3BL5A

Crystal structure of quec from bacillus subtilis: an enzyme involved in preq1 biosynthesis
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
213
structure length
195
Chain Sequence
KEKAIVVFSGGQDSTTCLLWALKEFEEVETVTFHYNQRHSQEVEVAKSIAEKLGVKNHLLDMSLLNQLAPNALTSTFVPGRNLVFLSFASILAYQIGARHIITGVCEGYPDCRDEFVKSCNVTVNLAMEKPFVIHTPLMWLNKAETWKLADELGALDFVKNNTLTCYNGIIADGCGECPACHLRSKGYEEYMVMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Queuosine biosynthesis protein queC
publication title Crystal structure of QueC from Bacillus subtilis: An enzyme involved in preQ(1) biosynthesis.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 67
structure length 195
sequence length 213
chains with identical sequence B, C, D, E, F
ec nomenclature ec 6.3.4.20: 7-cyano-7-deazaguanine synthase.
pdb deposition date 2007-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06508 QueC Queuosine biosynthesis protein QueC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3bl5A00
1COZA 4ZT3A 3AL0C 1N78A 4MW1A 1H1TA 2QUIA 3GMIA 3TZLA 1NUQA 2J07A 4HJXA 4ZT6A 1PFYA 2J08A 2EL7A 3NBAA 3G59A 3PNBA 3KFLA 1WQ3A 4R2LA 4QBTA 2CUZA 1VL2A 1N2JA 3ILVA 3X1JA 3FI0A 2HMAA 3QTTA 3FIUA 4KR6A 1JGTA 3MLAA 1EFPA 5TEWA 2I1LA 5TEVA 1N77A 1WQ4A 3D6UA 4MVYA 2CYCA 3U1VA 4R0NA 3FHJA 3ELBA 3COYA 3PXUA 3CLUD 5FNZA 1YUNA 1O6BA 3A4IA 1S4MA 4ZT7A 4J75A 4AS1A 3SP1A 1NUUA 2OV4A 3Q12A 2QTMA 4I6GA 2X1LA 5KCMA 1YUMA 1T6YA 4I6EA 1MOPA 4YP7A 3HGMA 3G5AA 4A91A 3N8HA 4MAFA 1ZH6A 3CVVA 4DDHA 2VTBB 2WSIA 3IMEA 4MUEA 1VBNA 3TS1A 1QJCA 2PXHA 1MBZA 2JANA 3GLVA 3ND7A 3L93A 3DPIA 1KR2A 1O96A 2A1TR 2IJGX 3H9CA 1QRSA 3IOEA 4KR9A 4HPWA 3ZGZA 2QUJA 4PBSA 2CV2A 1IQ0A 4ZCRA 2H2AA 2QTRA 3OTWA 4MWDA 1F7VA 3AIIA 4WSOA 3COVA 1G8GA 2QTNA 1OWNA 1VBKA 3D6VA 1KORA 1JZSA 3IOCA 3HL4A 3JXEA 1WXFA 3CVUA 1OWPA 1Q19A 4EG7A 3UY4A 2ZUFA 3SEQA 3PNVA 4GU5A 3FH0A 2CV0A 1V8FA 5LLTA 3ND5A 1R6UA 1GZUA 1IVSA 2IP1A 2RE8A 1O94D 4HK4A 3BL5A 4MW2A 4PBRA 4EGAA 3DV2A 3H9BA 2A7XA 2Z3VA 3CLRD 1NI5A 2PFSA 4XSVA 5BNZA 3K9WA 2PG3A 3CR8A 1JIIA 4L2IB 1MAUA 4MW9A 3LCJA 1MB9A 1IHOA 4UZFA 5J5AA 2X3FA 3MXTA 1KQOA 4JXZA 3UOWA 2DPLA 3L92A 2D54A 1N1DA 4JYZA 1XNHA 4EF6A 2QUHA 4EG8A 1G59A 2J09A 1U0BB 1EFPB 1O0BA 3UC5A 1QTQA 3KT8A 1JILA 2BTEA 3MMXA 4ZT4A 1M8PA 1TYCA 1J21A 1JMVA 3CA8A 1WZ2A 2CSXA 3H97A 3ZJVA 4OUDA 5AHWA 5DK4A 4CDNA 1GAXA 2A86A 2V0GA 1I6LA 2A1UA 4EG4A 1EFVA 3UMVA 1EE1A 1LI5A 3IOBA 4MWBA 3SYTA 1X8XA 3IVGA 1QU3A 3PNYA 2E89A 1YIDA 4KPUB 1T6XA 3CLTC 4ARIA 1H3FA 1EJ2A 4NX2A 5KWVA 1U7DA 3AG5A 1IFXA 2D13A 1J09A 3CLSD 4MW0A 3KT0A 2H29A 3ISJA 2RD2A 4ZCSA 3TNJA 3A04A 1O96B 3KT6A 4DLPA 2BYTA 3IDFA 3SDBA 3PRHA 4XFDA 1K4MA 1RQGA 3FWKA 4ZCTA 4S1OA 1NUPA 3CLSC 1GTSA 1J1ZA 3AFHA 4NAUA 1N2EA 2DLCX 1JEDA 4JXXA 2E18A 2OQ2A 1K4KA 2HZ7A 3RK1A 4ND7A 5K0TA 1MAWA 3I05A 4K03A 1EXDA 1D2RA 3S3TA 1F9AA 4XFJA 5LFAA 1V47A 4NZPA 4CT0A 1NUTA 4MUGA 4DJAA 2O8VA 2TS1A 4YMIA 1GLNA 3F3MA 5J59A 1O95C 5JBNA 2G36A 3SEZA 2CYBA 3ZUGA 1OD6A 4KR7A 1T6ZA 1QNFA 1N2BA 3RJZA 1TFUA 3IMCA 1F4LA 4HJRA 4DDMA 1P7PA 3TZEA 1TQ8A 1KP2A 1R6XA 3ZIUA 4ZCQA 2E0IA 3ZXSA 3QE4A 4GRIA 3COWA 3MLBA 4EFKA 4JZYA 1WXIA 2QJTA 1ZJWA 1LW7A 1SURA 4ZT5A 1U3DA 4MUJA 4F4HA 1I6MA 4X0EA 4MUIA 4G5YA 3IVXA 1H3NA 3M5WA 1ZUNA 1XNGA 1MJHA 5H7XA 2DERA 1KAMA 5EKDA 2XRYA 1OWMA 1M8JA 5DASA 1F7UA 4OJMX 5KHAA 4E1AA 5HUHA 3FY4A 3NBKA 3FETA 3IUBA 1JIKA 2A1UB 1OWLA 4H3SA 1EFVB 1WOYA 4Q93A 1G8HA 1KKUA 2X1MA 1Q15A 1KH1A 4FZJA 1KQNA 1NUSA 3E27A 2PZBA 4RUKA 1QU2A 3CVXA 3ND6A 1T9GR 1QQTA 1PFUA 1NZJA 4JFAA 2D5BA 1KAQA 4G6ZA 4KKVA 4YP6A 2A88A 3ZJUA 1M8GA 1KH2A 2Z08A 3INNA 2VXOA 1WJGA 2DXIA 3LE8A 1DNPA 1J70A 1Q77A 3DLAA 3P0JA 3RHSA 3VU8A 3AG6A 1CT9A 1EUQA 5IJXA 1WXGA 4CQNA 2GOYA 2JAXA 1H3EA 4ZT2A 1OWOA 3CLTD 4MULA 1G8FA 1U3CA 3H05A 1M1ZA 4ZCPA 3ZXIA 4G5FA 1LI7A 3RK0A 1IQUA 1ZH0A 2CT8A 2PZAA 2DEUA 4Q16A 1X6VA 3HV0A 3UK2A 4QRDA 3VRHA 1GN8A 1O97C 4EG1A 5F23A 3CVWA 3VGJA 3Q4GA 1FFYA 2R5WA 2B7LA 1O5TA 2YWBA 1ULHA 4MVCA 1GTRA 3HMQA 4NAHA 1PFWA 4PY2A 1OBHA 1OBCA 4U63A 3C8ZA 4MW5A 5IHXA 1N2HA 3TQOA 4BWVA 1N2GA 4MW4A 4RPIA 1MRZA 2DETA 2GKSA 3RFFA 4MW6A 4EG5A 4L2IA 2J4DA 1A8HA 4J76A 1Y42X 3A05A 3LOQA 4TS1A 2AG6A 1IQRA 5HUJA 1WXEA 4U8HA 4QREA 4R2MA 1O95D 4PBTA 2AZXA 5K0SA 1Q11A 1PG0A 3RBAA 1N75A 2DUMA 4UZEA 1NURA 1WY5A 4AQ7A 3FOCA 4MUHA 1JECA 2CFOA 1PG2A 2IELA 1NYLA 5DB4A 1N2OA 3HZRA 2CV1A 1N2IA 2XRZA 2ZUEA 2A1TS 1N3LA 3SZGA 2NZ2A 3IVCA 1I6KA 4YP5A 1TYBE 2PZ8A 1B6TA 4EG3A 2YWCA 3OP1A 2EJCA 1J1UA 1IRXA 3COZA 3FNRA 1JZQA 1K97A 4KPUA 2A4MA 3X1KA 3KT3A 4EG6A 2Z09A 3CLUC 1TEZA 3G6KA 4YBRA 3ZJTA 1ILEA 4MQ6A 2AKEA 1M83A 1JHDA 2HGZA 2C5SA 3HFJA 5DEOA 3A2KA 1M8FA 3FG9A 1VLHA 3K32A 3P0HA 1I2DA 1KQPA 4MVXA 2A84A 1NP7A 4I6JA 4MVWA 4P2BA 5HG0A 1TYAE 5TGTA 1KH3A 3P0IA 1NSYA 2YXNA 4OUDB 1MB2A 2J5BA 3IH5A 1EUYA 1UFVA 3N9IA 2X0KA 2O5RA 2V0CA 4MLPA 2NSYA 1YI8A 2QUKA 1YULA 1VBMA 4NDAA 5H16A 2JA2A 1XJQA 1BS2A 1T9GS 3DO8A 2VTBA 1WKBA 1JIJA 1U7XA 3IMGA 1HYBA 4MWCA 2CYAA 3SZ3A 2DR2A 2QJFA 2WB2A 3GUZA 3H99A 4WNYA 3AKZA 2YY5A 2PIDA 1J20A 3X1MA 2ZP1A 1YIAA 3MUEA 5TS2A 4DE5A 5FO0A 1JEEA 1M8KA 3QTBA 1GPMA 2WQ6A 4F3RA 3TQIA 4ND6A 2QJOA 3P52A 1O0CA 1O97D 1K92A 1QRUA 1O94C 1PFVA 1QRTA 3IODA 3IUEA 5FO1A 3FDXA 4DNXA 4MUKA 3CLRC 1R6TA 3NV7A 4MUFA 4ARCA 1XNJA 4U7JA 4CDMA 3CVYA 5LM3A 5J58A 1MC1A 2GM3A 1FYDA 4MUNA 1TYDE 3N05A 3N2YA 4DDKA 2WQ7A 4MWEA 1KP3A 1WXHA 1IH8A 2E21A 3Q10A 4K0RA 4MW7A 4NATA
chains in the Genus database with same CATH superfamily
2R48A 5C5EA 1M67A 4E2WA 1DDIA 2WJ3A 4KIJA 1RRCA 4NU6A 2JIRA 1JF8A 1AO3A 1DAOA 2NOAA 3GGSA 2J07A 3WYBA 4AJ2A 3LC2O 4CFYA 4IXNA 4JYPA 1OPXA 3ZHUA 7REQB 3GARA 4JLUA 4BX3A 5KNDA 3TSYA 1OLXA 4Y9SA 5KYKA 1C2TA 4PG6A 1VB3A 3KE9A 3WV4A 3RVNA 4AWAA 4HXFB 4ZV7A 5IDWA 3QW2A 2IOQA 1E8MA 4AZ3A 3EXEA 3ADCA 2BBOA 4ACAA 1ZD8A 2OV6A 3QM1A 4D3ZA 4W99A 1X3SA 4OAPA 5E2AA 2HMAA 1FBTA 2Q8QA 1RHUA 1WCYA 4PWZA 3G49A 3PUHA 1HSOA 1M6HA 3N8GA 1XWWA 4E5UA 5LZ5A 2X9LA 1H4VB 3TNLA 3UHJA 1YACA 1UAGA 1YZLA 2O2IA 3FCYA 3RUFA 3BJMA 1P5RA 2ZDQA 3ROPA 4N8EA 4TTTS 2MINB 3HWRA 4J0JA 4JOSA 2IW1A 3TL2A 1EWKA 2JLBA 1GQFA 3WYNA 3KKQA 2ENUA 4KEAA 4L0CA 4X1IA 4JJKA 1X15A 1X80A 2C3YA 1V8BA 1GARA 2PT7A 1UK6A 3ASUA 2QI9C 3PFBA 2KI5A 3VC1A 4C29A 2LD4A 4I6GA 1OX4B 4OHFA 1DSSG 4HWOA 1T6YA 2VA9A 2AOVA 1UDAA 4DLWA 3FOWA 1MEOA 5CVDA 4F8YA 1GPLA 5U4QA 4PINA 5TNXA 1M2EA 1H6DA 1ZH6A 4MAFA 1OTYA 2JASA 3SQWA 4BUZA 1IJKA 1ZL0A 4XGRA 3GY0A 3QHQA 3E9RA 4N7RA 2C95A 3HO1A 1V43A 2ZRPA 4I1PA 1LDBA 1F8UA 2FSSA 4HHEA 2IIVA 2PU5A 3RRFA 5CEEA 3EQ8A 2HXSA 3O8QA 1DQZA 3WJ1A 1BJRE 1E3WA 1EVQA 5DLQC 4MI9A 1Y7LA 3NHJA 4IBOA 4W8GA 5KDLA 1Y6GA 4BO8A 1H8HA 1U7PA 2B5WA 2X22A 1QR6A 1M76A 1C9EA 5DNYB 1XTPA 2P6UA 3DT6A 1KZHA 2WJJA 1WXQA 4I1SA 5B4UA 2HU2A 1Y82A 4BJHB 1V7ZA 1FX0B 4Z4QA 4WNCA 2PBZA 1M2OA 1G291 3G1TA 3IR5A 3QITA 1OVMA 5IAEA 4YP0A 5BW5A 2XVXA 3MQ4A 3VOAA 1N7GA 2PUBA 1LRKA 2IYVA 2L2QA 3OEED 2C7VA 2DGDA 2F2TA 2E4AA 3MRXA 4IZ6A 2QNIA 4Q3EA 1EFUA 3HV2A 4GP7A 1CDEA 5A4KA 4IV8A 1CUAA 3MT9A 5ALRA 4CL0A 4DZTA 3UY4A 2CDCA 1UC5B 3X43A 4CKYA 1ONBA 1SD1A 5F2KA 5FBVB 2IYUA 4FSDA 4YJ3B 1K5HA 4RLSA 2YBDA 1AS3A 2W6PA 4W5HA 3NVDA 1Y8CA 2SKEA 2YRXA 4JHXA 3RR2A 5HM6A 1O94D 5KC9A 1SOAA 3PHBE 5D1NA 3ZV3A 1O54A 4FT4A 4UHDA 3V5NA 1DRUA 1CG6A 3SGLA 3KUXA 3VAYA 3R75A 4ZRMA 5K01A 2GTHA 3WI7A 3KVVA 2BFAA 4FFPA 3USES 1GGHA 2E5LB 3B70A 3LXMA 3EFEA 2FPKA 2FSUA 4FOLA 1U1CA 3QLTA 6GPBA 1R37A 3WDMA 4ZVLA 1A2OA 1WHSB 2JH9A 1PT5A 2AQIA 4LQCA 2ZYVX 4PR3A 3URKA 2OD2A 2WM3A 4XM2A 4HNAA 1HDCA 2R68A 2DRIA 3PKJA 3AQ4A 2D4AA 3L8GA 3UOWA 2VPTA 3CJQA 3CJRA 2IY9A 2OCLA 2RH9B 3KYDB 3CZCA 4LCEA 1VPWA 4YAWA 3C1TA 1M66A 2XUAA 1OROA 2Z1MA 1Z6XA 4EO9A 2WFAA 4KE9A 7AT1A 3WNBA 3L4BA 1M8PA 4HR7A 1WF3A 4E13A 4ZWNA 2HM7A 4WNIA 3L77A 1ZIYA 2EF1A 4GMGA 5K8LA 4P2GA 1M1YB 4W9MC 2DFDA 2QW8A 1M10A 2OY0A 2ZIXB 4QOIA 1BH6A 4RZUA 3V4PB 3ZJVA 5DF1A 1X2BA 2G1UA 2WYWA 1QE5A 2F1JA 4K9SA 1VP9A 1JDBB 1ODKA 1Q7EA 1P5JA 1KEVA 1HWYA 1LI5A 1F2DA 5EP2A 3VYVA 5B7GA 2X15A 3SYRA 4GM0A 5L3VA 3CO0S 4XAQA 4E5VA 2JLZA 2ON6A 1JKJA 1U1GA 3DE5X 1XQXA 4XB2A 1Y1PA 1W0KA 1H0HA 5KI6A 1TA0A 3MA0A 4YAUA 4M98A 1R5JA 1U7DA 2GN1A 3OLCX 3C1OA 4I50F 3RS8A 3UANA 4L0DA 2GFIA 5LUAA 3L43A 2ZWPA 3RRZA 3UMBA 2B8WA 2Z95A 2DULA 1G4HA 2QL7A 3AP2A 1U7ZA 3F1KA 1XMOB 2VDQB 4LMAA 4N3AA 3OTQA 2I1VB 4INZA 1ESNA 2QTLA 2I55A 4TT3A 1NL3A 3H0CA 3WB1A 2AUNA 2PO7A 3SDBA 4RV4A 1RI1A 3II6X 2B94A 4NOMA 1PV4A 5KOJB 2OBBA 2JI9A 2DUNA 4JJ4A 5A3JA 1QZUA 1D8AA 1W85A 1DIAA 1G6Q1 1GCAA 2C8LA 3H5AA 2ZPAA 5ALFA 2IV2X 3U7QB 5AJYA 3UHOA 1KMNA 1B6RA 5DGHA 1CULC 3IUPA 3UT6A 1IEWA 2J0VA 5TPWA 1GA4A 1QONA 3T3NA 5DHUA 3JD1A 1RWNA 3TQTA 4M53A 2FPGB 521PA 2JJQA 5HF5A 1E6CA 1D7AA 1E69A 2F3QA 2YINC 1FTSA 4KMOA 5JQGA 3N2ZB 3GEPA 3C6MA 3WK9A 4GX5A 2OOKA 4R2XA 2J9XB 3DDHA 5JBQA 4BEBA 5KQGA 1TLTA 2GF2A 2QYSA 1ZR4A 4LJ7A 1T8RA 1NQAO 2EHDA 2FN3A 1IPEA 4NCNA 4Y2JA 5I7WA 3F5QA 1O95C 3AF2A 2PQ2A 4OAQA 3K0AB 1E2BA 5B55A 4OJTA 3LUDA 2PBRA 3U31A 3V46A 2H3HA 2CYBA 2YW2A 1GTMA 5K0JA 2YXEA 5EMLA 2ORVA 1Q44A 2YW9A 3DTVD 4UAJA 3TBKA 4FU0A 3SSAA 1HF3A 2D4HA 2HTEA 1M2JA 3G0OA 3QOYA 1KE1A 2PWZA 3W04A 2YKGA 1PVDA 1L8LA 3D6FA 4BNLA 1Q3KA 2VSQA 3R23A 4NNJA 3I6YA 5C5CA 2GWHA 3IHLA 1UM9B 2K4MA 4ZCQA 3AVYA 3C98A 2Z98A 2SCUB 4GIBA 5IVHA 4AECA 3GWZA 1R5BA 1K7SN 3LUCA 2VK4A 2PLNA 5BNTA 2PJDA 3YASA 2J0UB 3A6ZA 1L5YA 3D8SA 1DEXA 4MEJA 3TUJC 3R20A 5I4BA 6Q21A 2QTCA 3VJKA 3NZEA 1NWHA 1Y98A 1E2EA 1SY7A 1YL7A 1H3NA 2XUZA 2ZRNA 4IHJB 5HF6A 3J80A 3ZDBA 2MSKA 2PHZA 1Z63A 4YMTA 5LOVB 1QHSA 2IUYA 3OFNA 2RGDA 1M8JA 3FVRA 1D2AA 1UJNA 3F90A 2Y4NA 3NBKA 2XUDA 4FS8A 4NV0A 4LSGA 3ZU6A 4EA9A 4H3SA 3PXCX 4B5KA 5JNTA 2JAWA 1D6NA 4GWLA 2BZ1A 1TT5B 4JQZA 4AZWA 4CTKA 1XQYA 2AC2A 5EUBA 4U0JA 1KKUA 4OQYA 2P75A 1IBMB 3R0QA 2QRQA 3E22B 5BV7A 2YOHA 4O8CA 1HDXA 4PYKA 3TEFA 4MV4A 3E15A 1E98A 2O50A 1G3MA 1V39A 2R62A 2BEUB 4RUKA 4TWZA 3TEJA 1C4KA 2XUIA 1NZJA 1IC6A 4JGGA 4KFUA 4CM1A 3CURA 3IQFA 4Q34A 1R0XA 1T26A 4JI4B 1UMDA 2O2SA 3BGOS 5BW6B 4Z7QB 4R1OA 3AF0A 3IEXA 4FUTA 1GZ3A 4B32A 3MCZA 4O25A 2PAFA 1Y9ZA 3UWSA 4LDJA 4BWYA 1WD7A 1NVUQ 4V39A 3U44B 5FIUA 2ZBGA 4L28A 1XCMA 3N0WA 2ZCUA 4QM7A 3T95A 5C35A 1NVVQ 2MSLA 2JGDA 4LCBA 4TRRA 3GNQA 3K3PA 2V0NA 4RVCA 4FC7A 2D0PB 1SVKA 2WA2A 3BZUA 1LI7A 4UHKA 4L4XA 1XROA 3GT3A 5HTKA 4XJXA 2NSDA 1C1YA 2R66A 3COSA 4QXQA 2I3DA 3SYNA 2H9YA 1EXNA 3C15C 4ZZ2A 1RQLA 1Q3TA 4KQXA 2GK6A 3LG2A 5U4XA 1RBQA 4F96A 3L0OA 3QELB 4OFWA 2ACKA 1WCV1 3G7UA 1EJBA 3ZWNA 5BR1A 3U2QA 2ZULA 3KAQA 4FZVA 5JLAA 2RGYA 3LT2A 3RIEA 3NCHA 2MSWA 3NHSA 4C7MA 2OBNA 2J3IA 2XUPA 5KNBA 1JA9A 1OBCA 2ICAA 2YS7A 3FWHA 3UCEA 3BQNB 3ELWA 2VJOA 4BWVA 3L6DA 2ZRQA 1GV0A 3KEQA 1QAMA 4L75A 1FFHA 4UEJA 2VEDA 2VH5R 2RGNC 4X60A 5CB4A 5LQAA 1KOFA 2XZOA 2XT6A 1VZ2A 4Y6SA 1CY1A 4UHHA 1TAUA 4TMTA 5LKRA 3SHOA 4PZAA 1MCZA 4D4JA 1RAEA 5BN1A 4DM4A 2PE5A 3VOBA 3KPJA 3A06A 4R2MA 8GPBA 4RQBA 3AF5A 2Q1TA 2EJBA 3I45A 5K0SA 3VH3A 3M83A 1OC4A 1BO6A 2PRJA 1N75A 2DUMA 1QIMA 1U2RA 4S1TA 3CX7A 1EVLA 3FOCA 4JROA 3HH8A 3GP8A 2WBLC 3BWEA 4I4TB 2QTZA 5KDOA 1AO0A 3GA7A 1Z2CA 1ZO8A 3HDHA 4Y6GB 3AJDA 3H7AA 3MNFA 5FD8A 3RARA 5DI3B 3LO8A 2XCUA 3B3QA 5JH7A 3NBUA 2EYUA 2AI1A 3REGA 3TFWA 5IKXA 1N3LA 2G5CA 3RIXA 4R31A 4L4UA 4TZ0A 3TN7A 3HPQA 1SC9A 1JR6A 4ZARA 1XPOA 3BL6A 1KEPA 3B3GA 1G16A 1QR2A 2EW8A 2C4WA 3JRNA 4FBLA 4NF2A 1R50A 3CF0A 4UCFA 7REQA 4PRZA 2EQBA 4MB6A 2V7BA 3WQQA 3COZA 2HRQA 3E6AA 1ACJA 1SKQA 2G6BA 3P9PA 1CJCA 4IGKA 3NJ4A 4H60A 2GM4A 2QTWB 2D62A 3SEFA 4E51A 5K4GA 4DWOA 3IJ5A 3TLZA 4KV9A 3NV9A 1E1KA 4NYJR 2WPDA 2W8BB 2NAFA 3ACDA 3T3IA 5CNIA 1P77A 3ZX4A 2DFTA 2YR0A 3FMVA 4J03A 2OFFA 4IEIA 1I0IA 4N18A 2C2WA 4IDEA 4B83A 1Z4QA 1ZMTA 2K6GA 2IYTA 3FKSD 1S2LA 4DA7A 1IJBA 2CXSA 2GYUA 1EDOA 4UDOA 5HILA 4B87A 3EQ9A 3N76A 3K05A 2WUGA 1N5KA 4FMDF 5F12A 3TECE 1V2GA 4RTSA 2EL9A 4LF8B 2LCIA 2YJ6A 1ENOA 1K3FA 2A84A 2AYXA 2MINA 3MB5A 4B48A 4Q9LA 4Q4AB 4A2QA 5DSTA 1NR5A 3IYLW 4JI6B 2DPMA 4CLDA 3HP4A 3RNLA 10MHA 2P3OA 2FWIA 2GXUA 3GUUA 3NHAA 1L4BA 1WVMA 1U7HA 4UEWA 1L5HB 1MX5A 1ULUA 4ZJYA 2J9RA 4CCYA 2G5GX 1Z6PA 3DHWC 2ZJAA 3Q3GE 3E9MA 1VPEA 4S0ZA 4TLAA 2COEA 2IS4A 3ZY5A 5AVQA 3HY6A 2WNSA 2ACVA 4U6NA 4KE6A 4LWQA 4PVCA 1XPJA 1U0SY 2R6CA 4NI5A 5JXJA 1T9DA 1Z47A 2BI8A 3D7RA 1K06A 1YTUA 1A76A 1V37A 3RBXA 4KR2A 4GL2A 4IS3A 2W6NA 4IDBA 5IAGA 4E30A 1QP4A 2QYHA 3DA8A 3D6TB 5DNAA 4AG6A 2OFWA 3WTCA 5JD4A 2PIDA 1E1QA 1YZFA 2NZYA 3AETB 3AKZA 3P7MA 2JBWA 4D4IA 1JEEA 4RY2A 4BMSA 3SSOA 3EA4A 1FX0A 1P81A 2PD3A 3N1UA 4N5IX 1GNSA 1L3BA 2VC2B 3HUTA 1Q6YA 2GJ9A 2RGUA 3FSGA 5FTKA 1M5TA 2AOTA 1C0PA 5EPOA 4GXNA 1D4AA 4OY3A 2YL2A 2JCXA 3TB6A 4GOND 2ZBDA 3DXZA 4CM8A 2PQ0A 1Z7BA 4R2IA 5KYTA 3GA0A 3SX2A 4EFDA 3VBCA 1KK3A 3CUWA 2GGSA 1KIFA 1OT3A 1YQTA 4MK4A 3F6EX 4YUVA 2HA5A 2VUTA 1JRLA 3NUGA 4IUCS 4OMCA 4MWEA 1VP3A 2KWIA 2R6ZA 2Z9CA 3DVQX 4JBXA 4LN1A 4TYPA 4HDMB 2Y2UA 2OAP1 3SJZA 4YV0A 3LMKA 4PANA 5F2OA 1BX1A 4JB8A 2EXXA 4KQIA 2XMGA 3MEQA 1SKUA 3DLCA 5EXEA 1T2CA 4NATA 4XX1A 1L7VC 3U19A 1VHTA 1OJLA 3FBWA 4ND2A 1YVDA 2NU6A 4WLNA 1T4CA 2QUIA 3E4DA 4FBMA 3WBKA 3AFGA 5SICE 1NUQA 3R7FA 3CIOA 2J08A 4PLHA 4B09A 4CLHA 3GBPA 3PCRB 1QGDA 2IYSA 1UJ4A 4Z4FA 2B5OA 1JBKA 1WHSA 4DIBA 4DV0B 4QOHA 4BBPA 4KTVE 2PX0A 3URMA 3G0DA 4Q9NA 3CMMA 1BE1A 1VL2A 2ERXA 1KPHA 2C83A 1ICIA 5EUCA 3GLGB 2BDEA 4PSCA 3MLAA 3ONEA 3DMRA 2UXBB 3KYDA 4H6WA 5G1PA 5A3SA 5EJ8A 4TKUB 1YB5A 3PC6A 1KOJA 2MR5A 3SQNA 4OK5A 2Z8ZA 2GZMA 4UUNA 3ZWDA 4C2UA 1OI7A 2NLOA 2VVTA 4LBVA 4P6VF 5TT1A 4E7PA 1QDLB 4ER0A 4YJGB 4L73A 5CITA 1M1YA 1D2MA 2HGSA 4CM3A 5AM3A 1GEEA 5H0IA 2ZIXA 5HOQA 5LXTF 3RRYA 1ND6A 3COYA 4UD2A 3B6ZA 2PQMA 2BEVB 1XZEA 3CISA 3ID6C 4IYJA 1O6BA 4WBXC 3H11B 4YP1A 1VG0B 1XP8A 3CKKA 4BVHA 2FZWA 2PKWA 3WYCA 2RHMA 3BXOA 4AJKA 4DBLC 1ZA2A 4DFDA 4PX2A 4F2DA 4K6KA 3M1IA 4U7TB 1RKBA 1BWRA 3D7KA 1TTHA 2P4QA 2YOGA 1QVWA 4YT5A 2PT9A 1RC0A 3P9ZA 1N8SA 4Z4IA 2D0IA 4YP7A 2ZRGA 3FB4A 3TXYA 4EW1A 2WWVD 3TNDA 1KYTA 2XY4A 4Q0MA 1E9SA 2FW0A 3EEQA 3A6GA 1HH4A 3FRJA 4IDFA 4KIUA 2P3QA 2CVZA 2BY4A 1JEJA 2W93A 1XZLA 2WJPA 3PHHA 1QCYA 4JKIA 5DXAA 5B58T 4DA6A 2VTBB 1QV7A 4Q9DA 3UC9A 3U39A 2P2GA 3E9ZA 5A62A 2R8YA 4BJ1A 1QG4A 4OX9B 1W4LA 4UM9B 1SHJA 4XQCA 3OJWA 3OAAA 1HYHA 3F3KA 2VZ8A 3NEAA 4L5AA 5JPIA 1V8PA 3HJAA 2AWOA 2J7PD 3OFVA 2JFFA 4XDYA 1TAQA 4GI7A 4LDPA 2INGX 2CLHB 3P9QA 4IOMA 2FJPA 2ZREA 4KMMA 5CDFA 2PZJA 4EHAA 1CV2A 2OCBA 4YQFA 1VRWA 1F6BA 1DQNA 1U7TA 4GD3Q 2NVWA 2YYSA 3ADDA 4I55F 3KVRA 1UZUA 2XADA 3QHAA 1NBMD 2FPGA 3JVVA 2SNIE 4FK8A 4NPHA 4QUAA 5LP6C 3UPDA 4CL2A 2JGFA 1GPBA 4LF6B 4BTLA 1UK7A 2CLEB 1P9RA 3A9SA 3H1EA 2DVMA 3P4YA 4IY1A 3HL4A 4MKZA 1LB1B 1TZBA 4O63O 1TXGA 2NZ8A 1UUFA 4J2OA 4JK3A 2WF7A 2V3WA 1TC1A 4BC0A 1R4ZA 2GO1A 4D0NA 1OI3A 3M6LA 4ZQCB 3K0AA 4ZI5A 3G2OA 1PZNA 5AK3A 5G0UA 2ZB8A 1T4MA 1R6UA 4P86A 3RT1A 2R8ZA 1XNQB 2IPXA 4KE8A 3SBOA 2R0QC 3BL5A 3JYQA 4QASA 4MPDA 3RANA 2FDCA 1DRVA 1CR2A 1F1BA 2X76A 2TMKA 3ET4A 3ICWA 3L7DA 4M86A 2LCQA 4ERXA 3JAKB 2V5UA 3KFVA 3WL3A 4UPEA 4DADA 2UXCB 3PNLA 2HPAA 4JQYA 3B7PA 3EQ7A 4FDTA 1SUCA 1K75A 1XZPA 3I5AA 2R7MA 5KYVA 3W4IA 4H4EA 4Q7EA 4UNIA 4XGNA 4D4HA 4YFYA 2HK7A 1EE2A 2GVDC 3B51X 1VG8A 3PNKA 4JB2A 3VU0A 5L9AA 3JZIA 3PYLA 2J0UA 3M6FA 5HE9A 1V41E 4F56A 3GT0A 1H2BA 3U80A 5KOHA 2W42A 2P8JA 2QUHA 3IULA 4Q3NA 3ANTA 1U0BB 3B1FA 1O0BA 3B53X 1UJ2A 5B3JA 4IHJA 2ZYGA 3BMOA 3T5AA 1KFKB 4UQOA 2YICA 4J8PA 5SZIA 5C46F 2Q5LA 1PV1A 2ZSEA 5HKAA 1SUFA 3H2SA 2G8LA 1A9RA 2QP4A 4C88A 2PR2A 3GROA 4QUHA 3QLUC 1C80A 2ODEA 5AHWA 3OEHD 3T94A 3RLFA 1AJEA 3F6BX 3B3JA 2BMAA 3CX8A 3DVAA 5FX2A 2B34A 3B6KA 1DXOA 3RF7A 3FYCA 1NDUA 1TT5A 3WNZA 4JC0A 1PR1A 1Q1GA 1X8XA 2A5GA 1OY1A 4G41A 3WRXC 1QPBA 5JC1A 2XA2A 3DOFA 1G21E 3E22A 4GSKA 4TKVB 3WLIA 4DV3B 1QU3A 1ZJYA 1CFJA 4AULA 2REQB 1H5NA 3O7WA 1FSZA 5DBOA 4NY1A 2BEUA 1BVRA 3FYHA 2FGKA 2F1RA 3VVBA 2PNFA 1BGVA 1V0JA 4K6GA 5I3CA 2FVXA 4LYDA 3GLRA 3HJUA 2XQKA 5HJ5A 4JLNA 4CXMA 3ANNA 3CUKA 1XZ8A 2QU7A 2DMRA 3SX0A 2X9GA 3ISJA 1P74A 4GNKA 3OE4A 2H5JA 4EEKA 3RYFB 2O3RA 4PQFA 3T4PA 3I04A 3U44A 3PENA 2A92A 2J5XA 1M2GA 1QDEA 4RMGA 3TKLA 1J1IA 4QTUB 4ZCTA 2PUDA 2Z6VA 3DE7X 5EC8A 3VTAA 2HW8A 3I4FA 2ZR9A 1N2EA 3B5IA 1T25A 2O8NA 2VPPA 4UOZA 2P1DA 3BFKA 1N1EA 3K9NA 4FLMA 4GKBA 3T0FA 2YVKA 3V9AA 4AURA 2E18A 1B0PA 2FFHA 3AXSA 1XBTA 4M0CA 5JCJA 3TMAA 4H7PA 1R4NB 1Y6FA 1HY3A 3O03A 3WLOA 5B53A 1DAIA 4DLNA 4QVKA 4J3JA 1DJMA 1RHJA 4K03A 2XVYA 1SPXA 2I2BA 3I01A 3OP4A 5JG7A 3V7YA 1F9AA 3QELA 3FKSA 1Z6TA 2PANA 4PYIA 5HKKD 1X38A 3QG1A 3IV7A 2BD0A 3V9PA 3KUCA 2JFNA 4XYGA 4TKLA 2O8VA 3CUVA 3Q2OA 4D0LB 4KQGA 3VDRA 1AMUA 4MYHA 1OE0A 2XGOA 3HKDB 1NVVR 3VKUA 3L79A 2GI4A 1XU4A 2Q2NA 1XZJA 2ZATA 3O31A 2PUFA 1QNFA 3O0TA 2VZEA 5KYGA 3SJAA 3S1AB 3IMCA 2MYUA 4LOLA 1Z15A 3D2LA 4P7BA 4DR2B 3SDZA 4ZODA 2G67A 2F8LA 2Z8YM 3QFCA 2HZBA 3NOQA 3VNQA 1B2LA 1HBJA 1T2VA 1KI6B 4UNQA 2ZIUB 3H2KA 2I3BA 1TYZA 3HMKA 4M1KA 1HLPA 2I6FA 4HMOA 2ID9A 4YBZA 5GZ1A 5M34A 4PQEA 3K0FB 4PX5A 5BXQC 3EY4A 3INRA 5E6RB 2GZAA 4EBFA 3NWBA 3C3XA 2H7YA 3CUTA 3HJRA 4LMRA 4LMPA 5B1EA 2C58A 5HMLA 3OKPA 5I45A 4Y0NA 4RIEA 1P18A 3AKYA 4FWBA 4UFOA 1YDFA 1CR1A 4BNDA 4IJMA 4JU8A 1OBFO 3LOPA 1U8XX 4AN0A 3RUPA 3ILXA 3SKXA 1RYNA 1T2AA 2NM0A 2VAWA 1I51A 3K2IA 1PR9A 3KB8A 3R7AA 2WTUA 2EJUA 3H2YA 5LBIA 5BR7A 3KVOA 4PIMA 2W6IA 4HQ0A 3IQXA 1VLJA 3MFQA 4JXJA 2GN9A 1NKSA 2H4WA 4W7IA 2OYCA 3WIDA 5HUHA 3KZVA 3VHRA 2YQZA 5K6TA 4ND5A 2VWQA 3HABA 1ORHA 3EC2A 2RAVA 3B7WA 3AUUA 1AZWA 4YCLA 1ZNZA 3EZYA 1SRRA 4KLZA 1VL5A 1J56A 3PT9A 2HQOA 3TIXB 4C6RA 1IVYA 4X61A 1HSZA 4MA4A 4LZPA 2JI8A 5KSWB 2Z6UA 4BLTA 3EWIA 4AFNA 2ZJ0A 3ZIAD 4DPMA 2OYSA 3QEKA 4AUMA 2H65A 5ALPA 4F72A 1QU2A 4DDVA 3R9KA 3TIIA 4XWTA 4RVFA 4YAOA 3KZNA 2B4AA 2ZK7A 4H1TA 1OLOA 2I34A 4OQQA 4U5QA 1CSEE 1Q22A 3IKLA 1G2IA 3SN6A 5KHOC 4YLGA 5C5IA 3EULA 1K7YA 3HM9A 3WHPA 4F3CA 3MS7A 3ZI4A 3K9FC 1Z68A 2VXOA 3OMLA 2XCLA 4WFKA 3EYAA 1GNLA 2WF9A 3PSHA 3CE6A 4EECA 4ZC8A 1QYDA 4DV2B 1EUQA 2Q9BA 4Q4AA 4TKMA 2A9VA 5DH9A 1H3EA 2EARA 4G1UC 4BB0A 4R40A 3Q8LA 1UFQA 3AOEA 5C81A 3HYSA 5ALVA 5LQNA 4GZMA 1ZSVA 2VJQA 2OBXA 1L5HA 4U39A 1D09A 4BO9A 1MXHA 2CLMB 3RK0A 1XLUA 3SDSA 3V32A 1C9MA 4N1AA 2BHNA 2BZGA 2N1MA 3EXIB 4YX9A 4M37A 1FQKA 3H1FA 3IUMA 1RVDA 5CXQA 2YMPA 2X58A 3QSYA 4CBVA 4IIJA 1NE7A 2V7VA 2VYCA 3MINB 4INJA 3DE0X 4Q4JB 1ESMA 4YO7A 1CUWA 3U4DA 2JJ1D 3H5TA 3BICA 1PN3A 3ZI0A 3KUUA 4QRHA 5EA2A 1PW5A 3DAFA 4GBJA 4ENQA 3AJ8A 2J9ZB 5EPUA 3RSZA 5HJEA 1BGXT 4NCJA 4ZQBA 2VOJA 2CCKA 4K9KA 5D7NA 3TQOA 1U2TA 4ZK6A 6REQB 3ZK9A 4C0XA 3F6SA 3OH8A 1SCNE 2C94A 5ENVA 2F4VB 2RBGA 1V5FA 4CN9A 3LC1O 5H8WA 3R0XA 4B8WA 3KBBA 4CQMD 3KCNA 3RSGA 2HA2A 1P2UA 3F0TA 1E0DA 1GKIA 2ZJOA 3OJLA 2IEDA 4LDZA 3ZS8A 2JIOA 2JATA 9ABPA 2CE2X 2P2DA 3THRA 2GBLA 4J1QA 5HUJA 4PX3A 2YCLA 3P20A 1FLVA 3AESB 2M9MA 3GCGA 3QXHA 2Q3LA 4AYWA 1QZZA 3NALA 1XYGA 2K5UA 4QFMA 3E9YA 2ZPUA 2P62A 3HYRA 4QOGA 4S24A 5EINA 2IVZA 4U7HA 1M6EX 3S2ZA 3ETDA 4ZYWA 3PDIA 4GXTA 2JK0A 1L7DA 2Q28A 4D97A 3K0BA 2J7PA 4JEIA 4DJTA 4O2AB 1O7JA 1QO9A 4IMIB 4DLUA 2XE4A 4Q82A 3UW3A 4JI0B 3FPKA 2C8JA 1QV9A 2C9DA 3GLSA 5DW0A 3REQA 1H85A 4WA8A 5EGNA 9ATCA 3HXQA 1BS9A 2W90A 5J1TB 2YV4A 2GAIA 2IZ6A 2XSZD 4L95C 4M9ZA 3UIEA 3VAAA 4DRZA 5CBPA 1XZFA 1ZX1A 1IM5A 3UJDA 1HTWA 3GCZA 2F1HA 1HRDA 4CWAA 5EZYB 4JJAA 3CB2A 4JMLA 2PUCA 5T4EA 4RO0A 3I8OA 1C9NA 4INOA 4J6EA 3LT4A 4AMBA 1TEZA 1N9KA 2C4UA 2Y0DA 3AY7A 2VCYA 1M6WA 3P96A 3PCTA 1CZOA 4KFSA 1N3YA 2P4UA 1MMFB 1OKKD 2VJCA 3ROQA 4KACA 4PXAA 3GLGA 2D5IA 1Q0TA 4KK3A 1H66A 5DCUA 5AHOA 2AKEA 4UVEA 5KX5F 4TKUA 3CNNA 4A3SA 2XE7A 4RMIA 3PR2B 4WUTA 1NBIA 1SQ5A 5FQOA 5SY6A 3LBHA 4QWMA 4HY3A 1X1AA 1JFVA 2GAFA 3CCFA 4AS3A 2GAJA 3KKPA 4FEEA 3TLGB 4OLBA 3CS3A 8MHTA 4YJGA 3P0HA 2XUJA 4KK4A 3WGVA 3RSHA 3HXMA 1LV7A 4NCXA 4JX9A 3PQDA 2BEVA 1G8PA 3FPHA 3PKIA 4X20B 5B7PA 1AHPA 4RTJA 3F5SA 3P0IA 5F3RA 4X97A 2D59A 3T54A 3DV9A 5JSKA 1T5HX 2W6CX 4OXXA 5HZHA 1WDWB 2WIKA 5J23A 2ZAMA 1ZK2A 1UKEA 2ZIFA 3I37X 4N3CA 1Q0UA 2JLAA 2V0CA 4G0ZA 4EHIA 2ODAA 2QUAA 3W5AA 2VWHA 3QLVC 2BKVA 1WDMA 4G2NA 1TM7E 3JY6A 5KWEA 5EQFA 2B2XA 4ESOA 1O2DA 1SELA 1F12A 1EX1A 1GUZA 3N7UA 3DEHA 1BS2A 2CHQA 2VTBA 4D81A 2HA7A 1QGOA 2OV3A 2XEDA 1QRRA 2LIVA 1CUHA 1Z4PX 2WM9B 3E53A 4XUCA 3DXFA 3U3ZA 2D2XA 2QRJA 1LWNA 1KVTA 1X7XA 2XAUA 2XWQA 4ZO9A 5AVJA 5J40A 3OCVA 3ULKA 1DUIA 4YDHB 1AXGA 2DYKA 2ZJFA 3BMQB 2W98A 3L01A 5M2QA 2XXAA 1D1QA 4DA8A 1Y7TA 2L82A 4EJ0A 4WNYA 5ECDA 1GT6A 3JATA 2PZEA 3ZLBA 1R6AA 3HFSA 2QKYA 4BNIA 5ALJA 5FO0A 4P5DA 4RPCA 4J1TC 2JAOA 1FVHA 1TO6A 1EINA 5FTNA 3BWBA 5DHSA 3GEIA 1SUBA 2BF7A 3CF4G 2AV6A 4HDSB 2PJUA 4TZ6A 1XZGA 1Z45A 2VJYA 2VNIA 4QUEA 5KQLA 4WEOA 4BNHA 1DDOA 4X7RA 5FTLA 5JFTA 1T3ZA 1SIUA 4TYNA 2PCLA 1RJ9B 2EZUA 2W2KA 2YY7A 3NV7A 3OOYA 4IX1A 5BQ3A 2FCRA 1CUJA 2BFCB 2WAYA 3L46A 1T8TA 5A5FA 3WFJA 1KNXA 1OV6A 3F96A 1XMPA 1PLLA 2HIHA 3G2KA 4G0YA 1LNZA 4LRTB 2E21A 2VSXA 3HB0A 1ZN8A 1DKQA 3WRYC 3GEHA 1IBRA 3AJRA 3H16A 5JANA 4LFAB 2PTHA 4BVGA 5LDDC 3RIYA 3RFXA 1DOAA 3DYVA 1I0LA 3SC2A 3AL0C 3JVDA 1SXJB 1IPHA 1Q12A 4LS3A 5T4BA 3TYXA 1FXSA 1O77A 3JAKA 1AKMA 4KL8S 1JAIA 3ESQA 3FMGA 4R8MA 3RS9A 3PUZA 1MLDA 3TF5A 1WUHS 2O8EB 2XZLA 2IOHA 5AOAA 4X6LA 3BSFA 3ZXUB 4F4JA 3GD7A 5A71A 5T8KA 1C7FA 3PNBA 1J00A 3WLKX 4CG2A 1HG0A 3A4TA 4BE4A 1M1NB 2WPNA 5HKKA 4QBTA 1K7CA 3FPGA 5KYYA 2HPHA 4MV9A 4EBBA 2F43B 3E3OA 5JI3E 2RGCA 3GFGA 5CJPA 1VKJA 2WU1A 3V48A 2AKAB 1G6KA 3G0IA 1HKHA 2V7TA 3K8QA 4FYHA 5ERYA 4DEYA 2RH8A 2PU7A 1S01A 3BHNA 3RK4A 2KYRA 4AG5A 4QJBA 3A3OA 4P3PA 1CS0A 4GMHA 1YFKA 1WXWA 4J0IA 1E1RD 3I6IA 5AVRA 4JT2A 4MPTA 5KWSA 2CEKA 3QVOA 5ENDA 1CVRA 1L8XA 2I3GA 1J5XA 4PQYA 3WKDA 4NOKA 4CMEC 4HFNA 5KEIA 2MYTA 2Z83A 1IQPA 2OFXA 3QXJA 2VTVA 1ADJA 2IU3A 1E0JA 3AP3A 2HSJA 2IP2A 3DEKA 2X1LA 4C6TB 1S4QA 4I6EA 1MOPA 2REQA 1QG0A 4BKMA 1B43A 2AN9A 1IG3A 4AP5A 5D3KA 3DB2A 4FMCF 4FMBB 2C2HA 1F51E 2ID7A 1WB9A 2YZ2A 2P4SA 1LK0A 2BDTA 1KTVA 3ED1A 4BJ3A 1QB7A 1MBZA 2DWUA 2QM3A 1QCCA 1MQAA 4MI3A 2X14A 3SAJA 3JPWA 4TKZA 4TL7A 3RYFA 2WD9A 3GLKA 4KDFA 1QAOA 1R7RA 1SCBA 4FLFA 5HKBA 1MHTA 3V2UA 2IJGX 3H9CA 4D82A 3FTPA 3UATA 4LV5B 4ZI7B 2OHGA 3H19A 2BFMA 2YQ5A 2WF6A 3JQDA 4JSTA 1OZGA 1X1EA 3OZUA 1PGPA 3CH7A 4KXNA 1R0WA 4Z99A 2MSDB 4IDGA 5CDFE 4DPLA 3V7NA 3QK7A 2FY8A 4KH1A 4JVSB 3QNWA 1OBOA 2Y93A 1EDEA 4RK4A 4NZ9A 5H70A 1H2AS 1BWQA 2WW8A 5BR8B 2A67A 1KETA 5ICCA 3G3EA 3HY4A 3ZEIA 1ZMRA 1C4XA 4S35A 5DRTA 1H9CA 1OYVA 4NYIQ 3UK7A 1NATA 3KLPX 1WXFA 1Q19A 4EG7A 4MWTA 3E2PA 2JZNA 5AK0A 3HKDA 4M9SA 1ZD5A 3FHCB 2W7TA 3VZRA 1NI4A 4RJKA 3TPZA 5LLTA 1FDOA 4FGJA 2R11A 6LDHA 1IVSA 1QFJA 4LXTA 4JELA 4B45A 2Q6OA 2R6HA 2WG1A 4RD0A 1N34B 3F67A 4PCLA 4S1PA 3A4MA 3PTZA 1R8YA 3E9CA 4B2IA 4XQGA 1GJRA 4UM7A 2O5VA 2HHCA 1N7IA 1UIMA 4LZJA 3CR8A 4QU5A 3ZK8A 1KI6A 2IF2A 4F12A 2VA8A 4G5QA 4NARA 4B6GA 3I0ZA 3NDRA 4MW9A 1A3CA 4WK6A 3K0FA 4WLVA 1MJGA 2JGEA 2NU8B 2JVKA 1Z56C 2JD2A 5E6RA 2JJ1A 3L7AA 1J2JA 1KSGA 1MNQA 1MPTA 4NEHB 5CHYA 3ZBTA 3HUUA 5K3OA 1U98A 3GLQA 5FNVB 3W3AH 5LZ4A 3R8FA 3AH8A 3W8FA 1L7NA 3E4CA 3R0ZA 2WE8A 3H9UA 4JLMA 1B3RA 4M9QA 4WESA 5EQDA 1DCKA 4W7HA 5HFNA 4ZVTA 4N7MA 1MA0A 3KU1A 1AN0A 2I6TA 2HLDA 3V2GA 4B4KA 4XD2A 2O8FA 3LDUA 2OXIA 4K1XA 3NHUA 4JKOA 4TV9B 4NG4A 1HOTA 1JDPA 1GRNA 4ZOEA 4QYSA 1XTSA 4G0OA 2W6ZA 1R0LA 3BQMB 3DAOA 1VE6A 4ZQHA 2W4QA 2WZQA 2GPAA 3MK31 3PVSA 4R5MA 4BNGA 4CTMA 4RA9A 4PYJA 4FB5A 2RHLA 1TU3A 1Z6QA 3DFIA 5YASA 2X2EA 2C31A 1PJ4A 4MX8A 2QSYA 4FZ5A 4NX2A 2ATCA 5ALIA 4GZLA 2W9XA 2Q9UA 3KTAB 4IQ0A 1HFEL 1U8EA 4P7JA 4Z0HO 2ZSJA 1WP9A 2VIIA 5KNDH 2RDMA 4DHEA 1J09A 1DQPA 1Z83A 2UVPB 2HH9A 2MSCB 4HGZA 5ENZA 4ES6A 3EVNA 3RAFC 3RS7A 1GGVA 3DBRB 3HA7A 3PGXA 1LC0A 1MO4A 2C4VA 2GF0A 3HCCA 4Q12A 2BT4A 1SU8A 3IKVA 4RMNA 1YZ3A 2AI2A 2CLIB 2BM9A 1VL6A 1ABFA 2DQKA 1G8SA 3B1VA 3CZQA 4IGIA 4N6NA 4KRXA 2YZNA 3T5MA 4DCNA 1X0VA 1JB9A 2M6LA 1GFZA 1MO6A 2BHRA 1R16A 4WA7A 4XYBA 2X0JA 3R5JA 4LKRA 5GOZA 4YCAA 1YR2A 5LB4A 2DLCX 4II7A 1PX0A 1WVIA 3EXIA 3A2LA 4NMXB 4TMVA 4B4DA 4P58A 4MOWA 4CF3A 4UEOA 4ND7A 1TJ5A 1IIBA 4O5OA 5F7XA 1RYZA 3GB9A 1NOJA 2OAGA 3BKWA 4QHTA 2R5NA 2V45A 3VUFA 1DRJA 1QBKC 1ZXBA 4BBZA 4WLOA 4XFJA 2BISA 3C6YA 2AE1A 4NFLA 4J16C 4QXRA 4KKXB 2VF7A 4M9XA 3ZBUA 4BRWA 5I7SA 4P7FA 1N1GA 1EDZA 3IVAA 4UUAA 4R8VA 3F7NA 3NAGA 2AFHB 2BGKA 3R6GA 2CL6X 2G36A 3R9XB 4H1UA 1HZZC 1XHLA 4UMVA 4OGLA 1PO7A 1WMEA 1JE1A 3BD9A 3IP8A 2W0MA 4K46A 4Q1DA 3TLCA 4CLXA 5JTTA 1X9HA 4H1HA 1ECFA 3KHUA 2VEOA 4LBYA 5K3AA 5F98A 2ZSDA 2QTFA 5CNJA 3UA3A 4B3SB 3H3FA 2YZMA 3MUNA 5DCWA 4K8OA 5IWCA 3MTBA 4BLVA 2P3SA 4EO7A 4L4ZA 2RGGA 1A7AA 4EGQA 3R76A 1JPVA 1U99A 221PA 3AESA 3OCZA 1PJLA 3KYIB 1KSHA 1THGA 5C4MA 1W46A 4NPCA 1EK5A 3IURA 2CNOA 2WJ6A 5FLXA 4D25A 1B14A 4RKQA 5BWNA 2ZUUA 3BA1A 3IOYA 4P4GA 1M34E 3FDZB 4FP9A 5CJ2A 2W11A 3GXBA 4G5YA 5BP7A 2QQFA 2JS7A 2CY0A 5JAHA 2XX3A 3IBSA 3OF5A 3SHQA 1J07A 4EPTA 4TROA 4S2EA 1UADA 2NTJA 1GSHA 1F20A 2HBQA 1J25A 2RC6A 1O5IA 3CX3A 3M5WA 1XNGA 2Z9DA 2WKWA 2PSHA 2OBLA 4D9NA 4EABA 4RPLA 3RU7A 3WYFA 4E15A 3GGCA 4M0LA 2J8ZA 4Q1CA 2HRRA 2QUBA 4DT1B 5BPHA 1RYFA 2PS3A 5IKPA 1V4VA 2CWDA 2W2XA 2CLLB 1ZXXA 1UZLA 1PKXA 3CZPA 4DV1B 3K0SA 4V38A 3G0HA 1L6RA 3A32A 4C5AA 3G8AA 7ADHA 4KRYA 2NO5A 1IYZA 2UZIR 2O8DA 4H3KB 1RJEA 4A2WA 2P4HX 3QVWA 1T9BA 3G5LA 3S27A 1T36B 1S6YA 4W5WA 4C7JA 3SE0A 5CDYA 3R3YA 2ZM6B 1R0KA 1BD4A 1WLYA 4B3FX 1KBOA 4UBIA 3BMXA 4A8TA 2H17A 3PLNA 3A0RB 3HO8A 3LGAA 3TLGA 2NO9A 2B30A 1LCIA 4DN6A 1RIIA 1WJGA 2JAUA 2DXIA 3GNSA 2D00A 3IHWA 3LUHA 3MTQA 3Q7IA 4Y30A 3RHSA 3OBIA 3HHEA 3SF8A 2EWMA 2XD9A 3NJRA 1TM4E 2O0LA 4GXQA 4X20A 5H81A 3V3TA 3AHCA 4QGHA 3WBJA 4BV9A 3PTAA 1UP6A 4PLPA 1RZRA 4REOA 1KKMA 2V4MA 1F48A 2FWRA 3NUQA 5DWDA 3EBLA 1VJTA 2IFTA 1HGXA 3L8MA 1L3IA 3OZSA 2O2YA 3E1KA 4G5FA 2REXB 2JGAA 3X3HA 5LNK6 2PZAA 2JKZA 3HCNA 3UJNA 1ORIA 3I9JA 4AMZA 3Q3VA 4NENB 2CLSA 4IRUB 4HGPA 5JQGF 3A8TA 2W2LD 3AIKA 4IDOA 3F5FA 2DJIA 4ETMA 2WKQA 1XZMA 3GXOA 2AOWA 4A27A 1UXGA 3KQTA 2F17A 3GBVA 4QO8A 2IT1A 4G97A 1JG3A 4GR5A 4DBLE 4H35A 1XR3A 4GZ6A 4Q3LA 4RSHA 3SJCA 4BJ5A 2BH9A 2YWBA 3EPPA 4IS2A 3A6DA 3NGMA 4GX2A 5IH7A 2I4LA 4RQTA 4S3MA 1GFIA 1E1RA 2PPVA 5E7QA 1NRJB 2JGIA 4B3IA 5I9IA 2B2CA 1UOQA 4ZN6A 2Y1KA 1SCAA 4JB0A 4N8SA 2DJ5A 1GP2A 3CH4B 4G0XA 2GZDA 3R6TA 3M34A 3RFFA 5KQRA 2FYTA 2ZITA 4IG9A 3ZTWA 2IOYA 4CCAA 1T8YA 1Y33E 2J41A 1Y3DE 1GGKA 2J3EA 2W0SA 3VFDA 3WADA 4YRSA 3IPRA 4TS1A 1KQGA 5C8YA 3JW8A 2GVZC 5F3WB 5CFZA 4QYIB 4C1BA 1RJ9A 2XMPA 3UGTA 2IX3A 1A98A 2FRXA 2VWGA 5EKUA 1GL6A 3SSMA 2EU8A 1OGIA 4QEKA 2NYVA 1JEQA 1WY5A 3P2YA 4LECA 4UZEA 5CLQA 1EK2A 2HMWA 3E0QA 4II3A 4LVUA 3ON5A 4YJFB 4HWPA 4Q1FA 5CYOA 2QMQA 4MV0A 3ZE2B 1F2UA 2R3SA 4C4YA 4HVAA 2HSEA 2ZTMA 4ZVUA 3TR6A 1X7WA 1KERA 2ZJ1A 5F35A 3ZU5A 2HWXA 1XD8A 1YS7A 3NKFA 5I7VA 2HSDA 2NO6A 1ZVMA 4HXGA 4S0XA 3KYJB 4NS1A 1VLZA 3ROMA 1R9NA 4DCTA 1AA6A 2DR0A 3CPJB 4BKOA 3MPUA 4HLQB 4IO1A 4RD6A 1VCOA 2O8EA 2I3AA 2FSHA 1KJ8A 2ZW9A 4K6MA 1K97A 1VPDA 4KPUA 2A4MA 4V02A 2EJTA 3EMKA 2FCAA 1Q83A 4LZOA 1ZM2A 5LMNB 4EG6A 3AKCA 1NBME 1E9RA 2XB4A 1M1NA 3I39X 1YZKA 1WEHA 2RAFA 1DUSA 2O2ZA 2YASA 4OLFA 4BO1A 1S1CA 2NP7A 4WN9B 3ZDXB 1K27A 1QMGA 2F43A 1ILEA 4QECA 4CMAA 1XK7A 2PUTA 3S8YA 1S96A 3FZNA 1NTRA 2FW8A 2TMYA 3E9DA 4QXOA 3WOHA 2P2CA 1JDVA 3DZKA 3RU9A 2CVPA 3QENA 5DEOA 1ZLYA 1SKYE 3AF3A 3PEUA 1GTVA 1TVKA 4BBJA 3OQJA 1QQ5A 4K86A 4R9NA 4IHAA 1CZNA 2CJFA 2HF7A 1T6BY 4RGQA 1IUOA 4TSKA 1KH3A 4JVLA 3UOAB 1Z0JA 2Z30A 1BA3A 4PLGA 1DXHA 1S9HA 4XWYA 5KTKA 3LLCA 4F97A 4KJZA 5KVVA 1G7TA 2H31A 1T4GA 4Z4CA 3GJRA 3RFCA 1UPAA 5AVYA 3DWIA 3UJHA 4CF6A 3CX6A 3M6AA 3VU9B 2OPBA 2VZLA 1IXZA 1JQKA 4NCIA 4EHNA 5A6SA 3IALA 4PE5B 4JBIA 5KKCA 4QUDA 4D0RA 5CW1A 2G82A 1N25A 1DAMA 4HQRA 2R44A 1TIPA 2DT5A 1O9GA 3C2QA 1IY1A 5FR2A 4DREA 3A1FA 2HJVA 5CDHA 3DBVO 3N6VA 2QJFA 2EQ5A 2PYDA 3AP1A 5CCEA 5K8VA 2XUHA 5JYCA 3VO9A 3WIOA 4OK3A 1SCIA 5AVKA 2ZP1A 1YIAA 4EJ6A 1L3CA 4GYKA 5CB4F 1IAVA 2XB2A 3B2NA 1M8KA 3OQMA 5ECYA 3NIDB 1V3TA 3AL3A 3KPUA 5G0WA 3ZWVA 4PZYA 4WMLA 1KDPA 3FOZA 3ZCXA 3IAM1 3ZK7A 1E66A 1EIZA 2OCGA 4LWOA 1ZJJA 3X0DA 5KZMB 1L7XA 2FF5A 4KAJA 3QPUA 4JLDA 1I7SB 1R6TA 1I6WA 2QY6A 5EN4A 5EJ2A 2YIDA 4ENWA 4GZ3A 4E4YA 3L0BA 3DOUA 3S2UA 1LS6A 1MC1A 2X19A 4HT3B 3GC6A 1E89A 2IDMA 3FNIA 4L5CA 5JH7F 3G9TA 3IBFA 3UZUA 3RC3A 2PZFA 5JZBA 3ZHOA 2Q0SA 3AEYA 5HM8A 1O0SA 2DP4E 1LLUA 3VR5A 3K72B 3K96A 2WC1A 3SJ7A 1EWYA 1RRFA 2O4UX 2OXEA 4JVOA 1SM4A 2I5PO 5DHRA 4D9GA 3GJ5A 2AJCA 5AOCA 1SCQA 3QUTA 1PFYA 1DT5A 1MGOA 3M5CA 3VNAA 1HE8B 2D2VA 4LW8A 2VNAA 4R1PA 3UMFA 4D26A 1F6DA 1KJ9A 1RXUA 4GYJA 5KNBH 1FSSA 2H1LA 5DW3A 2GKOA 1XXHE 4ZAVA 1DBPA 5JS1A 4XSGA 4QZVA 3O94A 1YHYA 4FFRA 2B98A 2NYUA 2NU8A 4R2LA 3WK5A 1EFAA 4TGLA 4BX9A 4C01A 3ILVA 2GBIA 3LPDA 4JUDX 4EDHA 4EY5A 3P4XA 1YMVA 2IZZA 2IEGA 3E23A 5G0SA 1GM5A 1PEKE 2XBLA 1NMZA 4B3TB 3LIIA 2G8NA 1OTHA 2H08A 3ZE7A 1KI3A 3AR2A 1NIPA 3AEQB 2VZ9A 4PFJA 2BF4A 4RPHA 1CK4A 3OE1A 4KWHA 1UWLA 5JATA 3VNUA 3AYXB 2I6SA 4CZ2A 2GN8A 3OD5A 1L5NA 1NFFA 4TQAA 2K2WA 4Q37A 3G13A 1E7YA 3CLUD 3JQFA 1RSZA 3KQSA 5LJLA 3BJZA 5T3UA 1NQVA 3RVOA 1S4MA 5DIZA 4ZT7A 3QW4B 2BEWB 1LBSA 2I6GA 2YJ5A 4MR9A 1QTNA 3SP1A 4YCSA 2IBSA 5KSPA 3LKZA 5BQPA 3DJFA 2IH5A 3SFVA 3WYAA 4Q3KA 1ZZEA 3QA3E 4CU5A 3KB6A 3FR8A 4M7PA 3OJEA 2NU9B 3N8HA 2H0RA 4O2RA 5JARA 1H2EA 3INYA 1RZUA 1MOQA 6CHYA 3T9DA 4O0MA 2JGMA 2UVPA 2ZSHA 5JTUA 3KETA 4PSAA 4NK4A 3T0GA 3OQBA 4GL4A 1FUUA 1H42A 1HE4A 1UWVA 3WC4A 1Q7TA 2FEWB 5LJIA 2I1QA 1PNQA 2ZRMA 4CMHA 1DBRA 1L7PA 1O3YA 2BTQB 1GZSA 2D8MA 3DPIA 4QJIA 4IQ8A 3WLHA 2F9MA 1WDKA 2NO7A 4BN0A 3KWLA 1V11B 4NL4H 1R6VA 3MWJA 3OWHA 1E4EB 1PQPA 4BLOA 1JHPA 1WO8A 3HU3A 2CHUA 3QZUA 4QDOA 4I36A 1REQB 4GBMA 2XCIA 4QNMA 1EDBA 2IYLD 5IZCA 4JEMA 4CODB 2GPJA 5KYXB 2G5TA 4J1NA 3KSBC 4QOEA 1XU9A 3PFIA 2UZ0A 4HYEA 1EB8A 4F2WA 2X4GA 3FM9A 2GARA 4NR0A 1Z4OA 4YECA 4BO4A 3H8WA 3RW9A 5JSQA 3L49A 4AY6A 5I3ZA 4KQKA 2ID4A 4LCJA 3FFBA 3SZOA 4B75A 1UDCA 2AFHA 1RQ2A 3FPAA 2CDBA 4YP9A 2G77B 4GU5A 3HACA 5AUNB 4LV6A 1W6RA 4HV4A 3KQNA 1X77A 1JBQA 1UZMA 3DPUA 3RCBA 2RMKA 2ZANA 1ANKA 3IX7A 1IHYA 1S8OA 4DCPA 1G18A 4MW2A 3UUFA 4QA9A 4U2GA 2VAVA 3MMSA 3TOZA 3F4KA 2E4WA 3JWGA 4W82A 1JYEA 2H5LA 2ZJYA 2XCOA 3PR3A 4GLFA 4L9AA 4OGGA 2HQBA 4N03A 3WGJA 4OH7A 4ZA2A 2J9FB 4AKSA 4KQJA 2YH2A 1P7CA 3KR1A 4RHYA 2PWPA 2O0KA 3MCTA 3DBLA 2DF8A 5G1NA 1ST3A 2WUFA 2NQTA 1IHOA 3PFHA 4GF5A 5EG5A 2FUKA 2Y0EA 5H3LA 1KRHA 2C9MA 4HG2A 2JJ8A 1T2DA 2Z5FA 3LKDA 4MKFA 3WLQA 2WYHA 2XODA 1PLKA 1XD2B 2DBRA 1U8CB 2IYAA 2N3ZA 3CRRA 4U9HS 1F0YA 4V0KA 1FYWA 1Y8RB 4F60A 5JWHA 3NFRA 4JYZA 3T4UA 4RHUA 1QK5A 2HCBA 2CCJA 3C8UA 1XCOA 1R3DA 2J6IA 3LY8A 4LXHA 2VAXA 3D5QA 1X1DA 1SZJG 2IZ0A 4U6SA 4C3UA 5CH5A 4OPMA 4HUQA 2NXNA 3GDOA 3U4MA 2ZXEA 4IQFA 3IS3A 1GTG1 1ADCA 4IXTA 5FV4A 3KS9A 2F3TA 2PO5A 5BQOA 4BNJA 4DT1A 1T1RA 2WV9A 5C2JB 2VYND 1GAXA 3PRJA 3FYSA 1J06A 1P29A 1SG6A 2DKFA 3A10A 4PRYA 4RD1A 5HCUA 4YRPA 2IBTA 4DV6B 3HWSA 4ITRC 3DF9A 2Q5IA 3LRXA 3OE7A 4J7AA 2FPXA 1IK4A 1CZRA 2RKOA 2R6FA 5A7HA 3T35A 5B3AA 1X7HA 1JVNA 3DV0B 1CJBA 1JL3A 1T36A 2CXHA 2HU8A 4MRPA 2GERA 3MTDA 4Q4CA 4Z3KA 5IN4A 2VHQA 4IX9A 5H80A 4HATA 5LQSA 3DXYA 2OB2A 4V1CB 2E85A 2W2TA 1OHHA 3EGVA 1UDRA 4S1VA 1WV1A 3UG7A 1ABBA 1ZD3A 1LW6E 4LQDA 3GEBA 5CVCA 3RODA 2RD2A 4CTJA 3ZV5A 3WYEA 1HNNA 2Q5FA 1HLDA 1KOLA 5HZKA 4CEHB 1GAWA 5A4JA 4QJ4A 4CFZA 1ULTA 2VRWA 4R3NA 5AUQA 5BNIA 1V8OA 3GRUA 4IIFA 1NUPA 4XX0B 1GTSA 2QPOA 4N0DA 4MP6A 3ZTTA 1CETA 1Q57A 1K6EA 4CU2A 3T1YB 3O75A 1THMA 5IG2A 1Y6ZA 1NU6A 4HH4A 5LU8A 2HZ7A 3UXMA 2ZYUX 2DECA 5JYEA 3DOIA 3DLTA 3LY7A 3HXLA 2DFVA 5JD6A 2WNHA 4R83A 1V47A 5JPDA 2BFNA 2DQZA 3UJCA 2DZDA 1P5ZB 1I3CA 4N41A 3RVRA 2W6JA 4J0GA 4R54A 4YTEA 3SFTA 4RTQA 1FMLA 3KFXA 2IIBA 4ISBA 5CW2A 4RCVA 5H9VA 5DM60 1CUZA 1QF9A 3RFUA 3LWZA 1EHIA 1C3OB 5LD2C 3L40A 1R0CA 3JTMA 5F7ZA 2OGTA 3BSYA 1AS0A 2ZVJA 2B9EA 4ZAFA 3KSDO 4X92A 4OIFA 1NOIA 5CM2Z 2YV1A 4EUNA 2AF3C 1HC7A 1NY5A 2GFHA 3KPWA 4WZBE 4X84A 1WUYA 5CVJA 5BN3A 4G01B 2DKOA 4ZZ0A 1BE8A 1B23P 3L4SO 2G76A 1NYQA 2H5EA 3Q5DA 4OQDA 4UAGA 3WBBA 2QRVB 3RVKA 4DMMA 1TQ8A 3LZCA 2ZR7A 1UM8A 4ZO6A 3E7FA 2WLTA 1IEVA 4FDVA 1S2IA 3BOSA 3FR7A 3LSYA 4MLZA 4EFKA 4WE3A 1MF7A 3S99A 1OGJA 2JH8A 3X1XA 3ZGVA 1ZS9A 3DGEC 3HVRA 4MI1A 4BWFB 1I6MA 2VUIB 2V9CA 2GD1O 2I6XA 1WNTA 1YDEA 3I4CA 3QA9A 4IHJF 4X5OA 4Y2PA 5ICMA 2VQFB 3LCCA 3UXEA 4RE6A 4JWKA 3U7JA 4N4AA 2J7KA 3H84A 3EIEA 3EFHA 4FW9A 3O95A 4M8LA 3LP6A 3PA8A 3N74A 5AW4A 3L8FA 1UBLS 1QRDA 5FT9A 4KR3A 1FQJA 4KDRA 1SULA 2I78A 1CQXA 4FNGA 1W34A 2EW2A 3PL1A 1LU9A 4FFBB 1UFRA 4NBKA 3EK2A 1NJ1A 2OHHA 4L8YA 1OWLA 3MJCA 5BSTA 2NGRA 3E3NA 4TQGA 1WOYA 4UAUA 2ZZMA 3EJWA 1KZ7B 3F4LA 8OHMA 1Z6YA 2FZLA 3VBEA 1PL6A 2B3DA 2I2WA 3MJVA 2VT3A 3SC6A 3EXFB 2ASVA 2GRJA 1Y5RA 1ZD1A 2I4MA 2X3UA 3GF4A 2ODQA 3VOSA 2WILA 1Q3HA 3QG5A 3WKCA 3T38A 2NU7B 5DTIA 3BE4A 1WPQA 3ESAA 1LLCA 2IOFA 4PHHA 4ZREA 4G8DA 2ZIGA 3TO5A 3WNVA 1I7NA 5CNMA 4ARSA 2ZXFA 1VL0A 1U3TA 3F9RA 3KYBA 1T29A 2LE0A 2Z08A 4XLLA 1GPNA 1TMYA 3GT4A 1RKQA 4X54A 1BDJA 1BVHA 2HJRA 1YGPA 1OBVA 2HQRA 3WNQA 4E1BA 5LP6B 1QK3A 1ONNA 3ZLVA 1N57A 4P7GA 2BWJA 4OQ4A 3ZNOA 4F6LA 2O8BB 3EVDA 2GRUA 4WOCA 3E9QA 2H2DA 1NYRA 4EUSA 4Y7CA 3H05A 4ZCPA 2QRUA 3BGSA 3NBFA 4OJQA 4YXWD 2XQIA 3UTDA 3S2SA 1XCJA 1GZ4A 5AVZA 1OT5A 4RY8A 2DHCA 2Y1LA 2A9RA 1NSTA 1T1GA 3WQHA 2UYHA 1KBZA 1V6AA 1GN8A 2BFDA 2HJGA 3CZ5A 3ITNA 4XXHA 1YS4A 3EH1A 2G0TA 4C4RA 1TU0A 3P9KA 4XWAA 3CVOA 2EDCA 3ES9A 5EWMB 1ZIOA 5JS2A 4CLRB 2X7XA 4YRBA 1H65A 5J5CA 2QRPA 1T5SA 4MIEA 4Y2RA 2C59A 3RG8A 3VU1A 4MMZB 2C9OA 2XDAA 1L4EA 3MUOA 5JHHB 3UJ6A 3QSGA 2IYXA 4EY3A 5EZ5A 3JQCA 2D1SA 4MW5A 4UMDA 2DETA 2ZIAA 3D5EA 2LUOA 3HVHA 2E9SA 5F1PA 2KS6A 2D6FA 4V0QA 1G1AA 3U7HB 1NW4A 1RM0A 2EFDB 3QNUA 3R3ZA 4UU1A 4EAAA 9LDTA 1IN8A 4U5XA 5LLSA 2AG6A 2XNDD 5JJKA 3FVWA 5I8WA 4BU1A 1BZYA 2PKEA 4I1YA 1YK1A 4TWIA 2H4HA 2R8RA 3UYLA 3A1SA 3G0CA 2OQIA 2Q46A 4D44A 5EMKA 5KQSA 2OHIA 5HTOA 2CNBA 5TJHA 2IF0A 3GO4A 2IGTA 1EB9A 1KDZA 4QATA 1TM3E 2HIGA 1V35A 1ZEMA 5AM4A 1XZCA 4DCVA 3CW2A 1I3NA 1SAYA 4KUGA 5HJ2A 3WKEA 5ICFA 4NBVA 1A04A 2XRZA 3SZGA 5K0NA 3JYNA 5I9MA 1EAMA 1R6BX 2X9VA 4PC7A 2CDNA 4M21A 1XEWY 3UB3A 2Y1EA 3MMPA 3OP1A 4ZDIA 4G1EB 2D5CA 3D4PA 3DMPA 3C74A 2YV5A 4HMPA 4W63A 1X7ZA 3R09A 2NQ2C 4M8IA 3NUZA 3UM9A 2OP0A 4BNKA 1W581 5FPKA 4RKEA 1KF0A 3NVMB 1E5XA 1BMTA 1NVDA 2Z09A 4B8ZA 5CT4A 2VYQA 4S05A 1JT9A 2KHZA 2XGMA 1PL8A 4GEKA 1QHFA 3ANSA 2QIOA 2B4RO 2OZLB 2ZFUA 3JQ9A 2OXCA 5IEBA 2F3UA 2PKRA 3RB8A 3ADKA 5HHTA 2QRMA 1Z5UA 1K3TA 2C5SA 1T5OA 3NHPA 3MRTA 4NJMB 1SCDA 2HDOA 3T6KA 4A92A 4D9MA 3AEQA 4ENTA 4D02A 1YAHA 1DEHA 4MICA 1XTJA 1TB4A 4LGYA 4KN6A 1T35A 3OHPA 4G65A 1ZIXA 5AKIA 1YGYA 4Z0TA 2QEQA 3IIJA 3MYYA 2ZYTX 5JCOA 5SY9A 3B1JA 4EYQA 3Q7EA 4ENUA 2BEWA 1GGEA 4X1OA 1XZNA 1AZTA 1MB2A 3HA2A 5EERA 1TKCA 1R27A 5BV1A 1K66A 3N9IA 2QYOA 2AD1A 2NSYA 1YI8A 2DBVO 1GDDA 3BSWA 1QYIA 1LY1A 1WPGA 3JZMA 3UBMA 2QUKA 2CMGA 4JJFA 3AMVA 1VDMA 1K6XA 1YULA 1XXHB 1ZPDA 2NU9A 3LSTA 4IIJF 3ADBA 3IAFA 5BQXA 3SQDA 2IU0A 4FDMA 4AO7A 3OD1A 4NQRA 1J97A 1HTTA 1WABA 3IMGA 1GRVA 3IXMA 3LECA 3USZA 1U3GA 3VR2A 1A9XB 2ZB2A 1OAOC 2W2VA 1J7JA 3V8NA 1VPLA 3GUZA 4KYTA 2QX7A 3IAAA 2XQVA 1V11A 1VKOA 3FB1A 2VYNA 4OA8A 2YY5A 3S68A 4RW0A 3SNHA 5BWOA 1VJRA 4MQ4A 4U2BA 2ONJA 5BWMA 2BKEA 1IWPB 1FW8A 2RSLA 1PWZA 2QRGA 3LQ4A 2I7XA 1YRHA 3SXUB 2P9HA 1K08A 5JHGB 1V26A 2NX2A 5KYXA 2HUNA 4RK0A 3O8LA 1MV8A 4WNAB 4P5EA 5EEHA 4PHCA 3F9IA 3LBIA 3PPIA 2VDMB 2QQ0A 1B8NA 1ONOA 3IHTA 1LBEA 2AQ8A 5B1HA 2G4CA 3ABZA 4HAYA 4LMBA 3ILSA 3JAWA 2YJ3A 1XL1A 4MGIR 3W6UA 2X0FA 3W79A 1ZCFA 4BVJA 1QIJA 1VKZA 1F1JA 2CXUA 2FR8A 3LCUA 2WQ7A 3LX4A 3TG2A 5FOXA 1NASA 4H7KA 1X7YA 1C0EA 5IABA 5MHTA 3L7MA 4F38A 3DFUA 3I58A 4RSGA 1DX6A 3RQSA 1THTA 3UJBA 3DCNA 4FT2A 4RZSA 1BH2A 4E2FA 3AERB 2Y0BA 2FSVA 3LF2A 3M6XA 1H1TA 2C8VA 1YONA 3MVEA 3UN1A 4AKEA 1RT9A 1JWBB 3G8BA 1KO5A 4MYRA 4QQFA 3WLFA 2QYTA 4AO6A 2HY7A 3C14C 4KYVA 4J3FA 4B71A 2HHHB 4A8HA 2J9FA 1RAGA 3NBAA 4NU8X 4DB4A 4JWTA 3MWLA 3ZUPA 2FMTA 5DWVA 1XN4A 5AR1A 1UP7A 5GVRA 3LX6A 1A71A 3UAXA 4Q02A 3VI4B 3HUEA 3KFLA 2HRCA 3EEIA 4HDOB 1B16A 1W4BA 1P1RA 2VZ0A 4UTPA 3I9LA 3HNOA 4LNHA 3R9IA 3ME5A 1TTTA 1AZLA 1XD2A 4F8EA 3X1JA 2H51A 3DVSX 2QAJA 2BW0A 1Y8RA 1Y3HA 3FLAA 1VIDA 5FBHA 2F48A 3PFCA 2R8XA 1ULAA 1Y0BA 2GK4A 3OZCA 4FFSA 1CR4A 4C22A 2ZKLA 4XIYA 3H42B 3UOGA 1N77A 2V7PA 2QSZA 3SS8A 3MJTA 5GJCA 2ZQZA 5CLLA 5J63A 4B5LA 1ZM7A 1C0KA 1GGFA 1MQ8B 1XT6A 4QLAA 5ISMA 3DKVA 3ZVMA 3FHJA 4A8PA 3HCAA 1U0GA 5DZSA 3BGDA 3PXUA 2DCMA 3U37A 5L3SB 2EP8A 3GRCA 5FBKA 2OBFA 3H8VA 1FS4A 1YUNA 3OJCA 5FNZA 3R3JA 3L84A 2FW1A 2VRCA 1K2WA 3EHDA 4L08A 1MC5A 1ZCBA 4AS1A 3M1LA 1KXJA 1MG0A 3HBMA 1HYEA 4V24A 1XAGA 4MARA 4OGWA 2TRSB 3RWBA 2BEJA 2KJQA 2QZZA 2CUKA 3K16A 5AM2A 2I7DA 5DP2A 4YMSA 5IUJC 3LI2A 2E1RA 4L8GA 4RH0A 4UCQA 4B9AA 4M87A 4GQBA 3IT1A 4A91A 1ISJA 2R6AA 1CJSA 2B37A 2FOIA 3M3HA 5A6VA 1P33A 2BFOA 3N59A 3ODPA 4HNRA 4KODA 4DDHA 4V1CA 3TS1A 3GDFA 1B0AA 5AUPB 3O1HB 1AKQA 4JJ7A 4EP1A 4YIHA 1BIFA 2UZ1A 3WHIA 2GBCA 1I4TD 2QN2A 1DG9A 1F5SA 4R68A 4JLKA 4NZMA 2Q0XA 4YREA 3VGPA 4AJ1A 1OA1A 4R7GA 4AJLA 4KFRA 1GLGA 1SG0A 1F5NA 2GB4A 2R4TA 4NBTA 3KAKA 4ZVVA 1A4IA 4KU4A 3W5UA 1NLUA 3CPHA 3HB7A 3KZKA 4U7DA 4PBSA 2H1IA 2D1YA 3E7DA 4QWWA 5SYMA 3AV3A 1VLLA 3C48A 4FGLA 3OX4A 3ENWA 3QKRA 1GRQA 3IERA 2VSFA 1G8MA 2CCGA 2FE4A 3QWAA 4KIFA 1A5BB 1RABA 1TECE 4CQMB 3LHDA 1Z36A 2YIVX 1ZCJA 5BYBA 1MRNA 3RHZA 1V7PC 4URHA 2EEPA 2Q0QA 3BK7A 2NSLA 5C8ZA 1JZTA 4OB7A 1FNBA 1JZSA 1QTIA 3B13B 4TN1A 3BN3A 2QZPA 3KYCB 3MOSA 1DOZA 3CJTA 1IDN1 4IJVA 2F59A 3SEQA 4LY9A 4QUBA 4TT8A 4RZHA 3FH0A 1FFXB 4LXGA 3OI7A 3JQEA 2AG0A 1FSFA 1J99A 1SN7A 3EZ9A 2GXSA 1LUAA 1IEXA 2GLTA 2JFVA 2RE8A 2CFTA 3QI7A 5FUWA 3TL6A 4BOYA 5KUTA 5BN4A 3PICA 1SKAA 3I3OA 2XDQA 3PZBA 1UAYA 2GEUA 1Y7IA 1DHTA 1OQAA 4HRAA 5CH3A 1WMBA 1XRSB 2WTMA 4YRJA 1Z88A 3RSQA 1XVAA 2PKQO 4MEBA 5FLKA 3W5HA 4ZOAA 3WB9A 1B26A 3NP9A 1VSVA 2P2LA 4Z9XA 1MAUA 1ABEA 4JI5B 1MB9A 4CKZA 5I51A 1ARZA 3BXZA 4R9UC 4UZFA 4B82A 3TAXA 4CT4B 1DEOA 1MEEA 1PSWA 4I46A 4Q4DA 2WSLA 2EHJA 2IHNA 3HC7A 1YDGA 4HC4A 5L4SA 2QN7A 5CMLA 3A26A 4NBLA 3PEWA 4TWBA 2QTGA 3OZEA 4DIOA 1OFIA 4N7BA 5KU7A 1UH5A 2B8TA 1ZI8A 2IXTA 2LP4Y 3E8SA 4JI3B 1ST2A 1XVLA 3DPSA 4YCJA 1GUDA 1QIIA 1DVRA 1BC5A 3WNCA 5L3QB 3BEOA 2SKCA 4WASA 4FE7A 3CW9A 3H97A 3LL4A 4I3HA 1N2CE 3ABSB 5B7NA 4HL6A 4FFBA 1Z2AA 1Z7GA 5PGMA 4C4PA 4LFCB 4EYGA 1EUCB 4RC9A 3GA5A 3IP7A 4MGHA 4A03A 3HB1A 2V0GA 3UMVA 3W4KA 3WJ2A 1IU9A 1QM5A 2VJLA 4RTKA 4WZBB 1MN6A 1QVRA 3TSCA 4CIDA 1NNUA 2COUA 2QD4A 3QKSA 2IWHA 5MN5A 1YAJA 1KNQA 5A1TA 2PGJA 3QFSA 3EXFA 1T4BA 4PO3X 4YRFA 1C8LA 1CQIB 5K0LA 1OH6A 5GJBA 4YRIA 3KRTA 2BGRA 4TTPA 2NU7A 3UMRA 5KWVA 3GHYA 1VL1A 1FFAA 4JLBA 1FP2A 1IFXA 3AVOA 3OJ0A 1U02A 2H4ZA 2NW6A 4LG1A 4OQNA 4HUTA 2VAMA 1L4HA 5DWQA 2TECE 3ANYB 4DMUB 2OC9A 4D4GA 3LNTA 3ZHQA 3CZRA 4ETWA 5KJ6A 1L1RA 4AAYA 2FXVA 3B6IA 2O1XA 2TSYB 4P82A 1H05A 2OGSA 3EVZA 5C34B 3OPVA 3PEEA 2VBCA 3TNJA 4DCMA 5K09A 2OMKA 2IKSA 2XQGA 4Q9AA 3ZS9A 3IDFA 3I1IA 3T3PB 4UAVA 2BMFA 4TSRA 4X85A 1D8TA 1WZNA 2X13A 5BUZA 4NFSA 1RCFA 3FWKA 2WTNA 4BKRA 2O8BA 2G08A 3CXRA 2Y05A 1EP1B 1N6OA 1SHLA 5B5SA 3H6KA 1ZM9A 1WM1A 3FRIA 1W4CA 4FCTA 5DYYA 1E61A 1WU8A 1ZNQO 4ZU6X 1MV5A 3RVLA 2Q9CA 2BR3A 1G2QA 1PFKA 1YVUA 4A82A 4LF4B 1QE0A 4ZAYA 4BVFA 3NJ8A 4B4OA 2XXBA 4WKCA 4DCUA 2AN1A 5THKA 3B8HA 3MPOA 4HPJB 5IBCA 1X8KA 5HGJA 1EXDA 4IGFA 5IT0A 3AO0B 2BRUC 2P9YA 5LFAA 3G8DA 1YR6A 2RBKA 5THXA 5EWMA 1QF7A 4UVDA 1HURA 5DYNA 3T7SA 2HT1A 2V6JA 1YJBA 4YMIA 1E1DA 4ANFA 1UBKS 5E3HA 5B6PA 3HYCA 4J4TA 1DPGA 2BCJQ 2HI0A 4BNMA 3GFOA 1A4RA 3H3XA 1WDLA 2ZWAA 4G9BA 4JOQA 3STYA 1QS0A 2RGBA 4AJPA 4H6VA 2NP6A 1CUSA 3OPNA 1XN1A 2PX8A 3FYUA 3TH5A 1O4WA 2YFQA 4MAAA 2GNOA 2II6A 4N5LA 3LTNC 3K70D 1C9KA 5TV2A 2X0NA 3M4YA 3QX8A 4DDMA 1TT7A 3LH5A 4MS1B 5DHPA 1W1WA 2HRZA 4IH9A 2OK8A 1PK8A 4L16A 2PUGA 3HBJA 1KYVA 4CEJB 1B76A 4WXHA 1P7ZA 4TX1A 1YJAA 1NLZA 2EAUA 3RJTA 2WWRA 3M4NA 4Q9KA 1LWOA 3VZSA 3MGAA 1YNOA 1QFSA 3SCZA 5IC6A 1J0BA 1EFKA 2OENG 3DFMA 3JZDA 5BT8A 1U2SA 2BFBA 2Y3IA 4OGFA 1W4ZA 3W4JA 4J49A 2JGKA 3ANLA 1ZHFA 1FUEA 3RS0A 5IT4A 2ZYAA 3RFVA 4GWKA 4RF3A 4C0AC 4EL0A 4BX8A 2C7BA 4C2TA 3BRWA 3L7OA 4KXWA 1U2DA 4E6EA 4GYYA 2ESRA 3MN1A 4WACA 3IFSA 1IG0A 2HLPA 3M5PA 5K8CA 1K6MA 1KI4A 2GHIA 3DLPX 3GP3A 5DASA 3ENVA 3MAJA 4NZZA 3U60B 5JBIA 3FY4A 3OIWA 4NTZA 5JCZA 4K2AA 2QR3A 1JIKA 2GN0A 1LPAB 4YUWA 4O29A 2PN1A 2VFAA 1MT3A 3PIDA 3NBZC 2QGNA 4DYVA 4E7OA 1JH9A 2WSSA 4PIPA 5C4GB 3ZCVA 2IHYA 1TA4A 3UAGA 5JYBA 2PSDA 3EZ6A 1Q1ZA 2OZLA 4PLCA 5I4CA 1E3MA 2QN8A 4TRMA 1PW7A 4BIIA 5EJIA 4O6VA 1M0TA 4L3WA 4EEXA 1JV2B 4X95A 1DIOB 1IDOA 3HA5A 4Y2HA 1LRJA 2NACA 5ALEA 1GZ7A 5IDVA 1TAHA 3CXUA 4NJMA 4AU1A 5CFNA 5F5LA 4RK5A 2C4HA 1LJUA 4YMLA 1IMJA 3PITA 1H1LB 3INNA 4B3XA 5JW6A 5CHEA 1WB4A 1Y81A 3ZQ6A 2RGRA 2FWMX 5AI5A 3RTDA 2H48A 4MCAA 4JJGA 4C87A 5B12A 1WXGA 3GJ7A 6NULA 1TF5A 1ZJ5A 4U4AA 2VXYA 1KDTA 4ZPXA 3ODGA 1DE0A 2PGXA 1HORA 2C7OA 4R81A 4Y3UA 3HCRA 2XUOA 4AL4A 1XDWA 1CP3A 3DMFA 3AXTA 3FPEA 1JHRA 5AVSA 1BCRA 1QH9A 1RWQA 1Y3IA 4GLJA 3KOOA 4TVKA 2GHTA 1FJHA 4KWIA 3IXQA 3ORFA 5C18A 1FZQA 1X6VA 5ELXA 2UZ3A 6YASA 3I9V6 4F45A 4Z1MD 3JWHA 4OB8A 4ZV4A 3EQZA 4NBRA 3BRQA 2AB0A 3WYDA 4BP8A 4F2PA 4EG1A 3IAS6 2QG4A 2YFYA 3HVKA 3LHKA 1U8UA 1N2SA 2RG1A 3QHPA 4L0MA 4M6WB 3ZIDA 4CV2A 4DIKA 1YZUA 3AM1A 1W76A 2GRAA 1WLSA 1L4FA 3QVUA 4JGIA 2E4XA 2B78A 3RRNA 1GTRA