1Q77A

X-ray crystal structure of putative universal stress protein from aquifex aeolicus
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
138
structure length
138
Chain Sequence
SNAMKVLLVLTDAYSDCEKAITYAVNFSEKLGAELDILAVLEDVYNLERANVTFGLPFPPEIKEESKKRIERRLREVWEKLTGSTEIPGVEYRIGPLSEEVKKFVEGKGYELVVWACYPSAYLCKVIDGLNLASLIVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein AQ_178
publication title Structural homolog of Universal Stress Protein from Aquifex aeolicus
rcsb
source organism Aquifex aeolicus
total genus 43
structure length 138
sequence length 138
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-08-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1q77A00
2HZ7A 4ARCA 1I6MA 3HZRA 2QJOA 1GAXA 3A2KA 4HK4A 4MW9A 5IHXA 1EUYA 3TQOA 4ND7A 3CVXA 1RQGA 3E27A 4Q16A 1VLHA 2VXOA 4YP7A 2VTBB 4KR7A 2X3FA 5FNZA 2DXIA 2ZP1A 2J08A 1N77A 1QJCA 3ZUGA 2A88A 1ZJWA 1G59A 1GTRA 4QBTA 2PIDA 4MW7A 1O95D 4F4HA 3ZJVA 4FZJA 4ZT6A 2GOYA 1M8FA 5LLTA 4JZYA 2GKSA 3SZGA 2HMAA 3PNYA 1N2OA 1NUQA 1MOPA 3Q10A 1K4MA 1WKBA 1QNFA 3DO8A 2OQ2A 3OTWA 3PNBA 4UZFA 4H3SA 3BL5A 3S3TA 3A4IA 4KPUB 5BNZA 3A04A 3CR8A 3HL4A 3ND5A 3DV2A 2DERA 4S1OA 1YUNA 3HMQA 3KT3A 5J59A 3L92A 3QE4A 4RPIA 1NI5A 1NYLA 3HFJA 3ZIUA 3X1KA 3FOCA 1MB2A 3FETA 1JHDA 2R5WA 1IRXA 1V8FA 2A7XA 1DNPA 3D6UA 3U1VA 1HYBA 2J07A 4XSVA 1JGTA 3N8HA 3KT0A 4L2IA 4NAHA 4AQ7A 1Q77A 3VRHA 1JIJA 1LI7A 2XRZA 1GTSA 1YUMA 1U3DA 2E0IA 3F3MA 3Q4GA 3CVUA 3ZGZA 1EFVB 1O95C 1SURA 4NX2A 4MW1A 1EFPB 5DK4A 1NURA 1PFUA 4MVWA 3FY4A 3P52A 2O5RA 1G8FA 2V0CA 3SEQA 1KH1A 1N2GA 3K9WA 1IH8A 1WQ4A 1MAUA 5AHWA 4MUEA 2X0KA 3INNA 3DPIA 3KFLA 2IELA 2QUJA 4OJMX 4MW6A 1N2EA 3MLAA 3P0IA 1H3NA 4J76A 4MQ6A 1PFVA 4JXXA 3D6VA 2QTNA 4MVXA 3TQIA 3OP1A 4PBRA 4EG6A 4KR9A 3IVGA 2CV1A 2DUMA 3A05A 1J1UA 4ZCSA 1KR2A 5TGTA 4DDMA 3ND6A 2D5BA 2H29A 4NATA 2CV0A 1NSYA 5EKDA 4CDNA 5K0SA 2OV4A 2E21A 4HJRA 2VTBA 2QTMA 1COZA 3ZXIA 2HGZA 1WY5A 1KQOA 3CLSC 4ZT7A 5HG0A 1N78A 2BYTA 1Q19A 1LW7A 1U0BB 2BTEA 1OWPA 1MRZA 1OWOA 1VBNA 3UY4A 1NUSA 3NBKA 3MMXA 3PNVA 2QJTA 5HUHA 4MWEA 3MLBA 3G59A 3GLVA 4CDMA 1O0BA 1WQ3A 3P0JA 2JA2A 1CT9A 1M8JA 1T9GR 2Z08A 2NSYA 5JBNA 3G6KA 4UZEA 4MW4A 5DASA 1WXHA 4KPUA 2D13A 3TZEA 1YULA 4EG5A 3ISJA 5FO0A 1XNHA 2J5BA 4MW2A 2AG6A 1NP7A 1WXGA 3AFHA 3M5WA 2ZUFA 3FIUA 1MJHA 4ZCPA 1TYBE 4OUDB 4ND6A 5J5AA 1I6KA 5LFAA 2A1TR 4JYZA 4HPWA 1IVSA 3X1MA 4EF6A 1O96B 3COVA 1N2BA 1EFVA 3FG9A 1EXDA 1J1ZA 1EFPA 4EFKA 2YY5A 1LI5A 4PBSA 3RK0A 5IJXA 4EGAA 1FYDA 2WQ7A 3PXUA 3GUZA 1T6XA 3KT6A 1JZQA 1R6XA 3LOQA 1XNJA 1J21A 1N2JA 4ZT3A 1BS2A 5DEOA 2PZ8A 4U8HA 2Z09A 1QRSA 3IUBA 1WOYA 3IH5A 3IOCA 3RBAA 1GZUA 1MAWA 4MVYA 4F3RA 1VBMA 1A8HA 4GU5A 1N2HA 2PFSA 4J75A 2GM3A 1FFYA 3AIIA 3NV7A 4YBRA 1TYDE 1K4KA 1M83A 2JAXA 1U3CA 1X6VA 3SZ3A 4MULA 1VL2A 3IVXA 3AG6A 3CLSD 4U63A 4XFDA 3FI0A 2E18A 3H99A 1M8PA 3CVWA 2IJGX 3X1JA 1KH3A 1F7UA 2DETA 1K92A 1OWNA 5H7XA 4MUJA 4MUGA 2QUIA 2O8VA 4DE5A 1OWMA 1KQNA 1F7VA 3IMEA 1TYAE 4K03A 4JFAA 3FWKA 3IMGA 2EL7A 3ELBA 3ZJTA 1GPMA 4U7JA 1EJ2A 4K0RA 1K97A 2CYBA 4MWBA 1VBKA 4NDAA 5TEVA 4G5YA 4MLPA 1PFWA 1ZH6A 1ILEA 2PZBA 4ZT2A 3ZJUA 5J58A 4MW5A 1YIAA 4JXZA 1D2RA 3MXTA 1KP2A 1H3EA 3IDFA 3FHJA 4R2LA 4NZPA 3TZLA 1U7DA 2D54A 3I05A 1IFXA 3COWA 4ARIA 4OUDA 5TS2A 4Q93A 2H2AA 1B6TA 4NAUA 1YIDA 3RHSA 1OWLA 1O96A 3TS1A 2EJCA 3IOEA 2V0GA 1IQ0A 3P0HA 1Q15A 3ILVA 4QRDA 3N2YA 2CYAA 2A86A 2WB2A 1IQRA 1KQPA 1OBCA 1TFUA 3AKZA 2IP1A 2PZAA 1OBHA 4ZCTA 1V47A 4CT0A 1J20A 1JMVA 4MUFA 1JEDA 4I6EA 4WNYA 1YI8A 1NUPA 3UK2A 4DNXA 4ZT4A 1ZUNA 3LE8A 1KAQA 1XNGA 3PRHA 4HJXA 1EE1A 1O5TA 3IVCA 2YXNA 2A1UB 1ULHA 2A4MA 5LM3A 1QQTA 3CLUD 3AL0C 1M1ZA 2G36A 2QJFA 4PY2A 3CLTD 2NZ2A 4G5FA 1JECA 3RFFA 5F23A 1O97C 1JIKA 4EG3A 5FO1A 3VGJA 1F4LA 1QTQA 1I6LA 5TEWA 2J09A 5HUJA 3SYTA 2DLCX 1QU3A 2X1LA 2CT8A 2B7LA 1H3FA 1TEZA 1OD6A 1J09A 1M8GA 4KR6A 1G8HA 4E1AA 1KAMA 1O0CA 3H97A 1N1DA 2JANA 1PG2A 1KH2A 2CFOA 2CUZA 3IUEA 1IHOA 1S4MA 3COZA 1JEEA 4R0NA 2YWCA 3IMCA 3LCJA 4DJAA 1KKUA 4PBTA 1EUQA 2AKEA 2DPLA 3TNJA 2TS1A 1GLNA 2DEUA 3CLRD 3N9IA 4MUNA 4TS1A 2Z3VA 4MUKA 2E89A 5DB4A 1NUTA 3Q12A 1I2DA 3UMVA 3CLUC 2QTRA 4MAFA 4EG8A 4ZT5A 2XRYA 2AZXA 3H9CA 2ZUEA 3CLTC 4ZCRA 4ZCQA 4MWCA 3ZXSA 1KP3A 4I6JA 1JILA 3HGMA 4XFJA 1JZSA 3H9BA 5KCMA 5KWVA 1QRUA 3H05A 4X0EA 4AS1A 1QRTA 4EG4A 3CVVA 1F9AA 3N05A 3GMIA 4DLPA 4MUIA 2A84A 1WZ2A 1TQ8A 2CYCA 1KORA 3SP1A 3MUEA 3AG5A 1R6UA 1Y42X 4DDKA 4MUHA 1WXIA 4P2BA 1H1TA 3UOWA 3IODA 3KT8A 1N3LA 1XJQA 4MWDA 2WSIA 2QUHA 2YWBA 1O94D 3CLRC 3QTBA 4G6ZA 4EG7A 1JIIA 1PG0A 1T6ZA 2A1UA 2J4DA 2PG3A 1G8GA 4BWVA 4QREA 2WQ6A 3HV0A 1WXEA 1O6BA 1NUUA 1J70A 4I6GA 1T9GS 1WJGA 3QTTA 3SDBA 3C8ZA 4DDHA 4R2MA 3VU8A 1O97D 1P7PA 4A91A 3L93A 3JXEA 4GRIA 1TYCA 3IOBA 2RD2A 4MVCA 3ND7A 4WSOA 1MC1A 1UFVA 3K32A 2X1MA 3RJZA 1PFYA 4MW0A 5KHAA 1MBZA 1N2IA 5H16A 4L2IB 1QU2A 1WXFA 5K0TA 3FH0A 1NZJA 3FDXA 3CA8A 4YMIA 2DR2A 2CV2A 4KKVA 3G5AA 2A1TS 2C5SA 3COYA 3SEZA 1ZH0A 1N75A 2QUKA 4EG1A 1X8XA 1MB9A 1R6TA 2PXHA 3FNRA 4CQNA 3RK1A 2CSXA 3NBAA 2I1LA 1O94C 1GN8A 3UC5A 1T6YA 4YP6A 3DLAA 2RE8A 1Q11A 1M8KA 4RUKA 3CVYA 1IQUA 4YP5A 1U7XA
chains in the Genus database with same CATH superfamily
1G5RA 4M46A 1SUAA 3LRTA 3VAYA 5ULLA 3OO1A 4EVQA 5CJPA 3T3EA 2LP4Y 3VPDA 1T0IA 3M34A 4RWEA 3O8DA 2BMWA 3Q11A 3IAM1 1ZGCA 4ZXPA 3SKVA 5C53B 1E2BA 4A03A 3F7MA 4YQZA 3O4VA 3SM3A 3NBFA 1DKLA 5DU2A 1FFAA 1OXMA 1J25A 3JRXA 3UA4A 5B30A 2I2XB 3E27A 3TG2A 1BOFA 4BC0A 1QO0A 1EAMA 4QXMA 1OLXB 3PUXA 4P3KA 1L7DA 2XBMA 3WK6A 4JUDX 2EW2A 3LQKA 2JLWA 1VJTA 2PX0A 2PRIA 4QJBA 4OHZA 3L77A 3A14A 5HZMA 2DWPA 5A04A 4F2HA 1LPPA 3ZJVA 5EMNA 2WINI 2CCGA 1NVAA 1VCNA 2H4WA 3F46A 1WEHA 2EDCA 3HSYA 3R6GA 3DZJA 1D5CA 4QIHA 2EHJA 1L7BA 2RCYA 5HKAA 3DOHA 3QU9A 2ID4A 4ZRNA 8GPBA 1QF6A 4DARA 3VNAA 4JBXA 3LNCA 4R2KA 3Q10A 4QXOA 1E1LA 3FZNA 2MINB 1A7JA 4CV1A 2RAVA 1R9NA 3FTNA 3WQRA 3VC3A 3M1YA 5AW5A 1ZESA 2F17A 3A04A 5AI4A 3AI7A 4K6MA 4WADA 4Y1RB 5FBWB 2AYXA 2G9RA 3KZMA 4JVSB 4TVOA 1GL7A 1U3GA 3NC0C 2NU6B 4ZZ3A 1RKXA 2M6RA 1EE9A 4LCJA 5HKKD 4RGVA 5CFQA 4U7GA 3TZKA 4DV2B 4QO8A 1GYQA 4WERA 2FMUA 2QMOA 5MN6A 2ZWOA 4E2WA 2PJRA 1V8FA 4O8ZA 1U7WA 3J81k 1S3GA 1BQ3A 3L2OB 4YPOA 2ORYA 3OOHA 4QFBA 3TK1A 3UWPA 4K46A 3ITDA 4WBSA 1DJNA 1M33A 1MV5A 1DPFA 5LDHA 1L7QA 2RHTA 1HA3A 3R7BA 5BPFA 4F86A 4UU0A 3TX6A 3E15A 2CLHB 3EARA 1COWA 3RC3A 4ESOA 1SURA 1Q7TA 2JCXA 5ALNA 1LX7A 3OEYA 4PGFA 3UANA 1PFUA 2POQX 2WF7A 3K09C 1N3IA 1GGFA 1NZDA 5F9HA 4Y0NA 2PKEA 3OIDA 2WYIA 5EE5B 2P2NA 5AHWA 3RJTA 1YAJA 1QF9A 2B5OA 1L1QA 1TO1E 2X0KA 2XHEA 2ZJZA 1AKUA 3A58B 3KXKA 1YCHA 1VIVA 4R01A 3GLIB 2WWVD 6CHYA 1OIWA 3RYCA 1EEXB 3RK4A 3TR5A 1YRWA 1RTKA 4EPVA 3BEDA 1CUEA 3C98A 2WWXA 4JOCA 4L9AA 3VZBA 4RTLA 2CNBA 1U0FA 1M2EA 2G9QA 3EGOA 4BNDA 5C4IA 3A4MA 1US8B 3NBMA 4MV4A 1Z06A 1KAEA 3AF5A 2HCFA 2UKDA 1V1RA 5C1OA 1PT5A 2OXRA 1KS2A 2FNAA 3R5SA 1WOMA 2XUPA 4OI2A 3V00A 5DGIA 4HDCA 4ACBA 4BB6A 4BX2A 5CVUA 2E4AA 2DMRA 4NZOA 3BXFA 4BQPA 3DBLB 5IYZF 2NV2B 2ZVDA 4XVCA 4MR8A 4KLAA 1U0JA 1SIBE 4B9AA 1YF3A 2PGNA 1Y34E 2IYVA 2A78A 4F9GA 4DDVA 3CRW1 2QAJA 3AERA 4OAPA 3M2PA 4ZT7A 3WWZA 3KPVA 1ORRA 2VZ0A 2E4ZA 2I6XA 4R4JA 1CD5A 1DI0A 1WDMA 2VH5R 4P31A 3U61B 2R7MA 4EGQA 1G7TA 2IUUA 4UPVA 1U0BB 1XGKA 2FRXA 4IGFA 3WVNA 4H0FA 3E81A 1M7HA 3H9UA 3JQGA 3W6NA 4BCDA 1FUYB 2OXEA 4NOJA 3LS2A 4E21A 3BZWA 1RP1A 3I04A 1J97A 1FY2A 1C8KA 1SZCA 1CS0B 3Q3EA 4QX6A 1NVTA 3BGDA 5I9TA 1CUZA 1AN9A 1A8QA 1JKXA 1JX6A 2EGGA 2FZKA 4ZEOA 2E4UA 4JOQA 3C4VA 4AZWA 1U8FO 3VI3B 1Q0SA 2WIKA 3CGGA 5K4AA 5HWSA 5K09A 2UVPB 3QPAA 3O7WA 2EVWX 3M6XA 4FIDA 5ICSA 3HCCA 2P68A 5ESDA 2O8DA 4X1KB 1SA0B 2HWUA 4I1YA 4IIFA 3IQXA 1Y33E 3M70A 4R1NA 2G17A 3KHUA 1WA5A 4L0CA 4EF5A 2XTNA 5B37A 4R1PA 1P60A 3IDOA 3GLIE 4MGKR 3CXUA 3AEUA 1K98A 1XKLA 1M0EA 3KOYA 121PA 3HGTA 1JHUA 1JHVA 3WAJA 1OXTA 2GWHA 4G8BA 1OB2A 1MJHA 1GPUA 1ZKDA 5FF9A 5J5AA 4Q37A 2ZXEA 3L1KA 2VHYA 3JYQA 3QLVC 3HKDA 7MDHA 3C3CA 1XAGA 3O91A 3VZQA 4NZNA 4ARZA 1EDOA 4G4SO 4J1TA 2OYCA 2FP4B 2G5TA 1DCKA 1KEWA 3AR5A 3DVQX 3QJGA 7AT1A 1I7SB 1MFPA 2RSLA 4D98A 5HK9A 4RK7A 3MM4A 2Q41A 5F2OA 1GNPA 5K6TA 4JJ7A 1E1RA 1NI3A 1PN3A 2AXQA 1CLEA 4BQOA 1N33B 4B3RB 1IXKA 2Q3HA 3A36A 3RKRA 3K4PA 2PGXA 4O1IA 5FUWA 1JQBA 2C7QA 1U6IA 3OZAA 4IIBA 3VR5H 2XLBA 1Y7TA 1YT5A 4FGSA 4RXUA 5C46F 4JT9A 4YK7A 2JB9A 3HP7A 5KQPA 3WK8A 4P22A 3FMPB 2HEIA 2PZ8A 2XAUA 1KE1A 1FSSA 2H63A 1E1KA 4Q9LA 1ESNA 1ZR4A 4HQKA 4JH0A 1P39A 1E5DA 1GOTA 1VBMA 4DHEA 2ECKA 4NQRA 4WDRA 3LWNA 4B3HA 4AKSA 1UC5B 1PL0A 1XXHB 3C2QA 2RFLA 4WBXC 4EZIA 4U7DA 5DX8A 2NACA 3NV7A 1XDGA 1Z4KA 2FX2A 3EXAA 2GD2A 3FDZB 1FFDA 3MJEA 2CXTA 1WZEA 4YNBA 5EQJB 3A1SA 3HDJA 4RA6B 5A3VA 2ZG6A 3BK2A 1IWOA 3LVRE 4ZQGA 5BQPA 5JECA 5A0VA 2VXCA 2E4WA 3E9DA 3GGPA 4MB0A 2KWIA 5C0OE 1ONBA 2HLHA 2XZDA 4A73A 3DQZA 2XUAA 4OBXA 5AFSA 2ZYRA 5ITVA 3ORSA 1FTWA 1FS6A 1QFJA 2OKGA 3LQRA 3PDWA 4MUGA 4W8HA 3SXUB 3MJDA 1XHLA 3UM9A 3EA4A 4DC1A 4L0DA 2OV8A 3HYTA 3DMTA 3D3WB 4R83A 3G17A 1CULC 4YAWA 3CB4A 1GZHB 3OX4A 2G7ZA 1AKWA 4C06A 4YQYA 4E4TA 4LXHA 3WV5A 1YTUA 4IGAA 2OXIA 2ODWA 1O6ZA 2OORA 1KETA 2ZFUA 4DOMA 3BE5A 1KMQA 3O7MA 1T6BY 2BFPA 3CZCA 1RQ7A 3NBUA 2L42A 5CVEA 3UT0A 5CIYA 4MR7B 1AXEA 3U2QA 5GV7A 5A4JA 1HG1A 3VNVA 3KVYA 4C2TA 5CHEA 3OOWA 1XDBA 2Q2QA 4FILA 1QTRA 4AQDA 3AYXB 4DC0A 3D4NA 3ZU4A 4R3WA 3C1UA 2VK2A 2EBUA 1L4NA 1Q92A 3CX6A 3AHCA 5B7GA 1IJEA 3PS9A 4MB2A 2ZCVA 3CX7A 4ZIRB 5BVGB 2ZRJA 1PJBA 3FCCA 3CUEF 4KBFA 4PPYA 3C7CB 3F6EX 5FORA 1SK9A 2H4JA 4LMRA 3EIEA 1ZOLA 3ANTA 5E6RA 3AF6A 1DG3A 3HGQA 4ZMBA 5KJ1A 3COWA 3KD2A 1LXCA 4F96A 5KS2A 1L5KA 3VR4A 2NQ8A 1QP7A 4BAGA 1I5RA 2XB2A 1TKCA 4XD7D 1FFXB 1XXHE 1GPNA 2VNSA 4GOXA 3TNFA 4MS4B 4E1VA 4F21A 3OCXA 3F49S 4X66B 2LVBA 4LFCB 10MHA 2EQBA 1JJAA 4X64B 2IZ5A 4HRAA 1G1AA 3EG5A 2WNSA 1ORDA 5D7NA 3PC4A 2QJWA 2OQIA 2WIJA 2XMQA 3AJ8A 2DWOA 3SGLA 1CR4A 2R1VB 4IFIA 2WB2A 1BMTA 1OBCA 4OP2A 4LOAA 4Q1CA 4WOKA 5FNVF 4BJ6A 1G18A 3ZQUA 3ZE9A 2IUSA 5M29A 1TCBA 3TLMA 2ODEA 4CV3A 1YR2A 4FDUA 3AX6A 1JEDA 2ZB2A 3EGVA 5ARBA 4AG5A 1HDEA 2HTEA 1D5WA 1YI8A 1NQWA 1T8UA 2WHPB 4EYEA 1CY0A 3L49A 3ODPA 4RDCA 4MGHA 5I4CA 1WW3A 2HXGA 1X1RA 5FA5A 3PA8A 5B1HA 3T7AA 3VDNB 3MNFA 3W2IA 1ZGBA 5TSDA 4S1WA 2G06A 1ZM2A 4JBHA 5I9SA 1B3BA 3HA5A 4IDBA 1FXSA 4IZ6A 1X1EA 4JI3B 4AXXA 1LD3A 2V4ZA 4XX1A 4Y98A 4M0DA 4KGDA 4IGIA 4KIWA 3E7DA 1D1PA 1I30A 4G0PA 5EIXA 2HHCA 3OQ6A 2I7VA 4P32A 4B3CA 4HFRA 5IEBA 3HXPA 4BX0A 3DC2A 3MEQA 1BMFA 1PTKA 4EUKA 2CZQA 2EKBA 1ZJ5A 2PKRA 3P5SA 3ZHZA 3P19A 4D8YA 4BMZA 2ZUBA 4C3UA 3H65A 4TTIA 1USUA 3GOHA 3LX5A 2A30A 3ZK9A 1KGDA 5K6RA 1YQXA 4L5CA 3KLNA 2GESA 3GV0A 3IHLA 4N5NA 1DC6A 3ZWOA 4IDGA 4Q1DA 4DIBA 2J59A 2J09A 3WL6A 3DFUA 4C0KA 3INTA 1M7GA 5CVVA 1XDDA 4FEYA 4PQGA 4GKVA 3DLTA 2C7VA 2I4OA 2OO3A 4EDFA 1CUHA 2VAWA 3VPSA 4C4XA 4D82A 2WAAA 3QITA 1RLTA 1LPSA 5EUQB 4BJ3A 2Q28A 5L7YA 1SUSA 1EG7A 3LQFA 2P75A 1E9VA 2YV5A 1G42A 4TMXA 4Y6QA 4WBNB 4RTQA 1DHTA 2F7SA 2OCKA 4A8PA 5ALTA 3A3OA 4HAIA 1HL3A 4P86A 3CIOA 3L7IA 1FU8A 3O9VA 4MV9A 3DS8A 3KUXA 4G5OA 1QHSA 4G26A 2ARKA 5GJWC 2WWHA 1JDVA 3AEZA 4V3CA 2OHOA 1ND5A 3A7DA 2K6GA 2OVFA 2VJNA 1HZJA 2BIFA 3GJ6A 3GBSA 1OZAA 2ZB3A 4FVTA 4PZ0A 4LVOA 4YP9A 2JBHA 4IZIA 4QFDA 4AYWA 4IYJA 4MV5A 2HMVA 4XOIA 1PR3A 4PGHA 3JAWA 5EZYA 1E7RA 4FU0A 4IIXA 4JI6B 4Z4HA 3H11B 1R8XA 1F7UA 2JCVA 2QNIA 2YS6A 2J4CA 2WU4A 4MAFA 4QULA 1Q6ZA 1M2KA 2Q29A 3E8XA 3HWWA 4Z9YA 5THKA 3RR2A 3PLAE 3JCZA 3GBPA 3F5DA 3B13B 4U7WA 1F0PA 3HS3A 3AY3A 1XHEA 4PLTA 1TOAA 3M6FA 3P2YA 3FMOB 3BREA 3W8NA 3E9NA 5AXBA 1WTCA 3BK1A 1C0LA 1BDIA 2DBQA 3KHKA 1HQYE 1QRUA 1U6KA 1A9ZA 4NCIA 4EHJA 2LW7A 2G1JA 4LGVA 4F2PA 1QMPA 3CNOA 1ZA2A 3MYRA 3K8ZA 2IVZA 5D1NA 2GEFA 5G3YA 5ILQA 2QM0A 3O9MA 5KYGA 1V2GA 2CYCA 2O9JA 2PU7A 1OW3B 5E1MA 1LTHR 1LQUA 2VZ9A 1FFSA 1QAQA 3RYFB 2C3OA 2G40A 1INLA 1C7RA 3B3FA 3BIOA 3ZWYA 2OG1A 4BUJA 4E5PA 3DLPX 5TDHA 4FJ1A 4MV1A 3L8EA 1XQXA 2H1IA 2ZRQA 3BRWD 3GXOA 3QLUA 4ZKDA 1XG5A 1H1TA 1JR6A 4J1TC 4AROA 5DN6D 3G1UA 2W6IA 3I83A 4EA9A 5KNBD 1PS9A 4TM8A 2UYYA 1AF7A 4ER3A 1SHZA 3FW1A 4WOBA 5B53A 1FS5A 2W6ZA 3S7TA 4FZVA 1IDN1 1XIVA 3KZVA 3UAWA 3QPCA 1X3SA 3UAZA 5JQGA 1AQLA 5J2UA 4BWVA 4JSYA 2DUNA 4W1QA 5AJYA 4KQFA 1ODCA 4FLEA 3I8SA 5JAIA 1VE1A 2QVZX 3PXBA 4UEQA 5B4UA 1EJ0A 2HA7A 4IQ8A 4LHWA 1T9GS 2QOEA 5H68A 4AC9A 5LYJF 1SVLA 2IP2A 1JF8A 1R1DA 1KZ6A 1RIIA 1SD1A 3E4DA 3KYBA 1PGPA 4RYLA 1H2XA 1RM4A 1XUOA 2HREA 2O7QA 3BS4A 3E3NA 3GZ4A 1Z5UA 4HQRA 2Z8YM 1CVLA 3Q8XB 4Q00A 4RKQA 4DKJA 3D8TA 3OIYA 1H8ED 5JZOA 3GAAA 1G64A 1NN5A 4FYIA 4GPBA 2G4LA 1RRVA 3K32A 4R68A 2MMGA 3UYLA 5BUZA 4WKBA 1YJ8A 3E9YA 2ZKIA 3FE2A 3OIGA 4DW8A 5FWXA 4F8YA 5KHAA 4LZAA 2JI9A 4X60A 4NCNA 4DCMA 3DE2X 3A9RA 3PC6A 4FGLA 5HCIA 1C3VA 1SO8A 3INYA 1DG9A 4RS4A 3RYIB 2XA1A 5AW6A 1NZJA 5TMPA 1RRGA 4FT4A 1NW4A 3QW2A 3U4DA 1CRQA 1VM6A 5DYYA 4CCAA 4IUCS 1BNCA 1RRMA 4BU0A 1R12A 1YS9A 4HN2A 4F7WA 2AJCA 4TS9A 2JFHA 1XJ5A 2Y1OA 3DMTC 3TQRA 1SUCA 1M3SA 1AS3A 3NBAA 3DO6A 3T1YB 2X9GA 4LHYA 4M21A 7MHTA 1ONPA 5DLPA 4PX2A 2OORC 1FF9A 1JDNA 3WLKX 2C29D 2FPPB 3R23A 3R24A 1AUPA 3I72A 1WXWA 1GG5A 1PJ4A 2SKCA 4NG4A 3W9SA 5I7UA 4YACA 2FW9A 1U1IA 4J07A 3ITEA 5C81A 2W0MA 1GPKA 2QTVA 6GPBA 1SKYB 3EZ7A 2PE5A 3LHSA 1RQGA 4FR0A 1SMKA 3T6KA 1PUXA 4GKKB 3A2LA 5EAIA 2HQBA 1STOA 2A4KA 1XVLA 4D74A 2IHNA 4YJFB 1U0EA 4FHCA 1CLUA 1QM5A 3CU5A 2JRCA 3D6HA 4KXNA 1O08A 5G0SA 4BQEA 2BI4A 2WIBA 4HB0A 5G2OA 1V8BA 4NF2A 2HN9A 1NV8A 4FGZA 2GN8A 3GVCA 4G0OA 2OY0A 2PIDA 1DC8A 3KCQA 3AKCA 2G3YA 4ZO7A 5K3FA 4BDTA 3UGKA 4AKGA 1IM5A 3AVPA 2ZSKA 4OX9B 4DV3B 3NEPX 4RZ3A 5KJFA 4TZKA 1RYHA 3B1XA 3CT4A 4TSFA 5FXMA 5JS2A 2JJ2D 3HBMA 3I32A 4FK8A 4IRMA 3WYEA 3LZ6A 3ODGA 2RJOA 2AR0A 4QU8A 1TRHA 3SS7X 4KZPA 1HX7A 2AA3A 2GBFA 3HBLA 4NBSA 1WZIA 3TRHA 4LCBA 1H5NA 3D0RA 4A27A 2FP3A 3GRZA 3PFWO 4KOAA 1NX9A 4PLWA 5CFOA 1T2VA 4RJ2A 3VMFA 4WBNF 3H5RA 3HR8A 4X71A 1OXSC 4IDNA 1GWNA 3T5TA 4GRAA 5M34A 1LV8A 4NFSA 2BLNA 2ZW9A 4Z9BA 3TLXA 3DTVA 3UAXA 1R2QA 4GLBA 1SZPA 5G3ZA 2B9VA 3IT3A 4ER5A 5J59A 4I4IA 4OA5A 2SKEA 4M38A 3FPEA 4AWAA 3FOCA 4ZGBA 16PKA 1WX1A 1FTGA 2ENWA 3LLSA 1BJKA 3K6JA 2A7XA 1TUBA 4AJLA 1ZITA 3MPUA 2REBA 3PITA 2JBAB 2WMNB 4WXYB 1PW5A 5TB5A 2J46A 1AY0A 4S05A 1GAWA 1EA7A 4MUXA 1JHQA 1XU9A 2A7QA 3ZGZA 1PUJA 1SKYE 4NX2A 4RF2A 2SKDA 3QBEA 4UHJA 2QIPA 1UM9A 4JJKA 3HRKA 2BM8A 4MITA 2MR6A 2Q99A 5HKLA 3CJQA 1N2GA 2BGJA 4JA0A 5IH7A 1ZJ4A 5LMZA 1G20B 3MOGA 4EA7A 3GJZA 2RG7A 3B1YA 1DAGA 4GOJA 5HOEA 5GTDA 3PZBA 2IEGA 1AXGA 4P7GA 4QBKA 2QWXA 3R74A 1HK7A 4GLJA 3A3YA 3R76A 1H3NA 3GPLA 4YUZA 2POCA 2MWMA 2WSBA 2YDYA 3PK0A 4EHIA 4FB4A 1CF4A 1RLIA 3ROKA 4P6VF 5CD9A 2VPZA 3O90A 4UZSA 5HIIA 1BH6A 1IK6A 1SC3A 2X6RA 1L4BA 4IHJA 2Y93A 2ZSEA 4DQDA 1P2UA 4HQLA 4UPDA 5FR2A 1FRQA 1UP6A 4XD2A 1K88A 3LC1O 4G5SA 2Z9BA 2Z6UA 3LWBA 3FHTA 1IPFA 1KY3A 4CG3A 1ZJJA 2BHSA 3EGXB 3K1TA 5KYXB 2E4VA 3QNUA 3N2NA 5K0SA 2BN4A 3THSA 1LSUA 2UV8A 5AXDA 2VRNA 1EZZA 3QVGA 2YWDA 4OL9A 3OZFA 4YHBA 3TLGB 3N1UA 4G07A 4CW7A 4X8LA 4W6QA 3GLKA 3LOPA 2ZJ2A 2BKVA 3VYWA 4PZ9A 4C6RA 1VDMA 4MUYA 5J4VA 4IIJA 4CT5A 2IZ0A 2EFCB 1RXSA 1UJMA 2XD9A 1L8LA 2YIDA 3BRCA 2B1GA 3GIDA 4MVJP 5J2TA 3GCDA 4MEBA 1CRZA 2Z08A 4LTDA 4ASUD 1AO0A 2QN3A 3ZKWA 1BVUA 4AJPA 2OT3B 3ZDQA 5DH9A 1YS4A 2PS0A 3CC8A 5KJCA 2HFKA 4P7JA 4YLEA 3FWPA 2BMVA 2XYPA 4RZIA 3QLUC 1Z35A 3KDSE 1X0VA 1DT3A 2HI0A 4QFMA 3C0KA 5CEJA 1G20E 4CM8B 4IWXA 1ZRNA 4Y2QA 5HIAA 3DLBA 5KMGA 4YRMA 4QD3A 3NTUA 4A2PA 3R3ZA 2HHHB 2DKFA 4XCXA 1UKZA 3IUYA 1SXGA 2W6MA 2H7YA 1GNQA 2VBFA 3FCAA 4ZCPA 1V0JA 3ZZTA 4RF5A 4UXJA 1E3JA 3UK1A 5K6AA 1JNXX 5LFAA 2A5YB 2DUWA 3UVEA 2P6OA 2FN8A 3GT7A 4HPWA 4CM4A 2CF5A 3FFWA 5BRNA 1ZC4A 4AJJA 5D3MA 1CUFA 4EF6A 1EFVA 2JI4A 3AUTA 2M6KA 3NKVA 1QK3A 3I01A 3IP6A 4MQEB 5LA6A 3IR6A 4LEIA 3HCNA 4NBLA 4ZVLA 3H5VA 2BTQA 6ABPA 5BN4B 4G0WA 5HA5A 4JI5B 1PR5A 3M4XA 3KT6A 1R5JA 3IALA 1YHYA 2P2LA 1Z3IX 3IQEA 5EMKA 1ZIOA 4AJEA 3LVBA 1IVYA 1ENZA 3O1HB 3WA6A 5JFTA 1J21A 3F7NA 4ITRC 1Z0KA 1TNDA 1W7AA 2V0NA 3HVRA 4GQIA 4DQVA 4GECA 2ZIFA 1Y63A 3AH8A 3LBYA 2EWWA 4MINA 5F3DA 3RJMA 1A1VA 2Q3JA 3ENKA 4FYMA 5HBRA 1C2YA 1GZUA 2OGWA 3IPLA 5FWDA 1FP7A 2Q7DA 4J75A 1RJGA 2RGXA 2B5VA 2YZ7A 3KQMA 3N76A 2CJXA 4OPMA 4IEFB 3ZV3A 4QUDA 5FEUA 2QN1A 3LBAA 4X7RA 4XQGA 4XGIA 1N8SA 1ZOSA 1DBVO 5I3CA 1TGVA 2WWRA 2XVAA 2WMOB 4KYUA 2DSNA 4N01A 4NJEB 5E7MA 2PS1A 5IBRA 3L7JA 5LXTA 1SOVA 3BOSA 1UMDB 2CMHA 4YGYA 3LLUA 3O8BA 4N7MA 2GM4A 3QVXA 4HWRA 1TKBA 1XTPA 4G0XA 4LRUA 4ZOLF 3LUJA 3O47A 3OX1A 4RKWA 3WMGA 3V1UA 4UC0A 3EPHA 4N82A 2CKMA 2R751 4O3MA 1L7VC 1Z15A 4E3WA 1KYIA 3V4PB 4CN9A 1G5PA 1XCBA 2WD7B 3K6SB 5CDFE 2OL4A 1P9WA 1FNDA 2X0DA 2JJMA 4MTCA 4EW3A 1FP1D 2PMEA 4D97A 3TLAA 2XDYA 1FFBA 3JVVA 2W8ZA 5BW5A 1W85B 3GJ3A 4A8TA 1VE6A 4BNIA 4D26A 3GHYA 4TL7A 4U7JA 1JQ5A 3NXSA 3NHAA 3JR3A 3OJOA 3DT8A 3TQFA 2VHXA 1VRWA 1L9XA 1B3RA 1E8DA 2ZSHA 1UAYA 3ZLJA 3I58A 4D0LB 2YW2A 4AY3A 4R05A 2RMKA 3ESRA 5SZHB 1KQGA 3AB7A 3O1LA 5FL3A 1JQ3A 4RIIA 5DTEA 5EL0A 2Z2XA 1C81A 4KNYA 3IXLA 5B3KA 3KFXA 4B84A 2OGTA 4JU9A 3RF6A 1DAHA 1MV8A 1YB1A 4GE0A 4RQBA 5BYBA 1BHQ1 2FPIB 2QP9X 3G1WA 1NDQA 3I05A 3DVRX 4OHCA 1CHDA 1FU4A 1ADFA 3O9ZA 1VYUA 2CNLA 3FAZA 4LY0A 5SYNA 3L5OA 1AQ6A 2BR5A 3UGTA 1XP8A 1R4NA 2J3JA 2IRWA 1K66A 5FOSA 1GM5A 2OD7A 2VRBA 1MX3A 2GERA 3BE8A 4IFBA 1O96A 1L5GB 2GJ8A 3HG7A 1TW2A 3E23A 1XEXA 3OEED 3QPDA 1SUBA 2X5KO 1T2DA 3OT5A 3P0HA 4L22A 2PGDA 4TKLA 3SYMA 1EK5A 1TC2A 3OE7A 6LDHA 4ND4A 3UFXB 5IKMA 4J0DA 3FZGA 3AEXA 1ZMXA 4K2AA 4OHXA 2P6RA 2YJ4A 5A4FS 4Q39A 4UHDA 3T1QA 5BN5A 1KI9A 1V47A 1JKJA 5EHIA 4BB9A 7REQB 1PT6A 1PJTA 1QIIA 4GC5A 4Q7MB 2G25A 2V54A 4M2LA 5FIUA 3VR5D 1ZSYA 5DV9A 5GOZA 1B93A 2H7XA 3GJXC 2ZI5A 3RIHA 2Y9PB 2V7QD 3MWKA 2B1IA 4Q05A 1VLJA 1Q2XA 2W9XA 1LLFA 1RYZA 2XQVA 4P9NA 3WGYA 1UXHA 5CFMA 3PHJA 2F3SA 1YA4A 3TLZA 2QYHA 1T3TA 3M81A 3AGQA 3QELA 1Y4SA 1T1IA 2YIJA 4YASA 5JXWA 3N2KB 1Y1PA 1ZMRA 5A3QA 2QT1A 3LC7O 1U5AA 4G2TA 3D7MA 1YCGA 4LX8A 5K0GA 2DKOA 2LXNA 3G3EA 2WP0A 3L18A 1F14A 5AI6A 3KTAA 3H4VA 4PY2A 3CLTD 4P84A 4ZK2A 5JAZA 4BFZA 5GZ1A 4IP0A 4RIFA 5D86A 4BZXA 4AJ4A 1JECA 4I14A 3W9YA 4OX9Y 2FETA 2YQ4A 2HBQA 3QW4B 1Z0DA 2EC5A 3NUZA 3WLSA 3WYDA 4RJTA 1MEJA 3E6AA 5FRDA 4DT1B 2QA5A 3L6UA 3QKTA 3KEFA 4BLSA 2OP1A 4PR3A 1W96A 3VR4H 1CNMA 3JQ7A 3QX8A 3V7NA 4UBIA 4PAOA 5L3RA 1M8GA 1SCQA 3EGCA 1FP6A 4ME6A 1SBZA 2QK4A 2RHGB 1TT5A 5T3UA 3CF6R 4E2FA 4FP9A 4HNHA 2ZTVA 3MIIA 4Y7DA 2Q5QA 3DFKA 4G8CA 3COZA 3LXMA 4ZREA 2XCUA 4H7EA 5ARDA 4PX5A 4QHYA 4KV7A 2IYEA 1F6DA 2DULA 4E4RA 1T5DX 3CNQS 3RWMB 3ZHOA 3KVRA 1K2VN 3GVXA 4KMSA 4MH0R 4RD1A 1JWLA 2IZOA 4A0FA 2QM7A 3EFOA 1T2AA 3BSYA 4EO4A 3ZNOA 3BSSA 4EGCB 1NLMA 2LPMA 1AK1A 4MUNA 4B7ZA 4A15A 2YWJA 1JYFA 1JL3A 1K5GA 1M1XB 2GFHA 2GTPA 2QVBA 2P2SA 3HNPA 3PE6A 4CU5A 5SZIA 4EARA 1OC2A 2WF5A 3HJAA 2GCOB 2R1TA 3L01A 4P7KA 2R47A 3DEIA 3I6YA 4WKOA 4U2GA 5GZ6A 3TDNA 4ZCRA 2X76A 4CKYA 1YJBA 3G2HA 1DEOA 2AJ8A 3AP2A 5IKPA 5L9AA 1SHKA 1BZYA 1UIRA 2VYCA 1JLSA 5P21A 3HGMA 1FMCA 2IYRA 4TYYA 3DB1A 1DO0A 3PQ5A 4KXXA 3DJFA 4YYZA 3S1LA 5CA0B 4EJSB 5AOBA 1MHPA 2QUBA 5EZ6B 3VAAA 1SOWA 3QJ5A 1U5BB 1XZCA 3L8ZA 3PBKA 4MVJD 1E59A 4DV7B 2B78A 1DBWA 1Y5LA 2QT9A 2ZREA 1DUSA 1Z9BA 1K7SN 3JASB 3PR3A 4BL5A 5IS2A 1B00A 3S2GA 2PBRA 3I5AA 4CR7A 3SP1A 2D2VA 4ZZ0A 5K6AC 2WZDA 1I7NA 3LIPA 2X0EA 2RONA 2VA9A 3P2JA 1FMJA 3R3HA 4KVFA 4L8YA 2YMLA 1I7LA 3KV3O 5I9MA 3KLPX 2YJNA 4GICA 4X8OA 1P31A 3IBFA 1UKYA 2ZAMA 4INOA 5EJGA 3RHTA 2BZ1A 1K8ZB 4LOKA 3VSBA 4POOA 1J5EB 3QOXA 3M6AA 4OMFG 2WSIA 3MMZA 2XKKA 2J3LA 1LLCA 3M5DA 1CV2A 3PU6A 3THWA 2GN0A 4G6ZA 1T6ZA 5ER6A 2CGEA 3M4YA 1Q22A 4J2OA 1KO1A 5ALPA 5C1IA 1BIFA 1U0SY 5I47A 1I5OA 4UTZA 4DM7A 1Z4LA 1PLLA 5HE8A 4HSEA 1LBSA 1RPZA 4DVJA 4DR7B 4ZJZA 1NN0A 4RQTA 3CURA 2C8VA 3KSRA 1UZAA 3RV3A 3G9ZA 1AQJA 2OBYA 4ZVPA 2ZUTA 1P5JA 4Q18A 3T3GA 3ADDA 1FTQA 3R5JA 2WMDA 1D1TA 1OC4A 3GEGA 4Y1FA 3WO1A 3ZE1B 2FE1A 2YBDA 5HDBB 4OMUA 4EFMA 3N8GA 3I2HA 2UUPA 4WH0A 3RFVA 4BMSA 1W88B 1ZNQO 4MCAA 1YMQA 1M6EX 4ZEVA 3F3SA 5DM70 4JNCA 1EX6A 3MJTA 4MW0A 1ISPA 4X90A 5IAEA 3TSWA 1GNLA 3OJ0A 3CNNA 3I34X 3OKPA 5JXGA 4MCIA 3MILA 3K0SA 1QU2A 3PNOA 3EQ8A 2C03A 2BCEA 4RDXA 5GM1A 2QZZA 1D9ZA 2XF8A 2Z5GA 3GP8A 1WPQA 3SEZA 1P5FA 4AMYA 4B3BA 1GCAA 2C4TA 2GVZC 4CR6A 3DAFA 4F6LA 5ADHA 4RXMA 1TTTA 4H4EA 2P77A 5KX5A 2AFHB 3T94A 3ZTWA 4ZHSA 3SQXA 1QLWA 1E4EA 2D3TA 3EVNA 1GN8A 2QKYA 3PVZA 1KS9A 1GDTA 2Z9DA 1UM8A 4NWIA 1R64A 1W0JD 5CAEB 5U4QA 4JC4A 5D87A 3NOOA 4XUCA 3SHWA 1NWCA 1CY2A 1PL6A 3PPXA 4GOLD 3MCTA 4BKMA 3MPOA 3ILXA 3FKSA 1YDMA 5EYPB 5GVSA 2C2YA 2DBRA 2P4EA 3I53A 5FI0B 1YVPA 5EUMA 3LCVB 2BGMA 3HB4X 2WPDA 3BWMA 1JUDA 1EBBA 4ALIA 2GUGA 2FR8A 3TQOA 2IX3A 1U28A 3C6BA 1FNCA 3ZLBA 4E03A 3NDRA 4PNZA 1VLHA 3WYGA 4MRPA 1JHPA 2DH5A 2PEYA 2N9UA 2NG1A 1BHSA 1WP4A 2IITA 4GI3A 4BOYA 2IEDA 1I14A 2W93A 4GZLA 3REGA 4OM8A 1VSTA 2GK3A 3OM9A 3GEHA 2FPWA 4OJKA 1V8ZA 3RAJA 3S1AB 5BQOA 2AJDA 3UA3A 2ZUCA 2DQZA 3UWDA 1ADBA 4YAGA 3S2SA 5KYNA 1N36B 4EELA 1CEYA 5HJ2A 1V71A 2W2TA 2YOFA 3KYDA 3UV7A 2AW3A 3HLTA 1DE0A 4FDLA 1JALA 3OQNA 5IKEA 2HA5A 5TLSA 1HE3A 3AT1A 5A3SA 3AYZB 3JQ6A 3WISA 3FPCA 5IX8A 2ZTLA 1VFPA 1SXIA 3QUSA 4K9SA 4X62B 4HHEA 1WG8A 3A4IA 1DPGA 3CLVA 3DM9B 5DBFA 3H2KA 2VHWA 3AW9A 2AFHE 4IDPA 1E1QD 2I3DA 2VSNA 4AWXA 4ZZ1A 4R9NA 4ROTA 3WJAA 4GR4A 3K16A 2UZAA 4Q21A 3OG9A 2ATEA 2DRIA 1YZGA 1DC7A 5I9IA 3PSHA 2ZYIA 1RWNA 4K2HA 2QE7D 2IS4A 4ITVA 3AINA 4P4SB 4L6AA 4JXKA 1DBSA 5DNDA 3QMWA 4R8LA 3RIEA 2PR2A 4RESA 1Y3DE 2R6AA 2VF7A 4MLCA 4GZ3A 5EIEA 1PU2A 2RGAA 4LDNA 1HTTA 3KAKA 1YXMA 1RC0A 2OKCA 3BJRA 3DTTA 4F91B 5ICGA 4H08A 4IZOA 4EB3A 1ZOPA 4PG6A 1AGYA 1QONA 3U3ZA 5IBQA 3TUZC 4C5BA 3FY4A 4M1ZA 1PIWA 2QTAA 2C7BA 3WGQA 1H4QA 3NDPA 4D5GA 2OZPA 5CA0F 2PA3A 4UBKA 2XYQA 2RGRA 4QBFA 1QGUA 2JIDA 3B82A 1VMAA 4RZUA 2IELA 5CG1A 2CE7A 1AHNA 1E4OA 4MW6A 3LRPA 4WMLA 4G0NA 3UJHA 2QY6A 1AB5A 3NVDA 2DPGA 2V03A 2XEXA 2EBHX 2VWQA 3IQDB 2G72A 4RY2A 2PRZA 4BNYA 3KPUA 1NQTA 4MPTA 4OB7A 3ZH2A 4R16A 4JQOA 3U7IA 1XCLA 4CIDA 1Y6QA 2E4XA 2HSDA 2IE8A 3OP1A 4E6EA 1S2IA 4A6EA 2O23A 4HVLA 4J0QA 2HH9A 4YRZA 3OF3A 2AXEA 1ZBQA 1MX5A 2F1OA 2X8LA 3HBNA 3N3BC 3EZLA 4GZ5A 3E1SA 2JF0A 3ES9A 3NKLA 1U8CB 5YASA 2ZJAA 3C6MA 2OGZA 2VO1A 5AK4A 5IJAA 5AMXA 1VLLA 2YX1A 1CNFA 3Q6NA 1CZKA 2VJOA 5TT1A 2N1MA 4CPDA 1NBOA 5JU6A 4JR0A 4TV8B 5EWLB 1IZ0A 1VSBA 2XF2A 4G65A 4PZZA 1IB0A 1D6JA 1FCJA 1GSOA 2D5AA 2O2ZA 2Y0DA 2JJYA 3JQ8A 5HG0A 4D8UA 1NHGA 2F3QA 4ZVRA 3HTXA 1FRVA 3V9AA 5DM60 2BYTA 5FDFA 1YQQA 1KSJA 1OWPA 4BJ5A 1VBNA 3MLEA 1MHTA 2Y76A 1UDXA 1RHQA 1U7ZA 4GPEA 1YR9A 2IEZA 4MV3A 5ED4A 3AJ9A 2CKDA 1G8JA 4KRXA 2FEPA 4NENA 4JEUA 4KFSA 3GLVA 2FYTA 1X1QA 1FVFA 1CBUA 2RHMA 4HDRA 1O0BA 4FEGA 3AF3A 4QUBA 5L6MB 3AM1A 4OH7A 1IHYA 2NSYA 1B15A 2Y1FA 3D6NB 3K35A 3I1YA 1Q7BA 2VPTA 3QF4A 4CLOB 3OUTA 2JH9A 4NU5A 2BKEA 2QT0A 4YV2A 4OKNA 4J6FA 1LF0A 3F9IA 3P2IA 1YULA 1Z7WA 3LW7A 4QWWA 5DHSA 4EB6A 5CT9A 3OFKA 3ISJA 4JLAA 4F4IA 4K9NA 4XPZA 4XSHA 4Y2SA 1LJUA 1YK0A 2EIXA 4CKCB 2JLYA 3EGDA 2FSGA 3G02A 2K87A 2V58A 3MTBA 5JS1A 4N0EA 3LC0A 2GARA 4YREA 2QG9A 2W11A 5C5CA 2JLXA 3GFRA 1G3UA 2H1SA 2FUG1 2NAFA 3FFBA 4D9KA 3QBDA 5FLKA 4Z4GA 1GR0A 1UBOS 2XB9A 3DZFA 1T1SA 1NVEA 4OM7A 2AN5A 3VU9A 3OOJA 3K70C 4G37A 1XVTA 4MVJE 4KP7A 4MCJA 1VLVA 5K8CA 4OQMA 1QS0A 1S7GA 5G4KB 5AW7A 1OGJA 5IM4F 5CM9C 1Z13A 3Q9LA 3TDMA 4PYRA 5CDTA 3FUXA 2ZJFA 1QO0D 1R6XA 3I6MA 3K8YA 4H7HA 4BNNA 4BRZA 5AVWA 4AY5A 2PSHA 4ZT3A 4IKEA 2W2LA 1SD2A 4Z2AA 2WYWA 3U7EB 4RFVA 4NFYA 4CHTA 1CQXA 2JIOA 1MGOA 1DWPA 2K2WA 2GN2A 3V5NA 4H3VA 5TQ0B 1E94E 4KJXA 3EMDA 1C7JA 1A9SA 1XV5A 2BHLA 1GUFA 2JI7A 1QG0A 3FR7A 4FR5A 1T4CB 4M0LA 4YEDA 2PUHA 3PNQA 1K4KA 2ZDQA 2OB1A 2JAXA 4HAOA 2X0IA 2Y4OA 2FEAA 2IHYA 3HWSA 4BPBA 4QLOA 4KI0A 3K9GA 4HGOA 1D04A 2I4TA 3AUFA 2HBZA 3E8MA 2YHIA 3PCXA 1UZLA 3PXDA 2IXEA 1YKFA 2NWQA 4DABA 2NMVA 2AD5A 5EP2A 4ZYTA 3RFUA 1ZONA 4B45A 3L8FA 3VA7A 4ZYUA 5H7XA 1BU5A 2P2GA 4WX2B 4IDQA 4DDWA 3EPKA 4KODA 2P4QA 5JHHB 1CZOA 2FR8C 1AUVA 4A5SA 4RQUA 2H16A 4PRKA 1U28C 3P7MA 5DNUA 3AEQB 1NDHA 3TPCA 3EPPA 4LG1A 5I5EA 4O4IA 4QPNA 3J81A 3S2UA 1EIZA 2W6PA 2CUTA 4NDAA 2L19A 1U0LA 5B4VA 2EERA 2QTLA 3NU1A 4OF4A 3P26A 4CTNA 2F8SA 4GSKA 2UXDB 1XXLA 1IUNA 1DJOA 2QM8A 3NFYA 5F98A 4JB2A 3R9IA 4Q6WA 4ISCA 1CYEA 4G24A 4Q4HA 1COWD 2IYLD 3TD2A 1EGAA 2BGRA 2R9VA 3TMAA 2V7UA 2EX0A 2QF7A 3KXIA 2GNPA 1SKBA 2HIHA 2YXDA 3DMDA 3DEHA 3L8DA 1GTL1 1MQAA 2VNKA 3PXXA 4U2BA 3ZHSA 1LB1B 4UU1A 5FUQA 1DP4A 1PJAA 2Z04A 3BN3A 1IE3A 3MWFA 4M89A 4ZOEA 3X43A 3GFOA 3WFJA 2MIIA 4J4HA 2XDWA 3DBVO 3DV0B 4L4YA 5HTKA 5JAMA 3QXSA 2HJRA 1P8JA 1L4GA 4OXXA 2WD9A 1GYPA 2ZIEA 5TS2A 1QIEA 5EPOA 3UIEA 5AKYA 5JH7A 3TUJC 1XA3A 1RQPA 2Q6OA 5ICEA 1C0KA 1L7PA 2Y67A 3MQFA 4DXHA 4U02A 2JAPA 3DZBA 3IQFA 1PL8A 1SVKA 3V8RA 1VBFA 3VO1A 3L8HA 1WW2A 2M1ZA 4FCWA 5CX4A 4KG7A 4QRDA 3TDKA 3HCRA 4KQ9A 1NSTA 2OCYC 2JHCA 2PJZA 2QX6A 3PPWA 3FHCB 1J99A 4JJAA 4P81A 2ZYSA 4C07A 3KZCA 3FA2A 1VJGA 1XBTA 1E9FA 4BN5A 4RJKA 4TV8F 1LY1A 1MT3A 5ILOA 1V11B 1D4FA 3DBHB 4OHRA 2WIDA 2XCIA 1YHNA 4XWKA 4XYGA 3V4LA 4HMQA 2E85A 3W2FA 1WVGA 4D6PA 4ZXFA 2XKBA 3CBQA 3EWNA 3TSCA 4FCCA 2EKLA 1RT9A 2GPNA 2GPBA 3AETB 1J2YA 1XRMA 3V3TA 3L7LA 2G8LA 4OHPA 1T0JB 1LDYA 4MOWA 5IMBA 2QVXX 2Z2JA 1YVEI 1FOEB 3BB1A 3F96A 1X1AA 4WNCA 3RUCA 3H1FA 1UXIA 3BF8A 3M8KA 4FYYA 3T7KA 6NULA 1NW6A 2Z2KA 1A9YA 4C0QC 4Z4QA 1U1CA 4QSMA 4HWPA 3PQ7A 5F12A 3L6OO 4BB5A 1U9ZA 3GDWA 2JASA 3A7EA 3EYAA 1IULA 3Q5DA 5AJVB 1ACJA 3BWVA 3OI7A 3D5EA 4WPGA 3U9TA 1N5KA 2ORVA 2D8AA 1ODIA 4H6WA 1GL6A 5AKIA 1CQJA 3IKLA 1DINA 4J7XA 4YRDA 1YGPA 1Z73A 3LRXA 4A8JA 1QDEA 4JK3A 3SHTA 3ECCA 1TKAA 3CKYA 3LSTA 4KQHA 3K4HA 2W4IA 4L8LA 2ZE6A 1UFQA 1KPHA 4FBLA 4G4GA 1U8TA 1V6SA 5G1PA 1MKYA 4PC6A 1XFDA 1N6NA 2ODNA 2QTTA 2P6UA 1KIMA 2V7WA 3IHTA 3ER8A 1T3ZA 2JG3A 2MYNA 2LGJA 3SSMA 1P2GA 5JARA 3O8OB 3N0TA 1IQPA 4JIGA 2GD0A 4G84A 4JGBA 1BH2A 3L79A 1TDJA 5U1PA 3T95A 3HJBA 5IF3A 2BR3A 1KQFA 2DUUA 3V2IA 3CUKA 3A4TA 3FVQA 4LWZA 3T35A 5BXYA 3V6MA 4A9AA 3FWZA 4Q7QA 5B2ZA 3LP8A 1O1YA 3AHFA 4KDRA 4JQSA 2VCHA 3RUIA 2NO5A 4AZSA 4G0UA 3NTRA 1E32A 4XJXA 1L2TA 4YIKA 1WHSA 2QTRA 3UG6A 3B7PA 4P0TA 3KQNA 1K08A 1I2MA 3PDHA 4ZCQA 1RXYA 2CVOA 3MOSA 3ROXA 2B30A 2DGDA 4D8XA 5DWDA 1TZBA 1PYDA 3G5UA 3TSZA 4JB3A 4UUBA 2ZOSA 1U0TA 2PK3A 1SHUX 3G5LA 2NYRA 3MMSA 3KOUA 4L75A 4N7JA 4NV1A 1DXQA 4UM5A 5CW1A 4R71A 3QEBZ 1V95A 3GMIA 3KSDO 2D2FA 3WJ2A 1YS7A 2ZIVB 3E5MA 3KB8A 1RRKA 5CFZA 2P9FA 3V32A 1WZ2A 5C35A 3H2JA 1HLFA 3GRRA 3L6BA 4CMJA 4QTXA 2V7PA 3OOSA 4JVNA 1SKMA 4ZEXA 3G0BA 3MUEA 8MHTA 2ZZMA 3LF2A 3JQ9A 4HS9A 3AF4A 3ABRB 1H23A 1T10A 1YA8A 3D6MA 1Z47A 2ZBPA 4BO6A 3GO4A 3UOWA 2AMJA 2OAP1 3NHJA 3BBPA 1CY7A 2KE5A 1PCXA 2GKGA 4WLEA 4NE2A 1TVCA 2Z2IA 1B0ZA 2XY4A 3Q0IA 3TBKA 4F1WA 2CLKB 5AKLA 2PH5A 3CPJB 3V7YA 2VZLA 3CLRC 2ACVA 3OCCA 2XADA 2CFCA 2I22A 3MC1A 1E9CA 1C30A 1ZH8A 2PNFA 3PYLA 4J1SA 4RADA 3C5HA 4BFTA 3WGIA 2WQ6A 1U5CA 2E2WA 3R0XA 3A06A 3AR8A 3CJRA 2C3PA 1WXEA 3T3IA 1NUUA 3NRCA 2J5KA 5DSTA 3CKKA 5JTUA 4XTRA 2Q27A 3SDBA 1XZQA 1F6BA 3RF7A 1UQUA 1Y6FA 4ZARA 4Z7NB 2IHTA 3SSAA 4CKXA 2NOAA 3I6IA 5E4TA 2ZBQA 3L93A 3LFHA 1KMIY 4JB0A 1ZK0A 2LCIA 2QSUA 3C7AA 4L27A 4LSGA 3UMBA 2VJDA 3UKJA 4YUYA 1PJRA 4C05A 4NCAA 5JS6A 4HY3A 1QFZA 2BJWA 1PFYA 2YL2A 3FSGA 4AMVA 4OAQA 2X23A 3GLTA 4MWOA 2XUOA 5ESXA 3BFPA 1J0DA 4GBED 3AI1A 1AX9A 1QG6A 3I37X 2BF7A 4KBGA 3G5AA 4MARA 3GJ0A 4TS3A 4GVXA 2NLOA 1UZUA 4AUNA 4EG1A 3MT7A 1JWBB 1XTTA 1XU4A 4UNPA 5AQ1A 4C1BA 4NYJQ 2OILA 4R84A 1FX0A 1KIFA 3D6JA 3L8YA 1RSZA 2R87A 4WXMA 6REQA 4B79A 2XUIA 3FFAA 4XQCA 2Z9CA 4C2BA 1IL0A 2YHAA 2EJBA 1UWVA 1Z4NA 3RYCB 4D25A 3B51X 3RM3A 2B98A 4XKJA 3ZBPA 1ZMTA 5L45A 1Z5WA 3D3QA 1MJGM 1G16A 2NVOA 5H83A 3PDIA 4BNDB 1TMGE 3ENWA 2JFWA 2ZXUA 1EQAA 2N3ZA 4PAMA 3KLOA 4DEVA 1T2FA 4ZQIA 3ROQA 1X9HA 1V1RB 3ER6A 3JVIA 1BGVA 1EUYA 4UNNA 3SE0A 5AW2A 5JMOA 3PIRA 1NQOA 1E9AA 3PUVA 3VBEA 4G1FA 3A3NA 2D1RA 3S44A 3ZNPA 2Y1LA 3DKRA 1LBTA 5J63A 2HX1A 3CH5A 4L3OA 3TRJA 1Z0UA 1UBTS 1GEGA 4FS8A 2P6MA 4MR8B 1IZZA 4N8DA 5AHOA 2ONYA 5ESRA 1BDBA 5KAMA 1GV1A 1HKHA 4FD3A 4IHQA 2ZP1A 4RDHA 4I99A 5HE9A 2CNWD 3AERB 1A71A 4OK6A 3UAVA 3UHJA 3EZ6A 1BMFD 2VXBA 1H9AA 1BDMA 2YFYA 4DY4A 5EJ6A 2OGSA 1G59A 1DKNA 2P27A 4EYGA 1POWA 1P2FA 4HXGA 5F1YA 3JPWA 3WWYA 5AD1A 1FIUA 2XCTB 1OE0A 4E7PA 3JQGB 1II8A 2HJSA 2FWBA 2XGMA 1SKAA 2PUAA 3A1VA 2O2JA 3JAKA 1K86A 2P3QA 2V55B 4RA9A 4DJFC 3WMRA 4Q19A 1JAXA 2GN1A 4ZYZA 1X1BA 4PLZA 2QD4A 3S6JA 3CR7A 1MOPA 6YASA 2WWFA 1MN6A 1L5MA 2P35A 1W5FA 3AOEA 3QXCA 4B34A 4U8GA 4BNZA 1RWQA 2CBGA 2O8DB 3HL4A 2A5JA 3AIOA 1OI2A 1VB3A 1E0SA 2FLVA 4P5DA 4N0QA 5E2AA 5LUAA 3FZQA 2WM8A 5HQJA 4EIWA 4PYQA 1TUIA 3HMQA 3R5HA 1E3DA 4UBNA 1VHQA 3AEUB 1FUKA 1C4KA 5FFNA 3HFJA 4BNFA 3ERCA 4OYHA 1VL5A 4IQGA 1JHDA 1IRXA 1S9HA 2ZZNA 2XXJA 2C54A 1I0IA 4J16A 4QDZA 1LW6E 5ICFA 2FEOA 2BP7A 2EKQA 4XYLA 4K88A 3KXLA 4DTIA 4F5YA 1SBYA 2FZLA 3HCPA 5JNWA 2DXIA 2XQJA 1YUMA 3DFMA 3UPDA 2R8OA 4ARZB 1YK1A 3QMVA 5L3SA 1B2LA 4A8JC 5H80A 5CEFA 3VHQA 1RMQA 2JNWA 4U2KA 4UHKA 4LOJA 1F51E 3KHTA 4HVAA 5GAJA 1Y1QA 3OP4A 1T3SA 4R51A 2UZ3A 4O4JA 2UAGA 5CT4A 3K53A 2FOIA 5C8DA 1YZKA 2Z4TA 1A88A 1U3TA 2DHCA 2H85A 1Q50A 3BHIA 4I1SA 3ELWA 4QG7A 3KSAC 2KLHA 1I4OA 4MMXB 4G56A 3W90A 1R66A 1F06A 4ZYLA 4N7RA 4NH0A 3EVGA 1TT7A 4W1PA 4CEHA 1VG0B 2C07A 3NBYC 3N2EA 4RMJA 1E62A 2MCFA 1JN0A 2FJPA 3WL7A 4YYEA 1HT1E 3MB5A 1TAUA 4IJKA 4KUGA 1AQNA 1N8KA 1TJYA 4KXQA 4OSOA 1MXHA 5D3KA 2G88A 4EHAA 3QI7A 2W6ID 1W94A 1EUCB 3UK0A 4XIJA 1Z28A 2OCLA 3IJEB 4GMGA 1PV4A 4ZO9A 1OI3A 1E2QA 5CDHA 5HFJA 5JISA 3L07A 2CNNA 4JLOA 4QNMA 4IDCA 4FWBA 2EU8A 5EGNA 1S2MA 2H29A 4ZAYA 2PSJA 3GCZA 3GFBA 1XU7A 1ZK2A 4B5KA 2VTBA 2V4MA 1P5ZB 5F21A 4X6UA 3ZD9A 2E49A 5E3JA 5TR9A 1K0UA 1UOQA 4FTWA 1UXKA 1KQOA 4X54A 1HEYA 2I6TA 1DJQA 1V9LA 1EDBA 2ZTHA 4I5EA 4PSDA 1W75A 4WT7A 5BWCA 2C1ZA 3L7CA 1Z36A 4R69A 3VPHA 3H2BA 3W2GA 3L7YA 1UKBA 2EQAA 2DPXA 3O2JA 1J9EA 3CUYA 5TGDA 5BMOA 2QR2A 2WABA 5FTWA 5I7FA 1LCIA 1OFUX 3NORA 2VHJA 1NUSA 3JZDA 1EGMB 3I45A 4JBNA 4Y9TA 2MYPA 3A2NA 1Z0FA 3LT1A 4Y2HA 5JW6A 3RVPA 3HXTA 4N7BA 2OZKA 4DVGA 4WLUA 4BLRA 1C0IA 3C5CA 5I7AA 4YAFA 3R75A 4K9RA 5B1YA 2O50A 3AR2A 3PL5A 2DB3A 1KRHA 2JKVA 1XCPA 4WVFA 1DC3A 5TE9A 4WY8A 1I3OA 4YT4A 2QUZA 4OHWA 3RWBA 1G38A 4E31A 4TVKA 3S5JA 3FTDA 3JQ9C 2O3UA 2GUWA 2GXUA 4RKYA 4X93A 1CDZA 1ZM9A 4YT5A 2COKA 4KFUA 2IYXA 4FOTA 4KQJA 3RIYA 4GRDA 1JKMA 4V24A 3U80A 1KC3A 4EJMA 5EE3A 3S5UA 3DFFA 3PZRA 4F4JA 2FEKA 2NUAA 2V3WA 1ANKA 3V2GA 3MSCA 3L3BA 4GPAA 4PC7A 2QU8A 4A3SA 3HV2A 2EX1A 5E6RB 4D41A 1T8YA 2H59A 2F1HA 2QLBA 1NC3A 1NLUA 1ZK3A 1B74A 1TYZA 3PJRA 2VRCA 1UK8A 1G8YA 4OLJA 1F5SA 1TX4B 4RNCA 3T5MA 1MC5A 1YOVA 1G9SA 3RT1A 8ATCA 2GCIA 2OPBA 2LDXA 2R6FA 1SU6A 1Y8ZA 2PGAA 4X6YA 3TKYA 1U0OC 2PZEA 4TYMA 1EFPA 2EP7A 3ZHXA 1T4GA 4JJGA 1CY6A 4XARA 4DIFA 3IAM6 3JWIA 4M55A 3L0SA 3FHOA 3AKDA 3VU1A 5DYNA 2DQSA 1EVYA 4JSRA 1DXOA 4Y0VA 5BVHB 2CJWA 3TBFA 1M73E 5A5DA 2XMBA 3U60B 1PEKE 4Z0TA 5AW9A 3YASA 3FI9A 1E7WA 2SNIE 1H2RS 4IYRA 1M10A 2HDWA 3ICEA 4RH1A 4NAVA 2KBEA 1L5WA 3DULA 4I8IA 2CW5A 1ABEA 3E7FA 1T5OA 1O03A 1PR0A 3CEAA 4JLWA 3V2UA 3RD5A 4DGQA 2OFFA 3BTUA 5BRJA 1KL7A 2PFSA 3RUHA 4OL0A 3CSDA 5KEIA 3J7AC 3OZBA 3P0FA 1VDZA 2GM3A 1U9IA 3OIWA 5LZ2A 1SPXA 4BFVA 4O29A 3UMSA 3F9CA 1MABA 4TSFD 4XWGA 1M83A 1Y7PA 1T1EA 3P9KA 3C70A 4QWMA 4YJGB 3X3HA 5JATA 1VE3A 1R9JA 1ZZGA 3ROMA 1K7CA 2F3PA 1L5NA 3M9WA 4AKHA 2A5LA 1MC4A 1BXGA 1L0BA 5FTNA 1KDPA 4JUBA 4ND5A 3VZCA 4LV8B 2XZPA 4AM8A 1NPTO 1JKFA 1M8PA 1OXKB 3OT1A 3JZAA 1KH3A 4FOPA 5SY9A 2CVHA 4Q3EA 2VR1A 3I9LA 2CLSA 2NTYC 3VNBA 1C3JA 2C31A 3I62A 1ZGGA 1F7VA 2IGBA 2BCGY 3Q0EA 3BFVA 3QPVA 1Q91A 4HDMA 4P4TA 1LX6A 2OBMA 3ELBA 2H0RA 3STHA 1FLVA 3D5TA 5JUWA 4LBVA 1P0CA 4UUAA 3ZJTA 1S0UA 2C9OA 4M4SA 5DOZA 1GGVA 1G5QA 4RVGA 4RVDA 1TZCA 9ATCA 2V7XA 3TVDA 2VPQA 4IL5A 2X22A 3PEFA 4PZUA 4RPGA 2VNIA 3MRVA 3ZJUA 4IIDA 3PXGA 3PF9A 1EFTA 3NP7A 1JR4A 2V59A 1E2EA 5JASA 3MXTA 2PZJA 1WMDA 3EVEA 1MLDA 4CQLA 3RS9A 1X14A 3BD7A 1VOTA 3ED5A 1KK3A 3EEQA 4K8OA 5EOVA 1EGHA 2VHCA 3GGOA 2YZKA 3FR8A 5MHTA 2B8TA 2I34A 3GJ8A 3IPRA 2IHJA 4GMXA 1DWOA 2XT6A 2R84A 4YDRA 1FPMA 3HRHA 1XNQB 3WMWA 1KGSA 4EPWA 4YAEA 5EZYB 5BY2A 2PX2A 4RD3A 1VMKA 3CZ9A 3AOEC 4J0IA 3OT4A 4B8WA 3PLNA 2A57A 2AOXA 1KI8A 3PQ8A 3KQTA 2VUIB 3LUDA 4JSTA 4KW7A 2F9FA 2HL6A 3T8YA 2CYAA 1YE5A 2EYQA 2VSYA 3V1MA 4MXDA 5EJIA 1U3UA 4Z1OA 5A7FA 4TWBA 4PHCA 3R4CA 4B74A 1OBHA 1QQ5A 3E9MA 3ZDEA 5IJZA 5CCXA 3RG2A 1W4CA 1XMOB 3BD8A 1KMMA 4J16C 1ZJ6A 1JMVA 3AR7A 3FPFA 3QBVA 4ZDKA 5F9FA 1D8AA 3FVTA 1IEXA 4ESHA 3NR2A 3U3OA 3ZD7A 3ADPA 1LF5A 3HN7A 2O48X 3KLBA 2FRVA 5AW1A 2HXSA 4GYKA 4M1OA 1JFLA 3C1OA 4LA4A 2JGMA 3DZDA 2A92A 4JC8A 4K9OA 1BXRB 3WV4A 2L17A 3BIWA 2TMGA 1E2IA 1E5QA 5DULA 3A0RB 2VJAA 3MJCA 2GHIA 4DLKA 2EBWA 1EE1A 5JQGB 1ZRHA 1C3XA 1P4GA 5J2UB 3EZNA 3EXG1 3SNHA 5EKXA 1JBKA 3H2SA 1CS4C 5BNFA 3SVLA 4PVDA 3U44A 2AUNA 3GMDA 4JD5A 1YDFA 1OI4A 4L85A 5FBKA 2J30A 3AB8A 3RWOA 1YDGA 3L1VA 3CEMA 4KQMA 3AU9A 2X3UA 3Q3JB 1TQDA 4QDKA 3DUFA 3RQIA 4V0QA 2NU7A 1YJAA 5ED0A 1OXVA 1Z16A 1J22A 1RM5A 3WWPA 1HOTA 5BT8A 2D0DA 4I3HA 3Q41A 3H5TA 2VUUA 2WKRA 1N5JA 2GAAA 3AHHA 2FUKA 4RVOA 2YVKA 4J8PA 1QTNA 3I2KA 2HOQA 3K0AA 4WFKA 5CIWA 5AJXA 2BF4A 3GJ5A 4R2HA 3W0LB 4DQ0A 5I7EA 1TEZA 2E5LB 1IZ7A 1EVKA 5FWXB 2TSYB 3QVTA 1QKKA 1APBA 2XE6A 2UYOA 4JJIA 3MCAA 3U5TA 2J9GA 4PSAA 2I7TA 1O0CA 1GUBA 3HMKA 2AJTA 4DCNA 4Y0AA 4I1PA 1GXSA 1XL0A 3A6EA 5JXJA 4EHNA 2P3OA 3B70A 4OAOA 3UWSA 1T3GA 2P1RA 4HATA 5EFZA 2I2WA 1KKUA 2QSYA 1CIJA 3H2HA 5LKAA 1LNZA 4N6OA 1QV7A 4WJLA 3EXHA 4HB4A 3LYAA 4UBJA 5DX1A 3F73A 2AFRA 4F3TA 1EDZA 3QXJA 3DOUA 3QFCA 4H4DA 4IJWA 1DX6A 2XXAB 2X2OA 1CVIA 1I3KA 3KUDA 3QKRA 5CNJA 2ATXA 4BNXA 4NV0A 4W5QA 3G0CA 3KVNA 3ESDA 3QP9A 4OCZA 4Q9IA 5DCWA 2FPUA 1ODTC 1Z2DA 5ES4B 4EG8A 2G1PA 4H1HA 2B2XA 4RYDA 5L6LB 4EHBA 2AZXA 2VDWA 3OMLA 2NZVG 1EIWA 5FBZA 4M9SA 3C7DB 4R5MA 3H9BA 4JEHA 3OU7A 3G0IA 1FSPA 2QTVB 2HBYA 3RNOA 1K7FB 1PZMA 4X63A 4Q4JA 2E6KA 3BT7A 2CMFA 3GYBA 4GC9A 5K0BA 4QJIA 4KK4A 5F73A 1VKNA 2HADA 2EEPA 4WDQA 2A84A 4BQFA 3ZLVA 3GJYA 4KHZA 1VIMA 3QBTA 1F1BA 3QIAA 1M0WA 1IUPA 1KPGA 1CR1A 1YU9A 2LKDA 2ZB8A 3I1IA 3LA8A 4G0QA 4LZNA 2YV4A 5KVQA 5GIOE 1W93A 3T7CA 4HYTA 3AP1A 3GGJA 1KO8A 1LBQA 4NULA 5K3FB 4I4TA 4HYQA 1ZD9A 5I8WA 3T61A 1JLRA 1QYCA 3AQ4A 3R5XA 3C8HA 1C7EA 2ZUDA 1N3LA 3GP5A 4DLXA 4HAXA 3HEBA 3OLCX 3ZD8A 1F2VA 2C2BA 2FN3A 3B78A 1FFHA 1CP2A 2YFHA 3KZKA 4GFDA 4Y6RA 2JCBA 4ATNA 4MYRA 1RPNA 3KQOA 1DQPA 3ONNA 4LQLA 3A1DA 1QYRA 4R1LA 5C4MA 1T2NA 1RWVA 2RH5A 1BE0A 4O2AB 4R1UA 4WUTA 2R66A 5EWMA 3LV8A 4C29A 2G7MC 2WFMA 1XT6A 1VYVA 2E4YA 4MB6A 3SQNA 3O4IA 1U1DA 2XYGA 2HSGA 4HN4B 3BKWA 1XTIA 1MOSA 1TVKA 1U9IC 1E1CB 3C8UA 2H1OA 3MTJA 3PWKA 4UUOA 4TKMA 2RGEA 4I4NA 4JLUA 3B8EA 3EIFA 3SIXA 3U0BA 3G23A 1C50A 1OLXA 4HNRA 1QR2A 2PMDA 1TUBB 2C97A 3X1YA 4BC1A 5ALIA 5EZYF 2RI6A 3VDXA 1P1CA 1FVXA 3UB3A 5JAHA 3PRJA 4KSCA 4KFTA 2PIAA 3G2JA 5IP5A 3FDXA 1SH7A 3EW9A 5IXYA 1EVQA 2ACEA 2LCQA 1VQ1A 4GWGA 4ENVA 2YS7A 2A5DA 3NPAA 3BMCA 2PMKA 1UM9B 3DKPA 4ODIA 1SELA 2OAGA 2IT1A 1PK8A 2R44A 4H0CA 4CTJA 3KU1A 1L7NA 3BAFA 5TVGA 1X7ZA 2HK6A 3OE7D 4OIMA 3NAGA 1UPCA 3I0NA 1PHRA 1PWYE 2D0OB 4MMZB 2IXTA 3DCYA 3RRNA 3TZ6A 3UC5A 3ID6C 1B0PA 1SBNE 2BD0A 2GNOA 4BS9A 5EIHA 3B9QA 4HSGA 2Y05A 4C30A 1A5AB 2AI1A 3NKFA 3T5GA 2BW0A 5K3EA 4S1OA 3WL8A 1B6GA 4EK9A 2G9VA 2FPSA 3PRKE 1V41E 4KR2A 1R6DA 4F11A 4M22A 3VHRA 1F8GA 2R7AA 4HZIA 4IHJB 1AUOA 3A9WA 4B2IA 5KHLB 3D1JA 3CR3C 5KTOA 4EBBA 3WZ2A 2R6DA 2GAIA 2OCGA 2O7SA 4D4LA 4QKQA 1CDOA 4XB2A 2AEJA 2CMGA 4G9GA 5JQGF 4XCVA 3ST7A 3SJBA 1GDDA 1SCNE 4M1TA 2ECQA 5J2UF 4WUVA 4I9NA 3S8YA 3DA8A 1Z2CA 1NC1A 3HA7A 4H7JA 4Z2YA 3SF0A 1QLJA 3QVGB 1C1XA 1KJNA 1JDSA 2B3TA 4YRJA 2DG2A 1B2RA 1PBNA 1Z34A 2NV0A 3CKLA 3ZUGA 2DHRA 1CDDA 2X15A 3SYRA 2FQYA 3D6AA 4F4FA 1GTRA 3X2EA 4Q7LA 4MW7A 2QORA 4C3VA 2PV0A 4YCMA 3ENNA 3Q8LA 1N0HA 1YNSA 4QDTA 2G6BA 4EVSA 3D8NA 3NXKA 3HZZA 1S2LA 2J33A 4IG4A 5LMNB 4IIJB 3G0DA 1OBVA 4TGLA 4D79A 2B4AA 5J2TB 3FROA 1GPYA 1ZC3A 3I6ZA 4OI4A 4IMRA 1ZOOA 2XKAA 3R6LA 4AUMA 2BFMA 3HCAA 4PFSA 3ZKWB 1VL0A 1PLKA 2IV2X 1DELA 3WB9A 2AG8A 2MMCA 1E18A 2H54A 4H7DA 5A71A 2G76A 2DBVO 4QUEA 1PDOA 2NXWA 2Q21A 2VPYA 5T3YA 3MHTA 4W4TA 2JFNA 1JQAA 1YZYA 3OY7A 5L95A 1US8A 4WKNA 1H2ZA 3DGEC 2PX3A 3FF4A 4NPHA 5E1BA 4NPAA 2O8FA 1Y6ZA 1G8AA 1ZGJA 1KJIA 3IXQA 3OY2A 3P4XA 4HYYA 2PUFA 3K6KA 2GWRA 3VTKA 3ZIAA 5KMGB 2Z58A 1I6WA 1EP1B 2JGAA 4OGFA 1TEVA 5LPNA 1WXXA 4FI3C 4AIRA 3BRQA 4UDYX 5C8VA 4DV6B 2R5WA 3OURA 3K5PA 2QLFA 4BVHA 1YRYE 4J91A 1LVGA 3FXAA 3N8HA 4M0FA 3RGWS 2WWGA 1L4LA 4IRUB 4TLLB 1JIJA 2B36A 2P91A 4WKCA 4RZSA 2BBTA 4CM4B 3OZRA 1A4XA 4MK4A 4C4PA 3Q4GA 5D3MB 3CVUA 1EFVB 3A6DA 4DADA 4DA4A 3HFRA 4MW1A 5LA6B 1O3YA 1RZRA 3RVLA 2O5RA 2BTQB 3HDYA 3RS0A 1MNAA 1J56A 4F4CA 1BEEA 2JLQA 2WZQA 1PBTA 2IYNA 4ZPJA 1FL9A 4IDOA 4J29A 4LE0A 4ZEWA 2OLJA 3ZGLA 5EJ9A 1QGAA 2O8NA 4K9KA 4TV9A 4Y30A 4HBGA 3HJGA 3BGWA 3P0IA 3PENA 4Y9SA 1ZWKA 1AZSC 4D6XA 1NTRA 3A4LA 2UVPA 4Y2GA 3ZHRA 3GNTA 5KKCA 2IW1A 2H18A 2HQSA 3CONA 4OXYA 5HZKA 4X1KA 2VP2A 4DA6A 5H4HA 1A2OA 4AY2A 2C95A 2P9QA 3MQ2A 4HQ6A 2VP0A 1UDWA 3K92A 1T2CA 3F4KA 2R00A 3L8CA 3NT4A 3RAGA 5TGTA 2X7JA 3MW8A 2OESA 5EVCA 1NVWQ 1R16A 2Q6KA 1A2KC 1Q0UA 5LXTB 3HK2A 4OJQA 2BELA 1RFGE 1Z3CA 1HDOA 3DMYA 2E21A 4BZPA 2CZGA 2PS3A 4DSZA 1ZLYA 1GQOA 1H4SA 1I36A 3H42B 4Z9FA 3ZXIA 2IDMA 2A9KA 1QHFA 2NYAA 1OF1A 3ECSA 2ZBUA 3OQPA 4J1NA 1VYTA 4WL0A 1E2KA 3CJTA 1GUAA 1I33A 3QE0A 2ZRNA 4D9BA 3PUHA 2BR4A 4RKEA 1YQGA 1J2TA 1U8AA 3L8MA 1XLUA 2IPOA 1ACLA 3WBJA 2BTOA 2YASA 5AICA 2W48A 2EIHA 3SYKA 2NTJA 3ZWCA 3S4YA 2EJUA 4BATA 3WGMA 3MMXA 1JIVA 2Z43A 3ANNA 4WY2A 2ZWAA 2OXCA 4IRXA 5H3HA 1FXWA 3BD6A 4IM7A 3W78A 5E3HA 3EFHA 3FGPA 4CM1A 3CW8X 2OO5A 5K2OA 4XDZA 1QYXA 3L1IA 3I8OA 4CVNA 5CLLA 4TZ0A 1ZIYA 2D3WA 2VWHA 3MVEA 4N5HX 2QZ9A 4C4AA 2DWQA 1Z5GA 1HV8A 3BDVA 4P36A 4AMBA 1PGJA 3JY6A 3X1ZA 4R7TA 1VZ3A 1R4AA 3E84A 1UJNA 3IAUA 5DHTA 1IBLB 2BBWA 1AV7A 5IAAA 4KH1A 1JI0A 1QCZA 3KU4A 2H2GA 1TM7E 3RT9A 5EXSA 4DWOA 5FPKA 1I80A 3VH2A 4A36A 3E7XA 4Y6LA 3EN0A 2JGIA 3F9RA 1ZXBA 5TQJA 3UAOA 1EUDA 2WU0A 4O02B 3S2ZA 1MB3A 4XVQA 4NKRA 4UJ5A 4JROA 1QOQB 1OLOA 3UJDA 1N25A 1M5UA 3T9BA 4DEXA 3LPAA 1M2OA 4B32A 4DR4B 1NN1A 1QYVA 3TQHA 2O59A 1R4NB 2WDZA 2R4UA 5J1SB 4CG0A 3UAGA 2I4LA 1UDCA 5C80A 4IICA 4V1CI 1O96B 1D0VA 1MAVA 2F3UA 3FKSD 1IAQA 3SXUA 5L7WA 2BI7A 4HWSA 1XEXB 4AO6A 4IHJF 1TZJA 2WPDD 4HDAA 2A59A 2Q9CA 2X7XA 1M6VA 1MRNA 4Q3KA 4OSPA 1CJMA 2X4DA 1C7FA 3WLNA 4PLVA 3QVKA 4CIYA 5JJ5A 2XUHA 4OBBA 3H17A 4C0AC 3CCFA 2OHFA 5BN5B 4BGEA 4W5TA 1JKJB 3VH3A 3WC4A 4BNUA 3H3JA 1AUQA 4J3FA 4IIEA 4OMDA 1V3QE 1YRAA 3BFJA 3LBNA 1Y5IA 4WGGA 3QE9Y 4LDQA 2BVNA 4QATA 4S0ZA 3W4JA 1IIRA 1U9JA 2BKLA 2IOQA 3GGGA 3PV0A 1P77A 3IDSA 4JL6A 1PJQA 2H1RA 2GNAA 2V65A 3QUAA 1C14A 1H93A 1P9LA 1VI2A 1VKOA 3FM9A 4HPXB 3EVCA 4JMLA 4XXHA 4K3UA 1G6OA 1FDWA 1Z83A 4TL8A 4IIJF 4F56A 4G09A 2CVPA 4X95A 2J3IA 3QELB 1KF0A 1LFAA 5CR9A 4IJQA 4DQXA 2YDXA 1F4VA 3IVXA 1P7CA 2AWNA 5EKSA 2WC1A 4DNPA 2B5WA 4U5XA 5L7TA 1AD2A 2Z8YA 2C83A 4BCBA 1FW8A 5JSKA 1ZL2A 3KTAB 2E9SA 2M1XA 2PGJA 4YJGA 3M1IA 4EDHA 1REQA 1K9SA 4I2NA 2NQTA 4HTFA 4E09A 3EIHA 4G5QA 2FPLA 4M88A 5DP1A 2BMDA 4JJFA 1GQ2A 3FWKA 3FYHA 3UGQA 2FQQA 3ZLUA 3IMGA 3BX1A 5EXPA 3FTCA 4J94A 3PDUA 4JVOA 2X13A 2FZEA 3WLAA 1SVMA 1YJCA 1CJKC 2CVQA 4NXMB 3ETEA 3UJNA 3OM0A 1NYQA 2IL1A 3D0KA 3KQHA 1TT5B 4JHXA 1GP2A 3IE1A 3GNLA 1YRBA 3AFOA 3S8EA 1NE2A 1O7JA 3DPUA 2WQZA 3T1HB 4RCYA 3T34A 1BFUA 4II2A 4ZDIA 3DSRA 4DLVA 5K0EA 2WU1A 5LA6F 3FHJA 3U4CA 5C1DA 3HN2A 3O8QA 1B26A 4R2LA 3GLFA 3K05A 3H2YA 2EZ9A 4IWYA 3EFOB 4DMGA 2XUGA 1CEXA 4NZPA 4TTJA 5LBTA 2R6ZA 3RLIA 5A3RA 3OVMA 4V0RA 1M2VA 3FCOA 5TQVA 5EJ8A 1YJQA 2GBIA 1EVJA 3DP9A 3VHXA 3BG5A 4OUDA 1E7MA 4QLAA 4NJOA 3A32A 3V4SA 3CLKA 2BM1A 3H8SA 4Q93A 4Q1EA 4BHTA 4OQQA 2R1TB 1KEVA 2OHHA 2QHXA 2QTCA 2ZUVA 1L5YA 3IUSA 4KXFB 4N5LA 1QYDA 4Q1VA 3S99A 2R85A 4DMLA 4NNJA 1QK4A 2EW8A 1N0UA 1RKUA 3KJZA 4Y2RA 4CE6A 4E2XA 1QQBA 3QU2A 3NWPA 2HU2A 3EIWA 3FB1A 3CVJA 3GGSA 1D7OA 5CJJA 2O14A 3SYLA 1ZMBA 2H3EA 3IQGX 2WYHA 4KX5A 5ALJA 3OQ1A 1JTEA 3PI6A 5KQRA 1NY5A 2AX4A 2Z83A 4J43A 1ZCJA 1IEWA 4PQYA 1H6CA 4BNVA 5B12A 4DV4B 4RIEA 2LE0A 1S3FA 2VJCA 3OKFA 5LXTF 3DHWC 2AX3A 4YN3A 2Z5VA 3R77A 3RC1A 4EB8A 4RPLA 1R0YA 5A05A 3QKIA 3GN1A 1NT2A 3PJFA 2DFTA 5GWXA 5T6BA 2A3RA 3HVIA 2KI5A 1U94A 4WCDA 4DMMA 2A94A 5K8VA 3WX0A 2CDCA 4O1HA 3WGNA 4L51A 3ETLA 2BRUA 2J9YB 4ZT4A 5KREA 3NYWA 4LDAA 1R9MA 3LE8A 3PG5A 3OLQA 1F0KA 4RFLA 2WSSA 1J9GA 1NR1A 4O6VA 3F2IA 3IVCA 2QL6A 4RZ2A 2O2EA 3O03A 1CUDA 3KR9A 4P4GA 2OVBA 2XMPA 1JG1A 4OI1A 4AJNA 1W73A 4BN4A 1ECCA 3H1TA 4M8NE 1DQNA 2HT6A 1CR6A 1KJ9A 4OGWA 4E07A 1PQPA 2G04A 3TJRA 1A96A 3TTVA 2I33A 4XQ0A 3WIEA 1T1RA 4PFJA 4EY4A 3W2EA 3K70B 1N6PA 2NZ2A 3ZZUA 3N74A 4G5FA 2H11A 3R09A 3RW9A 4GH5A 2YYYA 2YWFA 1JIKA 1CQIA 3PHGA 3ZJYA 3VGJA 3EDRA 2H06A 2R00C 3DAYA 3KFVA 1ORIA 3OHPA 3N7AA 1BRMA 1P1JA 1SOUA 1H2AS 3CX8A 5HBGA 1GADO 4C4ZA 4DYVA 4OQXA 2D8MA 3V8VA 2QD3A 3I8XA 3ESAA 1DL5A 2J5RA 4FBGA 2RKBA 2QN9A 1IEVA 1FSZA 1RJFA 3D6TB 2XE4A 3NLLA 4I9HA 3M3DA 4DM3A 1H9BA 4KR6A 4AJ9A 4YPVA 1W6RA 2R96A