5BW8A

2.8 a crystal structure of a get3-get4-get5 intermediate complex from s.cerevisiae
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
349
structure length
320
Chain Sequence
TVEPNLHSLITSTTHKWIFVGGKGGVGKTTSSCSIAIQMALSQPNKQFLLISTDPAHNLSDAFGEKFGKDARKVTGMNNLSCMEIDPSAALKDMADLTGSIPGIDEALSFMEVMKHIKRQEQGEGETFDTVIFDTAPTGHTLRFLQLPNTLSKLLEKFGEITNKLGPMLNSFMGAGNVDISGKLNELKANVETIRQQFTDPDLTTFVCVCISEFLSLYETERLIQELISYDMDVNSIIVNQLLFAENDQEHNCKRCQARWKMQKKYLDQIDELYEDFHVVKMPLCAGEIRGLNNLTKFSQFLNKEYNPITDGKVIYELED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/transport
molecule keywords ATPase GET3
publication title Mechanism of Assembly of a Substrate Transfer Complex during Tail-anchored Protein Targeting.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain rm11-1a)
total genus 110
structure length 320
sequence length 349
chains with identical sequence B
ec nomenclature ec 3.6.-.-:
pdb deposition date 2015-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02374 ArsA_ATPase Anion-transporting ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5bw8A00
3RRYA 4G3XA 3NC0C 4R2HA 3PR1A 5TY0A 3THWB 4A2QA 2OBLA 2OFOA 1UBEA 1Q1QA 2JASA 3UMRA 1KY3A 4U5XA 4B76A 3A1UA 4KAXA 2FSHA 4KFUA 3CX7A 3T1TA 2AWOA 4MITA 1BS1A 1VG0B 4Y0VA 1I2DA 1XEFA 4HAVA 4C0JA 4DRZA 1IY1A 3I32A 4OKSA 4UNPA 2EWWA 1N6HA 2G77B 1C9KA 4NCJA 2ZPTX 1C1YA 3B6EA 4CZ2A 1WF3A 2WWHA 2CVHA 3WBKA 4LOAA 1RRPA 4GBMA 4CT4B 1NBMD 3NG1A 2IEZA 3EARA 3QBTA 1P3JA 2GNOA 2ZR0A 3MUFA 1XF9A 4JZKA 4NCHA 2QRNA 3AVVA 2GEVA 3A4NA 1X6VA 3WY9A 3K70C 3RHFA 1W2GA 2D7DA 4C9BA 4JT4A 4MUAA 2J7PD 5BW8A 1PLJA 1IJEA 4D26A 3O47A 4G01B 2JDIA 3RVBA 4KFTA 1DE0A 4L5BA 1Q44A 2W6JD 5JWHA 2G1KA 5CDFE 1J8MF 3AKEA 2YKGA 3ZQ6A 4IEIA 2IXGA 1N6KA 1G3RA 3K0FB 4KHZA 1OHHA 4HAWA 5KHOC 2AFHE 1EX7A 1KO8A 2J46A 4HDQB 4ACAA 2RB4A 2O8CB 3EZ7A 4OQMA 4EPRA 1WBBA 4LHYA 5G41A 2ODNA 2G9NA 4MDFA 4GOXA 1SVSA 3BH6A 1DAMA 4IDQA 3Q3JB 5FUXA 1G7TA 4QBHA 4B47A 1NIJA 4B6EA 3A1VA 5JI2E 4OI2A 1E9FA 3OAAD 4PZYA 5CYOA 1RFLA 4LY6A 1M7GA 4PAOA 1IN8A 3KB2A 2IS4A 2ZYVX 3KKNA 3B2EA 3PJRA 3C15C 2A5GA 1NN1A 2ZSFA 1SZPA 1E79D 3CF2A 4D4LA 1KNQA 4F92B 3Q5DA 2O8EB 5KYKA 2CLSA 4JBWA 4BLOA 1NG1A 3HYTA 1MO3A 4R71A 2VSOA 3AV0B 3WMFA 2GAOA 1E2LA 1DG3A 4TZ6A 1NJGA 1E94E 2I3BA 3QXSA 1HH4A 2QT0A 4UNSA 3BXZA 3AF0A 4PO1A 4DDTA 5BN5A 2DWPA 4M8NE 2B8WA 4IXMA 1DG1G 3WNCA 2JLSA 2PZFA 4M9SA 1OH7A 1XEWY 2CLCX 3P27A 5GJBA 2LCFA 4BASA 2QMUA 1CP2A 2VH5R 4II7A 3VU9B 4HI0E 2I1VB 3HDTA 1M1YE 3HWSA 3TVDA 1ZVQA 4A6PA 1OH6A 1Z07A 3DKPA 4C3ZA 3RSOA 2Z4RA 1CR0A 3IHLA 1S9HA 4LI0A 5DLQC 5IT5A 1R5BA 4AD8A 3TW8B 1B0UA 2F3RA 2GCOB 1RRCA 2ZTSA 1J8YF 2YVUA 3O8BA 5L3QA 5SZKB 4NYJR 4FN5A 4WZAE 3PEWA 3GLHA 4FMCF 2OFWA 2BBOA 5K8UA 1Z0KA 1X8LA 1N6PA 3BBPA 3NDBB 3PEVA 1YZKA 2OV2A 2ZSDA 3UWOA 1VECA 3I8SA 4AYWA 4ARZA 4CIDA 1JJVA 2PCLA 3BC1A 4G0NA 5BN4A 4V0LA 2J5XA 1XD2B 3M4YA 1DEKA 4LBVA 3I92A 4IDPA 3U44B 1NN5A 3CH4B 3ZZUA 3JVUA 4O2LA 3CPHA 4DZZA 1S1CA 2WKQA 2OXCA 3CRVA 2H92A 1NKSA 1S3GA 2EWVA 4V0ME 3C5HA 3NIBA 2C96A 4G5OA 1OFTA 4LYFA 4Q4JB 2GCPA 2IYLD 2OM2A 221PA 3D31A 1E2FA 4X8OA 4DKXA 4XSGA 1LS6A 3GP8A 1H8HA 2JJ1A 4B44A 1VCOA 3KQUA 4BLSA 3QQ5A 4TTPA 2K5UA 1GRQA 4PPGA 3Q85A 3CWQA 5FOUA 5GADl 1A82A 3AVOA 3WHKA 1WB9A 1TQ4A 1DAFA 3BAFA 4JLOA 4YMTA 1HUQA 1GNQA 5FBQB 4AKIA 2J9RA 5JHHB 4DHEA 2PCJA 5E7MA 1QHIA 2FFQA 3SN6A 1G41A 1JALA 1TMKA 2IBMA 3SOPA 1PVOA 3KKPA 4QXAA 5TDHA 4KVAA 4ZIRA 1V5WA 1E9CA 4Q1CA 2V7QA 1D2EA 2QTFA 4POAA 4HZUB 1E98A 1ZM2A 1FPMA 4JLJA 3UKDA 4C0BA 2XX3A 3T1VA 3SQXA 1XB2A 2VP9A 3TR5A 1AZSC 2IUSA 3GLHE 4MDEA 1NVVQ 4K8OA 1O87A 3LY5A 1W2HA 2CVFA 2D4HA 5EXTA 2HDNB 5LB4A 3U3MA 1WCV1 1A5TA 3TR0A 2ATXA 4JLVA 3K1JA 1RW4A 3HR8A 2DWQA 2IYTA 4WAUA 3Q9LA 4LJYA 4JBYA 4PR0A 4I81A 2YC2C 3N2EA 2ZRGA 1DADA 1X1RA 3W90A 4KV9A 4NYIQ 1X1SA 3QEOA 1N6LA 3GEEA 4AKGA 4IOLA 4ZO4A 3RWMB 2RGEA 1WP9A 4ZCMA 4LZZA 5L8VA 3VNUA 1CBUA 1WBDA 1GUAA 2ODBA 1FL9A 1AGPA 1NVVR 1VIAA 3TK1A 2GA8A 5EZ5A 2XTNA 1T8TA 1HV8A 2BWJA 1WMSA 2IHBA 3H2YA 1Z29A 1N6OA 2NO6A 3BB1A 2YOHA 5CITA 1XEWX 5JZVA 4A0FA 4NCIA 3PXGA 2JAQA 4Q4AA 5TB5A 4NONA 2VP0A 4NYIR 4QFMA 3SC3A 4QKQA 3U3KA 2IEYA 4JVSB 1G4UR 4LX0A 1I2MA 2E9SA 821PA 5DIFA 4BFTA 2EVWX 5AUQA 2JLZA 4C7OA 2GKSA 3I73A 3CUEF 3FB4A 3ZIAD 3K0EA 1CR4A 4IFBA 1TU3A 5H70A 2NGRA 4ZDJA 1FW6A 2ZJ5A 4YC7A 1W0JD 1W7AA 5L3RA 5HKKD 2FF7A 2J1LA 5EXPA 5C2JB 1KKLA 3PIRA 1NN3A 3BORA 4D82A 3GJ8A 4JS0A 4RCYA 2IWRA 2AX4A 4QBGB 2YYZA 3GEHA 3EW9A 1TADA 1ZINA 3WMGA 1KHTA 3AB3A 3AUYA 4A2WA 1XZPA 3TNFA 1D6JA 2BEJA 2WMNB 1X8KA 2JJ8A 3FHOA 3KL4A 1G8FA 1GTVA 4D0GA 4LHZA 2AHOA 1S96A 1D2NA 1KNXA 1GM5A 1KKMA 2BBTA 1ZIPA 4HAXA 1ZM4A 1XP8A 3VAAA 3AKDA 4HLUC 4YMVA 3F3YA 3QKSB 1F6BA 3THYA 2ZQ5A 1OH5A 1CJVC 1R2QA 1A4RA 2WJHA 4FINA 4QHSA 2ZI6A 3RLFA 2A7QA 5L3QB 4XWKA 4PC6A 1FP7A 2GZHA 2ZRIA 2AR7A 3GLHB 1U90A 1OFUX 4HLUA 2PX3A 1DO2A 2OCYC 4J0QA 3SDZA 1G6OA 4KO8A 5JCPA 1UPTA 1SKYE 3QE0A 2CE2X 4TLAA 2JA1A 1Z28A 3WRYC 4A4DA 1R6BX 1NMYA 2GVZC 4B74A 8OHMA 1KDRA 3BD9A 5LD2C 4ZCIA 4PO9A 3A4LA 3MWYW 1UBCA 3Q7QA 1KIMA 3FYHA 4D0LB 1OB5A 1ZP6A 2FU5C 5EP1A 3U5ZB 3PFIA 3PEUA 3CX6A 3IBGA 4WVFA 3B78A 2JLRA 4MGKR 1G8PA 2VHTA 1Z6YA 5ANRB 4ZKDA 1E4YA 2FSGA 2OHFA 3B60A 4DIEA 2HV8A 5KO2A 1E1RD 5GVRA 1N5KA 3ZLJA 4MKIA 4UNQA 4DT1A 1E2NA 3K9NA 2FDCA 3MJHA 4TMZA 2FOLA 2RHMA 5DI3B 2WAYA 1I4TD 5KNBA 1SVKA 2PX0A 4NPHA 2O0HA 1E0JA 4LV6A 1OXXK 1KSHA 1XEXA 1FNMA 1P72A 2O5VA 1S9DA 5B2ZA 3AVQA 3E5HA 3AKCA 4ZDKA 1LFDB 3CZPA 3EPLA 2B21A 3AF1A 2CJWA 2AN9A 2WWYA 2WSSD 4URUR 4TYWA 1D9XA 4PSKA 4Q4LA 4DJTA 1K5GA 2OE2A 4MA4A 4TT3D 4TL7A 4CVNA 4JLPA 3W34A 4DCSA 4A36A 4TL9A 4TN1A 4Q9IA 1Z83A 1W49A 4IDOA 4B3DA 2QP9X 4Q9LA 4MKFA 4PC7A 1IOZA 1TTTA 3MGCA 1AZTA 2PZGA 5CLQA 2JIZD 1ZNWA 5EE3A 3A4MA 4BZXA 1JNYA 1SVLA 3FKSA 3QJYA 3QXJA 3WBJA 3A37A 1MT0A 4DLYA 2WV9A 1ZU4A 121PA 3EIEA 4BFZA 4AI6A 5E7IA 1GILA 2VHJA 3VR2A 3L0PA 1CJMA 3T5GA 2EYQA 4UXJA 1HY3A 1YR8A 5FL3A 5SZIA 2IXEA 2WSMA 3NDPA 3SE0A 1SXJD 4FD2A 3LBNA 5D3QA 3GJ7A 4Q5IA 2WOOA 1EXMA 2DCUA 2WPDA 5HZKA 2CNWD 1Q21A 4CEJA 1CJUC 3KQLA 3AVXA 2PT5A 2ZRAA 3DKVA 1JAHA 1L8QA 2B6HA 4ESVA 3CPEA 3LX5A 4NH0A 5FPYA 1DELA 1GRRA 1ZAKA 1COWA 1FMLA 2AXPA 1NRJB 2ZUCA 1E2DA 1T4GA 1Z6TA 3GLGE 4ZDWA 4PZLA 4CEIA 4Q4AB 3QUSA 3VMFA 4EFLA 2J0SA 4NE2A 4JMPA 3FHCB 1KMQA 4KCGA 2O8BA 2XTZA 2HJVA 3FWYA 4US2R 4WBSA 2F43A 4LYHA 5BWMA 4WXPA 1SKYB 3T15A 1RKBA 4QGHA 3SBEA 3FMOB 1XJQA 1ZUIA 4DDWA 3CRW1 4ILEA 2ANCA 4D0NA 4HSEA 1G8HA 3P20A 3QF4B 1NSTA 4EPWA 5FBLB 5LPNA 2KSQA 1XTRA 2R8RA 3UK6A 4IOMA 3V9PA 3KUDA 5FOVA 3BGWA 4M1SA 4RFSB 1JAIA 2RGXA 4KBFA 5F2EA 2B7BA 3ZZ0A 1P9RA 2C9YA 1R8SA 2KE5A 2OXRA 1BKDR 3CRMA 3N2IA 3PUYA 3FTQA 3J81k 1NI3A 1R8QA 3FGNA 3LV8A 2QMHA 2VHCA 1LVGA 4B32A 3KJGA 3BFKA 1LF5A 1RYFA 3QENA 2O0JA 4HDOB 4S2EA 1FNNA 3CNLA 3KFVA 2VQSA 3P4XA 3VFDA 3F5FA 3THYB 1T3SA 5CB6A 1GIAA 1TEXA 2IYRA 2NO7A 5DE3A 5KSYA 4IW3B 5JECA 2BM1A 4Q01A 1VCMA 1CTQA 1FQJA 1XFAA 3RANA 2ZE7A 3NBXX 1N3BA 1P62B 2ZJAA 2QPTA 1Z0DA 2CLDX 3G5UA 3WNDA 3WNBA 1GDDA 4A82A 1X8JA 2VP2A 3B9QA 621PA 1ZU5A 2JLYA 1XD8A 2HT6A 2KJQA 2J0UA 1HEIA 1OYWA 1G7CA 2O52A 2VSXA 2C9CA 2ZUDA 4QGFA 4JSTA 3SEAA 1T8UA 2RCNA 1JR3A 4C2UA 1CJTC 5J4HA 3ZGXA 1XPUA 3MLEA 3FMIA 1Z2CA 5BYKA 1TAGA 2Q9CA 2RKOA 5KDLA 5AJWA 2B7CA 3KKOA 4NMMA 3RNLA 4TQAA 1IHUA 3KQHA 5CJ2A 1NNEA 3GMTA 4CEHA 3VX4A 4KODA 1XMVA 1UEJA 1UKZA 4F4IA 1GFIA 3ND8A 5KOYA 1Z0JA 5BYJA 4DSNA 3QOFA 1QG4A 1VYTA 4RKEA 3BJIC 1MABB 1AS0A 4DLUA 3FHTA 3PUWA 4PQFA 5FUYA 1L2TA 1Q20A 3H0KA 4PQRA 5GJCA 4EJSC 2VRWA 3PEYA 2JJ2A 2XZPA 4ASUD 4G1UC 2PL3A 2O8FA 1G3MA 4Q9JA 4CDGA 1F60A 2PH1A 4DT1B 1W36C 2WWWA 3QG5A 3TKLA 3GLGB 2JCSA 2A2ZA 2HLDA 4RY2A 3RDPA 4PC2A 2D06A 3X1YA 1WDTA 2CXXA 3AQ4A 3C7KA 5EXSA 1CRQA 2EU8A 3GQBA 2ZS8A 3QPVA 2REOA 3CF0A 4B43A 4EJSA 4E5UA 5KPJA 4E09A 1XEXB 3BWDD 1W0KD 1U8YA 1VG9B 1XMSA 2QN6A 4A9AA 2ORVA 3GFPA 1X3SA 2ECKA 3PVSA 1E0SA 1NL3A 3CW2A 2OFXA 1CKEA 1KK0A 1RYHA 2X2EA 721PA 2BBWA 5FBRB 2FFBA 2HT1A 3I62A 2UKDA 2Z43A 3LRPA 4KLNA 5B57C 3T61A 2ZJ2A 3PCRB 2GEDA 4QG7A 2UZIR 4B3FX 5J4YA 4LJ7A 5F98A 2FFHA 4TWZA 1R5NA 3GCGA 4H9GA 2OLKA 2W0SA 1XTKA 3QIAA 1F2UA 3EASA 4OHXA 4C30A 5HPYB 2R6DA 2CL0X 5TMPA 1P2UA 2YWGA 1CRPA 4UQOA 3BH7A 3OEED 2HF8A 1NY5A 3RRZA 1EK0A 1T0HB 4TL6A 5DO9A 4QM6A 4A0GA 5A0FA 2H5EA 2H16A 2W0MA 2KBFA 1Z6XA 4GSYA 1AS3A 2FG5A 5EE1A 2QP4A 1EG7A 4OQXA 6Q21A 4FWTA 3B85A 2XEXA 1AIPA 2ZRJA 3UATA 1UJ2A 2ZR7A 5H1YA 3W3AA 2ZRLA 1XJCA 3KJHA 3L82B 4CEJB 2QAGA 4IEEA 5J40A 4RCZA 5IHPA 4LJ9A 1HT1E 3BFVA 4BZQA 4DEXA 4P0TA 3EXAA 2F3TA 1DOAA 4M1TA 5FL7D 2ZRPA 2WJIA 4X8LA 2VHQA 1K6MA 1U99A 3ZH9B 1EFHA 3TSOA 4CEIB 2EFGA 1H8HD 2YWHA 1SKQA 1EFRD 1S4QA 2O8BB 4OQLA 2P0EA 2QE7D 4XSHA 5JRJA 4A0HA 1TU4A 2F43B 3AVUA 2R6FA 3D8BA 4V03A 1RVDA 4LV5B 4ZPXA 2GF0A 1CLUA 3IPXA 3IUYA 3DO6A 4JBXA 3M0EA 3WYGA 2O8DA 4DC9A 1IM2A 2XOKD 2UZ3A 3KJIA 4NL4H 2VF8A 1GKIA 1OIWA 5F9HA 2BOVA 2FV8A 2VBCA 4EAQA 2REBA 4Q1EA 2Q3HA 1P60A 1IN6A 4U7DA 1N0UA 1IXZA 2H1LA 1T0JB 4BECA 2KI5A 2JEOA 1X86B 2RHDA 3CNNA 1XPOA 1BH2A 1DVRA 1LNZA 4ZKEA 3LAWA 4I1SA 2R65A 3DMDA 3P26A 3KZ1E 3U2QA 4WZ6A 4BFVA 4F38A 2NMVA 3W6PA 1KAGA 2Q6TA 3L0IB 1RC8A 3ZS9A 4TZ0A 4WOPA 1ETUA 3ZQJA 1Z5ZA 2IK8A 3QXCA 4B35A 4DXAA 1P6XA 3SYNA 3CX8A 4HLCA 4AG5A 3AUXA 1N0WA 3AVTA 5L3SA 3TQCA 1G7RA 1WQ1R 3QVVA 2OO7A 3QG1A 2CK3A 3P32A 3Q5EA 5JWOA 1J2JA 3ADCA 2V6IA 4BWYA 4CGZA 3D6TB 1QVRA 1W1WA 1TF2A 3UWKA 1U0LA 3VX3A 1KO5A 1JQLB 2OESA 2J0UB 5FUWA 2W6ID 2DFKB 3IIJA 1KSJA 3RS0A 4BE7B 2NZJA 1W46A 3L2OB 4US0R 4NTZA 1UAAA 2H17A 2CL7X 2P65A 4JLBA 4MRPA 2ZSAA 4NYJQ 4PHGA 2ODEA 1TPZA 1PLKA 5IK2D 2W2XA 1ZW6A 1NG9A 1KK3A 2D2EA 2ZSEA 4CEHB 5AJVB 3AKYA 2MSDB 1U94A 4TYNA 1MRSA 4B2IA 3BE4A 1FX0A 2CCKA 2YZ2A 2OAP1 1VKJA 1ZMXA 4P4TA 1OKKD 2BBSA 3DMNA 3M6AA 4FXPA 3B7GA 2B8TA 4UXIA 2NO0A 2WM9B 4PAMA 5AUOB 3GLFA 2IYZA 4XOIA 2F55A 4LHWA 2BMFA 4URWR 5EUQB 1G8YA 3L8ZA 1XXHA 4YDSA 3GEIA 3R7WA 1JBKA 4Y0AA 2DYKA 5FBVB 4HB2A 5FR1A 4CRWB 2ZSBA 3P4YA 1ZCAA 4IRUB 3DM9B 2I1QA 1N2CE 4Z1MA 3KKMA 4KBGA 4P4SA 2RMKA 3I5YA 1F48A 2GEUA 3KX2A 2A3RA 5C18A 4BFWA 1T91A 1VPLA 3S1AA 1CIPA 1MV5A 1G6HA 3OF5A 4LBZA 5FFMA 3HJNA 2ZYTX 3EC2A 5AJZA 4PPFA 1GWNA 1LF0A 2OBNA 4IOKA 4DVGA 4KSBA 2AKYA 2ZJYA 2C9OA 3FPAA 4IHQA 4LK2A 2F1JA 2ZRBA 1F2UB 1OE0A 3RC3A 4LHXA 4B6FA 3OEHA 5C46F 2QPAA 2IA5A 3R8FA 5DISB 4EPTA 1ZCBA 2YOGA 2XAUA 2D7CA 1Z0FA 3MWLA 1QF9A 2WZQA 4PHFA 1ZM9A 4TSFD 3CRQA 4D4JA 3LA6A 4KLZA 4Q18A 5DSZA 1GL6A 4GFDA 1KO7A 1HE8B 5TXGA 1CXZA 3U3RA 1T6NA 3DZ8A 4OJQA 4M9XA 1DBSA 1PLLA 1QVAA 2EFDB 2X77A 4HUTA 5HZHA 5KSOA 4NYMQ 1CS4C 5B30A 2PMDA 5JMTA 2QAGB 1R0YA 5EJEA 4PHHA 1N0VC 5GJVC 4F91B 1RPZA 1U0JA 3MWKA 3ZD7A 3B1WA 3C5CA 2JLWA 2PBRA 4JLAA 3GLFE 1KDTA 2MMCA 3DDCA 1M74A 2Q3MA 3SR0A 4BFYA 2IS2A 1DAIA 1Q0UA 3RS3A 4TYYA 3SYLA 2YINC 2NZ8A 2P5SA 2GWHA 3BOSA 3H86A 4WW0A 2QGZA 3BH0A 3C8UA 3PG5A 3GJ3A 4IXNA 1FMJA 1DAKA 2FPMA 2VF7A 2W00A 4EFMA 2WWXA 4TLBA 3IIKA 3EWAA 1MO5A 2W2VA 1NBMA 1OFIA 3SJAA 1Q12A 2BMJA 5JRZA 3SQWA 2WJVA 1XTQA 1E4VA 4OK5A 4NYMR 3TE6A 4RD4A 1J90A 1Y3AA 4M4SA 4B2LA 1G9XA 4LHVA 1G5TA 4QM7A 3KB1A 3JZMA 5J4VA 1GITA 1S2MA 2O8DB 4AWXA 4OI0A 2J7PA 2ONJA 1IQPA 1R10A 4DB2A 1IY0A 5CB8A 1W5SA 1M7BA 1MR3F 2LKDA 5CJPA 5DGXA 4F4JA 2AK3A 4US1R 4KITB 2W6JA 3CRRA 2RAPA 3UG6A 2WJJA 2AD5A 3LVRE 1KTVA 4OQNA 3TAUA 2ZEJA 2AL7A 3WP0A 1L4UA 2G3YA 2V4ZA 4M53A 3ZYCA 5JHGB 3KQNA 1M7HA 1KOFA 3TQFA 5E3HA 1ZIOA 4EPVA 1O3YA 4K46A 1F3OA 1SVWA 4YXWD 1OIXA 3K70B 1R5OA 5EQTA 1EFCA 2J87A 3UANA 3ADKA 3OAAA 4IDNA 4Z8XA 2CDNA 2WWFA 4PTLA 1T9HA 1DS6A 4JL6A 3ICEA 2VP4A 2ZS7A 2VP5A 1AM4D 1PUIA 3HU2A 1EFUA 1JJ7A 1E79A 5L3SB 2XSZD 1FP6A 4OBEA 2LKCA 3CM0A 2IYVA 4PO8A 1WRBA 1YZGA 3FVQA 3TSZA 1QHGA 3NWJA 4KJZA 5J4LA 2BV3A 1HT2E 3O8CA 4RD0A 3BB3A 4P3YA 4D25A 1QBKC 2G0TA 4LV8B 1JQJC 1PJRA 3F0TA 1JI0A 4NCKA 1KSGA 5EE5B 521PA 1E2EA 2HF9A 2BEKA 4Q1AA 4ESHA 1P9WA 2FJUA 4LYJA 5C4MA 2QT1A 2C99A 2R9VA 4F93B 4BFXA 1NBME 1E2HA 4PPNA 3WXMA 3SHWA 4DLRA 4GP6A 4AK9A 5KPDA 1KDOA 1QHSA 2BKEA 4MRSA 2ZAOA 3OIUA 3SS8A 1EWQA 2DBYA 2F1HA 4LJ4A 3AF4A 4JYBA 4Q1DA 2DFNA 2NIPA 2ZETA 5EE0A 1U9IC 1G64A 2ZRHA 4DCUA 1E0KA 3I4LA 3I72A 2ZS9A 4KVGA 4QRHA 3L43A 1FX0B 1E69A 2XJ9A 4DLSA 1DAHA 1UKYA 2Z0MA 1P75A 3W6OA 4PAQA 4D80A 2C98A 5M04A 4HATA 3LO5A 1IN5A 1ZRHA 1E2GA 1ZYUA 4DUGD 3EAQA 1ZC3A 3REGA 4E07A 2QTHA 1NVUQ 3W5IA 4X8HA 4JT2A 3PENA 3GLFB 2WOJA 4B3XA 3KXKA 3HU3A 3TUJC 3VHLB 3R7WB 1SULA 3UPUA 1E2IA 4XD7D 3U3OA 1CJKC 3GJXC 1N5JA 2RGCA 3N70A 2CBZA 2PZEA 1KSFX 4V0NA 3C14C 2RH5A 4TYQA 4ARZB 5EXXA 4P4SB 2FMXA 1TUEA 1QHHA 3OE7D 3G0HA 1N5LA 2ZRDA 4NDZA 4QGGA 3VR4A 3S1AB 1ONBA 2IS1A 1E1QD 4AY2A 4GZLA 4YONB 5CK4A 3QPWA 3NBZC 4HLQB 2O0KA 2G88A 4CW7A 1CEEA 4AIIA 4KSCA 4QL3A 2GJ8A 2CCJA 4KYUA 5EP3A 3RABA 3B8HA 3ONWA 3X1DA 4G5QA 3VHXA 1FQKA 4MKGA 5KTYA 3SJBA 4NZYA 4B3CA 3IO3A 1LY1A 5EE9A 1E9AA 1YZLA 3K0AA 1YR7A 2C8VA 4TLDA 3GPLA 2C95A 2ONKA 1OB2A 1E0AA 3AF3A 5FTLA 1W47A 1LW7A 4AYXA 4DLTA 5DN6D 4E22A 3T06B 2QBYA 2OCPA 1CR2A 2MSEB 1ZNZA 1YZUA 1GNPA 2CHQA 3JVVA 4JL8A 2CMKA 5E4FA 3K0SA 1BMFD 3QF7A 5EUMA 4DLWA 5H8WA 2GXUA 3VR1A 2YC4C 4Q4HA 1JXOA 1Z06A 3GD7A 2IYUA 2ZANA 4I1UA 1GP2A 3LLMA 1IY2A 4MH0R 3ADDA 2ZI9A 2RGAA 4ZIRB 4EIWA 2UVQA 1OIVA 3RC8A 2JLVA 4OYHA 3C41J 1A2KC 3QBVA 3EIQA 5DHFA 4BFUA 4MRNA 1A1VA 4JVMA 2VA8A 3NKVA 1ESMA 5F3WB 2QRZA 3TGPA 2NTYC 4DCTA 5H68A 2JLQA 3A58B 3MWJA 2RGNC 3K9GA 1KGDA 1Q1EA 3AF2A 5KUTA 1E2PA 5G3ZA 4DSOA 4HEJA 2XNDD 3FE2A 3IBYA 3OESA 1DTSA 2VSFA 1M8PA 1P4SA 1XWIA 4CYMA 5DHAA 4D2IA 3KXIA 3QKRA 2BMDA 3FFAA 2GK6A 2ZE6A 1FZQA 1MRNA 4M22A 3GLIA 4Q21A 4M9QA 3QPUA 2RGNA 3KUCA 4RVCA 4FMDB 1E9SA 1TQ6A 1T3HA 4UNRA 1KO4A 4LC1A 2QSZA 3P1JA 1E32A 1H8ED 1N6NA 2DR3A 1G17A 3BK7A 1NLYA 4W5HA 3FMPB 2IUTA 4HDCA 3OFND 3LD9A 3TW4A 1V43A 3QNUA 3SHFA 2FGJA 2QPOA 4Q7KA 4IJMA 4LPSA 2WKRA 1A2BA 4JKIA 4Z54A 3DEFA 2HYIC 2IXFA 2QY9A 3PUZA 3ZIAA 1DARA 3CIOA 2EFCB 4WXRA 4C7OB 2Q0HA 1W0JA 4O0MA 2ZIAA 1Z63A 5G3YA 3TH5A 1BYIA 1KI3A 1VHLA 2L0XA 4KU4A 3R9IA 4DIDA 1Z0IA 5HKKA 1XBTA 1G16A 2P67A 3K53A 5BN3A 2XZLA 3VKGA 1F2TA 1AQYA 1Z47A 5A5GA 3K0CC 3ASYA 1AK2A 2WWGA 2E87A 3EZFA 3KKQA 1G20E 4L9WA 4LYAA 3WMEA 2WICA 1E2QA 4JJKA 3CWZA 1KJYA 1M34E 1XCGB 3CO5A 4B3GA 2ZE5A 1TX4B 2ODWA 5AJXA 1US8A 3SBDA 1SVIA 3E70C 5E95A 3K0CA 2VPPA 3MSXA 3SI7A 4AC9A 3K9HA 1U8ZA 4O2RA 2J41A 3WYFA 1SHKA 4AKHA 1NVXQ 2F6RA 1YZTA 1GRNA 2PT7A 4MGYR 4UKDA 2WJGA 3TSWA 2GILA 1MOZA 1P61B 5FTMA 3GFOA 3W9YA 4B33A 4EQ6A 1XNJA 4DB4A 2WIAA 1KYIA 4M1MA 4QOSA 4XVQA 1Z3IX 2F1RA 2WMOB 3K0FA 1SVOA 2EQBA 3EIHA 3NHBA 2JDID 2ZRMA 3PUVA 4W9MC 3AGQA 5JBQA 2O8CA 3QKUA 1VHTA 3R9XA 3I61A 3FFBA 5JSZA 1KZGB 3A36A 1KDPA 4N0DA 4XWOA 1OHHD 1E2JA 1GKUB 1I4LD 3K70D 3TMKA 4GNKA 1QHXA 1D9ZA 4HAZA 3SYKA 5CK5A 1NY6A 3E2IA 2X19A 4H1UA 1OFHA 2OEPA 4BFSA 4ERNA 2LWIA 2Q3FA 1SHZA 5C4GB 1GSIA 2J0QA 4URXR 3KDSE 1EFTA 2Z5FA 4UJ5A 1Q57A 3HR7A 4L16A 2ZREA 2HUPA 2ORIA 3W8RA 5LD2B 1FUUA 4G5GA 1E1RA 2FNAA 3OHMA 3U60B 3B13B 2WJYA 5JEEA 4MYHA 3K0AB 4C0HA 4UJ3A 3ZS8A 3ASZA 3AGPA 3DHWC 5BQ5A 4EPXA 3I3SR 1FTSA 3HP1A 3LH5A 4HUQA 3NC1C 2QBYB 4PC1A 2FE4A 1ODFA 5CIQA 4QNMA 4WIAA 4Q7MB 3VQTA 3B9PA 4RD2A 1Z6GA 4D4MA 1WXQA 4Q4HB 2QM8A 5DYIA 4M2LA 2WSSA 4NKRA 3AP3A 2GXSA 5FOSA 4PQYA 2KBEA 2NPFA 5F9FA 4TT3A 5CM8B 2V8OA 4YMUA 2FX3A 2GCOA 3T12A 2CJWB 4RD3A 1W4RA 2BM0A 4YMSA 1OW3B 4QNRA 2HXSA 4B48A 2HEIA 1SXJC 1G3UA 2JIZA 2OG2A 1S8FA 3U7FB 4LPKA 2QMEA 4JLNA 4EUNA 1J99A 1JR3E 4V0KA 2GDJA 3W8NA 1W44A 3X1XA 2WTUA 4D81A 1L4YA 1XD2A 4OJKA 2A9KA 4P32A 1LTQA 2QI9C 5B64A 1DAEA 4MQBA 3QXXA 3FOZA 3NVAA 4PC3A 2P6RA 2DWOA 1SXJA 2IW3A 2Q9BA 1CULC 1W4AA 4M1OA 3QKRB 2FFAA 4FMCB 4Q03A 5EP4A 4C0QC 1NSFA 2GZAA 3T35A 3GLIB 2CNWA 2D3WA 4Q66C 3NBFA 3E1SA 3SU8A 2HYDA 1S3SA 5TARA 5D3MA 4YQFA 4R2IA 3KXLA 3LVQE 1GL7A 2ZUBA 4ZV4A 1J70A 2FPKA 2R2AA 4BLPA 1HQYE 2F7SA 1AA9A 2FSFA 1KJWA 5AUNB 5L3VA 2ZJBA 2G6BA 5CDFA 4XTRA 2QQ0A 1XRJA 2P3SA 4M1WA 5FI0B 2J59A 5KDOA 4KXFB 1P9NA 4LJ8A 2V6JA 2JJ1D 1ZC4A 4R98A 2D62A 4QBIA 2J3EA 4Q47A 2G1JA 5K8IA 4Q1FA 3B1ZA 3UMSA 3Q72A 3NTUA 3SJCA 2DB3A 2ORWA 2GXAA 3C4JA 5GVSA 2H7VA 2PLRA 2IYXA 5LDDC 3CR8A 2RGDA 2YOFA 1UADA 3KJEA 4QHTA 2VO1A 4HZUA 2VEDA 3CLVA 1H65A 4NU0A 1MO4A 4MRRA 4OQFA 4C0SA 2X1VA 4XWAA 1G19A 4GZMA 4TLCA 2IF0A 2V7QD 4C0KA 4ZI3A 3NH9A 1E9DA 1F2TB 1GVNB 4GMDA 2ATVA 3ZVLA 1E9RA 1F5NA 3LNCA 4JLMA 4NBSA 1W4CA 3AVPA 5FPSA 2ERXA 3K09C 1SXJE 1DAGA 5JEDA 4P4UA 2GF9A 2P6UA 2QZ4A 3BIFA 1US8B 4OHZA 3EZ2A 3NHAA 4MGZR 3LX8A 3M1IA 1SGWA 3X1ZA 4JYCA 5LB2A 1OXTA 2V54A 1YRBA 2WIBA 2ZI4A 5FOXA 1ELOA 2BVNA 3KTAA 2XXAA 4NCNA 4HLDA 4P33A 3OZXA 5C1BA 2R62A 4NHOA 3K09A 1OT3A 3NEYA 1RJ9A 4BQSA 2OCAA 4TLEA 2AXNA 2PEZA 4C0LA 4EQ6B 3K8YA 3EX7C 1AGRA 4DCVA 1C4OA 3RYTC 3R8CA 3R9WA 3EZ6A 5G40A 5K8LA 4BGDA 2ASEA 1IBRA 3NXSA 2P6NA 3Q7PA 5FH9A 3MD0A 3LLUA 4LC0A 5JSZB 2OILA 2GJKA 5JJLA 5JJKA 3B1YA 3W6NA 2I4IA 3LW8A 2V3CC 1UM8A 4N3NA 1LV7A 4L8GA 4L4UA 5FUVA 3RS2A 4TMTA 2DFTA 4W5WA 4F4CA 3U4QA 1II9A 3EPHA 2QEQA 2YJTD 3BRWD 1FOEB 2P2LA 3DOFA 1Z8FA 3SNHA 4QC2A 4BLQA 4H1VA 4LUCA 2F9LA 5KSZA 1N5IA 1IN7A 3KFXA 5FR2A 1D8TA 1YKSA 1CF4A 3TUIC 5AWFC 2V9PA 5IF9A 3ICQB 3IPYA 1II8A 5FOWA 4V0MA 1NJFA 1UKVY 1Z2AA 2Q21A 2PJZA 4B3BA 3EPJA 4DDUA 1XTSA 4ASUA 4AURA 3DOEA 2BKUA 1BOFA 1G5PA 4LBWA 5IDVA 3EG5A 3V4FA 1G3QA 3RRMA 1G4AE 4RZ2A 3ZJYA 2ERYA 3RWOA 1E2KA 4ACBA 1JPJA 3I1FA 4I99A 4BLRA 1ZNXA 2IYWA 1E6CA 2WKPA 2KWIA 3TLXA 2O8FB 4HUQB 3U7HB 1Q3TA 3VKWA 4QJ4A 1J7KA 3MAAC 4ITRC 4FCWA 4GP7A 4RJLA 1GNRA 4LJ6A 3ETLA 1W0KA 2KB0A 3IIMA 4E03A 1IN4A 2W83A 2QL6A 3IGFA 2FPLA 2D74A 4ZCLA 4EJSB 3VTKA 2VYFA 3B82A 3CZQA 3QKSA 3DL0A 4M9ZA 3RSLA 1S0UA 2Z6VA 1W36B 2C78A 1D5CA 1ZM7A 3B1VA 3BB4A 2XTMA 1K5DA 1R4AA 1NIPA 2QA5A 5HE9A 2V1UA 1BYUA 3EPKA 3IQWA 4PPQA 2A5JA 1PUJA 1WE2A 1U0HC 2N1BA 1UKEA 5DI9A 1ZUNB 3THOA 4DSTA 3U6BA 2H18A 3IHWA 1CU1A 4ZDIA 3OEEA 2GXQA 2J0VA 4N0EA 2IT1A 4N1AA 1TL7C 3UMFA 2RGBA 1U2RA 2V55B 2PMKA 1KAOA 3CB4A 4OHWA 3RRNA 3U7GA 1RE0A 1SXJB 1ZBDA 2OBMA 4URVR 3ECCA 1P2TA 1OV4A 1Q1ZA 3EA5A 1PZNA 1VCNA 4C4PA 2W2TA 1IAQA 4RZ3A 3IQXA 1ZM3A 4UNNA 3TBKA 5D3MB 4HAYA 4RZXA 4PZZA 1DO0A 3QKTA 5FL7A 5FPHA 1G291 4RFVA 3UIEA 3O8RA 2ZU0C 1G1MA 1KI6A 3HPRA 2IC5A 1EFRA 1GG2A 1KO1A 4M0LA 4B75A 1XXHE 2YHSA 2Q9AA 2QE7A 1AQUA 3K9LA 3A8TA 1KMHA 4GPTA 2QROA 4MGIR 4Z8YA 4TMWA 2XZOA 1NKTA 1ZD9A 1NLFA 1Q22A 4U00A 5DI3A 4NP6A 4LCBA 4JJZA 3NEJA 1KZ7B 2WWIA 2VL7A 2NQ2C 2OUKA 4A0RA 1YE8A 1UDWA 2OSBA 4C0AC 3GJ5A 2XOKA 5UKDA 2MSCB 1YRAA 1GZSA 3LXXA 5AK0A 3ZZTA 2GZDA 4TQUS 4QJ5A 4BPBA 1YQTA 4PXAA 2ZYUX 4LWZA 2GETA 4YDHB 3T5DA 1UEIA 3PQCA 2R6GA 1FFHA 4GRAA 4JLDA 5TVKA 4G5RA 2OCBA 4D6PA 5G53C 3AP2A 1G8GA 4OK3A 2AKAB 1TQDA 5GJWC 5JS7A 4RKFA 2XITA 1YR6A 5K8TA 4OHVA 2IYQA 2VHUA 4PANA 2YV5A 4LDJA 4PX9A 3ND9A 4O3MA 1E3MA 3OIYA 4OI1A 2ZROA 5FTNA 3SFZA 1OLOA 1SQ5A 2J7KA 3FMFA 4TMKA 4DWJA 4G5SA 4M1KA 3SJZA 1Z08A 1XCMA 1OSNA 1OPXA 2Y8EA 3FKSD 1HTWA 4TTQA 4B34A 5JWRA 4K81B 1XTJA 1N6IA 5JCZA 3REFA 2FEMA 2X8AA 3KTAB 4QBFA 2ZJ8A 1YR9A 2XXAB 2XGJA 4I1VA 1IXRC 2NG1A 4RD1A 2CCGA 4Q7JB 2SHKA 1YJ5A 2D2FA 3CBQA 3AVYA 1RJ9B 5CM9C 4KYIB 1UDXA 2WPDD 3CF6R 2BJWA 2P5TB 1XCPA 4TL8A 2BDTA 1N25A 4UXHA 5CYPA 2W6IA 3A1SA 3UXMA 2R44A 2BCJQ 4JLKA 1XD9A 3IDQA 2OLJA 5LBIA 2ZU6A 5J5CA 2XNSA 1WA5A 1COWD 3EWSA 1VCIA 2JLUA 4OHYA 3LQQA 1YZNA 3ZVMA 5IK2A 4EKDA 4AKEA 4GT1A 4EDHA 5HCNA 1XJ0A 4X8MA 5AUPB 3RS5A 3U4QB 4L9SA 2YNMA 4GMXA 3SZRA 1S1MA 2HXYA 3H84A 3WRXC 1P2VA 5TV2A 3QF4A 1YVDA 1EESA 1OF1A 4HB3A 4PSVA 4B2PA 1E99A 1VYVA 4JKYA 3V00A 1II8B 1OKKA 4DEYA 3VNVA 1KI2A 2F9MA 4IKEA 4ZI2A 4RFSA 2WVJA 1VDZA 3IO5A 1MO6A 3G82C 4JVLA 4XIGS 4JSYA 1U9IA 2G0NA 2IYSA 5DH9A 1VYUA 3I5XA 1TF5A 1YHNA 2BIFA 4CT5A 2IL1A 2X2FA 4HZIA 4DLXA 2CE7A 1HURA 1XXHB 1IONA 3PUXA 3QSYA 5AJYA 2DPXA 2R6CA 3ADBA 5FTKA 3N5CA 4Q02A 3A1TA 4Q9HA 2GTPA 3QEJA 2QGNA 1L7VC 4Q48A 4PFSA 1JEDA 3WP1B 1E2MA 1NVWQ 1OXUA 3EA0A 2QORA 4R9UC 2QMOA 4TMXA 2QP3A 1RRFA 4RD6A 1NLZA 3H1TA 3DVLA 4IVQA 4MRVA 3OIVA 2BCGY 5HR5A 1RRGA 3IEVA 4F7WA 3IKJA 5J4KA 1KI8A 3GFTA 4LJAA 1QDEA 4IVPA 4U02A 5BXQC 2GK7A 2FN4A 1GKYA 3DZDA 4PHTA 4RSGA 1QHYA 2FZLA 2W58A 4BEJA 3DPUA 4LBYA 4TQ9A 4ON9A 1OH8A 4TSFA 3TIFA 2PLFA 4YMWA 3I8XA 3CONA 3NH6A 4Q19A 2GVDC 5KSPA 3U6KA 3DM5A 4MYCA 3BFXA 1JR3D 4GL2A 1OXSC 3JZAA 5FBWB 4LJ5A 5ELXA 4HB0A 3AP1A 4A1FA 2JATA 1P2SA 1OJLA 4L15A 2CHVA 4RZUA 2CEAA 2A5YB 2QG6A 2C04A 3LBIA 4O25A 2GAAA 3GJ6A 2PJRA 1MABA 2R6AA 1PV4A 1R7RA 1R0XA 4A8JC 5FPTA 4BUJA 2V1XA 1KI6B 4WZBE 3T1OA 4GDFA 1KJZA 2FH5B 4BEBA 2GHIA 1NN0A 1M6NA 1HE1C 3L0SA 1OYYA 2B92A 5SZJA 3Q8XB 4HAUA 1Y63A 3CH5A 1CR1A 4FW9A 1VMAA 3RS7A 4URYR 3GLGA 1BO6A 1KMHB 2JJ2D 4GOKA 3LQRA 4P31A 5SZHB 2E1RA 2GJSA 2IHYA 5IRCD 4A8JA 3OIWA 1DPFA 4IVRA 1W48A 1IXSB 1II0A 4QGAA 1GOTA 2HLDD 3X1WA 3A6PC 2ZRKA 1MH1A 1P5ZB 2MMGA 1XTIA 4OL0A 1KI7A 1P73A 1TF7A 2QNRA 1YZQA 1P7CA 1JB1A 2WAXA 2AD1A 2NOAA 4BZPA 3AEZA 1W36D 2AFIE 4DLZA 4JIMA 2JLXA 1HA3A 2VIIA 1ANKA 4HYYA 4R7ZA 5AR1A 4XVRA 4I4LA 1JEEA 1Z22A 4YLGA 5FPKA 2IX3A 4Q1BA 2QU8A 4DBLC 4XVUA 2ZI5A 4EFNA 1RIFA 3CR7A 3VR6A 4YXWA 2FA9A 5DYGA 2GBLC 1KY2A 3TJZA 2FEOA 4BRUA 5JLJA 2A5FA 4C2TA 1D2MA 5KDDA 2G83A 2OZEA 4HB4A 4MUBA 4A15A 3D3QA 1ZD8A 4FI3C 4JVNA 4OK6A 3VKHA 2N46A 3LXRA 1U81A 3RS4A 2XSZA 1UFQA 4AG6A 3THXA 4I1OA 4XJXA 3LWNA 3W5JA 1E9BA 1JXMA 3A1WA 2IS6A 2GBLA 1TNDA 1ZNYA 2H57A 4A92A 5DNYB 2EFHB 2BJVA 2ZJZA 3LDAA 2QSYA 3MFYA 421PA 2GJ9A 2ZM5A 3THWA 4TTRA 2ZI7A 4V02A 4V0OA 3C16C 2QENA 2H8KA 3TUZC 1W4BA 1NP6A 1AKYA 1FUKA 2A30A 3UG7A 4A2PA 2VLIA 3ZDQA 3AH8A 2C5LA 2ZVPX 2ZYWX 1U98A 2OT3B 4QJ3A 3MMPA 2IF2A 3B1XA 3IEUA 4BLTA 1NMZA 5CIWA 3PITA 2BC9A 1AN0A 5EZ6B 2GRJA 2YWEA 3NBYC 4D4KA 1VG8A 2C77A 5JS8A 2OAQ1 1ZUHA 4JL5A 1T5LA 3HU1A 1XU4A 2BHRA 4Q7LA 4AYTA 4B73A 4S35A 1KI4A 2FSIA 4CF7A 5JI3E 3GLIE 1UF9A 3BS4A 1HQCA 5FOTA 1QZXA 4DUGA 5HCIA 5J47A 1JR6A 4Z51A 1N6RA 5CLLA 3MCAA 1G7SA 5EP2A 1EGAA 3KQKA 1K8RA 2F1IA 2VP6A 1RZ3A 4KFSA 2XB2A 2J45A 5FTJA 1KK1A 4XD7A 2WBLC 4W7SA 1XMJA 2AK2A 2IYYA 4KI0A 1UBFA 4OI4A 2IUUA 3FKQA 2AWNA 1E96A 3OE7A 4LSGA 1IJFA 2ZXUA 2HCBA 2C03A 2NPIA 2REXB 4LGMA 2ZRNA 1E1QA 1R0ZA 1Z0AA 2ZVQX 3RAPR 4A6XA 4FMBB 5JFGA 4W5JA 1QHHB 2BMEA 1T3LA 1TEVA 1NMXA 1QG2A 3MJRA 2YWFA 3CKLA 1SVMA 1UBGA 2ZJOA 5HTKA 4FCVA 1HYQA 1JPNA 1OXVA 1XZQA 3BERA 1KI1A 4GI7A 1XPRA 1EWRA 2O8EA 1VG1A 4FWIB 2CK3D 4DCNA 3SFVA 2GCNA 2HCJB 2PEYA 4XTCS 2EYUA 1XMIA 4IOJA 4PSAA 3QY0A 3QI2A 2IWHA 3ZVRA 3L8YA 4M21A 5DN6A 3CPJB 1LB1B 2NO9A 1KK2A 5P21A 1B23P 2GESA 5E7JA 3WYAA 1BIFA 2QM7A 3AVWA 1AKEA 3R20A 1BMFA 3X2SA 4DDVA 2N42A 3LW7A 3VU9A 2QUZA 2C2HA 5KNCA 1ESNA 1ZJ6A 1XX6A 3CNOA 5HE8A 2GJAA 3IILA 3TAHA 4B71A 4Q9KA 2EFEB 3ZVNA 2WHXA 4M1YA 1AJEA 3W3ZB 1LS1A 4Q00A 1JECA 1R0WA 2ZR9A 2ZAMA 4FCTA 1VTKA 1YU9A 1FTNA 2TMKA 4IFEA 2FWRA 5JJIA 1KI9A 4XH9B 3U3JA 5KNDA 4FIDA 4TYPA 2QAJA 1Z6AA 5FI1B 2JGNA 3EC1A 1GAJA 3GJ4A 1EX6A 3T1QA 1M2OB 1NF3A 2XNDA 3VR3A 2FZ4A 3D7MA 2FGKA 1W5TA 4A8JB 3LBHA 2DY1A 4ABYA 4BRWA 1Q1BA 5A4JA 4FMDF 2ZRCA 1QHNA 2Z83A 3O8DA 2EW1A 2XJ4A 2CL6X 2VTKA 3LFUA 4MKHA 4QHYA 1TQ2A 1ZD1A 3ZD6A 4DSUA 1TUIA 5KU1A 3U44A 4MYUA 2QTVB 3TRFA 4Z1MD 3QXHA 2RGGA 3F8TA 3T34A 2ANBA 3PV0A 3MRSA 4IDHA 3TVTA 2DHRA 3WHLA 4DLVA 2DFLA 3U7EB 3AM1A 1H8EA 2XB4A 2Z4SA 3FDIA 3OFNA 5B58C 4Q4JA 1U8AA 1QRAA 1E9EA 1XDBA 4LRWA 3V4RA 2ZITA 2A78A 3L0OA 3H4MA 2ZRFA 4WA7A 2QAGC 1GL9B 4GOJA 1G5RA 1T5IA 1A7JA 1G18A 1VIYA 3OEHD 4TMVA 3QVUA 4URZR 1AS2A 2ZI3A 2ZE8A 2NO1A 1MKYA 3EZ9A 4MYTA 1Q3HA 2A5DA 3HYRA 2CHGA 2HJGA 3THXB 3HPQA 4EPYA 1G21E 3B5JA 4KFRA 3GJ0A 3U61B 1G3IA 2QQEA 3VR5A 1I4DD 3MG9A
chains in the Genus database with same CATH superfamily
3L1HA 4G3XA 1MEJA 2CMFA 2IZ0A 2W2KB 5K6AC 2BEUB 5HJ2A 1EX9A 2ECQA 3W2TA 4QASA 1R6VA 3PR1A 4LDPA 3O9VA 1MCZA 4BPRA 3HEAA 1ZUWA 1FSFA 2JASA 2SCUB 1KY3A 4U5XA 1EVIA 3A1UA 1ULHA 4KFUA 2CSUA 1OZFA 4MITA 1VG0B 4MLPA 2ZULA 1TD9A 1ZXXA 4C2AA 4YRMA 2QZZA 3UH0A 1NJ6A 4DRZA 3JQAD 4OKSA 4UNPA 2AMFA 4X24A 2CFCA 3ZEAA 2EWWA 3CN7A 4E08A 2R1ZA 2ZSKA 5YASA 1C9KA 4F84A 2C2WA 5AD1A 3B6EA 1BSVA 1W59A 4ZO7A 3UTDA 4UOQA 3UUGA 1S2LA 3WBKA 4KQJA 1IMOA 1NBMD 2B8NA 4P53A 5CEFA 1CVRA 1QRRA 1TJYA 2IEZA 2KM1A 2N75A 1E62A 2ZB4A 3QBTA 4MI9A 2O3TA 3MUFA 4RL4A 5BORA 4N6GA 3A4NA 2O1EA 1X6VA 1I10A 2BCEA 3HLYA 3T4UA 4C9BA 4MUAA 1N1DA 3HFJA 3L41A 5DGTA 1XAJA 4CTOA 1HR0B 1PLJA 1I36A 1KERA 1XG5A 3JW8A 3B53X 4ILKA 3HO6A 5DTIA 4J3JA 4C4SA 4D26A 2I7XA 2NTNA 1H2BA 3IAS6 1DE0A 4TXHA 5CDFE 3AKEA 1ECLA 1FRNA 4GX5A 4DLBA 1Q11A 4BYMA 1OHHA 4HAWA 5EKDA 1TFUA 5KHOC 2EX0A 4KFCA 4HDQB 2JAOA 4MPJA 4ACAA 3T0IA 4OQMA 4IR7A 2FG6C 4Z7OB 1AKMA 4GOXA 3EIUA 3BD8A 1SVSA 3BH6A 4Z53A 3W06A 3DMYA 4MS3A 4QBHA 4B6EA 4OQDA 4R8VA 4IG9A 3RVQA 3JASA 1V8BA 1IN8A 3K2EA 1K7YA 3PWTA 3RUIA 1QANA 4DCOA 5I7EA 1EWTA 3OOYA 3WLOA 2Z4TA 1M1NA 2Z95A 1USIA 1UWKA 4BB0A 4S3MA 2JIBA 4LHEA 4XWTA 1I1OA 1PFVA 3HWWA 4QAQA 4IH9A 5AT1A 4EG7A 3OTHA 3P97A 4JBWA 4MR8A 4X97A 1EHCA 2ZTLA 2BSAA 3AUTA 4R71A 3EIXA 4OO3A 1J8QA 2HBZA 3WMFA 1FFXA 1E2LA 2GAOA 2X41A 2DH6A 2PGLA 4TZ6A 5TC4A 1QP4A 2GRAA 3DZGA 3JZFA 3KQYA 3LDGA 1YUBA 2FMFA 1YB4A 1Y8CA 3GH3A 3EULA 1YR3A 3WYEA 2VJMB 4ZAZA 2B8WA 1ZIYA 5K3FB 4WOJA 2OV3A 5TNXA 3NJRA 3P27A 1V5GA 4UM5A 1CIVA 4MR9A 4JUIA 4XB2A 3GRYA 1XLUA 2PQMA 2RSLA 2P0YA 3NBQA 4II7A 4KYTA 3ISJA 1G66A 1SHLA 5JG7A 4YV0A 1M1YE 2WU3A 2PLNA 3GP3A 3C6KA 1GSOA 5ER6A 2WT4A 1I0ZA 1Z07A 3G5LA 5EEHA 1UMCB 3RSOA 3CCFA 1ZI9A 1G21B 2OZVA 3QYJA 3R5FA 4XUGB 3TCNA 1PR3A 5DK6A 1ZGGA 1EP2B 2PKXA 1U7XA 3A10A 1WKVA 5U4QA 3BTOA 4FP9A 1ESDA 1PGNA 1T1EA 2HCRA 1RC1A 3TW8B 4YQYA 5GZ6A 3HL4A 1Z4JA 1RRCA 1J8YF 1JIJA 1C2TA 3K92A 1AGXA 5DB4A 5L3QA 1KZ4A 4A5SA 1E5TA 1Z8HA 2W6QA 1GGHA 5U4XA 3WQRA 3FUXA 1T43A 4DJJA 2AI3A 3CEMA 1IC6A 2OFWA 2BBOA 4P34A 2FWJA 1N6PA 3NDBB 4HQNA 4AYWA 1E3IA 1OA0A 2GLUA 1JDPA 1VECA 4MIOA 2YV1A 1OYVA 1JJVA 1TCVA 2Q29A 4NARA 1PR0A 5ARDA 1IEWA 3I92A 1T3ZA 2HNAA 3U44B 2ALJA 1ESCA 2HMVA 1Y7HA 3S68A 3VMMA 3SSOA 5B1IA 3ZZUA 5CB4F 1PT9A 1F8UA 4G4IA 2ENWA 3OPQA 1F9AA 4F8JA 1UC9A 3P9YA 2F3QA 2BLLA 4K6FA 4E51A 3C48A 3G2IA 4BVEA 3AT1A 4DMMA 3SIRA 5JBIA 1XEAA 4MMYB 4DAOA 4G5OA 5AI8A 1L7MA 2R8ZA 2CL5A 4Q4JB 1U7WA 4AXBA 1JHDA 2QLTA 2VUTA 2FPUA 1S2IA 2HMWA 1U0EA 1J9EA 2XMGA 1J56A 1E2FA 3PHBE 4X8OA 4XSGA 2HRZA 5FWYA 1LS6A 3G0OA 1O9HA 1P6QA 5D1NA 2CLFB 3GP8A 4MK4A 4RS4A 4BRSA 3KQUA 1VL1A 4BLSA 4LFBB 4TTPA 3UK7A 2K5UA 3PDHA 1F4VA 3MILA 4PPGA 3M33A 3Q85A 3CWQA 4IJKA 2DPYA 4L5AA 4R8KA 2YCBA 4MPRA 5AKGA 1TQ4A 3D0KA 4ZT6A 3KDPA 2FZVA 3BAFA 3BEDA 2G25A 3KE9A 1JLHA 1GNQA 1HUQA 1HZZC 2HWYA 4QLBA 4AKIA 2GERA 2AEJA 3EVAA 1N5OX 4N3AA 2J6IA 5E7MA 3SN6A 2QTGA 1G41A 1JALA 4EO7A 1V6SA 2IBMA 3QX7A 3N9IA 1M5TA 5JVDB 2DWCA 4KVAA 4ZIRA 1V5WA 1E9CA 4BGVA 5A5VA 3UJNA 1D2EA 3I45A 4PU0A 5I7AA 1FPMA 4W6ZA 4C0BA 5AW4A 3SZOA 3BMQB 2XWSA 4IZ6A 4WXYB 3EXHB 3T1VA 3UMVA 5JU6A 1NP7A 3SQXA 1NRWA 1JL3A 2DOKA 2WVHA 3TR5A 2IUSA 4H08A 3GLHE 2VZLA 4KXXA 5AHRA 1LI4A 2J85A 1TGYA 1TIKA 2D4HA 1BCSA 1YULA 3BZBA 4E1BA 1G2PA 2HDNB 1Z4NA 2GYUA 3KC2A 4FJ0A 2DH5A 4I66A 5A05A 4CF3A 3PNMA 5FT9A 3R6LA 1C9YA 1TOAA 3E48A 2CMHA 3TYXA 3HR8A 3PXCX 5BSFA 4I50F 3Q9LA 2HY7A 3WGYA 1MJFA 3BJZA 4I81A 2ZJ0A 4NICA 4PR0A 1NXXA 5FNVF 2OYRA 4ZEXA 1NQUA 3RKRA 3W90A 5BRAA 4KV9A 3W04A 4D3SA 4NYIQ 1LDEA 1KFJB 1YGPA 1X1SA 1BDMA 2NUPB 3I5MA 3QEOA 1N6LA 3GEEA 4TM7A 3W2IA 4BQIA 3BQMB 4U2CA 2QRGA 1Y4AE 3SEZA 2VF4X 4XX1A 4D6YA 3OQIA 1ZXLA 3OQMA 4LZZA 5L8VA 3VNUA 1VE3A 2WM8A 1GUAA 5K3DA 4FLEA 3ORFA 2GA8A 3RSHA 4EY3A 1CDEA 2NLOA 3QLVC 1QGDA 3P2IA 4O1IA 4YQEA 5T4EA 1WY5A 4X6YA 4H3KB 4OL9A 5ADWA 2YBDA 1T8TA 1RQXA 2IHBA 3H2YA 3NHRA 4Q3AA 2QVBA 4UQPA 1GA4A 2YOHA 2FUNB 4YHBA 1HDRA 3VR6D 1C80A 3HVUA 4TOIA 1FXWA 4R1SA 3IAFA 3QX9A 1G6KA 4M99A 3FZGA 4NONA 1LWOA 1GNLA 2VHZA 3BMOA 3TN7A 3KTOA 3ANTA 5KYWB 4Y18A 1OCEA 2VWQA 3CBGA 3IQIX 4OXKA 1CETA 5KOJB 5KYXA 4O2AB 2GN8A 1KZ6A 1BRMA 1K3FA 1P74A 1W30A 2CW5A 1TI7A 1G98A 1P18A 2VJAA 3PL5A 4HNGA 1QFMA 3VNRA 4QT4A 2P41A 4C7OA 2GKSA 1COZA 3I73A 3KNZA 5F3RA 4BAUA 3ZIAD 1V4BA 1FVHA 1XSEA 2AB0A 2CEKA 4MNTA 1ML4A 3C2QA 4INJA 3RJZA 5H70A 3VNBA 4J16A 1ZH0A 4MROA 2JH9A 2PMBA 5AXAA 1W7AA 3SS9X 1SUDA 1WP4A 5FI5A 3DZFA 1NQOA 3MJDA 4OFWA 1QYCA 2WTEA 4O8ZA 1WETA 2J1LA 5EXPA 4A26A 3F6EX 1CZRA 3F3MA 3BMXA 2ZYIA 3MRTA 4GPZA 4R3UC 3R7BA 4M49A 1JQAA 3MBKA 3KOMA 4RCYA 3MM4A 4HEQA 1DLJA 3L92A 1D2HA 5THKA 4ENWA 1QAQA 2JGEA 2OMKA 1X70A 3BGOS 4MV9A 1Z4PX 4PSDA 4QUGA 1JBEA 3HHEA 2PQ2A 4A2WA 3CW9A 5I4BA 5JXIA 3TNFA 1D6JA 1U1GA 5PGMA 4D9JA 2QTBA 1YOBA 4FEGA 1P29A 3OJEA 2JJ8A 1R9NA 2O7RA 4C21A 4PSUA 5CVEA 1G8FA 2NU8B 2AHOA 3GXOA 1D2NA 4YI3A 4G0YA 4TVKA 1Z34A 1MW8X 2BBTA 4HAXA 1ZM4A 3OCVA 1WTAA 2EBFX 5K0LA 2UXDB 4LMBA 3THYA 1A5BB 1TMGE 3CMCO 4EY5A 3Q8WA 1X1EA 3IKMB 3DLHA 2C0PA 4L4RA 5LFAA 2XI4A 3RLFA 1BXKA 3ENQA 4XWKA 3MJVA 3FYTA 2HD4A 3A9WA 5C1OA 3P9QA 2PX3A 3RCBA 2J3QA 2RJNA 1MORA 5JCPA 1Q0TA 4PLZA 2Y6VA 4B4OA 2OR3A 1HLPA 4JJGA 4II3A 1YV9A 4LW8A 4M0FA 1UKCA 3H5WA 4HX9A 1W5AA 1B41A 2J33A 3WRYC 4A4DA 1R6BX 1NMYA 2GVZC 2JHCA 2V5AA 1KDRA 4CIAA 3BD9A 5LD2C 2GS9A 4JX9A 2Y05A 3IP8A 3OLYA 4PO9A 4ZCIA 3G9ZA 1L9KA 4ARCA 4LWPA 4XVHA 4Y6PA 4IV5A 4D0LB 2IE8A 1ZP6A 1YR2A 2DUWA 4ZVUA 5JJ5A 3HSKA 1GZ6A 2IKQA 1O95D 4MWBA 4WOBA 1RHKA 3IMGA 1Z7GA 3K2QA 3ONFA 2CDBA 3RRBA 1NFQA 1G8PA 1QIIA 1SEVA 1THMA 2JGJA 3I4FA 4HZGA 3RO7A 1Z6YA 1NBAA 4TVBA 3U7JA 5LDGA 4RY8A 3D6HA 1FJGB 4JN6B 2WZDA 2XXJA 3TS1A 1Y3CE 4HKTA 3DTVB 4TSRA 3UT5B 3GDGA 1EB8A 4DIEA 2VDJA 3ND5A 1DOHA 1V39A 4DT1A 3K9NA 3R7AA 4DY6A 5DMHA 1L7PA 3HCAA 1C30A 2EZTA 1U4NA 2RHMA 3P9ZA 4H31A 4LQ4A 4TMZA 1DNPA 1PGQA 3LC2O 4ZZ1A 5ELLA 1SVKA 5AESA 2R6R1 1IEVA 1PD1A 2HBQA 2CGEA 2I2BA 2JBAB 1E0JA 2OCKA 2ZT8A 3IP1A 4JEUA 1I9GA 1DT3A 1BFUA 4LV6A 5HKLA 3RTAA 1P72A 3C6BA 3PNLA 4E5KA 2EZ4A 3LPMA 1BJRE 3AKCA 2IH4A 1SZDA 4CUZA 2C8LA 4OGKA 1RDFA 2B21A 2GASA 3D6AA 3BWXA 2WWYA 2ZIFA 3WDSA 3ZGLA 4DA7A 4QPJC 4ZOEA 4DJTA 3LBYA 3ZHSA 5HQ3A 5K0SA 4WI1A 3OX4A 4N0PA 3P94A 4U7PB 2VVTA 1LBIA 1WOYA 1E1CA 1Z83A 3OA2A 3S6JA 4Q9LA 3WYNA 1C7RA 1AZTA 3KLNA 3V1KA 2JIZD 1CZNA 3UAOA 4MB2A 1U1EA 3RG8A 1K92A 3SVLA 3DOHA 1XCBA 4UBLA 4Y30A 4MUKA 4JI6B 5A0VA 1BXRB 5FBZA 1QV7A 3IX7A 3EIEA 5KU7A 5HUQA 3FETA 1USKA 2QRHA 3GB9A 2VHJA 4KGXA 2ONCA 1JV2B 3L0PA 4A2CA 1Z7WA 2J6CA 4RK1A 5JV5A 5K3BA 1YR8A 1C2YA 3E9RA 1E64A 4QEKA 3CB2A 3F9CA 2DLDA 2V7TA 3U0VA 1G38A 4O08A 2QL7A 1KH2A 3KSDO 2DCUA 3FSRA 1Q50A 2CNWD 3DKKA 4ND7A 4AMGA 3I0MA 1GUYA 3OZRA 1QE5A 4S2UA 2O8NA 1UJBA 1LBHA 1ADCA 1QV9A 3MIIA 1YZVA 4N49A 4B0OA 3AFHA 4UDNA 4YLEA 3B89A 4DR1B 3LK6A 4FHCA 5SY4A 4JZYA 4NH0A 4XX0A 1X77A 2G6TA 2WFLB 2AXPA 2WMYA 1BX1A 2C2ZA 1T4GA 1XQ6A 4EM6A 4CEIA 4Q4AB 4RE5A 3ROZA 4MUEA 1MTOA 1LFAA 3FHCB 3LWBA 3P2MA 5EXEA 4ZOCA 1L5ZA 3R5HA 4K9PA 4US2R 4NOJA 3GHHA 2M1XA 4RHCA 5BWMA 4AF7A 3DJFA 3TOZA 2ZATA 2WUWE 1M73E 1QH8B 2P78A 3FCCA 4D5GA 1MGPA 2QLJA 3GZ4A 3CGGA 5E3JA 4GKVA 4ILEA 4NFYA 4D0NA 1XMQB 4RTSA 1T0UA 1FXSA 2ZB3A 4XM0A 2MINA 1MG5A 4R83A 3CRNA 1DBQA 5I3ZA 2IV7A 4WLFA 4DTIA 1KOJA 2R8RA 3FCXA 1KZHA 1U2QA 3H3FA 4TRNA 5E6UB 3KUDA 4TKMA 5EKUA 5FOVA 2FW0A 3WDLA 2FPXA 1EVQA 5E9WA 1JX6A 5F2EA 1GUBA 3V3KA 2W93A 4IO1A 1UM9A 1SRQA 3PUYA 3FTQA 4LNAA 4XGIA 3X1MA 2I6TA 5K0JA 3SFTA 1AB5A 1D04A 1NBWB 1B0AA 3I8OA 4ZYWA 3NGLA 2PO5A 5CT5A 1BKYA 2WSBA 4TXLA 1MOPA 3M5PA 1LF5A 4EP1A 1GV0A 2O0JA 5CD9A 1N2SA 1RQNA 4HDOB 3N07A 4S2EA 1FNNA 4U9HS 4DLAA 3SMVA 1R6DA 4Z9BA 3LPCA 1OBFO 1P39A 2QLNA 3F5FA 3RYCA 4KRFA 4PGFA 3JYOA 3D9QX 2H5JA 3RU2A 3K6RA 1GIAA 1SKUA 2NO7A 3CXRA 4ZD6A 1SBNE 2AQIA 2CJPA 3AZQA 2FG7C 3HP7A 2BM1A 3M3HA 5IMBA 3VZDA 4LK3A 5AVSA 1XRRA 4OHOA 3ZK9A 5TPZA 2ZE7A 3GPBA 3NBXX 2PFKA 1BS2A 2FWNA 1Z0DA 2CLDX 1KEZA 3WNBA 5ESXA 2AF3C 1X8JA 2VP2A 3B9QA 3OOSA 4QQRA 1Q74A 4A82A 4D44A 4IIYA 1GNTA 3ILHA 2KJQA 5CITA 3BRQA 1OYWA 1C41A 4L74A 2QD1A 2C9CA 4TTAA 1AN9A 5CNKA 4QG3A 2QVZX 1CJTC 1M2FA 5BMVB 1W93A 3MLEA 3DG9A 3NHYA 5BYKA 1TAGA 2RKOA 2B7CA 2Y71A 4KK3A 3TGWA 4DRXA 2XR1A 4AQYB 4OMCA 4QFDA 2LP4Y 3KQHA 1RKVA 1YB5A 5JCJA 1FLAA 4RACA 2PLAA 2EW8A 3A2LA 3CTPA 3QUQA 4QTXA 1TYAE 2V7PA 1IQ0A 4F4IA 5KOYA 4X6XA 5DNUA 3OTIA 2P9QA 4GS5A 1ZI6A 4QD3A 4YBRA 4D9FA 3BJIC 1MABB 4PYMA 2VT6A 5ALOA 5E1BA 3WJ2A 2REQB 4Z2YA 1NBHA 2WSLA 2NSDA 2RB5A 1MP0A 4EG0A 5H7XA 3GT4A 4FDTA 1L2TA 2CB9A 4KQ2A 3L1UA 3H0KA 3OTWA 4PBTA 1TM2A 2GAJA 2DTDA 4XGNA 5CHEA 1YJBA 2JJ2A 3CEHA 1IZYA 4EY7A 2PWPA 2PUDA 2Q3CA 3PEYA 1RJWA 1RKQA 1KPGA 2HCFA 2W90A 3DT8A 4QOIA 4QXQA 3V8BA 1G3MA 4Q9JA 4U2BA 1O54A 2PH1A 2DLNA 4BKPA 3ZU3A 5JBNA 2WWWA 3QG5A 3GLGB 2AMYA 1ZICA 3OE1A 1QK3A 3TTWA 5JCOC 1ARZA 4WLOA 1XLTA 2HLDA 5BV0A 1DKRA 1T4MA 4PC2A 2H0QA 3DSRA 3F71A 3AQ4A 5EXSA 2EU8A 3C43A 3GQBA 2VPIA 2REOA 3QPVA 4U63A 4ZEWA 8ADHA 4E5UA 3IEXA 3M2TA 3RT9A 4OBBA 1XEXB 2X9QA 1IIRA 1U8XX 1W0KD 3BWDD 4PLFA 2ZUEA 4EJ2A 1U8YA 3WOVA 4IQFA 1XMSA 1EBBA 2QN6A 1JHPA 3L6RA 4BO0A 2UXCB 4H27A 1E0SA 1NL3A 5B3LA 1NOKA 3OA0A 4K05A 1JJBA 1JLMA 1RYHA 2Y0CA 4UHCA 6PFKA 1XRLA 2YV3A 4KLNA 3LRPA 5F35A 1Z13A 5B57C 1ZX1A 4G5FA 4D0SA 5AH0A 2ZJ2A 3PCRB 4QG7A 3FKJA 4LJ7A 2FFHA 5F98A 3JQEA 4C01A 5LQRA 4GX2A 2OK7A 1RYMA 4CIVA 2X3UA 2BFDA 4GZ5A 3UGJA 3EGDA 1AXRA 1F2UA 4GICA 2UVPA 3C6MA 1JTVA 1NR7A 1Y9AA 2YWGA 2WJ6A 1WMFA 3AHJA 3M5DA 3DBOB 3ZEIA 5JO0A 4HH1A 2H3HA 3OEED 2HF8A 2ZUVA 3DVAA 1PFKA 4X54A 5CH5A 4I1YA 1U8EA 3KKKA 1ADGA 5ALZA 4IUYA 1NONA 4Q24A 3ZBQA 1Z6XA 1AS3A 1EM6A 2DFPA 2FG5A 2GBFA 3JV7A 5EE1A 3L77A 3A7EA 4OQXA 4ZARA 3VOBA 5AW7A 4X65B 1RD4A 4QDTA 3E5NA 2YV4A 3A6ZA 4HUJA 4KQ6A 5EJ9A 5BXYA 1R15A 1ZMRA 2ZRLA 2QX9A 3KB8A 6NULA 4QZVA 3EEOA 2WQ7A 5IHPA 1BMTA 4FUTA 1FU4A 3L7OA 2YHUA 4E2YA 2QTZA 1RQLA 3CUUA 2JJQA 4V3BA 3X43A 1DOAA 4Q0MA 1BAPA 4ZVTA 4H17A 1VLLA 4X8LA 1U7TA 3QWFA 4CV1A 3E61A 3AHCA 1GN8A 5L6MB 2FWMX 3F49S 1LD3A 3A9SA 3O92A 1HXHA 2AC2A 1I30A 1WPXA 4IIJF 2FX2A 3AL0C 4D41A 4CUJA 5JRJA 1X0XA 4A0HA 3MXTA 4KO1S 2GN4A 3OZ7A 1IOVA 4KMSA 5A7GA 1DXHA 1U2PA 2XBMA 2R6FA 4FHEA 3TLYA 4F0JA 2HQ1A 1EG2A 2J31A 2WNSA 4YP1A 2OOSA 3F6YA 4J1TC 4ZPXA 3TG8A 1TC1A 1H4VB 1Q0HA 1YVRA 2OORC 3DO6A 3IUYA 5DXAA 3REQA 2X42A 4E5DA 2HFKA 4XJSA 3WTBA 1MC4A 4FIZA 4HPWA 4MUIA 1JJIA 2VF8A 4KB5A 1GKIA 1YC5A 4R51A 4XR9A 3IKVA 3QELA 5JD3A 2AQHA 3OOEA 1HEYA 4EAQA 4MDFA 2REBA 3NUGA 4Q1EA 1CUIA 5C0OE 5TQ2B 4U7DA 2Q0QA 3K72B 4L9AA 4JI2B 3O6VA 4EHNA 3E9YA 5H16A 1A96A 4QEDA 3UAXA 4BECA 1DC6A 4OHPA 2JEOA 4CLDA 1V96A 4NE9A 1PS0A 1DWOA 1DVRA 1TVKB 3TIXB 4WKOA 3QBJA 1JH8A 4YBZA 4DV5B 3P26A 4K7JA 2E6KA 4WZ6A 3O84A 5HIIA 3MTQA 4F38A 2PUEA 4QPCA 3JRNA 1HSOA 2XCUA 4DCMA 1RC8A 7GPBA 1VQ1A 3ZS9A 3G0DA 4WOPA 2PTGA 1Z5ZA 4N7JA 4LZNA 4RNCA 4XGQA 5HF9A 3ZHVA 2UUBB 3ZJTA 1UBRS 1OVGA 3QZUA 2PRKA 2GHTA 3E5MA 5IJ0B 3AG6A 1WQ1R 2WK1A 3BKWA 3SC2B 4YCLA 4ZZ0A 2XCLA 4H77A 3WGVA 3AQIA 1QK4A 1R12A 2BELA 1L4FA 5FWXA 4KPUA 4PYJA 2X8WA 1DKMA 1U9JA 2W4QA 2V6IA 2JCVA 3QRWA 4RVHA 2NZYA 3WG9A 3U19A 1U2TA 4OB7A 3F47A 4JODA 2PKQO 1U0LA 1KO5A 3FF1A 2JGMA 1JQLB 1XTBA 2WM2A 4F71A 5LIPA 1I7SB 5FUWA 1YQ9A 3I2IA 4AY2A 2R4UA 3LUBA 2WG0A 3RS0A 1O8BA 3IUPA 1FUYB 1RI4A 3LCMA 2JJMA 2HIAA 2P65A 4YYZA 1RABA 3JWHA 4HAIA 1BDJA 3E3LA 4YIKA 2ZSAA 4HNUA 1L5OA 4G26A 4PHGA 1ACLA 1T9GR 5F33A 5KOHB 2QXYA 1PLKA 5IK2D 3OJFA 2RHOA 2OO5C 3OQHA 2W2XA 3C5VA 4FLFA 3JQRA 1O8CA 1QPGA 5AKJA 4YPVA 4CQNA 2OGZA 3LRTA 3ZWNA 4CEHB 4RMJA 2CVOA 1MRSA 1X7WA 3HRIA 4PLGA 5CNMA 4B2IA 3BE4A 1U2SA 3ZW9A 4RTQA 1CUUA 1I3LA 3O8QA 1QKJA 3IV6A 3IESA 1OX4B 2QTAA 3DMTC 4PXSA 2UYCA 2YZ2A 2HIGA 5DHTA 5DKFA 2DX7A 2EDAA 4W82A 2KMLA 3M6AA 4NSNA 3WWDA 2FW9A 3B7GA 4EEZA 3BUSA 2B8TA 1H2WA 4L27A 4UXIA 3ZJUA 4KZPA 4CMIB 5AUOB 2GBIA 2OHGA 2PSHA 3CNHA 5AI9A 3TFOA 3CCBA 1I6WA 3C3WA 5ENVA 2HRBA 3L8GA 3ZHYA 1NWHA 4URWR 5FFFA 1G8YA 3D0QA 1XXHA 3HZHA 1NGSA 4IX1A 3ZXIA 3KLMX 1A9XB 3PX2A 1T5TA 3KU4A 4CRWB 3T5PA 2ARKA 4UEQA 1G1AA 5LP6C 1I6LA 2HSGA 3KKMA 2NZVG 2VC2B 1I5OA 2I7TA 1TRKA 4J75A 5DSXA 2HNKA 3I5YA 2IEGA 2GEUA 3T7RA 2IP1A 4BFWA 1T91A 5IU6A 1CIPA 3GEPA 1T24A 4G2NA 3ZNOA 1WVMA 1F8FA 2E7ZA 2DVMA 1EP3B 1LRKA 1PD0A 5FFMA 1NYRA 2F48A 2CF5A 3GI1A 4G86A 1K8QA 2PX4A 3Q11A 5IYZA 1LF0A 3EODA 3L40A 5T57A 3WZLA 1JU3A 2EP5A 3BVPA 1ZDMA 3M6UA 4C08A 2VPQA 1OX6A 3DEKA 4P2BA 3M6WA 4E31A 5G0WA 1MDBA 2ZJYA 4KWIA 3W9UA 3LUKA 3DLBA 5IKXA 1XZCA 1GYPA 4PBSA 4DDKA 3GUZA 2J5QA 4LK2A 1NQ5A 2F1JA 3OM0A 4B6FA 2V65A 3GYBA 3OEHA 5ICFA 3SHTA 3O94A 3R6TA 2IA5A 5AK4A 3ZHTA 2PS0A 5A3VA 4YH1A 3HKCB 3P9KA 1A3CA 2XAUA 4ZWNA 3DBRB 1PWXA 3F67A 4CDNA 5AVWA 3FSGD 3MWLA 3TPCA 5GIOE 1Y5LA 3HB1A 4LXHA 3WQSB 2QGFA 4MKZA 2IRWA 3N86A 1J09A 3WSTA 1KO7A 2ZUWA 3IVCA 1Z6QA 1O0BA 2FR8A 4M9XA 1QVAA 4KR6A 5HZHA 5JC1A 3E9EA 1E6UA 4WCFC 1KY4A 4UCFA 3U9TA 4HWPA 4ZOAA 3NUQA 3CKKA 3ZCPA 1UZAA 2ROQA 3I0NA 4E30A 4EW3A 5B3KA 4R9RA 4Z4GA 3KZNA 3HDVA 4MV3A 4EY6A 2PBRA 4J4TA 3MJSA 2DSTA 4JLAA 4WBNA 3I2YX 4K9LA 2BGGA 2IY8A 2RI6A 4LMRA 3UPDA 2IS2A 3ED5A 3VVMA 1QTQA 1MQSA 1MIOB 3WA7A 3ROQA 5IN4A 3BXEA 1HM5A 2P5SA 2GWHA 2AR9A 3QWAA 4WW0A 1UAAA 4RE6A 1PW7A 2G9UA 3BH0A 3HWX1 3KR1A 4FZ5A 5M7EA 3GJ3A 1NRIA 4CR6A 4FBLA 1EK2A 4ZYTA 5I4KA 1Z68A 4PIPA 5EHQA 3QNMA 1THTA 1T2UA 1VGVA 5GONA 4BJ1A 1X1BA 5TGZA 4YJ3A 4BIMA 1Q12A 4JP1A 3PFHA 3DOCA 1GAXA 2YMQA 4NYMR 1J90A 2WU8A 1KFKB 1G5TA 3KB1A 5JZSA 1BW9B 1GITA 2LZ0A 5FDFA 3ILSA 3ZJ4A 2J7PA 4KAAA 2ONJA 1IQPA 2COKA 4DB2A 5DXFA 1IY0A 4LE1A 4UMDA 5CB8A 1W5SA 1W52X 2H1RA 1MR3F 3JQ9A 3ORYA 3VR0A 1R3UA 5DGXA 5JQGB 4H6VA 4BO2A 1GAQA 2EV9A 4ZVRA 1UAGA 2DG2A 4D46A 4KITB 5K3OA 3CRRA 2BZ1A 2RAPA 1T5HX 2JFQA 2ZIEA 3GXBA 3LVRE 3TQQA 1Y1TA 3SE7A 3ZYCA 2AL7A 3RU3A 2JRCA 2WT9A 1M7HA 1UINA 3TQFA 5E3HA 3K0HA 3N53A 3EVFA 4S24A 5EPEA 4K46A 4KN9S 3ASUA 5E8RA 3ZDCA 3IJ5A 4ZU1X 4GPEA 1OIXA 4QBTA 2IEAA 5AHXA 1EFCA 1P0MA 3UANA 3HCOA 4M1QA 2VSNA 1HC7A 5JSFA 4PTLA 1U31A 4XDGA 4JL6A 5HZGA 4RMNA 1TECE 3BE6A 2VP5A 2EFJA 1GTG1 1N2CB 4BVJA 1EUCB 1GLNA 1E79A 3GA0A 3C8DA 1SOVA 2MSKA 3UYKA 2Q5IA 2IYVA 1BE1A 1V16A 3QFSA 5ALPA 3RR2A 4AJJA 3NWJA 2J3DA 1VI6A 2Y27A 5IULC 3EGXA 1FZTA 1N8TA 1M1NB 1RM4A 1V6AA 2W2OA 2PSSA 3KQOA 3O8CA 5EIAA 1QBKC 4LV8B 1KSGA 1W87A 3F0TA 4OOEA 2PJDA 3ZZ1A 3LWDA 1FDSA 4H6PA 4Q1AA 5EY5B 4R69A 1G9TA 5KVAA 3VTFA 2G28A 3CLRD 1P9WA 2FJUA 4LYJA 4W8HA 5C4MA 3JQ6A 4O4LB 1B8OA 3IMCA 4BB9A 3QUCA 2HTFA 1E2HA 3GWGA 9ATCA 4LOHA 3SHWA 3WXMA 4DLRA 1X14A 3G0BA 2BT4A 3WB2A 4DOMA 5CFNA 1GPBA 1KDOA 1QHSA 2FI1A 4MRSA 3WGGA 3USES 4GLBA 2W8BB 4HADA 4MR9B 3AF4A 5BV1A 1JHVA 4OKIA 4YT5A 5B7NA 4G1VA 4KAJA 4HQKA 5B2FA 1BDHA 2AC7A 5L7WA 4Y3UA 2VHWA 4RF2A 3DE3X 2CBGA 3FNGA 5IZCA 5J1SB 4RHUA 3RC9A 1J8FA 3TRJA 3VR4H 3ZIDA 2W4IA 5JSHA 1UKYA 2M6SA 4O1HA 1QORA 4LRXA 2C98A 2XB8A 4R2MA 1SB9A 3T4PA 4C6HA 1QUFA 1ZC3A 4O4HA 2QTHA 1FFDA 5H0IA 3X2FA 3VYSB 4HYTA 3WK8A 2VZ8A 4WX2B 4JT2A 3PENA 4X8HA 4WZBA 3GLFB 5E1MA 4PICA 4B3XA 1PVDA 3KYBA 1DC4A 3NWPA 3F5DA 1AA6A 2SBTA 4UAUA 4CKBA 1E2IA 1TFRA 3U3OA 3C7CB 5H81A 2ST1A 1A5ZA 1N5JA 2MOKA 2RGCA 3FBGA 3JZIA 3N70A 4W8GA 1KSFX 5I45A 4JXXA 4QYIB 4WK4B 4ETIA 5B3AA 4AO6A 2Y66A 4J49A 2L42A 1T9GS 4XB1A 5TT1A 5CDGA 2B4RO 4DLTA 4I3FA 4RJKA 2ZRDA 5T6BA 4DQLA 3VR4A 3S1AB 1V2GA 2XZDA 3CHYA 3PHHA 2QWXA 3WI7A 1XNHA 1E1QD 3ZHUA 4L5YA 4C7BA 4EBBA 2VFAA 3FYSA 2P5YA 2M2IA 3NBZC 2FPPB 4PV7A 4YAEA 5KNBH 1JU4A 2O0KA 2G88A 2I78A 4EELA 1CEEA 4G5QA 4WDRA 4CETA 3OE5A 3UHJA 1C0KA 2V7UA 1U8CB 3RSZA 5KTYA 1YHYA 4X9XA 1LKZA 1W6UA 2NWQA 3L7BA 3SWWA 1RAHA 3W5BA 5I9IA 2JI6A 5U1PA 1E9AA 1YZLA 3GPLA 4TLDA 2R86A 5EHGA 2WIJA 1OB2A 3PGMA 1E0AA 3SXPA 1XA3A 1RRKA 3GC6A 5FTLA 2ZPAA 3AFNA 3Q1LA 2AI2A 3OECA 4JSRA 2WA1A 4J6EA 1H6CA 1Q15A 1WULS 4O59O 4UCXA 3STYA 2QBYA 4Y0NA 2JCYA 1FTQA 2JHPA 3UOAB 1BRTA 1C3OA 1Y8RB 3WLLA 1UJNA 2WNIA 4A73A 3JVVA 2J9FA 3TIIA 3H2BA 4GC9A 8LDHA 2I71A 4C07A 1ID1A 3GD7A 4FYKA 3UN1A 2OPBA 2ZANA 2BF7A 4I1UA 5KQGA 4MH0R 4YQZA 4X95A 2ADFA 2H2DA 1EIZA 2XODA 3RHTA 2IH2A 4ZIRB 3ADDA 1N3LA 4EIWA 1REQB 1E3LA 1OIVA 4XFJA 2JLVA 1G8JA 1WDLA 3W4KA 5T3UA 3V8QA 1ZUD1 3H1GA 1T4DA 1ZIXA 5DHFA 1IWOA 3PGJA 3RYIA 1NOJA 3DUFA 3FOBA 4MRNA 1A1VA 5A4IS 4PYQA 3RBVA 1TIBA 2QRZA 1BCSB 4Q4CA 3QU5A 1S6YA 5JNRA 3TGPA 2R8YA 2JLQA 2FQ1A 1V41E 5ARBA 1KGDA 1H2ZA 2AIRA 2Y0PA 2R1UA 5C1PA 1E2PA 1U8TA 2ZIXA 4DSOA 4HEJA 4BU1A 2XNDD 3IBYA 4R40A 3LGSA 1QDUA 2C4HA 2JFBA 3S1LA 4H7KA 1X3LA 2QLBA 1T13A 3DVQX 5EESA 3IVRA 4NNJA 5CCEA 1KHHA 4DV0B 5LMZA 2BMDA 5GM1A 1XYGA 3I2JA 4DJEC 5ES3A 3QPUA 5DEOA 3IP7A 2IH5A 4G85A 3OLXA 3OQIB 4RETA 1Z38A 2ZTVA 1DZ3A 1L3BA 1TQ6A 2M32A 5K7SA 1KO4A 4FSHA 1BX3A 1IBSA 1KS2A 5BUCA 1H8ED 3UFXA 5CW1A 3BK7A 1AZWA 2GPTA 2IGTA 4JD5A 1U0SY 3V7UA 1QS0A 3OH8A 3OFND 2ISCA 3ESXA 1V43A 2WUDA 3SHFA 5I48A 3NOXA 4Q7KA 3EXFB 3FPJA 1JKMA 2WKRA 4M3NA 4ZEOA 4TV9F 1A2BA 1TMYA 4AP5A 3QHPA 2GF2A 3HU5A 1Z88A 2IZ7A 1K4YA 1H4TA 4I4TB 4CF4A 3D7NA 1RWNA 3PFNA 2XYPA 3BMOB 4I14A 2Q1YA 4HGRA 1Y3HA 4B8YA 5ALDA 3IOYA 1DIOB 2QKYA 2VJYA 1O6ZA 2PYIA 3BCRA 2FPIA 3SD7A 4YJ2A 2VXYA 4J7UA 2BGTA 4MQEA 1M6EX 4WXRA 4D02A 4GNRA 1NR5A 1VJ1A 1WV0A 4KDRA 3VZSA 4YR7A 2Q0HA 1W0JA 3BX1A 1SWVA 1SN7A 5DBEX 1NUSA 4X85A 5G3YA 2HRRA 1V3UA 5D8DA 1H2EA 3TH5A 2L0XA 2OHHA 3VR5D 1D1TA 1O08A 3RUFA 3UXHA 5HKKA 1E4OA 1EFVB 3DNPA 5ICGA 1XBTA 1N8NA 4B3RB 1L5VA 1NZJA 3FPLA 4NNOA 1RI2A 4OG2A 3VKGA 1I01A 1F2TA 2ID7A 1AQYA 2ZKIA 3PXUA 4OLFA 5EVCA 2BM8A 4M89A 4N5MA 3Q0TA 3E7WA 2WWGA 3CH6A 5EIEA 2QRJA 4WKPA 1OWOA 5EMHA 4L9WA 1G20E 3WMEA 3QVOA 4Q12A 4QUBA 3DR3A 1KJYA 1M34E 2BFPA 1I6MA 2XCQA 3C45A 3PLAE 2E4WA 4UUQA 3IVGA 2DGDA 2ODWA 1QRDA 2Q0XA 2K4MA 5JUWA 5E95A 3N74A 3V8NA 3VZCA 3BULA 3ZWVA 4KC0A 1LI5A 4A8HA 1KY5A 3KAQA 3DV0A 2PMWB 3QJ5A 1Q7CA 3RSQA 4ML3A 4TS9A 1OLXA 4DW8A 3ERCA 4O2RA 1B6GA