1Q77A

X-ray crystal structure of putative universal stress protein from aquifex aeolicus
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
138
structure length
138
Chain Sequence
SNAMKVLLVLTDAYSDCEKAITYAVNFSEKLGAELDILAVLEDVYNLERANVTFGLPFPPEIKEESKKRIERRLREVWEKLTGSTEIPGVEYRIGPLSEEVKKFVEGKGYELVVWACYPSAYLCKVIDGLNLASLIVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein AQ_178
publication title Structural homolog of Universal Stress Protein from Aquifex aeolicus
rcsb
source organism Aquifex aeolicus
molecule tags Structural genomics, unknown function
total genus 43
structure length 138
sequence length 138
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-08-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1q77A00
2CFOA 1N3LA 1TYAE 1WOYA 3COZA 3ELBA 4R0NA 1X6VA 2H2AA 1K4MA 1R6TA 2XRZA 3ZJUA 2A4MA 4F3RA 5J58A 2VTBA 1N2GA 5J5AA 2CV1A 3DPIA 5TEWA 1T9GR 3OTWA 5DB4A 1VBMA 5FO1A 2ZUEA 1U7DA 4EG1A 2H29A 3A4IA 4MVYA 3CLSC 1COZA 3D6VA 4CQNA 4EG3A 1GZUA 1TYBE 4K0RA 1GAXA 2GKSA 1ZUNA 1EFVA 2YWBA 4MUFA 1M8FA 4NZPA 4MW5A 3F3MA 3PNBA 2WSIA 1IQUA 1OBCA 2PXHA 2J09A 3Q4GA 2WQ7A 1WZ2A 4HJXA 1JECA 3UY4A 1YUMA 4MUJA 3L93A 1N2HA 4PBTA 1KH3A 1O6BA 1XJQA 2A1TS 3FWKA 3ND6A 4UZFA 3D6UA 1MB9A 3SZGA 5HUJA 3VU8A 2JANA 3GMIA 1KR2A 2A86A 2Z08A 1O97C 4MW7A 4NAHA 4OUDB 4Q93A 4AS1A 1ZH0A 3FDXA 1JEEA 2DXIA 4MUNA 1TEZA 3TZLA 1B6TA 1LI5A 2WQ6A 3AL0C 1EFVB 3FI0A 5J59A 1NUUA 4BWVA 1JHDA 3FHJA 2JA2A 1N2OA 3SDBA 3AKZA 1GLNA 1IFXA 3PNVA 2Z3VA 3IDFA 1YIAA 3FNRA 4ZT3A 1F7UA 1M8JA 3N05A 2Z09A 3H99A 2O8VA 3IMEA 4MVXA 2IELA 1N1DA 3PNYA 3CLSD 1FFYA 4I6EA 1KP2A 5K0TA 2ZUFA 4EF6A 4ARIA 4MUHA 1QU2A 1KQNA 4WNYA 1U0BB 5IJXA 4XFJA 4QREA 4KR7A 4MW1A 3KT6A 2GOYA 1J09A 2J07A 4DDHA 2YY5A 1NSYA 1R6UA 2YXNA 4J76A 4MVCA 1O97D 1J1ZA 1OWLA 1OWMA 4ZCPA 3UK2A 1WXGA 5HG0A 3UC5A 2PZBA 4F4HA 1Q77A 1KQOA 2DR2A 1NZJA 1R6XA 3X1KA 1VBKA 3ZIUA 1KAMA 1H3NA 1KORA 1MC1A 2IP1A 4AQ7A 1CT9A 1J70A 2HMAA 3UOWA 3FH0A 2CT8A 3Q12A 1MRZA 4XSVA 4MLPA 3AG6A 1JEDA 1J21A 3H9BA 3OP1A 1NUTA 1M8PA 3GUZA 4MWCA 3MXTA 1O95C 1EJ2A 1T6YA 1JZSA 4RUKA 1RQGA 2I1LA 3BL5A 4KR6A 3KT8A 4KPUA 3CVWA 3IUBA 1NUSA 2E18A 1WXHA 2QTRA 4GRIA 1EFPA 2CYBA 3QTBA 4EG8A 2QUIA 1TYCA 2PZAA 1KP3A 3ZXIA 4P2BA 4DNXA 1OWNA 3P0IA 2DLCX 3UMVA 1QU3A 1D2RA 1X8XA 2VXOA 4U63A 1EUYA 4ZT6A 2QJTA 3RK1A 3KT3A 1U7XA 1EUQA 3MUEA 4G5YA 4MW0A 1PG0A 3RK0A 1M1ZA 1KQPA 1IRXA 5LM3A 1N2IA 3INNA 1NP7A 1U3CA 3PXUA 1KH1A 3ND7A 1G8HA 3M5WA 2RD2A 3DO8A 1TYDE 2DUMA 1JILA 4PY2A 4MULA 3IVCA 3CVVA 1O95D 4EG5A 2J08A 4NAUA 2VTBB 2QJOA 3IVGA 5H7XA 4G5FA 5TGTA 3CVXA 3RFFA 1YULA 4ZCQA 3VRHA 2E0IA 1EXDA 1GTSA 3ZUGA 1G8GA 4MUKA 1WXFA 4DLPA 2NSYA 5JBNA 5IHXA 2D5BA 3LOQA 2AKEA 1IH8A 3G6KA 2QUKA 5KWVA 3AG5A 2E21A 3CVYA 2J4DA 3RBAA 1O0CA 1EE1A 1QTQA 1G59A 3TS1A 2HGZA 1NYLA 3KFLA 1UFVA 1JIKA 2QTMA 1JGTA 2PZ8A 1P7PA 1K97A 5TS2A 4DE5A 1T6XA 4MW4A 1WKBA 4YP7A 1ILEA 4HPWA 4U8HA 2WB2A 1A8HA 3ILVA 3LE8A 1NI5A 3P52A 2O5RA 3C8ZA 2DEUA 2V0CA 1T6ZA 4U7JA 4X0EA 1PG2A 1JIJA 3KT0A 2PG3A 1GPMA 5LFAA 1WXIA 4MVWA 3NBKA 5FO0A 2XRYA 3FY4A 3FIUA 1MAUA 1YUNA 1O5TA 1QJCA 4A91A 4FZJA 3ZXSA 1KAQA 1KH2A 3IOEA 1QRSA 3CVUA 4KKVA 3COYA 5FNZA 4JXZA 2X3FA 3NBAA 4E1AA 4JYZA 2X0KA 3IMCA 2A1TR 2QUHA 3ZJTA 2AZXA 1O94C 2A1UA 3IODA 4ARCA 3X1JA 3CLRC 3GLVA 1G8FA 3SP1A 1XNJA 4MWDA 4YBRA 4H3SA 5DASA 3H05A 1V47A 1Q19A 3N8HA 1WXEA 4K03A 4EFKA 4PBSA 4ZT4A 4QBTA 1I6MA 3SEZA 4YP5A 2X1LA 3U1VA 3DV2A 4I6GA 3CLTC 2BTEA 1T9GS 3L92A 2CUZA 3N2YA 4ND7A 2CYAA 3TQOA 2V0GA 2HZ7A 2A1UB 1F9AA 3SYTA 2DERA 2DETA 1N75A 3IMGA 4EG7A 1VLHA 1M8KA 4ZT5A 1PFVA 5DEOA 2OV4A 1XNHA 4R2LA 2TS1A 4XFDA 1Y42X 3SZ3A 4R2MA 5F23A 3IOCA 1VL2A 1I2DA 2EL7A 4MUGA 2CYCA 3K9WA 3TZEA 3IH5A 1N77A 2AG6A 1ZH6A 1O94D 4EGAA 4J75A 2A84A 1N2BA 3FOCA 3P0JA 1OBHA 1F4LA 1H3FA 1PFWA 3CLRD 4JZYA 3AFHA 4NX2A 3QTTA 2B7LA 3IOBA 1PFUA 3P0HA 4I6JA 4CDMA 4YP6A 2C5SA 2YWCA 4GU5A 4G6ZA 4EG6A 5DK4A 3RHSA 1KKUA 4HJRA 3HFJA 4KPUB 1LI7A 4ZCSA 4S1OA 4ZCTA 3CLUC 2OQ2A 1EFPB 1QQTA 1JZQA 5KCMA 3CLTD 3FETA 1J20A 1VBNA 4KR9A 4NATA 4JFAA 1ULHA 1OWPA 4RPIA 1GN8A 4MWEA 1IQ0A 1O96A 3H9CA 3TNJA 5HUHA 2ZP1A 2A7XA 4OUDA 5EKDA 3N9IA 2G36A 3G59A 2JAXA 5KHAA 3IUEA 1MJHA 3FG9A 3H97A 4PBRA 4ZT7A 3MMXA 1J1UA 3DLAA 1DNPA 4ND6A 4MWBA 1MAWA 1MOPA 2NZ2A 3MLBA 2R5WA 2X1MA 2A88A 4QRDA 3ND5A 2PIDA 1SURA 3IVXA 3A2KA 1XNGA 2IJGX 4YMIA 5K0SA 1O96B 1IVSA 1N2EA 3AIIA 3E27A 2D13A 1QRTA 4L2IA 1ZJWA 1JMVA 4CDNA 1HYBA 4ZT2A 1BS2A 2QUJA 1YIDA 4CT0A 1I6LA 1NUQA 3CLUD 1WQ3A 2DPLA 3A05A 1MBZA 4OJMX 3HV0A 1V8FA 3CA8A 1WY5A 3I05A 3CR8A 4HK4A 1NURA 1TQ8A 1PFYA 1U3DA 1I6KA 1QRUA 3G5AA 1QNFA 3VGJA 1K4KA 4TS1A 3MLAA 4NDAA 4Q16A 1FYDA 1OWOA 5BNZA 2D54A 4L2IB 2EJCA 1F7VA 3HGMA 2RE8A 2J5BA 1N78A 1WJGA 1OD6A 2CV0A 3ZJVA 5TEVA 4DDKA 4DDMA 1H1TA 4WSOA 1IQRA 3S3TA 3K32A 1WQ4A 3COWA 2PFSA 3QE4A 3HZRA 4MAFA 4MQ6A 1N2JA 3TQIA 2BYTA 3JXEA 1O0BA 3ZGZA 1S4MA 3Q10A 1K92A 4ZCRA 1IHOA 5H16A 3PRHA 1Q15A 1JIIA 1Q11A 4MW2A 3X1MA 3LCJA 2GM3A 4UZEA 2CSXA 2CV2A 3RJZA 2QTNA 1YI8A 1M83A 1NUPA 3A04A 4MW9A 4MW6A 4MUIA 2E89A 1GTRA 3SEQA 4DJAA 2QJFA 3NV7A 1TFUA 3ISJA 3HL4A 1MB2A 1LW7A 1M8GA 3HMQA 4EG4A 1H3EA 4MUEA 3COVA 4JXXA 5LLTA 5AHWA
chains in the Genus database with same CATH superfamily
4XQGA 1T9AA 4QUAA 3O8QB 3PPWA 1B1AA 3ED5A 1KO7A 3ANNA 4KHZA 1Z8FA 1O9BA 5KOYA 4R1UA 4R0NA 1MFPA 1S2LA 2FQ1A 1GFZA 4FNMA 4KIGA 1E6KA 1QH1A 5MGBA 1KYVA 1MKYA 2O1XA 1L5YA 4UVDA 5KYVA 4CT5A 1WY7A 4QYSA 4W7SA 3VTAA 1YR7A 5B7GA 1YBFA 2GZRA 3BCUA 3E2MA 2B1QA 4KRGA 3WQRA 2NWQA 5BSVA 1X7YA 3AIKA 1X86B 2VTBA 4CT4B 4Q9HA 2EGHA 1HLDA 1NDQA 2JIDA 3NHYA 3EH1A 4LRQA 4QG7A 3NWBA 1YAHA 4I81A 2QD1A 1P61B 2H29A 1F38A 3EC7A 2PKXA 4UHDA 4A6PA 1A71A 2I4OA 5K8JB 4K0KB 2D2IA 1IMJA 1VXRA 2AOUA 2XZDA 1T5OA 2JAOA 4B34A 1CZLA 4KX3A 1JDVA 4R3NA 4LDQA 2C2BA 4LIPD 2XKAA 2BFMA 1X9IA 3AHJA 3JQGA 5EOVA 2FQQA 1B26A 1BX1A 1W8DA 1YCFA 3N2EA 3FSRA 4Q4JB 1DPGA 1U3VA 2PRJA 2W8ZA 1SVNA 3B6JA 3JASB 4HJXA 4I1SA 1PE0A 2G06A 3G5TA 4O1HA 4ZYZA 2GPSA 1XA4A 1V8PA 5CH8A 2X77A 1Z33A 4Y2YA 3LQFA 4EHAA 3IUPA 3WKDA 2O3RA 2FW7A 4LXGA 3DQZA 2P2NA 5L53A 3SZGA 4DUYB 2GCNA 2YOFA 1VKNA 4G84A 5HUJA 1FJXA 2A86A 4M83A 3RVKA 5IUJC 5L3QB 4B47A 4KUHA 1WUKS 2QN2A 3E9MA 4RJTA 1T25A 2ODNA 3O83A 3L4BA 2YWGA 1OPXA 2DUUA 3ZTYA 3TZLA 4AJ9A 4M9ZA 5JPDA 1S2IA 2HTEA 4KFTA 1DAKA 1JHDA 1AKVA 1UBMS 3OO1A 4D4HA 1Z6ZA 2ZI5A 3CJRA 3I12A 3RQSA 5E2AA 2OZKA 3WIUA 1GLNA 5K6TA 1C3OA 1AHPA 1XQ1A 4HDNA 5LC1A 1BN6A 4V0QA 4LAFA 4UAJA 4DYVA 2VUHB 3AQ4A 1JKIA 1LPPA 2JH3A 1CIJA 2ZB2A 1DBPA 5EJ6A 3AR8A 3D8NA 4QDJA 4UEOA 5EE3A 3H11B 4YQZA 5ADVA 3D4IA 1RW4A 3EF3A 3C3JA 1FFYA 1BTOA 3U4AA 1NXQA 1E3QA 2FDXA 3OEWA 4X7PA 2B82A 3A1UA 3AR6A 4J1SA 2YNMC 1Q2UA 3ZU5A 3LLCA 1KVQA 1UPBA 5IJXA 3E82A 5FR2A 5GOZA 3H2JA 5FKJA 2JAWA 3CNBA 3EUEA 4YXWD 3C16C 2MSNA 4EHFA 5EE1A 3TLXA 2O5CA 3KT6A 4N1AA 3G2HA 2OV1A 3RLFA 1CLUA 1T0JB 3T3DA 2AZDA 2L17A 2DT8A 4DDHA 4TYNA 1YWGO 4UPDA 4EYKA 3WBKA 4LC1A 4LTNA 1CNMA 3HWRA 2QVLA 1IY1A 5KYUA 5KYGA 2GTIA 5CNMA 3LBFA 3UK2A 5I45A 1CUWA 3TW4A 4JLAA 3FTEA 1AQ6A 3GMDA 3EIUA 3SGLA 1R2QA 3OE5A 2NYRA 4TVKA 3KKMA 3NU1A 2B4KA 3CNHA 1SBYA 3R3ZA 4M1EA 4JI5B 5CXSA 1DEAA 5TGZA 2CLFB 4DBZA 5ITZA 4F93B 3UUGA 4LN1A 2WWGA 4OHOA 1APBA 4S1PA 5BT9A 1SXJE 2ALJA 3IIIA 4MMYB 2QRMA 4PIMA 3Q12A 2R68A 3PVSA 5DCLA 5AW5A 4CI9A 4FW8A 2QLTA 3IGFA 3Q85A 3RHFA 1QP8A 2A0XA 1FRZA 4FFDA 3RAPR 1S01A 3P9NA 1ZGJA 4XQCA 1JU9A 2A0KA 3A3KA 3WNZA 4AUKA 3OUTA 3KXPA 1E3TA 4FBLA 4KTVE 2AC4A 4J0KA 3SOPA 2J3IA 4YLYA 3ZNPA 1C4WA 1RJ9B 1YRBA 3DAGA 1N8NA 2ZIXA 1LK7A 4M4SA 2GBGA 2VHVA 3CZ5A 3W5JA 4BU0A 3UTCA 4OGLA 3VOAA 2BZSA 2WAXA 1R0KA 2ZJ4A 1ZNWA 1N4AA 4CQJA 1SKYE 4P35A 4JDPA 1CB7A 3COPA 1EFPA 2FEAA 2CYBA 4DRXA 3PQ8A 1K4YA 4N3NA 4ZP1A 1CP3A 1JFLA 1R8QA 1LLUA 1KP3A 1Z2EA 3ANLA 3EDOA 2WP0A 4O8ZA 2IS1A 4P2BA 1TTPB 1WHTA 1EM6A 2DZDA 2RHRA 1YOVA 2YMPA 1D4FA 2YV5A 4CN8A 3NKLA 2P78A 4KWEA 4PSCA 4QYMA 3Q7EA 2NZWA 1E6CA 1FA9A 4HGOA 1SA0B 3IT2A 3NBMA 5AM2A 5JCJD 5BORA 4AY6A 2H4WA 4P34A 4NU8X 1MIOB 4MPDA 1U1GA 1GTMA 1NMSA 3W6ZA 3ABSB 1SUWA 2J32A 4YJ2A 2XDWA 2WV7A 2V7WA 2ONKA 3NETA 5U4XA 3RK0A 3A6JA 4NFHA 1RWVA 3MPOA 4HWRA 3WBBA 4DVJA 5JDIA 1UXOA 1Y48E 4XD7D 2WD7A 3RVQA 2WBLC 3KYCA 1N2IA 4BWFB 5CDSA 4LEIA 3DOHA 1KDVA 5BVHB 4GGOA 2NV6A 2FPWA 1BAPA 1MTOA 1TTQB 2RD2A 2PGOA 3SIPA 4BFLA 1JBEA 2GN2A 2VI5A 3DOIA 3WI7A 2QJOA 2WSLA 5C9ZA 2X4LA 3ZYCA 4V0NA 3ABIA 1JSRA 3KP1A 4DSNA 2YHBA 1SUDA 3OX3A 4HB2A 1KF0A 2FWJA 3ZBQA 4XQ0A 5FI0B 4ZEXA 2Q1YA 4MCIA 2WUEA 1ZDMA 3QKRA 2PPLA 3CRQA 4HGNA 4M87A 4MVJP 1XQVA 5GM2A 3D6MA 5HEKA 3ZLVA 2XIQA 3G6KA 3O95A 1K3FA 4URUR 3CVYA 1P44A 2DTDA 1YB5A 5FORA 4RXMA 3STWA 3SSNA 3TS1A 2IYRA 4GD3Q 1BA3A 2FCAA 2FUEA 5JU6A 1BVUA 1VECA 2QORA 5F77A 3QLUA 2FPXA 2O6HA 2WPDA 3CU5A 5C8YA 4EPVA 1ONSA 3OESA 2KPOA 1OGYA 2OXTA 1W52X 3P20A 3S2UA 3MTQA 3ZBPA 3HM9A 3G9XA 2YQ5A 5A4KA 4XR9A 3NDIA 3HKEA 3B20A 1L8OA 1G18A 4JR2A 4RLFA 2AI2A 2GNAA 3QV1A 3P0FA 1GPMA 2RGAA 1WS6A 5FO0A 5FI5A 2XCTB 5TNXA 4KI0A 2Q5IA 3BORA 1DIBA 3O1JC 2CNDA 3QX9A 5CM9C 4LTMA 3H9JA 4KFSA 5KU7A 1FP6A 2Q5EA 5L7WA 4DFDA 1E8DA 4Q4CA 3THXB 1GQSA 2ZRIA 5AJUA 3CF6R 3R3UA 4HCJA 2SBTA 2ACEA 4B31A 1G9SA 2BFEA 3EG5A 2Y1LA 3IKJA 2PKYX 3D0RA 3ICOA 1TK9A 2Y0CA 4KU4A 4XRRA 1HFJA 5CK4A 1SQ0A 1BOOA 2YL2A 1FYFA 3KDAA 1N6KA 4RF4A 1GVNB 3IJPA 3OLVA 4Z6KA 2PX5A 3ACBA 4JBNA 4MPRA 3ELYA 4ZYUA 5BYKA 1U81A 3PQDA 4RD4A 2WFMA 4LVOA 3FE2A 4GOKA 5A6SB 4BQRA 3DMFA 1XSEA 3D6HA 1G8FA 2I6GA 3P9SA 4C7VA 5TARA 3F8TA 2OUIA 3GC6A 5IAGA 1ARZA 1KZ9A 4DV6B 3FSGA 2VWPA 1JWLA 4ZOBA 1BGXT 2VP6A 1KRWA 5CFLA 5D3MB 5FIUA 4EFKA 4PBSA 1ZC4A 2W4QA 1I6MA 1N5DA 3P8ZA 2E6KA 1QFZA 3C3PA 4LZWA 2NXCA 4ZAVA 5L95A 2RH8A 1OYWA 4R1NA 2CXHA 1LGYA 2BJVA 1BWPA 1DCMA 4P92A 1FIUA 2O8FB 2Y1GA 3ROTA 4W5NA 1PR5A 5EC8A 2FEOA 1N6HA 2CYAA 4MUBA 4AJEA 1MB3A 3KUDA 4M9QA 3IC5A 1ISHA 1E5VA 1OIXA 4NYMR 2I33A 4G41A 2DERA 4GOND 5TSDA 1MD9A 1XJ0A 3DEAA 4BNGA 1P17A 1AOXA 3HDYA 2D59A 2ZYTX 3DDCA 3GMTA 3ODGA 2RB5A 3M6VA 3I9OA 3D1JA 4UOQA 4BNJA 5JZOA 2QZZA 1LSSA 2TS1A 1S96A 2R6HA 3SZ3A 4R9NA 5FTKA 1YXMA 1OAKA 4DEVA 1I2DA 2AVNA 4FMBB 2ID9A 4MUGA 4QYWA 5JFOA 3FPGA 2QI9F 3WHKA 1CY2A 4YLEA 4WT7A 2GH1A 3ZIDA 1GZ4A 3RRJA 5FBZA 3PEYA 3VVCA 3IJRA 5JANA 1UH5A 1G1AA 4J75A 1KGDA 1DKOA 2ZIGA 5HHTA 5EKSA 3PEWA 3PFFA 4TGLA 2R00A 2H63A 3QKTA 1UBGA 2BPOA 5EUBA 2C61A 4CM9A 3QTTA 5M04A 1JUDA 4Q24A 1H8HD 1NRWA 4HDRA 3UJNA 4POOA 3G3EA 4ACBA 1LSUA 5C53B 3VH3A 4K6GA 2AFIE 1YQ9A 4EHNA 1LI7A 1Y6FA 4F2GA 3BSSA 1PJCA 4UMFA 4I55F 4N03A 1LI4A 4RK5A 3HJCA 5JISA 2X13A 1KPHA 2E82A 2RARA 4AY3A 3FWYA 3HI6A 2OAGA 4F3YA 4ZYWA 4FBGA 4C4SA 3VR6H 1T3LA 2CUNA 1KVRA 2VL7A 3CVJA 3OT1A 3QG1A 1C9MA 4QO8A 4XJSA 4ZI7A 4JR1A 4C4OA 2C2YA 4B7AA 1H6DA 1TVKA 2AFHE 4JLMA 3OCUA 3BWYA 3NNNA 4HRAA 4TZ6A 2D0OB 1UOOA 3EXFA 1NX6A 4JGBA 3AJEA 1BHO1 3RS7A 4GKBA 2IF0A 3B2QA 4WKOA 5IABA 5ECDA 2VP2A 4BGDA 3IVRA 3OC6A 2RHOA 2EZTA 2VF7A 2OZLB 3HCNA 3F3YA 2XKJE 3DFMA 3E5NA 4NONA 5H81A 1PGNA 2XE8A 3DAHA 3WK4A 3OIDA 4LYEA 1VRVA 1ONNA 2XWJI 4XIGS 3BMOA 4YJHA 2QUBA 3NR2A 4X84A 2Q2VA 5IAAA 3QXXA 4OHMA 3RRBA 5I8PA 4JI8B 1QRTA 4HI0E 1KC1A 3A2NA 2OBXA 3KPVA 3UH0A 3CB2A 3ZK9A 4B3TB 1B4DA 1P0PA 3OZFA 2R65A 3OHPA 1T9KA 5CDTA 2V6JA 4CI0B 4DNPA 1TX4B 3AI3A 3TJMA 1UFQA 2NZVG 3GCXA 2DPLA 4HEJA 2P68A 3A05A 3GDHA 2BGIA 5JSZA 1FVXA 1BDHA 3NAZA 1ZSYA 2ZVQX 1WY5A 1TK3A 1X1SA 4K1LA 4YACA 5CT9A 5GP1A 3TB6A 3UJ8A 5GJBA 1GPWB 4WEOA 3GJSA 4KB5A 1IHXA 5KNCD 3FR8A 1QRUA 1O6CA 3F5DA 1DT3A 4ZOLA 1TF5A 3NJ4A 4E46A 1OHHD 4WVLA 3VGJA 4TS1A 1R4MA 1QAMA 1I24A 3R7WB 2FUKA 4DLZA 2IT1A 4N0EA 5EJ8A 5JCPA 4A26A 1TAGA 3R6LA 1EFRD 4DXDA 3Q2KA 2ZTLA 3BRCA 4P3YA 4YRGA 2X4DA 3NAQA 1GCOA 2R87A 5GINE 1H9BA 3SR0A 5IASA 2HCTA 3OTHA 4RIFA 1HLPA 3ZZNA 4F4IA 2EV9A 4M2LA 1N78A 4CWAA 5KZMB 2P77A 1ZGCA 4PSKA 1D2CA 4D1YA 4YPFA 1OY1A 2EARA 2WHQA 4EFMA 1K86A 2ZE5A 3KWLA 2FJUA 3OE7D 4IP0A 2G6BA 3QU7A 4J4TA 2HIAA 3GRAA 1RWBA 3ZHYA 2ZIVB 1OV4A 2Q27A 1WA5A 1YC5A 2P9CA 3FJYA 1RT9A 4ZN6A 2IHVA 2LV8A 2WT9A 3EXAA 3QHAA 3QMMA 721PA 5LMZA 2HHHB 4NCBA 2VPXA 1N7GA 2CFIA 5ED0A 2WTXA 5G0VA 4FEYA 3CONA 3LRXA 3ZV4A 4HDSB 5JS7A 5G2OA 1G3IA 1YE8A 1CTQA 1TMKA 1L4GA 2E5WA 2JJMA 1RI4A 2MSKA 4UREA 2HNAA 3UK6A 1KJNA 4P6VF 5DWVA 3BTOA 3EJ6A 4ADSG 3RS8A 3A25A 3WLKX 4MJ3A 4G4SP 3R2JA 1DQPA 3VHLB 4CLHA 1V16B 4HO1X 2QG6A 5CLFA 3NO4A 4X24A 3RYCB 1S4QA 2PO5A 4Z9AA 2GYUA 3UQZA 2YINC 4ZZ1A 2IHNA 1YC2A 1IBCA 3TRKA 4EHJA 1DG9A 1H6BA 2O8BB 1IN1A 4FFOA 3EZ7A 2PV0A 3PIRA 1R8XA 1UWCA 2F9MA 1JT2A 1RXYA 2J87A 5FP0A 4DJAA 1C2YA 2FF7A 3IT1A 1Z5NA 4X1IA 1KO5A 1Z5PA 1CZOA 1KJIA 1WCV1 3L7YA 4UDOA 1IL0A 3QLTA 4AX4A 2V6IA 4KQIA 5HTKA 2IIBA 2Q0HA 3SC6A 5B4UA 5DIFA 2XEXA 3HLKA 3KEOA 2UVPB 4L74A 3V1UA 2JRCA 1JFFB 2NX2A 2XECA 1CULC 3HSKA 4GX5A 2UU9B 3OG9A 1IWOA 2ZITA 4DLAA 5HJ7A 2W0MA 3JZMA 4EA6A 3VV2A 3STXA 3FLAA 2ZYHA 1C7EA 3PC8C 2I2FA 4IX9A 5GJVC 5C5CA 5KTTA 2DBRA 3AVPA 1HNZB 1ZUIA 2W2TA 1Q3TA 2PZJA 1Q0TA 1V8DA 3C6QA 2GHRA 2H31A 2FDRA 2XNJA 1X1DA 1HZJA 3AB8A 4HGQA 3P97A 4E31A 2I91A 4CGZA 1UP7A 2WF5A 1P72A 3WGLA 4EZBA 2CXTA 5IULC 5JSKA 3L6DA 4M8LA 4DB4A 1GG5A 4J3FA 4XTCS 4LQLA 3ZE2B 3WJAA 3J7TA 3V9PA 4BB0A 4QSMA 4EG1A 3C14C 1CWUA 2B6NA 3T6KA 1UM9B 2Z3WA 3BQMB 1COZA 3D6VA 4RJKA 4PQYA 4CLEA 1EWTA 1X7HA 2NO1A 1AUVA 2UYYA 2P2LA 3QVSA 3EA0A 4YECA 3P2KA 3C74A 4K0RA 4QDXA 5REQB 3U3MA 3BHMA 3GXBA 2CKMA 1XF1A 2BR5A 2G07A 4JQOA 1RI2A 1PJBA 2LNDA 2XNHA 5HDQA 2QB5A 1B8PA 5CGQB 1TRHA 2ZQ5A 3HJBA 3HXTA 3QP9A 2Z4SA 3Q8WA 3UCFA 4IOJA 3LUAA 5E6SB 4R40A 4MV3A 1GILA 2BISA 2Q8QA 5ALNA 5HXAA 1G5HA 1ECBA 5L3ZA 1M6WA 2OO5A 2ZWAA 3CW9A 3JQ9A 3KUKA 4BB9A 4BMOB 3C5HA 2VJMB 3JAKA 5C7LO 1VM6A 1NBIA 5E7JA 2J30A 4PBTA 5C31A 3SF8B 1O6BA 1SWWA 3AF0A 3T41A 2ZRHA 4AZ3A 4C88A 1Q0HA 1UXHA 3MINA 3B5IA 1HXHA 1MB9A 1CS0B 3GJZA 2YJZA 4UM5A 3ASZA 4R1LA 4GHWA 3ASVA 2Z08A 4TYPA 4W8GA 4OPMA 3H4TA 1FTQA 1E2EA 2LPMA 2NU6B 1TM3E 3AFGA 1FUUA 2CJPA 4QSHA 4L4XA 1RIIA 2NV0A 3EVAA 1JVSA 1U7ZA 4IICA 5ECGC 5IH3A 4OATA 4ZMRA 1LI5A 5LZ8A 4GBJA 1GZ7A 1B43A 2QN8A 3AL0C 3HJGA 1G5TA 2KWIA 2LBPA 3PHHA 5DX8A 1N0HA 3ANSA 3DMGA 3PEUA 5TF0A 2PQ2A 1GQ2A 1Y7IA 2VH1A 4TOIA 3L1VA 2H3EA 1SVLA 2R2AA 2ZANA 1F7UA 1V9LA 4IAOA 4X93A 1XO1A 3WGUA 2J0UA 2C97A 3J7AC 5COAA 2NTEA 4I1VA 5E9JA 4MTLA 4U2EA 3AVVA 1A2KC 1PR4A 1PUXA 2E1PA 1GNLA 3TI9A 2ONYA 1KA9H 1TVCA 1ZISA 3KPJA 1B0UA 1GRCA 5F2EA 3T7IA 4G9GA 2P9JA 2Z2IA 3K0SA 4XH9B 4H4DA 4DMHA 1Y4UA 1P7VA 4NYJR 1QU2A 3HUDA 1UP4A 2R8PA 1F12A 2WLTA 1XZIA 3IVMA 3N6RA 3Q5DA 1Y1QA 3H1TA 4ZPJA 5EJEA 4UASA 1R9JA 1CR0A 4P08A 3V55A 4CF5A 1XKXA 3S7ZA 4XFJA 2QG9A 5TR9A 1NSTA 3HHPA 2AE1A 3GH3A 1LZKA 5EVCA 5CLIA 4C14A 3WOHA 1HY3A 4BNFA 3T7SA 1VG9B 1OH6A 1FPMA 3TN7A 7ADHA 1J9ZA 3Q3VA 1VI5A 2R8BA 4NYIR 5D00A 1TA4A 2DP4E 3B6IA 2XMCA 3EXG2 3TWOA 4B3DA 5EJ7A 2PH1A 4XQEA 3V6LA 4K9PA 1E2KA 4DV3B 2X2EA 3AZQA 2GDJA 4B87A 1NRIA 1P18A 3AFOA 3WWPA 4HWTA 2P91A 3BGDA 4BQQA 2WSYB 3CB4A 4G37A 5HG0A 3OLQA 3RODA 1Z4QA 2VZ0A 4GWLA 2IZ0A 1Z12A 1K8ZB 3JYOA 1N2CA 4LYGA 4MQ4A 1GGJA 5F5XA 2WLSA 3QBEA 5KKCA 2WA1A 1YFKA 1H4SA 1U0EA 3OQ6A 3DMYA 5C80A 1PQ4A 3DKRA 2QX9A 4EPYA 1T5SA 1XEFA 3EVBA 3FH0A 3MPUA 4O1IA 2K2QB 1P2SA 5BQ5A 4CDGA 1LRKA 5TIIA 3LMKA 3DYBA 4P7KA 4WLEA 3A6LA 2GEKA 2H9YA 2Z8YM 3WWCA 5HSGA 1RPJA 2RKBA 2YVQA 5BPFA 1A0OA 5AK5A 4R98A 2CNBA 2ZTSA 1O95C 5CH5A 4Q4AB 1LDNA 1DJNA 1E3SA 2Q5QA 1PX2A 3K4PA 3SS9X 3W8NA 1XRRA 4TT8A 1JEYA 4TM7A 4GZ6A 2I1LA 1UUFA 3DHEA 4P98A 5K4AA 1Z3IX 2PKEA 4KPUA 4NC9A 4Y1RA 4ARVA 1K88A 2XOXA 4IJMA 3STVA 4DMRA 3R41A 1PF7E 4YMVA 2QSYA 1CUCA 1NY5A 4GRIA 4D81A 2HQRA 5H68A 4AMBA 5D6OA 2NLOA 4W82A 4O2AB 2PX3A 2BM0A 1U8CB 2AC2A 4B35A 1TGYA 1QGUA 4I3GA 2RI0A 4XKJA 3KQMA 1ZOIA 4JBWA 4E33A 1N9KA 1SUEA 2Z04A 2IPOA 4RY9A 3U4DA 1EAYA 4A5SA 3HWSA 4IQ0A 4JSYA 4TSFA 2ZUBA 3NHWA 4J1TC 1PR6A 3FF1A 4TKMA 3FMOB 3HDJA 1H2WA 3O4RA 4QOJA 1LTQA 3OUZA 1JI0A 2ZGVA 1PKXA 1YVRA 4QULA 1LJLA 3EQ6A 3GR6A 2QTLA 4HQFA 1QCZA 2O8CA 1II9A 2VF5X 1ISGA 2H48A 2PD4A 2WU8A 4OYRA 3UAGA 4ASUA 3A1EA 2EXXA 3W78A 1DKRA 2PS0A 3WBFA 4BXOA 4JT2A 3ZHUA 2POQX 4M98A 3DC7A 1NP7A 2DF8A 4Y30A 3HGTA 3N0XA 4P54A 3R5HA 2O3TA 1TPYA 3M5WA 4HZIA 2C3PA 3L07A 5A3SA 1SOMA 1G3MA 4RK1A 1JILA 3C3AA 3ZS8A 1REQA 2VF2A 2LKDA 3O5AA 3HCWA 3REOA 4B74A 1BCSA 3L7AA 2OY0A 2BW0A 3WLSA 3O4VA 2Y4OA 2AR0A 2VPTA 1OX4B 3IULA 2BE7A 1XTQA 1MJ5A 2BFCB 2NQ2C 1KFBB 4JJ4A 2KBFA 3IAM6 3UMSA 5A4MS 3U6BA 3NDJA 1QHYA 3AM3A 1E79D 1VBFA 3C97A 4G5QA 4LFAB 3L05A 2C82A 4KIUA 3GLFB 1SUFA 3O03A 3KSUA 4NCJA 1M7HA 2YASA 4OI1A 3KZVA 3RYHB 4B0PA 5HPYB 3O0DA 1EGHA 1BYUA 2B21A 1WV0A 3H1AA 1U7WA 2IITA 3NH6A 4WEQA 3ORQA 2AEEA 5TS2A 2HCJB 2A9PA 2GQ0A 4ZVPA 3I9KA 4MV6A 4P93A 1H2RS 2J33A 4OK6A 4RS3A 2DPHA 1WNTA 1TJNA 3D1VA 1Z26A 1UF9A 2BUAA 2PUTA 2B4RO 3PUZA 4J7CA 3PICA 3QUQA 5ALKA 5LUBA 3UGKA 5BR1A 6NULA 2O5RA 4RCZA 5ICSA 4OM8A 5DBHX 3RO7A 5ENDA 5DOVA 5BQ3A 3URKA 5HFJA 1X77A 1JJFA 2G5GX 5IXYA 5G53C 4HX2A 3GQVA 1PG2A 1O03A 1TEVA 2O0HA 1UT5A 2FPIB 1OFHA 1U1IA 3KQWA 4M7WA 3NBKA 4RAOA 5C3UA 2XRYA 4TWBA 3L4EA 1UDBA 4ALMA 3PNLA 4YT4A 3F3SA 2JIZD 3M6LA 4MGZR 3U7IA 4TTQA 4W9MC 3N74A 3O84A 4BAGA 4L4SA 3TSAA 4B2LA 3LZDA 3BMXA 4UAUA 1B15A 2AB0A 3HZZA 2QTHA 3IOEA 4N7MA 4DTIA 1Q17A 2J45A 2A35A 3BSFA 2W8BB 3QBTA 2I7VA 1IJBA 4QTZA 5KDLA 2ZPUA 3KG2A 4HQRA 4Q7KA 3UVEA 3U1TA 1TK2A 3WHIA 4E1AA 5A3JA 1J22A 3KAJA 2VZLA 1H1LA 2UYCA 3U7FB 3HR7A 2X4GA 4JEHA 4D02A 2WUDA 3I9V6 4LJ4A 4MTCA 4BJ3A 2QUHA 4DUPA 3BILA 4RH1A 1E2NA 3FSJX 4RW0A 1RI5A 3AR2A 3DZHA 4C78A 4D5EA 4V02A 4UU1A 1N5IA 4HDCA 3JQEA 2JEZA 3TUZC 4QQNA 4IIJA 2PGLA 1FW6A 2YXEA 3EARA 3EMVA 3HLTA 3P9ZA 2G9VA 1Z8DA 3OOWA 4INPA 1NRJB 1H2BA 1HEUA 4OHXA 4RXTA 2IYFA 3L7JA 2WJZB 4CODB 2P40A 4HLUC 4S1TA 4E51A 3OU2A 4PGAA 3E35A 2YV3A 4YBZA 1C5KA 1OREA 3DV2A 4I6GA 2FR8A 1HDGO 4YN3A 2BTEA 4YHHB 4DIMA 1ULAA 2I4MA 1FMJA 1U0HC 3QYFA 4QHYA 2W5UA 5EP3A 3L8YA 4NF2A 1Z0IA 3PE3A 5C34B 1KE2A 5D51S 4X64B 2A1UB 1BKYA 5L8VA 3DL0A 1F9AA 1L6RA 2BFBA 3DCIA 3KZMA 3I39X 1E98A 3M5CA 1NVWQ 3Q6NA 5GQSA 2C0PA 5TGDA 1GG9A 4WDRA 4C2TA 2ZUUA 1L5FA 5HRUA 3SSMA 3Q6MA 4P82A 1CK4A 3OP4A 4FB4A 4ZJUA 2ES4A 3BL6A 1TZKA 2CF5A 1PJ3A 1PVVA 5FF9A 4WK2B 3VAZA 1EX6A 2EWWA 3OQOA 2QT9A 1CKEA 1WTCA 1BFDA 3LBIA 1HC7A 4EPWA 5JSHA 4KDEA 1TDJA 2C4NA 4AL4A 4DQXA 2ZVJA 4X7BA 3EPKA 1MV5A 3IP1A 4OHWA 4NY1A 2MDTA 4TXNA 4AXXA 4EGAA 2XHZA 3FOCA 1Z5WA 3LM8A 1PTKA 4Y0NA 5CMLA 1TA9A 3CLHA 3MILA 4ISCA 3S1LA 4IOLA 4B6GA 1G7TA 2QW8A 3BREA 2W6NA 5D5PA 3E7WA 3EDCA 4GNKA 3VJRA 5E6RB 1EVIA 3CX6A 3OJXA 4PE5B 3ABQB 1TU0A 1VE1A 4Y8VA 2JLWA 1U7PA 3ZVMA 1W1UA 3CE9A 1QWOA 3FYUA 3WWDA 4WZBA 4ZO4A 2FETA 4YONB 5GONA 5IVHA 3OQHA 3JZFA 2VHXA 4PO9A 4D9HA 2ZSDA 3I32A 2BRUC 5HR5A 4BNHA 1H23A 1P4AA 3R5FA 5D6NA 1FLAA 4JEIA 1OWPA 3SJCA 2NU8A 1XLWA 5AUPB 1X7GA 5DI9A 3S1SA 2JLYA 2V03A 1L5KA 1LPAB 4FN4A 2HCRA 3I4LA 3RS2A 1AF7A 3L04A 2H51A 4JKIA 2I7XA 2WVHA 1PR3A 1UXIA 4FYHA 6CHYA 2Q2WA 2R85A 1GRRA 3BRWA 3ZV6A 1Q7RA 1F5NA 1B16A 4DLWA 5ARCA 5D2CA 1WMSA 5ALFA 3SMQA 1QF6A 2QL5A 2NZ2A 2PNFA 3IOYA 1OI3A 3PCXA 3KJFA 4JJEA 4OHCA 3BCHA 2JASA 2ZKLA 1DRKA 1RAAA 1FFEA 1O6GA 3CO5A 5E7QA 3ZHVA 2B8JA 2ZZKA 2YXDA 3RYIB 2JZCA 4R1QA 1WL8A 2ZJ6A 2ANBA 4PLHA 1AK9A 2OD9A 2ZUCA 3UJ6A 1L5HB 1YR1A 4EGSA 1SR8A 3HCPA 3DEIA 4BX9A 4DNFA 1UOEA 4A1OA 4CL2A 1SIBE 4ZQBA 4WBSA 1TQDA 4DC0A 3JAWA 4UTPA 1E8NA 4F5WA 4MB6A 4N47A 2D5IA 3K73O 3EWAA 5AVWA 1P74A 3LK7A 1QVRA 1L3IA 3EOBI 1ITZA 3STUA 4LF4B 3UXYA 2OTCA 3NGMA 3FTNA 3M82A 1W8IA 4IF4A 3KALA 4LHSA 3UB4A 3MA0A 2XW6A 3N0VA 2O3JA 4RLSA 3N75A 2ZKIA 3AHEA 3GG2A 2IUSA 2YY7A 3QIVA 3EDMA 2FEWB 3OMXA 4XUGB 3GARA 1BVRA 1I4LD 2V9PA 1QYRA 1CY7A 1H22A 3ONEA 2D62A 2QZSA 1XP5A 2WD8A 3V2UA 2JFWA 2P1ZA 3X2SA 1P3Y1 4RTLA 2W42A 3G5AA 3ANTA 4WK6A 2DM6A 2VYCA 4HB0A 4AF8A 1SU8A 2KYRA 2RAVA 3K15A 4GSKA 4X9XA 5DBOA 3S55A 2DY1A 3IP8A 1VJ1A 1EX1A 1XQWA 1XCMA 1RNLA 1SKUA 5CXXA 5JMWA 2VYFA 3BB4A 4M46A 5C5DA 3G2PA 3HRIA 4YRCA 4UBOA 2FJPA 2YZGA 1NVDA 2Q3JA 4RY2A 4RTRA 5BVGA 3G79A 3HXQA 4PSAA 2J5BA 4IS3A 4DIUA 4DLNA 5IBQA 3ZZMA 5FWYA 2FRXA 3PNOA 5F2KA 2QV7A 1L6IA 2WHRA 2RHMA 1G5FA 4WK0B 5ARDA 1NNEA 1T3HA 4WNCA 3PXAA 4IDOA 2D3TA 3EBPA 3L6CA 4JL6A 1T2EA 3SHVA 1S0UA 2DBYA 3K32A 4PEVA 4XVUA 2PFSA 4MKRA 3WNQA 1N0WA 2AKAB 1YZGA 3VPFA 4G63A 3MJ4A 1RHJA 1F2UB 2I3AA 3JXEA 2E85A 2VDVE 3KQOA 3SNHA 5JZBA 2VAXA 3HCEA 5A3VA 2WYUA 4FGJA 4GLFA 4N5LA 4ZZIA 4Q5IA 5CT5A 5EMLA 1AUPA 3RUHA 4CIWA 3E53A 3WRYC 1TZ2A 5GVSA 3OQ1A 1Q15A 2FZKA 5L6MB 2VPWA 2IXTA 2QLMA 4P84A 4JC0A 4GYKA 3JYQA 3HSYA 4OFWA 4BGUA 1V95A 1DGQA 2O59A 5C37A 2R8RA 1Y7HA 4E88A 3ZW7A 1U98A 1SQGA 3I42A 2XYQA 5INTA 1J0DA 2YJGA 4I5DA 3KR2A 4OA5A 5BR4A 3S7TA 3T7TA 1SBNE 1XRMA 4DV2B 3ZTTA 2XUDA 1F0YA 1A2OA 1G1MA 1MR3F 1UPXA 4JJAA 4K9SA 3AEXA 2BGKA 2E55A 4N82A 1GNTA 1YCDA 1D2NA 2HPHA 3IDZA 3MF4A 5AICA 4DZRA 4AZVA 1WVIA 4W5OA 3COVA 1LBHA 2YJ6A 3QOXA 3BK2A 1Q20A 5LM3A 1D8AA 3R8FA 4BC1A 1AXGA 2HV9A 4UUNA 2G40A 5BQFA 1MG5A 2AFVA 3DV0B 5J1SB 3NBUA 3M9WA 2YW9A 4W1QA 1LPSA 1TFRA 5F35A 4AYTA 3LBHA 3VDXA 3BKXA 4HDMB 4CPDA 1Y9AA 4IS2A 4TTJA 3UT0A 2NG1A 4TM8A 3AVXA 1K68A 4F91B 3LKBA 1TYZA 3W1VA 2P79A 4MARA 3T4XA 3JASA 2VP9A 3BMNB 1FNMA 4UVHA 3FNHA 3IA7A 3NLLA 4XI9A 1XPRA 3ZY3A 4NLLA 5EESA 1BFKA 2VKTA 3U3XA 1Z0UA 1JHZA 2QRHA 2FWBA 2Z4TA 4UFOA 4F92B 3I0ZA 2HADA 3EX7C 4CFSA 3H9QA 2V6FA 1BMDA 4E4TA 3JYHA 1U7DA 2N1MA 4NBTA 3UEOA 4AKGA 1SOVA 1OLSB 3DD5A 2ZYRA 3RC1A 4E5DA 2JVJA 4LGMA 3WMRA 3A70A 1GGFA 4LK2A 4WN3A 4CMEA 3CWQA 4ZEMA 1TYBE 5BMVF 2QTAA 2A9QA 4ZZ0A 3WNCA 2HLPA 4E1BA 3I1JA 1QKKA 1T5BA 4NZPA 4GPAA 1W1WA 2GERA 4Y2SA 4ZVRA 4F9GA 2I99A 3HJTA 5K4GA 2P69A 5JG7A 2D2EA 2YNMA 3KLBA 2PXHA 1XHFA 4FFNA 5KVAA 1KO8A 4ARSA 2FY8A 2P6OA 1A96A 4BMZA 5BYJA 1P1RA 1IY8A 3SJ7A 1EK6A 4KXLA 4LOHA 5FTMA 3FSGD 3BTSA 3QBDA 3M6AA 1TECE 1NF8A 1FQKA 3KDSE 4WZAB 1AGNA 3ZX5A 2JGAA 2V7UA 4JI1B 3ZCXA 3O21A 4D8UA 4I2NA 1EFCA 3N0TA 4EUNA 2P1RA 3MBIA 2QRKA 3O94A 4QOGA 1HLFA 1SBZA 4FOLA 5PGMA 3BFXA 2Q3MA 1ZRMA 3NOQA 3PR3A 3HN2A 4G85A 4BWVA 1T8WA 2WI8A 4BOYA 2QZ9A 4I4TF 2OSVA 2JFUA 5IM4F 2H5JA 4F1WA 3AKZA 1P6QA 3H0EA 1Y7LA 4GX0A 1CIPA 3M6XA 4NBSA 1DC8A 5JIBA 5FTWA 2Z8YA 1GQRA 1VI2A 3ITKA 4E07A 5DN6D 1QH8A 3MS4A 4KW7A 2GN6A 4F3KA 3PNYA 5LDHA 1NPYA 2JH8A 3E8MA 3LA8A 2WTMA 3G9UA 3IXLA 3DLCA 3A31A 2JFOA 1PJ8A 4HQNA 3NUQA 1KP2A 2BKVA 1SBTA 1FSGA 3EXG1 4EKGA 1KQNA 3V2HA 2NP7A 2CDBA 4XUCA 1JFRA 5ALTA 3EMKA 5B64A 4OLHA 1P0IA 3EC2A 3QQ5A 2QRVB 4TSRA 1SVSA 5K03A 3H19A 3RRXA 2FTKE 2XMGA 2YWFA 1XWFA 4FN5A 4CM9D 3NHZA 4QT4A 1LBTA 2HWYA 2XLCA 1J09A 1C0LA 1Y1SA 2P5TB 10MHA 3IO3A 3L1JA 2J07A 2QOEA 2W6PA 4BNVA 4N0MA 5DDIP 3PUHA 3DVQX 3HKBA 3M3HA 4J76A 5T3UA 3O2NA 1O97D 5FUMA 1FP4B 2OCGA 2PM8A 1JBKA 1R8JA 1YR9A 2ST1A 3IB3A 3IAXA 4H6WA 1ESZA 1SQFA 3HYNA 1CEQA 3UC5A 1Z35A 1E94E 1RJ9A 2REOA 2VTDA 3O9MA 1RM0A 4JI0B 2NMVA 2JLBA 2R44A 1R6XA 1N9GB 3L6RA 3Q5GA 1LPMA 4XDGA 4H18A 1U6IA 5B5SA 2NU9B 2BGGA 2JFVA 2HMAA 4RZ3A 5KTNA 3GA7A 4W9NA 2OBYA 1E7WA 3PV0A 2HA4A 3VPAA 4YRSA 5DLYA 1JBQA 1ZJJA 1U3WA 3BA6A 1CJCA 3K8OE 4KYVA 4CTNA 1Z7YA 2OO7A 2C4HA 2XOKA 4QXPA 4MVJM 5KWVA 3GLHB 1XCBA 2OFXA 1VMIA 3L02A 4KO3S 1NT4A 4ND8B 4EKEA 4ARBA 3GEGA 4KGXA 4PWYA 1SA0A 3G0HA 2RKWA 4OH1A 1QQBA 4WXEA 2QVBA 1MIOA 3P9YA 3DOOA 1VPWA 2GUWA 2PTHA 5EHIA 2DJ5A 1PW5A 4GPD1 5JR3A 4RTNA 4LF8B 2W2OA 2J7KA 3JWIA 2IGBA 1IAQA 3LUHA 2WAAA 5AVUA 3A9SA 3AKEA 1PL8A 1X0XA 3BFJA 4O2BB 2NVUA 1ZK4A 3E7FA 3HY6A 4LOKA 1XMIA 3F6EX 2F3UA 3KIPA 5BVHA 3GW8A 1DQRA 4RZSA 1MQAA 3ZJ4A 1F1BA 3M3DA 3IL2A 4RD2A 2IEGA 5T8KA 1L5NA 2W4MA 4F8EA 5KWEA 4BB5A 5DOZA 3UMVA 1D2RA 3IX7A 4OHKA 3UK0A 3UMMA 2P3OA 1NNUA 2E4ZA 3CPEA 5AM4A 5BNWA 4MRMB 1JR2A 3Q1LA 4OHRA 1MVNA 4I5IA 1G291 1J24A 2FWRA 4KDCA 4D41A 4F38A 2P0YA 1PG0A 3ORYA 5H02A 4CV1A 2VRCA 1ID8A 2VZ9A 4RTJA 4BHTA 4UZSA 4O33A 1C81A 4EF5A 1I30A 2CD7A 1NR1A 3Q7IA 5H3LA 3AIOA 4D80A 4K87A 5I7WA 1BHQ1 2F1OA 3RQIA 2CLDX 1GQFA 3CWCA 3GVHA 3ENQA 4TMYA 5I4BA 1FTWA 2GXQA 5KTYA 1XC7A 4NH4A 2PSEA 1J42A 1E2GA 1XBTA 4IKEA 3OZIA 1EB9A 3RBZA 4BMDA 5KTPA 4PY2A 1L7VC 1U2TA 2B5VA 3AZOA 4FT2A 3EMBA 1VSVA 3KHUA 1KNXA 4WH0A 5H83A 3WMFA 3ESZA 4C4RA 2WFAA 2Z6AA 3T54A 1F0NA 1JX6A 3NYIA 5BN1A 3DHWC 1LK0A 2HSGA 3BK1A 5IPFA 3L4KA 1PNOA 2NXEA 2VLIA 1G8GA 4MK4A 3WIDA 1AN9A 3IELA 3UW1A 2W43A 3I9FA 5JWOA 3UBTA 2G1KA 1G8JA 1KI2A 3I1YA 3M2TA 5EZ6B 1IH8A 2ZI3A 4K2AA 4MSUA 3PXCX 1AKYA 4JOCA 4P5PA 4B82A 3UWOA 2RGBA 4D8TA 5FV4A 2YIJA 4R6WA 2JLUA 1ZR2A 2ISCA 5AVKA 1DQNA 2NTNA 4MYRA 4HB4A 4AMGA 1W5AA 3VKUA 5M7EA 1JGTA 4BQIA 5CVJA 3DUFB 1VB5A 1KP9A 4MEJA 1N3IA 1R9GA 2C2ZA 2CMFA 2R6GA 2O23A 3QKWA 4M55A 5J2TF 1NOJA 5IC5A 4BWYA 1XTUA 5AK3A 5FPTA 4IVQA 2X6TA 2J6HA 3KVRA 3HCOA 3EGDB 2ACWA 1KVSA 3NT5A 3JTEA 8OHMA 5CVEA 1G3RA 2PE5A 2DMRA 5B37A 7YASA 1U7OA 2Q5JA 1AN0A 3V4ZA 1FW8A 3GI1A 1T6ZA 2OMKA 4X0EA 1B23P 1EPUA 1L4EA 1JJIA 1PR0A 3GFOA 2BGLA 1KQGA 1NSFA 4LYHA 4F9TA 621PA 4PO1A 3AJRA 2HXSA 4OLBA 4OQEA 4TVOA 4BGEA 2I34A 1EB8A 3R40A 2SKDA 2D0DA 4FGKA 2FZ4A 5DGTA 3I9MA 3F67A 2X2FA 3QVJA 5B12A 1A27A 3QLVC 3HRHA 3MBOA 3SC2B 1H6AA 5HS4A 4RH3A 3T4UA 1AE1A 1HDYA 1YZTA 4IDGA 3KQSA 1VMKA 3RAJA 4AJ1A 1A9RA 1U2RA 3X1ZA 3C5VA 3O4IA 4P2GA 2IDZA 3NGLA 4LYAA 1ZU4A 2Y1FA 1SVIA 1RZUA 4IJ6A 1A9SA 1E3WB 2C9YA 3VJKA 2CK3D 4EITA 4CEJB 1SRRA 1N33B 3NHFA 2NYUA 1RAHA 1AIPA 2GHIA 4Y2XA 4REOA 3ZY2A 2W71A 2Z2KA 1EI9A 2HDHA 5DCUA 1P4HA 3Q3JB 3UK7A 5BR8B 3KQKA 1X2EA 3E5MA 2GAAA 1FEZA 1V96A 3U49A 3SY8A 4HY3A 4ABYA 3PB3A 4UJ3A 2XTNA 3FZNA 4XWOA 4YRJA 3NAGA 2NO4A 2DPGA 4AYXA 1X1TA 3GBVA 4IEEA 4RVOA 5I7UA 4LJSA 3T5PA 4RV5A 3ROQA 1MZVA 1K66A 1JG6A 1KBQA 2GGSA 5JHGB 1M2JA 5JNUA 2XYRA 3HHEA 2J4CA 2QHXA 4KIJA 1N5LA 3JVEA 3H2YA 1Z88A 3A7EA 4H60A 1QX3A 2V5VA 3S6JA 2V0GA 1RPZA 3B8HA 3QE0A 1MVOA 4L95C 5IBRA 4W6ZA 3MWLA 5JQGA 3GRUA 2QAJA 1H0HA 4ME6A 5DCYA 1RCFA 1W4BA 4GVPA 2QMEA 1Y5MA 5EZYF 2C2MA 3AO0B 4L22A 3I6BA 3KKZA 3QEOA 4IDHA 4RIHA 4TTSA 1D2HA 1YVEI 3I8OA 4Z4QA 3GGPA 4FDUA 3ACCA 4HNAA 1XTPA 1IK6A 1OX5A 1Z47A 4RADA 5JEEA 4M1KA 4N7JA 3K9WA 2AHRA 5IT5A 3G1WA 3QWIA 1TVEA 1JV2B 4C1BA 1IN4A 3N2KB 3PVZA 5B1YA 2YWDA 2DSNA 2Q6LA 1SZPA 3DMDA 4PIPA 2ZYWX 2XF8A 3CRNA 3DOUA 1O2DA 3DFZA 1BKSB 2NAPA 3I76A 5FQNA 3VNRA 2DCMA 1BVHA 4DN6A 4BO8A 2DHEA 4UXIA 4CDMA 2C5SA 4IGAA 2XCOA 5CBPB 3V3KA 1VKOA 3VKFA 5EZQA 3VXKA 1HL3A 4BO0A 2OFOA 3IR5A 3M4JA 2OZLA 2VJNA 3IPAA 1SIUA 1JZQA 5BYAA 1RYYA 2IHKA 1WHSA 2AN1A 3A1TA 4FOSA 2ZIFA 3F6PA 5D3ZA 5EKTA 5G4KB 4C0HA 2JA1A 3ZE0B 3OO0A 1GN8A 1Z5UA 2JC3A 1IQ0A 1FXWA 1JA1A 1QG0A 3RIXA 4RKFA 2JLCA 4ZJPA 4PHFA 1RI1A 5GVRA 1QTNA 4AK9A 2R6JA 2BEWB 2G36A 2I6XA 3KNZA 3LECA 3IEXA 1MNQA 4FKBA 3RTGA 3VR2A 4IBOA 2ISSD 2WUVA 4PGMA 5LKAA 2XWBF 3O1IC 2ZAIA 4BV2A 1WLSA 5JCZA 4YT2A 2QS9A 2HV8A 4XX1A 1QRDA 3NVDA 3IERA 1Z2AA 3P27A 2XWPA 1PJLA 3V1NA 4EHBA 1NLZA 1UPFA 2ZQZA 2HHLA 1NPDA 2PIDA 3PC2A 3QXSA 2QTVA 1T4BA 4CG3A 1E4OA 3OU6A 1EIZA 2P11A 3HUEA 4J03A 5SZKB 2H6EA 1IMOA 3LWNA 3SYLA 4V1CA 3E9CA 3FWPA 3LC1O 1EM8A 1Y3CE 1DV1A 3S44A 2RIPA 2FH5B 3N86A 5G02A 3IA2A 1XJ5A 3E48A 2QM7A 5L6LB 4PINA 1LC3A 3EFBA 3LIIA 4YALA 2Z5FA 1SVOA 1PX0A 3CJQA 1XRPA 4I9HA 3F5MA 3CRVA 3ZX4A 2GARA 4OGWA 5KNDA 1A97A 5CXUA 2H1FA 1E3JA 2CHUA 2R96A 1XU7A 2X19A 1NKTA 3MLEA 3NW9A 1G6Q1 1GA1A 1I4DD 3FSEA 1TCAA 4HVAA 4KCGA 4ZAGA 4AROA 5IJ9B 5KTOA 5JXWA 4C4PA 2ISQA 3CA8A 2PH5A 1X7XA 3DS8A 3SYKA 2AK3A 1JIVA 3CR8A 1VQ1A 1O77A 4G2TA 4IJKA 1DCTA 1VJ0A 2WWWA 5AIBA 3CHYA 1I14A 4KNVA 5A7FA 2ZRFA 4P4NA 5T7BA 5HA5A 2XI4A 1KSJA 3ESYA 4HSEA 1DX4A 2F3RA 3R3VA 4LY6A 2VHEA 3N5CA 5CX4A 1IUNA 2FPGB 3CT4A 1OI7A 3S68A 4A2CA 4HDSA 5BN4A 1KE1A 4C4XA 3OE1A 3W7VA 3FCSB 3DDZX 2OHXA 2NUAB 1S9HA 3WDMA 3D6JA 4JASB 2EERA 4BIMA 1NUHA 1DX6A 4QXQA 1MZPA 4C7OA 4NPHA 4YQYA 3SJUA 4NE2A 4KLZA 1MAVA 3OZVA 4L0CA 1V16A 5DNYB 2BI7A 2JIOA 2OKGA 3P0EA 3DAFA 3W6NA 1ZMXA 4K81B 4RKWA 3LLUA 1RIFA 1H1TA 3M6IA 3WA7A 2ZYUX 4FB5A 3K70D 3ZGXA 4BO6A 2E2WA 4B79A 2ZS7A 5ALWA 1GZSA 3O3OB 2FZEA 3PC8A 4AFNA 4YCMA 5AVYA 2BYTA 1QFXA 3TG2A 3CG0A 2Q3BA 3ZHCA 5AVZA 3HWX1 5LQAA 2ZS9A 3H5IA 2RGRA 1QK4A 2X23A 1VG1A 2WTNA 2UVPA 3CZCA 2R6AA 1ZIDA 1X1RA 1JFFA 2ACVA 1QTIA 4HH3C 2F8TA 3HA3A 1UJ5A 2BM1A 4TWIA 4ZDWA 3TLJA 2W2PA 1KVTA 4MEBA 3S8MA 2WAYA 3K8YA 4D9BA 1RXIA 4GL4A 3I64A 1VL6A 3KOUA 3TLZA 4EW2A 5F9HA 4ETWA 4E14A 3TQQA 3LT5A 4K7JA 4QNRA 4NWIA 3OZEA 1YI0A 4HYTA 4YJFB 1U8AA 2V6BA 4XYLA 3UWSA 3B85A 1QZ3A 1YK0A 4H6XA 4MV0A 4QTXA 4BLWA 2I87A 4Y2HA 3ZYZA 1JEAA 3FJOA 1NT2A 1SC1A 2ORVA 4YRIA 1BEZA 2HDNB 3FDJA 1J56A 4KQCA 1SC4A 3D54D 5FH9A 2QZJA 4KMRA 3C3MA 3FCUB 1UM9A 2FJ0A 1KK2A 5HNKA 1BWRA 2R751 4DC9A 2WG0A 3CW8X 4HAOA 2WIBA 3ZOZA 4C0XA 1TM7E 3IIJA 2XYGA 4X60A 4JK3A 2X5JO 1Z28A 3U7HB 3WWYA 2QP4A 2B98A 2KJQA 16PKA 2YJ5A 1EHYA 2HSEA 2QKYA 1LS1A 3CNOA 3MFYA 1R6TA 5E6SA 2A6PA 4F0JA 5JASA 1MUUA 3U80A 1Q7CA 2GVZC 2HUNA 3VTZA 3GP8A 2PPVA 1N2GA 2VJMA 5U1PA 2V4ZA 3FPBA 3JCZA 3SF8A 4C2AA 2AOWA 1DLJA 2PLNA 4AY4A 2HCBA 2R97A 1CS0A 5FO1A 3BEDA 4RNCA 4HVLA 3JYPA 3KSZO 2I1VB 5DHRA 2Z43A 5HF5A 4MVYA 4ZQEA 3ZDQA 1B0ZA 4RC9A 1KAEA 2MYUA 4DIEA 3K0CC 4D6PA 4HS9A 1OKKA 3NP7A 2Q0QA 3I4FA 4FFVA 1JQBA 3WMXA 6PFKA 1XMOB 1GAXA 4KVAA 1SD1A 4ESEA 1VPEA 1VPTA 4JB8A 4R5MA 5HK8A 2WT4A 3EF0A 3TZ6A 1M2NA 3LYLA 1XWIA 4BATA 4DTCA 1XMQB 1ZWKA 2IYOA 3DMNA 4AJ4A 1U8ZA 1YMUA 1EDEA 1Z0ZA 1EDZA 2Y6VA 2NQTA 2IXFA 4G3XA 3VR3D 1M1NB 2C7VA 2EKPA 1OR8A 4E2ZA 4J2TA 4NNOA 2Y8EA 1NN0A 4H35A 4EJSB 3CUVA 1RYNA 1Q74A 4N0PA 1PVOA 5LQJA 1HK7A 4DV4B 3I5UA 1KAGA 3CSSA 3K0EA 3BJMA 3QSGA 4W5TA 4DWOA 3RJ5A 2YHUA 1XA0A 3HPRA 3FYTA 3NATA 2JJ1A 5BR7A 3FUXA 1BE6A 2ERCA 3DT9A 1GTG1 1H85A 3KKPA 3WTCA 4IUDS 4D42A 3A28A 1ZOPA 5J2TB 4ALLA 5CW2A 2OPBA 4RSGA 4ALIA 1F2VA 2KW5A 1GSOA 3I1IA 3HN6A 4MVJA 4AKSA 4EJSC 5B2ZA 2ZM6B 4KX5A 1B6RA 4B45A 4G0YA 1ISFA 1TQ2A 2YWRA 5ICEA 2O8VA 2J3QA 3WLQA 3NFYA 3S0JA 1JFVA 1NDHA 2BVNA 2G7ZA 3ZU3A 5LQKA 5DYWA 2QSJA 3VTFA 1F51E 2JLXA 3U7RA 1JW9B 3L8ZA 5A5VA 3UAVA 5CNKA 5KVVA 4ROTA 2JIBA 1AXRA 3AKCA 5TMDA 1LC0A 4OHZA 1EFDN 1PJQA 4IZ6A 3VC2A 4DARA 1PVDA 1WF3A 2J31A 1V2GA 4F72A 2W6CX 2CXXA 3DE7X 4QPZA 2CC2A 3HZOA 2PYDA 5JQWA 4QE3A 3Q41A 1LBEA 2WWFA 4XUEA 3W0LB 5JW6A 1YQEA 3GRKA 2R8EA 3WGJA 1YONA 2Y05A 4C5BA 4DIKA 3R5XA 5CK5A 3TZCA 2C7QA 1Q6YA 1VE9A 2X2OA 5DWDA 2HO4A 3TNDA 2MSWA 3EVTA 1PJZA 4YRDA 3WK9A 4F5EA 5L51A 1Q3KA 1UOQA 3WIOA 1EINA 3G7NA 1OWLA 1R6AA 3GGJA 4R9UC 3SKXA 2X0FA 1NAHA 2I3BA 1QOQB 3QIAA 3G6WA 4OK3A 2XDYA 3FYHA 4QQFA 1KK3A 2I54A 5CT4A 2Y0EA 3RFTA 4Y6RA 1G41A 3ZWVA 2PZGA 2I78A 2NNLD 4IHJF 4MCHA 5CH3A 2ORWA 5F3DA 4PC2A 4B8WA 1MC1A 1DXYA 3C7TA 4AZSA 1MX5A 1J70A 2K7ZA 2BFOA 3WE7A 4Y7CA 5I9MA 3FCXA 1RLTA 3HP1A 1XZAA 3WSWA 4YRRA 4O2AA 1DAPA 3K31A 4BB6A 1G4AE 1V3VA 4MLPA 4XSVA 4A82A 4CLOB 3AVWA 1C1DB 1IN8A 3NUZA 4D3DA 1E1DA 1JEDA 2HL6A 5DHAA 1CR2A 2J3HA 1XHEA 4E1VA 4OEHA 4EUKA 1V25A 1NUTA 1OH5A 1UKVY 3AINA 3FVTA 3DZ8A 1DVRA 3RUCA 4Q9KA 3FVQA 4YV0A 2VJLA 5K1ZA 1Y5IA 3OX2A 4U0KA 3NHLA 3UICA 4P9NA 2WWRA 4CMIA 1QP4A 3EQ8A 4TV9F 2I76A 4OF4A 4PC1A 3B6KA 5EZYB 3CLKA 2PGDA 1G5PA 3K92A 3CVWA 3NHUA 1UC5B 4JT8A 5ADHA 3JR3A 1I3NA 4BFYA 1AQUA 1KQ3A 2RHTA 3I2GA 1XPJA 3AUSA 2ODAA 5AXDA 5B6JA 1I94B 2IIQA 4FR5A 2CE2X 3ZQUA 3MB5A 3ZXIA 5AKYA 4KR3A 1O9GA 3TTVA 3MJCA 1MP0A 1CJMA 4WXRA 2EJTA 4Q3AA 2O0KA 1BS9A 2CN1A 2JEOA 3E0QA 5H70A 2RG7A 4GPBA 2K5UA 2YZ7A 1U7TA 1OW3B 1RWQA 1FFCA 5E6UA 3ADBA 4EWLA 4NS1A 3EFOB 1C50A 3HA2A 1JLLB 1OX4A 5FJJA 3C8HA 2BFCA 2V7GA 2AXQA 2FN7A 5AD1A 3B3JA 4MW0A 4RLHA 2XAUA 4J1NA 4L08A 3L7NA 4EF4A 1HPLA 2H54A 4GOMD 3TR0A 5B2EA 3RYHA 2WT8A 1SVKA 2Q1WA 2ZG6A 4BC0A 1QR6A 1C30A 1EWYA 1LCIA 1T9ZA 2JFQA 3H7AA 4GXRA 4IVRA 3ZI7A 2J0VA 3P5SA 5C7IO 2HRZA 2VNJA 1BROA 2Z9BA 3K9LA 4LXYA 3PRKE 3TQCA 5B57C 5C81A 2VK2A 3CF2A 3A9WA 4FWBA 3A6PC 3IPCA 2WMYA 3QG5A 3RSFA 4U7DA 3A3PA 1VJRA 3OEYA 2FUNB 1W4RA 3H2IA 3QFCA 1DUVG 4XXHA 1JPVA 3ZVNA 1SQSA 5H80A 4L9SA 5JVDB 3TVDA 3OOJA 2XE4A 2J8ZA 3IDOA 1Z2PX 3RS5A 1S2OA 3PWTA 4B3IA 1PYDA 4UQPA 2BH9A 4CEIA 1CUSA 2GBFA 1I7DA 1ZH2A 3PXBA 2AKEA 1EBUA 1Q0SA 2PUJA 1W0CA 2GUGA 4UBMA 1KIAA 4X90A 5TT1A 2H1SA 5CX1B 1VB3A 2NSDA 2RH4A 3KJHA 5DYNA 3I6QA 1PDVA 3LKDA 4N18A 2RHJA 1P7PA 3WK6A 4ID3A 1VSBA 4RU1A 3B78A 4UDXX 1J8VA 5DRYA 1HE1C 1QIEA 4L3WA 1C4OA 3L0DA 4Z9XA 1WVMA 2NW6A 2YZNA 2N3ZA 1W30A 2W8BA 4H7IA 5AXBA 4KG7A 2Z0MA 1OX6A 1I7LA 1XQ6A 4F4DA 1B2LA 1G6OA 1KY3A 2ZRAA 3KZNA 3BL8A 4IMRA 4NOMA 5JT1A 2QENA 3E3OA 3RS4A 5A9SA 1GCGA 3ESCA 1SCAA 3IUYA 2XZOA 5JNTA 3FDFA 1WW2A 1E2UA 4HADA 1X1EA 2V0CA 4HLUA 1QH9A 1XMJA 1H4VB 3TLCA 4B44A 1NI3A 4YK7A 1YU9A 2DFKB 3EFHA 1AMUA 4F71A 4X66B 2EKLA 1MMFB 4HTFB 2QM8A 4RBNA 1JR3E 2X9VA 4Y1FA 2ONZA 4KVZA 3L0PA 3G8DA 1PWYE 1QJCA 3WSVA 1W75A 3O74A 3UF0A 3MG9A 3S5JA 4BTVA 2Q21A 5K3OA 1UC8A 2OM2A 2QX4A 3UAZA 4YUWA 4IV5A 2OHGA 3TLGB 4JYZA 3A6ZA 4JC8A 3BDAA 1W96A 2VDMB 5DLEA 1EXWA 3R8CA 1Z2OX 4GYJA 2C8KA 2PRIA 2G70A 3KE8A 4NCXA 1JS1X 2A1UA 2ADOA 1B8NA 2JGDB 5AVSA 2VEOA 1WUTA 1Z6TA 3MWFA 4I4NA 3B7WA 3I45A 4KQFA 3BXXA 4KTTE 5B1DA 3RTDA 3SQWA 4NV0A 1T2DA 3ID6C 1K7SN 3KUUA 4P0QB 3DE3X 3G17A 4TQUS 3F4BA 3DP7A 1X7ZB 1FP2A 2F7SA 2OCLA 3G7UA 4DCVA 1XRJA 2FPMA 3PS9A 3U56A 4K03A 3UWKA 2PUHA 3WGVA 2CCJA 3K6KA 1KY5A 4YP5A 1XJWA 1RYHA 1CUGA 3GLRA 1XTIA 2BE9A 1EUCA 3L0CA 4XX0A 1N1MA 3S27A 4N76A 3DEZA 1YGYA 1U28C 1P31A 3AJDA 4F7DA 4HUQB 5DGIA 1E9CA 2BRUA 4FFBB 3RSGA 2AG8A 3B82A 4C01A 3SYTA 4C2BA 5FBQB 4FFSA 5E6RA 2CVFA 5A04A 4EG7A 2CLOB 1DHRA 5CVCA 1A9QA 1L8AA 4K05A 3REQB 4Z49A 4QATA 3NBZC 1Y3HA 2AG0A 5KTMA 1SU7A 4YR7A 3T9DA 1DDIA 1BU5A 1W2HA 5HVNA 4FFLA 1VL2A 2WKPA 2B3TA 3VHQA 3TECE 4HN2A 1ZSVA 2HQOA 4YRLA 4ZCQA 2C04A 4US0R 3V8MA 2GNPA 3DBLB 1NJ5A 3E9RA 3RIEA 3BXEA 4L8GA 2VZ8A 4KIFA 3P0JA 3PFKA 1OJLA 3DO5A 1EEHA 4P4GA 3PTLA 4PZCA 3PNSA 2B7LA 5IK2A 3W05A 4BCCA 1PFUA 2AQHA 4YRNA 3PC4A 3LIPA 5FYQA 2YXLA 2VDNB 2E6UX 2VDWA 5K0LA 1FX0B 2PVCA 5EXPA 4CCYA 5JTUA 1PN3A 2EU8A 5DHTA 3CUYA 4C3VA 1E2PA 3KYIB 3RYIA 1UAGA 1QHGA 2QQ0A 1RHRA 3AEZA 1XV5A 2VP0A 1ND6A 2BM9A 3MUNA 1L5HA 2AZTA 3TKLA 5J4VA 4BNWA 5BNFA 5BW5A 5I3CA 4NATA 2V54A 2Q5LA 3RS0A 3BJEA 4BQEA 5JO0A 5J4KA 4DR7B 1KDTA 1M2WA 5TMPA 2OK8A 3C3BA 1VP3A 2F3TA 4O4HF 1R8YA 3HYCA 3MSXA 5H59A 1YKSA 1Y5LA 4HWSA 3WIBA 5CYFA 4IXWA 5JBQA 4HEA6 2C9CA 3R75A 5KHAA 3FUCA 4M0EA 2V7EA 4ZCLA 3H97A 1XAJA 1D7OA 1Y4ZA 4Y9DA 4ND6A 4XOIA 3R8XA 4D46A 4BP8A 4WN9A 4NJMB 3OHMA 4H7JA 5IDQA 1TM2A 2E4WA 2WOJA 3K1TA 4O4IB 4D9CA 4CM3A 1UMDB 2PU7A 1DOAA 1LLCA 3ND5A 4FMDF 4BU1A 3ESBA 5LBUA 2HK8A 3GDFA 1U2GC 5DM60 4MLCA 1DZIA 1UXJA 2IJGX 2JGLA 3KYDB 3OEED 2PH7A 5DFAA 4K5QA 4EAAA 4Z54A 1NBEA 1UBSB 3IP9A 4MIKA 3HO8A 1U2SA 5HCIA 4B85A 3NKFA 1GVHA 3I2YX 3QNWA 2AOXA 3ZC3A 4OQXA 3SZUA 5LP6B 3GZJA 3K0HA 5IAKA 2I5PO 3EOAI 3L1HA 3MYRA 1ULZA 2XOKD 4URZR 4ZT2A 2VH5R 1ZUHA 3E9DA 3D59A 1ZRHA 4FD3A 3IQGX 4E7OA 1L4HA 5MFPA 1BJKA 4QWMA 1ZJ6A 1WZNA 3T4EA 4TSKA 3N58A 5C5IA 3S1AA 3OJOA 4BVAA 1U4NA 2IL1A 1PZFA 4ZAXA 2QYHA 5HGJA 5LP6C 5BXYA 5F7OA 3MTEA 2H85A 3HP4A 3O6VA 4M9UA 5KJ1A 1RFGE 4X8LA 5JDCA 1MB0A 2BMJA 5B7QA 2AMFA 4QEKA 2WJVA 2I3DA 1QNFA 3OCVA 3L8HA 3N39C 3LRPA 4W1RA 1RQPA 1NN1A 4RVCA 3HNRA 1AGYA 1RYMA 1JKJB 1WZCA 5J2UB 2ABWA 4IUCS 4LYFA 4C21A 1LWOA 2YVAA 1M7BA 4FMCF 4CR6A 2FP4B 3RC3A 3ZBUA 5CDFE 3FRHA 3DZIA 1C3EA 3BXZA 1F7VA 2LDXA 3N0RA 2ZCVA 5CTAA 1WPRA 3CR7A 3RRMA 3F97A 5LDGA 1WG8A 1YDHA 5LMNB 5L3SB 3QVWA 2F2TA 3RYFB 4PX9A 4O4JF 1YR6A 1I9CA 3T1HB 4DDKA 3SLRA 1AGPA 4ZVQA 3RIHA 2KE5A 4MR7B 2PHZA 4HXYA 3TTXA 4O4LF 2MOKA 4WSOA 5B6IA 3B1ZA 4INZA 3CZAA 1X1CA 3L3BA 4JYAB 4DM3A 3N07A 4D6YA 1O0SA 2XOEA 2HBRA 5DXFA 2QTZA 1RLMA 1THMA 1FLDA 1ZN7A 4MS4B 4URWR 2EBFX 1TCBA 1PDOA 3MGCA 4NDNE 1Z5GA 1C14A 2J41A 1OVMA 4UBLA 3GIDA 3IKTA 1DQYA 1G2OA 1ZH8A 4IHJB 4AKHA 3LQ4A 8ATCA 4I5FA 3ERCA 2VSNA 2XEDA 3RADC 4X95A 5K0BA 3DV0A 5CITA 2BJWA 2XMBA 2QMQA 1M2OB 4BIIA 3LTEA 5IMSA 3PK0A 2C9OA 1WZEA 1WMBA 1WZIA 3QPBA 13PKA 2X0JA 4HDMA 4P83A 4L7QA 3VBEA 3E22B 1PT9A 1EK5A 1PI3A 1SC6A 1GZ5A 4ISBA 4RJJA 3H6KA 3PWZA 3KB6A 4NAVA 2E89A 1ESEA 1ZI6A 5KNDH 3D3WB 4PZYA 3ISVA 1Y89A 1DIGA 3UUFA 3HBNA 4W99A 5ITZB 3C4VA 1LW7A 4OGFA 2ZTMA 1XCGB 2DFNA 5FNVB 1NUAA 2PBLA 2J7PD 4TV9B 4X6LA 5CGZA 1OLSA 3V34A 3K2IA 3A32A 3RBVA 2H2DA 3LCCA 4FDVA 3G1TA 2F62A 3HV2A 1I80A 2G6TA 3C6BA 3GT4A 1D1TA 2CFOA 1OAOC 1R5NA 4R8MA 5BNIA 5JH7F 3OWOA 4WA8A 2GPBA 3PTZA 2ZEJA 5B58T 1AS0A 1NJGA 3GMSA 4L0QA 8ABPA 4JLSA 4M76B 3WKCA 2XY4A 5GPBA 3U62A 1VZ3A 3AI7A 4Q9AA 1X6VA 1Z4JA 1GGHA 3QUTA 4JROA 1GHTA 1XXHB 2PXAA 2X9GA 4P7GA 4WZBE 3ZNQA 4BBJA 4R0MA 4J0QA 4KV7A 3AERA 3QENA 2YJTD 1KYXA 4HFJA 4YAKA 1M2VA 2Q1TA 4IMPA 5K0FA 4H7PA 5EJ2A 9LDTA 1X74A 1X7WB 5CUQA 3G82C 4KQMA 5TEWA 3LCRA 4Z5XA 5BQXA 1LPNA 2FG7C 5DB4A 3VR4A 4R69A 4YGYA 1I3KA 2LRHA 4G5XA 4TKUB 1U90A 4NEHB 1IQPA 3V2GA 4CQNA 1VLZA 1SB9A 3FRIA 5F52A 1OC4A 3GB9A 3NC0C 3ZWNA 4RXUA 4BVGA 5LZ9A 4B6OA 1OZHA 4GE0A 3CJTA 4BLTA 2AOVA 1NM5C 3LUFA 1ZMRA 4EO9A 1T13A 4M7PA 3K71B 3RR2A 2GZMA 2ZJ8A 4BO1A 3FVVA 1Y5RA 2BN4A 1ZP6A 2W11A 2J6CA 4IRUB 2D0PB 4LRYA 2IYNA 1A4IA 3ES9A 3IR7A 4IDFA 4OQPA 1A5TA 4Y2PA 5CA1A 3DLIA 1E66A 2HLDA 2YYAA 4Q03A 1USWA 3HXOA 4JQSA 1GNQA 1VJCA 1FMLA 2FFQA 5TMBA 4OUDB 2BMVA 3UQYS 3FBTA 5JZVA 3QF7A 4U7FA 4ZU6X 4A16A 1YA4A 1EX9A 2O05A 2W6ID 2WF7A 1E96A 1Z3CA 3T61A 4JYPA 1GPAA 3PDHA 2MR5A 3B1JA 1P73A 1ZUNB 2IEYA 2ZWIA 2QRVA 2Q0XA 3D31A 2D1FA 3DMRA 3FHJA 2IV3A 3I23A 1E7MA 4I19A 1TVMA 3BWXA 3DKPA 2JK1A 4KBYA 2A59A 3VMMA 2BFWA 4Y7DA 3FOAA 4QUGA 1CBUA 3F6RA 3LH5A 3PNVA 5EUCA 1SXIA 3JQ6A 2VQ6A 2WM9B 1QVZA 5EXDA 1U5BB 4MDYA 2M2IA 2P62A 2XZTA 2V8OA 4KK4A 5BUZA 4FLEA 4G5OA 2JHCA 2QDKA 3QFHA 1CY6A 1FP4A 6Q21A 3WVNA 2QW0X 3D4OA 3LXXA 1OA0A 1E77A 2Q3DA 1A4UA 4K6MA 1DBVO 2O57A 1YI1A 4BAZA 4F84A 1TADA 4QUIA 4DIBA 5ADWA 4MHSA 3HKDB 3RF6A 2UUPA 3EXEA 3N6XA 4FS3A 4WWHA 3RSHA 3ZQKA 3T5DA 1N9GA 3CMCO 3K3PA 3SAJA 3KQNA 1M2KA 1M1XB 2NU9A 4E6EA 4CKBB 2AV6A 4MP6A 3UMYA 3HYLA 4D4JA 1SK9A 3JQ7B 1RXVA 5DM1A 1Y33E 4B3HA 1ZGAA 2ZI7A 3HJFA 4QREA 3E70C 4YB8A 3L41A 4B81A 1VE5A 3QM1A 4EGFA 1KMNA 4RMJA 2IOQA 3PJRA 3L8FA 2PQ6A 2OBNA 2I6FA 3GLHA 4XFKA 2IH2A 5C8DA 1CJVC 1Q1GA 2ZAMA 3ZKWB 2O2ZA 1SHLA 2XRFA 1WCXA 2GO1A 3CEMA 2F3QA 2JGEA 2Y2VA 5JC1A 1U0JA 2Y9PB 3GNTA 2V6MA 4ZCPA 4B8ZA 4DY6A 2FMFA 1QO0A 3SNKA 5G0UA 4OL9A 3P2OA 2WILA 2QT0A 1HYEA 3VPGA 3VX4A 3BHNA 3AXSA 1QXSA 2FCRA 1KAMA 3VR1A 4RESA 1H3NA 4O2BA 2Q7OE 1IATA 1T4DA 2MJLA 3AR5A 1II8B 1M67A 1MJFA 2D3WA 2ZZMA 2ZSUA 3G0GA 1QFMA 3DWEX 2ECFA 3PA8A 4R3UC 5C1IA 5CCBA 4BKOA 3E23A 5AK6A 4M21A 1TEXA 3WQQA 1U8FO 2GEJA 2Q6OA 2CNWA 2J5RA 4U7PB 2GM9A 1JAHA 2AG1A 4PGGA 3HMKA 4KWHA 5T4EA 2ID7A 2BONA 3H75A 3QFSA 3ZIAD 4HNRA 1R9NA 4MRMA 5HF6A 3KZKA 4RWZA 4EB6B 2IU4A 4IZOA 1PUJA 3BFPA 1M66A 3MFQA 4RENA 1MDFA 4INJA 1NZFA 3DSRA 1W5EA 5EI5A 2C1ZA 3HRKA 4HS4A 1W0KD 2QTRA 3VJMA 1O57A 1YQUA 3FYDA 1NJSA 3EWNA 1PLJA 2BV3A 1NYTA 4P7JA 2G4CA 2YXBA 1T2NA 4F6LA 4NE7A 2VUTA 2IC5A 2JBAB 2CLKB 2JB9A 2R1VA 2D1QA 2FXIA 1PS9A 2IYPA 5HS6A 3DWIA 2DLCX 5IH7A 4RZXA 2FX5A 4HXFB 4DNQA 4PNPA 5J1TB 4K6KA 3RARA 2EG5A 3OT5A 4NCIA 1QRAA 5CFQA 5JYCA 5GV8A 3E1KA 1A2QA 5KI6A 1KDOA 3NASA 3NNDA 1XHLA 3INTA 3K9NA 4J3JA 3PZRA 4LE2A 4XWYA 1Z63A 1ODIA 3I8XA 2PVSA 2W90A 1P81A 3PE4A 3M9LA 3IQIX 1ECPA 2XIJA 1ZG3A 3DUFA 4MINA 2FEKA 3A4MA 3OQIB 3RF7A 3T06B 2A0WA 3ZZTA 4ZK2A 3MMSA 2DUMA 3QVMA 3P26A 1NAIA 4O4HB 4EGCB 3IVCA 3N7TA 4HLNA 4BN4A 2FSFA 2G63A 3LT4A 4U2GA 3T1YB 1GV1A 1BJRE 3FLEA 2WWIA 3WTBA 3L46A 4P3XA 2F17A 3QEKA 2GXSA 2RJNA 1SEVA 4H7FA 3G2OA 2W6OA 3IJ5A 2HSDA 3S99A 3PQ4A 2VLBA 3JWGA 4PCVA 1UBRS 6AT1A 3NCHA 4PAMA 1QORA 1ZQ9A 2VXBA 2Z9CA 3P2JA 4JD5A 4MGIR 4ZO7A 2XRMA 4EY3A 3AG5A 3IHLA 1SD5A 2ODEA 4Y2VA 1QTQA 3MJHA 3V4FA 2VP4A 1I7PA 4LHVA 4LF9B 5GZ6A 2IS4A 1P1FA 2XUJA 1NFRA 1YU6A 2JARA 2QVCA 1WP9A 2ZSEA 4A2QA 3KB2A 2ECKA 2VWQA 1NATA 3DHNA 3OJWA 3WP0A 1CD5A 3BPSA 4PRZA 3T7JA 4ECEA 5KJCA 2A0UA 5A3RA 2HQSA 3ZCVA 1MEJA 3W3AH 3PCRB 2O1EA 1QKIA 3FPFA 2BR3A 2PIAA 3TCXB 4CVNA 2DEUA 2V3CC 1G2IA 1I5RA 3G2LA 3L82B 3U3ZA 2AZMA 3F49S 1FRFS 5EUQB 1DB3A 1WCIB 2VJYA 3KR9A 2HM7A 2YW2A 3CRZA 3PLRA 2C31A 4JJGA 5EP2A 2VNIA 1VA4A 4LZJA 4MI6A 4CU2A 3AILA 1NONA 3WZ2A 4UTNA 2MTBA 4G9BA 3KB8A 4BMVA 4XB6B 4RS4A 3ZXSA 4U6SA 1T1SA 3LGSA 4FWTA 3BBLA 1DBIA 2VCYA 1IZ9A 2QX6A 2CVPA 3UAWA 1UBNA 3V9AA 1PT5A 2RHCA 4B9EA 3BEOA 3R3XA 3OIYA 2RJ3A 4FUQA 1PNVA 5FEUA 3A4NA 4B43A 1T8UA 2PMCA 1T6BY 3D6FA 4Q6WA 3S2SA 3NVMB 5CU7A 3VU9A 1TLTA 1V7CA 3RU2A 1PT8A 1QYXA 6REQB 5GZ3A 3FGOA 4FR0A 2QTGA 4Y6GB 4OLFA 2GTPA 1JKMA 2GZHA 3B89A 3QE3A 3V8EA 4ZJYA 3A2LA 3OC0A 4O4JB 5LJIA 1W48A 2L2QA 2VBGA 4KLAA 5IARA 4HQ0A 4EUSA 1EUZA 2B9VA 4D99A 1WDMA 3L7IA 2P6RA 1L5QA 1KXZA 4L4ZA 1UJ2A 4CV0A 3KU1A 4FOPA 2OCPA 4LF5B 2QYOA 3BGVA 4YMSA 4LDZA 4G5SA 4Q12A 1UKCA 2O50A 5D3KA 2X0DA 3H3FA 3NHJA 5EQTA 5ICFA 1MABB 2WYOA 3SQNA 2Q3EA 4AG3A 5HKKA 1P0FA 3EDYA 3N2KA 4LHXA 4NCNA 1Z16A 5DNVA 5FLKA 5TJ9A 4G1VA 2QU8A 1KOGA 3TQOA 2WJ4A 3FXAA 1OU0A 4JDUA 2R7LA 1RRFA 1COWD 3W2EA 5BXQC 3W6UA 3GRVA 1Q21A 4QVKA 2WA2A 3OECA 5CBPA 5A6VA 3ZDZB 5HGXA 4WLOA 2C9BA 4MDEA 2RIRA 2C99A 3ER9A 1E8MA 2CJXA 4EKNB 1M8KA 1ZZEA 2H0AA 2J4FA 3AK4A 5C4MA 5FEMA 3GRCA 2CXUA 4NQZA 3T3NA 1Y42X 3RTAA 5G4KA 1QIIA 1CFJA 1QIGA 3DFFA 2EL7A 4Q66C 4JENA 4WCFB 4O6VA 5G0TA 3JARA 2ZE7A 1USVA 1V1JA 4CMAA 3G13A 4D4MA 2W70A 1FYXA 3GJ6A 2WINI 3JQAD 4L4UA 4YCAA 1GPYA 3GHHA 3OCXA 3LW7A 1KYYA 5FAKA 4MVJD