA 3RIEA 1PT7A 1FK8A 2Y1EA 1XMVA 2J3DA 2PJZA 3F8TA 4GBJA 5AW4A 1ZJYA 5KWJA 1XN4A 1D2EA 2Q1XA 3A9SA 3HN6A 1RM3A 4EKIA 3RC9A 3AR3A 4AJEA 3LSYA 3EGEA 1U2GC 3NP7A 1PFGA 2NT3A 2DFLA 5AVOA 1G8JA 2EWVA 1V11B 2ZT8A 3WNQA 1CIPA 4G56A 4Z99A 1E0DA 3NG1A 3TX2A 3GRUA 2ZSDA 3RREA 2EATA 3ECSA 2QS9A 1SMKA 1KHHA 4WZBB 1RRFA 4MMYB 2JZNA 1QH8B 3L7OA 5J2TA 1VPDA 4HY3A 4RZHA 1JZSA 3BILA 4RJ2A 1GXSA 3FPEA 1N75A 2HM7A 1YZNA 1KH1A 2YWDA 3FIUA 4IO1A 2A9RA 4FB4A 4HV4A 1XMQB 1BDHA 3CRVA 5FLEX 1JB1A 3D43A 1B0PA 3GJQA 3SEZA 2BHSA 3U4CA 3WLOA 3GVPA 1NX6A 4BKMA 2ZUWA 1ULTA 3B12A 3I9KA 4IRMA 3V3KA 4RKEA 3CEPB 4B32A 2VP9A 2GHQA 1HXHA 3EAFA 4QECA 3C8ZA 1CNMA 2ZEJA 3ER9A 1Y8RB 5KNDA 5DNEA 1JH8A 1L3CA 3WJ1A 3IAAA 4PO8A 4RH1A 4AFNA 4D5GA 1ACMA 4OQDA 2R1TA 2F3PA 3BXFA 1R6AA 1X9HA 1JIQA 1UC9A 3KL4A 4RHFA 3TRIA 1JTEA 1YGYA 5J47A 4N3AA 2ZR0A 1TA0A 2Z1NA 5CDTA 1I1OA 2ORWA 4TQGA 4B40A 1Q21A 4LJ9A 1R6XA 3IBCA 3GLIA 3PE3A 2PWZA 2P77A 2DG2A 1YC5A 3GBPA 3HGTA 3SP1A 3IUNA 5FUBA 2B4AA 4PEVA 1WUTA 2R1VA 4QX6A 1QKJA 4QEDA 1XFDA 2OHVA 3I01A 3SJBA 2WIKA 3WG9A 2R4UA 3R24A 2VTBB 1UBUS 1XK6A 1XMJA 2XE4A 1COZA 3L0CA 5F7JA 5KYUA 2IUYA 3UJCA 2K87A 1HG1A 3G2JA 3RNLA 1KFJB 1TYBE 4Q3DA 4AROA 4ITRC 1PTKA 2VBCA 3TBHA 1JSLA 3DJFA 1I4WA 3H0CA 2Z4RA 3OZIA 4RK1A 2TMYA 1E1QA 2CV1A 4UUPA 3E8SA 3OQVA 2AEFA 2NU9B 3ZHZA 4ACAA 3UANA 1CLUA 4ITUA 2KM1A 3QWBA 1T4DA 2OBYA 5IM5A 1OXTA 4R7GA 5ABPA 5BR8B 1RQ7A 4I50B 3D4LA 3Q9UA 3FTDA 4TMXA 4ZDIA 4X94A 1WF6A 1L4FA 1NXTA 2BC9A 2QMHA 4FK8A 4O2AA 4U6SA 5F33A 1Z06A 1XL1A 2X8LA 3V3TA 1KNXA 4DJDC 1JGTA 4LISA 3SHTA 4Y3UA 3T1OA 2X3YA 2BCGY 3GXOA 2AD1A 2R11A 1KE2A 2DSNA 4GRIA 1TD9A 1Y3FE 2H00A 4WGGA 2GO7A 2PV7A 3DE0X 4C6TB 5AVTA 4RTMA 4KFTA 2BKVA 2IDKA 2EX1A 1BE8A 4HI0E 3RU9A 3W5JA 4BKRA 4F04A 4EPXA 1UMBB 3OVMA 1XD2B 4LYGA 2I71A 2VZLA 4ZD6A 1M66A 3HKDA 2QTFA 4FGUA 1KU6A 3CEMA 4KJXA 4K6GA 3C7DB 2IC5A 4ZVLA 5A9TA 4EL0A 2PT6A 4RTKA 4B7CA 3BL6A 4IGKA 5JYEA 4TUYA 3OUTA 2D2IA 3SC3A 1NVAA 4AZ0A 1T6ZA 4GNRA 1YA4A 1G20A 1EFUA 1ZSVA 5IUJC 1J21A 2BTEA 3GNTA 1FNDA 3H2YA 5CRIA 5CNJA 3U2QA 1JBQA 1OGIA 1UK6A 1ZINA 2G0TA 2Q6OA 3R8XA 3W5UA 4EGFA 4BNUA 2IGBA 1EXWA 1SXIA 4YI3A 3VPDA 2HIMA 5TS3A 3SZMA 2Y8EA 4FJ1A 4HGPA 4DBZA 2XBUA 2ZJ2A 2P3QA 1TFRA 3OZGA 4FFBB 1ZD1A 4XDHA 3GLFA 1B8VA 4FM9A 2V7UA 1BROA 4MQBA 4XWGA 1QPBA 1Y7TA 2XMSA 2XB4A 3R6WA 2J48A 4LRQA 1U7PA 1BKSB 1YBAA 2Q2VA 3QKSB 4HRAA 5F2OA 4AIIA 1JHZA 1RTKA 1IXKA 1YQUA 3ICPA 4FR5A 3NNNA 3IBFA 2UUCB 2C8LA 4ZHQB 4KQFA 4NCJA 1E4EA 3WK7A 2OBMA 3IKLA 4Z54A 1KEEA 3QXSA 3QVVA 3AEYA 3RRBA 2ZATA 3EDQA 2PA3A 2RH8A 5M3BA 2WU0A 1IB0A 2NYUA 2A0KA 4P5PA 1I5RA 4PCLA 5DASA 5ICEA 3C7TA 5CG2A 4C9BA 1ZGAA 1CSEE 3QW4B 1SU8A 4IBOA 1L3BA 3RROA 3DDHA 3HJFA 2PUVA 1Z62A 2ZQZA 2E85A 2RGXA 3ES9A 3F5MA 4IIYA 1ISMA 4U7TB 2BP7B 5TRTA 5IKXA 4IX9A 3LY9A 4OLBA 4BNKA 2YBDA 3S29A 3C7AA 4DEVA 1ZR4A 4CT5A 2ODPA 4MUIA 5CNIA 4Q4JA 2HBRA 1SFRA 3H97A 1BQEA 4IIGA 3SR3A 1JG3A 2O07A 3HGQA 4P9NA 4AMYA 1T34A 2G0AA 4BX0A 4DEYA 3TG8A 1ZOPA 3QQ5A 4IRXA 4OXYA 4DJ5X 2AOWA 2NVOA 4JBLA 4C4RA 1QK5A 4CMKA 2Q4DA 4LNHA 2K6GA 3OCJA 1WUYA 2R8YA 4LJLA 4LW8A 5E1DA 2IHNA 1UDAA 3FTEA 3PGXA 4Y2VA 3SPXA 3H17A 2DGDA 5HE8A 3KQYA 3TFWA 4RZ2A 4XOUA 4YI5A 2XDQA 1E79A 3Q7RA 4KSCA 4D2IA 3Q7SA 4M9SA 4G07A 3WLAA 4TWRA 5K7SA 3U9TA 1E2MA 3Q6MA 4OBXA 4RNCA 1FYXA 3G2OA 2A0WA 4JKOA 4RKQA 3HKCB 1VI2A 1UDCA 1W46A 4QDJA 3C5HA 4RD1A 3TPCA 3WBBA 2A57A 3MA0A 5B12A 1CR2A 4JI2B 4RMIA 4R98A 3N8HA 4UHEA 5E6UB 4RPKA 7MHTA 1T2EA 1N0HA 2VEDA 5EIEA 4JELA 5AI4A 2FZCA 2QZSA 1KDYA 2X9NA 3H1AA 3PGKA 3AVPA 4US0R 1XZIA 4W7HA 2AX3A 2X8AA 4FFRA 5IJZA 5LP1A 1T5SA 5NULA 4CF5A 2WSLA 3STXA 3W5DA 1JVNA 4N0DA 1E8DA 3WL7A 3MYYA 3WAGA 2PDAA 4HADA 4ALNA 1ZW1A 2FOLA 3DKIA 5C51B 3BZUA 1YQXA 4DQUA 2OYRA 3RSSA 4QDTA 5A3JA 2EKPA 4R8LA 1P5RA 2JI9A 3D4NA 3RBXA 5C7IO 1T2UA 3LKVA 3NS7A 1WU8A 2AQIA 1A2QA 2Y6VA 3EXAA 3HB1A 4KQGA 4YLEA 4C4YA 3OF5A 1YB2A 2A4MA 2OP0A 3Q8MA 4BATA 1WXQA 3FFTA 4KTVE 4W8HA 4DWOA 1KI4A 1THMA 4J0HA 2CNKA 3ZGYA 4OXQA 4R1PA 3E27A 4XR4A 2CXQA 4QE3A 2P4SA 3L07A 2YXLA 2HMWA 4CLEA 4HJRA 2G09A 2CCKA 5ELLA 3TJMA 2J3QA 2WFAA 2NUBA 4BO4A 3OQ1A 4D4LA 4D9IA 2CUZA 2DHQA 1DIAA 5J2TB 3VYVA 4DRYA 4L3OA 2HPHA 3V2UA 3GAMA 4ER0A 2PEZA 2GM3A 3AUJB 2ZJ4A 4H3HB 2J41A 3EXIA 5L7YA 2G5PA 3AXSA 2VR1A 4LYEA 1K0UA 4YEDA 1YZVA 3SNKA 1S96A 2ROQA 1QNLA 2JFHA 3O8LA 2EKLA 2QTZA 2QUHA 2DQYA 2HJWA 2JHPA 5ALJA 3PX3A 3AKDA 3O4JA 4FCCA 1JFLA 4TT3A 3FVWA 2HSZA 1HQYE 1N2XA 1NQTA 2JK0A 1X15A 3AV3A 4W6ZA 3U6BA 3SY8A 5MGBA 3AUTA 5CJJA 5A4DA 3AHEA 3ZE6A 3ZX5A 3SAJA 5HCNA 1A77A 1ETHA 2CY0A 4MLZA 1WPRA 1TPYA 4EUEA 1BMTA 2GPYA 2R1TB 4MW1A 4K9NA 3VPCA 4IDCA 1KJIA 2PPVA 3BE4A 2A9KA 1CQWA 4HN2A 3PLAE 4M89A 4QM6A 1LPBB 1L8AA 2OGZA 1QG6A 4K9DA 2H0RA 3PGA1 4WTOA 3A3NA 1BS2A 4R81A 2PGDA 1J20A 5EJ9A 3GLIB 2JLVA 1QZ3A 1ZJWA 4W99A 4RD0A 4UE3S 1W36C 4MRPA 1EM8A 5E9QA 1KI1A 2XUOA 3ZE0B 2Z6UA 4M0LA 2R1VB 4RLFA 2IZZA 3E81A 4B3HA 1EE9A 5E9AA 4QT0A 1YR8A 1OYOA 4ZT7A 3FDXA 3FR7A 3H5NA 3ONVA 4NZYA 4OLHA 5KYUB 3AI1A 4EKNB 2XXAB 5KNCA 1ABEA 3E9RA 3IAM6 4EATA 3AL0C 3M2TA 1WB5A 4MVJM 3TN7A 1RRVA 1OF1A 4B4WA 4AY6A 2VUIB 4ETNA 1E6WA 1YB4A 4GQBA 2QT0A 4DCJA 2V5AA 1M5TA 3FUUA 1ZH2A 5LYJA 1GADO 1GEEA 2AUNA 4DMHA 1XCLA 1JDSA 4E5YA 4H3VA 1T8UA 2Q2NA 2FK7A 3VPHA 1NJGA 5AP9A 6LDHA 1LEHA 3UN1A 2PRYA 1OV4A 1JR2A 3ZY3A 1W4BA 4J0IA 4O2AB 3DNMA 1MVOA 1EK5A 1TGYA 2D2XA 2YXPX 3IAFA 3NP9A 5L40A 3MWLA 5B30A 1GQFA 4NV3A 5CUQA 4LBZA 4GMHA 4KR0A 5CITA 2Q3EA 1SKBA 2VHJA 4UZEA 3R7LA 3KLBA 1J0XO 3NEYA 4AK9A 4BKUA 4D8UA 4JI5B 4JSRA 3K96A 5DM0A 3O3NB 1E7SA 5I8PA 3VZQA 4J16A 2I4OA 1X7ZA 4LRYA 5CT6A 2JAQA 3GJXC 5K03A 1G2IA 1LZKA 1QF7A 3HKDB 1SZDA 1P6XA 2O0LA 3SIXA 1Z2DA 3DFIA 3PQCA 1H0SA 2XT6A 4D6PA 4MPPA 4PQEA 2OHFA 1RPNA 5PGMA 1PSZA 2HL6A 4I50F 3GPCA 4TUYB 4WNCA 5GINE 3PD1A 3IP5A 4AZ0B 2XRZA 1EUZA 2J3IA 1JZQA 1OC4A 3D3WB 1VLZA 1RCTE 2FN9A 1VJ5A 1J2RA 2WVAA 1MAAA 1ZN2A 3Q9LA 5LC1A 4J4HA 2FCAA 1L5FA 2IE0A 2WD9A 1CUXA 1J07A 2D2EA 3MJDA 4NYMQ 4DLVA 1LKZA 1C4XA 4GWKA 4M1SA 3QYJA 3AUXA 4YWJA 3HB9A 3HJNA 2I62A 1EX9A 2IKSA 2PJDA 1KO8A 3KUUA 3PR2B 5A4KA 3JAWA 1FS5A 4HAUA 3MJTA 3SM9A 3R3SA 1TCVA 1WCIA 2FI1A 3KQQA 1Q83A 4P4SA 1V4VA 4K86A 1SG9A 2AR9A 3T3HA 4RW0A 4BRUA 1FP2A 1OPRA 1N0VC 2O5VA 4EQ6A 1L5HA 2K5UA 1E4EB 4RHYA 1KEEB 3CX4A 3B6ZA 5FOWA 5JZ9A 3JATA 5H3HA 2CXHA 5M7EA 3KWFA 3U7EB 3BICA 4G09A 3SVZA 1KAEA 2ZSUA 3V9AA 4O4JA 3M2PA 1A04A 2RGYA 3UMMA 3ZC3A 3EBLA 2W0SA 2JFBA 2IV3A 1P29A 1N7IA 2AXQA 4CM7A 4WXYB 5CD1A 2E1RA 1T2VA 1Q5PA 3GGSA 2QAGA 2Z8XA 3HU3A 4TN1A 4YTEA 4ZYLA 4WFIA 1SWWA 4IDPA 3DCNA 1TA9A 2IITA 2JJ1A 2J1LA 2HK9A 3N0RA 4B7UA 4J94A 1U2PA 1TQ6A 2FPKA 4KGVA 4Q4JB 5DBHX 1MT3A 4AX4A 2QLBA 3ZVKA 2VUUA 4RO0A 3BFVA 4KVZA 5IULC 1YQTA 3IQGX 3ABQB 2K2WA 3DBHB 5TGZA 1JLSA 5EEHA 1G9TA 4HBZA 2IW3A 4HXEB 4N3NA 4RWZA 2OM2A 3A6DA 3DEAA 3EUAA 1HF3A 1RXUA 5JSKA 2KYRA 4JVSB 4JH0A 1V8OA 5JRZA 1G3UA 4PZLA 4F2DA 1C7ZA 1XCOA 2PZLA 1QO9A 2WUEA 2RBGA 2YNMA 3DDWA 3PKJA 5HDQA 5C32A 3TOSA 5M04A 3A10A 3QTTA 4TVKA 2G9UA 4YP5A 2NZUG 1TRHA 3RS3A 2GZDA 4B6RA 2XDQB 4ARBA 2PZMA 5E7IA 2IEGA 4DUZB 3QI7A 3SIRA 3UFXB 1DI0A 3BGWA 1F5NA 3G49A 5HMMA 2PUWA 3SJ7A 1BKYA 1TUIA 3V1LA 3AQ4A 4E5PA 2PKYX 3U1BA 2FWJA 2O52A 3DV2A 1T5OA 1PBTA 2QIOA 4R3WA 1Y89A 3ICEA 1A8PA 4DXHA 5F35A 3ZEAA 1LK0A 4HQLA 4CFYA 1OXVA 2NQ2C 2H1FA 3AZPA 4Q7MB 4AKHA 2NX2A 5FEUA 4CF6A 4AS1A 1OA0A 2GCNA 4QXOA 4R1NA 4I1SA 4KQEA 3PWZA 3WIBA 2H7VA 2RHMA 4ALLA 1WSDA 4IOKA 1P74A 4PNPA 5TT0A 3GVXA 4D4HA 2ZK7A 1ORDA 4OGKA 1ZSYA 5ECGC 4BMNA 4BGIA 3V2GA 2HU7A 1XTJA 1RZUA 3RC1A 3GBSA 5CGZA 3OZVA 3DFZA 1M6HA 4C6HA 2HFKA 5KOJA 2V45A 4C0QC 4LXXA 3LHIA 4RD6A 1PGPA 3KQSA 4S04A 1UQUA 3DE6X 4P7KA 4FTWA 4WFQA 3B7PA 4RTPA 4C0KA 4LYAA 4RY0A 4B3DA 3FSGD 3KCNA 3K32A 4V0LA 5CK5A 4A0FA 1IQPA 4M3NA 2CMGA 4KOAA 1JQ3A 2JASA 3TL6A 3PEUA 3MMPA 3LYUA 5EZ5A 3FVQA 3KR0A 1N2GA 2LDXA 2PBLA 3VGPA 4Q00A 3ZHQA 3AVXA 2JLWA 3QOXA 1W36B 1WR8A 1S4QA 5EQJB 1PFQA 5D87A 4CUJA 2BDUA 3NORA 1GY8A 2C9CA 3USES 1KK1A 1VP3A 4PS0A 2XMDA 3QVTA 4P35A 4EF5A 4TZKA 3N8KA 4CWAA 1VYVA 1GRCA 2V96A 3DD5A 3EQ6A 3EXIB 4QHSA 3T4EA 1ZH6A 2GRUA 4FQ5A 4L8WB 2CCJA 3E2MA 3FCOA 3IQIX 5F3DA 3FPSA 3KB1A 2BGNA 1T4CA 1U28A 4DOMA 4QPZA 2FETA 5I7EA 4M1ZA 3QU2A 4MVYA 3RBAA 4RVUA 3WMEA 5JBQA 3JQ9C 5K0TA 1BMDA 2EP8A 4L4XA 1E2NA 1KDVA 4DG9A 1PUJA 1AM4D 2MYNA 2VPTA 3DO8A 4GYWA 4X61A 1EHYA 2NVWA 4I36A 1ZDMA 5K3SA 4WN3A 3UT5A 1OGYA 2LVBA 4KVFA 4HZUA 3P19A 1N5MA 4E4RA 1GM5A 4IJKA 1YAHA 5EG5A 4IIUA 5LB2A 3PC3A 5T5QA 2F48A 3KVOA 1IBRA 5J2TF 3ZHUA 5DZSA 3W1WA 2C5FA 5LFAA 4Z9AA 2GCIA 1OTHA 5EWJB 1IIRA 5L45A 4LC9A 1JEOA 1ZY2A 5A0VA 3AR9A 3FLMA 3KZKA 4H7EA 3CKMA 5AICA 4YIKA 4FEYA 3IC5A 3RGGA 3HXTA 3ZPXA 1PG0A 1EM8B 3OI7A 3LPDA 4ZQGA 2BGWA 1BHJA 3JSXA 4DNPA 1KARA 2NVUA 2Q6VA 3KPVA 2OMKA 1RWQA 3I6MA 3N05A 3IULA 3SX0A 1U9IA 1X1CA 3QU7A 4GQAA 3TTTA 1XLTC 3C85A 4HDSA 1TCBA 2YIMA 5U4QA 5CIWA 3P97A 3UFBA 5IH7A 4JY7A 3ZD6A 1TKCA 2TSYB 1J42A 2I1VB 4EW2A 4MCHA 4NNPA 2GESA 5LYJB 2J9GA 2XMZA 3AINA 3ITEA 1Q0TA 2HTFA 3PDCA 4JJ4A 4BQOA 2CNNA 1XZDA 2PN1A 4M0CA 3LM8A 1FTGA 1KDRA 4F6CA 2RD2A 1E9VA 1ZRNA 1QXSA 1FE8A 2FZEA 2PUGA 4EHJA 3NGMA 4UU8A 3GEDA 4N5DA 5CP8A 2NU8B 4RSHA 1X7HA 3PHCA 2WTNA 3OM9A 5FH9A 5JJKA 1HWYA 1ADYA 2XQGA 1ZMRA 1CZUA 1Z0KA 1PDVA 5JBNA 4G2TA 3KSBC 1HT0A 3UMYA 2W2KA 1RHJA 1RI2A 2ECOA 2X1MA 2BV3A 1EFCA 4C0AC 3LVFO 5JCZA 4PC7A 4LF4B 4P3YA 1MV5A 1DX4A 1U6JA 1LGYA 3L7BA 1ZNQO 4CQJA 5IT9A 1N32B 5AH0A 1Q1EA 1B7GO 1HLGA 2H2FA 1DIOB 4LC1A 4LZOA 5TDHA 3MC1A 3T3MB 3BXZA 4DLNA 4O2AF 1LPOA 2NQTA 3S4YA 5DSZA 4E14A 2C5BA 1RHKA 4IIJA 3NYIA 1ZLXA 4DAOA 1EX6A 3SEQA 3IB6A 4PS1A 9GPBA 1I0IA 1XP8A 2R5WA 1EDEA 4N3CA 1NYTA 3DKRA 3N2ZB 3HVJA 2RH5A 4GE3A 4R68A 4X5OA 5IBRA 4W7SA 5TEVA 3ZZNA 4EG4A 3MUFA 3DCIA 4NZZA 3R0IA 3WIUA 1AMUA 1P2BA 3H6GA 3JAWB 4YECA 3HCNA 3ELWA 3GRVA 1WCIB 1WZCA 3PP8A 4DUGA 2CNWD 2CNBA 5C8YA 3TEJA 1MZPA 3P9ZA 4P4SB 3KEGA 1QV7A 3P0HA 5HF5A 1L2TA 4TZTA 4EQ6B 1L5HB 5IZCA 1X8LA 3UGQA 3Q8LA 2A5JA 3NRBA 1WXHA 5H3LA 3JATB 2YJ6A 4B3SB 1DRUA 3A9VA 1E9SA 3HSSA 1EDBA 1A95A 1QH0A 1USGA 1KJ9A 3HSKA 4O4JB 4WERA 1NJFA 3BSFA 3OM8A 2F7SA 1FS4A 4MI1A 3H2SA 4YJGA 3F7MA 1PR1A 2WSBA 4ZK2A 2QAGB 5ALRA 4RENA 4FMBB 2ZXFA 4YAKA 3V4SA 4BTLA 4QDXA 4MEBA 2ZKLA 1QK4A 4FN5A 4Q6WA 5FI0B 2H9IA 4F9FA 1ESMA 3MWKA 4OQLA 3NM5A 4C2UA 3A9UA 4RJKA 5KYGA 4D26A 1AQUA 3C39A 3GEEA 2BLNA 3DV0A 1OIXA 1UINA 4R5MA 4MR9A 2JA2A 4EFDA 5BN4B 2QPLA 1A9YA 1KQPA 4X3CA 2FHSA 5JI2E 3GCDA 1GZ3A 4DQKA 4TKZA 4C3VA 2WJYA 3NBMA 5ES3A 4QAQA 5DHTA 3ZV5A 3HCOA 5FBZA 4NU8X 4ALIA 1YFKA 2ZUFA 2LIVA 3E7XA 4U39A 5AK6A 3S8MA 3O8NA 1LA2A 1OBOA 5FFFA 3MG9A 2QTTA 4RD2A 1E6LA 2NZVG 2AN4A 4CM6A 2NU7A 4ZALA 2A0FA 3HYCA 2P9JA 3FYUA 2E5LB 1AGYA 2PLRA 1HDCA 2RB5A 1LI7A 1MJGA 4YO7A 5B1YA 1T2FA 3K9FC 1ZWLA 1XLVA 2VT7A 3NANA 2EEPA 2Q27A 4FHZA 4EI9A 1T8TA 4JUIA 1P5FA 3L84A 3RTEA 2HIGA 4IYJA 1NNLA 1NVTA 1YS4A 2OB2A 2GLUA 2YV4A 2FPOA 3KJQA 1Z75A 2NXNA 3OIYA 4UATA 1PZHA 3H5TA 4JODA 2QM8A 2WYWA 4PLFA 5I4BA 3OWOA 3EVDA 2FR8A 5DLDA 5AIAA 4MKFA 4DQXA 4B46A 5KOJB 2IYPA 4OHYA 3IX7A 3HDHA 2L19A 5F23A 4FD3A 2ZETA 3KLOA 1C1XA 4DDWA 1SC1A 4IXDA 4F7DA 3RAEC 2NXJA 4YP6A 1P3DA 4M9UA 5EE0A 4YR7A 5JISA 3MB8A 2NO0A 1MO5A 4TV8A 1GYQA 2O0HA 4TMKA 2HJSA 3Q1LA 2IE8A 5FP0A 1ZGJA 4N40A 3TZHA 1JSXA 1XHEA 2ZCJA 4F4FA 2F1HA 2JGNA 4HNAA 1FTYA 5FR1A 3VHLB 4F8YA 5B58C 3O8CA 5IS2A 3WRXA 1XAGA 2FB9A 3RSHA 1MX1A 1PDWA 3BWCA 2HSWA 4DARA 1TUEA 3T9EA 4ZQEA 3H7AA 1E62A 4U2DA 3SMQA 4ASUD 3A2NA 6GPBA 1NKTA 4M38A 4LDPA 1O94A 5EUBA 1HNXB 4DB2A 5CD9A 3QU4A 1Z3CA 1NVWQ 2D7JA 3IUEA 3KYIB 5CLQA 5BWCA 1QIIA 3KP1A 1CY6A 1T4CB 1O6FA 3BULA 3OZAA 3P4UA 4TT3D 4CCWA 6AT1A 4EKEA 3AVUA 3HP7A 1LDEA 1VRWA 4G5QA 4ZQHA 2VATA 3DVQX 4JC5A 2ON6A 3HN7A 2D1SA 3HC7A 1G3QA 1RKVA 4LJ8A 2N42A 5ALLA 1JT2A 3WB2A 1VJDA 3OQBA 2FWRA 1BFKA 4WOBA 3UT5B 1E1LA 1LCIA 5FB3A 1KSHA 3TZCA 2R6CA 4HZUB 3UMGA 4EARA 5DN6D 4GXTA 2H9YA 2I55A 3TINA 2QV7A 1F51E 2OILA 2CEKA 3TUZC 1V5WA 2G5GX 2DETA 4BVJA 2QUIA 1IXYA 1ZJ5A 1GNQA 4P98A 1PL7A 3OKCA 1O97C 4OHOA 4IIHA 3IKMB 4DEXA 4BE9A 5HKAA 3IR5A 1EWRA 1YMUA 2P9HA 1AA6A 5BN3A 1GN8A 1IE3A 4WLOA 4FLEA 4Q93A 5EY5B 4MPRA 2HRRA 4OF4A 5IUKC 3AY7A 2OL4A 4JR0A 2LIPA 2GF2A 3QEAZ 1NMYA 1LS1A 2QX8A 4R2LA 3F74A 2NVUB 1G291 2F8LA 2A30A 4UPEA 1J8VA 2XZPA 5JQGF 3SYTA 2G1PA 4M1OA 4B2PA 3KKZA 4I1IA 1VLQA 4PNZA 4HDSB 4UNNA 2CXUA 2GEFA 2AIRA 4JR2A 2HAEA 2HRDA 4B9EA 4BE7B 4P58A 2D1QA 4G26A 1XU7A 3W2HA 4GSKA 4OYLA 1NL3A 2O7RA 4B8YA 2DMRA 4WKPA 4L51A 4EECA 3O5AA 2B4RO 5TPZD 3EE6A 3TDKA 4FC6A 2NSYA 2GXQA 1TE2A 2BZGA 2VHXA 1AZTA 2XQJA 3F3KA 4TYQA 1WB9A 3I23A 1BIFA 1GQRA 2J33A 2QMOA 2I3ZA 2RHBA 4I2VA 4CKWA 3ZWYA 4MQEA 5FFMA 4HZGA 3DOJA 2V0GA 3L40A 1KC1A 3UW1A 4JXZA 3SK0A 3VR4A 4D74A 3C7CB 3CE9A 1UFKA 3H4VA 4JJGA 3VU9A 4MVJE 1RWKA 2PZGA 3GLHA 4HMQA 4V3BA 1U2TA 3T1QA 3R3JA 3K0KA 2I7VA 1IZ7A 2P1RA 5JAOA 1EP9A 2GJKA 3TRJA 1RWNA 4BNDA 3OE5A 5EHQA 2WUDA 4FHFA 3VA7A 4Z0NA 5ALNA 1JRLA 3WGTA 2W2KB 4E32A 5JROA 2OM6A 3W4IA 5B58T 4W63A 1FYVA 1U2EA 3QPAA 1EBFA 3WYFA 3MD0A 3N74A 2GDJA 2XDYA 3OTHA 1V43A 4GI7A 4M0MA 1F8XA 2B37A 4MR8A 2JH3A 4PRLA 5BV1A 2UUOA 2OXRA 1JTFA 5TF4A 2V7QD 2ZBDA 1ZOOA 2AE1A 1DHRA 1CJVC 4IIVA 3BHNA 3X1KA 1B15A 4IIJB 5ICFA 1O95D 4OOFA 2PSJA 2CVFA 4HFNA 4JD5A 5EKXA 4GOXA 4BKOA 5IJ9A 4PGMA 4QNMA 3MTIA 2XD9A 2GYYA 1TEZA 2GCEA 3PFNA 4RE5A 2OCIA 3VNQA 4DXDA 4CHGA 2JANA 4G0XA 5IMSA 3P7MA 2MTBA 2HLDD 3L7CA 3BFJA 4X6LA 5B2EA 2R4TA 4PLVA 1I8TA 1NRIA 2E4AA 3NATA 5DLEA 2NYVA 3BRCA 5C8YB 1WDWB 1VP9A 3EUWA 3QX8A 3HLKA 2GTIA 1GSOA 2RCNA 2UV8A 3KSMA 5F1OA 4EVRA 3KWMA 1MJNA 5ILQA 5HOQA 2BHNA 3HY4A 2RH4A 1F6BA 3AR4A 1KR5A 2QY9A 1SG0A 3VVMA 3EBPA 4RSGA 3QY0A 1I5OA 3AIMA 3DFMA 2JH8A 2OLJA 2Q5FA 3HJAA 2WF6A 2XXBA 4JLUA 2HN9A 4XASA 4DTCA 2AZXA 3ZCQA 4YJGB 3BCHA 1T43A 3SZUA 5I7AA 4TXNA 5IVKA 4RVFA 1HDOA 1LUAA 5HBGA 2B21A 3O7WA 4RESA 4D79A 4UOZA 2ZIEA 3Q6IA 1EHCA 5ESRA 2ECFA 1KFKB 5BW8A 2WSYB 3DMFA 4P1ZA 2V97A 4QLAA 1D5WA 4A27A 2VJNA 2BMAA 2KLHA 2BFAA 5B2ZA 1HE3A 4C78A 2NTVA 1ZEMA 5HEKA 1G21A 1F48A 4LKRA 5E9JA 1R0LA 5AVSA 3CRRA 4QBKA 4FNMA 3DV0B 2R8PA 1Z5PA 1LLQA 3G2NA 3HMKA 4RFLA 3AF2A 3DOOA 3PVSA 1Z8HA 2XV1A 4MR9B 1T0JB 3TGLA 5LDHA 4BCCA 3H84A 3HADA 1RADA 3X2FA 4BUCA 2YIVX 2FF5A 3SR0A 5DH9A 3D2AA 4ZVUA 4G9GA 5FCDA 4AD8A 2VDRB 3A4TA 4X45A 4EGJA 1ORTA 3G6WA 2J07A 4M87A 5E6SA 1JQKA 5IRCD 1Z29A 3CB4A 1KK0A 3D8TA 4X20A 3ZS8A 2APJA 5C8ZA 1ZSNA 5BV0A 4AN4A 4DRXA 1TJ3A 4TLDA 1ZU5A 3BS4A 4QFMA 1U7ZA 2G06A 2BFFB 1EA5A 2I99A 3ET5A 4LTMA 3EF0A 4DJTA 1VJCA 2YJNA 2QR5A 1ZVMA 4EELA 4EY7A 4RM2A 3FYUB 2ZP1A 2UZIR 1JSCA 2JKVA 4TTTS 4YRPA 4OQFA 3KYBA 3OZWA 4Z86A 3S28A 4EUHA 2VZ8A 4ENPA 1JSRA 2GARA 4H59A 3RW9A 4E4YA 4XPIA 1A3CA 2A59A 3BIXA 3URMA 3ETGA 4PG5A 2B1GA 9LDTA 4IG4A 4XYMA 4R3UC 5JR3A 2JLSA 4FYKA 4V0QA 5AIBA 2W93A 2JFNA 7MDHA 3IAXA 5KDDA 3K5IA 3T52A 2F55A 3PFHA 3F5FA 4FEGA 3PR3A 1NTRA 1RFLA 2CFOA 3PB3A 3QHQA 5C0OE 3WWPA 3VI4B 2YZKA 3GFRA 1SCQA 4BQPA 4LZWA 3R0ZA 1F4LA 2VQ3A 2RG7A 3PEVA 2VDKB 3AYZB 4ZU6X 3U3MA 4TV8B 4XEHA 4DSUA 1Z56C 2O20A 3C70A 3RTCA 2UDPA 4F1KA 3A4NA 4CF4A 4KXYA 1G8KA 2WNSA 3ZGNA 2W2OA 4HNAB 1RP7A 4P31A 1G8FA 3UK6A 1IG3A 1Z39A 3PGMA 3W6ZA 3QSGA 1ZICA 4K1LA 3R5SA 2LW7A 3ILYA 3KEFA 1QQTA 1KORA 2LRHA 2VOJA 4YRRA 2JLXA 4BHTA 2PX5A 2J9RA 3E1KA 4ALMA 3IP1A 5ALOA 3TMAA 1A88A 4U2KA 1ZH0A 5CNMA 5CPBA 1YVPA 1GDHA 2I67A 3DL4A 5HWSA 2R47A 1H0KA 2WF5A 4ARIA 1LBSA 2DTEA 2HDWA 4D0SA 1E2KA 1TKAA 2BF4A 4IM7A 1OREA 1JF8A 2GBGA 3ZCTA 3G59A 4O2RA 2ZR8A