1Q77A

X-ray crystal structure of putative universal stress protein from aquifex aeolicus
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
138
structure length
138
Chain Sequence
SNAMKVLLVLTDAYSDCEKAITYAVNFSEKLGAELDILAVLEDVYNLERANVTFGLPFPPEIKEESKKRIERRLREVWEKLTGSTEIPGVEYRIGPLSEEVKKFVEGKGYELVVWACYPSAYLCKVIDGLNLASLIVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein AQ_178
publication title Structural homolog of Universal Stress Protein from Aquifex aeolicus
rcsb
source organism Aquifex aeolicus
molecule tags Structural genomics, unknown function
total genus 43
structure length 138
sequence length 138
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-08-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1q77A00
1K4MA 3FDXA 2O5RA 1T6ZA 1KKUA 1O97C 4R2LA 1TFUA 2GOYA 1O95C 1TYDE 2NZ2A 3N05A 4L2IA 3K32A 3SP1A 3P0HA 4RUKA 4HK4A 1O94D 3F3MA 1JIIA 4PBTA 1X6VA 1OWMA 3RFFA 4EFKA 2AKEA 1WY5A 2ZUFA 1F7VA 3ZGZA 3GUZA 1IQUA 3ZUGA 3UMVA 3BL5A 3VU8A 4QBTA 2QUIA 3CLRC 4KR6A 4KR7A 1WXEA 1GLNA 3IMEA 2A84A 4MW6A 5J58A 1DNPA 1WXIA 1WQ3A 1MAUA 3MXTA 4ND7A 5TEWA 3NV7A 4NAHA 4YBRA 4DNXA 1F7UA 1MAWA 3ZJTA 1N3LA 1J1ZA 1EUQA 4K0RA 3RJZA 3CLUD 4MWEA 1GTSA 4MW0A 3DV2A 1OWPA 3SZ3A 3PRHA 1MBZA 1J09A 1WXFA 4MW4A 3FOCA 3INNA 3CVYA 1J20A 1GPMA 5HG0A 1FYDA 3AIIA 2J08A 1WOYA 1D2RA 1JZQA 1S4MA 1I6LA 3I05A 1MC1A 4ZT4A 2CT8A 3C8ZA 3N8HA 3QE4A 4L2IB 4EG5A 1TYAE 1WJGA 1GAXA 2CYCA 1IHOA 4MULA 3A4IA 3AFHA 1WKBA 3MLAA 3RBAA 1YIAA 4Q93A 2Z08A 4ZCPA 2D13A 4DDHA 4NZPA 4FZJA 3PNBA 4WSOA 1FFYA 2CV0A 2YWCA 3CLUC 2A1TR 2YY5A 2DERA 1O5TA 1U3CA 5HUHA 2E21A 1OWOA 4MVXA 3P52A 2XRYA 2BYTA 3ISJA 3NBAA 4Q16A 3FHJA 2CYAA 3HMQA 2DLCX 3FY4A 1JIKA 1PFUA 4DDKA 1KQPA 1EFVA 3TZLA 4OUDA 4PBSA 1M8GA 1YUMA 2V0CA 2DR2A 4MQ6A 3UY4A 3ND6A 3COZA 4U7JA 1O6BA 1RQGA 1TYBE 3ZIUA 3H99A 1J1UA 2QUJA 3MMXA 3N9IA 4MW1A 5FNZA 5BNZA 1YULA 3KFLA 1QU3A 1NUSA 1O96A 5DASA 2PFSA 3TQIA 4ZCTA 1JGTA 1N2JA 1VBKA 1VL2A 2ZP1A 3NBKA 4YP6A 5J59A 4QREA 2PIDA 1M8PA 4S1OA 3TQOA 1ILEA 4HJXA 4MW7A 1N2OA 2X3FA 4MUNA 2J09A 2AZXA 3FETA 1JMVA 3IUBA 1F4LA 1ULHA 4K03A 4X0EA 2WQ7A 2VTBB 1PFYA 1H1TA 4ZCSA 1Q15A 4KKVA 1HYBA 3AKZA 4I6EA 5DK4A 3TS1A 4JFAA 1YI8A 4MUIA 1IQ0A 4J76A 1Q11A 5KWVA 3DO8A 3CLSD 3M5WA 4MUKA 1OD6A 3KT8A 1NYLA 4MW5A 4ZCRA 1PG0A 1EFVB 4KPUA 4OUDB 3COYA 5HUJA 3AG5A 4JXXA 2X1MA 4CDNA 1LW7A 1P7PA 1QNFA 1TQ8A 1ZJWA 2J07A 3ZXSA 4ZCQA 3ZJUA 3H9BA 4MLPA 5LLTA 2PZAA 1O0CA 3G5AA 4UZFA 1H3NA 2QUHA 3HFJA 1OWLA 3G59A 3P0IA 1MB2A 5FO0A 2YXNA 4UZEA 2PZBA 1EFPA 3Q12A 2QJTA 1O94C 4NATA 4JYZA 4R0NA 3A05A 2OQ2A 4CDMA 4EG4A 5DB4A 2WSIA 4EG7A 3CVUA 3HGMA 2A1UA 3CLTD 2J5BA 3X1MA 1EUYA 3AL0C 1KH1A 1T6YA 4ARIA 4DDMA 4MVCA 1KR2A 3U1VA 4BWVA 1I6KA 4GU5A 4ZT7A 1IRXA 4YMIA 5K0TA 1G8GA 4OJMX 1TYCA 1A8HA 4F3RA 2PXHA 1MRZA 1XNGA 4EF6A 4EG8A 1ZH0A 1N2GA 1XJQA 4KPUB 1KH3A 2H2AA 2DEUA 1WQ4A 1N2EA 4AS1A 2R5WA 3DLAA 1JEDA 1U7DA 3VGJA 2IP1A 3CA8A 4MWCA 1H3FA 3FIUA 3QTBA 1PFWA 1GN8A 2QJOA 4MAFA 4ND6A 4XFDA 3FWKA 4NX2A 5J5AA 2HZ7A 2D5BA 3COVA 1G59A 3P0JA 3SYTA 1G8FA 3PNYA 1R6XA 3ND7A 4MWDA 4G5YA 1IH8A 1LI5A 1ZH6A 4G5FA 2A88A 1GZUA 1NUPA 3TZEA 3AG6A 3UOWA 1EFPB 1N2IA 1T9GS 1K92A 4XSVA 1WXHA 5AHWA 3KT3A 3MLBA 1M8JA 3PXUA 4P2BA 5K0SA 1NI5A 4F4HA 3G6KA 2ZUEA 2Z09A 1M1ZA 1KQOA 2DXIA 2WQ6A 2EJCA 1PG2A 4U63A 3FI0A 3IOCA 4EGAA 2TS1A 3X1JA 5KCMA 2AG6A 2X1LA 1O97D 5JBNA 1JILA 1UFVA 1M8FA 1J21A 1NUQA 1KH2A 4R2MA 2HGZA 3Q4GA 1ZUNA 2E0IA 3FNRA 4KR9A 2GKSA 1VBMA 2A4MA 5DEOA 4I6GA 1O0BA 1PFVA 1N78A 2WB2A 4CQNA 4DE5A 4RPIA 4E1AA 2DUMA 4PY2A 1TEZA 1QU2A 2A86A 2HMAA 3GMIA 3CLRD 1WXGA 1QRUA 1F9AA 1JHDA 2E89A 4NDAA 2JA2A 4ZT2A 4A91A 3IODA 1KQNA 1QQTA 3CR8A 5F23A 1IVSA 1N2HA 2B7LA 2QUKA 2XRZA 2C5SA 1KP2A 2DETA 3K9WA 2VXOA 1YIDA 1I2DA 1MB9A 4ZT6A 3UK2A 4DJAA 1OBHA 1LI7A 3HV0A 3HZRA 1Q77A 4H3SA 1I6MA 1O96B 3RK0A 3HL4A 3IMCA 3KT0A 5LM3A 1JECA 1Q19A 4MW2A 3ZJVA 4GRIA 1JEEA 4I6JA 2CSXA 2V0GA 3L92A 5LFAA 1R6UA 4EG3A 4G6ZA 4TS1A 3DPIA 3OTWA 3CLSC 4MUJA 3VRHA 2A1TS 1NUUA 1COZA 4MWBA 3RHSA 2OV4A 2DPLA 1M83A 3ELBA 1J70A 1U7XA 3L93A 1EJ2A 3ILVA 1KP3A 1EE1A 1JZSA 3IVGA 4MVYA 2IELA 1MOPA 3GLVA 4NAUA 1QRTA 3IOBA 1BS2A 5TEVA 4DLPA 3SEQA 4MUFA 2GM3A 3COWA 4WNYA 3UC5A 4AQ7A 1Y42X 1N77A 1IFXA 3D6VA 1N1DA 3ND5A 3N2YA 2CYBA 4MUGA 3SEZA 1IQRA 4U8HA 4PBRA 2X0KA 5H16A 1U3DA 4HJRA 3CVXA 2PG3A 5TS2A 1U0BB 2JANA 4CT0A 2E18A 1G8HA 1KORA 4ZT3A 1NURA 3CLTC 4ZT5A 3ZXIA 3RK1A 4MUHA 4MVWA 4QRDA 1NUTA 5H7XA 4EG1A 1B6TA 2H29A 4JZYA 1QRSA 1NSYA 1XNJA 2A7XA 3FH0A 2RD2A 3IOEA 5IJXA 5IHXA 5FO1A 1N2BA 2VTBA 4MUEA 3A04A 4J75A 1WZ2A 2CV1A 4XFJA 2NSYA 1V47A 2A1UB 3MUEA 1T6XA 1N75A 5KHAA 3IUEA 1X8XA 2CFOA 2IJGX 3KT6A 3E27A 2EL7A 3X1KA 3H97A 2YWBA 3SZGA 2QTMA 3FG9A 2G36A 4YP7A 3CVWA 3IVXA 1O95D 3LCJA 2I1LA 2RE8A 1VLHA 1SURA 3LE8A 3Q10A 1GTRA 3QTTA 1JIJA 3IMGA 1R6TA 2QTRA 3S3TA 1EXDA 3CVVA 3IH5A 1K4KA 1NP7A 1QJCA 2J4DA 1XNHA 1OWNA 3H05A 3TNJA 3JXEA 3OP1A 3SDBA 4JXZA 3A2KA 1CT9A 1VBNA 2CUZA 2QTNA 1KAMA 1YUNA 3IDFA 4ARCA 1OBCA 1H3EA 2D54A 2Z3VA 4HPWA 5TGTA 1M8KA 1V8FA 3D6UA 4MW9A 3H9CA 3PNVA 2PZ8A 4YP5A 4EG6A 3LOQA 2CV2A 1NZJA 5EKDA 2QJFA 3IVCA 2JAXA 1KAQA 1K97A 1QTQA 1T9GR 2BTEA 2O8VA 1MJHA
chains in the Genus database with same CATH superfamily
2GZ1A 1OTYA 3FDXA 2DKFA 3KAPA 1NVTA 1WV1A 3W2FA 2JVKA 1OYWA 1YB4A 5CTJA 5CYPA 4A23A 4ATNA 4BNDA 3HVRA 3ZWQA 4JIGA 4BVBA 1G38A 1AKYA 1OXMA 2VRCA 1TPYA 2Q8QA 5HM6A 3KL4A 4L3VA 3Q3EA 4D5GA 2Q1WA 2B1IA 3N05A 2HFKA 4CN9A 1UBTS 3N2KB 1BCRB 1J9ZA 2VN8A 4J2OA 4MGZR 1A72A 5ESWA 1E6EA 4P80A 1GGEA 3RFFA 3HPRA 4Y1RA 1KK3A 1UP6A 1QH1B 2PUVA 2Q2VA 1V5WA 3W2TA 3ENQA 3PLRA 2YBDA 3GPBA 4DLTA 2ONJA 4QFBA 4I5EA 2AZ4A 2DFVA 2QAIA 4HB4A 5ELLA 3DLBA 1NMSA 1TJPB 3CH5A 5AOBA 4REQA 2FZGA 3B6JA 1RYFA 2JLRA 1JA0A 2EJVA 3AHGA 5FWDA 3V1TC 4L9SA 5C32A 2D59A 3PRJA 4B6GA 3QVLA 2PRIA 1T0JB 3E2IA 3QSYA 4WOKA 3JV7A 1BAPA 2CHEA 3ANTA 3MW8A 4G23A 1QAMA 3B3QA 1WXIA 1H2WA 3OQOA 3I62A 5HCNA 1WQ3A 2OZKA 7REQB 4BXOB 3EEFA 4PIVA 5AI0A 2JKVA 3M3PA 4K86A 4BQQA 4NRDA 1PSDA 1MGOA 3F98A 3JALA 4PLPA 2ZIWB 4TKUA 3VSBA 4MP6A 3GFQA 4NBVA 4TT3D 4F8JA 3GRYA 2J9YB 2O2GA 2HEGA 1Y33E 4LHVA 5C9ZA 3SM3A 3I9NA 1I2ZA 1T10A 1UBEA 2PLWA 3DZKA 3N2ZB 5M3BA 2KSQA 3IJ5A 1YDFA 1G17A 3MERA 3QA9A 4BZZA 2I3DA 2VC2B 5EIEA 1WR8A 4P31A 3FOCA 4QM7A 1A4XA 2QF7A 4WLUA 1GNTA 4RIIA 3ADBA 3JD1A 5EXPA 4CUZA 3GVPA 2Z83A 5SZKB 2AOXA 4N7MA 1JSXA 1JHPA 3C87A 1MFZA 2Q3FA 2VLBA 3BWMA 3OJCA 1T34A 4MULA 3C7CB 4M37A 1FTGA 3WGLA 2PS3A 3AFHA 2XMBA 2OEPA 1VTKA 1Z25A 3BBPA 3CZ9A 4WBSA 2ZAGA 3RBAA 1AXGA 2FPPB 2KHZA 4I9HA 3SQMA 3K3PA 4R7TA 5TV2A 1RP7A 2I2FA 3KHUA 3T3HA 3RPEA 1KPIA 1LX6A 3UT0A 4ZEWA 5B2FA 4D7AA 3AFGA 1QG4A 2F4NA 5I9MA 3ZU4A 1NLUA 4AULA 5UKDA 3PDIA 3SEAA 4NS4A 1Z5NA 4NZPA 1G63A 4P08A 4UDYX 2NYUA 1XXLA 1WABA 2QYSA 2R6HA 5HRCA 2PUDA 1FFYA 3JWPA 1A8IA 2VNAA 3T7IA 5LZ7A 3DQQA 1TAQA 3DXZA 5SY4A 2V7EA 2Z3ZA 2RHRA 3WGVA 4MKFA 3ZHYA 1C7EA 2OAQ1 3CMMA 3G5MA 1Q50A 2FUG1 3EN0A 3M82A 1OWOA 3TMAA 1Q1EA 1XJWA 4RL4A 3ICQB 1XWIA 1T6BY 2BFCB 2PNFA 4EFNA 1DGQA 5BN3B 1TZ2A 5EJ9A 3A9WA 4F96A 2OK7A 1XA3A 5EE0A 2L19A 4I4TB 2NU6B 3CV3A 3L7LA 5DSTA 2PNJA 1PE0A 1ECGA 2CFCA 4EA8A 3W9UA 5C7OO 4KOEC 5F7ZA 3GQBA 4HDOB 1IONA 2CHFA 4WESA 4GLBA 2HRBA 4G89A 5KYUA 2H5JA 1L1QA 1NU8A 2Z5VA 1E3MA 4E6EA 1ZR2A 4OJQA 4BCCA 1VDMA 3WDKA 1NWCA 5CDUA 5TMEA 1E3DA 2FQYA 4MW1A 4E5YA 1BJTA 3D1VA 5T4BA 3TZHA 3KFLA 3ZNQA 4U2EA 3H1AA 4DGSA 1U8XX 1RAAA 3IDZA 2WZBA 1LJLA 4YP6A 1OW3B 3VBEA 1ZO8A 4UM9B 3CRQA 4JCOA 1CF9A 1TT5B 1Z8FA 1L5GB 4BQFA 3RJ9A 5ED4A 1SXJA 1NN0A 3BDIA 4TS4A 3BTOA 1DS6A 3RIXA 5BMVF 3R3WA 4Q15A 4QYIA 4HJXA 1H8HD 1S7GA 1XAJA 4GM1A 2X23A 4LOIA 4DANA 4DXAA 4GZMA 1RAHA 3R09A 4O6VA 1M75A 3FETA 2DFPA 4YALA 3EF1A 5CXXA 2VT6A 3BMCA 2R00C 3CT4A 5TARA 2WQ7A 3SZOA 1Q2UA 2KE5A 1Q15A 4HN4B 4KKVA 2DJIA 2IXAA 3VYUB 2XQJA 3A0RB 5HWSA 1R9MA 3T6KA 4JFAA 4GDMA 3ASYA 2QSUA 1FF9A 4F3TA 2Q1TA 3AJAA 5DTIA 3WSVA 2P5TB 1NZFA 2PKRA 4IHAA 4D8YA 5EQTA 2HPZA 4GLLA 4C7BA 4D45A 2UUPA 5HIAA 1ISFA 1DXHA 1F6WA 3KOYA 1VGRA 1X8LA 3R6WA 3H7IA 1COWD 3G0DA 4NG5A 4O59O 3W5IA 5BSKA 2C7RA 4BJ5A 1UJNA 3W9YA 1G7TA 4X8OA 3VPXA 4FNMA 1N6HA 1MN6A 1M1NA 2QZPA 3MSCA 4OREX 5SZJA 4L8GA 3V4PB 5GP1A 3I58A 1K0FA 3T52A 5I7SA 1NQUA 3P5SA 2VTKA 2XUJA 5FHRA 4UMFA 5GZ3A 1B0PA 3Q3VA 3ONFA 1OGIA 1YK1A 1FJHA 3Q3GE 4O1MA 1RU3A 1O1YA 2WUEA 3OTGA 5IJ9A 5LP6F 1N8NA 1XCOA 4IX9A 4GOXA 1IVYA 4G1CA 4LWOA 2O57A 1SKYE 1IG3A 3CX3A 1Y4UA 4ZO9A 4EVQA 5JJIA 4FYHA 1K68A 1R4NA 3DGEC 3DULA 3EW7A 2PMWB 3I1FA 1Y4DE 1HFWA 3EWSA 1EFPA 3Q9SA 4II2A 3EQZA 1E79D 4B46A 2GAOA 1GNSA 2Y9MB 1YR6A 2OGWA 2OQ2A 4ADSG 4EJSA 3NEJA 4M86A 3AF6A 4HX2A 4B82A 5I7EA 2W2OA 2YIDA 1MJNA 3EISA 3WLQA 2PUEA 2IWRA 3TEMA 4AG3A 1Q6YA 3ZWDA 1DCMA 1DG3A 4TWRA 3UJBA 1A1VA 2ZUDA 1VPWA 4YN3A 1F8YA 4MB6A 1SUCA 3TOVA 1SEVA 4B6OA 3EMKA 3RSLA 2RI6A 3HM2A 3E1KA 1I1NA 1N5LA 3RBXA 3O4RA 3U1VA 1KR2A 2GZAA 3PZRA 4BWVA 1I5EA 1CE8A 3G79A 5JCXA 2B1RA 4IW3B 2QZ4A 1NHWA 1YBMA 3JR3A 3Q7PA 2J0UA 1S01A 4Y1RB 4H59A 3O3CA 4HAIA 3N59A 1VG9B 4IZ6A 5DYTA 4IDFA 4L07A 1ZM3A 4NU5A 4E4RA 4HNSA 2G6TA 1EU1A 2CXXA 4OM8A 4EG8A 1MJ5A 1N2GA 3UWDA 5JPCA 3OPXA 3BCSA 4Z4CA 4L6CA 1NG1A 2N3ZA 4RY2A 3S1AB 5JNLA 2O1XA 4REQB 5F33A 2F8TA 1JEDA 4YUZA 4L5CA 4UM5A 1TAHA 3CA8A 5A0FA 3ZE9A 4C07A 4F5YA 1I10A 1U11A 4O2BB 3A4YA 1SY7A 3FWKA 5FORA 3VYTB 1U9JA 3DZGA 1Q1GA 5JDIC 1N7GA 1ZICA 2G5CA 2W9XA 4MO9A 4E08A 2F1JA 3PVZA 4F2PA 3K30A 1ODJA 1EWKA 5IWAB 1WPQA 4FGSA 3QUQA 1G1MA 1SQ0A 2AFIA 2JJ8A 2XBLA 2XAUA 1P80A 4Z51A 3FHCB 2ZRJA 4MTLA 5IVIA 3TZEA 1N8SA 4G26A 1ZPDA 5IUKC 3TNLA 2GN4A 2O2ZA 1DEAA 2F43A 3D5EA 4LDJA 3EJ6A 1A7AA 4M1ZA 3L4JA 3DCYA 4P92A 4UU8A 4JGBA 5AJYA 1LPOA 3UAWA 3HXTA 4HDCA 3FUTA 4YHBA 3HFSA 1M1ZA 2VF4X 3ZXUB 3ACBA 1XDBA 3GZJA 3WIOA 4DV5B 3OEWA 3DD1A 4EGAA 2QG6A 2OFOA 1F51E 3GH1A 4ECAA 1P29A 3I64A 4RH1A 1XRJA 2VA8A 3N8NA 4QOEA 5LOVA 3KQKA 2H6EA 5JBNA 4H3VA 4N47A 4Z2AA 2PQ2A 3DZHA 1NZDA 4DT1A 1T25A 4TKLA 3SCZA 3ZCPA 2GHRA 4ENQA 3GFPA 4UM9D 4B3HA 3JD4A 3M4XA 2UUOA 3PDIB 5KAMA 1FFWA 1WZEA 3BFPA 3OICA 3Q4GA 3DPUA 4LE1A 4BOYA 4DGQA 1YZHA 3PE3A 1YRYE 2VPXA 3JVVA 3BPSA 3THYB 1RHQA 3PKZA 1U0FA 3I9MA 4TKVB 4AJ1A 5LD2B 3C24A 4JYAB 1SBCA 1U2PA 1SVOA 3RS0A 5J2TB 2QMUA 2A86A 4U7WA 2G25A 3PUXA 3QFSA 1A2OA 1F9AA 3GEMA 4I1SA 1QRDA 2X0EA 2AJCA 2HQOA 1GSOA 3LLSA 4RVCA 1ZMRA 2P8SA 4WPGA 2IEAA 2ZCJA 1C3OA 3IODA 2AGVA 1DUIA 3JD2A 3SD7A 5BR8B 1O6FA 1G8SA 4PV7A 3RVBA 1HZZC 2C82A 1CS0A 2CKMA 4FZ3A 1Y4ZA 5BUCA 3E9DA 3S7TA 3EUEA 3ZEIA 4WESB 2DOKA 3T3PB 3G2LA 5HXAA 3QHQA 4X7PA 1YQ9A 4KSYA 4O4LA 1J2JA 4O8ZA 4DNOA 1K8ZB 5KYUB 1N2SA 4ZQIA 3QWFA 3NR2A 3W3ZB 1K75A 2IHYA 2OSBA 2WE8A 1JHRA 5CVJA 2ZIGA 4DLUA 4OHUA 2IUUA 1JWLA 1N1EA 2I66A 2JASA 2Q7XA 4ER5A 1I6MA 1CY7A 1FC0A 3GBPA 4WRRA 5AUPB 5CB4F 2VKTA 3RYCA 2C3UA 2SKEA 3HCOA 5B7QA 2H1CA 5HX7A 3KU4A 1QP4A 3NYWA 1T1IA 3PRKE 3PX3A 2JDIA 4I1YA 1ZL0A 5J5CA 2OL4A 3RC7A 3TZ6A 3CUWA 2YZMA 1M66A 3NHAA 4GRIA 3OZSA 5K3FB 3RFUA 4HWTA 4QYIB 4B32A 5BUZA 4X1IA 1FPMA 1U1FA 1U81A 1HQYE 2QD2A 5B58T 4E70A 5CNKA 4MUJA 4EYSA 1WVMA 3FOBA 4RGQA 5CIQA 2ANBA 4UHHA 5F2OA 5G0WA 5EGSA 4HNTA 4P22A 4WLVA 2YHIA 4P3PA 4D79A 3L7YA 3EAQA 5KQMA 1MO6A 4P1ZA 3VR2A 4F5EA 2F1OA 4EHIA 2FDCA 1RYNA 4GXNA 3C8UA 5K5EA 4AUNA 5DW0A 4EYGA 4EITA 1Q7BA 2H2HA 3AJRA 4Y0NA 2R8EA 2D1TA 2H8GA 2EBUA 3QFCA 4Y2HA 3WZLA 1EIWA 3HXOA 2OT3B 1PQYA 2QT0A 2ZS9A 3EZXA 3OQBA 3PNLA 4KNVA 4FYJA 1ZU4A 4DRXB 2I0FA 1G21B 5IJZA 3U4CA 4BLRA 2VLIA 2Z95A 3CW2A 5EMLA 4AP9A 1KPHA 4Y9RA 1NVVQ 3ND5A 1FMTA 2BKXA 3EGIA 2G06A 1M1NB 1WW3A 1KMNA 2VZ9A 4ITUA 2EZ9A 5ALRA 3SQDA 3THXA 2FKNA 4X63A 2G76A 2PG3A 3H2KA 5ALIA 2OAGA 4LF4B 1U0BB 1OT5A 3GLHA 1GPYA 2ZB4A 4TV9A 3T9FA 2V7XA 1XRNA 2FFBA 5IJ9B 1DAKA 2ZRDA 4QOFA 4DZRA 5JC1A 1JH9A 3PA8A 4EY3A 3H4VA 2VP9A 3RVJA 3TDKA 5JANA 5KOJA 1YS6A 1ZHOA 5KINB 2H29A 4PAWA 4RZ2A 1SKAA 1R4NB 1SHLA 1U7PA 1WSBA 2WIBA 4J91A 4KAJA 3EZLA 4MPTA 5AVJA 4KIJA 4CU5A 4A15A 1OV4A 3D4OA 2O7RA 4OHWA 3TCXB 1SC4A 4K8RB 3KEOA 1N2BA 1CHDA 4Q00A 4EJSB 2XMPA 3NUQA 2WWWA 1P2GA 4FGJA 3LKZA 2HF2A 5IT5A 5KOYA 2I4IA 4NQRA 4HADA 1ZS9A 5CT9A 2PD3A 1QDLB 2D0DA 2ZJAA 1RWXA 3DM5A 2HMSA 2DTEA 3AM3A 3HJRA 4L6IA 5A4JA 3ZD7A 3VJMA 1UMCB 2CNOA 3O8QA 5J23A 3BMXA 3WMGA 2EP5A 1TM7E 2X15A 4GE0A 3OZ7A 3QE3A 5G41A 3UAOA 3T3OA 2I9KA 5BUSA 1EEXB 2VAMA 5L7TA 2GSDA 3NIFB 1CE8B 4OAQA 1D9ZA 2GVDC 2VDQB 4R2HA 4UUQA 3ZHSA 3I0NA 3NS7A 4UBJA 1SCNE 2J0UB 2XHZA 3B1WA 4DUPA 2QR3A 2I1LA 1TX4B 3L8GA 4HUQB 1TCVA 4KQGA 4PLTA 2K7FA 1E9DA 2CVZA 2CE2X 4CLXA 1UBJS 1IEXA 1CULC 3DV0A 2ALJA 3S3TA 2YYZA 3I32A 3LCUA 3QUAA 1OJLA 2GO7A 3GMTA 4XB6B 2X58A 3JQRA 1Z4LA 2RHLA 1Z9BA 3TSZA 1RMQA 2Z6UA 1D2MA 4TUYF 5E0KB 5HE9A 4LXQA 3A2KA 1QFMA 3PEUA 1U6IA 1UAGA 3IMFA 3I23A 3JRNA 2IY9A 5EL0A 3TAHA 2DPXA 4ZYWA 4HY3A 4LF7B 4P5DA 3DTTA 5F1YA 1M8KA 2Z04A 3UKJA 4DIKA 4Z7QB 4HGYA 4ZVRA 5EHXA 1T9KA 4NCJA 3A25A 1H66A 1K5HA 2ZYIA 3TG8A 3GEDA 4RSGA 3GRVA 4CKZA 1DZIA 3MWDB 1KAQA 1UBRS 4FFWA 1W4LA 1Q74A 3PR1A 5ER6A 3ZWYA 4Z7NB 2AXNA 2F43B 1TEXA 1XRSB 1NXOA 3HDHA 5FB3A 4QNMA 4C4AA 3VPFA 4D9HA 1N3IA 3IIEA 1MQSA 3SHTA 3NMUF 4ZAWA 3GAMA 5CDYA 1QE5A 3KJHA 4EBBA 3ZVNA 4A8TA 4L2IA 3QMVA 3OTHA 4OIMA 3A7EA 3P0HA 1NVWQ 1JIIA 1X94A 5CVTA 2FUEA 5IKMA 4Y2RA 3P71T 1XKXA 2VHYA 2AKEA 4IYRA 4Y2GA 4K28A 3OG9A 3TRHA 2FV8A 3ILYA 5LOVB 1J25A 1R0ZA 3ET4A 4ND3A 3SGLA 5K2OA 2X19A 3GK3A 4R3WA 3OQMA 3THRA 1X7YA 1YZTA 2BMJA 2WJ4A 4D3ZA 4B75A 3ICWA 2X9GA 3RUEA 4DT1B 7ADHA 4E33A 5GZ1A 3UKDA 5ERXA 1XLTC 2PUWA 4FQ5A 4OQLA 3P9RA 1FXSA 3IUNA 4AJNA 4CF7A 2CC2A 2VTDA 1VMDA 2R7NA 2VHXA 3GLQA 1A50B 5DRTA 4YUAA 2O2EA 2XCIA 4NH4A 3KM0A 3ZGXA 5KVSA 4XIJA 2HEIA 4UARA 1WULS 1ZI6A 1E5DA 5JZVA 5H3HA 2CWWA 1IJFA 5CITA 1MAWA 2Y0BA 3HLYA 4ENVA 1J1ZA 4QPNA 3TRKA 3TTTA 2DT8A 1GD1O 3DAHA 2ZAOA 3HP7A 3SQWA 1LDYA 1Y81A 4PFKA 3P2IA 5KYXB 2EQAA 1ZSVA 4CM3A 5KTPA 2AOVA 3ZLTA 4RETA 1SGWA 1C3OB 2VAWA 1MZPA 5F5XA 3AUTA 4TQGA 2H1WA 3U4GA 4X65B 4YAKA 2CXUA 1DQPA 4PC2A 3EGEA 1RKUA 3AIIA 1RPNA 1O6ZA 4I3GA 4FE7A 1IQPA 2X2PA 4NENA 4QTZA 3WG9A 3QEOA 3C85A 2CLHB 2O7QA 3MQ4A 4JYCA 4O4LB 5DBFA 5DLYA 4RJKA 5JS7A 4Z4QA 2VHZA 2GAAA 4YRGA 1E2FA 5BWMA 3K9CA 1JP7A 1BOFA 1P1HA 1PNOA 1YJXA 3BHIA 3D8NA 2PSHA 4TT3A 3N75A 3ZBPA 4Z3DA 2IU4A 2GK3A 3NHUA 3P45A 4K2HA 2HCRA 4YMVA 4MKIA 5LDDC 1E20A 2H4WA 2COUA 1BFUA 4J1TA 1RLJA 1WZCA 2GCEA 1FRFS 5F9HA 2WJAA 2BI7A 3H9EO 1BD4A 3KOOA 2BHNA 1LPNA 1M2GA 1VG8A 3WFJA 2B8JA 2G0NA 2YMLA 2ZAIA 4JUBA 2YICA 2ZBGA 4IJ5A 4OM7A 3DWEX 4X1IB 5CFMA 4YJ3F 1HWYA 3EVFA 4B6EA 3OETA 1QR2A 2IOQA 5JCJD 1FDOA 2H31A 1E1CA 1RHRA 3H8JA 5TE9A 4QEKA 1U28C 2IZ0A 5CH8A 4IF4A 4NBUA 4NNOA 2H8KA 4GBMA 2YHIB 1NBEA 5CFLA 1RWWA 1Z56C 4B40A 4JEMA 1YE8A 2EW1A 4TYWA 1X2BA 1Y3CE 2HWUA 3BK7A 4KAFA 4BFCA 5LDGA 1DVRA 3NBUA 1Z0IA 2GF0A 1E4YA 5AICA 3KUCA 4J3NA 5JS8A 1BKSB 1M0TA 4P34A 4JUCA 2SBTA 5ARDA 2H17A 5K8TA 3U19A 4QVGA 4LI3X 3RS3A 4ZYVA 3GBVA 3L05A 3QMMA 5TT1A 4G56A 2ZJ2A 3DONA 1YONA 5SICE 5BSUA 3SLRA 4JITA 2IYSA 2R66A 1IK6A 5HM8A 1VE9A 1PHRA 1XTRA 2QUJA 1E2JA 5ILGA 1KOJA 2YZNA 4P7GA 4C0XA 3THXB 5IX8A 3BMNA 1I9CA 2F3UA 2RGAA 3BFKA 4BWYA 5ARCA 3OKAA 3LZCA 4TV9B 4IDAA 2EJBA 2OXTA 3RFCA 3SBDA 2HXSA 4ZAGA 1IEWA 1EX9A 2AN4A 1E2KA 3LSYA 4OU4A 1PL7A 3WFZA 5A71A 3ADCA 4J3FA 4IV8A 5B55A 3N2EA 2VJLA 1E3JA 4EECA 1YTUA 3C45A 2AI3A 1VJTA 5KOJB 1BX0A 1A5BB 4A03A 1N2OA 3KS9A 2OCGA 1UPBA 1SUDA 2GERA 2AUMA 3UWMA 3VU9A 1PDOA 1KU0A 3IUBA 3EMBA 1E58A 3QOYA 1R64A 5IC5A 1OLOA 2W6CX 3FTPA 3QKIA 3ICOA 5GGYA 4Z3KA 1AZWA 4Z7OB 5F2NA 4YS6A 1J06A 4AN4A 1ECJA 3CXUA 2NUBA 2PAAA 3E3OA 3NYIA 4BUZA 1CB7A 3V1MA 4P84A 4B73A 1C81A 3J7TA 1DG1G 1QXSA 3D7KA 4JKYA 3TBKA 1SPBS 3HDVA 3NHRA 4ID9A 5JAMA 2EG5A 2V65A 4TL7A 1AUVA 3UKOA 4F1WA 1GRQA 4O2LA 4UUMA 3O8QB 5I47A 2R8BA 4F8EA 3EYWA 4LC0A 4ZI7B 3VZCA 4HMQA 1XC7A 1JR6A 4TVSA 1L9KA 1Z5OA 1GTL1 3BIWA 3E9ZA 4N82A 5IN4A 4AQDA 1NW3A 3QV2A 1QANA 3FNBA 1I32A 1QLHA 2ZB8A 1SVIA 1TQ8A 1WCIA 2ZE8A 4HF7A 2VJYA 3HVKA 2XCUA 4DHEA 5IULC 3DV0B 2EHJA 4YGYA 4MB2A 1LK5A 3ZDZB 1XLUA 4CXMA 4M8KA 3V9AA 2CFTA 1CVRA 1UJ5A 1XZAA 1EFDN 4IL5A 4B3XA 4LBYA 4CV0A 3KKPA 4RZHA 5JECA 5K8UA 1I7DA 2ONYA 1XBTA 4DUGA 3LH5A 3DF7A 4QYSA 3CS3A 5JPIA 1SUIA 4LSZA 5AVKA 4RKRA 4DR6B 4CUJA 1UPAA 2KM1A 3BSSA 3CWQA 3VZBA 3HBLA 4OSPA 4V0MA 3W06A 1KTIA 3WAJA 3EX7C 3WX0A 1BXZA 5J4LA 2BFAA 1VPEA 2A9QA 1WD7A 3DTVD 4B80A 5CG2A 3ELYA 4Z4GA 1R6VA 3EIFA 1O5IA 2FQXA 3MB8A 4MI1A 4B31A 4CDMA 5FLXA 2P0AA 5CDTA 3DBLA 4M4SA 4IGKA 2YXBA 4RSRA 3GJRA 4PVCA 4D3XA 4BIMA 4KR0A 1L7QA 5FBQB 3CLTD 2FZCA 3WKEA 4P38A 4FJ1A 5COAA 2JEYA 1YUBA 1F6DA 5DDIP 1OYVA 1G60A 2P2ZA 3NRCA 1IN7A 5EA2A 3L0DA 5DM1A 1D2EA 1M6YA 3JARB 5GONF 3VPSA 4ARIA 5DWDA 1ZAKA 1XNRB 1PG5A 2ZYGA 3MWYW 3WMFA 1I6KA 1SFRA 4GSKA 1A97A 1W85A 3B6MA 2GK4A 2P9CA 1NKTA 2R6R1 3DMFA 3K0CA 1QV9A 2X9NA 4L9AA 1MABB 3G9UA 2C84A 1DAHA 1KJNA 5E2IA 4OLHA 5DMHA 4BEJA 3D8UA 2RK6A 4PINA 3C1OA 2GRJA 3TVTA 5AM5A 4BKRA 1J8QA 1VLMA 3CW8X 3OIDA 1XJQA 3SJCA 1X7YB 3K35A 4WY2A 3TR6A 1XAIA 2FRVA 1C7IA 3LD9A 2HCBA 2I4NA 5KIAA 1FMFA 2B3DA 1S7CA 4Q24A 1CNMA 1DXQA 3E6AA 4EDFA 4AS1A 5KTNA 2Q4BA 2W4IA 4W8GA 1ZBDA 2DH6A 5CMLA 4A27A 1HNWB 3FYUC 2NYVA 2YY7A 3G17A 4H17A 4I4LA 2ZITA 4WCFA 4ZXFA 4MAFA 4L5JA 4O4HF 4XFDA 3WY9A 3QVOA 5J5AA 3X44A 3U3ZA 5A9TA 2RH8A 4U6QA 4C01A 1Q95A 3EFEA 4KV7A 1O89A 5MGNA 1ZJ6A 3FJYA 3AI7A 3V00A 3ES9A 4M1TA 5FQOA 3F6PA 4ZTZB 1NBME 4BTEA 5DLPA 1DKUA 1RTKA 3EG5A 3M70A 3PI6A 3DXFA 4G5SA 4CMIA 1GQRA 4M54A 4GPBA 1VECA 2PKCA 4B7CA 4F93B 2ERCA 4JUFA 2ZJZA 1N7JA 2ZUEA 4BQIA 1RM3A 3KQOA 5LZ4A 4HYEA 4NENB 4UQPA 3LF2A 2O0MA 4AC9A 2W4MA 4WZBE 3MWGA 4Q3CA 3MMZA 4GD3Q 5JFOA 5FYDA 3AHHA 5JR3A 1YB2A 1L5WA 1V8ZA 2OFXA 5KJ6A 3JVEA 4CW7A 1KVSA 4QWWA 4M46A 3CFYA 1NMXA 1TOAA 4OSOA 2YJ3A 3UVEA 1TM5E 2D1SA 4CBVA 4YMTA 1KZ4A 4NBSA 5IAGA 4C5CA 1ENOA 4EL0A 4HDKB 4RC9A 2YUIA 2AYXA 1JG6A 4H6VA 1GFSA 2IEDA 1MB3A 3MS7A 2ZZNA 1CDDA 4R2MA 5FWXA 1M7BA 3TKYA 1E5QA 1IEQA 4QBKA 2R4QA 1HE3A 1WX1A 2QZ9A 3DNFA 3JQDA 1E0AA 4IJUA 1KZGB 3CT6A 1KBZA 2JFOA 3A06A 3SBOA 1UM9A 5K45A 3CRNA 3I9V1 2CLKB 5DEOA 1UXIA 3SHOA 4D26A 1PFVA 2BJHA 3ESZA 4ZEOA 2E5LB 1E1CB 3RTBA 3LX6A 5I4KA 1XDUA 1Y8RA 4TYPA 2QRLA 1AKQA 2WP0A 1ZHHA 2ZIZA 5F3RA 1QH8A 3PT5A 1H1DA 4M7OA 2B4RO 4CDRA 1BXGB 1Y34E 1LNSA 4NDAA 4XR9A 2R87A 3FNFA 2QL9A 2ZVJA 3K1AA 2JCVA 1T24A 3SSMA 2G04A 3WGUA 5ALOA 3O82A 4ZAFA 1AVTA 2FMFA 5IABA 1FQWA 1SUSA 1XMOB 1TU3A 4BE4A 3ZQKA 4TTIA 1Z2OX 5F21A 3MFQA 1RXCA 4PFSA 3U81A 4EJ6A 4BNIA 5KKAA 3CBGA 1BKYA 3OT4A 4KFRA 4Y1EA 5T4HA 1JA1A 2QNIA 4CM8B 2BFNA 2MSKA 1GLVA 3BSWA 4ISCA 3NFRA 1OBHA 3V7WA 4D6YA 5BWNA 2IXBA 1ULAA 3Q0IA 2QU8A 5BQXA 3L5OA 4MINA 3RG8A 3BMNB 4TTTS 1G19A 2RAFA 3D81A 3ODPA 5F2KA 4MYHA 2FXIA 3GP3A 4FOOA 5FNVF 2ET6A 3ABSB 1M2HA 1X7ZB 3I1YA 2CDNA 2JFVA 3N86A 1E89A 3E1SA 3KALA 4FX5A 4LJ7A 2GFIA 2RKWA 2V9PA 5L6LB 5GM2A 3O21A 1NLMA 3EARA 4BYGA 2P79A 1CU1A 1R4ZA 2Q1UA 3UJHA 5HE8A 1PYGA 5TVGA 1EA5A 5G1NA 3I4LA 4YRPA 4TMWA 2ZRGA 4Y2TA 1YJ8A 5PGMA 3DEJA 4FBLA 3T15A 2FWRA 2AFVA 4S1VA 3BREA 3IR5A 2ZKLA 3L0CA 4LK2A 5CIWA 5ITVA 1Q0UA 4M6WA 2WPNA 3PFHA 2ZB2A 1GUFA 2BZGA 1R0BA 3P9QA 4W5TA 2YINC 1AS2A 4MO2A 3LZ6A 1V2GA 4C0BA 4MPJA 1SVMA 4H1UA 4PLZA 2C4TA 3SHWA 1QCCA 4RABA 2IHZA 3I76A 2B34A 1QRTA 1VMAA 2A67A 4DG9A 1W87A 3ZTWA 1RRFA 1SBTA 1U5CA 4QPZA 5B2ZA 2JD2A 4DABA 4YUWA 5EFZA 1ZD4A 4JB0A 2J3DA 1JSCA 1OA0A 4TPKA 4YJ2A 2HBRA 4QU8A 1FFHA 4HOYA 4AJPA 4OJKA 3ZX4A 4DLZA 1RXVA 3H0CA 2K5UA 2Z8ZA 2CYBA 2ZETA 2AMFA 5BSWA 4BX8A 4M76B 4HJRA 1NU6A 1I5RA 4ZVKA 2H5LA 2XQGA 3TMKA 1RYEA 2DPHA 2GILA 3PNOA 3K70C 4JC4A 3M4JA 2X6QA 1TD1A 2XNCA 1HT0A 4RIHA 1MG0A 2BE7A 1ZKDA 2VVTA 2ZREA 5K3BA 3OFND 3Q3CA 3VVCA 3FKSD 3DM9B 3GG2A 1PR9A 5A4IS 2GWRA 4Z1MD 4NU8X 2X3UA 3RR2A 2IHVA 2PRZA 1W96A 4C08A 5BSEA 5C8YF 1ZVVA 4L0CA 2D0IA 3QE9Y 5B1HA 4UBOA 1WD5A 1F8GA 1R7RA 3DBLB 3LC2O 2NZUG 2AEFA 5JDCC 3LT2A 3F7TA 2XMDA 3HB9A 3ZGOA 5THQA 4Y8VA 1RAFA 2GBCA 2HWYA 1G98A 2EKZA 5TVKA 1WUIS 2FPMA 2GPTA 3LL7A 2Q0HA 2R48A 3AHJA 4KE7A 1VC2A 4Q7KA 4R8RA 2YW2A 3VO8A 4UOZA 5IBCA 2RHWA 3FNIA 5EE1A 4FCTA 2J3HA 1VBFA 1XEXA 4IIJA 3BUSA 4B47A 5AFSA 4M88A 2GDJA 3C43A 2XF8A 4PG5A 3RHZA 2I8CA 4WJZA 1GRNA 4N5IX 1FNCA 1B7GO 3OU7A 4TQAA 2NV2B 4Q9IA 4HAZA 5BSRA 3OEHD 3L43A 3T0GA 5CFQA 2WP8J 1QJ4A 3MJCA 1UFRA 3NT2A 4Z2YA 5IMSA 3RVLA 1ODKA 4HAWA 1HT3A 3RVKA 1SBYA 1FTWA 2CEKA 1LC3A 3A31A 1AXEA 3AHIA 3DAOA 3EZYA 3ROXA 3N0VA 4LMAA 4WCFB 1CD5A 4E0BA 5AI4A 1CBUA 2OGZA 3DEKA 4QG3A 3NO4A 4F45A 2FN9A 2VF7A 1U0SY 3V4RA 3IDSA 3KQWA 3WGGA 3K20A 4PHHA 4UASA 3LHSA 3BJZA 2XSZD 2HFJA 4L75A 3TSWA 4BMPB 1F38A 1ADFA 1NN3A 2PZLA 4KV9A 1T0PA 3VR5H 3DZ8A 4EG6A 1VIAA 3KZCA 5BYAA 1JWAB 3NLLA 4AY5A 1HKHA 1IXZA 2XF2A 1U02A 2OFWA 1ZINA 3IERA 1WUKS 1KJZA 4CMIB 4FB5A 2DB3A 3ITKA 4P4GA 1I1HA 1GQSA 2FYTA 3D7LA 3P9NA 1VJ5A 3TD6A 1NPYA 1YDEA 4PZ0A 1O95C 5FUVA 1MEEA 1TYDE 2GEKA 5G4LA 3SP1A 3FCAA 4JT4A 2REQA 4EA6A 4B3RB 2GLUA 2Q41A 2VWPA 4KWTA 3TI9A 1VGQA 2BPOA 4JI7B 1EK0A 2PTHA 3F96A 4Q1DA 5KWEA 2WJ6A 3ICVA 3DAGA 3DJFA 3W2GA 3HKBA 3DHWC 4RGVA 3G5TA 1BMFD 1S8OA 2GARA 4XWOA 1V9LA 1WHTA 2WFAA 4P35A 2XVYA 2CXPA 1TKAA 2JLUA 1P61B 1Z4IA 5TB5A 4A0HA 4RA9A 2ZRKA 4GC9A 2XLBA 4RQBA 3CRZA 4FOLA 1U2GC 1D3AA 2LGJA 2XA9A 5EE3A 5FWXB 1E9EA 1RJDA 1GLNA 3MJEA 1Q0QA 3LBNA 4F86A 1UWVA 4J90A 4M8IA 4W5RA 3TLKA 3MTIA 4S24A 3K94A 3ZCRA 1IHXA 5ES3A 1PAUA 2FNAA 2FUG6 2HJ9A 4G1FA 4MVJF 3K5PA 4P4SA 4MHOA 3RASA 3RU2A 2HK7A 5IVPA 3GPLA 4YBRA 5LUBA 4EYEA 4UUPA 3UICA 3V2GA 4Y2QA 1GTG1 5BO5A 4R9SA 4RK1A 3K1AB 3MVEA 4JIMA 2VDPB 1F17A 2PAFA 5JARA 2G40A 2XXAA 4MB0A 3KZ1E 1OREA 5H9VA 4YRSA 1U90A 2Q6IA 3IVAA 2PBLA 4LVOA 3MJFA 1IBLB 1RQPA 2Y99A 3V5NA 1Z4OA 3IV7A 2ZYTX 1U2DA 1XVAA 2PZMA 2WAOA 3GP5A 2ZWPA 3EZ6A 3FI9A 3WJ7A 1F2TB 1KIAA 5CDFA 2ZW9A 4XWKA 1R8JA 4KIUA 2CT8A 1L8LA 4V02A 4OKIA 2PBZA 5EG5A 4DJDC 5AVXA 3MINA 1PZGA 2A0XA 5ALHA 2O1SA 4FCCA 4R1PA 1PD0A 4BKPA 5K4AA 3FSGD 3GEPA 4REMA 1WW8A 1IL0A 4NCBA 4RPCA 1G64A 4I46A 4UC0A 4Y1GA 5AK4A 3WBBA 3C5VA 3QH4A 1BRMA 4ZCPA 5M5BA 2BH9A 3ZWWA 4C7VA 3ILHA 1JEOA 4D4IA 1XU7A 2FP3A 3V33A 2BFPA 1AO0A 3DFIA 3COJA 4GSYA 3PQ3A 3ZLBA 4BQRA 1YVPA 1EDDA 4XUEA 2CV0A 4MI9A 1LTHR 2GF9A 5CBPA 7MDHA 1IRIA 1SZCA 2WU0A 4N76A 2A0KA 4GG1A 4PCUA 4C1BA 1U3CA 2YBEA 3MEQA 5L3RA 2VF8A 3BMQB 5TF4A 3ORRA 3ZNNA 4BZQA 2Z8YM 4J9VA 1K6XA 1CUGA 2FG7C 2ZI9A 3LXUX 3P9YA 2KLBA 5LMNB 3MMNA 1F12A 2ID7A 2E4XA 1CQPA 1QFZA 2VJPA 4LRYA 4M53A 4E21A 1E6WA 3HMQA 4KLNA 2DLCX 1XVLA 2D8MA 1SBHA 2PR2A 3A8TA 1IWBB 3ILSA 5I4CA 1M7GA 1RWPA 2YV1A 5IUNC 3CNQS 3UAYA 1G3IA 4EYQA 3BE6A 3ZDDA 1JDUA 2NV6A 4YRFA 1JVSA 1OFVA 3H8VA 3PIIA 4OG2A 4XYMA 2BGGA 3L79A 1H4TA 2HY7A 2N9UA 4H6XA 2PA0A 4G36A 4M0LA 1XPRA 2EYQA 1K63A 1C5KA 4JYBA 5CP8A 5BMVA 4OB7A 1D2GA 5IXJA 2AD1A 3OCYA 4GP9A 3I8XA 4XUGB 5H59A 3VISA 1DAPA 1M67A 3KQVA 4JI3B 4OHBA 4IIDA 1VXRA 3O3NB 1R8SA 3UBMA 3QWIA 3NTOA 1HLDA 1KL7A 2QZZA 1Q14A 2Y1WA 2EZUA 3SN6A 1X13A 3OJLA 1Y7IA 2QENA 1FVHA 1KZ1A 3BXOA 3LXXA 1EFUA 4GPTA 4GICA 4KSBA 4UD2A 1YVDA 3TQOA 2IS1A 1DDIA 2W2KA 5EP3A 1F8XA 5HF8A 4C14A 5LKAA 4C7XA 4WLOA 1NBOA 2QPLA 4K03A 4PSAA 5FF9A 2QJWA 4MKGA 3VR1A 3VVBA 4QM6A 2H7YA 4BC1A 2GPSA 1WCWA 1W93A 3IPCA 3ENWA 1XWWA 3QLVA 4Y18A 1CEYA 1HDIA 3TLZA 3RNOA 2FSVA 2PGAA 1FDUA 3IP8A 4HBZA 1C8VB 3AIKA 4MUIA 4YRJA 3RTAA 5KYGA 4JR1A 2Y1KA 4LHYA 5B1DA 4YFVA 3TK1A 4A10A 3LXRA 4WZAE 4DSAA 3JVIA 1CJUC 4UXHA 3M5WA 3L0SA 1TQ4A 4NXMB 4RD1A 4D97A 721PA 3U9TA 1ZA2A 3ZHVA 2PJZA 3TJMA 4KVFA 3VZRA 3CZQA 3DBRB 1ML4A 1W36B 5LP6A 2DFDA 2PMKA 4A73A 2BR4A 2J9ZB 4CCAA 1M6HA 1HE1C 5K3CA 4KHZA 1CLEA 2FEPA 4P5EA 3PGXA 1IN6A 5DSZA 3URKA 4DCOA 1AN0A 2F64A 2Z5GA 5K3DA 4ZTUB 5T4EA 4K0KB 3OOHA 1LXCA 4P3KA 2J45A 3HU5A 1N0UA 2Q4RA 1XL1A 1CCWA 1ISIA 3U17A 4G9EA 2VT3A 4ETMA 4ZIRB 3HXLA 3CPJB 4QQRA 3WRYC 2F55A 3N53A 3ZHZA 3NP7A 4NBRA 1VIDA 3CRW1 1C1YA 4B74A 5LP1A 5TLSA 2LIPA 3GGJA 4DN6A 2AF4C 3UOAB 3NC4A 1LGYA 3ED5A 3FPGA 3THWB 4NATA 2IC5A 1Z4JA 3DE5X 3B6IA 5E95A 1NYRA 1NOIA 1OKKA 4YMWA 5DB4A 5AKJA 4GXTA 1CNFA 1W1WA 4TMKA 3T5TA 4EG7A 1Z4MA 4Q3AA 5EIFA 1IWPB 4NU6A 4S35A 5CJJA 1J8VA 3QENA 3HGMA 5DI3A 2RGYA 1NLZA 1OHHD 1Z08A 3LAWA 5E9AA 1L7EA 4PGAA 4HVTA 3PX2A 4DA9A 1A9TA 1WA5A 3G9TA 4DKJA 2LTAA 1N3YA 1UJ2A 1OXVA 1I3LA 1AKTA 2DFNA 5KQLA 4LUCA 4JOQA 3OE5A 2R62A 4GU5A 5FYQA 2F3QA 3OURA 2FWAA 3PQ4A 1JR3E 3G5UA 1G5RA 2N46A 1OIWA 1TYCA 1VE7A 1RTTA 1AKWA 1T2EA 3GLTA 3UAXA 2HRQA 4BP3A 1G3MA 4BU1A 5AVUA 3CEMA 3L41A 2MJLA 4MYRA 4QELA 3ZNPA 3U09A 3WA7A 2JEZA 5FUBA 3EC1A 4UNSA 1C9DB 3AR4A 1GGFA 3QIAA 3LCCA 1UF9A 2ZYRA 4N3CA 4M1YA 2A9PA 3C3DA 4ZRDA 3ROTA 4CTNA 3I12A 1V48A 3JSXA 4BTLA 1VKJA 1PJ2A 2X8WA 3DCJA 5DNDA 1XAHA 2Z98A 2XKBA 3PEYA 2IUSA 2W6QA 2NZWA 3FPLA 1PLJA 4UJ5A 1T9ZA 1GHTA 1CJKC 1LEHA 4YH1A 1OH7A 4F97A 2H06A 4P4SB 5DBHX 5E3HA 1G8FA 2JAHA 5IZCC 4ABYA 2HNAA 4QGGA 1QGDA 3RRNA 4IJ6A 2CE7A 1ZH6A 3LBYA 2DHQA 4G5FA 1OQAA 1NUPA 1V7QA 1Z83A 2EKLA 2NU7B 4GEGA 1GRCA 3GBSA 3QKWA 3DE6X 1TU0A 4BAUA 1SG9A 5BQ3A 1NT2A 3G2NA 4CMAA 2ZRPA 3C3MA 4ZQHA 1Y8CA 4DCMA 2PU5A 5AWFC 3UA3A 5AW2A 3TIIA 4ENTA 4UM8B 2HMVA 2PKQP 1WMAA 2GD0A 3L6RA 1W9MA 2Y71A 3U40A 1XF1A 3NPAA 4PX9A 4M7PA 2ECQA 4QZVA 5D8DA 5BVHA 2QIOA 2EJCA 3HR4A 2AUTA 3ACDA 4UNQA 3S70A 1PG2A 1T0UA 2ZWIA 4RZ3A 3PR3A 4GM4A 2IIBA 2JHCA 3MUOA 3LP8A 3VVLA 1R0LA 2WUDA 4N0EA 2WF9A 4M60A 3AF5A 1H05A 3MINB 2ZRMA 5ITZA 3BBLA 2XH8A 4EI9A 5JW6A 2HCTA 1T2VA 2JJMA 5IBRA 3V2UA 2W2TA 4UHKA 1E0JA 3HJNA 4NCNA 2HM7A 4RLQA 1NUQA 1XZEA 1K4YA 2D4AA 2XUFA 4CHTA 3ELUA 3F3YA 2R44A 1SOVA 2MMCA 2PYIA 3IBCA 1EWTA 2PRKA 2D0PB 4I9UA 1Q7RA 4JLBA 3U3OA 1HMYA 3GFVA 1HURA 3N2GA 1MH1A 3AM1A 2X7JA 5IF9A 1N0WA 1KJJA 1H42A 2BAGA 3DNPA 1QYVA 2J41A 1N0VC 2I6GA 2XE7A 4D0SA 1U8UA 1FY2A 1CJCA 2HV8A 1KJYA 2P6OA 4H1TA 1RKBA 3FMVA 5HIKA 1PR1A 4R81A 2F8LA 2W0SA 2ZWMA 2AWOA 1C7QA 1DQNA 4O5OA 3E5NA 1E32A 1II0A 3IIIA 3O31A 4IMRA 2B35A 5AMXA 4DCVA 1U8ZA 3TGLA 1Z18A 4YPOA 4KGDA 2JGFA 4ZJYA 1OFUX 3WLPA 4BGUA 1EVYA 4XH9B 1MO5A 1SQGA 2WD7A 1VJCA 3BWXA 4FWBA 1KO1A 2O0JA 3B1JA 1X80A 2WM2A 3P4XA 1IVSA 1HRDA 1MJGA 2YVAA 2HSGA 1XEWX 1E92A 2JLVA 1JDJA 4BMXA 2DE0X 4KK4A 3QI2A 1DAFA 2ZI6A 3QYPA 3U3DA 4BJ1A 1H8ED 1O54A 5CB4A 5KTYA 3L0ZA 1B93A 3HXKA 2VJDA 2EKBA 4MWSA 5BMVB 4LOJA 1QGZA 3FB1A 4ZI5A 2FWPA 3N0TA 1H23A 5CB8A 2NT4A 2E9SA 2I1QA 3WWYA 1WNFA 3GT7A 5HS4A 2JGDA 3JR7A 2ZBRA 2O3JA 1Q19A 4JAVC 4YMUA 2AYZA 1DAEA 3IRUA 2VRNA 3PDJA 4I6JA 2CSXA 2ODBA 3QLEA 3A3NA 4M49A 4WJLA 4B76A 3M4ZA 4XM1A 1LLFA 1ONNA 1THMA 3Q87B 4PZUA 1D4ZA 5DM70 1U0NA 5GV7A 3R7DA 2QTAA 4JQCA 4Q4CA 1UFQA 2EWWA 5ILQA 2AW3A 2IH5A 1SU8A 4MWBA 2WD8A 2OV4A 4EG0A 5CDHA 1QYWA 1V2HE 2PGDA 3E0QA 4Z7JA 1LBHA 1B14A 1Y9DA 3I9LA 3TB6A 3VTKA 1V5IA 5K1ZA 2FMHA 3RSGA 3TTVA 2GNPA 1K9VF 1UMKA 1BU8A 3FBTA 3PP8A 4OPMA 1EWYA 5HW0A 2O50A 2HA0A 3W6UA 3CN7A 1Z7WA 3WLIA 5LQRA 1T2FA 4N41A 4TWAA 1GP2A 3U9SA 4KMSA 3WRXC 4R1LA 3T1YB 5CRIA 3GIWA 4MVJH 5I6DA 3ET5A 2VPWA 3AHCA 3JYPA 3I8OA 3AF0A 1YQTA 3WBKA 3GUUA 3CVXA 3NDBB 1GNRA 3EEYA 5TS2A 5EKXA 1RPAA 1NR5A 1WO8A 2QTWB 3RRXA 1E8NA 3VH1A 3D59A 5HIJA 4RCVA 4ZQGA 3CTMA 3ECCA 1OSNA 4MP3A 4F5ZA 1Q0ZA 4QFDA 5JZMA 3LK6A 2ZR8A 1YZLA 3KZOA 3ESDA 4Q5IA 1EVQA 4ZA2A 1VL5A 3PKJA 3WLAA 5BW8A 4BNVA 3PB3A 1V25A 1WPGA 3E2MA 4BNTA 4C7OB 2ZGVA 4A6EA 3HB4X 4YUXA 1HMPA 5HZMA 2VHEA 2WABA 2BIFA 1YFKA 2NXCA 4XQEA 1JG4A 5C5IA 1Y8ZA 2R65A 3NH6A 4Q6BA 4PZEA 3HKDA 1C9MA 2VTBA 4S2UA 1J42A 1O5OA 1DIBA 4XFJA 1KMQA 5JSKA 3B13B 5KYTA 2GCOA 3NAMA 2PL1A 3HNOA 4NOMA 1X7WA 2V3VA 4R2XA 4DNQA 2OYRA 1N75A 2I29A 1XB2A 3ETJA 4OHVA 3S99A 1XWFA 2CNNA 2J7PD 5I7HA 2ODWA 1GG2A 1QUFA 2ZRAA 3CUKA 2AN5A 4MQLA 4MICA 4HEA1 4HCJA 4IXMA 4MV9A 5DJ5A 3JWJA 4AB1A 4MJXA 1DLIA 2GJ9A 2O2CA 3K8QA 4HHEA 4DPKA 5F9FA 1SG0A 4PG4A 3B5EA 5CYOA 4JI6B 2QTMA 3T7EA 3VKUA 3KJXA 3CH7A 3ADPA 3WISA 4BNNA 1R2QA 1O3YA 1USIA 3IKVA 4TUYA 2B0CA 3VC3A 3W7AA 3ZHBA 4IDCA 1ECPA 3NONA 1PJQA 3B8EA 1QKJA 2G82A 2XQFA 2M1ZA 3EZGA 1E5LA 4LV8B 4XRRA 1UMDA 2J4DA 4YDSA 1FNNA 1U31A 4UTZA 4TTSA 4KAXA 3HP1A 1FFCA 3F5SA 4OATA 4RACA 4B5LA 5CX1A 1IY9A 3L7BA 3BICA 1OUMA 4P4UA 2WWIA 3A9UA 4OB8A 1NSFA 1OLUB 3GRKA 2QHXA 3RV4A 3FCCA 2HIHA 2PWZA 4ER7A 3BQMB 3SDSA 2XJ9A 2QQEA 1FA9A 1VKOA 3EGDB 4PTYA 3M0EA 4XTCS 4FB4A 4QT4A 4Q3KA 2B2NA 3RUIA 1B8VA 4UCWA 4N6NA 1GG8A 3EDQA 3CSSA 3E5HA 2RB4A 3OX4A 4AROA 3KSAC 1M2FA 2QROA 1Z2AA 1TECE 2M9MA 1K4MA 2CXSA 2ESRA 1G66A 2BCGY 3JVDA 3NV9A 1V6SA 3TRFA 5BPHA 4MVJD 2RI0A 3WDMA 4H7KA 4BN0A 3BL6A 3Q88A 4ZKEA 5KVAA 2P35A 4GVLA 2MWMA 5IT0A 4Q4LA 2P77A 4AL4A 4MIYA 4V2UA 2WYUA 1N36B 2H52A 4RUKA 5FL7D 3O91A 4MPDA 5A7GA 1EZZA 4BO0A 3I01A 2XSZA 4HWKA 5KHOC 3CUVA 5GQSA 3UG6A 3GGSA 3SC6A 4ZHQB 4HNUA 4RY8A 1HDZA 1QLWA 2DBQA 4MS1A 3I5MA 4G0ZA 1S96A 5ECGC 3V6LA 1YVRA 2F3PA 3F6EX 1F1JA 4M21A 4J6FA 4EB3A 3ZGNA 1A5TA 1UIMA 2A0FA 3WYEA 1WB6A 5ITZB 5LNK1 3ZUGA 2JARA 2R86A 3NTLA 3RYHA 1GGKA 1DTEA 5F7OA 2IZZA 4DKXA 2QSYA 1ZDMA 3HCCA 4JCCA 1BH6A 5D3ZA 1Y7HA 4LJLA 4GYKA 1DE0A 1I14A 3E9QA 2PUGA 4MW6A 1XU9A 4QIHA 3C3JA 4NQZA 2PS1A 4CM9D 1BMFA 3HBFA 4EVRA 3AF1A 1QGUB 3GNTA 1IOLA 3P26A 4L8YA 1NQOA 2HWXA 4NZYA 4DEYA 1B2LA 3LX5A 5IM5A 4YQZA 2RHJA 1VLZA 1EUQA 3NHYA 1OY1A 1E1YA 4LTNA 3UBTA 1AQYA 3TIXB 3OQJA 4C6TA 4P81A 1RPJA 3AVYA 1AE1A 1OWPA 3U3XA 5FI5A 3B1YA 3H9GA 1MBZA 1VKZA 1YOVA 2WD7B 3HJTA 3OF5A 4ZC8A 4IDQA 4D0LB 3DVAA 1X80B 3MTDA 4LYFA 4B6QA 3GB9A 4RVNA 4KI0A 4MEBA 5EQFA 5TJ9A 1L5ZA 2OM2A 4DLKA 5CB4B 4GXQA 4MA0A 3PSAA 1JLSA 2NTNA 3S5JA 1NNEA 3PJRA 2IZ6A 4GQAA 3VYSB 3G8BA 4YYEA 2QVBA 2GWHA 1XMSA 3CVJA 3MLAA 3L9XA 4M1OA 1W59A 2EZ8A 4PLCA 3R3HA 2F8MA 4MGYR 2B4KA 1KFJB 4GYWA 4LY6A 4YJ3A 3DEHA 3DT6A 4EO4A 1W7AA 2WW8A 1ODSA 4C0LA 5JMOA 4FGZA 3V4OA 4MYCA 2GEBA 2YN0A 1K3UB 4LECA 1GFWA 4PHFA 3IEXA 1JG7A 3C3EA 5BQPA 2QRGA 3NBXX 4F0JA 3DL7A 2QEQA 2XPCA 4DC0A 4URUR 4IS2A 5IARA 2WWVD 2O8EB 1A0OA 1L4KA 1WUHS 4QUBA 5JT1A 3G1WA 1TQ6A 1AKRA 4GX0A 1G5QA 2H1SA 2J6HA 2XRYA 4GI3A 1MQ8B 1E5TA 3P4UA 1YL5A 1PBTA 3NW9A 3RS2A 3VR5A 2OZPA 2X6RA 2ZSDA 2FAXA 3PXEA 4UEOA 4AW9A 1A04A 4XVHA 1N25A 3OLZA 3AZOA 4GOLD 1OI7A 1TUGA 1SNYA 1Y3DE 2JKZA 4QPCA 1RHJA 2QX6A 5EJMA 5AD1A 1M6VA 4MYSA 4C1NA 1PEAA 2C2OA 4ZV4A 2HSWA 4IG4A 3BDAA 1M8GA 4QYXA 3EGXA 5M04A 1FSGA 3W2EA 1ZUHA 3U7JA 2QG9A 2YNMC 3M5DA 5MGBA 4CCYB 2A9FA 3K0FB 4AJJA 3I34X 3EEQA 4E2YA 3KUUA 3OWOA 1W5FA 2SICE 1ZN9A 1YULA 3MSXA 5BR4A 1N0HA 2JFXA 1T4BA 1NUSA 4O4JB 5CW2A 1M1YE 2X9QA 1KRXA 3R5JA 3MGAA 5JPDA 3FUXA 5GV8A 1C7ZA 4IX1A 1Z74A 4R5HA 4AIRA 4AYXA 4LYJA 5IM4F 2WJJA 4UDXX 3FYSA 3A1DA 1M8PA 3PA6A 2ASVA 4BMYA 4GWGA 2G6BA 2O7SA 4IDOA 3UJ7A 5BV7A 5FWYA 1T1GA 2QW0X 3Q0EA 4RQUA 4UTNA 2HJRA 4JLMA 3TJRA 4QJ4A 3VJLA 1H2ZA 5KTOA 2IEBA 2ZS8A 3TW8B 4R2KA 3LBIA 3MJDA 5EMMA 3F4LA 3SM9A 3HP4A 3PC4A 2P7IA 4PHTA 4F8YA 1G7CA 3HKDB 2VTBB 3L6UA 3OCVA 1M3SA 1C41A 2FWMX 1BIFA 1XELA 2Q45A 1YCGA 2REBA 2XIJA 2GCOB 4HEQA 4I6EA 3ISTA 4L73A 5DK4A 3PFCA 3A4MA 4AXBA 4BNUA 1X7WB 1OC2A 2R4TA 5B2EA 2GM4A 3TR0A 1THTA 1R9JA 3JD3A 2G70A 2WWXA 5H5JA 2JC3A 4KXMA 2EATA 3DO8A 3RS7A 2YASA 3LVFO 2COEA 2QBYA 3CY6A 3VKWA 1OD6A 3RC2A 3CWZA 5BN5B 3G2HA 4HH1A 4CEJA 4P36A 1MHTA 4WOBA 1L4YA 2WWHA 2IEZA 4KIFA 3BCUA 1WUJS 1LW7A 2WM8A 3KBBA 4MEJA 3O2QB 2YMPA 4QOHA 3KR9A 5ALWA 3UHPA 3A27A 3VZDA 4UEKA 4R71A 3DOHA 5LQKA 1UK9A 4A0SA 2QX9A 5C1BA 1WWKA 4EVIA 2AQ8A 2FRDC 1XRRA 2IYQA 4EB8A 4WK6A 1U0GA 1UMDB 2ADOA 4QXQA 3SOPA 3ZU2A 2I2WA 1H9BA 1ULUA 3VKVA 4B6JA 4F72A 3B20A 5DOZA 1ZJ4A 2QDXA 1I7SB 3M6WA 5IG2A 4BX9A 4PAGA 1HOTA 2BZ0A 3PLNA 5F76A 4TZTA 4DV3B 4EPYA 1SMKA 2QIPA 1QFJA 4M87A 1I30A 4PS1A 3R76A 1CLUA 1XO1A 4BLOA 4GZ3A 1FW6A 1V7ZA 5T67A 2G7MC 4L9WA 2V7PA 3KELA 1GAQA 2RGXA 3IHLA 1M34A 1QMGA 3BX1A 3KLBA 2WKPA 4NE2A 2F3SA 4R3NA 4DCJA 4EARA 5GONA 2UYCA 1EQ2A 3IRVA 1WDTA 2XZLA 1PW7A 3O1HB 2IFTA 2PKEA 3HABA 4KPYA 1BKDR 5BPFA 1JR2A 1GVNB 1N57A 1II9A 2UZIR 7AT1A 1XT6A 2BE9A 3VNSA 5EWLA 1UCFA 3AL0C 3GPIA 4D42A 5D01A 3GIDA 3W3AH 2H2FA 4NCIA 1CP3A 1EPUA 2WTAA 3A1UA 2PU7A 5HMLA 4QT0A 5L7WA 4O3MA 2ASEA 1G8GA 4L57A 4X5OA 5TNXA 3U3KA 1C7FA 2XWPA 1CUEA 4UTVA 2BL4A 2H51A 2JIPA 3HI6A 3KTAA 4MS1B 3V7YA 4BN4A 2QRHA 3SC2A 5FEUA 3ORQA 1NXTA 5H83A 1KAGA 1L7XA 1FLVA 3EGWA 3BD6A 2J59A 4O4HA 3SIPA 5H8WA 1HDOA 4HTAA 4RPJA 2H2AA 2C7PA 2V4ZA 3RYHB 2DEUA 2G9ZA 3DLAA 4Q3BA 2R6JA 1QS0B 3KG2A 3MUNA 4RIFA 3UCXA 3BVPA 1EH5A 3D7MA 1KS9A 2C0CA 2NO7A 3WHLA 5A3JA 5HJ5A 3FIUA 1K86A 4ZAZA 3I9V6 3EOAI 2IHNA 1ODLA 1JJVA 2QN2A 3HB7A 4MRVA 3GV0A 3Q7EA 1I0IA 2X40A 4RZIA 4LQDA 5A5VA 6ABPA 2QUZA 4H7HA 3L5KA 4LDAA 2BC9A 4LJ5A 5HPYB 2XYQA 3GX1A 5CAEA 4WI1A 5IRCD 5KI6A 4FC6A 2A9KA 2HA3A 3HGQA 4U2GA 2EX1A 1SD1A 2WE7A 3DHNA 3FPAA 5A7HA 1RR6A 1T9GS 1JUDA 1U7UA 1A95A 3D31A 4ILEA 1J0XO 1X8KA 2AMLA 2GA8A 2OK8A 3JQAA 5K0SA 5HQ3B 2BGMA 2UYYA 4FR2A 4MR7A 4PFQA 4XUDA 1HKUA 1TEHA 2AJLI 3DVAB 5FTNA 3RSFA 4D43A 2IIQA 1V3UA 1WB4A 2EBWA 2QPAA 2ZKIA 3WXBA 4AWXA 4R0MA 5A06A 3AP1A 1YR3A 4YCJA 3AV3A 2L2QA 3ZLJA 2E82A 3CE6A 5C8ZA 1XU4A 3V34A 3IS3A 5K0JA 3CZMA 4HQNA 3ADKA 3PHGA 1QLJA 3HUTA 3OFJA 3Q1KA 2LV8A 3Q7QA 4ZALA 4D9MA 1TTPB 5EEHA 5ICGA 3PSHA 2D2VA 4LJ4A 4OQZA 3P94A 1OFIA 4RE5A 2JHGA 5E2AA 1SKYB 3VOAA 1CJMA 3Q8KA 1QP7A 4LNUA 5K01A 3EBOA 4I1OA 4BGDA 5FRDA 5CB6A 2DZDA 1JR4A 3TR5A 1ZU5A 4L8FA 2I03A 5IVHA 3HYLA 2I3BA 4EJFA 5IJ0A 4ECEA 3AF4A 4LX8A 5C18A 1O0BA 1CNEA 1CF2O 3CRVA 3G2PA 2OXCA 3EG9A 3LJKA 3RVPA 5B4VA 3OCZA 2RJNA 1WXQA 1JG1A 3E3LA 1UXKA 3EGCA 1PUJA 3LLVA 2EW8A 3PDCA 2O06A 4GR9A 1VG1A 3H3JA 3IBSA 4KCGA 2BBWA 3RNLA 4F6RA 1QB7A 1NBHA 5AM3A 4P7JA 1A8PA 1FVXA 2W6PA 1Z5VA 2G5GX 1JS1X 2C2MA 1UAAA 3RRZA 5C8XA 1DX6A 1NF2A 5KUTA 4YDHB 1M6VB 2REOA 1OAAA 3IT1A 4GLJA 2Z3WA 4OMDA 5C7LO 4B0OA 1J07A 1KETA 3LKBA 3OIYA 3T99A 1DX9A 3I2IA 5FNVA 3F7NA 1GQYA 2YDXA 3KWJA 1MB9A 1TMYA 3A6EA 3OUTA 1YC5A 1YR1A 3HL0A 1J5PA 4W63A 5DLEA 5ADUS 4OMUA 1N9KA 5HDQA 1P1BA 2Y66A 4LHEA 4TSFA 3AY0A 4YVFA 2XBMA 4RULA 3AFOA 3OHMA 1CUWA 1YQQA 2YJTD 4MP8A 5KOIA 1WXDA 2Q0QA 1TUIA 1YMVA 3AJ9A 3LPAA 4DV2B 4G37A 4KXNA 1XQXA 1P77A 1QK4A 2V5AA 1B3BA 3AVPA 3EXG2 4ZREA 2E4WA 5FWYB 3DDOA 3E61A 3VR4H 3G2QA 3HO1A 3T7SA 3NC0C 4Q1EA 1NG9A 1RAEA 3W1WA 1GL6A 2ZSBA 1FDVA 1FEZA 4AJ4A 2XVXA 3QU7A 3JWIA 4INAA 1D04A 3C1AA 4ILKA 4PPFA 4IOJA 4I3HA 1ZGHA 1M83A 2AFRA 2AIRA 5FOVA 4B7AA 1L4NA 2SKDA 3T3IA 3F8TA 4D4LA 3MD0A 4E7OA 1Z82A 2PIAA 4KVAA 4FFBA 1IY8A 2X4DA 1YRLA 1NVDA 4NAUA 5JRDS 4AY6A 2APJA 2YN2A 5CK5A 2RGDA 1ZX1A 5FFFA 1KOGA 3DWGA 2QBYB 1FZTA 1BFKA 5A4AA 4C5BA 2P9HA 3E3MA 3TGPA 3PIRA 5ISMA 1FUYB 2W2QA 2IBTA 1HTBA 3TRJA 5DHUA 3C0KA 3Q7TA 3FHLA 1FIUA 1VP3A 4CQMA 4DIFA 2C97A 3HDYA 1UZMA 3PYXA 7GPBA 1U4OA 2BEUA 2GD2A 4BFTA 4EM6A 5IKOA 1SXPA 3OKFA 3V4LA 4EBFA 3T06B 1ADBA 1UXJA 1XRMA 4KVZA 3BRSA 3BSFA 4K2AA 1KORA 3GRRA 2CL0X 1VPVA 3B70A 4Q4JA 5JC8A 1L7MA 3TRIA 2UAGA 3DEFA 4NEQA 1BX1A 5K6RA 1RC8A 3PQDA 3ZXIA 1K6IA 5HRUA 2XA1A 2IF2A 2FG6C 2IEGA 5CDSA 2WUGA 4NIMA 1C3JA 2J6BA 1M34B 3Q0TA 5TDHA 2ZJ6A 5AW9A 4KWCA 2C42A 3HYCA 3SKXA 1F20A 2YC4C 2O8DA 5HBGA 1DEXA 2YR0A 2QRNA 4XGKA 3NAGA 3BXPA 1WU8A 3D7SA 2NXNA 3TTSA 2RBEA 3H1PA 3SZMA 4MQBA 3A3OA 1HE2A 3TPFA 4OHFA 3UXMA 1RC0A 2WVGA 3IUSA 3ZC3A 4UPEA 3OLXA 1JSRA 1CZNA 1ZN8A 3ROFA 3SZGA 5FUYA 3KTDA 3ADDA 4GMXA 2QL5A 4YAFA 4FONA 4GRAA 4E14A 1D1QA 3JQ6A 3KTAB 2I34A 1SURA 2I6XA 1W1IA 3N8GA 1Q7EA 1RWKA 4IGEA 3SC2B 2UZ4A 1GTRA 3HWRA 2JH8A 3PJEA 1L1RA 1ST2A 3OZRA 4ZEMA 2PUBA 2Q5HA 2D0OB 4O4HB 4D80A 1TE2A 3CXRA 3Q1LA 4MDEA 4ZFNA 3V32A 1XNHA 1OWNA 4GXRA 4FSXA 3NBFA 2YVUA 4WFIA 3ZE7A 3F74A 4AMZA 1THZA 3PK0A 1FU4A 2AOWA 3FCUB 4G84A 4HQFA 3OP1A 2B4QA 4NE7A 4NK4A 3R0VA 1VYTA 4HLDA 2R00A 3D8BA 3BIJA 3RFTA 1D6SA 1KAMA 1YUNA 4YC7A 2VDNB 4Z0NA 1QHEA 1AQUA 2JIMA 1NAHA 4HQRA 3UMYA 1C2YA 3SBEA 5L6MB 2P4QA 5B1YA 5CAEB 2D5AA 2EFYA 1GM5A 5AVOA 3A28A 2OXFA 3UPTA 2FZWA 1QG6A 3Q98A 4OEHA 3KVNA 4ALLA 2ZBVA 1W19A 3NQ41 2BFWA 1JIVA 1N6RA 5E4YA 5HNKA 2BJWA 1QTRA 4EUSA 1K7CA 3KFVA 1RWOA 4YRQA 3JQAB 3OM8A 2DKOA 3W0LB 1E2NA 3EF3A 4MR7B 4QQ8A 4ZVSA 1LVHA 1KYZA 3PUJA 3D54D 5A9SA 5AKYA 2QV7A 3NTVA 3RIGA 4ZDJA 1XZNA 2QAGB 3NBAA 3UV7A 3WOHA 1CUXA 1CY2A 2AVDA 4AJIA 4D4KA 4W5QA 3RQIA 2PUFA 3L9WA 2ZDHA 5TMPA 1ZN2A 4GKKB 1U1GA 4K7JA 1BROA 1O87A 1SCKA 1XROA 4U6NA 3QPWA 3QU9A 4YT2A 3PFNA 4CLEA 1MVOA 2CXQA 3KL2A 3QRWA 1OA1A 4HN2A 4KTVE 2D62A 1J6UA 1YS9A 4S0XA 4D8XA 2HT1A 1XTVA 1FQJA 3IA2A 3PJGA 3KE9A 3K15A 5ULLA 4Z1OA 3I6ZA 3ACCA 3PHCA 4MVJA 4HB3A 1SHUX 1KYVA 5ICSA 2F2TA 2QUIA 1L8OA 3CLRC 4RV9A 3QELA 5FFMA 1SH7A 4LNUB 3NWBA 4D0NA 3TLBA 3VYVA 1NBAA 4AKGA 4JMPA 4XWGA 3DFKA 4WACA 1P4SA 5DX8A 5FL7A 1GNPA 1YRWA 3OSZA 1HEIA 2QZJA 3EQ2A 3NKLA 1G4UR 1Q84A 1NJ2A 5IJ0B 3DKVA 4LJ6A 1TJNA 4ZCLA 4BNXA 4BEWA 5L7YA 1AGYA 4HG2A 1EDEA 1EFKA 3WV5A 4A8JC 2QN9A 2YJ6A 3EG9B 2IUYA 3O7WA 1OCEA 1YI1A 2Q3BA 3GA0A 2H1IA 4J7XA 2QL7A 1SJ9A 3TSCA 1GU1A 4YRTA 1XZIA 1L7RA 4AG6A 2J5XA 4F6RB 5LPNA 4JI2B 1Y5MA 3CLUD 4J0QA 2O20A 1PJSA 2OD2A 4GS5A 3DV2A 1NLFA 3KB2A 4V3BA 3V1LA 3VU3A 4Q0MA 4ND8A 4QTUB 3USZA 4MW4A 3INNA 3P2YA 1CZUA 1GPMA 3IDOA 4D92A 1G8PA 1U5AA 4XOIA 3SKVA 3TEFA 3V8BA 5AW5A 3WK6A 2WSLA 2B5OA 1BXRA 1AQIA 1JZQA 2OZLA 3W5HA 4CM9A 1I6LA 2BMEA 4AMUA 1KJ8A 5FNVB 5F1OA 1GGJA 2FPIA 2C9ZA 2QRVA 2I5PO 3BXGA 3BG5A 3IQZA 1TYAE 3E58A 3QXHA 3FPHA 2HSDA 3L1KA 3G9XA 3T94A 1M5TA 5CLFA 2R1VA 4BUCA 3DOJA 5E6RA 1USWA 3P2JA 2J32A 2JB9A 3K16A 1I9GA 1RYBA 3SJ7A 1UQRA 4RESA 3DF9A 3LX8A 3M6LA 3EPJA 1V8BA 3BMOB 1E2PA 1MAVA 4Y9DA 2OA0A 2X0RA 5BOSB 1Z17A 2B78A 5CNIA 4AJHA 3QEMA 3DAYA 2J0QA 4CR6A 1NF8A 1C4KA 3OPYI 5AK6A 3S2ZA 4ALJA 2IYLD 5C1DA 1RZRD 1ORWA 3IJPA 4JLKA 1QF9A 2I4OA 4AJOA 3AR6A 3H2SA 3QVKA 4WDRA 4PC3A 2IYEA 3V4FA 2C2ZA 1M7HA 4UEWA 3WDLA 5JRJA 4HBGA 1PT6A 2BW0A 4UMEA 4Q1AA 4HH4A 4NP6A 4RLSA 1NQAO 3RVNA 5IH7A 4U7GA 5E6UA 3VR0A 1SXJE 3BGVA 1DO8A 4MQFA 5TJHA 3MD9A 3TGWA 1LZLA 3LY9A 3J81k 4FX2A 4QPJC 4WY5A 4OL9A 4FFBB 2CYAA 1CUVA 1FNMA 3OHPA 1JIKA 5FWNA 5L3VA 3AI2A 2PX4A 2G09A 3Q8WA 2BMWA 4N9WA 1DC6A 3W2IA 5IJWA 3VDXA 1MB4A 2H08A 2K2WA 2P78A 3SMQA 5KU1A 1KSHA 1G2OA 3EWNA 5G0SA 1U1DA 2Y1DA 3WNZA 1M2EA 1NDUA 2BEJA 2H4FA 3A1SA 4RTPA 2MSNA 2HUNA 3AOEC 1XF9A 2O2SA 4IUBS 3NVKI 2O8BA 3B3JA 2ZU0C 4L4RA 4URFA 3SJUA 2ZVQX 5D6NA 2ZTMA 4D6PA 4XWTA 4CQMB 1DUVG 5B3LA 2XQIA 1M33A 1MC8A 5SYMA 3L8CA 3G88A 3MOSA 4LHXA 3BEDA 4NYMR 4O4IF 1GXSA 2WINI 1GYQA 1X3SA 4PCVA 5EWMA 3ND8A 4JHXA 1F2VA 1ZD3A 1Z4PX 2G72A 2MYNA 3C7KA 3EA4A 1ZC3A 3KCQA 1D5CA 2NLOA 4AF8A 5JI2E 4TSRA 2H59A 3HEMA 3K72B 2FN3A 1JIQA 2QDKA 5A1JA 1E9CA 5JH7B 1FX1A 1AO3A 4UDNA 3DC2A 1ZY2A 4OBEA 2OE2A 1FLNA 5BOVA 1A88A 1DPFA 4Q01A 3PFWO 1YBVA 1WMDA 5KYYA 4BP1A 1ZOSA 1KSGA 3WFIA 2DTXA 2OGTA 2V96A 3RSCA 4BPRA 8AT1A 1XZPA 5FEMA 4HLCA 4QRHA 5COBA 1HZZA 1XA0A 2PMBA 3MCUA 5AK3A 4CKXA 1OB2A 3G0HA 1BO6A 4I5DA 1WXWA 3VAZA 1YI8A 1P91A 4IM7A 1IQ0A 3GJ3A 4GLFA 1NRIA 2BRUC 2OHGA 2ZATA 1ZXBA 2H1VA 4IBOA 4IGIA 4A2PA 4W5JA 3N76A 4W7HA 4XM2A 4QHTA 5KWVA 3HSYA 2FUKA 1VJGA 4ID3A 3VNQA 3TUZC 4Q9JA 4ZU3A 5EZ5A 3TUIC 2DKNA 1XK7A 3N39C 1T4DA 1ZJZA 3CUYA 1CYEA 2ZPAA 3IEIA 4J03A 4EL5A 4E1BA 2I6TA 5JCOA 4ZYXA 4U39A 1QQ6A 3VSEA 4ACBA 5TY0A 2ZQ5A 3WO1A 3H75A 5EINA 4WV3A 4BN5A 1ORIA 2GBPA 4FYKA 2WILA 1IIBA 2LIVA 2PZFA 3ZJUA 1QFXA 3DZJA 1MC5A 1O0CA 2UXBB 3K71B 3MBKA 1KI7A 4IJKA 3TXAA 3BTUA 3FPBA 1OFUA 4UZFA 2QP4A 3CZCA 1HORA 4B4WA 2G8LA 2DPGA 4ZOAA 4HFNA 2W58A 2JJ2D 5IAJA 3E3AA 2IGTA 2AVNA 3M6FA 2UV8A 3IT3A 4D98A 2AFHA 2YXNA 1ML3A 3C6XA 4NR0A 5AKZA 4CKEA 2Y8EA 3P96A 4M38A 1X15A 4KGXA 1JKFA 2HHJA 2BN4A 3RVSA 4BKMA 1G41A 3EXHB 1IYZA 4CEIA 2O48X 4OLJA 2GXAA 1BE8A 3I3OA 3K70D 1HA3A 4YAOA 2O8EA 2WSIA 1PGJA 2J9XB 1V5GA 4EY7A 5KB3A 1PK9A 1PQPA 2FWBA 1ZJ5A 2QGZA 3OJ0A 3PUZA 4WXEA 1ATIA 1G5IA 4S1NA 4XX1A 2A92A 1SOWA 4FDVA 3F49S 2I2CA 4CHGA 1LCIA 3UMFA 3M5PA 1LDEA 4IVQA 3RJMA 3K6SA 1W5BA 1ICIA 2W6OA 3R0XA 5C1IA 3F71A 2HHLA 1ENZA 1V8OA 1GA6A 2AFIE 2CNBA 2C3MA 2LPMA 4C20A 3DQZA 4QYWA 1NW5A 3ZWVA 1DCFA 2MSEB 3E4CA 5CURA 5I5GA 2JK1A 3WLTA 4F3NA 3DLHA 1Q0SA 3C8HA 3WLFA 1R5OA 3IESA 4YECA 1RZUA 3DAFA 1VFPA 3RE1A 1XPOA 1XCPA 2A9RA 4EUEA 5FFNA 3MHTA 1EXVA 3ZNOA 4RF5A 5ICFA 1DINA 1AK9A 4OI2A 4XIYA 2B2CA 1OILA 2JJYA 2XGSA 2XVZA 4Z9XA 4EF6A 2H57A 4KPUB 4D9IA 1IULA 1E2MA 2XEXA 1KH3A 4FUQA 3ANXA 2R47A 4LJ8A 1SC6A 2EZTA 2YTZA 1U7DA 2Z9BA 3H13A 4G5RA 1P0CA 4D6XA 1VHTA 1I36A 4HEJA 1GCUA 3STVA 2DHRA 2ID9A 2M6LA 2IITA 4C0QC 2D5BA 5HHTA 3PQ8A 3BOSA 1I3KA 2QU7A 3KTFA 3PNYA 4M83A 4Q05A 3LHIA 3GT0A 4BVLA 5KSPA 4QODA 4FVTA 3DDWA 3IPAA 4GZLA 4I5FA 3NHFA 4HMPA 3UOWA 3T5CA 3I04A 3TQQA 4CMGA 1EUCA 4OX9Y 2AUNA 4XSVA 2VWQA 3IJRA 4PO1A 4X93A 2XNHA 1NFRA 3STUA 3UPUA 2B4AA 4LOAA 3I1IA 4G0XA 3T1OA 2CBZA 3TRDA 4BE9A 5JYCA 1GKUB 2B8EA 2PL3A 1KF0A 2EP7A 4FKMA 4NICA 1ODTC 3FR8A 2O8FA 2BSXA 2OZLB 3H1GA 2Z1NA 3WB9A 1W8DA 1B15A 1II8B 1JVBA 4FM9A 1H4SA 3FI0A 1XRQA 5SV2A 2BI4A 1VE5A 2EQ5A 2FPIB 4YWHA 1PZMA 3RO7A 2DGDA 5L4LA 2JI8A 3O8BA 1P9WA 4LRUA 3L7JA 2Z5FA 2CDRA 4RJTA 3OQ6A 5REQA 1PGPA 5GM1A 4WGGA 3LCRA 3TKAA 2WF7A 2VAPA 3A1CA 5FPTA 4HQLA 3TTUA 4AWAA 2ECPA 1CUDA 4N5MA 1FYEA 1F3LA 3QEMB 5BV2P 4AO7A 3B2QA 1OGYA 3OLYA 2H16A 2OLKA 2E0IA 3GJTA 4U0KA 5JJCA 1PLKA 1I51A 2VATA 1HBJA 3U16A 3P27A 1MB0A 4P0TA 3T4PA 2ON6A 3I30X 4G4SP 4GGPA 4BNWA 3EFOB 2HGSA 1IJBA 3K2BA 3H4IA 3R3ZA 1EYZA 3L8EA 2I4TA 4D99A 4ARAA 2HQ1A 2GZRA 2GYWA 1GEGA 3MRVA 4MQFB 1HEYA 4QEZA 4X84A 5FPYA 1GFIA 4LKOA 2HA4A 1RQNA 221PA 4DIBA 1AF7A 2PQMA