3BL5A

Crystal structure of quec from bacillus subtilis: an enzyme involved in preq1 biosynthesis
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
213
structure length
195
Chain Sequence
b'KEKAIVVFSGGQDSTTCLLWALKEFEEVETVTFHYNQRHSQEVEVAKSIAEKLGVKNHLLDMSLLNQLAPNALTSTFVPGRNLVFLSFASILAYQIGARHIITGVCEGYPDCRDEFVKSCNVTVNLAMEKPFVIHTPLMWLNKAETWKLADELGALDFVKNNTLTCYNGIIADGCGECPACHLRSKGYEEYMVMK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Queuosine biosynthesis protein queC
publication title Crystal structure of QueC from Bacillus subtilis: An enzyme involved in preQ(1) biosynthesis.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 67
structure length 195
sequence length 213
chains with identical sequence B, C, D, E, F
ec nomenclature ec 6.3.4.20: 7-cyano-7-deazaguanine synthase.
pdb deposition date 2007-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06508 QueC Queuosine biosynthesis protein QueC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3bl5A00
3E27A 1VBNA 2ZUFA 1JEDA 1Q77A 2GKSA 3CVVA 2QUKA 1WJGA 4KR6A 3H9BA 1WQ3A 3FOCA 4U63A 2A1UA 3FHJA 3SYTA 2CV2A 1O96B 1D2RA 1ULHA 3RJZA 2D54A 3AG5A 4DDMA 1NUQA 4NX2A 1PG2A 1TQ8A 4L2IB 1U7DA 2QUJA 3KT8A 1K4KA 1O97D 1T9GR 1H3EA 1QRTA 1J1ZA 4KPUB 2CFOA 3H05A 2XRZA 1K92A 3ZXIA 3A04A 2VTBB 2J5BA 4R0NA 4MWDA 1R6TA 3X1KA 1PG0A 3PNBA 5LLTA 2CSXA 1X6VA 2QTRA 1G8GA 1MOPA 1XNHA 3K9WA 4NZPA 3IMGA 1GN8A 1IHOA 1M8JA 3N05A 4QREA 1MBZA 2DETA 5AHWA 1GLNA 4PBRA 1I6LA 4J76A 3INNA 3KT0A 1MC1A 4Q16A 2B7LA 3DLAA 2PIDA 4MW5A 3TNJA 1R6UA 1NUTA 1MAWA 2BYTA 3RFFA 1PFYA 3UC5A 3RBAA 2A84A 4ZT7A 2Z08A 3K32A 2PG3A 1LW7A 1GTRA 4MUGA 2A86A 2D5BA 3SP1A 4DJAA 3N9IA 1U3CA 2IP1A 1J20A 1NURA 4RPIA 3A05A 1J70A 3ILVA 3KT3A 3MLBA 1O95C 1HYBA 3UOWA 1TYCA 4P2BA 3HMQA 4DLPA 3Q12A 2TS1A 2IELA 3ND6A 4YP6A 2CV0A 1OWOA 3TZEA 1WOYA 1PFVA 2J08A 1V8FA 3FG9A 3P52A 3FIUA 1KH2A 3COWA 3F3MA 3Q4GA 1U7XA 1JZSA 5FO1A 4QBTA 2E0IA 2AKEA 4EG5A 2A1TR 2Z3VA 1KP2A 4KKVA 3G59A 4GRIA 2V0CA 1MJHA 4A91A 1QU2A 3C8ZA 1JGTA 2IJGX 3ND5A 2EL7A 2G36A 1N3LA 1MRZA 2QJOA 1QRUA 1MAUA 3NBKA 4KR7A 3N2YA 5KCMA 4ZT2A 4E1AA 1V47A 4H3SA 4DDHA 4DE5A 1GAXA 4S1OA 3L93A 3SZ3A 2OV4A 1Q11A 1OWLA 1QRSA 3X1MA 3AKZA 2QTNA 4HK4A 1K4MA 4ND6A 1F7UA 2DLCX 1MB2A 1R6XA 1QTQA 1KH3A 3COYA 4J75A 4MW1A 2HZ7A 1PFWA 2A7XA 4EF6A 3HGMA 1U0BB 1K97A 3ZIUA 5IHXA 1NYLA 5J59A 2DXIA 2AZXA 1VBKA 1QJCA 3MMXA 1A8HA 2HGZA 1Q19A 3VRHA 3ZXSA 3G6KA 4NDAA 3IVGA 2OQ2A 3SZGA 5BNZA 1NZJA 4YP7A 1M83A 3VU8A 4AQ7A 1O0CA 1KKUA 3SEQA 1PFUA 1QQTA 4R2LA 2WQ6A 1H3NA 2D13A 2H2AA 1T6XA 2GOYA 5KHAA 3X1JA 2DR2A 1CT9A 1DNPA 1X8XA 1IVSA 1TYDE 2PZAA 2DPLA 1JEEA 2JAXA 4NATA 4EG1A 4K03A 1EE1A 3OP1A 5LFAA 4ZCRA 1Y42X 1GPMA 1KAMA 3MXTA 2CYBA 3CLRD 3QE4A 3QTBA 4MVCA 1YUMA 4EGAA 4XSVA 2ZP1A 2X0KA 3TQIA 1ZH0A 4F4HA 4TS1A 2XRYA 5H16A 2R5WA 5FO0A 2CT8A 2QJTA 1OWPA 3H9CA 2QJFA 1U3DA 3CLSD 3CLUC 4XFJA 3G5AA 4G6ZA 2WB2A 3CLTD 3D6VA 1VL2A 3CA8A 2J07A 1N2HA 4MQ6A 4YBRA 3UMVA 1GTSA 4CT0A 4MW7A 5DASA 3TS1A 5FNZA 1QU3A 3RHSA 3IODA 1VBMA 3NV7A 4GU5A 3SDBA 2WQ7A 3LCJA 4ZCPA 5J58A 2RD2A 1EXDA 4EG8A 3TQOA 2VXOA 5K0TA 4MVYA 3ZGZA 1BS2A 1YIDA 5HG0A 1EJ2A 1YIAA 3MLAA 4I6EA 1KQNA 4U7JA 4ZCQA 4ZCSA 4UZFA 1IQUA 4MULA 2C5SA 3MUEA 2QUIA 2V0GA 1N2OA 4ND7A 4ZT5A 3IOBA 1N2GA 1IH8A 3RK0A 1YUNA 1EFVA 4ARCA 4OUDB 1NUSA 1OWMA 2WSIA 3A2KA 2JANA 4MW0A 1N75A 1WZ2A 2DEUA 3GMIA 2X1LA 1IQRA 1M8KA 1EFPB 2PFSA 5TGTA 1YULA 1OWNA 2J09A 4I6JA 1O0BA 1YI8A 4MAFA 1T6YA 3IMCA 2Z09A 3ND7A 3ISJA 2AG6A 5EKDA 3IUBA 1WQ4A 1O97C 3QTTA 1EUYA 4QRDA 1N2BA 1ZH6A 4ZT6A 1LI7A 1O94D 5DK4A 4ZT4A 3CVYA 2DERA 1WXEA 5HUJA 4G5YA 3JXEA 3COVA 3U1VA 1JIIA 1G59A 4FZJA 4RUKA 3LOQA 1J21A 1LI5A 1T9GS 2GM3A 3ZJTA 5KWVA 4UZEA 1TFUA 4F3RA 2X1MA 3IOEA 3KT6A 2A4MA 1NI5A 4AS1A 1M8PA 3IVCA 4OUDA 4CDNA 1N2IA 3UY4A 2EJCA 1KAQA 3CLSC 4EFKA 4MUHA 1I6MA 4NAHA 1T6ZA 4DNXA 1OD6A 3CLTC 4MVWA 1H3FA 4PBSA 3RK1A 1KORA 3S3TA 4CDMA 1P7PA 2YXNA 1EFPA 3IDFA 1F9AA 1JECA 3CVXA 5H7XA 3HZRA 3TZLA 1JHDA 4EG6A 3IH5A 5HUHA 3FWKA 3FNRA 4WSOA 3AL0C 4BWVA 1IRXA 2NSYA 3IUEA 5DEOA 2ZUEA 1UFVA 4DDKA 1M1ZA 5J5AA 3UK2A 4Q93A 4EG7A 1JIJA 2PZ8A 4MUIA 3IOCA 2RE8A 4ZCTA 3ZJVA 4JFAA 1SURA 2E18A 1XNGA 1J09A 1IFXA 2E89A 4JXXA 1EFVB 3NBAA 2PXHA 4YP5A 1G8HA 4WNYA 3HL4A 2HMAA 4MWCA 3A4IA 3I05A 1XNJA 5K0SA 1JILA 1NUPA 4KR9A 1O5TA 3D6UA 2CUZA 3IMEA 3H99A 3PNVA 5F23A 3AG6A 4MUFA 5TS2A 4EG3A 2CYCA 4MLPA 1J1UA 3P0HA 1COZA 4MWBA 4JZYA 2QTMA 1JMVA 3DV2A 4MW6A 2PZBA 4PBTA 3ZJUA 1WXFA 1KP3A 3H97A 4HJRA 4R2MA 1N78A 1EUQA 1JZQA 3Q10A 1N77A 2YWCA 3FH0A 5LM3A 2BTEA 3ELBA 4HJXA 1O96A 1F7VA 3COZA 2A1TS 1O94C 4L2IA 2DUMA 1OBCA 2J4DA 2CV1A 3AFHA 3GUZA 4KPUA 3HV0A 4JYZA 1KQOA 3DPIA 3N8HA 4K0RA 3SEZA 1H1TA 2X3FA 2VTBA 3ZUGA 4XFDA 1MB9A 1KH1A 1ZUNA 5TEVA 3M5WA 4MVXA 1M8GA 4MW9A 3LE8A 2YY5A 4MUKA 4ARIA 2E21A 2JA2A 1NP7A 3HFJA 4MWEA 3FI0A 4MW2A 1RQGA 5JBNA 2CYAA 3FY4A 1N2JA 3DO8A 3CLUD 4CQNA 1TYBE 1I6KA 1N2EA 4YMIA 5IJXA 4PY2A 4ZT3A 1FFYA 4MUEA 4EG4A 3AIIA 3IVXA 4U8HA 3CVUA 3PNYA 1VLHA 1JIKA 1TEZA 5TEWA 3GLVA 1OBHA 3CVWA 1FYDA 1IQ0A 3OTWA 1QNFA 2A1UB 1WY5A 2H29A 1Q15A 3BL5A 3PXUA 1ILEA 1NSYA 2NZ2A 3FETA 1GZUA 2YWBA 1O6BA 1NUUA 4OJMX 1ZJWA 1S4MA 1B6TA 1XJQA 4I6GA 3CLRC 4G5FA 4MUJA 4HPWA 1F4LA 1WXIA 3KFLA 5DB4A 1WXHA 1O95D 1KR2A 1WXGA 4MW4A 1N1DA 4JXZA 2QUHA 1I2DA 3CR8A 2A88A 2O5RA 3VGJA 3P0JA 1TYAE 1G8FA 4NAUA 4MUNA 3PRHA 3P0IA 1WKBA 1KQPA 1M8FA 2O8VA 3FDXA 3L92A 4X0EA 2I1LA
chains in the Genus database with same CATH superfamily
2QRMA 1KO5A 1MC5A 1VBNA 3D8TA 5KJ1A 3R7SA 4PAWA 3ZLBA 4KR6A 3PA6A 4Z8XA 5JNLA 4FCCA 2GRJA 2LR0A 5EPUA 2ERXA 4L78A 4HXYA 1KJYA 3LT5A 3PEFA 3U4HA 3W3AD 1EDEA 1QIIA 4XQEA 3S40A 4IKPA 1V45E 3ROZA 1OIVA 3H9QA 1QZ3A 4URXR 1U8UA 4L73A 2QXTA 3WOVA 2QZJA 4ZJZA 4M3NA 3PEWA 5FI0B 1W44A 5ERXA 1M2FA 3TKAA 1UXIA 4AN1A 2J31A 1AS0A 1KO1A 1KJJA 1U3UA 3IT2A 2FR8C 2X0IA 5EIBD 2V0NA 4KAXA 3U39A 2GHRA 1DX6A 4ZI2A 1IHUA 2J6BA 4CUKA 4GVXA 4NMLA 2IT1A 1B73A 3SHVA 1KBZA 4EA7A 2CNNA 4X3CA 4OHCA 4ZZ2A 4DG9A 1AGRA 1ZI8A 2QBYA 4XWTA 1UK6A 3GQBA 3SMQA 2I4OA 2I8LA 3TOVA 1NI3A 3Q7TA 3K05A 3HXPA 1FNMA 2CFTA 5AVZA 3SJAA 3G2OA 4S0ZA 2OVBA 3H83A 3ZZNA 3F6PA 5CXSA 4B1FA 2VQDA 1XYGA 1HT2E 1PKEA 1E9DA 3FVTA 2NTJA 3PFNA 5D3MA 3DYVA 4AU1A 3GLIE 1G3QA 1GEEA 5BO5A 4WHMA 4AJPA 3PS9A 2R68A 4LI0A 4WEOA 2HFJA 3ANMA 4M46A 1LPBB 3OIWA 4N5HX 2DLDA 4UAVA 5K6RA 4BC0A 2I33A 4MKGA 5EOVA 2CLIB 2PU5A 3E3AA 2G25A 3L1VA 1XMJA 4JLWA 5AI6A 1LY1A 3Q7EA 5KYGA 3R2JA 1TVCA 3HEMA 1P4GA 4QFBA 3HVUA 1EVQA 1JU9A 4QE3A 4ZODA 2H6EA 1ZH4A 5HFAA 5ARBA 4IXDA 1WMEA 2FRDA 5L7WA 4BKQA 3IKTA 3TRFA 1YB4A 4IRMA 1Z4OA 4X1IB 2YV3A 1VLZA 2E49A 1FU7A 1AZSC 1OXVA 2CDRA 4FUTA 4OHUA 1Y3CE 3FHCB 1QH9A 4HLUC 2H08A 3MOSA 3KLOA 4FJ1A 1SIWA 5COBA 3M7IA 3IDAA 4X90A 5KQPA 3VKUA 4I0WB 6REQA 3GJ8A 3O1LA 2HJHA 4HC4A 4ZVOA 5K0EA 2UXBB 4ZVQA 4MCHA 4W1SA 3M2PA 1J9EA 5E3JA 5K3FA 4DC0A 2ZITA 2CV0A 4RPKA 1WSWA 4N8DA 3IV6A 4RIEA 1A7AA 1CC1S 2JFUA 5FB3A 1LQTA 1UMBB 2Q5EA 4PG5A 4CMIB 1K5DA 4DANA 4ZYWA 3PITA 1Y5RA 1MAHA 4TXLA 3VSAA 1JXQA 3O38A 1FLDA 1XN1A 4HN9A 4M49A 5J9FA 4ZGBA 1BIFA 1WXDA 4IDAA 4IZIA 2W0MA 3A1UA 2WWYA 4ITUA 4TYPA 2WU3A 3UFXB 4ZTZB 3LRPA 1U02A 4GYJA 4DWJA 2XWBF 2FB9A 3RS4A 2ILTA 1CIVA 2WTBA 3BF8A 1N8NA 1OXKB 4E3ZA 4IDHA 4URWR 3PFIA 1TOAA 4YYEA 4IIVA 1QV7A 4XB1A 2NP7A 1QU2A 1NHGA 2LE0A 1L4FA 2RK3A 2UZ3A 4IDDA 4DARA 1PZNA 1TUBB 2UUPA 2YUIA 2HC9A 3I6MA 4KC0A 4KV9A 1OLXB 1PR6A 1Z6XA 4JB8A 5IKPA 2GAAA 3F6BX 3PR3A 4GF5A 1W0JA 1W35A 3OP4A 4E1AA 1QIHA 2PS3A 1TEVA 3ORFA 3IX7A 4K87A 2IDMA 4EUNA 2YN0A 4FFLA 4AURA 2WHPB 1HDRA 4IIHA 5A4FS 1NJFA 3TLMA 1ILWA 1L5VA 2VUHB 3UJHA 4DQVA 2NV0A 2E48A 3UHFA 1X80A 1O8CA 1KAGA 3GWGA 3VVBA 2IZ7A 3LXRA 4GZLA 1EDOA 3KD2A 4JNCA 4XQ0A 4DIEA 4X1KB 3CISA 3DHYA 3EVFA 5FTKA 2PA0A 1FJ2A 4AUNA 1SZDA 2P4UA 2QX9A 2H2GA 3TLBA 5LIRA 1QHGA 1JI0A 4MSUA 2AG5A 1D4FA 5LBUA 3F9RA 4OBWA 5CVUA 1SU8A 4JV5B 3JQ8B 2EC5A 3QU9A 3RYFA 3HJCA 2WT9A 2C92A 3CXRA 3QENA 2EP5A 2CLFB 2VZLA 1QJCA 4KJXA 2PKQO 3H87A 5H1YA 4C20A 5JZBA 3PNQA 1N1GA 2EFHB 3K0HA 4WACA 5GJBA 4BQOA 4NDAA 1KPHA 4HX5A 4RMIA 1VQ1A 1KAEA 1GTMA 1VCMA 3L8EA 1OZ0A 4IGIA 4DHEA 3GZ4A 2D0OB 2OORC 1UPCA 1QQTA 5GONA 3HCFA 2HO4A 3RKUA 3T3NA 1IJKA 1A97A 1Q0UA 3B1FA 4RF3A 4P83A 2P6UA 3FSJX 4EFLA 3H9JA 1EM8A 5IH7A 1BOOA 1I4OA 3JWPA 4OMUA 5AIAA 3IQFA 1GPJA 5JROA 4EG1A 5IT4A 4IO1A 3ML1A 1EK1A 3NUZA 3MXTA 2W0SA 5JCXA 1E92A 1QVZA 4PZCA 4A92A 1SG9A 4BQEA 2WSMA 2Q0HA 4GPZA 3M9XA 3VZCA 5ITWA 2H2FA 1FMJA 5TJ9A 4DQLA 4JDPA 3NDBB 1T8UA 1Y7PA 2R5WA 1XEWX 4WLEA 3ABIA 2P8JA 1AJEA 3Q9LA 1YB2A 2WMDA 3H9CA 2HAEA 2C42A 3I04M 2XZOA 4LF4B 3RG8A 3AEKA 3JQBC 4G6ZA 4U39A 4BB9A 2GDZA 2G4VA 2PD3A 3DKPA 4PFJA 3BZWA 4H31A 1EDBA 1G9XA 2JIZA 1A5SB 3O1IC 4R1LA 5LDDC 1HEIA 3VPAA 4DA0A 5C4MA 2CW5A 3E9NA 2NU9B 3GFQA 4XJTA 4MHTA 4OKIA 2ZTLA 5A3QA 1F12A 4J0IA 5LMZA 5FUVA 3MELA 4NCNA 1IXKA 1NMQA 1P44A 1KJIA 2LDXA 3K35A 1P1IA 3QHAA 3LCJA 1Q0HA 4KVFA 4M37A 2FPPA 5BQ3A 1EWKA 4CVNA 2IHBA 2V8BA 3BQMB 4ZEWA 1RC0A 4AY3A 3MFQA 3NJRA 4PANA 3TQOA 2FEKA 3JPWA 1BGWA 1M3SA 4IIUA 1PKXA 4EUHA 3MWYW 4RVOA 1A7UA 1O4WA 3CF0A 1R0WA 4MWGA 3ZBUA 3MLAA 2CLSA 1TW3A 2OHHA 4DIMA 1JXAA 4CTMA 1SKQA 2XRMA 3OJEA 4TVSA 1Z3CA 1FY2A 1ZKMA 2QUIA 1X0VA 3GLIB 3SEZA 1UPAA 4GQAA 4H6VA 4MLZA 1MP0A 2FG7C 2FFBA 4AULA 3PUIA 1N2GA 4M88A 1WDMA 3NHFA 3VSDA 3C14C 2WWFA 4GZ6A 5CD1A 1GPLA 5D51S 3TBFA 1BXRB 1GGMA 3EX7C 1Y7IA 1Z9BA 2HCTA 3KZNA 1JPUA 4HQLA 3BFVA 2B30A 4Y2JA 3FLAA 3LIIA 3LQFA 2VDOB 5CB4A 1JA9A 3R6WA 1HZZA 4CQLA 1GCGA 5EJ7A 1A2OA 1SR8A 4FHGA 4NK4A 5FUWA 3LXUX 3HK2A 2GRAA 4ZV9A 3FGZA 2UV8A 3AMVA 3K0FA 1E1NA 5IKEA 5KOJB 5UKDA 2ZBVA 1KBOA 3I37X 1Y8QB 1XMXA 4JWTA 3PUKA 2OV1A 3SYNA 4ARZB 3THXA 2GBCA 4EHKA 2QKYA 3FW1A 4KXWA 1H2BA 2FWRA 4EMBA 1FDIA 1WSDA 2DHEA 1Q1QA 2HWKA 5DTIA 4RENA 1AZWA 3NIWA 3OZXA 5SZIA 5EE3A 2E4YA 3BCRA 3WMEA 4D9CA 2IFTA 1N6RA 3PFGA 4P0PB 1A2BA 1DCMA 5JO9A 4I8XA 1ADFA 1T9GS 4NTZA 2YC4C 1VPVA 3HACA 4QUDA 4F3KA 3ABOB 3ZCQA 4XLLA 1EVKA 2C5EA 2GA8A 2X1MA 1O4VA 3AKDA 3WYNA 4DBLE 3SLKA 1NPDA 3NUGA 5K3CA 3DZDA 3O4RA 5DTRA 1RWOA 2IXDA 2Y92A 2D1FA 1OZGA 4UUQA 4YXFA 5EESA 1I0LA 2L18A 1CY0A 1LPAB 4UE2A 1MTZA 1RHRA 3LK7A 3UMRA 2YQZA 3IBSA 3UY4A 4G26A 3RU2A 4Y2YA 3TE6A 1EFDN 5DLQC 4YMWA 5IM5A 4CKYA 3QKUA 2WJ4A 4ZVTA 2CXSA 4NNOA 5HNKA 4MKFA 5FBVB 3DZIA 2HI0A 5BR7A 2XKAA 1MTOA 4JVOA 2PPLA 4MYRA 4YRBA 1RLIA 2IBTA 3DEIA 5BYJA 5F5XA 4PAMA 4WSOA 3G9ZA 4G5RA 3TW0A 3KQTA 1R9GA 1WCIB 2O2JA 3OQOA 2NO9A 1PHPA 1E3SA 4MJLA 1YI0A 2AQHA 3H75A 3I83A 4PZYA 2VQEB 1N1MA 1P91A 3R24A 4IX1A 2ZWVA 2QTHA 3AHDA 4OYRA 1U28A 4RA6B 3RRBA 3KPJA 1OYWA 3M1AA 3PA8A 1L8AA 3CJTA 3GH1A 3IUNA 3NVAA 4X6LA 1S2NA 3H18A 3G2IA 3THRA 3A1NA 5H82A 3AERB 2V3VA 3EYWA 3AY3A 5E3IA 3OQHA 4ZALA 5A4DA 3C6KA 4QQNA 2IEBA 2OMKA 3SZUA 3WLEA 3QQPA 1C8LA 2W6QA 3E0QA 3LA8A 4Z6KA 4HSEA 1E1QD 2FOXA 1MOSA 2R8BA 3VBEA 1DAEA 1P8JA 3DFUA 3TQTA 3NORA 4AKGA 5FI1B 3RFCA 1SUSA 4L0DA 1Q6YA 3WWPA 1LQ2A 3OMWA 1UP6A 3D6UA 2YWRA 3KV1A 2VJQA 3TR0A 2RKWA 2FMUA 2G5GX 3I6BA 1C4XA 4X71A 3ZCTA 1VHJA 1N0VC 1W76A 2O8BA 1KYTA 2HXSA 2I3AA 4Y0AA 3C16C 4Z53A 4F6RA 4QIHA 1JMVA 2BFPA 4GW3A 1H0SA 2CMKA 3D43A 3HZZA 4NV1A 5C0OE 3DP9A 2A0FA 5ECWA 2ZZMA 1DI0A 4CMCA 4HJRA 3V97A 1N78A 3FSGD 1Z4PX 2WYIA 3WYBA 2W2KB 4BNWA 1XD8A 3L7DA 3VSEA 1HGXA 3VMFA 3VU1A 2MOKA 3IURA 4QQRA 4KODA 4MQ4A 5FT9A 5FOXA 3DLBA 5HK8A 1Z22A 5LWQA 4B6EA 2DH6A 3NIDB 2EJTA 4O4LB 2XT0A 3AJDA 3EXFA 2XNDD 4IOLA 4PO3X 3RS7A 4ZO6A 2PUGA 1XPUA 4KPEC 2HKIA 3JQ9C 1WBDA 2FHSA 5EIWA 2ZZNA 4KBYA 5EXDA 3B2QA 2CY0A 3I1YA 3MWJA 4ZCIA 2NTYC 2W48A 4L7QA 3A4YA 1GPAA 5IABA 1VG1A 4UJ5A 2NUAB 2DAPA 5ALSA 4WK4B 4RJTA 2QP3A 3NU1A 4G5QA 2JLSA 1IZ9A 2BISA 3OQIB 4FHCA 2QYHA 4WLFA 5LQSA 3HCRA 1D0IA 5JBNA 1KHTA 1L5ZA 1LSJA 2D5IA 3WFZA 1D04A 2QD5A 3DE3X 1TYBE 1U7UA 2R25B 1L7OA 5FHRA 3SX2A 3ZHBA 4LYEA 1QOQB 1P1CA 1E69A 1R7RA 4ASUD 2WHXA 3V4RA 4P2GA 1GRRA 1IG3A 1ZC3A 4NABA 4YA6A 1EK2A 5JCOC 1YDGA 2PHZA 3OTWA 5CG1A 1X3SA 1M7BA 3O4VA 4JVMA 4DF3A 4A1FA 3G1UA 3ADPA 3F5MA 5CMLA 1HX7A 4CF4A 4RDHA 5DYTA 4B43A 3DDNA 1EGQA 3AEQB 3ZU4A 2GD1O 1N7HA 4QVIA 4K8OA 2C2YA 2WPNA 2XWQA 2C77A 2BGGA 4NU5A 4MCIA 5JAZA 3B3QA 1FZTA 1YCGA 3BWMA 2O8FB 5G0TA 1ABEA 2ZJOA 3A28A 3CEMA 1KZYC 4Q15A 4JUFA 1X7WA 3LZ6A 1ZM4A 4YLGA 3RT7A 4KXMA 4DKXA 1QLJA 4JUIA 5JWRA 2D1TA 3P5BA 1DBVO 4F72A 1ISHA 3CE6A 1NBWB 1T4BA 1O95D 4CL0A 4PLFA 4JT9A 3I9OA 1E0AA 3ROPA 3H1PA 4AXXA 3FCCA 3K9CA 3I2GA 3U0VA 5JJLA 2YNMD 1EGMB 3U49A 2AE2A 2R6AA 4JXZA 2MSKA 3TEMA 2H7YA 5ERGB 1FP2A 1M1XB 5DCUA 1RJFA 5FLYA 4G0NA 4ONEA 3LUFA 4GH5A 3C8DA 1BHJA 1K63A 1I13A 3BX1A 3RJMA 5BV1A 4PLYA 4EA8A 1E2KA 4ZO4A 1U0NA 5IC5A 3AILA 2WG2A 1QAOA 2AI2A 4X5OA 2NU8B 1JR3E 3WLSA 1ZLXA 4GMGA 2XPCA 4W7IA 5I9IA 3EQ2A 5E6SB 3ZWQA 5LQRA 4E7OA 1D8AA 2ZUTA 2HTEA 2QD2A 1J2TA 1GRCA 3KJHA 2QVGA 3MWLA 2JI7A 4X8MA 3F4LA 4QARA 2NNWB 5IXJA 3OEHA 3OF2A 5CX1A 2H11A 2HFKA 2REOA 2REBA 4M0LA 1VFNA 2R85A 5DTMA 3VOSA 4BDTA 4UATA 4O4HF 3MGGA 1J1ZA 2AEEA 1C3OB 2OPBA 3N1UA 1JQDA 2JJ2A 1W6UA 3Q41A 4URYR 1J25A 1Z0FA 2BP7A 4XQ9A 5E9QA 3CF4G 1KHHA 5ALQA 1SKMA 1R5OA 1KEZA 2FP3A 2HDNB 2I55A 2WOJA 4MWDA 4UC0A 5LZ7A 3AZOA 3TMKA 5JU6A 5J47A 4B3TB 5TVGA 1CCWA 4QHYA 3GLHE 2EEPA 5EINA 3IP9A 1P1JA 1JAXA 1LV7A 2AZDA 3H8JA 1KTVA 3K0CA 1G7TA 4BKRA 2FK8A 1G6OA 1YVPA 5AQ1A 1OZHA 2FNAA 1EWVA 2CVPA 2D2XA 2ATIA 3NASA 4M86A 3EXG2 4QREA 3SE0A 2DETA 1G6HA 5CK4A 1A88A 4Z86A 1SRRA 2EATA 4MWOA 3P27A 4RY9A 4GWLA 1MC1A 1P1HA 4MINA 4I4TB 1FS5A 2BFDA 1MXFA 2QGFA 3PHLA 3UQYS 2V3CC 3DWEX 3GA5A 4OV6B 1PSZA 13PKA 1YRYE 5DZSA 3EWAA 1Z47A 7YASA 1WO8A 3WK5A 2G6TA 3WK4A 4HR7A 1GG2A 2NU6B 2HPAA 2YUTA 1EP3B 4LPKA 4IJ5A 1Y1LA 2RHWA 2Q5FA 4XA8A 1KYIA 3RS8A 3V8EA 4BLOA 2JLRA 4F5YA 1TCCA 4Z3DA 3FUTA 3KVNA 3RUPA 1XB2A 4UTZA 1SVWA 3KXKA 1T9KA 3S44A 1A4IA 1QO0D 3DR3A 3G17A 3TXYA 4KLCA 4JJGA 5C1BA 1B0ZA 2EBFX 3I42A 2I2FA 3DAYA 3VR4H 1FUEA 3OUTA 1YZNA 1P2FA 3ZCPA 2Q8QA 2YZ7A 1T36B 1YH3A 3BXGA 1A2KC 3RTCA 3CEHA 4UDOA 4F71A 4M0DA 4DVGA 4EJFA 1I4DD 4V0MA 3PL5A 4JSYA 3T5BA 3VSBA 5KKNB 4UFOA 4EF4A 2ZE7A 1HE8B 3GEEA 4QXQA 4S05A 4Q19A 5LQKA 1Z29A 2YZGA 2CFRA 3K9QO 3FG9A 1OFTA 1JHVA 2XF8A 3SR0A 3EAQA 4FSHA 3FYTA 3A11A 4RKRA 5HF8A 1X1EA 2N47A 4FT4A 3S1LA 3COWA 3M3HA 3F3MA 1C30B 2WVHA 1I3OA 3O5AA 2V59A 2SKCA 4EG5A 1B2LA 3U4AA 3BHMA 2FQWA 4WK0B 4YYZA 5JPCA 1A5BB 1JNYA 2BPOA 3GRKA 3EW9A 1GZ3A 1M2GA 2IYYA 4H4CA 4JODA 3SIWA 1PQYA 2HWYA 2QM3A 4PXAA 1VSQA 1NVGA 4OQQA 3NATA 1K08A 5KYYB 3TTUA 4OFZA 1EEHA 3BIXA 1D2HA 3EXIA 4ZYUA 1LBSA 5K0BA 1ZGZA 1CVIA 4NZNA 3EUFA 3PWZA 3HKDB 1MIOB 4FW9A 1QE5A 3RYTC 3DT6A 4DNQA 3CLKA 1YUBA 3NBKA 1CRPA 4TROA 3I4LA 1VXRA 5KTYA 1PR4A 4JUDX 4NULA 1PIWA 3LVRE 4MROA 1ID8A 3DJFA 1RAAA 3ND8A 3V5NA 4N0QA 4JR0A 3PQ6A 1ZESA 2Y1XA 1JKFA 5E38A 2QXUA 3X1MA 1BGVA 2EX1A 3RIXA 3WLHA 1JG7A 4NYIQ 2MR5A 2AC7A 2YJNA 1GGJA 4D80A 3FF4A 3L8CA 4KN6A 4R8LA 1JHZA 2VJPA 2ZUDA 1AG9A 1AHHA 3ZYZA 4TLLB 2QZSA 1KWGA 4TMWA 4CLRB 3C87A 4E5DA 3SSOA 2HIGA 5J63A 3BDVA 1CYEA 4NFYA 1MAVA 1YBVA 2FW9A 2G1KA 3RSHA 1R66A 5BN5A 2O59A 5KDOA 1CEEA 1IXYA 4W9NC 4WCVA 2Z5FA 3IOYA 1GA4A 5FEUA 3LYHA 2HHAA 2AG0A 4S35A 4L4UA 1RZRA 1BFUA 1DBQA 4L4ZA 2WEKA 1L3IA 1V2HE 3SYLA 1O9BA 2EFYA 1P2TA 3OT5A 1I1OA 3TGWA 2IZ5A 4C5CA 2GEBA 3BF7A 1G8SA 2UVDA 1X39A 3NHYA 4GMHA 4GSKA 1WU7A 1IN6A 4Q3LA 3AB8A 4TTPA 4YRNA 3UJ6A 4EDHA 2WSSD 1PV1A 1H85A 2WTUA 3KSAC 4FHZA 3VA7A 4J0JA 3LRXA 4WNAB 1NXSA 2F3UA 4F7WA 1U2ZA 1Z8DA 2BMDA 2EFDB 3M4NA 3L6BA 4B7UA 3EPKA 3HV2A 2FE1A 5ICCA 1BQ3A 4Q18A 5IJWA 5DTJA 2OCKA 2JFBA 3MMNA 4NOMA 5D84A 4EK9A 2CYBA 2HQSA 3QTBA 4CMAA 1P5JA 4B6OA 2XR1A 3C7DB 4FINA 2YVUA 1JQJC 1FJGB 2PQ0A 1SCUA 6PFKA 1KMMA 1XWIA 3OCVA 4EPRA 2XRYA 5H16A 2PEZA 1EZZA 4GMFA 2A33A 3QLJA 2N3ZA 3BE6A 4NENB 3ZJTA 1NYQA 2W42A 5CB6A 2FP4B 1B8VA 4QDOA 3SS7X 1F8UA 2AD5A 2J07A 3KKMA 5IJZA 1KDYA 2IX9A 4CT0A 5F1OA 5FNZA 3HN7A 3ISVA 5C8YB 3KYDB 3AEZA 1B0PA 2YFQA 4ZO7A 3ZK7A 4BUCA 2V58A 1R4AA 5BSMA 3NAZA 4UUMA 4ROSA 4BVFA 2IPLA 1QP7A 1CV2A 3TPFA 2DF8A 4F2DA 2CMHA 4DZZA 1XMQB 4GOJA 2AWOA 4U3JB 3QBEA 1K5HA 3EISA 2P69A 2VXOA 2ZJ2A 4RVFA 2D1QA 4JQYA 5HEKA 3UA4A 5K0TA 3QHPA 5AJYA 3ZGZA 3QUBA 5ALPA 1YIDA 3T54A 4DLYA 3GRPA 5HG0A 5B64A 1UBSB 5DOZA 1MH9A 2QR3A 2ZEJA 3PCXA 1NC1A 3TAXA 3VOBA 3TKYA 5DSTA 5L51A 3GP3A 2QP9X 4ZCSA 1LJ8A 5DFAA 4FEYA 3WAJA 3P0EA 3SHFA 4FDLA 3ZVLA 3N2KB 3QYAA 3HLYA 1XL1A 4J2OA 3JYOA 3MBOA 4MQEA 4IUBS 4XAQA 1HFWA 4CTOA 1WZNA 3MGBA 1AKVA 3QE0A 2WG0A 1HFKA 3DMPA 2E6KA 4RMGA 3ECCA 4S1TA 2XCQA 3A6FA 3REQB 2BFBA 3HJTA 3UK7A 2WSIA 4IQ0A 4CM9D 2B83A 4NQRA 3KQLA 2QX4A 1N2CA 1S4QA 3CIFA 4YUXA 4TTRA 1ZK1A 3ITEA 2QNBA 3BMNB 3ZZ1A 5K4HA 4B7CA 1TTTA 3D3JA 3HC7A 1VL8A 1NPYA 4TOIA 4C6SA 4N3AA 4UZSA 4EJSA 3DMTC 2VG8A 5JJIA 2W11A 1KZ9A 2Y0BA 1U7ZA 3IMCA 2W6IA 1T8WA 1H4TA 1V8DA 3TXXA 5BSEA 5EJAA 4PX2A 3L82B 3ISJA 5IAOA 1D1QA 2TMGA 5HKKD 4M0FA 1KSFX 3G68A 3LCMA 2IIPA 1N2BA 3QXCA 4M0EA 4GD3Q 1WXEA 2IL1A 5HUJA 1GY8A 1U6JA 1LS1A 4F3CA 5LKAA 1JIIA 1CIPA 1ZGCA 3K8YA 4EQ6B 2FN4A 4REQA 1E62A 3T4UA 3L40A 3ZV7A 4A9AA 4CMIA 4R0MA 4ZVRA 4AW9A 4Z2AA 3QX8A 4FMCB 2EQAA 2W2TA 1QFYA 4JBLA 1T5SA 1ZYUA 5DNVA 3T1NA 4BB5A 4NAVA 1S1MA 2CWDA 4GUDA 3C6YA 4K9LA 2O50A 4D5EA 1X9GA 3IJ5A 4QU8A 4L9WA 5JS8A 4PRKA 1NI5A 1OB2A 3KQWA 4DMHA 1H1DA 4B8ZA 2R0QC 3Q3GE 4YGXB 5TXGA 4IL5A 1KYZA 3SC6A 3HU1A 4WLNA 2ZKIA 4HPJB 5J2TF 4FYPA 1N2IA 3KSDO 3K5HA 1AK9A 1ZHFA 2ODNA 5EERA 1NC3A 2VYND 2H17A 4O4HA 4EFKA 2WTMA 2WWTA 3N2EA 5CVJA 4ABYA 1C4OA 4UVDA 4DNXA 2OXFA 1AUPA 2HRQA 1J8YF 4MKHA 3E22B 2WJAA 2HUPA 3IIMA 1JF8A 3CHYA 1F9AA 2Q0XA 1Q16A 2I2BA 3EG5A 3OX4A 2ODEA 2R6DA 2XSZA 5AW9A 3QF7A 4TTQA 1EP1B 3T3HA 4CU5A 3H9EO 3SBEA 2D7CA 3MN1A 5JI3E 2FSIA 4V0QA 1FDRA 4IZOA 2CVFA 2FEOA 3FJ1A 2ZSHA 1T5BA 3QKWA 2AI1A 1VKRA 2H0RA 5C5EA 1RHJA 2JB9A 2GASA 4AY6A 4IH9A 1GPDG 3VYSB 4HGZA 5K0NA 2QOEA 3OPVA 2MIIA 3DEFA 3EZLA 2ZYWX 3HBFA 4JVLA 3GEBA 4V0LA 3MC1A 3SBOA 4HAVA 1W46A 1V39A 1DRWA 4TM7A 1D8TA 4UVEA 4GR5A 2XHEA 4P8RA 4NFLA 5EEHA 4I5GA 2X7JA 1L5KA 3H3FA 4G36A 5C1PA 2Q9CA 2VH1A 3TW4A 1OY1A 1Y9JA 1OC2A 2HK9A 4EEKA 1YZUA 3P32A 4WNYA 1U0RA 1K1EA 4NU6A 2VL7A 4TZKA 2G0AA 3CBGA 3UHAA 1Z0KA 3C8HA 2ID7A 4DADA 4WBNF 4J16A 3WWDA 4CL2A 5KDDA 4NJMA 4PZ0A 2O9JA 3BS4A 3KD3A 5A7HA 1HWYA 1WABA 3H99A 3ZQKA 4CTJA 2GB4A 3GBPA 4HDKA 5CDUA 5GVSA 3AG6A 4MPTA 4KRGA 4M7OA 4EG3A 5K7SA 2XOEA 4MLPA 3HY6A 4CNBA 3U5TA 1G4HA 4C07A 4BE4A 3TH5A 1QWOA 1A4RA 3H04A 1E3EA 3GGJA 1NV8A 3MOGA 3MGKA 4MW6A 4RVUA 5KNCD 1ZVKA 2R44A 2OFOA 3O7MA 4BFWA 1IPEA 3QZUA 5IKMA 2UUAB 1WCV1 3HB1A 1T2EA 4NK5A 4QUHA 4CODB 3FH0A 5K0GA 2XCRB 1GIAA 3UAWA 3ELBA 3ZY6A 3E9ZA 2NV6A 1F0YA 1Z17A 2JGDB 1QX3A 2ZIXB 5TQ0B 1E6CA 1E9VA 1UKEA 2ZBRA 4L2IA 1RM5A 4PHGA 1TADA 3FZNA 2LPMA 2XYGA 3EBPA 3I1FA 3ACDA 4JCCA 2E4WA 2WYUA 1WSBA 4EBBA 4MR7A 4N40A 1UKBA 4Q34A 1EGHA 5DPMA 2MTBA 5A03A 4G41A 3M4XA 4ER6A 4MV5A 1H66A 1MB9A 5B7QA 2ZK7A 3VZDA 1N3BA 4B3BA 3M0EA 2F9FA 5B2FA 2X14A 5JHHB 1W4BA 1Y5LA 2EG5A 3WNCA 1JKJA 3ZY5A 1Y3BE 4BBAA 5IARA 1NP7A 2P2GA 4IIGA 4MWEA 2HA7A 3H1AA 5HF5A 4CF6A 1SXJA 2DHDA 3ABSB 4AX8A 4DKJA 1RRMA 2V65A 2NYVA 5G1NA 2FN8A 4N54A 4WLUA 2NZWA 3X2EA 1FDOA 1LSSA 5CJJA 1VM6A 1QFXA 3IYLW 2IHUA 5FYQA 3ZQ4A 5BMVB 1QH1A 3G5MA 1UAAA 2F1RA 3BH6A 3DUWA 1U1IA 3Q8KA 2GMWA 3JAKB 4GRDA 2TYSB 3U7RA 1MNQA 5BQPA 2F43A 4PGGA 1DBIA 2J3JA 4JBYA 4OK3A 1NRXA 3R9IA 3VR5H 2GK4A 5MN5A 1TT5A 3BXZA 3THYB 2B37A 2CC2A 3D8NA 3AU9A 3MTDA 5C18A 2Y6UA 3F9CA 5EWLA 5H83A 4FZ3A 2GN6A 4ARUA 4NZYA 3QPVA 4GI1A 4Y2QA 5JRZA 1GV1A 2I29A 3GV0A 3UVEA 4E51A 2X3UA 4JHLA 2R48A 3H19A 4LJLA 5FADA 3D59A 3D4LA 3KB8A 4I50B 1UFKA 1C1DA 5DCLA 1O6BA 4ETMA 2W2MA 4D0LB 1H05A 3T5GA 3L7KA 4LHXA 1B6TA 4QLAA 1PF7E 4E08A 3O4HA 1ZJWA 3QUQA 2BSAA 1DADA 1D4ZA 1PO7A 2ODAA 2JAUA 3E5RA 4X44A 4X8HA 3ZWBA 2ABWA 4C3VA 1G20E 3LHDA 4DRXA 1TVKA 2WKWA 5EJGA 1QR2A 1MXHA 1H4SA 4O3FA 3QOFA 2WP0A 2H48A 2CE7A 1MAAA 2EVWX 1LLQA 2VYFA 3PGMA 4JQOA 2CHFA 2IOQA 4J03A 1QOZA 2P3QA 2O5RA 2ZI4A 1OLOA 3BGVA 3TLGA 3J80A 1H9BA 3DD5A 4M1MA 1WVGA 3FF1A 3C5VA 3PRHA 1DKUA 1XZBA 1PVVA 4AZ3B 1EGVB 5EMKA 3R77A 5DHQA 3OZDA 1W36C 2YXBA 3DLPX 1TT7A 2Z2ZA 3E3MA 3I5MA 2WTEA 1U80A 4UNSA 1IHXA 4IDOA 2Y8EA 1D03A 1E98A 3GFRA 4X66B 1Z83A 3B6KA 3FHJA 5EMNA 1YZQA 3SYTA 4LRWA 4DLWA 4WRRA 4F85A 2IYEA 1JB9A 1A50B 4L57A 1XQXA 3L0PA 5DT9A 1FZQA 1TU3A 2LBPA 2PSSA 4R8MA 3MWDA 3MSCA 3T1YB 3HQ4O 1PYOA 4KNWA 2GZDA 4OOFA 4S1NA 3H05A 1UXKA 2FPOA 3LLVA 4CHGA 2LXNA 2OZLA 3RVJA 3BL6A 3WIBA 1C9NA 1QIKA 2QU7A 1QAMA 4OREX 2P0AA 2WWGA 1R6TA 4N7BA 1E5QA 4HNGA 2BI8A 1HY3A 4KGDA 2RGWA 1LK7A 2O2IA 3N0TA 2D0PB 5FFNA 1I4WA 4MRPA 4KSCA 1EIWA 4IQGA 4RMNA 3SOPA 3SQWA 1AXEA 4UEWA 2F3PA 1RFLA 4P35A 3DJYA 4QL3A 4PIPA 2F4NA 1KI3A 1CX9B 1P5FA 2KE5A 3FYUB 2BKVA 4PBRA 1PJZA 1E9RA 1K27A 2PX2A 3I2HA 3OJCA 4WXYB 3ZGYA 4C6HA 4OBBA 2VYVD 3JASB 1UIRA 1Z5OA 4HH4A 3INRA 3EF3A 2JFOA 3EWSA 3KT0A 2JGNA 4K8RB 4RKQA 4WXRA 5KQRA 2C3YA 4JR1A 5HZGA 1L7EA 2QTAA 4KGXA 2B82A 3TNJA 2WJHA 1GFIA 4WMLA 2OGSA 5BUCA 1O57A 2XWSA 2FWBA 3KJGA 3EWIA 3R8CA 4QWWA 3WKAA 3ONEA 4YQEA 1KY3A 3L9WA 4EH1A 1U2SA 5I7WA 4HAZA 4II7A 4P7KA 3B1ZA 2JFNA 4BZPA 1PL8A 4PHCA 5L3QA 4E13A 2XGMA 3PLNA 3KBBA 2GK7A 2XE7A 4CFYA 3M4JA 1Q1AA 1DQSA 5CT4A 4QXPA 3NWPA 3ZOZA 4ZJUA 1DINA 1N6OA 2PVCA 3ILVA 2WJJA 3ULKA 2XBUA 2ZCUA 3GELA 1F8XA 3NV9A 2RH8A 2ZR8A 1GNQA 1U7PA 4EA6A 2R1VB 4BN0A 3BREA 4JLPA 4YJKA 5CFQA 2O2DA 1UJ2A 3ZWXA 2XAUA 4YAWA 4DLPA 5FA8A 5T8KC 2NTEA 3M34A 1QAQA 4I1UA 4ETIA 2RGUA 3C2QA 4OH7A 1MJNA 2I34A 2PJUA 1X74A 4U00A 2RSLA 1Q92A 1R8YA 2F67A 2EWMA 2P9HA 2RARA 4J49A 1XDUA 2QM7A 2GBIA 3D1LA 3FI9A 3ZH2A 2COUA 3TPZA 2QDKA 2XT9A 1NLUA 2ZU0C 2PY6A 4BVGA 1T34A 2VJMA 3GGSA 4ZYYA 4CEHA 3AUXA 4NPAA 3VKFA 1G0NA 4NI5A 3LLUA 2ATCA 4MDYA 4YMUA 2X15A 4KKVA 1KP2A 3LZCA 1GITA 1GGFA 4HYYA 3QSYA 2PWAA 1GDDA 3QEKA 3E5HA 3U5ZB 3M6IA 1E94E 1NKSA 1OGYA 4IEFB 1XJ5A 1H8HA 2Y1EA 3U44B 1DAIA 5KUTA 4UREA 2JAOA 4HAWA 4OX9Y 3SQLA 3Q0IA 3L6RA 5J4KA 2E5FA 1FFXA 1L7XA 4PN7A 3ETDA 3H11A 2YXLA 3LF1A 4GRAA 5H02A 4YCNA 2AHOA 2H5IA 3MS4A 2G1PA 3K1AA 4DWVA 2X9GA 4KLNA 1QRUA 4DMCA 1Z88A 2ZTHA 3EXHA 4HWKA 2HF8A 3KKOA 3L93A 1HF3A 1NAHA 2CN1A 3ER6A 2QBYB 1QPZA 3OTOB 3G5UA 3OOYA 1Q5PA 1UKVY 4HDNA 2I4TA 5CDYA 1ECCA 2G08A 4FK8A 1I33A 1KZ4A 4DLBA 1T24A 5FA6A 1FA9A 4NESA 3WIEA 1KGDA 2QL5A 4IDQA 4LMRA 3S8MA 5HKBA 4MV4A 4X3PA 3S5JA 2ZJ7A 1TMGE 2FLKA 4KDRA 4FVTA 2P2CA 3LGXA 3TOXA 4BQSA 4DM4A 1V6CA 5D3MB 1JQLB 1EVJA 3NTUA 4DRYA 5JR3A 3MWEA 1ZSNA 4XYGA 2F64A 1TAQA 3CPSA 1VBKA 1E59A 4PQYA 3BL8A 3C6QA 1VLMA 1I5RA 4FFRA 1ZJYA 2QMOA 3G6KA 1G20B 4NMXB 3IVGA 5EKXA 1E2UA 2BE7A 3UAVA 4GECA 4CE6A 1XMVA 4DEYA 2ID8A 4ZMRA 1NZJA 4G0PA 1W7AA 2NM0A 3L6EA 3UMYA 3H2BA 1BMTA 2YCLA 3WL5A 1UZNA 1PFUA 1VIDA 1E4VA 1P1KA 1J0CA 4JLNA 5B57C 3NP9A 3N2KA 2WWWA 2O5VA 4Y2UA 4COKA 2QHXA 1BCRA 3LT1A 4M98A 2BCJQ 3E35A 3UB2A 3RUCA 3AVOA 1F14A 2HO5A 1NRJB 2JAXA 2QSJA 1UQUA 2XITA 3AWIA 1T3GA 1G16A 3GDFA 1E3IA 4LISA 1U28C 2NV2B 2CXXA 3OWXA 3PRJA 4L08A 2WD7A 3I6YA 3TNLA 4QPZA 3UA3A 3USES 4ECAA 4Q5IA 3O92A 4QPDA 4UNQA 1UH5A 1XD2A 1GSIA 3DUFA 5DTQA 4BNFA 1QGUA 6REQB 1NYRA 1Z33A 3K9NA 4O5OA 2NTNA 3IULA 1KDTA 1UKAA 5THKA 4XX1A 1AB5A 4HNTA 1RBZA 3OVMA 1RZUA 4RANA 1OTYA 3PQCA 2QJFA 4B9EA 3LW8A 4TUYA 2D1RA 5CGZA 3QBJA 4DCSA 2Q62A 4D97A 3EDCA 2J8ZA 1GNSA 4HH0A 4EI7A 3CLTD 4B32A 1VC2A 1RHKA 2WHQA 1FOEB 1DO8A 3UMVA 4E5VA 2C2GA 1FUIA 3TLZA 2X6QA 5DISB 3ITKA 1JTEA 3FOZA 4LWPA 1H2ZA 1V11A 1B3BA 3THWA 1RWMA 4BNYA 3RVMA 3EUEA 1YF3A 5CVTA 1QHNA 4QUEA 3MYYA 1YQXA 4LVNA 4Q02A 4FI3F 4KRFA 2IYAA 1ZJ5A 3G9UA 2Y1LA 1HBJA 2ACKA 4RKEA 5EMHA 2JLAA 3IJRA 3DF7A 4PC6A 2YINC 4HBZA 3FNFA 2I7VA 2IBMA 2RGDA 4EG8A 1Q22A 1U7OA 5H5JA 3G8YA 3WHKA 5ADVA 1WULS 2VRBA 3ZG6A 1YDEA 3UATA 4B44A 2XIQA 3L92A 1EJ2A 3KQPA 2HA0A 1V43A 4MZXA 4H1TA 2HLNA 4Y2HA 3I34X 2X2EA 3PPXA 4EUSA 4LWZA 4MLCA 1RP7A 4ESEA 2ZAYA 1PL6A 4G0UA 4NCAA 3PLAE 4ZT5A 3A6EA 5IMSA 5TJHA 3H17A 2PRYA 3CEAA 4LDAA 1MX3A 5CPFA 1VMAA 3TQQA 3VR5A 4C7BA 1SC3A 2H1OA 4RAQA 3D7SA 2Z2YA 3C48A 2W2XA 3AM5A 4ESHA 1Z08A 4OP3A 3W7VA 4OUDB 3RYFB 3W5AA 1DZIA 2E6UX 4IG4A 4R5HA 1XRNA 3B12A 3IBYA 3P9CA 1NI4A 1II9A 3GO4A 3Q5DA 4IIEA 1AY0A 1J2JA 1JG3A 1YE3A 5AICA 3QJYA 1S2GA 2P77A 4KXVA 4TV8B 2QX7A 4O2BF 4WXPA 4QYTA 4K3VA 1HV8A 2AC2A 3VPXA 2X1LA 4FYHA 4LYJA 4XUEA 5FV7A 3TMAA 4G1UC 1M8KA 2HPVA 4EFDA 3WXBA 5BP7A 4E03A 4HVTA 4I6JA 2WJVA 4DPMA 2QRJA 2WM2A 3OM9A 5GONB 4B45A 3DL7A 3HUFA 5MGNA 1CZKA 1K8RA 3LC7O 1TRKA 2AG6A 3C1TA 3PHBE 1G5IA 4FS3A 4IRUB 4KUHA 4TT8A 1O0SA 4W7SA 2O48X 2VPTA 2ZAGA 2ZRDA 4DCTA 2C20A 3C1AA 3WGNA 4L5BA 5C81A 4JFRA 4BMZA 5JIBA 2PGJA 3Q98A 1BDIA 1G3RA 2FRXA 1WNFA 3H5TA 1KVTA 4U8GA 4ZVSA 3FMPB 3WZLA 1LBEA 2PU7A 2BFWA 2DC1A 3DZGA 3EBOA 3PICA 4ITVA 1Y1SA 3GBSA 5EQDA 2NO7A 3VH4A 2RG7A 3NGLA 4UM9B 3L7LA 2PMWB 1W94A 3STVA 1T9BA 2YHBA 2J30A 4NYJQ 3O7WA 1Z2AA 2PEYA 4YLYA 1ZAYA 1POWA 1M6YA 3DO5A 4XVUA 1UKYA 5AVYA 1OUMA 5BYBA 2PV7A 4M1EA 4G1BA 3ICQB 1Q57A 3T1HB 1RMYA 3R7AA 5FH9A 3AEKB 5E8RA 1SHUX 1ODSA 1YBFA 2B4AA 2C7GA 2X2FA 2Q4TA 1OMOA 3GMTA 5EYPA 3TOSA 2OUIA 2RBEA 1EJBA 3EGDA 3UQZA 4YMVA 2OQIA 4HOYA 1GUDA 4G8JA 1I6MA 5FUYA 5L8VA 2ECKA 2XLBA 2ZI5A 1E8DA 3FBGA 1Q95A 1ZY2A 4X94A 5B5SA 5ANRB 1KORA 1IBRA 1EVEA 5F1PA 3DCIA 3IESA 4OQDA 1N9ZA 4DYVA 5CCBA 2FPPB 2FFRA 5CT9A 1DBPA 1Z0JA 2GLXA 2V4MA 3FAKA 4MI3A 3FWKA 4KQIA 2O05A 2CL6X 4LZZA 2XUAA 4WW0A 3MW8A 3S1SA 4DCMA 3S81A 5DEOA 3N58A 2VDKB 1TUGA 4MV7A 1VHTA 5DX0A 2QZZA 3G9QA 2OL4A 1VHWA 1JIJA 5KNBA 3IOCA 4MMYB 3INTA 5IWCA 4C01A 1VCOA 5GV7A 1SXPA 3G02A 2CCJA 1E63A 1NY5A 5AI5A 2RG1A 5F4BA 2JFFA 5A1JA 2FDRA 1SQ6A 3IUJA 1DFIA 1IFXA 2E89A 1C9JA 2XI4A 4M1YA 4RPGA 4DQ0A 3ENVA 1K3TA 4GPAA 2XT6A 2B5VA 2XUPA 5B6PA 3LKZA 1ST3A 4HH3C 1N25A 4KH1A 4MWCA 4QPCA 3LVBA 2GCOB 3UT6A 1GXSB 1SVOA 2PL5A 3FRIA 1MVLA 1S2LA 4KXFB 3JARA 4O33A 2C2MA 3DVAB 5DGDA 1CUFA 3HU2A 4CQLB 4URVR 5JY6A 5BSVA 1TC2A 1DVRA 1V71A 4K1LA 1CY4A 1OLUA 4R6WA 1JVNA 3L84A 3PXXA 1COZA 3H5AA 1UK7A 2FHPA 3MJFA 3QFTA 2FRVA 3OOEA 3K0FB 2Y76A 4KE7A 3UUEA 1E1CA 2QL9A 3KCNA 3V32A 2P2ZA 2WE7A 2J33A 3THXB 1OA0A 1WXFA 2K6GA 3H97A 1EDZA 4NBLA 1B3RA 3M1LA 2NZUG 2DHQA 2OV2A 3FHLA 3VZRA 2R5FA 2YWCA 5EXPA 1XUOA 5CNKA 2N42A 1PJQA 2IODA 3R3YA 4GKBA 5C7OO 5CFZA 1JG6A 1A3CA 3R7BA 1NM5C 3RAFC 1KGSA 4G1CA 1W29A 1XEFA 2IYSA 3GRAA 4LG1A 5TPWB 3IGFA 2A35A 1O94A 2I7XA 2VZ8A 5LZ2A 4EYKA 3EIWA 3EQ9A 3V8VA 4OKSA 1T3TA 1H2EA 3K6KA 2VJYA 2VJDA 4JSRA 4B85A 1BXZA 1ZHOA 2YIVX 1X7XA 2FX2A 3PEVA 4LZOA 3EIFA 4HAOA 1FRQA 2B1JA 2B5WA 2EG9A 2NXCA 3KCQA 4MVXA 3RRNA 2YY5A 4C22A 3CZ4A 4JENA 2IH5A 1NJ8A 3MTIA 3N28A 4KDFA 4P4SA 1RYZA 1NVVR 3HFJA 3UYLA 3J7AC 5LB2A 4PXYA 3L9XA 4OYLA 5KNBH 2CVHA 1V5WA 1ZX1A 4MK4A 4MYUA 1VA5A 1RI1A 2RHJA 2YN4A 2M6RA 4GNKA 3WGQA 1NN5A 2TSYB 1C7EA 4XWAA 3HM9A 1CETA 4NJEA 3BJMA 2O3JA 1CJCA 3O4IA 2QG9A 2J3IA 3FX2A 2LP4Y 2G04A 2QAGC 1WMDA 1R8SA 3E8SA 3NKLA 1H93A 3U61B 1TNDA 2AMLA 1OU0A 4WNIA 4TYYA 3LXMA 4UHHA 5CEFA 1XQ9A 3CTMA 2ZYVX 1QS0A 3ABQB 4X61A 3T9CA 2QMEA 3TEFA 4TMYA 4BX9A 1V4BA 1ID1A 2NZ2A 3LKVA 3OICA 4IJVA 1UOQA 2ZDGA 2DBRA 2PLFA 3FKSD 4KWCA 3SU8A 3ZHRA 4ENQA 3L6UA 2VH2A 3V4OA 4BLRA 1SN7A 2V7UA 5BOSA 1S4MA 1DOAA 1R0CA 2X76A 3QY0A 1O03A 1NZFA 1FNDA 2QB5A 2QLBA 1W2HA 1XZJA 2AXNA 1H8ED 3FB4A 4KQMA 2ZE8A 4GEKA 4MI1A 5HYVA 3QUAA 4ZOCA 4G1EB 3ZD9A 1EMDA 1TJ3A 2FW6A 4P53A 4NMHA 2YFKA 1BH2A 2H9YA 4R41A 1EXNA 3ZS9A 1IK4A 1Y1KE 4DAOA 5MHTA 1KIAA 1VBFA 2VUIB 3IEUA 4KQJA 2H4WA 1GQQA 2WU1A 1OI7A 2QN2A 3HL0A 5GV8A 2D5CA 3P0JA 3E0XA 1XC7A 5B58T 1UMKA 1EZ4A 2PKCA 2XMPA 4S2EA 1JH8A 4CLEA 3WICA 1ZIDA 2OLJA 2W4QA 2C97A 2KB0A 2Q41A 2WHYA 2HV9A 3OCJA 3OAAD 1YL5A 1B7GO 5B2ZA 1VYUA 3FPCA 4NPHA 2Q5JA 1AK1A 4A2WA 3IUQA 1E6EA 4QELA 5JUWA 2GYVA 1WEKA 2JDIA 4RTOA 5LSAA 3RT9A 3WFJA 1H9CA 4EJ2A 2BWJA 4RV9A 4JP2A 4UBJA 2QENA 3SS8A 1UEIA 3P9KA 3VO9A 4IIBA 4JELA 4C76A 3C4QA 4IMIB 4JC4A 2OFWA 2HBRA 1MQ9A 4MDHA 2Y4NA 4RVDA 5M2QA 2W71A 2HA5A 3LBIA 4W8HA 4EVIA 2HB6A 3KT8A 3LUGA 5TMDA 3MRVA 3KSMA 3QYJA 3FCYA 1AKUA 3EXFB 3OE1A 1EP2B 4A27A 3IBTA 1SM4A 3AVQA 3EHDA 3ZXIA 4ZYLA 2ZFUA 3W5IA 1J2EA 1OX4A 3D8UA 3A58B 3IR7A 2ORED 5CHEA 5IAJA 1XXHA 1XKLA 2PXAA 2Y1GA 2PMEA 3THSA 3L7NA 5IH3A 4JL5A 4OP2A 4JJIA 4NMMA 5AM5A 2BD0A 4IEIA 4XTCS 3G5TA 3PC6A 3WIOA 1TJYA 2ZQZA 4MI6A 3C5EA 3T3GA 2G28A 1KY2A 1BHO1 2BEWB 3OE4A 4NARA 3CRNA 3TIFA 1FCJA 1T8TA 3RU7A 5IU6A 1VHDA 3PR2B 1F4PA 2I3DA 2O7SA 4EYEA 1PT9A 1MEEA 1E1RD 3AJAA 2E4AA 3QPDA 5AXCA 1YRQA 3VISA 4I5EA 4Q6WA 3QLUA 1VZ3A 1J9GA 2IYWA 4Q1BA 4AYTA 1ZUWA 3NKVA 2O2HA 2R4QA 2VJCA 1G3IA 3ZE1B 2QJWA 3N6VA 5FI3A 2Q5LA 1ACJA 4A6EA 4AJ2A 5LD2B 3T7JA 1XE3A 1QP8A 1KO4A 1VECA 1TRHA 2HTFA 2RAUA 3DLAA 3K2QA 3RVBA 3F5DA 5L40A 3MSXA 3OE7D 2DQ4A 1N6LA 3ELUA 1RIFA 3RC7A 1I6WA 3DTVD 4L16A 1QKIA 2VSOA 3UC5A 4LGCA 4P93A 4RTSA 5KC8A 3D4IA 4D5GA 1X7WB 3S6JA 1QIDA 4ND8A 5IG2A 1MH1A 4BHTA 2Q45A 2RDMA 4FGUA 2RGYA 4MUGA 3CKKA 4QULA 1EKXA 2YWFA 3U4QA 3KJQA 4KR3A 3FDFA 4DBZA 4O2BA 2I4IA 2AMJA 2RAVA 1K3FA 2V9CA 3HB0A 3JPYA 2CLHB 3A6KA 4INPA 4P7BA 3WOHA 3DL4A 4BX3A 4RCZA 4AAYA 4DJ5X 2PK3A 2PQ2A 3MS2A 3OPXA 1NLZA 2BEUA 2C8JA 4QD3A 1OH8A 1MLDA 3IPYA 3SQXA 3PD7A 2FSGA 3UOWA 5A5VA 4PLPA 5AKKA 4BCBA 1OBFO 1TYCA 4XOIA 4ISBA 2UYHA 3GCXA 2JIQA 1L9XA 3EZFA 3O2SB 2WAOA 3DDZX 4UKDA 3GLGE 3ICEA 2FZVA 4D96A 5BV8A 7REQA 2P9GA 4FCWA 2AOWA 4ISCA 4OQEA 3QOXA 4JT4A 4LKOA 3SBDA 3IBGA 2GM9A 2NACA 3GQVA 5ADUS 2V7TA 5TQ2B 1EDDA 1PFVA 1VPLA 2PTHA 3DB1A 3AX6A 4CMEA 1JEYA 2CLDX 1QTNA 3KUDA 1XTPA 2VDWA 4FNAA 2PZLA 2ZCJA 2OD9A 1XJWA 4TWRA 2RHMA 3I6QA 2IOHA 2P79A 3EN0A 1Z68A 3A32A 2ZBPA 4DSUA 3GL9A 1UK9A 4XQCA 2Z3VA 1TM7E 3RW9A 5JVDF 1FFCA 2WUEA 3OM0A 2P40A 4AUKA 2YFHA 5BXQC 2PH3A 3OG9A 3OO0A 1XZIA 4E4YA 1QX4A 1V6AA 5KQGA 5AHOA 2RJ3A 3GG9A 3OEEA 2EL9A 4OMFG 2VQ3A 4QHTA 4EKIA 1L5YA 1OXMA 2DLNA 5TVKA 3CT6A 1YQ9A 4NF2A 1MAUA 3BICA 1KSJA 4WQMA 3W0LB 1EHIA 4XLZA 1E3MA 1GAXA 3V2IA 2I3GA 3ZDFA 3ZTYA 1IXSB 3D3QA 5CNIA 2VHQA 3D6HA 4NBSA 5KVQA 5MN6A 2EZUA 1MJGM 2OZVA 1F6DA 2AW3A 1NVFA 4HK4A 3ZCXA 3Q87B 5EG5A 4LRUA 2HU7A 5LZ9A 3V7YA 4KIGA 1JB1A 4D8TA 5JBIA 2FV8A 2XXAA 5A62A 3BSWA 2EHJA 4V38A 4W5JA 1ODKA 2IDKA 4J75A 3VTKA 4EYQA 3DHNA 2C7OA 3H1TA 2BRUA 1Y6QA 1GL3A 3B8EA 3EEIA 5DGIA 5C4GB 3TK1A 2PWZA 3OFVA 2EIHA 2QUZA 4RLSA 2BFDB 1K97A 3DAFA 3TTXA 2A6PA 4O4IF 5JAOA 3DO6A 1G2PA 1PGOA 5TPZD 3EHEA 1TZJA 4JP3A 3FWZA 5KWSA 5TMBA 1YZLA 3EF1A 2VPPA 4PINA 4Q9AA 3IAHA 3N3AC 4BMSA 2XW6A 4G1VA 3V1KA 1MC8A 4LDPA 1XNQB 4K26A 3HVJA 5CURA 1M2VA 3P4UA 4HMQA 3JD1A 1RPJA 2X1HA 1SUEA 3GBVA 4YDHB 1N2CE 3GLFE 3COSA 3K73O 4BLQA 4LSWA 1FE8A 1DIGA 3BM5A 4DQXA 3F74A 3LUAA 1Z5GA 1SKYE 3MA0A 3I9FA 1X9IA 4KOEC 3TJMA 4RWEA 3S55A 4YFYA 5H9WA 3V8MA 3C3YA 4CR7A 1XG5A 3KOWA 2B36A 2RIPA 2IX3A 1G2IA 3EODA 5EUMA 1UQTA 4XRGA 1YBHA 4BLSA 5IT5A 1WU8A 2LD4A 3A26A 2IBSA 4D02A 4BFZA 1T1RA 3NVDA 3QU2A 2P9QA 4RC9A 1GPMA 3OY2A 3T4EA 5AKIA 1BA3A 1YS9A 3NH6A 4R8RA 1QHEA 5JY1A 3IB3A 3SYKA 4EHBA 1KYYA 2R47A 2WZDA 3UB4A 2J0UA 1ZN9A 2YRFA 3JV7A 3IJPA 5J5VA 1N0UA 1W1IA 3E5NA 3ZU6A 2DBZA 3B3JA 3B78A 3ETEA 4HMPA 1MHPA 2HA3A 3CLUC 4BGVA 5E4YA 3RTAA 2DMRA 1XZGA 1KO7A 1N8KA 5I4IA 3MTQA 1EXWA 1THMA 1NIPA 4GOLD 1VP3A 4HDCA 4RY8A 5DHUA 4JLDA 1MF7A 2C9ZA 2X9LA 1L4YA 2GF9A 2OZEA 4Q03A 3HA3A 4LXHA 5IP5A 2UZAA 3TS1A 5HX7A 2IF2A 2PZFA 3U13A 4RKFA 1GQYA 3NHUA 3HHPA 1IYZA 4Q05A 3OQVA 2PKWA 1AGNA 1ETUA 4C0WA 1AU9A 121PA 3PENA 4R9VA 3RIGA 4J0QA 3HUUA 3ZBPA 1SUBA 2PCLA 3DE6X 1KXZA 3PFCA 3HKCA 4FUQA 1Y5IA 3PNLA 1DX4A 3EXIB 5SY4A 2QZ4A 1H2WA 4ZU1X 2J6IA 4NZZA 5H8WA 1V3UA 3AQIA 5AK6A 4K9QA 4BNVA 3L1UA 3KPVA 5AOCA 2WW8A 4H7PA 5JALA 1JBKA 2DCUA 2L69A 4I1SA 3U9LA 2VXYA 1JPNA 1P29A 1ZW6A 3BIWA 4LI3X 2VEOA 2XMGA 1QCDA 3DVQX 3LVQE 3CRZA 4U7JA 4XD7A 3LT4A 3PF9A 2WUDA 3NRBA 4B73A 5JZOA 3DEKA 4NOJA 1F9EA 2WE8A 4UMEA 1YQQA 2TMKA 1TA4A 4OHWA 4RJKA 2DFPA 5JH7F 4Q4DA 4OG2A 1P31A 2EP7A 1TXGA 1KEPA 1V8BA 1Z74A 3PPYA 4RM2A 2P78A 1JR2A 2BMFA 2CK3D 1XEXB 4A8TA 3W5BA 4PLWA 1Y34E 4W6QA 4CUJA 3L7JA 3O8QA 2QR5A 4OLBA 5LQMA 2XOKD 2JRLA 2ORWA 5BN5B 3KETA 1CERA 1QVVA 2HD4A 2EEZA 2OCXA 3BTSA 4GC5A 2Z4SA 3IPCA 2I54A 2JL1A 4I5IA 4NVRA 3I5YA 1NASA 2ZB3A 3HDYA 4FGLA 4F1JA 1BKDR 3P9IA 1WF6A 5LPNA 2PKEA 1ODIA 1CE8A 2AIRA 3CGWA 2HIMA 2J0QA 1Z28A 3CTPA 4BNUA 3CX7A 1KEVA 1OWNA 2XA1A 5TARA 1S5PA 4GIBA 1ZAKA 1S2MA 2A3NA 1YVEI 4MQBA 1BKSB 1T5DX 5DSZA 4BZWA 2OHFA 4PYJA 3KEQA 4C7MA 1X1CA 3KYCA 5AR1A 2WIDA 1RLMA 4J7XA 2AJDA 1N0IA 1E9AA 3G0GA 4TLDA 3P9XA 4RQBA 3J81k 1K6IA 3P9ZA 1ZIXA 2AUTA 1AV7A 3MCUA 1WDTA 4K3UA 1I3MA 5JXGA 1NBMA 2FZGA 3W3ZB 1FTQA 3AGQA 3ZV6A 4BATA 2JBAB 5BVGA 2FEWB 2I4MA 4UAJA 1B15A 2W6NA 1B6SA 4Z1OA 3OCXA 1KRWA 1YA8A 2H1IA 1SCUB 4OL0A 4QJ4A 4ZVPA 4CEIB 3FGOA 3F78A 1V9CA 1P2GA 3TSWA 3IQDB 1GL7A 1XVVA 1GKUB 2RONA 3Q88A 4PZEA 3BZBA 1AZLA 2ONJA 5J43A 3JQRA 2ZTUA 2CB9A 4N3BA 3NTRA 5IDWA 3QW2A 2IWHA 1K6EA 1U8YA 3D1JA 1K7FB 2Q6OA 3U3OA 2PVSA 3AETB 5GMOA 2FFQA 4US1R 1MD9A 1IHPA 2AFIA 2GWRA 2ZUVA 3GPDG 2FUEA 3H2GA 3L0ZA 1BVRA 1NFFA 1GGNA 1BWSA 3G8CA 4R1PA 3U48A 5K51A 5AVSA 3T9AA 1K98A 1Z39A 1SXJE 2W58A 4EO7A 3BORA 1U2DC 4HCJA 3GN2A 3AIOA 5DLDA 4BAGA 2ECPA 3RYIB 2VPXA 3LW7A 4AC9A 4FFSA 1LV8A 4KQ9A 4JYMA 4B3MB 1HUQA 3UJBA 1ZGHA 4BVEA 2XWPA 3HE3A 3PNSA 2AHRA 4NONA 3ZWAA 4C6RA 2FWIA 2ZUEA 3B3FA 1XRSB 3FN4A 3UK2A 4N7MA 4EG7A 4JMPA 1HZJA 1Y82A 2XTMA 5K3DA 4ER7A 1Q0ZA 4C1NA 3BUSA 5JQGF 3SR4A 3BGSA 2O1WA 2QPLA 3IR5A 4L7VA 4PX5A 1YR7A 3CPJB 4J91A 4WECA 2HU5A 2JZCA 2M9MA 4JC8A 4BQQA 4H9GA 4UTOA 1CDZA 3FLMA 2O5CA 2PRKA 1LK0A 4MQEB 1M1NA 4MQ5A 4BGIA 1E3LA 3ROGA 3IIEA 3LGAA 4JOSA 1YS7A 2R8PA 1O5IA 2E37A 2B7BA 4YP5A 2JJYA 3TOCA 2MT9A 4ZK6A 5GADl 5JNRA 3HL4A 4W82A 2BFBB 3FCUB 1KMIY 5FNVF 5U1PA 3LLMA 1XLTC 3UPTA 1ZI9A 1JFVA 1N2CB 3G8AA 3OZRA 3GLFB 3LRTA 2INGX 2YJ3A 3OQPA 1SKYB 2PCJA 3ECSA 4JYBA 4EJSB 2H18A 5H3CA 5JD4A 2BZGA 3DV0B 4LRYA 5E7IA 4D8WA 3TF5A 4G1MB 2MSLA 5DW3A 4AICA 2WFAA 3AF6A 2QTMA 2C1EA 3FPLA 4DDWA 2XD9A 3RD5A 1J0BA 1TTPB 1NFQA 1QGED 2IYQA 3P9YA 1I2AA 4K2HA 4I5FA 4PQEA 4C6TB 3BWDD 4DIDA 2VAVA 4X62B 2J9FA 1PEDA 4HL6A 1BYUA 1YB1A 3RSOA 3FE2A 2JI8A 3PUZA 3UYKA 1Q14A 1Z75A 1GZSA 3C3AA 4MIYA 3WK9A 2ZAOA 1PK9A 5AVUA 3QMMA 4IDEA 5HE8A 2BM0A 3QUTA 2AOVA 1ESZA 2J5RA 2XMRA 3P8ZA 1WHTA 2VAXA 4I3FA 5TGDA 1ZD5A 5ICGA 2CV1A 2ZJ6A 3PRYA 3TEJA 1GOTA 4F6CA 4JI6B 1E6LA 3HV0A 4EY6A 3T7IA 3H2KA 3O3NB 1DC4A 2ONYA 4G81A 5FPQA 4L15A 2QYSA 4Q3KA 3BWXA 4C7JA 2CNOA 1DP4A 4B4DA 4UCQA 3MWFA 2C7RA 3M5WA 1K5PA 2OO7A 3JQAA 5JVDA 3EBLA 2I4LA 3D7MA 5CFRA 1T9DA 1U5BA 3I32A 3R6GA 4LZWA 2J67A 1DO0A 3HCWA 3R0JA 4O4HB 5I9SA 1GLGA 4NBUA 1OF1A 3H7IA 3QMPA 5FBLB 1B26A 5DOVA 3HZHA 2EZTA 3WB1A 2J4FA 4P54A 4GNRA 3S27A 2W90A 4MNTA 1Q1ZA 1JEJA 3CLUD 3U26A 1N2EA 3QRWA 1NF9A 4OMCA 2XB6A 1R0XA 4JLJA 2C04A 4ZOLF 2Z5GA 3AIIA 1XDGA 4HY3A 4BMXA 1PNOA 1KFJB 2C83A 1TEZA 1F0NA 1P7VA 2ILVA 2J41A 3I2KA 4KWTA 5CCXA 1DFGA 4YRDA 2YZKA 2Z1MA 4DLLA 5KYUA 3A27A 4DNPA 2VP6A 5P8WA 2F90A 3FGNA 4FP9A 3UKOA 3TLJA 3TZBA 1DRVA 1RQNA 1MPXA 1R18A 2C4UA 2XD4A 3PC8C 3F96A 4U2DA 4F04A 3SVLA 1HPLA 2O2ZA 3AGPA 3I8SA 1C9YA 1WZCA 3VR4D 3B20A 4NY1A 4XR4A 5IASA 4J4BA 4TS3A 4O4IA 3ZY2A 5LJIA 4BJ6A 4Q82A 1M0TA 1F4LA 2JEOA 1JJ7A 4AP5A 3KU4A 4PSVA 4BGUA 1Y8ZA 4U9UA 4KKXB 1S8AA 1DS6A 1KR2A 1Y9AA 1O2DA 1JR3D 4OJKA 3RV3A 2B78A 1QCCA 2FPKA 4H08A 3RHTA 1SBIA 4MGKR 2A57A 3GVIA 4D3XA 3DLCA 4Q01A 3L49A 1HRDA 1MJ5A 3JQFC 4F2PA 4NJMB 1RXEA 1LPOA 1I2DA 2FVXA 1GKLA 1J07A 2PGLA 2WFLA 4Y1GA 4DQUA 1EWYA 2VDLB 2RI6A 2W2PA 4LNHA 1K7YA 3QPCA 4WZAA 4PONA 1RQ7A 3G0DA 3ICVA 5HJ5A 1SOUA 4UQPA 3P0IA 3RYCB 1NW7A 1BJRE 1AKWA 2GHQA 3UK0A 2IW3A 4DR7B 4NNJA 4V1CA 4E5SA 2RGNA 3QW4B 4H1VA 2YXPX 3IQXA 3TUJC 4BAUA 3LYAA 2Y9MB 3U31A 2ATVA 4A0QA 1II8A 1A2QA 3IKLA 3L77A 4AY5A 1UT6A 4C89A 5K01A 4V02A 3O2NA 2CV2A 2WV7A 5CA1F 3AKEA 2SCUA 3DOCA 2VTKA 2PAFA 2WINI 4RK4A 3AUJB 3COPA 1J1IA 1U04A 3DDWA 4JUCA 4L2IB 3E48A 2ZSDA 4HTAA 5TGZA 3ZNOA 2R1ZA 4GEGA 3LD9A 4X7BA 3U9TA 1CBUA 1RRKA 2Y2UA 1DT5A 4KO8A 2WIKA 4EHAA 4WY8A 3HB9A 1NBOA 4E88A 1TM4E 3X1WA 1ZC4A 5D3KA 2ZSAA 3K9BA 4FWBA 3M49A 1V4VA 2V6FA 1FIUA 2ZJ5A 1TD1A 4H35A 4D4HA 2GM4A 2NT3A 1AURA 1X13A 4TX1A 2CHGA 1P3Y1 2QM0A 2R8YA 4BNTA 5DBEX 2LWIA 1ENZA 4BTLA 1AV6A 3INYA 3Q1LA 2JLUA 4MZDA 3ABZA 4IJKA 2WTNA 1XNHA 4WY5A 3GVHA 4R1OA 1SXJB 4Z7OB 4CKWA 2JLXA 3IMGA 3H1FA 2R65A 4IXWA 3VR3A 2QMZA 1M1YA 4B79A 3PF8A 1R3UA 1N57A 2CVZA 1T6BY 2B1GA 2XDAA 3B52X 1KYXA 3OF5A 1G3MA 4I1VA 2C3UA 2Y0CA 2RJOA 4J76A 2XZDA 1K9VF 3VJMA 4QASA 1NNLA 2F43B 3INNA 4IYJA 4QDXA 3I9MA 5BR1A 1VE5A 3ZE0B 1RYFA 1J5XA 1TT5B 3QKRA 3O6VA 1QGZA 3OQ1A 5EWLB 1G8AA 3W05A 1EAMA 3OWOA 1U2TA 4JVSB 4RXUA 4DXDA 5JH7A 2WVAA 3FPJA 2ZT7A 1C1HA 1NUTA 2W8ZA 4U2CA 5FBQB 3MZ0A 2WABA 3RFFA 4KX5A 5LLDA 1CR6A 1C1DB 2N46A 3GNTA 5F9FA 1J9ZA 2VLBA 5CHYA 5K0LA 5DIFA 1WLSA 4XM0A 3FKQA 1M73E 2A84A 2A0XA 2QUAA 4WCDA 3UF0A 3BRSA 3QYPA 1V95A 3TI9A 4RADA 4UEKA 1LW7A 1X77A 1CB0A 2HGSA 4DRXB 1TVKB 1EUQA 4LE0A 2XYQA 3IIJA 3FNIA 1PE0A 1JFRA 5I8ZA 3MF4A 3RDPA 2IXGA 1Z7WA 4J3JA 1I7QB 2JK0A 5JZVA 3MJSA 3CUTA 3OHPA 4JJ8A 1TZBA 1E0DA 4RJ2A 3GY0A 5KMGA 1OBOA 5HMMA 4P9NA 3SD7A 2BFFA 1DIOB 3FUVA 1RT9A 5EZ6B 4DSZA 1XTRA 1W4RA 1F6WA 4DQKA 5C7YA 2DHRA 3OJ0A 4R51A 3VPCA 1IAVA 1SUIA 2JIOA 1U90A 3EG9A 1Z7EA 1JL3A 2LTAA 3D31A 1ZGJA 2ZI3A 1E1LA 4EZBA 2HOQA 1QV9A 1PS9A 2CLEB 2RH5A 4N76A 3C4VA 1OVMA 3PC2A 3N39C 4IR7A 1UMCA 2A9QA 4Q3DA 4RVNA 1XT6A 2M98A 4RSRA 5AVTA 2UUBB 1L4HA 2CXPA 1V5IA 1YJ8A 1HYEA 1E3WA 2WILA 3RUEA 1W59A 3LYUA 5GWXA 4R9RA 1GL6A 3LTNC 4HQ6A 3IQGX 3A2NA 2XVAA 3MWDB 5J5CA 3WNDA 4A3SA 4F0JA 3C7TA 1G8MA 3BSSA 4F21A 1E99A 2RIRA 2AFHA 3PNOA 3Q7QA 4YUVA 3HYRA 5SY9A 3ND9A 3AESA 4RDXA 1CEXA 2OZLB 3M70A 3ST7A 4AKHA 5AJTA 1FVXA 4IVRA 5D7BA 1BO6A 5CB8A 4L8YA 2A92A 4KB5A 3T61A 2NVWA 3GIDA 4UUNA 4HGRA 3MJDA 4UPVA 3U2QA 2XUKA 4XIIA 5CB0A 1V47A 1CUDA 1YE8A 3OZCA 4ZVKA 1T8SA 1WKVA 2G71A 4LYGA 3QA3E 3UN1A 2J85A 5HRUA 2P9JA 1Z2PX 1OWLA 2CVQA 1YZKA 3I9NA 3JVVA 4XGNA 5KZMB 3MD0A 3SQNA 1RAHA 2IUFA 3ZDQA 5JSFA 5JQWA 3IA7A 3OT4A 1Y81A 2Z6AA 2HJGA 4DL9A 4H7HA 1AKNA 3COYA 3SSAA 3ZHXA 3L8YA 1KYVA 3T4XA 3SKVA 4GM4A 4DCCA 1SIUA 1XWFA 5JQGA 4WWHA 4BP1A 1P0QA 4F06A 2P9TA 3KKLA 4Q9HA 3RWMB 3NHMA 2OGZA 2PJZA 2ZRMA 4H0FA 3VRHA 9ATCA 4WLVA 2A1IA 3CB4A 1QQ5A 3S1AB 3C3XA 3CCCA 4QRIA 2AMYA 2XECA 1IIBA 1WUJS 4RZ3A 1KKUA 1SVMA 2Q8NA 3D1VA 3EEFA 4Y6GB 5FNVA 3SEQA 3WRVA 1ZMRA 3WGUA 5A3JA 5L3QB 1MX1A 1EXVA 3OLCX 4OHYA 2UXDB 3OSUA 1BGXT 3C5WP 2VUSA 4YR9A 5CB4B 3W3AH 5A5GA 3CSUA 1JEEA 3G8BA 3NDRA 1XTVA 4D4GA 1W5BA 5KNDA 4KUEA 2XE8A 3ANNA 4B81A 3HH8A 5DRTA 4YUYA 2BGTA 2HMUA 2GFQA 2QW1A 2QV0A 2ZT6A 1DIHA 3P26A 5ALUA 4L6IA 1IHDA 3DZCA 4IG9A 2GN8A 1G64A 1TMYA 1HYHA 2VYCA 3QMWA 3DTNA 1IIRA 2H06A 4CTNA 4X85A 5EJEA 1UP7A 2EU8A 1IVNA 1ENOA 1CULC 1ZRSA 2I6XA 2Y3IA 3CLSD 1EWTA 4HX2A 4WKPA 3U3JA 3RYHA 2G70A 3UJ8A 2PR2A 2G1AA 4S04A 1MMFB 3K0AA 3H3XA 1IEQA 1BOFA 1H22A 5LR6A 4CEHB 1IWPB 4KH0A 2VLIA 2YL2A 4AP6A 1A8SA 3UHOA 3HXOA 4TSFD 4LY0A 3R7DA 2EAUA 1B43A 2R751 4P7FA 5DASA 3V1UA 2QN1A 4Q7KA 3V4SA 1R10A 1IY2A 1XXLA 4GWKA 1OI2A 3IODA 3ETHA 1FQWA 3G2LA 3WBBA 2O2CA 1X2BA 1XHLA 2ICAA 2ZRCA 1ECFA 1W8DA 5J2TB 2CDCA 2BFEA 2LIPA 4YT5A 1T15A 4A6XA 1LLDA 4QTUB 1GCIA 1ORVA 1FFXB 2OYRA 1TZ2A 5CIWA 1W0CA 4TQUS 4CI0B 2PL3A 1GEGA 3PZRA 4XX0A 4F8JA 4B34A 5ETJA 3BD9A 3K1AB 4OTZA 1RMTA 3NO4A 3NPAA 4ALIA 2WIGA 1I2MA 3EXHB 2I76A 1GVHA 2JGJA 1X42A 3JR7A 3ICWA 4L8VA 2QX8A 5F1KA 3KQVA 2DKOA 4ZOLA 3AF2A 3REGA 4HDNB 4L3WA 3VR6H 3ZWKA 4YAUA 3QBTA 4J4TA 5AKZA 1AO0A 1U99A 2R2GA 1SOAA 1PUJA 2HLDA 1ZOOA 3WISA 4AJLA 1A9XA 1T3SA 2A5JA 2P2DA 3IOBA 3RAEC 4D57A 3KOMA 5BPFA 5F3WB 1BN6A 5INTA 1M34A 1TJ4A 2ZJFA 4B6JA 1HLGA 1AN9A 1E4EA 2FEPA 3MWEB 2KJQA 3PD0A 2EDCA 3QELA 1K68A 5CM2Z 1OWMA 3I2JA 3VZQA 3E8MA 4YCSA 1NU6A 1CY2A 3T3OA 1X7ZA 3EVBA 5EWMA 5E3HA 2L2QA 3OUZA 4DLKA 2C82A 2BN4A 3CE9A 3FYDA 4PSUA 5F51A 3A10A 4WBSA 1AGXA 1QZUA 2BDTA 1NBIA 2YBEA 2WICA 4EVRA 4MUAA 1JH9A 5HCUA 1GSHA 3OT1A 3AM1A 4BMPB 1K75A 4BU0A 5LU9A 1VJ0A 4WBNB 2VVTA 2X8JB 1ZI6A 2FW7A 2ZRKA 1VXOA 2WTAA 1A27A 1JDSA 2O8NA 3I01A 1BCRB 4LHVA 2ZU6A 2PZMA 4AKSA 2C8KA 2FVYA 3ILSA 3JSXA 4XQGA 4FBLA 3URMA 4M9QA 3OJFA 1SKAA 2FWJA 4RZHA 5BSKA 5BUQA 2GZRA 2IVFA 1VE7A 2WD7B 1RMQA 1UBHS 2IIVA 3CG4A 3QVUA 4PCAA 1XAIA 4OLHA 2GXUA 1SAYA 1XD2B 3PNPA 4FZJA 2AJLI 1DTSA 1QGUB 3AP2A 1K6JA 2QWXA 4PYLA 5ALIA 3VO8A 5LQDA 3TE7A 2PRJA 2AJ8A 1YOVA 5T4HA 3ZE9A 1HK7A 3DNPA 2FMHA 1TFUA 4P98A 4D0NA 3W9BA 5CA1A 1LX7A 3OA2A 1WMSA 2VJBA 2DSTA 4FGZA 1TW2A 1F2DA 4H3HB 3RFVA 2Q07A 3QBDA 4L5YA 2WSLA 3T15A 3UAXA 1T5HX 2JVKA 1XAGA 3QWIA 4C0QC 1OC4A 1JEQA 3I4FA 4PSKA 4QBFA 3QM1A 4OA5A 1MORA 1SBTA 2VTDA 2I1WA 3K5PA 1G1MA 1LF5A 4MQLA 4EKYA 1U3GA 1J0DA 2P9BA 3TR5A 1V11B 1H3FA 3THWB 2XNHA 1HFEL 3U40A 5IZCA 4M1OA 3S3TA 5FUMA 1VG8A 4A16A 4MVJE 3HP7A 2QNRA 4OHMA 4WERA 3U1BA 1TI7A 4C0BA 3GC6A 2AI3A 1ZBQA 2PGNA 3GLKA 5EAIA 5KIAA 4IJWA 4W5OA 4WXEA 1ZLYA 3C5CA 4C0AC 4BMYA 2H1LA 1S01A 1C7IA 5GGYA 3X1DA 2B20A 3ZZUA 2B92A 4MQMA 3DLHA 3A9RA 1OPRA 5CW2A 2QRNA 3PVZA 4QKQA 4X92A 3AF4A 1KOJA 1MZPA 4GBED 2C9OA 4ZCTA 1XCJA 2GZAA 3OD5A 5BNIA 2AZMA 5SY6A 2ODQA 2CGEA 3GUCA 5DW0A 5JCZA 1W6RA 1SURA 3C6MA 4JOQA 2AX4A 2GYWA 4Q66C 4BQRA 3A06A 5GM1A 1A7JA 3UO8B 1APBA 3R6LA 1BMFD 1DOHA 2J3MA 1M2OA 2L19A 2ZG6A 3HMKA 3PQ5A 5PGMA 2EOAA 3GD7A 1X7GA 3GWZA 3OZ7A 5DBGA 4AI6A 2XNKA 4FHDA 3IAEA 3RIHA 3ZLVA 2ZYIA 3RSFA 4MV1A 1J0XO 1NI4B 1OAOA 2UYCA 4BFXA 4FI3C 1SUPA 2PH5A 2XB4A 3WV4A 2B9EA 1MB4A 5BOVA 4EY8A 5JAIA 1SK8A 1SULA