1Q77A

X-ray crystal structure of putative universal stress protein from aquifex aeolicus
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
138
structure length
138
Chain Sequence
b'SNAMKVLLVLTDAYSDCEKAITYAVNFSEKLGAELDILAVLEDVYNLERANVTFGLPFPPEIKEESKKRIERRLREVWEKLTGSTEIPGVEYRIGPLSEEVKKFVEGKGYELVVWACYPSAYLCKVIDGLNLASLIVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein AQ_178
molecule tags Structural genomics, unknown function
source organism Aquifex aeolicus
publication title Structural homolog of Universal Stress Protein from Aquifex aeolicus
rcsb
total genus 43
structure length 138
sequence length 138
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-08-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1q77A00
2CYCA 3X1MA 4G5YA 1GTSA 1R6UA 1EJ2A 1T6ZA 2A1UA 3ZXIA 4DDKA 4XFDA 5FO0A 3N9IA 5DASA 3P0HA 3KFLA 1SURA 1HYBA 2A1UB 4EG5A 4I6GA 2QUHA 1KH2A 3QTTA 4MUIA 5J5AA 3LE8A 4KR6A 4K03A 1ZH0A 1FFYA 1IHOA 4JZYA 1XNHA 2Z09A 3G59A 4KR9A 1NUTA 1JEEA 2HMAA 3N8HA 3RK1A 1N75A 3FH0A 4ZT3A 3GUZA 4DJAA 2PFSA 2A86A 1I6KA 2E89A 4UZEA 4ND7A 4MW2A 1OBCA 3PNVA 1ZJWA 4MW1A 4BWVA 3LOQA 2C5SA 3IOEA 4ZCQA 5KHAA 3A05A 1JILA 4OJMX 1XJQA 1YIDA 3DO8A 4ARIA 1N3LA 3LCJA 1JMVA 4ZT7A 2D5BA 3IVXA 3HFJA 3PNBA 3SDBA 4X0EA 2V0CA 1VL2A 3M5WA 3IVGA 4OUDB 4ZT4A 2VTBA 3TNJA 2OQ2A 1O97D 3CLRD 4MVWA 5IJXA 3SZ3A 5H16A 3IH5A 3COWA 4MWCA 5K0TA 2X1LA 1D2RA 2PZAA 3Q10A 2DLCX 1IRXA 2YY5A 1O96B 2E21A 3P0JA 1JEDA 4F3RA 1O94C 2ZUFA 3CR8A 3A4IA 4U8HA 3HZRA 3HV0A 5H7XA 3VU8A 3AKZA 1F7UA 3C8ZA 4R2MA 1F9AA 1VBKA 4A91A 2CFOA 4PBTA 4YMIA 1TYBE 3RHSA 3N2YA 1KP2A 1N2EA 2D54A 4KPUA 1NUQA 4PBRA 3ZJUA 2CV2A 3CLUC 3ND7A 1N2GA 3ZJVA 1WXHA 2IJGX 4WNYA 3K32A 4MQ6A 1NZJA 1R6XA 4H3SA 4MVXA 4ZT5A 4NX2A 2GKSA 3CA8A 4MUKA 3DLAA 3RBAA 4MW4A 1JZSA 3MXTA 3INNA 1EFPA 1G8FA 1MC1A 1U7DA 2J07A 4U7JA 3X1JA 1PFWA 4MUNA 4MW7A 2EL7A 4JXZA 1IFXA 2IELA 4L2IB 2YXNA 1WQ4A 3FOCA 3FG9A 3I05A 1WXIA 4S1OA 4ARCA 1KAQA 1YIAA 4R2LA 3FWKA 1KP3A 3HGMA 1NUSA 4R0NA 4MUGA 1ILEA 3MLAA 1WJGA 4EG6A 3JXEA 2CUZA 4HK4A 4NAUA 3OTWA 3CVVA 1O96A 5J58A 3AFHA 3QTBA 4UZFA 2JANA 3VRHA 3RK0A 3ELBA 2NZ2A 4YP6A 1NURA 1EXDA 1I6LA 2V0GA 3NV7A 3SYTA 1J1UA 3UY4A 4E1AA 4MLPA 4U63A 1U3DA 1MAUA 3SEZA 1O5TA 1VLHA 3IUEA 2A7XA 4EFKA 3TZEA 1F4LA 4MULA 1Q19A 3H97A 3D6UA 4Q16A 3UK2A 1NUPA 1G8HA 2AG6A 2PZ8A 4I6EA 4DDMA 2WQ7A 2QJFA 1WXGA 1EFPB 4AQ7A 1FYDA 5TEWA 4MUFA 1H3EA 1H3FA 1GZUA 1PG2A 3FI0A 2D13A 2G36A 4Q93A 3CVWA 1WXFA 3IODA 5LLTA 1GAXA 2A1TR 1O94D 1WOYA 2IP1A 3ND6A 4ZCPA 3FHJA 1Y42X 3RFFA 2BYTA 1QU2A 3H99A 1QRUA 2DEUA 1TFUA 1N77A 3PNYA 2J4DA 4HJXA 3NBKA 1O97C 3CLRC 4KPUB 1TYDE 4EF6A 4ZCSA 4F4HA 2Z3VA 4YBRA 5J59A 3UMVA 5EKDA 2PIDA 2E18A 1N78A 2CT8A 1S4MA 1N2JA 1JECA 1UFVA 1N2BA 1KH1A 4ND6A 4JXXA 5K0SA 2WQ6A 3CLUD 3G5AA 1GN8A 2HGZA 1BS2A 2DETA 3COYA 3D6VA 3MLBA 4EG1A 3IMGA 3X1KA 3ZUGA 1MOPA 4YP5A 3IVCA 3FIUA 3OP1A 5LM3A 4MW5A 5IHXA 1OWOA 2GM3A 1U0BB 2AZXA 3MUEA 1TYCA 2CYAA 2J08A 1M83A 5BNZA 2GOYA 1V8FA 4DNXA 1IQUA 3HMQA 1CT9A 5DEOA 3A2KA 3IUBA 1JIIA 1NI5A 1R6TA 1N2OA 1J09A 1JIKA 1MB2A 4DE5A 2RE8A 1VBNA 3FY4A 1T6XA 2RD2A 1O0CA 4MWEA 5AHWA 2QJTA 3H9CA 2J5BA 4HJRA 2JA2A 3SP1A 3TS1A 2A1TS 1OBHA 1QNFA 4QREA 1WQ3A 1QU3A 3QE4A 2X0KA 1QTQA 1QRSA 2VTBB 2DXIA 1N2HA 1X8XA 1NUUA 3CLSC 1OWMA 3AL0C 5F23A 4QRDA 1TYAE 2EJCA 1J1ZA 1GPMA 2QTRA 1K4KA 1KQOA 1X6VA 2HZ7A 1I2DA 3IDFA 1TQ8A 2WB2A 3IOBA 2PXHA 3PXUA 3L93A 3H9BA 3ISJA 3COVA 4MW0A 1G59A 2WSIA 1J21A 1O95C 1U7XA 2E0IA 2A84A 1N2IA 1O6BA 4G5FA 4JFAA 4NZPA 1JHDA 3KT8A 1YULA 4ZCRA 1M8GA 1H3NA 1IQ0A 3RJZA 2OV4A 2O8VA 4MVCA 3CVYA 4ZT2A 2CSXA 4GRIA 1OWPA 1MRZA 1KAMA 1GTRA 2YWBA 3FETA 4QBTA 4J75A 5HG0A 3DV2A 3NBAA 5TEVA 2J09A 2ZUEA 2H29A 2X1MA 1IH8A 1PG0A 3GMIA 3CVXA 4JYZA 1JZQA 1WXEA 1J20A 2NSYA 2DERA 1KR2A 1EFVB 2QJOA 4MAFA 3KT0A 1M8JA 1LW7A 1O95D 1OD6A 1KH3A 3KT3A 2JAXA 4EG8A 1QJCA 1K97A 4MW9A 1MJHA 1MAWA 3GLVA 5FNZA 1JIJA 5JBNA 4MVYA 2XRZA 3N05A 4ZT6A 1QQTA 3ZIUA 2CV0A 1YI8A 2AKEA 4NAHA 4HPWA 3MMXA 4MW6A 2ZP1A 3P52A 4KR7A 1OWNA 4ZCTA 1OWLA 1MBZA 1DNPA 3IOCA 2H2AA 2CYBA 3CLTC 1YUMA 2PZBA 1VBMA 2QTMA 1KQPA 4PBSA 4EG3A 1P7PA 4G6ZA 3KT6A 3DPIA 4NATA 3CLSD 1U3CA 3S3TA 3PRHA 3VGJA 1PFVA 3HL4A 2I1LA 1B6TA 1H1TA 2TS1A 5KCMA 5TS2A 2QTNA 4MUEA 3TZLA 3FDXA 1EUQA 3IMCA 2A88A 3Q12A 1M8PA 3ILVA 4EG4A 1V47A 4CQNA 1J70A 5KWVA 4XSVA 4P2BA 1EUYA 1QRTA 3IMEA 4XFJA 4AS1A 2BTEA 4MWBA 3TQOA 1N1DA 5HUHA 3ZXSA 3TQIA 1TEZA 1IVSA 1JGTA 1K4MA 2VXOA 1PFUA 3SZGA 1LI5A 3ZJTA 1PFYA 3AIIA 4CDMA 4YP7A 4OUDA 2XRYA 1WZ2A 1O0BA 1GLNA 4RPIA 4MWDA 1XNJA 5DK4A 3Q4GA 2R5WA 1KORA 1T9GS 1XNGA 1A8HA 1K92A 5HUJA 1WY5A 1MB9A 2X3FA 3A04A 1COZA 3SEQA 2B7LA 4CDNA 3G6KA 3F3MA 1EE1A 1IQRA 5LFAA 3U1VA 4TS1A 3L92A 3COZA 2YWCA 1EFVA 1Q15A 1ZUNA 2Z08A 1LI7A 3BL5A 3UOWA 2DUMA 3E27A 3K9WA 4K0RA 1M8KA 4RUKA 2A4MA 3FNRA 1T6YA 4EGAA 1YUNA 4MUJA 4DLPA 1I6MA 3AG5A 1F7VA 3UC5A 1KQNA 1Q77A 4WSOA 4CT0A 3CLTD 2QUKA 3CVUA 1NYLA 1RQGA 1WKBA 1ZH6A 4I6JA 4MUHA 5DB4A 1T9GR 2PG3A 2QUJA 4PY2A 4EG7A 2CV1A 1M1ZA 4L2IA 1NP7A 2O5RA 4GU5A 3H05A 3ND5A 2DR2A 1Q11A 3ZGZA 2QUIA 3P0IA 1M8FA 5TGTA 4FZJA 2DPLA 4DDHA 4NDAA 4J76A 5FO1A 1ULHA 1G8GA 3AG6A 1NSYA 4KKVA 1KKUA
chains in the Genus database with same CATH superfamily
1FUYB 4G5YA 1II8B 4CL3A 1I1HA 3D5EA 4OMDA 3SI7A 5DOZA 4UBJA 4WKGA 5LYJB 3NU1A 1VJGA 4JASB 4TKVA 3KFLA 4RTMA 3SSNA 2PUWA 4EG5A 2NO5A 3E2IA 2D1RA 3Q5DA 3AESA 4KDFA 4KO4S 4NBWA 3SXJA 1N6PA 4AKTA 4ZV4A 2ZSHA 3KR1A 2PLWA 2M1XA 2OFXA 3KKZA 1AN9A 1TMGE 1UK8A 4K03A 4ZYVA 4KIJA 2F1IA 1FYWA 4U9UA 2VTVA 4X62B 1F2UB 4JJZA 3I12A 4Q66C 4M38A 3TIGA 4AJ1A 4WJKB 1DOAA 2COEA 1Z4JA 3GUZA 4DR4B 1R9GA 1J06A 4AMVA 1I6KA 1TL7C 2XGSA 2ETVA 4PINA 1LPSA 2GB4A 4LRSB 2R6JA 2HRCA 1E2KA 3I5YA 1Z6ZA 2FEMA 3KVRA 4JOQA 4PQFA 4XEUA 3B5JA 4ZCQA 2HADA 5DFAA 4C7OA 4TZKA 2QD5A 3TZKA 1JILA 2BFEB 4FX5A 1EX7A 5CG2A 3UAWA 3C7AA 4LI0A 4ZT7A 1M2VB 1SPBS 3HFJA 2QNRA 2DTEA 3IPYA 2V0CA 5GQSA 3A6JA 1C9YA 5BW4A 3IMKA 3QELB 1QM5A 2WKPA 4WZAA 5AW6A 3L8HA 2O5CA 3FBTA 4YASA 2GK3A 1CYEA 1MC8A 2ASEA 1IBSA 2J67A 2P9YA 2YJTD 4N65A 3ZK8A 3PJGA 4R9VA 4RK1A 1YTUA 1A72A 1Z73A 3IH5A 3UF0A 2EW1A 1TUIA 3DO6A 4DQDA 3QBDA 2DLCX 1UOEA 1EG2A 2XUKA 1GU7A 1ZM2A 2D1QA 1YONA 4OPMA 3UAYA 3K0HA 1UKYA 3ZV6A 1V41E 4BEVA 1YGYA 3IUJA 1SOWA 1G5FA 4AJLA 1PNRA 1R5NA 5K3OA 3HB9A 4MUXA 2LV8A 5HILA 1I9GA 1NW3A 4RY2A 1HZJA 1CRQA 3BSYA 4R7ZA 5DULA 5FA6A 3THXA 1R8SA 4PYJA 1F7UA 1ZJZA 2XQGA 3C8ZA 2P9BA 4J4TA 5EPOA 4OB6A 1BGXT 3WQRA 4D5GA 4MPDA 1NWCA 1VBKA 2HBZA 2HQRA 4R01A 3UJ3X 2X4GA 3R7AA 4A91A 3T1TA 3AL2A 2W6JD 1BOOA 5AKHA 2KE5A 3PHLA 3ACDA 4TRRA 3SHQA 1N33B 2G17A 3ZZNA 5JCOA 2GM5A 4BO3A 1G63A 1KVQA 2QLBA 3SZOA 3MMSA 5JQGB 1AK2A 1CKEA 1F8YA 2UZ1B 2HQ1A 2X40A 2Y6UA 3OPMA 4MLZA 4BNNA 4HVCA 1BYIA 2J45A 4LC9A 5FORA 3W34A 5EZYF 3EGDA 2MINB 3SVZA 1Y3AA 1ZH8A 1RCTE 5AVQA 1FNNA 2N1MA 3AF1A 5T67A 3ZE1B 4PXYA 1XDDA 4LMBA 3SCZA 2BJVA 1JDVA 1VKZA 3LBYA 3OZRA 2QBYB 2UVQA 1HLDA 4FJ1A 2F55A 4OFBA 3LWZA 2GXAA 1QFYA 2IELA 4RANA 1BVRA 4C4OA 1KBOA 4IO1A 5CH8A 1SUCA 1ZWLA 4QNRA 4AZ3B 1MFZA 3FG9A 1A97A 5DF1A 4RJTA 1SHJA 1EVJA 3EIEA 1PT5A 3WY9A 2V1UA 1ISMA 2B4TO 1KC3A 2R87A 2RHGB 1TRKA 3IALA 4HADA 4IIJF 4YALA 4EX6A 1DJNA 5ARCA 1TLFA 2EAUA 3WNCA 1H8HA 2FU5C 3DYIA 1MW8X 3FOFC 3UB3A 2XV1A 3C3DA 1WJGA 4OHBA 1H2XA 2W2QA 5ECDA 1HQDA 2VK1A 3DVSX 5F5XA 5ILQA 1XXHA 3U3ZA 3F4KA 1Z3CA 1RXEA 2GJ8A 2PSEA 3ZU3A 2Z58A 3G17A 2QL9A 5EC8A 3LY9A 1PN3A 3PGXA 3VTAA 2JIBA 1OLOA 3SC3A 5T64A 3UK7A 4YO8A 4CIVA 3IAUA 1NMYA 1SVIA 1QONA 1ZW6A 3Q3JB 4PE5B 4FYWA 2HSEA 2QRQA 4C0WA 1JJBA 2H9IA 4B48A 1U3FA 1DE0A 1K4YA 2Q5JA 3KYJB 1IUOA 5FX2A 3RSZA 4XLLA 4OHOA 4TYNA 3FNEA 3U40A 4F3TA 2ODTX 1XCOA 4RZHA 1V71A 1JKFA 2PHZA 2IPXA 4NYJQ 4QE3A 1VYUA 3OKCA 4F9TA 3G2JA 5B30A 5I9LA 5JT1A 1Y8QA 3WGGA 1EK5A 4RBNA 3UUEA 3PX2A 4JNCA 2MR6A 2RHOA 2E1PA 3N3AC 4IZOA 3UM9A 1P1BA 2B8EA 3LHDA 2FPLA 4FE7A 5C3MA 4R1LA 5TX7A 2ODWA 5H8WA 1NVTA 4PONA 3E03A 3LCRA 1E6MA 5REQB 4GYKA 3RRZA 5K3EA 1Z6XA 2WSLA 4BHTA 4ENPA 4O33A 3JQ8B 3UTDA 4XOUA 2I6XA 4CG3A 4H7PA 1ONSA 4J16C 3L05A 1H3FA 1GZUA 1T3TA 4L95C 1WULS 2QENA 2C3MA 1QG0A 1C30B 2O2XA 4J1QA 2J3IA 2QUZA 1G6KA 2WR8A 3QYPA 2G67A 4O4HB 1WZUA 2C57A 4LXHA 1GFIA 4RYDA 4F5EA 1JEAA 3PC8A 2IFTA 5U1PA 1TFUA 3DBRA 1DELA 5F78A 3KHTA 3Q7IA 1L5LA 2AXPA 3RE1A 3O2SB 2IC5A 2NPIA 4MMXB 5HF9A 4KV9A 1FDRA 2GTPA 1TMYA 3RKRA 3MWDA 2I3BA 4S0XA 5J59A 3UJ6A 2E18A 3FB1A 1BD3A 3JWGA 2CT8A 1ZKDA 1R15A 4PC2A 5KOIA 2X9NA 5H4HA 4Q12A 2O7VA 3NWEA 3SQXA 4RMNA 1NW5A 2C58A 2JJ2A 4DR3B 4BLOA 5JANA 2XA9A 1F06A 4MGKR 3EXEB 1QRDA 4LWOA 3ZCVA 4K6OA 1LRLA 4Y6PA 3FHOA 3SPXA 2GYVA 2AFIB 3O1JC 1ODJA 3JAMA 4R5HA 1EUZA 1EVZA 1X9HA 5THXA 4DRZA 3AWDA 5ADUS 3GAZA 3E53A 1B73A 4YGYA 3KETA 1WF3A 4PIPA 4DCJA 4HGZA 1JR6A 4N0MA 2CXHA 5C3UA 1FP4B 2YWRA 1ZN8A 3R5HA 5JFTA 4TKMA 2O2HA 2FPWA 4EABA 1TYCA 4U39A 1X8LA 3K8YA 2ONYA 1UFQA 1BMQA 2W2KA 3A70A 3OU6A 1HLGA 1ZC3A 4JLUA 4YVFA 4GOLD 1BU5A 1P2SA 1WB4A 4HLCA 4IJMA 4RM2A 4S1WA 4F4IA 4YUYA 1RYDA 1DMRA 3NASA 5F2OA 1LV8A 3VKWA 4QHYA 4F5DA 4NYMQ 4R1PA 1OYOA 3A6EA 4EJFA 4V0RA 3WK9A 3ROZA 1J0XO 1ABEA 3PEUA 4DE5A 1E0SA 2WAXA 1UK7A 5JASA 3FMIA 1TM1E 2CHFA 4XJXA 2JLSA 3H87A 2WHQA 4MKRA 4MR7B 4QBHA 4RMGA 3VSBA 1U9YA 4U7GA 4HJRA 1E1RA 2FPUA 4Q1CA 3R8CA 1JE1A 4WK4B 5K6RA 2AVNA 3FRHA 5EIXA 1JG6A 1CRZA 1L8LA 1J07A 1Z75A 3HJGA 3R5SA 3KCNA 4KVGA 4XVCA 2OZLA 1R6VA 1NUUA 1OLUB 2JLZA 1QC5A 1E7WA 1EX6A 1TGVA 2MT9A 2P9ZA 2H7XA 4X90A 4Z0TA 1RABA 3O1IC 4XJTA 5F23A 3AL0C 5FAXA 1I4EB 1J0CA 2ZTLA 3IESA 2A5GA 4JOCA 1MO2A 4PIVA 3DXXA 1S8NA 3RTDA 3AUSA 5LDGA 1KQOA 2AN3A 2HZ7A 1PQWA 2W00A 2ZUWA 621PA 2QY9A 1NU6A 1WBDA 3NVKI 3QPCA 2RHRA 1X7YA 2EDAA 1AB5A 1ORDA 4FTWA 4CMKA 3LWBA 1L5MA 3ZHVA 1E1CA 1I1QB 2V55B 1QGUB 1N25A 1WR8A 4DY6A 5C2JB 3JZFA 2YQ5A 4AMBA 4XWTA 2JEZA 3AUKA 2P69A 1K5PA 2ZZNA 5J4LA 3TNFA 2LNDA 4W9NC 2E4ZA 2WM9B 4OHKA 2ZQYA 3RFVA 4C89A 2HNAA 1ECBA 1GITA 3KJNA 5C0OE 1P72A 3DH0A 4OXQA 2WIFA 3Q9NA 1JBQA 3QA3E 1AQJA 4Q1BA 3IIKA 4K81B 4DBLE 1J5EB 3G7UA 1E5DA 3IS3A 3K94A 5C80A 4ZJPA 3AYXB 2YWBA 4K87A 1QS0A 2VQ6A 1URPA 2OD7A 3MAJA 4QBTA 4ZQBA 1LDGA 1OROA 3DV2A 4NDZA 4G4SO 3HO8A 1E5LA 4XOIA 3TTVA 4A26A 2ZCJA 1YCDA 4M0KA 3VMMA 5J43A 2UYHA 4LFAB 2G0NA 2J09A 4XX0B 5JSFA 3L2OB 2AUTA 1FFGA 5HE8A 2G09A 1GVHA 3A9VA 1N7HA 1CB0A 1I0LA 1FFSA 1U8XX 3KV3O 2MCFA 3E05A 4W1QA 1OU0A 5AI9A 2QPOA 4QYMA 2NV2B 2P2CA 3OM8A 2QB5A 2IPAB 1N0UA 2QE7D 4A27A 5B7NA 5JG7A 4ZTZB 1PSDA 2JAXA 2BEUB 3MK31 1F8GA 4OP2A 1ZISA 2B2CA 4GSKA 5B58C 3TG8A 2QTZA 5TQ0B 4EY4A 1ZCBA 4KLRA 3T4EA 1JLKA 4ZEWA 5CLFA 2F3RA 3TWOA 3GLGB 2OHVA 3QUQA 5KJCA 2QTBA 1E6KA 3O8NA 5H9WA 3GVCA 3INRA 1EA7A 2RH9B 4DIEA 2RAPA 4E6EA 3HI6A 5ELXA 5EE0A 2UZ0A 3LCCA 4MJXA 4NH4A 1X0VA 2NMVA 2YV3A 3VBEA 3E3AA 1QGUA 3F9IA 3ANYB 5CHYA 1Y6GA 4L0DA 3HYRA 4FONA 2C5BA 4HUQB 4CTNA 3OU2A 1CCWA 2CF5A 3CLVA 4ZQIA 4NL4H 4FUQA 4E88A 4QA9A 2BH9A 2I8AA 1Y9DA 2GAFA 5I4KA 4F4UA 4N7BA 3K9BA 2X0NA 3KJZA 2XNDD 5JAZA 1TCUA 1ZA1A 3ILXA 3K15A 4NONA 4D5EA 3JSAA 3K09A 4DV7B 2H1FA 5JNTA 4A2CA 2BZ0A 3H9EO 4LK3A 1DG1G 2HNBA 1Z2EA 2XBMA 3EB9A 3GI1A 1KFKB 3NP7A 4UHEA 4MZDA 1FRFS 1TU0A 1Y34E 1Y6QA 1OH8A 2ODQA 3DMGA 2F3PA 3OEEA 3Q9SA 1JIQA 3GBVA 4V0LA 2HTEA 3OIDA 1FDUA 4BVAA 2ZJ0A 2PFKA 2AXQA 2NYRA 5LVAA 3A9SA 3ZWYA 5B1DA 1P1CA 3W2EA 2B5OA 4V1CA 2ZREA 3AKCA 5PGMA 1NY5A 1PAUA 4ZARA 5C18A 3DBLA 4OGGA 1G21B 3JQ9C 5CJJA 2DFVA 5I45A 3E4DA 1N34B 1A5SB 2ILVA 2GVNA 4ZVPA 4EMUA 1WAMA 4JGBA 1QPZA 1QGOA 3VR6A 3MJFA 3OCXA 2OCAA 1F38A 1POXA 3AP2A 3C1UA 4DIKA 3S0JA 2BFWA 3PEVA 1JVNA 1MTOA 1TF7A 2BFNA 2G1AA 3HKCA 1CIPA 5ALLA 1DP4A 1NBAA 1RSZA 1CJBA 1R0RE 4UKDA 3C5WP 3MQFA 3ORRA 3VU3A 3RC8A 3NBZC 2BP7A 2C95A 5DGDA 4RS3A 1SCJA 1QG4A 4Q3NA 1NQTA 3OX1A 2C2ZA 5LLDA 3AU8A 2WB4A 1F9EA 1IBCA 3TOSA 1MX3A 5BQXA 5IMSA 1PEDA 2ZZKA 5IJ0A 1X1DA 2KQUA 4R9UC 3T7DA 3IRVA 1W88A 2JCGA 4YDSA 3OLYA 2Z57A 3AIMA 4E4RA 1GPBA 1KI6A 1K27A 2AR9A 4I4IA 1E59A 4IL5A 5KPDA 4LYEA 1ZSNA 2Y92A 4P38A 4E5DA 1C3VA 4C3VA 2WJAA 4Y6OA 4AZ0A 5CAEB 2GEUA 2I3AA 4N40A 3SJ7A 5D6OA 1PEKE 3UOWA 4K0RA 3TI7A 4M0LA 4EY8A 4QWMA 2WF7A 2Z56A 1QGAA 3Q98A 1GNSA 1M2NA 4EX7A 2H63A 2P0YA 3NHKA 4B44A 4LY6A 5AK5A 1S2NA 3NVMB 1ZCFA 1O2DA 1RI3A 2PTGA 2VYQA 1FXWF 1JIXA 3CEMA 1ZPDA 3FCSB 3D8TA 4MO2A 4H3KB 3KPYA 3RSCA 3WKCA 2CNNA 4R4JA 5E3IA 3UK6A 5JJIA 2WHPA 5DI3B 3B60A 3NTRA 1RXYA 3CB4A 3H8JA 1R0LA 2XWJI 4MUHA 4U2FA 5TQVA 3RQSA 3UEOA 4DIOA 3QEBZ 1VKNA 2VP2A 1Z74A 1G3UA 3DFKA 4L75A 5IANA 4AJHA 4DT1A 1U0FA 1G17A 1T10A 1HGXA 2QM8A 2YZGA 3L1VA 3WNDA 4U5XA 4JYCA 2GVZC 5ESWA 3GDOA 4CWAA 1GU1A 3OMXA 4AP5A 5J2UB 5G0SA 2VSFA 1M1XB 1GDHA 3EGWA 3TW4A 1HE1C 3FPKA 1CUJA 3K5IA 1ISIA 4HDRB 5A5FA 4J4HA 4DLWA 1RXUA 3IUMA 2E48A 3U7QB 1FNBA 2DPLA 4DDHA 1ZOIA 2CD7A 2EEPA 1C4OA 1NMEA 1NNI1 3Q9UA 3V8RA 2OBYA 4NE2A 3WG9A 4BMNA 5BQ3A 1QF6A 3AG6A 3U60B 3ZU4A 3SE7A 4L5IA 4A36A 2ZBEA 2WWVD 5TXGA 4TQUS 1KGDA 3SIXA 3TLGB 4JV5B 4DDKA 2IEZA 3C6BA 3WB0A 1XLUA 4PZAA 2VJLA 3OPVA 2NTYC 1PR5A 3IPCA 2QF7A 4KQKA 4EBBA 2F7SA 3DD5A 2JARA 1QPBA 5AHXA 4YI5A 3V7WA 4E46A 2HA7A 1XNRB 3EOBI 2ZI6A 1KMHA 4IEFB 3D2CA 1MPXA 2ZRDA 1VMAA 3ZNQA 1ES9A 1U9IA 3ZWBA 4JR0A 1NBMA 3I2FA 3F7TA 1Z18A 4QLAA 2HMAA 1BKSB 5C31A 3WGHA 2PWYA 3JQGA 3W77A 1WHTB 1N75A 2O3RA 2WSBA 3JD0A 3WWEA 4Q9IA 2ZJ8A 4G23A 5I9BA 2HB6A 1IXSB 2XIJA 3PE3A 3D8NA 1RVV1 2K87A 2FWNA 4BAZA 3U81A 4AUKA 4EY6A 3BF8A 5KTSA 1LPPA 3T7CA 3GIDA 4RD6A 4A6EA 2IYXA 9ABPA 2CUTA 2VF2A 1CP2A 2R3SA 3Q87B 5AP9A 3UAXA 3TLCA 4XD2A 3UNXA 5DN9A 2HCTA 2WNHA 2NU7B 2AWOA 5G4KB 3Q8LA 4D8TA 3HCWA 4CLEA 4BQFA 3GGPA 4L6CA 3ICWA 1Z2CA 1S5PA 2GBLA 3LRXA 4FEAA 4II3A 2QMUA 3DC7A 4CEIB 4RLSA 1VE9A 5FHQA 4GHWA 1QV9A 2RB5A 4D9GA 1U7ZA 5BSRA 3KM0A 4OYRA 3W6ZA 4AN4A 2ACVA 4MA4A 2WUFA 3ZVLA 1VKRA 3ESQA 2H1RA 3GCXA 4GPTA 3T7AA 2GZRA 1O96B 4BZPA 3AB3A 2CXXA 3RW9A 1I7LA 4I9HA 4FGWA 3GFTA 4N7RA 5FT9A 4YMHA 2IYTA 2ZUFA 2AE1A 4OMUA 5DWDA 4H4EA 5EP1A 2OP0A 1AUVA 1DRUA 1XMSA 2GF9A 2J33A 2WD7A 4MR9B 5I8ZA 3UXMA 4DLLA 1RTKA 2ISCA 1LNQA 1F9AA 3K70D 4BFTA 5KC9A 2VAWA 3U37A 1L0BA 1LH0A 3ROGA 2B98A 3SYMA 2VZ0A 3B2NA 3PWTA 5IBQA 1VL5A 3VR3D 3RRNA 1FUKA 1OIVA 5E0KB 4PBRA 4F2GA 7REQA 5C81A 5HZMA 3LCVB 2B5WA 4ISCA 4URFA 2Y4NA 4Q3EA 4TUYF 2JGEA 2CNWA 2Q21A 3DE0X 4C4TA 2WG2A 5DNCA 4V0ME 2A78A 3FMOB 5FTNA 5IAEA 5CT4A 4ZT5A 2MINA 2GKSA 3W5CA 1V6CA 4UVIA 4B7ZA 4DCPA 3IJ5A 3KSRA 3K1YA 3E1KA 2DKOA 1OB5A 3ZD7A 2P9TA 2XT6A 3M81A 4PFQA 1WUTA 2JCYA 3CUEF 3EJWA 3DDWA 1P7VA 2MSEB 3ZPXA 2VDVE 1NNUA 3OTOB 4DCCA 2DY1A 1ZMOA 2ZJ6A 3ESAA 4EJ6A 1T4CB 3DTVB 3P20A 4CGYA 3B5IA 2XD4A 2ZE5A 3R9WA 5ALFA 3BORA 2ZS8A 2IXDA 5IARA 4FWIB 1RBQA 2UVPB 1O4VA 5JXIA 4JLWA 1SBNE 4S1OA 4G84A 4I1VA 1XPRA 4CMEC 1PE0A 4M1MA 2VRCD 1YIAA 1JI3A 3IJEB 3NIDB 4GKJB 2TMKA 3INYA 4YRRA 5KQMA 1LLQA 1ILEA 3IKTA 5E7QA 2PPLA 1IN6A 3OIFA 4WECA 5AOVA 1PT7A 3ILHA 3OD1A 4PG6A 4D96A 3COJA 2VNIA 3HO6A 2DG2A 1AG9A 2A7QA 2X2EA 1Q1EA 1YOBA 2PAAA 3ACBA 1X8JA 3K1JA 2FLKA 2Z4SA 2H4HA 4K6FA 4XVHA 3VDXA 1E4YA 4B4WA 2Q1TA 3NIGB 5ALHA 4BNFA 5A3RA 2NU9B 2Q2WA 1RWWA 5CT8A 2OORA 5CFZA 2ZR9A 3TAXA 3Q72A 2QUAA 4W8GA 1H8EA 2G4CA 2B69A 4MIEA 3PC6A 4L4ZA 1J0EA 4UM9B 4UDOA 4MR8A 3B7PA 3W8DA 3N75A 3OVMA 3W8NA 4GOXA 4PICA 5GZ3A 1MAUA 5JPDA 5KDOA 2GVDC 3CFYA 1UBHS 4B6GA 3QVUA 3PQDA 3FCXA 4NIMA 3WLTA 1GPYA 4RW0A 1BNCA 1E98A 1Z8NA 4WKCA 4A0HA 4DCMA 3R9IA 2AIRA 1M2JA 3FPCA 3HZHA 3GFOA 2DR3A 1ZD8A 2M98A 3R3ZA 1N5OX 2XXJA 1VOTA 4UCWA 1JS1X 2QMHA 1YKGA 1KZYC 3QVTA 4HX2A 4UOQA 4DWOA 5I3CA 2QYHA 3FMPB 4YDQA 1W8IA 4G85A 4F96A 4MYCA 1IZYA 4FVTA 4KXYA 3JR3A 6ADHA 4TKVB 1YDGA 3OUTA 4R8SA 5JHHB 4HZUB 3F8SA 1RM0A 3VKVA 1NLUA 3IHKA 1QHHA 4LCEA 5FTLA 4EPTA 5ILOA 4N4AA 5HKBA 3AUUA 4O3MA 1SCBA 1RBZA 4UJ5A 2O3UA 4EIWA 3B6KA 2FSFA 2IU3A 4CMAA 4US2R 3E22A 5IUJC 4M0FA 5BWLA 4PW0A 4URVR 1K6IA 4BMZA 5A5EA 2BI8A 3EVDA 3OTQA 1OR8A 1U0JA 1ZXXA 2J6BA 4D9MA 1RAFA 3UKOA 4AY4A 1JECA 1PT8A 2O8EB 1EI9A 2X5KO 1BS1A 3HKBB 5IK2A 4KDCA 1I5OA 2FCAA 4BX3A 1OLSA 3ITKA 1U2GA 3OIGA 3TSZA 2GHIA 2RH5A 4PQEA 2EFYA 3INTA 4Y2JA 2BZ1A 1Q0SA 1C3EA 1PQYA 2IS1A 2APJA 2B35A 4CCAA 4YV0A 1JKJB 1TMOA 3WE7A 2B61A 2VJAA 4H1UA 4O63O 2J30A 2GWRA 1P0MA 4IIBA 2IQIA 3U17A 1KS9A 1PR2A 3TXXA 3WR5A 1CY8A 2VJBA 3BRQA 3NWPA 2ZAOA 3H2ZA 3QVMA 4S1PA 2IYNA 3A06A 3K4PA 4NI5A 5KQRA 3IV9A 2FPKA 3EXHA 3O91A 3B2EA 3U31A 3SXUA 4UNSA 3RIMA 1E2PA 4BNZA 4XKJA 3KB8A 1V25A 2H0RA 8ATCA 1ESMA 2FDXA 2YQ4A 5HDBB 4K2HA 2IGBA 2VP5A 3DOEA 1E99A 1Z83A 4MKHA 4ALMA 2IVZA 1E94E 4U6QA 4EGFA 4DNQA 4QGFA 3JV7A 3N8IA 1USUA 3LKDA 3L06A 1O0CA 5AHWA 4AJEA 3K70C 1TK9A 1TZBA 4G0NA 1G6Q1 1DC8A 1HFKA 3HWRA 4LBZA 3W78A 4JCCA 4F9GA 2A1TS 1W36D 4NJEA 5K6AA 5LZ4A 1NLMA 1QTQA 2CB9A 2QDXA 3PC7A 3U4HA 1KMHB 1WPRA 2MSWA 3C8MA 3EXFB 3E7PA 4QYIA 4WZAE 2OFFA 1US8A 3U9TA 4EPVA 1PS0A 2KI5A 4L50A 4V2IA 2BH2A 4W9RA 1CS4C 5BN4B 3IP1A 2X9VA 3O38A 5CM8B 3UICA 4DXAA 1UM9A 4IQ4A 4ZFNA 4G1UC 4TT3D 3NNDA 4KHZA 3V9AA 4F3KA 4E14A 1X7WB 5HIJA 3HMKA 1G18A 5ALPA 3RS7A 2WB2A 4JLOA 2PXHA 4QQKA 5ALIA 2PQ0A 4X1KB 5BN1A 5L3SB 1FFHA 3OJ0A 5HCIA 3R0VA 3V2IA 3QBEA 3TRDA 2J9FB 3IQXA 1C2YA 3ESXA 3X1ZA 2QLFA 2H3EA 4IW3B 1MCZA 3M8KA 3RKUA 1K75A 4HWGA 2R62A 2W6ZA 4DJEC 3OESA 2CKMA 3H84A 3EISA 3USES 2FZGA 4GP9A 2I4IA 4R41A 5A9SA 1MQAA 2HSZA 2FEAA 3MILA 2PL5A 4S1NA 4TSFA 3TFWA 3U7RA 4UHJA 5DNDA 2BTOA 2FFAA 3IUYA 1EQAA 2I66A 3VHRA 3OQIB 3QX8A 5KBYA 1M73E 3OHMA 4K6CA 3GFPA 2V7BA 3CMMA 4B73A 5AVWA 1VYHA 4RZ3A 5AM1A 4DCVA 3VR4D 2IIVA 3JZDA 1KU0A 4KR7A 2QAGA 5EGNA 5HUQA 1R0CA 1BXGB 2FEOA 2W7TA 2O8BA 3WDMA 4M7PA 4U9IS 4ZVKA 2HT6A 1QBGA 2V7XA 1BCSA 2F6RA 1DO8A 3LT0A 5DCUA 1XMQB 2VBFA 3K09C 1WXEA 3CH6A 5CM9C 2FEPA 2FQQA 4G4IA 1KR2A 1IUPA 1ESDA 1TOAA 3BWBA 3O95A 4BO4A 3Q7PA 1K6XA 3AKEA 3V2GA 3VMFA 2LR0A 1S2MA 1HG1A 5GONB 3WGZA 5ITWA 3R77A 2YYSA 3F2VA 4IIXA 3H2SA 3AVXA 2FETA 5JNVA 2I2BA 3GJ6A 1YAHA 5JTUA 4Q47A 2Z9CA 1HNWB 4G1BA 2O50A 4PEVA 5BMVF 2ZRJA 1PJ4A 1LK7A 1YZ3A 2AMJA 2YFYA 2C4VA 3EVBA 4G0OA 2GAOA 4P2GA 3RROA 3VC3A 2GS9A 3VR3A 2VHYA 2WV7A 2Y1EA 2HLPA 3MTEA 4QJIA 3T3MB 1XEWY 2XA2A 2DHDA 2V7TA 1S8AA 3ENVA 1KS2A 3BGVA 1ZHHA 3MUNA 2XEXA 1ZBDA 3OX2A 1DUIA 1AY0A 2HPVA 3PR1A 5TT0A 2X77A 1DB3A 1N5IA 1U94A 3RM3A 4KFRA 2R97A 1B8PA 1TC2A 2W2XA 3AJRA 3VHQA 5F9HA 1C1XB 1GQRA 1Z68A 5K0EA 2PZBA 1AXRA 2I6FA 4EGCB 5K6AC 4M7OA 4CV1A 4O4IB 5KSOA 1DXYA 3C4JA 4NYIQ 3IA7A 1XN4A 4HEHA 2CVOA 4I1RA 1TM3E 3I9JA 1FS6A 1EFAA 2J3EA 1Y9EA 3G02A 1VA4A 3MJHA 3VI3B 3CF4G 2YL2A 4C03A 4ZAFA 1W36B 1PJRA 4J9UE 5DDIP 2ZU0C 1EVKA 2PRSA 3D8SA 3L7JA 4D9IA 5K5EA 1Z6YA 2OCIA 1PZGA 2ZR0A 2F90A 2O57A 2XCQA 4TKLA 2JFHA 3L7NA 1FJ2A 5E1BA 2XBUA 3H0CA 3PCXA 3MG9A 1M2OB 1T5SA 5LXTB 3U4DA 8ADHA 1Z5ZA 3OPYB 1ETUA 1QC5B 1UC8A 2RGEA 1NW6A 2GLUA 4E70A 3GLSA 1SELA 3ZJYA 3WRWA 1E5XA 1GLVA 1N2SA 1UAGA 1D6JA 1XZCA 4R2XA 3VPHA 4JDPA 3A1DA 3WYFA 2X58A 5HS6A 2C29D 5JRDS 3KQOA 2XSZA 3G2OA 1GT91 1Y1TA 1Q0QA 4OYYA 4X6UA 2C61A 2ORIA 1C9KA 3TQIA 1TEZA 2PBLA 2XUHA 4E6PA 1VI5A 2CZGA 5GGXA 4CXMA 3GLTA 1WUHS 1KJ8A 4FHCA 1R6BX 1YRHA 3I9FA 1W76A 4QX6A 4MIKA 2I2FA 4Y0NA 4F12A 4BNYA 1V1MB 4JC4A 1XMVA 4OUDA 1RWBA 4BKRA 5EP4A 1WZ2A 4BEWA 4IO0A 1GLNA 4J0IA 1ZNXA 3T5GA 2GEJA 4JJKA 3LBHA 5F3RA 5DCYA 3DBIA 5KWJA 3GLQA 3CZ9A 1C7EA 2NPFA 2W6MA 3OJOA 1WU7A 2GO7A 3W9SA 4FB4A 1KORA 4XLZA 2FSUA 5JD5A 4KPYA 4URYR 2WWHA 2E4XA 1WW8A 1CJSA 4RF4A 3EEIA 2DGDA 4A5OA 4YMVA 5HUJA 1RWQA 5EUBA 4AMGA 2CF6A 4D8YA 2GH1A 1T5TA 2II6A 4XAQA 1EP3B 2GJSA 1XMIA 1K7SN 1Z0UA 2HJVA 4TV8A 3SEQA 3F3MA 1KZ7B 1N0VC 5TQ2A 1ZRMA 2HHCA 3FGPA 5LFAA 1UMKA 3VU9B 4CI0B 1YJ5A 1FS4A 1D1QA 5TPZA 3RUHA 2CLKB 2HHHB 4O29A 1EFVA 2QZJA 4IQFA 2AN9A 4YRPA 4D9FA 4EO7A 3ANXA 2C7BA 2YJZA 4C1NA 1UEJA 3JZAA 5F1PA 3HGQA 4J0QA 1X77A 1YHNA 4AL4A 4ZOAA 4XPIB 3EMKA 5LDDC 1E2EA 3PDCA 3ZY6A 1SXHA 1D7AA 121PA 5IVDA 3K9LA 5L7TA 2WZBA 3E2MA 3RABA 4WSOA 4UTPA 3V7NA 2A3NA 5BSMA 2SKDA 2D7JA 1KFBB 1JHZA 3CVUA 4C76A 3EXAA 5CFRA 1JG2A 3HGTA 1YB4A 1SHKA 3S28A 3ZGNA 3JVUA 1NP3A 3I1JA 4PY2A 4LW8A 1KY4A 2J0EA 1C0LA 1UIRA 3EBPA 3CPEA 3DZHA 3IQIX 1LSOA 3PT5A 4CGZA 1T24A 2QVGA 3EXG2 3IUNA 4K0KB 1V1RB 2RGYA 2N75A 4DDVA 1YS2X 2GPNA 3T95A 1P2FA 3VKUA 1H1LA 3TR6A 3C45A 3EAQA 1X7YB 3OA2A 1TKRA 1UZUA 2Q62A 3NBUA 3PUXA 1S2GA 1OZGA 1WV0A 2MU1A 4QHTA 5AJUA 5MHTA 1Z5UA 2P1RA 1BC5A 1KKUA 2XCIA 1E0AA 1TU4A 1XN1A 2BTQA 2LD4A 3A1EA 2FSSA 1VCMA 4OQ4A 3TTUA 3P0FA 2P30A 3G82C 3GUUA 1FSZA 2WYUA 4NICA 4DMLA 1SBQA 1XAGA 5D3ZA 1NUHA 3SMQA 1CNMA 1XXHE 2ZWMA 3EZGA 5DMXA 3TZ6A 2R8BA 5IF9A 4E11A 1PJCA 1QHYA 2VPQA 4MPPA 2HF2A 3BHNA 4N82A 4PX3A 4Y9UA 4X7MA 2VYNA 1ZG3A 2P91A 3VA7A 1XWFA 3DLCA 4DR1B 4J4BA 4UUBA 5CU7A 1EIWA 3EDYA 4PSUA 1FFYA 1ZJWA 4WN9B 4DVJA 1E3WB 1HYEA 3DW3X 1MGPA 2OO3A 1Q91A 1WDMA 2QRUA 2AI3A 2I62A 2PX4A 2EW2A 1VCIA 2VUIB 1D1PA 2VXYA 2VYVD 2IYWA 2RHHA 4J1TC 3TSAA 3UGTA 3ZKWA 4BUCA 5JH7F 1EGVB 3L7YA 3HPRA 1RQNA 2L18A 1AS3A 3EHEA 3A6GA 4YPVA 2VTKA 5EOVA 3DB2A 3QH4A 3SD7A 5IVIA 3FYSA 4YT8A 3A05A 2VLIA 2XUZA 1AF7A 4AQDA 4OJMX 2VUTA 4OJKA 2G3YA 2R4UA 3PC3A 1OREA 1YXMA 1SOMA 3EAFA 4YP0A 4D0LB 3DKPA 2B4QA 4K9RA 4P6VF 3I1IA 3FYUB 3N3BC 8ABPA 5CP8A 5K2OA 4RTSA 4HQ6A 3NHAA 1CQWA 4M9QA 1NBME 3LP6A 2ESRA 3LNTA 1VL2A 4ZVSA 3NWOA 1SCUB 3MOIA 2XCUA 2GCIA 1VPDA 4XD7D 3A4MA 4IGAA 4OU5A 3NVDA 5EXDA 1EFCA 3BX1A 2J6IA 2NZXA 3DL4A 2BD0A 3NDIA 2QI9F 4K9KA 4J7XA 4TS4A 1ECCA 3ZHSA 1RJGA 1EWTA 5EIWA 1DL5A 5K3CA 4Y7CA 2PX0A 4I50F 1W29A 3UMFA 2I7DA 3OZBA 2YTZA 2DP4E 1FNSA 3OIYA 4A3SA 4QNNA 1DHTA 4EDHA 1I1OA 3PFBA 4UAVA 2O3JA 3L4KA 1XZKA 3TGLA 2HJHA 3AKZA 1OSNA 3BQ9A 3K0CC 5BW5A 2PT6A 3STXA 2VT3A 1QV7A 5FUQA 1ID8A 3E3LA 5A9SB 2LIPA 5K4GA 4PBTA 2UDPA 1TYBE 5KNBH 2ZTUA 2R2AA 3PXBA 1KIFA 2JVKA 1N2EA 2MSKA 3DUWA 2C42A 3PD0A 4ENQA 4PYIA 1XLTC 2GBFA 2JI8A 3ND7A 2EZ9A 5HTKA 4KNWA 5ABPA 5AESA 4ZHQF 4PN3A 1JYSA 4U7TB 4X9XA 2ZIXB 2P3OA 3IHWA 3UJAA 5ERYA 1SU8A 4G1FA 5CNJA 3GFQA 2W9XA 3SX0A 2HO4A 4MVXA 2PT5A 5HA5A 1XD2B 1YC2A 3TZQA 2I6TA 1FP6A 2OBFA 3LGSA 1JZSA 4PLWA 2GETA 1PGNA 3DE5X 3DAYA 3INNA 2BUAA 4N9WA 3FFAA 3MTAA 10MHA 4QXMA 2G04A 2H59A 3EVGA 2EF1A 1NVDA 1B8UA 2XKJE 4KITB 2NUAB 1Z34A 2LUOA 4HTFA 5C8YF 4IOKA 3W90A 2BKXA 4Y6SA 3I8OA 2XVZA 4I1UA 4R71A 1G60A 4N12A 5KMGA 4WFQA 2IYYA 1THTA 4NU8X 4QRIA 1WQ4A 4HL6A 1X1QA 2JGNA 3AY6A 1YZGA 3ZTYA 1W48A 1A4IA 3VYUB 1FP2A 5I7EA 4YREA 2C7RA 2FFQA 3AEZA 4P22A 4YX9A 1R6DA 2GESA 4TTAA 5DHRA 5TMPA 2PUDA 4XB1A 4UMEA 3LD9A 1JLSA 1LI4A 1QF7A 3GGSA 4MVJA 3HDVA 2JRCA 3RTCA 4BZWA 4HPXB 1I3NA 3DYBA 2NO7A 4HV4A 1JSCA 1ISFA 3C74A 2BOVA 2PCJA 5TE9A 2IEDA 5ALYA 4CM1A 3AFHA 3E3MA 2O48X 2P4QA 3VRHA 1U99A 1X1EA 3VNAA 3EZNA 3AC0A 1CQJA 1XD9A 4RM3A 4N6NA 2YFHA 3CE6A 1EUDB 1RRPA 2P6RA 4DOMA 2IWRA 3WC4A 1RFLA 1A1SA 2IYAA 3CLKA 4CV2A 4EVRA 1KR5A 3A8TA 2Q0SA 2FW1A 1JR3A 4FGJA 3OF3A 4CLRA 1WBJB 2BEVA 3AVOA 4ZKEA 4EBFA 4XGNA 1P9RA 1Z13A 5AM5A 2ZYDA 4RACA 2DX7A 3M4NA 1W6RA 1WPQA 1WHSB 4Q05A 3RTGA 5FNVA 1OC2A 5EXTA 5CGZA 4Q16A 4ZYUA 5CDTA 3UWMA 5EWJB 3KQLA 3WNVA 3RAFC 3GBPA 2CLOB 2AG6A 3GUHA 2HYDA 1GXSA 3KYDB 4BO1A 1D0SA 2P5TB 4L6IA 4YJ2B 5KVQA 4DDMA 3HYCA 5DLEA 5CEEA 1JU4A 2WUDA 1WXGA 1ORTA 4PSKA 2CDCA 3SKYA 5LJIA 2A5DA 2ZIVB 2XKAA 3V1UA 3M3DA 3ESDA 2Q3FA 1F5NA 1V4NA 3EGDB 1L4HA 1Z4NA 3MGKA 3NQ41 3PFNA 5I7WA 1MA3A 1MAAA 2V96A 3JARB 4X8OA 3S8MA 1N9GA 1F8UA 1WXFA 1QTRA 2PKCA 3Q6NA 2H5LA 4JJ7A 13PKA 1SUEA 4MB0A 1PJTA 2VSQA 4RD3A 4EFNA 3LTNC 5DGCA 3D7SA 1AX9A 3H99A 5M2QA 3PNYA 2VK4A 4FMBB 2JGLA 3ROEA 3CU5A 3SR3A 3L9WA 1HSOA 1ODFA 4YWJA 4GL2A 3NGXA 1KJYA 3I8XA 4N41A 3B6EA 5I9NA 1MHPA 1SVKA 3V48A 1XMPA 3DMPA 4EY7A 1NF3A 4WXEA 1H1DA 3R7WA 1UJBA 7ABPA 3E0QA 4YQFA 3TFQA 3B6IA 4HMPA 3HB7A 3V1TC 4DM7A 3BPSA 3FLBA 2ZJFA 2BCJQ 4JLNA 3CX8A 2DWOA 2VYCA 4BGEA 3TVTA 2J9FA 4DIDA 2O8CA 4DLZA 3OIVA 1ZN7A 4LBVA 4RE6A 3P27A 4BP8A 3JSXA 4YUXA 4QOIA 1BH2A 3EZXA 5ALSA 1NG9A 2O7RA 4G0ZA 4MV5A 3BB4A 5FL7D 4GYJA 4N76A 4LQCA 2EBUA 4L4RA 5EEHA 1V9LA 3ROFA 3TXAA 3UW1A 2VK8A 1DCMA 1SVOA 1OI7A 4J49A 2R5FA 5TSDA 5BY2A 1ODKA 2Y67A 5FQOA 2HBRA 1EWKA 1ULUA 2PGLA 4HTFB 4DC9A 4M1QA 3FOEC 2FWAA 1T2AA 3WL5A 3KSBC 2GM9A 2JJMA 1L3CA 1Z2OX 5FOVA 3P0EA 4LJ9A 2FQXA 4NFSA 1FRQA 1TM5E 2QTVA 4JUBA 4KHPB 5HIMA 3FWNA 1JIIA 2YH2A 2YYZA 1B4DA 3QPDA 5IC4A 1PS9A 3CZMA 1EDOA 1DLIA 1IVNA 1JR3D 1NVGA 1QZ3A 2M32A 3LX5A 3UATA 1GGJA 1N7IA 5C51B 4W5RA 4MV0A 3PZRA 4U2CA 3ESYA 1HORA 1GAJA 5GONF 2AK2A 4A03A 4CDRA 2C7VA 2HZBA 4C0KA 5B57C 1U2PA 4M9CA 4Q7EA 1G3IA 1JXMA 1RQLA 1T2EA 3GUCA 1HKUA 5CEJA 1KEPA 3QX9A 1MB4A 3GJ4A 3WNZA 5A6VA 2IBTA 2PZGA 3RQIA 3ZY3A 5C7YA 3HJTA 4OB7A 2CLHB 3FXAA 4PC3A 4N49A 4HGYA 1D4ZA 4RHFA 3VR5A 3SZUA 1VB5A 2Z6AA 3LDHA 1QKIA 2R1TB 4FNGA 4FDVA 4BCDA 1CDEA 2PANA 2ZB8A 1Z8HA 1W49A 3E18A 3QLVC 1A8IA 3HTXA 3JPWA 1C4KA 3PJFA 4FBMA 2V54A 2DSNA 1Y82A 2OGUA 1DTSA 3IDFA 3MOSA 1TQ8A 3OQVA 4ON9A 3T1YB 1R3DA 5HZGA 5JO9A 1ENPA 4R2IA 4LWZA 3RWMB 2Z3WA 1W5BA 3K16A 5LP1A 5CD1A 4GQAA 1IM2A 1KTIA 1QG6A 4CIWA 1Z26A 4FFDA 3OZ7A 2E0IA 1MZPA 4I0WB 1P5FA 2PWBA 3KT8A 3TQQA 3C7DB 4CI9A 4LXXA 1N5RA 1Y9JA 1GR0A 1FVFA 1C14A 4B3GA 4HKTA 2HRBA 1CY0A 2I55A 2OV4A 3AHEA 3BE5A 1QGYA 3G85A 3HVIA 4LZZA 4MVCA 4MI6A 3HM2A 2NVWA 4X5OA 3RIXA 1W0JD 1OWPA 5IKXA 3HJAA 4NWIA 1DC5A 1YIOA 1QAMA 3FTFA 1TLLA 2OBXA 3PQ4A 4LHEA 1PR3A 1SC4A 1WL8A 4J75A 4MV7A 5FWAA 4ARZB 2DTDA 3W3ZB 3ZDCA 2DRIA 2WLTA 4URZR 3ME5A 1C5KA 1TUBB 5IDQA 2H29A 5JCOC 3JQBA 1Z4LA 4U7FA 1KAEA 4RSGA 1E3WA 1OGYA 1ND5A 5DX8A 4B76A 3A1NA 3OCZA 2AFRA 3H8VA 3UT5B 3LCUA 1X42A 2DBZA 4EJ0A 5IEJA 1SC6A 4G5QA 3G0HA 5CTAA 2IYSA 3ND9A 4Y2QA 4ZZ0A 3QITA 4PYMA 2CMGA 3P7MA 4FMDF 5BSEA 4L4YA 3BIFA 2OO5C 4MVJM 2HHJA 3KUUA 4QFCA 4Y1EA 5A5GA 3IILA 1EH5A 2VSOA 2FW0A 1NATA 1WLSA 4XEHA 3ELUA 5KWIA 1B8NA 3OLZA 1J0BA 1VL6A 2VSYA 4TTVA 2C4WA 3TB4A 1N1GA 4ZDKA 1C7QA 1EJ6A 4QFDA 2HA4A 4DL9A 4RENA 4AY6A 1C3XA 4IIHA 3EIWA 4OUKX 4UVEA 1H23A 4U2KA 3X1XA 2C9BA 4RKYA 1TJ5A 4MW6A 2KPOA 5FRDA 2H31A 2ZDGA 5IC5A 1GSOA 1UAAA 3KR0A 5KSZA 1OI2A 3D0OA 3R9XA 1QK3A 5LYJF 5BN5A 2C4UA 4G5RA 2O1XA 4YCDA 1CUGA 5ALVA 2G83A 3BREA 1M5UA 2ZRKA 3OFNA 1NFRA 1WVMA 2BMAA 2P9HA 4IHJF 1ZJ4A 2ZPAA 1RADA 3A27A 3WIVA 1X80B 2E7ZA 3K6KA 1T0IA 1L5VA 1FTGA 1GG2A 3P2EA 4JROA 4QPDA 1C3OB 1BHO1 1SXJB 1OI4A 1H8HD 4MWTA 3ZNNA 1IN1A 3MIIA 3A4TA 2PYIA 2VPTA 1TT7A 5A71A 1ZCJA 2O6LA 2BM8A 4OBEA 5KCMA 3UOGA 5DK6A 2RJ3A 5EFOA 2GKGA 3D02A 4W5QA 2RGDA 1VKJA 2WWXA 3ONFA 4MCAA 3U7QA 1ONBA 1Z8FA 1SVLA 4COKA 3SJAA 1J70A 2ZATA 1Y1QA 1GKUB 3HU2A 1DAEA 1B6GA 1M6EX 3ZWQA 5DGXA 5IDYA 2OXTA 1KQFA 1QRTA 3LX6A 2HWKA 1OX6A 3AU9A 4KN6A 3T34A 4Q19A 1T4CA 5F7JA 2V7PA 3GPBA 2RHCA 2ZJZA 3CVJA 5H3LA 3H13A 4OM7A 5LBUA 1GCOA 2V0NA 4DA6A 3PBKA 1YD7A 4WLNA 3G5UA 4KQMA 5LA6B 2NZUG 3DOUA 1T4BA 3ZWNA 2RHJA 1U9ZA 3KKKA 4A16A 3OC0A 4QT0A 2OCYC 4HAXA 2HSJA 4IWYA 4YFVA 2L42A 1EGHA 5CB4B 1IXYA 4CDMA 3ZWMA 3CF2A 3EFHA 1KSHA 1RP7A 3DMRA 2C9DA 2WU8A 3HS3A 2I2AA 1IEVA 1XTJA 2WTNA 2P68A 3DTTA 4OHCA 3I42A 1AQNA 4JB0A 3RJMA 4RPIA 3OP4A 2CNOA 1AQLA 1IZ8A 1LTHR 1QH0A 2Q5OA 4KDEA 4BO5A 1I9CA 2REBA 1VIVA 5JSQA 5DM1A 2PU5A 1UBJS 5CIYA 5IAOA 1G64A 3Q7QA 5CVEA 4XGKA 1B41A 3DDNA 4BMCA 1L7XA 3WTCA 4II7A 1E7SA 1WY5A 4FDAA 4BU1A 2F00A 5K0BA 4LPSA 2DMRA 2WHRA 3G8AA 2D5IA 4EW1A 1E1NA 4KLCA 4A73A 3UFXA 4UTOA 4YAKA 1CSEE 4LK2A 4DQXA 4I8XA 5SYNA 3SSAA 3FWYA 4DMGA 5ERGB 1UMCB 2PA0A 4X8MA 4CCSA 2KBEA 2YN0A 2P3SA 2WC1A 2NU9A 3PNLA 2E5LB 2BLLA 1ZUNA 2OY0A 2Z08A 1R88A 3MWFA 3RVNA 4QLBA 5IFKA 3BL5A 1AIPA 4TT3A 3A6ZA 4HDMB 1Q50A 2X6QA 2Z2KA 2WYHA 2YZNA 4KN8A 2WTUA 2Z2YA 3VV3A 4CEIA 1S8OA 1WCYA 2H51A 1CERA 2I9PA 1UBUS 3JRWA 4ZOQI 3BEDA 3JQAD 4CJXA 4B6FA 1LXCA 5A2GA 3R5FA 4F60A 4ISBA 2I4LA 4X20A 4BWGA 1YWGO 4AFNA 1CZUA 2P2SA 3MWYW 1QYDA 2P27A 3R5TA 5AM2A 3ANMA 4CT0A 3WICA 1U3TA 2XDYA 4HEQA 4EKYA 1VBFA 1E9DA 1NQ5A 3CSSA 3CRRA 3KWLA 1H5NA 1YMUA 1DBWA 1BQ4A 2DZDA 2DFTA 1DBQA 1HXHA 2FX2A 2XODA 3N6RA 3ZKWB 3ZYZA 4BFCA 3JYHA 1U80A 2QMYA 4J9VA 4PRYA 1D1SA 5C4MA 4N7JA 1LFDB 4QDOA 3C1OA 1T3SA 1Q11A 2W0MA 3GLHA 2C0CA 1AXEA 3P4YA 1NBMD 2PRIA 2YDYA 5LD2C 4F5YA 3ABZA 4YJFB 3ESCA 4Z3OA 3Q2KA 4NE7A 4S2UA 1PLJA 3K73O 1EX9A 4ALJA 1JG7A 4YRQA 3PXGA 3SYNA 4BZQA 3CCFA 1P75A 2CNDA 4WJLA 1NF9A 2W93A 4RTJA 1Z37A 2ZYVX 4DA4A 2GEDA 3RSGA 1XLTA 3HDTA 2WFZA 1H69A 4EHKA 1S6YA 1TVMA 3LLMA 4Q7MB 1JFLA 4FR5A 3BERA 5JC1A 5C5EA 1RP1A 2F43B 2F4NA 3N9IA 3RT1A 1C3OA 1QTNA 1SXJA 1T26A 2BTQB 2PKEA 2Z1MA 4NP6A 1WDKA 1E64A 1ZI9A 1VC2A 3OZDA 3O2QB 1KMCA 3VVCA 5BUQA 5JMOA 4FMPA 4LXIA 1TRHA 1AZTA 3A1SA 4G5GA 1QTIA 2FSIA 1KNXA 3EMVA 4RJ2A 3AL3A 1EK2A 5LZ8A 4I55B 5L6MB 4FYJA 2B1IA 1QQ5A 2P8JA 4ZEXA 1ND6A 3IDSA 4Q7KA 4QYTA 2CWWA 5TVKA 1OW3B 4I1OA 1E3IA 1XA3A 2V59A 2OILA 1KI6B 3E70C 3NAMA 4H18A 4U02A 3AJ9A 1TCCA 1GHTA 1S3FA 3L3BA 3OECA 1IE3A 4H0NA 4KN9S 5FWYB 4BQPA 4ZYWA 4BFWA 1ULAA 3VZDA 1X7XA 5CVUA 1D8TA 4F04A 2P9FA 1A69A 3IOEA 5EIAA 2GARA 1RHUA 1UT5A 3FE2A 2ZIUB 4GP7A 3VR5D 4HGPA 4DILA 4YN3A 4KYUA 3K2IA 1PHRA 1T9DA 2NX2A 1XAJA 3DMHA 3PXXA 2I76A 1N5LA 1W4BA 3I4FA 3U56A 4KIWA 1WZIA 4NECA 2VQFB 2FZLA 1X3LA 4QL3A 1FXWA 3FVVA 5TNXA 4G36A 1HFJA 3R4CA 1MIOB 1UDAA 2EDCA 4IXTA 1XQWA 1BE6A 3HJUA 1QIEA 2JL1A 3TM4A 1KY3A 3QJGA 3CINA 3GQBB 1NVFA 1FTWA 4GI2A 2IU0A 4PZEA 3MGCA 4ARAA 4FFBB 3OQNA 1U3GA 3M82A 4B4OA 3OOYA 3PKZA 4QU0A 1EBBA 3K9GA 5CHEA 4YAEA 2RBEA 3AQ4A 1N0WA 5LQSA 3KJXA 3TOZA 1K86A 1BXKA 2OV1A 1OX4B 2YVKA 4F3RA 3U44B 1OGJA 4IJ5A 3D4BA 4AG5A 1XQ1A 4EB3A 3L0CA 2PUFA 1U8CB 3NRJA 1IHYA 1SKBA 3H9GA 4QYWA 4CF6A 1UM9B 2I3DA 3D2BA 3R40A 1XDZA 4KSYA 5H59A 4B43A 3TW8B 3Q1KA 2YWDA 5A4IS 1IHDA 1EFHA 2YV1A 2WM2A 3LW8A 4JLBA 4RXUA 4UOEA 4RTRA 2D5AA 4LNHA 3AO0B 3DBHA 4JT4A 3KZ1E 1WNTA 2GILA 4MA0A 2PGNA 4IBOA 4OP3A 3S2FA 4GBED 3VR0A 1QR6A 2ZXEA 3SSMA 4KPUA 1IEWA 4B4UA 2VQEB 4DA0A 3AOGA 3LDAA 3OMLA 4LTMA 1XU9A 3P0RA 1UPXA 2HDHA 2JFPA 3N8DA 1DPGA 3HP1A 3K32A 5CDFA 3VPSA 2HF9A 3MT9A 4Z7QB 3GP8A 1SGWA 1RJWA 1RAAA 2UUBB 2O3QA 3T3PB 3OICA 2YQZA 5B2ZA 4CFYA 1CZNA 2GZAA 4Q4HB 4F2HA 1VGRA 1LWOA 3TUJC 1EFPA 1U7DA 4WMLA 3UV7A 1G21A 4LQDA 1OYYA 1O8BA 1X94A 2H2HA 3R3HA 2AQHA 2C7GA 1K6EA 2WKRA 1YVDA 3FUTA 3H19A 1P73A 1W85A 1WE2A 3B5EA 3OETA 3QXSA 1Y1SA 4HGOA 3R7NA 4EATA 4X1YB 4YR9A 2H65A 1VCHA 1YCGA 3DKIA 3LTEA 1LB1B 3UPDA 4IMRA 1NGSA 4C7KA 5JECA 1GDTA 4DR7B 1QX3A 3WKAA 3VH4A 1QH8A 3FOCA 3OMWA 2Q4BA 5ITZA 3H9JA 4NBLA 3M5DA 5KU7A 2C8JA 4YRSA 3C3AA 3EUFA 4MR7A 1CEYA 1TZKA 4ZOLF 1MMFB 3NETA 2NQTA 4PLFA 4YJHA 4D8UA 5FTJA 1KP9A 1WVGA 3BXXA 2G6BA 1NMQA 4MUGA 3X43A 4NU6A 2LWIA 1M0TA 4H9GA 4K9SA 4KXXA 1YI0A 3KC2A 2I6GA 2VATA 3L41A 3QKIA 4K9LA 2Y66A 3MAAC 4JK3A 3KTOA 5E8RA 4UZFA 2O8FA 1XDUA 1NJ6A 3BJEA 4JQOA 4DV1B 1MAVA 5AM3A 5CA0A 1AKVA 1Y7PA 4B3HA 3EVEA 3E9MA 4MVJP 5TEVA 3DXZA 2B1JA 1RNLA 5NULA 5JV5A 2FI1A 1ZKMA 3NV7A 5KYUB 4LDZA 1XJWA 5L95A 3VBCA 1JXOA 4MDFA 3HYNA 2XYPA 2C7QA 4EGJA 1JJFA 1ECGA 1XVUA 2XYGA 3DGFC 2AQIA 3H97A 1UFOA 4C0QC 3S99A 1SVWA 2O3TA 2RI6A 3H17A 3TX6A 1F6BA 1DUSA 3BULA 1S89A 4NV1A 4RE5A 3UK1A 1YFLA 3UK2A 1QYXA 3VR6D 1CEQA 1W59A 2FN8A 3DLPX 5FR1A 3RLFA 4LVOA 1O58A 1CLEA 2G5PA 1VTKA 2VJDA 5BNFA 3O8RA 2D2XA 4Q1VA 2YW9A 4URHA 4FHEA 3G0CA 3N87A 1C2TA 3PWSA 3K53A 2IWHA 4B33A 4UTRA 1MJ5A 4LS3A 1UDBA 1FW6A 2JH8A 5AIAA 3UC9A 5LZ9A 2XDAA 3IIEA 1DKUA 3WMWA 5JU6A 3AM1A 1CR0A 1PWEA 3U7JA 1H3EA 4HQLA 4G9GA 2IITA 2P4EA 3TZCA 1AGYA 5B1EA 3FWPA 2YOGA 1GCIA 3LHFA 4BMPB 5DNVA 4WE3A 3H6KA 4HXYA 1T5BA 5DI9A 3KE9A 1EPUA 2QVBA 3N2IA 1QAOA 2QD2A 2ZRGA 3FTQA 2C54A 4PS1A 5J1TB 5DVZA 2ZRAA 4R1SA 3S1SA 4AUEA 2XGMA 1U98A 1UZMA 2IVFA 1MAHA 4EKEA 5DHSA 1DQNA 2J7KA 2WG1A 2Z3VA 3FFWA 5JZMA 4P0QB 4MRAA 4LA4A 1V4VA 5K0NA 1N2BA 1C3LA 1QH1A 2EHJA 3DDHA 4MDYA 4EK9A 2O8FB 3ET5A 3MD9A 4LNUB 2DBQA 3LL4A 2Y2UA 1GUYA 4AF6A 2Z2JA 5FPHA 2XLBA 4P4GA 4IIGA 3GLIE 2DETA 2W4QA 4L3VA 3A6DA 2B8JA 3D4PA 1E1CB 2RHBA 4LYHA 1H6BA 5JSZA 3UKDA 3ZCXA 1INLA 1W5FA 3U26A 3RYFA 1E6CA 1YE8A 2VYFA 1LV7A 3VOBA 4EHJA 4GMGA 2FUG1 4ZVOA 1BJKA 4EYEA 5KYXB 1P8AA 5FI0B 1HY3A 2QZ4A 3HADA 4NFLA 4MW5A 4QPPA 1M1YE 1XTVA 3IEPA 1EGMB 4EZBA 2PIAA 2GF2A 1T9BA 4OA5A 3G1WA 4BGDA 1FFAA 4Q48A 1T9CA 1CJKC 4HDSA 4Y9TA 4A92A 1KWGA 3LPDA 1PJAA 4MS4B 4FK8A 2A5JA 4WBXC 1KF0A 2DY0A 2F1OA 2F3UA 1U2TA 3HMQA 3MAGA 3OA0A 1G8JA 5DPMA 5AM0A 1ZD5A 5F1OA 2R9VA 2YZ2A 4RTOA 1R6TA 4M21A 5C1OA 4NS1A 2J0SA 2Y4OA 3FGZA 2G07A 4EA8A 2ONCA 2VDWA 1XVAA 2A58A 4Z4QA 1GGFA 3ONVA 4IR7A 5HBGA 4J3NA 3IMFA 1YMVA 4EYKA 5GJVC 4YT4A 4CIYA 2R5NA 3G9TA 3F7NA 3DZBA 3RRYA 4FPXA 2GEKA 4ID3A 4RLQA 3TS1A 4B5KA 1IIRA 5INTA 2FMTA 4DB2A 3DV0A 3VFDA 2AZDA 2VRCA 2ZVPX 1EVLA 2BJHA 2J5QA 4R16A 1AGNA 2YJ4A 1DUVG 3WBJA 4E32A 2H5IA 1N2HA 4F56A 1R5JA 4HDKB 1TUBA 3PA6A 3UH1A 5JJKA 3EW7A 4JFRA 1QFXA 2C83A 1ESEA 2VRBA 3QEOA 1ZYUA 3A9RA 5A4MS 1U6KA 5JYDA 1QHHB 4NMXB 1W5SA 1VSQA 1DOZA 3GNQA 3GRAA 1C1YA 4LDQA 2JJQA 3BKXA 4E7PA 4PGGA 4AJPA 1W2WB 2AWNA 1QX4A 4QTZA 1G5RA 5AH0A 4OLBA 2PAFA 4J0CA 1G4UR 4HRXA 2SNIE 3OT4A 3MT0A 4Y1GA 3KJFA 3GZTB 3PQEA 4IM7A 2WSIA 3DR5A 3FNHA 3LT4A 1O95C 4LY9A 4MQMA 4NRDA 4IKPA 3IT0A 3CH5A 4MQLA 1D8AA 5B37A 3ZXXA 3G79A 5CPFA 2AJCA 3WLQA 4B3BA 5K0JA 5L4NA 1DJMA 1JT9A 1ZOLA 4L0CA 4RXMA 5F64A 1O6BA 4FZVA 4V24A 4TV9A 4DTIA 3T0GA 2LTAA 2H0QA 4J43A 1EUCB 5KYNA 3S2IA 4YJ2A 2O2ZA 4YJGB 4ENVA 5EXEA 1P5ZB 2JGIA 3TXYA 3F4BA 3E61A 4QUEA 1VJDA 5D3MA 1V0JA 2NNLD 2B2XA 2A9QA 2ZRBA 3CH7A 3ZE0B 4L8YA 2EX4A 5JEDA 2XMQA 3D2LA 4D45A 5A0FA 2YJNA 4BFYA 1DXQA 1VA5A 2DBRA 2G40A 3A32A 3DWIA 3EPPA 3KKEA 3H0KA 3OEED 1L8QA 1L4UA 1LBHA 2O0MA 3H1AA 3QWAA 5DSZA 5ENDA 5HG0A 2AG0A 3CGGA 3MUOA 3IR5A 3QIAA 1JWAB 1P6XA 1JHYA 1TYZA 3PGA1 5CCXA 1NKTA 3GP3A 1G38A 2NM0A 1V5IA 2CBZA 1K9VF 2OXEA 1JZQA 4U4AA 1J20A 3GV0A 2Q3CA 2HQOA 3C3EA 4DREA 2WD9A 1J56A 1XEFA 2PH7A 4LAFA 1DIAA 4DLKA 2Q07A 4EHHA 2EIHA 4MRNA 1GZHB 3FYUA 2XTJA 3ONWA 4PXAA 2YC2C 4KQIA 5KTYA 2KS6A 4F2PA 1F51E 2H92A 2X41A 4P98A 4KSCA 4UTZA 5HRUA 1AK1A 1SBYA 4CMIB 4B1FA 4JYAB 2DKFA 3NRBA 2V4MA 5K4AA 1ZIDA 3TGPA 4REQA 4XTRA 5E6RA 2GO1A 4B6PA 5E95A 4G5HA 5JBNA 5THKA 3OJXA 4R05A 2XRZA 1P1FA 3NOQA 3D5QA 4GPZA 3GDWA 1WUIS 1XKXA 4R9NA 2BELA 4M99A 5AJZA 4NPHA 5A7FA 4UQPA 3TBKA 2CLIB 1YI8A 5FV7A 3LF2A 4DRXA 3IBYA 1Y7IA 3EG9B 1ZN9A 4NAHA 2Z6UA 1HDOA 3BT7A 1DJLA 3A3KA 5FAKA 4QXQA 3RU7A 3KHUA 3IAXA 2ADMA 3L8GA 5F51A 4M76B 3ICCA 3LC0A 3SK0A 4PPQA 1TQHA 3V8VA 1NLYA 1OXXK 1PBNA 4ZOLB 2DR0A 1ZDMA 2DWUA 2XVMA 4M53A 4AJOA 1ILWA 1DKOA 1XCPA 1BSVA 4K1LA 4MAAA 5LQCA 2FJPA 1KQPA 1R7RA 2XADA 4Q03A 5MDHA 4HVLA 4ATNA 5BSWA 4YMLA 4WXHA 4DC0A 3PIIA 1CETA 3NOVA 4BYMA 1FMFA 5TB5A 2IHYA 2O06A 4GPIB 1TVKA 3C2QA 2IUUA 4YLEA 1H1TA 3WVNA 4B3RB 4IXWA 1CE8A 3LQ1A 4NFYA 2P5UA 4Z9FA 3TZLA 3VOSA 3WGNA 4BEJA 2QD3A 3T7EA 1YZNA 2FLWA 1C7RA 1XHEA 1XR3A 4R0VA 4INPA 1QDUA 4LJ6A 1FX0A 4EYGA 4Z9BA 4RKRA 3GUYA 1Z6TA 5JD4A 4D25A 5EPUA 1R6AA 3R20A 4YRKA 3I4CA 1KZ6A 1BDIA 3EXIA 4ZAXA 1XP5A 3R7BA 2IF2A 3RIYA 5I7FA 1QFSA 1C9NA 1E1LA 1YJAA 3G0IA 3L4EA 4LIPD 1FSPA 1W52X 1XV5A 3CEAA 3D5TA 3F3KA 3S44A 3EARA 2XWPA 3DE6X 2PYZA 3EQ2A 4GZMA 4TMXA 1TA0A 1NN3A 1YQEA 4Y0AA 2OYRA 2I3ZA 1ML4A 2WHYA 4XXHA 3V42A 1IWBB 1PFUA 2G25A 5IN5A 2WYVA 5KOHB 3IEMA 2CDRA 4Z4GA 3DMFA 2I22A 4HQNA 2WMYA 3R7LA 4BX9A 3UGJA 4IV5A 3OAAA 3EVFA 4L4XA 4OOEA 3SQWA 5JW6A 3O8OA 4POAA 2V03A 3DV9A 4UVGA 3A6HA 4ZO6A 2ZU6A 4X7RA 4WOPA 1WTAA 3H5OA 4GP6A 1ECFA 5K03A 5IP5A 1Z0IA 3NT2A 3QKTA 4I81A 2B1RA 3M2TA 4XARA 4E30A 4YRNA 3KUCA 3V8BA 1D7OA 3OJFA 1KO4A 3HJNA 1I51A 3V97A 3CRMA 3P9XA 1L9KA 4QJBA 1NA5A 2P7IA 2KMLA 3B3FA 3QOFA 4X85A 1O94A 3X2EA 5BWOA 3HBLA 1IQRA 3P9YA 2R6HA 4H17A 5TGZA 3TSYA 2JHGA 1GSHA 4M9ZA 5LPNA 3AK4A 1P2UA 4GZ6A 2FPMA 3LQQA 3DP9A 4C7XA 3ZLJA 4DHWA 1EZ4A 1QHFA 2D8AA 3F46A 5I7SA 3IAS1 1AURA 3TKLA 4DUYB 2I6UA 3X2FA 2ZJBA 1JEJA 5A4FS 2AN5A 4DUGA 4RFLA 1SG0A 1ZU4A 1CY7A 2OKCA 1OI3A 4WPGA 4B84A 2BGRA 2B8NA 3E1SA 3IEIA 3K3PA 2RC5A 1G20B 1I2MA 4LDAA 4Z8YA 2ZB3A 2AJBA 2ATCA 3BBLA 2WVJA 3KJQA 1Z08A 4AAYA 4Q9HA 4CHGA 2EZTA 1XZLA 4KAJA 3EUWA 2EL9A 3B78A 1C7IA 4L2IA 1LCIA 4ER3A 1GTG1 4EKIA 2HRRA 1OTXA 3CNEA 4FYKA 1G0NA 4A15A 1V2GA 4IG4A 4CKCB 5JWHA 2QUIA 5IASA 5FI3A 3KOZA 3MWEA 5IJAA 3F6EX 1IEXA 3MRTA 3TOXA 4KPEC 4NDAA 3GJXC 3EY9A 4FFRA 3B7WA 3CV3A 2C5HA 3VPDA 3LJKA 4Q3CA 4TWAA 1BDHA 5I4BA 1OXBB 1LC3A 4OYHA 3UV3A 3TCNA 3D4OA 3TW8A 1ZY2A 1E6WA 5IUNC 1H22A 1AUOA 2B4YA 3A11A 4XFDA 1L1QA 4M8NE 4H6WA 3AHHA 4OMCA 5TQ0A 4C3UA 2ZCUA 3KJIA 3QY0A 3QXXA 1CQXA 4C7BA 3ZQJA 5HGXA 2OMKA 3UWKA 4J0GA 4IP0A 3A9TA 1OHHA 4KWTA 4PZPA 3HUEA 1KJIA 5DISB 2IYOA 1OVGA 1R5OA 3E5MA 1K3FA 1UF9A 1CDOA 2DAPA 2HWUA 4MJLA 4P3NA 5KIAA 2KB0A 2QPTA 2O4CA 3LOPA 4GMHA 1I13A 3RSQA 1XNHA 1CUEA 2OTCA 3AONB 2W4IA 4O2AA 3UXYA 4B2PA 4YRZA 3DM5A 4YXFA 2G9NA 3CEJA 4RV4A 1L8AA 4WNAB 3ZK7A 2ZWIA 3E15A 2WHEA 5EXPA 2CMFA 5EJAA 1YFZA 5T8KA 2P8SA 4OXKA 3D3NA 3TEFA 3PRJA 2NU8B 3N2NA 1YH3A 1A9XA 4ER5A 5EJMA 3ANSA 4M0UA 1EXVA 4K5QA 3SIPA 1ARZA 3MS4A 1WW2A 5J5VA 3LCJA 2K7FA 2VJPA 4MS4A 5FL3A 3IVXA 2ZCVA 1M6WA 3RUAA 1ZOPA 3MYYA 1F1BA 1NXQA 2HUPA 1XQ6A 2QDKA 5B55A 3AOEC 3DG9A 4D9JA 1HDEA 1JDNA 2QX7A 3O2NA 3ZQUA 2OQ2A 3PLNA 3CLRD 3FJYA 1RXIA 5H16A 2RHLA 1EYZA 4TSRA 3WGMA 4OHWA 4MWCA 5K0TA 5HTOA 5EJ2A 1Q7BA 3H5AA 5CFNA 1X7HA 5JQWA 1MGOA 3NGMA 4NABA 2W6QA 3OZEA 2YY5A 4L4UA 5CW1A 4PVDA 5NLLA 1XVIA 2VJCA 2XB8A 2GN9A 2V1XA 1H2HA 2ROQA 3ASUA 1RT9A 3OPNA 4Q37A 3FSGA 1ADGA 1DBPA 1UCFA 4G2NA 2FW8A 4AU1A 4YMUA 1WMAA 4E1BA 1C9MA 2GFIA 2HCRA 3RV3A 3CW9A 3EN0A 1NE7A 2EX0A 1TTQB 4TGLA 1I32A 3TQRA 4FI3C 2ZJ1A 4G97A 4S3MA 1NUQA 4TXNA 4W5JA 3ZJUA 1RAIA 1Z7GA 2RGRA 5COAA 4QTUB 5KHOC 4FC6A 3D7KA 3CIOA 2YUTA 2WMOB 4JJGA 3SBEA 1N9KA 2OQVA 3ETCA 4KU4A 5ELMA 3B6JA 1A4RA 2QJWA 3DL7A 4MEBA 1G8KA 5EJFA 5A3VA 2ZJ3A 4NX2A 3S2EA 3JQ6A 1KNQA 2AS0A 2YKGA 4Y2SA 2L69A 5IKOA 3RBAA 4WQMA 1YZKA 2JRLA 5K3FA 2O8CB 3L84A 2OSBA 1K68A 1YSCA 3U4QB 2QU8A 3L5KA 1GA1A 2JGMA 3O21A 4UPVA 3WB9A 4HRYA 2J5XA 2OVBA 2VFAA 1P0FA 4JYPA 1V8BA 3QUAA 2W6IA 4XWKA 4JGGA 3RJ9A 1RYBA 1T5HX 3CNNA 2AJDA 3Q6IA 3R7WB 2GJKA 4EB6A 3JZIA 1X87A 1C29B 2RKBA 3IRUA 2Z98A 1CQZA 3WGTA 4YCLA 1AKQA 1VHLA 4PYQA 4RAQA 5EKSA 2PWAA 3M6WA 4J2HA 3M1AA 5CXUA 5FLYA 3VU0A 4XLTA 1LDNA 2YXNA 1DBRA 1DMSA 4RETA 4D6YA 5K05A 2CNBA 4BQSA 2FN9A 3HUFA 2B7CA 2R8EA 4TWZA 5ERXA 4E5UA 1YVUA 1U0SY 5D3KA 5A62A 3CNOA 1WKCA 1IG3A 1GUAA 3CRW1 5HKOA 1T1SA 1Z82A 2NVOA 3JQ7A 3NYRA 2XT9A 2O2DA 2ORWA 3CCCA 5AR1A 1RYHA 2P41A 1VG9B 1NVAA 1NUSA 2OSVA 3K9NA 1Q6YA 3UCXA 3GVIA 3QFSA 5LR6A 1QF9A 5WRFA 4EG6A 1ULSA 2ICAA 5IDVA 1U5BA 4CMEA 5EJ9A 3DDSA 2VA8A 1IZ7A 2IDJA 3ND8A 1WA5A 4YGXB 1R0ZA 3TL3A 2DVMA 4JB8A 3OZVA 4A8TA 4HUQA 4TS3A 3QWHA 2JANA 4C21A 4NK5A 2PVCA 5KUTA 5EQDA 3RK0A 4XPZA 3T38A 1Z4OA 2IYPA 1OA1A 3QFTA 3UB4A 1E20A 3WSWA 3ZGXA 1RRFA 2WNIA 5E3HA 3T9FA 4ZZ3A 2ALJA 3VU9A 2Y99A 2RGNC 4P58A 1DT3A 3EMBA 2IOYA 3WYCA 1GNTA 3THWB 1KDPA 3B1FA 2ZI9A 4LECA 5LZ2A 4M54A 1SUDA 5FYQA 4JELA 4UARA 2QS9A 4B0PA 2VAMA 2XMBA 3FTCA 3JVDA 4RTPA 4BN5A 5KVAA 2QPAA 3FOWA 3D6UA 3QFCA 3O5AA 4JLDA 4PU0A 1VPLA 4QU8A 3VPCA 3LT5A 4D4LA 2I87A 1E6LA 2AFIA 2AJTA 3FNBA 3WTBA 3ZU6A 4CKXA 3ZCRA 2ZBUA 2WYWA 2QIOA 4YXWD 3BHIA 4L9WA 2WQ7A 2QPLA 3TJRA 5FFMA 3WIEA 1RXVA 3KU1A 5AUNB 3PQ2A 4OREX 2WUWE 3Q7TA 4E5KA 4F11A 1TO1E 4UEOA 4QXPA 3JYOA 4BIIA 2GPTA 1R74A 1XU4A 2SCUA 3AEUA 3OLCX 5I7AA 3IBGA 5KYYA 5LQAA 5CBPB 3ZY5A 2NXNA 2WWIA 3L0OA 2WT4A 4WBSA 1Y48E 5CT5A 5G0UA 2XD9A 3SLKA 3CF0A 3L8ZA 4MV8A 2JI4A 2VPYA 5FYDA 3ZV4A 3WWDA 1ZP6A 1J24A 4GYYA 2XUIA 1CW2B 4Q4DA 3AF3A 4JR1A 3JQ7B 4TN5A 1L5ZA 3SICE 1QRUA 4ALLA 2HMYB 1PT6A 2I0FA 2I7TA 2OZLB 1B42A 3NBKA 4QARA 3LHSA 1IJKA 3D0RA 3AVYA 5K1ZA 4G0QA 5EKDA 2HU8A 4D4JA 1HE8B 4BE9A 1QHGA 2GD1O 3BD7A 4XSGA 2C84A 4QEDA 5TR9A 3LVBA 3UAZA 2WSSD 3LQ2A 2X8BA 3DZKA 1HOTA 4JJ8A 4XJVA 2Z5VA 5K0SA 1J2JA 2QN7A 3OFSA 4HWTA 3T99A 3VYWA 4HNQA 4XWGA 3QKWA 4N6OA 3DGEC 1L1FA 1SCNE 2PXAA 1YDEA 3A3NA 2YVAA 3NIBA 5LJLA 1HT3A 2VPZA 5AWFC 1SHUX 3EFBA 1CS0B 2XKKA 1TCBA 3MMZA 1KXJA 2JAWA 4RF3A 4EELA 2ZIXA 4HAUA 4QEZA 3FR7A 5BMOA 4I3HA 3UMSA 3ICVA 3M6IA 5IM4A 1WDWB 4UUAA 5B6IA 2VJOA 2CFRA 2Z3ZA 1Y6FA 1MQSA 4QGSA 3PPIA 4PC1A 3HO1A 5BNZA 3X44A 2ZSDA 3P71T 3EGXA 3FB4A 2P75A 3EA4A 4IDOA 4MZXA 1ONNA 3SJCA 4C14A 4D3ZA 4YCCA 5KSPA 4ZICA 2J48A 3SS8A 4DZRA 2QQGA 2WPDA 4HLNA 1WO8A 5KNCA 5AJHA 5KCZA 3DZGA 3REQB 5GY7A 3TPCA 1JLMA 3P2YA 3F6RA 3PGVA 3QZUA 3A1VA 3MMNA 1QH9A 4UNQA 1PFKA 3K0FA 5FOWA 3CO0S 1ADFA 4QJ3A 1UKAA 1QQAA 1BQEA 2BM1A 3HJBA 1M3SA 4QUIA 1N2CE 2HFKA 4CL8A 4LPKA 4NOLA 1Q1NA 5GVRA 2VJYA 2Z8ZA 2YIDA 3G2QA 3L07A 3GJSA 4KPGA 4JI5B 4BRSA 4KXMA 1H66A 4D0GA 1QGDA 3LKBA 3QMPA 1TPZA 2WFMA 1NNEA 1GKYA 3GOQA 4QRDA 3LLVA 3ZJ5A 4DA9A 2P6UA 1KBZA 1W0JA 4K86A 4P3XA 2EWVA 4P7JA 3OI7A 4H2DA 2AX3A 2QTRA 4B3FX 4U0KA 1X7DA 3DZJA 4YAJA 1PJZA 1V1MA 3FA2A 4W5TA 4PHHA 5BUZA 2L17A 4ZJUA 1RKBA 4X6LA 1ELOA 3A3OA 2OUIA 4FE4A 3BE8A 5DBGA 5LP6B 5IJZA 1R00A 1NDUA 4K6HA 2XCRB 5KX5A 3MWEB 3WP1B 1J22A 2DQKA 3DFUA 4DMCA 3CT4A 1STOA 2RC6A 3CUVA 5ALXA 3S55A 1LTQA 1KYWA 5AVOA 1WMBA 2PWPA 2IYLD 3JALB 2B4RO 3OQPA 4K6KA 2R1TA 4NZPA 4PLHA 3SDSA 2XECA 1REQA 4RS4A 4YAOA 1IM8A 3SJZA 1NVWQ 1P0QA 2AOUA 1I36A 3K7EA 3VO1A 2GJAA 5CPBA 5ETJA 2R1VA 2CSXA 4F9EA 1PJLA 2GEVA 1GL7A 3B9BA 3UZUA 3PZBA 1BWQA 1WB6A 4R1OA 3O90A 3UBMA 1KMQA 1E1DA 1EFLA 4KRXA 1PYGA 5BRJA 5A3SA 3R3UA 3VPAA 4WADA 1TJPB 1D2CA 1BO6A 4R7GA 3GJ7A 1PR4A 3BMCB 1BJTA 3MCTA 3ZU2A 4BE4A 1SHLA 1JTVA 2X5OA 3TNLA 3W8FA 4YHBA 1VLQA 4DY4A