3BL5A

Crystal structure of quec from bacillus subtilis: an enzyme involved in preq1 biosynthesis
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
213
structure length
195
Chain Sequence
KEKAIVVFSGGQDSTTCLLWALKEFEEVETVTFHYNQRHSQEVEVAKSIAEKLGVKNHLLDMSLLNQLAPNALTSTFVPGRNLVFLSFASILAYQIGARHIITGVCEGYPDCRDEFVKSCNVTVNLAMEKPFVIHTPLMWLNKAETWKLADELGALDFVKNNTLTCYNGIIADGCGECPACHLRSKGYEEYMVMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of QueC from Bacillus subtilis: An enzyme involved in preQ(1) biosynthesis.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
molecule keywords Queuosine biosynthesis protein queC
total genus 67
structure length 195
sequence length 213
chains with identical sequence B, C, D, E, F
ec nomenclature ec 6.3.4.20: 7-cyano-7-deazaguanine synthase.
pdb deposition date 2007-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06508 QueC Queuosine biosynthesis protein QueC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3bl5A00
4YBRA 3ZJVA 4JXZA 1N2HA 5DEOA 1KQPA 1FFYA 5EKDA 3ZJTA 3N05A 1IQ0A 3P0JA 2A1TS 1WQ4A 1M8JA 4X0EA 5H16A 4PBTA 2AG6A 3TZLA 1MC1A 4NDAA 4YP7A 1MB9A 2QUIA 4R0NA 4FZJA 2X1LA 4H3SA 3X1MA 5LLTA 1N2OA 2WB2A 3IMGA 3X1KA 4UZEA 4DDMA 5DASA 2J09A 2ZUEA 3L92A 1O0CA 1JIKA 2PG3A 1ZJWA 4ZCRA 4BWVA 1WOYA 4E1AA 1QRTA 1ULHA 3FNRA 1YUNA 2PZAA 4AQ7A 3IVXA 1ILEA 2JANA 1IHOA 2R5WA 1QTQA 1VBMA 1GTRA 1N2GA 1OBCA 1JIIA 3KT3A 1EUQA 1VBKA 1H3FA 3SZGA 2GM3A 1VL2A 4MUNA 1U3DA 3A2KA 1O6BA 3K32A 1MBZA 4G5YA 3L93A 2Z08A 4YMIA 1MRZA 1KH3A 2BYTA 2B7LA 5DB4A 5HUJA 3D6VA 3ISJA 4EG6A 2QUJA 3ILVA 3CVWA 1Q19A 4MW4A 4HJXA 3SYTA 1BS2A 3CLSD 5FO0A 1QJCA 3FOCA 4Q16A 4K0RA 1JGTA 3MLAA 2A1TR 1JECA 1QRSA 3Q12A 4ZT4A 1EFPA 2WSIA 5HG0A 2WQ7A 2CSXA 2DPLA 2NSYA 3IOCA 1WQ3A 2A1UB 1O97D 2DEUA 3CLRC 2A4MA 4QREA 3H9CA 5H7XA 2O8VA 5IJXA 4EG4A 1KP2A 2YWCA 1F9AA 1XNJA 4HK4A 3RHSA 3S3TA 4ZT3A 3SEZA 1GN8A 1IH8A 1O95C 3AG6A 2PFSA 1T6XA 1WXIA 3PNVA 1Q77A 2G36A 2RD2A 3FH0A 1IQUA 2C5SA 3AL0C 4OUDA 5J5AA 1O96B 2EJCA 1KAMA 1TYAE 2V0GA 5FO1A 1YIDA 2QJOA 1OWPA 2X3FA 2CV2A 1OWNA 2QUHA 1I6MA 1QU3A 2AKEA 2RE8A 2J08A 1KH2A 3SDBA 1F4LA 1N2BA 1J1UA 1M8PA 4F3RA 4MQ6A 2CV0A 2E18A 1X8XA 3X1JA 1PFUA 3LOQA 1YULA 4XFJA 1K4MA 1TYCA 5LM3A 2E0IA 3UY4A 3QTTA 1N77A 3KT8A 2WQ6A 5HUHA 3AKZA 3DO8A 1JZQA 4EG8A 4KR7A 1WXEA 2J5BA 2A7XA 1LI5A 2IELA 2PIDA 1HYBA 1PFYA 4KR9A 3TQOA 2QTNA 3AIIA 4F4HA 1NUSA 3GLVA 3IMCA 2DERA 1NUTA 1XNHA 2X0KA 1K4KA 3CVUA 5TEVA 3N8HA 3CVXA 3VRHA 4UZFA 4ZT6A 3CR8A 3D6UA 1X6VA 1T9GR 1SURA 3HMQA 4MW0A 4L2IB 2VXOA 2YWBA 1GTSA 2PZ8A 3TS1A 2E89A 3QE4A 4ARIA 3DV2A 1PG2A 3FETA 4KR6A 1KP3A 4MW7A 1O94D 4MAFA 2HZ7A 3K9WA 1R6TA 3ELBA 3HFJA 4J76A 3NV7A 1WZ2A 5TS2A 3FWKA 3RJZA 3RK0A 2DLCX 1N2EA 1KH1A 4U63A 3FDXA 3IVCA 1J20A 3MMXA 3G5AA 1JHDA 1IQRA 2TS1A 1WY5A 3COYA 3N2YA 3U1VA 4G6ZA 2J4DA 4AS1A 4MVWA 3IUBA 2NZ2A 2DUMA 1G8FA 4ND7A 3G6KA 1M8FA 1QU2A 1K92A 1Y42X 4DE5A 5DK4A 1TQ8A 3FY4A 4Q93A 4P2BA 4ZCPA 5TEWA 2CUZA 1TEZA 4I6EA 4MULA 3MXTA 1WXHA 4ND6A 2CYAA 1XNGA 3ZJUA 3LCJA 1D2RA 4K03A 3QTBA 4DNXA 1IVSA 3UOWA 3GMIA 1R6XA 3E27A 3P0HA 1EXDA 1J70A 4MWEA 2CFOA 4MUFA 1WJGA 3ND7A 3VU8A 1G8GA 4ARCA 1R6UA 3IVGA 1GPMA 4EF6A 5K0TA 4U7JA 1VBNA 3SEQA 4NATA 1G8HA 4JYZA 3LE8A 1JIJA 3TNJA 4EFKA 1KAQA 1IFXA 4ZT7A 3OP1A 2QJFA 1JEDA 1I6KA 1TFUA 3IOBA 5J59A 3P52A 3KT0A 4MW9A 1U0BB 4HJRA 1J09A 3IODA 4MW6A 4NAHA 4NX2A 1T9GS 4ZT5A 2VTBB 4KPUB 5KCMA 4MUHA 4MW5A 1GAXA 2O5RA 3N9IA 1MAUA 1EUYA 4QRDA 3CLUD 4MW1A 4RPIA 1M1ZA 2D13A 3ZUGA 2OV4A 3COVA 3ZIUA 4OUDB 3A04A 3IH5A 1U3CA 1Q11A 1MB2A 1RQGA 3CLSC 4EG7A 1T6ZA 2DETA 2H2AA 4U8HA 1KQNA 3RK1A 5JBNA 3RFFA 2CYCA 2CV1A 2AZXA 2YY5A 1JZSA 3Q10A 5TGTA 4YP5A 1LI7A 4YP6A 1N78A 1M8GA 1EE1A 1M83A 4MUJA 4JFAA 2V0CA 2DXIA 1FYDA 1IRXA 1NYLA 3MLBA 1OBHA 1EFPB 3OTWA 3COZA 1MOPA 2IP1A 5K0SA 3CLTD 2OQ2A 3IDFA 2E21A 5KHAA 4MUGA 3F3MA 3HGMA 1H3NA 3H9BA 1OWOA 3I05A 4MLPA 3ZXIA 3CLTC 1KORA 4ZT2A 3AG5A 3VGJA 3ZGZA 4EG3A 4MUIA 5BNZA 2CT8A 1NUUA 1O94C 3FI0A 1TYBE 4CQNA 4G5FA 1J1ZA 3DPIA 1EFVB 4MWDA 3CLRD 1LW7A 4GRIA 3ND6A 2ZUFA 1H3EA 1DNPA 1O95D 3HV0A 5AHWA 3BL5A 5FNZA 3IMEA 2PXHA 1Q15A 3Q4GA 3DLAA 4I6JA 1EJ2A 4JXXA 2QJTA 2X1MA 1XJQA 3C8ZA 3HZRA 4J75A 2JAXA 4RUKA 2EL7A 3A4IA 3INNA 4DLPA 1N2JA 3P0IA 1NI5A 4DDKA 4I6GA 4S1OA 1NZJA 1VLHA 3JXEA 3CLUC 2YXNA 4PBRA 1QNFA 4MVXA 1MAWA 3FIUA 1N1DA 1JEEA 4WSOA 2HGZA 4R2MA 2VTBA 1O5TA 1WKBA 1OWMA 4KPUA 4PBSA 4QBTA 2QTMA 4JZYA 5F23A 1YUMA 2A88A 2Z3VA 3PRHA 4MUKA 1F7VA 1N2IA 3KT6A 4CDNA 3COWA 3NBKA 3NBAA 3SZ3A 4CDMA 2XRYA 3HL4A 4NZPA 4ZCSA 4CT0A 2PZBA 4WNYA 4XFDA 2ZP1A 1OWLA 1GLNA 1B6TA 4ZCQA 2HMAA 4XSVA 3H99A 1N75A 4DDHA 1I6LA 1OD6A 3H05A 2DR2A 1U7DA 1NP7A 1A8HA 1ZH6A 1KR2A 1O96A 2A84A 4MVYA 4L2IA 1ZUNA 5KWVA 2D5BA 2Z09A 3IUEA 4PY2A 4R2LA 1NUPA 3CVYA 3FHJA 4EG1A 1F7UA 4TS1A 3UMVA 3CA8A 3PNBA 2IJGX 3TQIA 3ZXSA 1P7PA 1UFVA 3PXUA 3CVVA 3GUZA 3IOEA 1J21A 1NSYA 3M5WA 5LFAA 1ZH0A 3KFLA 5IHXA 3RBAA 4ZCTA 2I1LA 3PNYA 1N3LA 4OJMX 1WXGA 4EGAA 2CYBA 1GZUA 2GKSA 1EFVA 1NURA 3MUEA 2D54A 2JA2A 3A05A 2A1UA 3H97A 3TZEA 1I2DA 1JILA 4MUEA 2J07A 5J58A 1H1TA 1M8KA 1TYDE 1O0BA 1QRUA 3SP1A 4HPWA 1KQOA 1PFVA 1YI8A 1G59A 4NAUA 2A86A 2GOYA 1WXFA 4DJAA 4MWCA 2BTEA 1YIAA 2H29A 1S4MA 4MW2A 2XRZA 3ND5A 2QUKA 1K97A 4EG5A 1O97C 3FG9A 1U7XA 1COZA 1MJHA 4A91A 1PFWA 1V47A 4MVCA 3UC5A 1JMVA 1PG0A 1QQTA 3UK2A 1V8FA 4MWBA 1KKUA 3G59A 1NUQA 1T6YA 1CT9A 3AFHA 4GU5A 2QTRA 4KKVA
chains in the Genus database with same CATH superfamily
4QHYA 2HRBA 1RYMA 1Z45A 1TMYA 2J7KA 5FI1B 5BN5B 3TAHA 3W7BA 4JXZA 1TD1A 5DEOA 3KD3A 1J39A 2WJWA 1FFYA 2ZIEA 3UWSA 4LRUA 5AXDA 2BF7A 3VR2A 1CC1S 1UDCA 3AEQA 4M3NA 3ADPA 1FFEA 1KZGB 4MYSA 2PUCA 2H17A 5FAXA 1YXMA 2V96A 4BVFA 1Y8AA 3IMFA 3INYA 1YZUA 3C8DA 3FPSA 3ICVA 1AB6A 2JLZA 4BVHA 2FEXA 2QD3A 3EPLA 3IDZA 4UAVA 3UJAA 1MO5A 1IOZA 1PJ3A 2V5AA 1JDPA 1S1CA 4MUMA 4TRMA 3U4AA 2I6SA 3LKDA 3SC4A 2O06A 2QUBA 3M0EA 3AVOA 4G56A 4DIBA 4FGSA 1I5RA 2QR3A 2C03A 2WRZA 3LVBA 5JTUA 1NW7A 4FWTA 3F5MA 5IH3A 3W9UA 2RAPA 3HCBA 1JAXA 4YTEA 3TH5A 1AM4D 2GZDA 2I67A 5BNWA 2P1RA 2EHDA 4RL4A 1ZWKA 1TLFA 3B12A 4W7SA 3W2TA 4J0HA 1EP1B 2BKLA 2C95A 2O3UA 1EYZA 3H17A 1P1JA 4WW0A 4C7KA 5KKNB 3QGMA 4KQEA 4U9IS 5K0CA 1LKZA 1SQGA 4NV0A 5FBRB 4RLSA 3Q6NA 1YVEI 1TF7A 1M1UA 4BFZA 5FP0A 2GM3A 3P45A 5D7NA 4QUIA 3TLMA 1N4AA 3R7WB 4EK9A 4C5CA 4D9GA 4Z7NB 4KV9A 4TX1A 4WLOA 5GOTA 2X4DA 3K1JA 2B36A 4XPZA 5ALKA 3P9ZA 1XOIA 2IC5A 3DEAA 1QGOA 4TL9A 3JYNA 3ZN2A 1A7UA 5FOUA 1PO7A 1P1CA 1VP3A 2A35A 2BISA 5A0VA 1GNVA 4DIOA 2AHOA 2HFKA 2GCGA 4N5MA 1VA4A 3AM3A 3EY9A 2CLIB 2BHTA 1Z5NA 2HNBA 2P4UA 3USCS 4A0GA 2Q6LA 3QIVA 4K2AA 4M6WB 1G7TA 1Q50A 1DTSA 1XD8A 3OX3A 2QN9A 4P4SA 3BMQA 1L1QA 1QJCA 2C54A 3UIEA 1JDJA 4HRXA 4FFPA 1YB1A 4RE6A 3EZ7A 4UCFA 1GUFA 5DTEA 1CVLA 5KOHB 4GUAA 2E37A 4Y1RA 3DBIA 3NGXA 3B51X 3GCDA 4EFNA 4X3CA 3M49A 3T8YA 1QVZA 1RBMA 4UCQA 2JGFA 1AQNA 3I8SA 3U5TA 10MHA 1ORTA 1MVLA 4B8ZA 3DO6A 4ITVA 4XWOA 3SQLA 3HI6A 4KYUA 5J2UA 1XEAA 1TUGA 1TYZA 1BE0A 5LMZA 4RVGA 1VLMA 4QVIA 2D2EA 2FP4A 3CLRC 2GBPA 4QREA 3V4ZA 1CS4C 5JAZA 4FHCA 4DANA 4NKRA 1ZFNA 4U7WA 3HSYA 3RARA 3LYAA 4ANFA 4ECEA 3M6XA 1LBHA 3HU3A 1EU1A 3LFUA 2QRJA 1T5DX 2O2CA 1SBYA 2EOAA 2RJOA 3GNSA 4AK9A 3D6AA 3QPBA 1R4NB 2V8OA 1LJUA 1MA0A 1J2JA 4OCZA 1K5PA 2F59A 3GRZA 4DJDC 5EIBC 3WFZA 2VDOB 4B0OA 1QH8A 3O47A 3V2UA 3RU2A 1WL8A 1FSZA 1T3SA 4L4ZA 3QYJA 4QD3A 1HE1C 2NPIA 2X1VA 3MCUA 4Q66C 4DNFA 2GWHA 2FWBA 1I9CA 4C4YA 1E0DA 1YKSA 1TUIA 4FIZA 3AB8A 4HNUA 1VJ5A 4XQ9A 2HNAA 1XVTA 1SB9A 1OXVA 4MQ6A 1ZM9A 5ERGB 1NVEA 4H4DA 3TTWA 4OQQA 2RGGA 1LX7A 3L1KA 3ANSA 4RACA 3CFYA 2GEVA 3N2GA 4OQ4A 4KQFA 4JP8A 5JDCC 5CVUA 1NA5A 2PKRA 3HH8A 4RPGA 4HN2A 1VA5A 4XFKA 2ZJBA 2WQ6A 3O9ZA 4HB3A 1NJ6A 3TJZA 2AJDA 2NVWA 1YHNA 1OFUA 2A5YB 4P92A 1DMSA 2CN1A 2R6ZA 3C7CB 3EBLA 1E1CA 4NCJA 4PU0A 3N8IA 1WUJS 2VRBA 3UHJA 1TX4B 2DMRA 2GEJA 2TMKA 2VQSA 3WHIA 4F3CA 5A0TA 4MV7A 5ITSA 2FFRA 2VOJA 3GT0A 3KB2A 3EARA 2XA2A 2NTJA 4L0CA 8ABPA 4IWYA 3BH6A 3DC7A 3L0IB 3JV7A 4C2AA 3DCJA 1K88A 4V0KA 4QPDA 4D46A 2RBEA 3R75A 2VTEA 4XUEA 1ZCAA 2HSDA 3UJ3X 1BFKA 1GGKA 1RQLA 1XEWX 1XXHA 3FSRA 1X7ZB 2C4HA 4LYYA 4UZFA 3V4OA 3DGEC 2J46A 5LOVF 3D6UA 1P80A 1PSZA 2XUIA 4PW0A 3Q5EA 2C29D 2QVBA 2YHUA 4DWVA 1N9KA 2P9QA 3Q9LA 2P65A 2QSYA 4L8LA 1IN1A 4DHWA 4KVGA 2G8NA 1T9DA 5ICMA 2Q7DA 3EZGA 3UMCA 2VBIA 2DQ4A 3HCNA 1TTPB 4KG7A 4JJGA 4U6QA 1WZ2A 1JBKA 1Q2UA 4D8TA 1Z0AA 3FWKA 3ZGVA 4OGGA 3T7KA 4MS3A 1J22A 2BY4A 1JH9A 1QGAA 2YWGA 3KPWA 5THQA 3ENKA 4AJNA 5E1MA 2B35A 3RQIA 2GTHA 4NARA 4TLMB 1KOFA 2Z6UA 3BWDD 1UBEA 4AS1A 4FNAA 4O3FA 3KUXA 4OX9B 2L42A 2CNNA 3ZWOA 4PICA 1EMDA 2L17A 1AGRA 1CD5A 2CHUA 4XLLA 1D6NA 1CY2A 1NBWB 3P9CA 1V8BA 3OKCA 4OY3A 4O2AB 3C3MA 1H4VB 4NNJA 1PL7A 4ZCMA 2OPBA 4KXYA 2GLTA 1F1BA 1MABA 3WQRA 3R9XB 4R9NA 3ZS8A 2FEKA 4DDTA 1BXGA 1S7CA 4UEWA 1VPTA 5G3ZA 1HDGO 3M9WA 4M9CA 4W63A 2RHHA 4MEAA 3VOBA 3UOWA 1IG0A 4J0GA 2B8NA 3TD9A 3WLJA 3I83A 3TLEA 4AMZA 4BKRA 3B5EA 2JIRA 5EI5A 3WGUA 4CCAA 4EKEA 4F3TA 3RPEA 3RRMA 1VE3A 2ECKA 2J0SA 4YJKA 3O38A 4FDTA 1EG7A 4NBUA 2QUAA 1W6RA 1MORA 3P9YA 4GGMX 2WHEA 1JFSA 1EFRA 1ZMRA 2BEWA 2UZIR 3FGNA 4KVAA 4EITA 4LVNA 2JHFA 5HKKD 5IDQA 2YWHA 3DEKA 1E4EA 1WVMA 5A2QA 1MJGA 1D0SA 5GINE 3L7JA 3VYVA 1FNMA 4FYXA 2XCSB 2OK8A 2P6NA 2E4ZA 1F8YA 4GPEA 4TWIA 2EKZA 3LUGA 3MXOA 5HF9A 1YJAA 3JRNA 3I73A 3ZOKA 5BY2A 4X20B 4AMBA 4BLOA 4F1KA 2IIBA 5AM3A 1I7PA 1G16A 2GM4A 2W8BA 2P2SA 3E05A 3E0QA 3L7BA 3RU3A 1R8JA 3ZHVA 7MDHA 4WN3A 2KB0A 1OLXB 3LQ4A 4JOQA 1VE6A 4D9FA 2YXDA 3HSKA 4E6EA 2Z0MA 3LF2A 4G1FA 4MW6A 4KWHA 4CQMA 1QFMA 3T15A 2BJVA 3EMDA 1RZUA 2AC4A 4KPUB 4MUHA 3GD5A 4KV7A 4WIAA 5G0UA 2IF0A 4UOZA 3ICQB 3LUFA 1TJNA 1DJNA 4D8WA 4K9SA 5B2EA 2HHAA 3M6AA 1TM1E 3IUQA 4WZBE 3UJ7A 2ILVA 5HVNA 1L7QA 2ODNA 2ZQZA 4DEVA 4M7WA 4B80A 1C7IA 4ALNA 5ABPA 5K0LA 5CM9C 1IN4A 3DDUA 5E2AA 3ZU2A 3PFWO 1UP6A 2JLAA 221PA 5ALUA 5T4HA 3UXHA 1YRQA 4L95C 1AF7A 4KLNA 4N3CA 4RA9A 1JZSA 2BHLA 4MPDA 1LLCA 2BM0A 4G0ZA 4ZAVA 4EMTA 2P6RA 2XCQA 5HTKA 1W2HA 1TMGE 4G23A 1ZIDA 2QQEA 3K94A 5KYUA 2XQFA 1NBHA 3INRA 1FP7A 3PFFA 4MP3A 5TDHA 4JLDA 3T52A 4PAGA 4OYYA 3IXQA 3T9DA 4DV4B 4HY3A 2X14A 3GP5A 3KBOA 4O2BF 1PEKE 4XDZA 2XYVA 1XQXA 4XM2A 3G2QA 4YO7A 1T0PA 2W6ZA 3PNKA 4CT5A 3BQ9A 1L5SA 2VF4X 5CVJA 3K9CA 2AMFA 1GARA 3LHSA 5DF1A 4LDQA 5KHAA 4BMSA 3BJZA 3GUHA 1PYDA 4IIVA 4P53A 4NG5A 3LZCA 1CUBA 4RJ2A 4JEUA 3LKZA 4M1YA 1LEHA 4HQ0A 3QTLA 4X60A 4NZOA 1FW8A 1YZ3A 3FOWA 1MGPA 1NGSA 3EFHA 3L7OA 4Z0NA 3A1EA 3RRFA 5YASA 3LQ2A 3ZBTA 4JLJA 3EXHC 3NHYA 3LYLA 1XZNA 3QKSA 2F90A 3W5DA 5D1NA 5AVQA 2WDPA 5ENZA 1EFVB 2XB9A 2BFDB 3GRYA 3U61B 2ZAMA 4XQ0A 3D2BA 2XTAA 4L78A 2Y71A 4TLDA 3DTTA 3KKOA 4BXOA 3NHSA 2PZMA 3U0VA 1L1RA 3CH4B 1AUXA 4Q3EA 2ZYHA 4HDMA 4UQPA 2ZKIA 5ILGA 2HDHA 4I8XA 3URKA 4DOMA 3HV0A 5A71A 1Y80A 2FSVC 2QYTA 2IKQA 2FFHA 5FJJA 5FNZA 1GG9A 2YDYA 3ORSA 2ZT6A 1ULSA 3AL3A 4OHYA 3OP4A 1UFKA 3W04A 4I6JA 4ZV4A 1WCIA 1T9CA 1OXSC 1C1YA 4W7HA 3UT5B 5K2OA 3H2ZA 2C1ZA 4U02A 5FBZA 1HSZA 2XNKA 2JAXA 3ETCA 1UFOA 1NSTA 4V24A 1YL7A 2FEWB 1NX9A 3OF2A 4LGCA 5HFNA 2Y9MB 1Z74A 3LZ6A 1NI5A 4AUEA 4KFRA 3LW8A 2P62A 3H87A 1K89A 3CPJB 4M9ZA 3CT4A 1QHNA 1BHO1 3L6DA 3LVRE 2PL3A 3PSAA 2WJ3A 2VK2A 5FPQA 5LZ2A 2OCPA 1MOZA 3PXCX 4QNMA 2UVPB 3DAYA 3K1AA 4N12A 4BKPA 2JI4A 1AQ6A 1EWVA 4FBLA 4F85A 1UJNA 3EEOA 3JAWB 1BFDA 1RC0A 4DXDA 2ZTHA 4JU8A 3ZBUA 4Z6KA 2AFVA 2ZJ1A 4DB2A 2EDAA 5ALRA 4CKCB 1BMQA 1J8YF 4WY8A 5JSFA 4GZMA 3LHDA 3F46A 3UH0A 3A1UA 3WYBA 1NY6A 5DI3A 2PGOA 1K8ZB 2W2MA 3OESA 4UDNA 1XAIA 1NW4A 4TKMA 1NN3A 4AWAA 4N7JA 2X9VA 1YVUA 4DBZA 2TMDA 5KSYA 3OZAA 4RC9A 1DBPA 3RIYA 1KYVA 2DWOA 1QHFA 3D8RA 1XZPA 1L5HB 1M34B 1FU4A 1Z17A 1KI6B 5EJEA 4Q1EA 5KINB 2MJLA 1KC1A 3PWTA 3KQUA 3SEAA 1DAEA 2WF7A 2Z9BA 1J99A 4KO8A 3J7AC 4DYDA 1W34A 4REQB 2PK3A 1O96A 2WJJA 1ZUNA 4GPAA 1XYYA 3IUMA 2GJAA 1A4IA 3EGWA 3I0NA 2QN6A 2CDNA 2XQIA 4G5HA 4MKIA 3UT0A 3HDGA 4EYOA 5KSOA 3W34A 1LSJA 1NUPA 2XMQA 3F2VA 4N5IX 1ZNQO 2C31A 2GBLA 3WADA 2AWOA 3S8MA 5JC8A 1JDBC 1OQAA 3OZUA 5IYZF 3U44B 5FTKA 1NWCA 3FPCA 3IRUA 4RGBA 2FOIA 1E7WA 5KDLA 1GIAA 1LBQA 5IDYA 1Y98A 3WNBA 1BJKA 4JVMA 4NQRA 2FXVA 4CKCA 4Z7OB 5LFAA 3G0OA 2UZ4A 1QDLB 2AXNA 2JFQA 4FSHA 4JY7A 5ALDA 5JSQA 5FKJA 5K8VA 5KPDA 1LBTA 1EFVA 1HSOA 3ASZA 3OEEA 1GNQA 5D3MB 5H9VA 5SICE 5LZ4A 3D2CA 1MD9A 5EP4A 2PRIA 4N18A 5HE9A 1E60A 1CTQA 1YCFA 3B6JA 3AR4A 3WGOA 1A7AA 1FRVA 4I1OA 2PLRA 2PUHA 4XDHA 2JLWA 3R7LA 2AMLA 1H1TA 1HDOA 1Q44A 2VYVD 4UJ5A 1X2EA 3PJGA 3SP1A 5KX5B 2V7TA 2YVUA 4B73A 3DW3X 4P5DA 1PJSA 3E23A 4KTVE 1A77A 2GOYA 3TMKA 1BIFA 1N25A 1RACA 3P2EA 4N5NA 4PF1A 3FLEA 1YQDA 2P68A 1DBVO 3P4YA 2ZWPA 3WMGA 4EW2A 2FSFA 4MMXB 5HRAA 2CJYA 4UQOA 4ZI3A 4DREA 5EKUA 1JTEA 1XKQA 3C43A 4ZMBA 2KSQA 4JT2A 2DTDA 4K0KB 1QFJA 4Q05A 4ZGBA 3Q1LA 4BTVA 5B7PA 2O5CA 1EVQA 1V26A 1DAMA 4F56A 1WLYA 3BJMA 4QNRA 2EJBA 3BICA 4LHWA 4ZQGA 1GKYA 4DMMA 1FDUA 2X1HA 3GPIA 3K3PA 1OXBB 4WERA 4P38A 3VU0A 1FXWA 3G59A 5FTJA 1L5NA 2O2XA 4LJ7A 4XCVA 3AC0A 4XOUA 4UNNA 3N8DA 1LDMA 1EX1A 2GPBA 4FKZA 4O6VA 1SIOA 5IT0A 1CE8A 3UJ9A 4ROSA 5GIPE 3TRJA 5GGYA 5ESWA 3JVVA 5EZ6B 4G85A 2WVAA 4HYTA 3TQFA 3FRIA 4QO8A 4WA7A 4BIIA 3NVDA 4D8VA 2OD9A 1IULA 4U4AA 2XUDA 4D0RA 3FUCA 4NCNA 5LUBA 1XE3A 3HYNA 3ZD8A 2C07A 2FMFA 4YDRA 5EKSA 3K2IA 3G2OA 5AKHA 2RG1A 5DGHA 1SZCA 4K9NA 3T1VA 2QQFA 3MINB 4LBWA 1YT5A 2DPYA 4RGQA 1L5YA 3PQ3A 4WRRA 5GONA 3DEFA 4PCVA 2X9QA 1UJ2A 3RUDA 5HJ5A 4JKIA 2CD9A 4DMUB 2JCGA 3WYEA 4D9MA 5TJHA 2ID8A 4OHWA 3VAZA 2WMOB 4BEBA 1CFJA 3NTQA 5FWYA 3IEMA 5IZCC 5DASA 4DLZA 1GGFA 5AXAA 5GONF 2QN8A 5FV7A 5FPPA 2MSWA 1QF7A 2V59A 3FPLA 3OHSX 4PFJA 3WAJA 5E9JA 3NR2A 3K1ZA 1PRYA 2VJDA 4QDOA 5CG1A 2WVGA 3RADC 3FNRA 1A9SA 3BKXA 1GEGA 1XD2B 3P0EA 4PZZA 5F7ZA 3B60A 2PZAA 4DUPA 2QTVA 2WM2A 2F48A 4I8IA 2HPAA 3OWOA 4GR4A 2G83A 1PQWA 2YZGA 1GG2A 1S3FA 2H2GA 1S2GA 4R2HA 1NY5A 4YWHA 4C0AC 1J0XO 4EJ2A 4LJRA 3IIJA 3O8LA 1H3FA 4I14A 3RFVA 2IU4A 3SXPA 3RTBA 2Q2OA 2FOLA 5ES4B 1CUVA 1U5AA 2UDPA 3V6LA 3PJRA 2OB2A 3OMLA 3QYFA 3RRXA 4F2WA 3KO8A 4CT4B 3G2HA 4LDNA 1F51E 1G7RA 5LR6A 5I7OA 1B23P 3X2FA 4GT1A 5KAPA 1NONA 3HEBA 4N82A 3H2HA 4R68A 4YAIA 3PRKE 1OH7A 4DHEA 3CZPA 1PW7A 2AEEA 1S5PA 3LT2A 4OBBA 4D80A 4LFAB 3V33A 1N0UA 3IOMA 4BJ5A 2MTBA 2ZSFA 4CM7A 5CBKA 4OYHA 1OH8A 3OCWA 3NTUA 4FYIA 4XD7D 4C1NA 5B57C 1GPJA 1T5TA 3HMKA 5LCXA 2Z98A 2A9OA 1T15A 1ML3A 1NKSA 9LDBA 1NRWA 4BRZA 1G8JA 2XDYA 3K92A 4S1NA 3N5CA 4H0CA 2HBRA 4TMFA 3TPFA 1A4RA 3OC6A 2HW8A 2XTMA 4WAUA 2FETA 2BTQB 3G3EA 4H35A 3W1EA 4EB8A 4BMYA 1ES9A 3T99A 3IOCA 5FIUA 4AURA 4US2R 2OFFA 1HG0A 1NAIA 2DF8A 2XMRA 3I3SR 3TMYA 5J4KA 1FSSA 1GR1A 2CMKA 3J80A 1M5UA 1RHKA 4QQFA 3HBJA 4RSHA 1XJWA 3WYNA 2XVZA 2ID9A 5H7XA 4TQUS 1UMDB 4LJYA 5IKMA 5FPTA 1DRKA 3ULKA 1XCPA 3N74A 2VRCA 4MVJP 1A98A 3EQ2A 4GZ3A 3MC1A 5GMOA 4RTRA 4E5NA 3ROQA 4ZI2A 4HN9A 2G6BA 1QS0B 1W4BA 3H11A 3AG6A 3M33A 4G5RA 4L73A 4OXXA 5HMMA 4E2ZA 1T6XA 3KWMA 2R79A 1J7KA 1K2WA 3C6MA 3DE7X 4DPMA 3EIFA 3MD0A 3EJWA 2VZLA 5A5GA 5CH3A 2SECE 3SSAA 5HM6A 3M82A 3N2KB 1CRZA 1J97A 3I9V6 4IH9A 5J5AA 1IDOA 3LT1A 5CUQA 2FSSA 2FR8C 4JLAA 3N87A 4CEHA 3QUBA 1DLIA 2H4HA 4NBSA 4OYRA 5D00A 1AN9A 2VP6A 1OWNA 1L3BA 4LJ8A 4XKJA 4BQRA 5F7XA 3NDIA 1KH2A 4J94A 1HT3A 1JKXA 3KP1A 5PNTA 3RYHB 1ZR2A 2P5YA 3P96A 2OAGA 1FFWA 2GHIA 3WZ2A 2IEGA 3ZDXB 3BWBA 4HGOA 4PINA 5AJYA 2IQIA 4FNOA 4GMDA 4I3HA 2HF9A 3P9XA 1IZ8A 3C97A 1XEWY 3MWKA 4D56A 3A9SA 4Y2VA 3SE0A 3BXEA 2HX1A 4CR6A 2W42A 3AM1A 4NU6A 3EMBA 1JFLA 3EW7A 3O73A 3Q0TA 1D7OA 4UUPA 1D1PA 2HMVA 2I4IA 3AKZA 3HKCB 4PAMA 3FCSB 4G5XA 4GOOD 3G88A 3JWPA 3QU5A 4NABA 2A7XA 4YAFA 1LI5A 4MVJD 3OQIA 2I4OA 1E3TA 3NUGA 5DI3B 3MUNA 1FS6A 4RDHA 2RSLA 2X6RA 4QUAA 4FYMA 1BRMA 1XZFA 2YMLA 2VDVE 5AHOA 1QO0D 3AHIA 5EXXA 1IWBB 2ZIZA 1X7GA 1ZKMA 1QCYA 2V6IA 2Q1WA 3TLGB 3EUEA 5A1TA 3I9FA 3FR8A 2P5UA 2MYUA 2IBMA 2R84A 3WGHA 5LZ5A 4OQZA 3TFWA 2ZREA 2JGLA 2QM8A 3K9GA 3ZE1B 1KDTA 2R6DA 3OLQA 2I2CA 2D1SA 5LUAA 3HB4X 4YP0A 1EWYA 1X19A 3IAAA 3CRZA 3T4EA 3VDQA 3DZDA 2AC7A 4QHSA 3GQBB 5LNK1 1Q3KA 2NSDA 4OXKA 1XZDA 2AW5A 2VSFA 2ZJ5A 2QZPA 3UWDA 3X44A 4ABTA 3MN1A 1ADBA 1Y3AA 2R86A 3CJRA 2YJ6A 3S44A 4D57A 2JIZA 5CDTA 4OHPA 2PSSA 1TIBA 2VZ0A 4HWGA 4IF6A 2G9UA 3CEMA 4DR4B 5KSZA 4O5AA 3PKIA 2ATVA 1AKYA 1UM8A 1DAFA 1JEQB 3MT0A 2B8WA 4GLOA 3HWX1 1WY5A 2I1QA 4FFMA 2VNKA 4ESHA 4ER6A 1PUXA 1PD1A 3QNMA 2OORA 4YK7A 3SBXA 1NOIA 2HRRA 3VSEA 3N2LA 3WZMA 1KMCA 1TZ2A 5BR1A 5L51A 1YBHA 3JQ9C 1UZNA 3QVVA 4G0OA 3UK7A 3EDMA 5EHXA 4MCIA 3MTQA 1ADYA 4ND7A 3Q3CA 4NFYA 1NVDA 4CQJA 2G0TA 2VJAA 1SHTX 5DLDA 3GLFE 4I66A 3HBFA 1J0DA 2D2VA 3WMWA 3G7SA 5AVUA 4DE5A 3M1YA 4XOIA 2OO3A 3O94A 5FQNA 3SHTA 4Y98A 4YRKA 4P2BA 4KFTA 4BC1A 2UYCA 2CJFA 1QR6A 4W8OA 1GPUA 1H2WA 4RCYA 2VJCA 1HYQA 3QPDA 3BGIA 4ND6A 3PGKA 4E21A 2OSBA 3N2IA 3UJHA 2XMDA 1YTUA 2Q4OA 2XNDD 1SHLA 2ZR0A 4CLEA 4LS3A 1JDUA 2CLLB 2PUVA 4FC6A 1P4RA 3I2JA 3TOSA 5C52B 3NDPA 1R6XA 3Q7TA 1MEOA 1YMVA 2OZVA 2Q3CA 4JUIA 4UXIA 2YHSA 3VXKA 1YSCA 4N7RA 1PTJC 4NH4A 4CV0A 1KYYA 1CZLA 3NASA 3QBTA 3EXHA 3STYA 1NTOA 2C5GA 3G5LA 4B35A 3FTDA 5K03A 3IVGA 1GPMA 1KL7A 5A04A 1PZXA 3L7IA 3ZZ0A 4CVNA 3F0TA 5ERXA 4ZU3A 1NXXA 3RM3A 4MRMA 2IYQA 4OGWA 1X1EA 1KU0A 1RPAA 4LV5B 2QL9A 1UZUA 1AHPA 3GG9A 4PC7A 2AKYA 1JQ3A 3G7UA 2VZ9A 1DC6A 3KUUA 3G23A 1HX7A 4GBGA 3TNJA 5HKBA 1KAQA 3RJTA 2IIVA 5L8VA 2CMDA 2WA2A 2WWTA 4H3VA 2GUWA 1KK0A 4X85A 4D4HA 1PL8A 3IOBA 5L95A 1VBFA 4A0HA 5B6PA 3DG9A 2OUIA 1Y1PA 4TM7A 2JIZD 2P6MA 1JQAA 1CY6A 1KOJA 5HOQA 1VYTA 1SHZA 4NHOA 1AC5A 3TOCA 3I6YA 1ZM7A 2X8LA 4B1FA 3BIWA 3OX2A 3MB8A 1QIGA 2R25B 2WFZA 3ONFA 5IFLA 1FYXA 2MU1A 5BR8B 2ZAIA 1UXKA 3T7JA 4RJKA 1IXZA 4MLCA 4NZZA 3TI7A 4MA0A 4TL7A 4FU0A 4TTIA 5MN5A 3L1UA 4IQ8A 4G09A 4IO1A 5KUTA 2NYUA 4MUXA 5AKIA 4DDWA 4JLUA 2C00A 4FI3F 1IEXA 1P19A 4BMPB 4EJFA 1Q57A 2BMFA 4QT4A 3LPMA 4LC1A 2C9YA 4H1WA 2M2IA 3N86A 2KX7A 3GVIA 3AHCA 3ZU6A 2YY5A 4B6GA 3K0AB 1UEJA 4FEAA 1UC5B 1M2WA 4HCJA 1GZ4A 3RG2A 5KNCH 1FZTA 1G6KA 3O2NA 3A4LA 4DNPA 4YV7A 3KKZA 4H7FA 4Z4HA 3NJ8A 1Y8RA 2CL7X 3I6QA 5F2EA 2YY7A 3LPDA 2PYZA 1EVEA 1BD4A 2QLTA 3IQWA 3AUFA 2W43A 5F5NA 3ZHCA 1RBQA 1QOZA 3PRYA 4JB8A 1CLUA 3DHWC 1CRPA 2PM8A 4JJ8A 1XT6A 2GEUA 2IYTA 4DSOA 4AX8A 4KOAA 1W46A 1L8LA 1T5LA 2OQ2A 3BWMA 3N28A 4JBYA 4GKKB 5F2KA 1I4LD 1PR9A 4US0R 4RSMA 1LD3A 2ZZMA 4JBIA 2XNHA 3E9RA 1Z34A 3HYSA 4IMJB 4S1VA 1GU7A 3SN6A 4CM4A 1NLUA 4K2HA 2RHJA 4IZHA 1PT9A 1CKEA 2CNOA 3F4KA 4BZZA 1AX9A 3EYWA 4JBNA 1RRFA 1NUUA 4BBZA 3DB2A 1BQ4A 2XUJA 2ZRLA 1WW2A 2PV0A 1XZ8A 1ISRA 1OYOA 1YL6A 1U3VA 3MWEB 1HO3A 1CZUA 1B16A 4UVEA 1XKTA 4DJFC 2J0UA 3CUWA 3G5TA 4RHEA 3RFUA 4EFMA 4IAOA 5L3SA 4Q3NA 2QROA 1YR6A 4AKIA 4KMOA 4X45A 3ND6A 4Y9UA 4Q4CA 2ZOSA 5DHUA 1O95D 1UKEA 3O7WA 3DR3A 1S2OA 1UMKA 5A6SB 1XPRA 1GCAA 2F3TA 4OLAA 3AM4A 3ER8A 5F73A 1X1RA 1IM8A 3IMEA 4J7CA 5EIWA 1KO4A 1Q15A 4J9VA 2Q1TA 1BXGB 4X92A 3E81A 2QLJA 1D1TA 1R74A 1JLRA 5CT4A 4D8UA 4EO4A 1EIWA 2BE9A 3O2SB 2QWXA 3BIFA 3GJZA 4R5HA 4YNBA 1QANA 3TI9A 4E5DA 4NK5A 4F5ZA 1DARA 1J9GA 1JQDA 2D8MA 2Z8YM 1KPIA 3IP5A 4HDMB 4I6GA 4UAGA 2X0EA 2NVBA 1BNCA 1JA1A 4GG1A 4NP6A 2IWRA 5GM2A 2YXNA 1XXHB 3OETA 4IY1A 3R4CA 4UJ3A 5JZOA 1QVAA 2WZDA 2VBGA 4YP9A 4V39A 3TIFA 2VTBA 4E5KA 3H83A 3HHEA 2KHZA 2CFIA 4PBSA 1G5IA 4QXPA 4IZ6A 3RUCA 3PEWA 5EXEA 3V8NA 4JI8B 1ORDA 2A9KA 3QPUA 2O1XA 4RQAA 4F4IA 2NT3A 3F6PA 4Y0NA 4OHVA 3TUZC 1Z8DA 4B3FX 3KL4A 1E1DA 4CDMA 3OT1A 1U7WA 5CLGA 3HL4A 4D3FA 3A9WA 1K6IA 4LXQA 5E6SA 2OCIA 1TFRA 3SC2A 4Y2SA 1FUEA 2ERXA 1E2IA 3RBVA 4BFUA 1I0IA 3FWNA 1KFKB 2P9JA 3CF4A 4ZQHA 4IV5A 4NLLA 1ZIOA 2I3GA 4BNFA 1UPTA 2RHCA 4PZPA 4Y2TA 1Z6TA 5B12A 2BSXA 4DSTA 1ODFA 5EYPA 1ZBQA 4HXYA 1ZP6A 4A23A 3FBTA 5ECDA 1OX4A 1DC5A 2OESA 1O4VA 1CJVC 4EX7A 1V9LA 2A84A 1C4OA 3BD7A 5KWVA 3ITEA 5GJVC 2GARA 3EXHB 5AK0A 1EZ1A 3B82A 5TQJA 3HN6A 3VPCA 3GZTB 3LXXA 5U9CA 2PFGA 1IB0A 5KO2A 1YAJA 4FUQA 4ZZ1A 4KCGA 1W581 2BVNA 3NVMB 4YAWA 5JZSA 4TS1A 1CRLA 1E6EA 5J23A 3RF6A 4HYYA 3W2HA 4LHSA 4Q3CA 3OOEA 1HE4A 4K9PA 2XF8A 3LWDA 4NCHA 4UTXA 5A9SB 1J21A 1NSYA 3DFKA 3ZBPA 5JBQA 3LX4A 4CGZA 4QRIA 4X8MA 3K7EA 3ZPXA 4IIEA 1ZUWA 5IAOA 1N3LA 4LXXA 3VNVA 2W6JA 1BWSA 4PPNA 4X00A 3KLOA 3K0FB 4BRUA 2QP9X 3R23A 3TSZA 1C9DB 3MUEA 3LNCA 1YZHA 4EYKA 5AVXA 5I01A 2W5UA 2NZYA 3DKIA 4JP1A 3FBWA 4HDNA 1O9HA 5A5VA 4PQEA 2CCJA 1XQVA 5IM4F 3PA6A 4HH1A 1WX1A 3H2BA 2WTBA 4NESA 3MD9A 2Q62A 4YB8A 1CF4A 4J07A 1CVIA 4WNAB 1HEIA 1QHYA 2AKAB 3KYDA 3NZEA 2IHTA 4B6JA 2YJGA 4DLNA 1L6RA 4RPCA 1T8UA 2FQYA 2AUTA 3VPFA 4RULA 1J0EA 3CZRA 4LGVA 1T8YA 3TZCA 1Q0PA 3JQBA 1NLFA 3TVTA 3B89A 3PPYA 3GLIE 1XZAA 3PV0A 4NYJQ 5BPHA 1VL5A 2FPMA 3B9QA 3WWEA 2O1EA 2XRZA 2FNAA 2A33A 3O1LA 4C78A 1XHEA 2H7CA 1CRQA 4PLFA 5CYPA 3AFOA 3VKUA 4CR7A 3RS4A 3E7PA 1PIWA 1JKJB 4IO0A 1G7CA 1KHHA 2B61A 3LFHA 2IRWA 1JMVA 2J48A 4LOJA 4QECA 1C5KA 4EHIA 2E49A 1B4DA 3G0GA 5REQA 3I8XA 4REQA 5J9FA 4AF7A 3BRWD 3Q0IA 1ACLA 1TLLA 3WP0A 5L3SB 1G64A 4ZVKA 4D43A 1FTYA 1CY4A 3Q2OA 1GGMA 3ICEA 4QSHA 1OIVA 1T10A 3IP1A 2VHYA 2HFJA 4NENB 4RHCA 2NPOA 3FDZB 4R1OA 1QV6A 4A8JA 3ZCQA 1FRZA 1EP9A 2JLYA 1FTSA 2MSCB 4LXYA 4QG7A 1X7YA 3MWLA 2PIAA 3AJRA 4X0EA 3U7GA 1P0FA 1LTQA 1TUEA 3IPRA 4BX9A 1Q22A 3GGOA 2VP3A 4MCJA 1E3LA 4YP7A 2ZVDA 4XIIA 3HO1A 3L7NA 3TNLA 3UM9A 3O8RA 1R12A 1GEEA 5A5FA 3D8SA 1RTKA 4R31A 3PDWA 4YR7A 3WGJA 4RZ3A 4H3SA 4DR3B 1QXSA 4PGAA 2I8AA 3L6UA 5JPDA 1AKMA 1PT7A 5L6LB 5DYGA 1GAWA 3RSZA 4XYBA 5BWOA 3CW2A 1QB8A 3OE5A 6LDHA 1AE1A 3L7LA 1PGPA 1UMBA 2ZUEA 2EGUA 3L92A 1IPEA 2CVHA 2PT6A 4KPFC 4V1CB 4NC9A 1D07A 4ZCRA 1Q7EA 1MV5A 4BNXA 5BR7A 2PQ0A 1Z47A 3K0AA 2R7LA 3R0IA 2Q50A 3B9BA 4P86A 2X2EA 4P2GA 4ZYXA 1EFUA 3CM0A 2OZEA 1EK6A 1TC1A 3M5PA 4HQLA 1FK8A 1Q0TA 3HCOA 1HL3A 3NBMA 4YJGA 1LLQA 1VBMA 3A6FA 5NLLA 4HLNA 4HT3B 2CNBA 4HNQA 3LV8A 1AK2A 5DBFA 2P9CA 3WIVA 4C07A 3KT3A 2ZR8A 1AU9A 3N2KA 1PJCA 1K3TA 2BOVA 4I4TF 1FS4A 4RY9A 2B9EA 2WSSA 4JR1A 3SVLA 4YCBA 1YBAA 1L5LA 1UMCA 4P82A 4WESB 1I3MA 5F3WB 1L7NA 2V1XA 4FK8A 4L8WB 4N7BA 4Q9NA 4EM6A 1EE2A 1Q7RA 1MX1A 3H9UA 3LUKA 4RXUA 1E2MA 2YYAA 3RCBA 1TYEB 2H7YA 4FGUA 3T3MB 4UMFA 2HT6A 3FNQA 3T3IA 3HLYA 4OIFA 1C0KA 1F14A 1J0CA 3DMRA 3IDQA 3FKSD 2QRKA 1N34B 2OB1A 3AKYA 5JEEA 4LBYA 5IKPA 1KRHA 2B94A 3KHTA 3L40A 3NV9A 1IHYA 4N3NA 3O92A 3M4ZA 4JN6B 5DNCA 1VCNA 5TARA 3PFCA 4CMKA 2WG1A 2WKWA 1LGYA 3D6JA 5KJ6A 3DBVO 1OB5A 4UFPA 2C4VA 2ZRBA 2CMFA 4MITA 3UATA 2CSXA 3JQPA 1UDXA 4KIFA 1P9WA 1ZJZA 2OAQ1 2Y93A 4A15A 1YS2X 1IB6A 3MT7A 2J9FA 3Q3VA 1TM7E 2CHQA 4G9GA 3FYTA 5HBGA 4UQLA 4M9XA 1PQUA 1AS3A 2BZSA 3K9LA 1VMAA 1CJBA 9MHTA 2DJ5A 1VFNA 2DPHA 3LDUA 1XKXA 4BKQA 4HGQA 3NKFA 4DBLC 1E69A 2IYWA 2OV2A 1CJMA 1Z15A 2AEFA 5DHQA 4NI5A 1ZL2A 4I1PA 2VATA 3DE4X 3LQ1A 4M76B 4W5NA 4WCVA 1EQAA 3P32A 2NN3C 3W2GA 2DTEA 5BVHB 1O95C 2VWQA 3EVBA 3OZSA 1YS6A 2JCYA 4G1EB 2NUPA 4FTWA 2Q5HA 1RC8A 2IS4A 3KZNA 4UNIA 3TO5A 2X5NA 2Y1LA 5SYMA 2PTHA 4E4RA 4IFIA 3VMMA 4EF4A 2CSUA 3JARB 1C3LA 2HSGA 5CLLA 4KWEA 2JFUA 3T7RA 3I76A 5KNDD 2RD2A 2CLKB 3KEQA 1E2DA 3U4IA 4YVFA 3G9ZA 4G0XA 1O96B 5HIMA 4BN0A 1XNQB 4AJIA 1IHDA 8MHTA 2WWHA 2H31A 4HI0E 3BX1A 1CDZA 1Z0FA 5HIJA 2QZZA 1KEPA 1R8XA 5AJUA 1YQWA 5B2ZA 4DRXB 1VMEA 3QW4B 3FUXA 4LF5B 4K81B 7AT1A 3QH4A 4GWKA 1FS5A 4NE2A 3STUA 3T9CA 2NZWA 4O3MA 4CFSA 3T3EA 1NP3A 3L6EA 4RD1A 2NZ8A 4DUGD 3MAJA 2BSQA 3LOQA 1H94A 1L4NA 3VKFA 4KP7A 1U6JA 2Z2YA 3U4QA 3VR3A 3JQ7B 1E98A 2QM3A 4J4TA 1FY2A 2ZDQA 3IPAA 4Q3DA 1G6OA 4TL8A 2HXSA 3B78A 1YR9A 4NNPA 3UHFA 2R8YA 3FVRA 3IVMA 2PBLA 3ZWMA 5HUHA 3GFSA 2PR2A 3DBRB 1BE8A 5HJ2A 5AKZA 5JDCA 3T35A 5K1ZA 3K6SA 2A5LA 2J5BA 4GX2A 4IX9A 3PBKA 4OO3A 2PIDA 2VUUA 1XDBA 3M5DA 3PFHA 1Q1BA 4BMXA 1PFYA 1Z5VA 3Q8XB 2JARA 2G70A 1J9EA 3D3WB 4XVQA 1VJ1A 1GTJ1 3CTMA 3BILA 4IZOA 4RA6B 3UK0A 3WLQA 2WKQA 1Z62A 4DR5B 3EQZA 1KJWA 3UHAA 1IU9A 5JNTA 1CUEA 2OZPA 2R6GA 3AR8A 1H5NA 3KB6A 4GLFA 3GRAA 4LC9A 2RAUA 4DCNA 2G1AA 4BZPA 4RHTA 2JRLA 4EEKA 1YO6A 2FPIA 5ENVA 2IEAA 1DQNA 3H5AA 1FP2A 5DT2A 2XODA 3EZ6A 3GJ8A 4OAPA 4OD0A 5T6MA 3ROZA 1PFQA 5LP6C 5LYJB 1M54A 2Z83A 2VXOA 1VIDA 5KB3A 2E82A 1XRLA 1ZVKA 2AFRA 3NATA 1ZCJA 3TS1A 3PXGA 2B30A 2V7EA 4RS4A 3E3NA 2VHUA 3VZSA 3FB1A 1B8UA 2GGSA 2YUIA 4LWOA 4C2TA 2J3IA 4IINA 4J4BA 4LMRA 1W5FA 3WKAA 4JBGA 4C0BA 3QEMB 4PZCA 4Q82A 1ZW6A 3S5JA 4E08A 4L5CA 2ZRQA 2YYYA 4URZR 2HO5A 4IJVA 3FDXA 3IVCA 4GEGA 1HFEL 3ZLBA 1Y3HA 2MT9A 2P2ZA 3G5AA 1IQRA 3L9XA 3WKDA 4B6RA 5C4MA 2BLLA 4G6ZA 1NVMB 3DLPX 2J3KA 3H04A 3PE6A 3WG9A 1E2LA 2OC4A 1JPJA 4AYWA 1V71A 3PPXA 3V8MA 1GU0A 3CKKA 3NGLA 1U2ZA 3QQ5A 2RHOA 2QNBA 4Q9AA 2EWWA 5F5LA 1W5AA 4ASUA 4CL8A 4TZ6A 2D8AA 2AN5A 2PEZA 3MAAC 1XZCA 4L8GA 3LHFA 1WM1A 3AZQA 4HQFA 2HGSA 4E11A 4EY7A 4OJNA 3O3OB 4RZQA 5K0BA 2JJ8A 2Q5EA 1X8JA 2ZIVB 3GYGA 1TEZA 3MERA 4C0XA 2QIOA 5AVTA 2NP7A 5M5BA 4J0DA 4MVJF 4CTOA 1M6EX 4HMPA 1HLFA 4U6NA 4IDCA 1XNGA 5F51A 1SBTA 3TZ6A 3H9GA 2NPFA 2DBRA 2YNMA 5CYFA 2A14A 3ZJ4A 5AK5A 5I5EA 4G4IA 3LBHA 1V9SA 1KXJA 4UC0A 3VR6H 2IGBA 4BFYA 4HQ6A 2A5GA 3CWZA 1XRMA 1OY1A 2Q1XA 2FN9A 4LWZA 2CFOA 2CNWD 1B14A 3USZA 1JG6A 3QU4A 2PE5A 3E61A 1LLFA 2D4AA 4W8GA 2BGTA 2DH6A 2OBNA 2UYOA 3UQZA 4ARCA 1MIOB 1PGNA 4TN5A 4K9OA 3WOVA 4F6RA 4UU0A 5E1DA 1I94B 4QICA 4QNNA 2WWGA 3LRPA 3G49A 5IF3A 4JX8A 2Z9CA 3QLUA 3UBMA 5DBOA 4GOLD 5CLHA 4E94A 4X6LA 3ZUPA 3U16A 1CYDA 4XRGA 2BUCA 3SYNA 1WUKS 4L07A 3L8MA 3V2IA 2OFOA 4FR2A 1M34A 4MVJE 2ZSEA 3HJBA 1R64A 3OCJA 4GICA 4HNGA 4JT8A 2HBQA 4U5QA 2NOAA 3UMFA 3UV7A 4KXFB 1QPGA 3A7DA 4EFKA 1XA0A 4GX5A 1HDEA 1PF7E 3FWPA 5AKXA 4C1BA 3L9WA 1W88A 2C04A 3R41A 4EAAA 3CBQA 2D5CA 3BIOA 3X1DA 1OI4A 2W2KA 5FUYA 4YALA 1XD9A 3VR1A 3M6MD 5HK9A 3R3WA 4OBXA 1YZNA 3BZUA 3JZAA 2V9CA 2VDJA 2GD0A 3F67A 4M9UA 4RNDB 3WK4A 3CH7A 1T9GS 4M0PA 2JEZA 5F1KA 2XE7A 2N1MA 3L4JA 3OCYA 1X1CA 3FTFA 3S2UA 5K3DA 4BNHA 1P6QA 1GAXA 5CFPA 3EGIA 3NP7A 3VBEA 4TROA 4CV2A 5TF0A 1MB2A 3G1WA 1K8XB 2XECA 3VZQA 4EG7A 5ICGA 4YRIA 3SX0A 2YYSA 3AIKA 3OM0A 2WOOA 4MV9A 4ZAYA 2FG6C 2VCHA 1YRWA 3WDMA 5TGTA 1I9GA 5FUWA 4C88A 4DLTA 5F2NA 2QI9F 2EFDB 2GHQA 1O6FA 1PNOA 3AGQA 4Z51A 5BSKA 2AT1A 1IRXA 3ABQB 3LK6A 4LDJA 4CMHA 3VKHA 1AXGA 5LB4A 3K96A 1TO2E 2CDBA 4M7PA 4PLTA 4IDFA 4N39A 4QBGB 4AP5A 5HXAA 2ZXUA 3C5CA 3KAPA 1YS1X 4G8BA 4LEIA 5LP6A 5BPFA 1S8NA 5HS4A 1LY1A 2PMDA 4FC7A 1OWOA 3BE8A 1I0ZA 2FSIA 1RAEA 4FW9A 4B31A 4C4TA 1FP6A 4RHYA 2ZU0C 1EWTA 5E0KB 3OLWA 1DO2A 4XWTA 1DEOA 3VYTB 4ZYYA 1FVFA 2AI1A 1GTG1 2YN0A 4BFVA 1LUAA 2MSNA 3ZV3A 4B3DA 3HO8A 3KAQA 4NEHB 3QX9A 4PZUA 3UHOA 1DRJA 2FHSA 1SULA 2IXFA 2R1UA 1U0LA 1PR3A 4FT4A 4RANA 1LVUA 4OP1A 4RF2A 4D45A 3QVWA 4LZNA 4BO5A 1WSDA 3C70A 3BG5A 4LZOA 3HSSA 3BXPA 4XEUA 4AG3A 4EMBA 4BQEA 2F1KA 3KQYA 1NX6A 3MG9A 3MT9A 1AK1A 3DGFC 1GSAA 1ORHA 4U5XA 1JLLB 1N8NA 2OO5A 3ESRA 8LDHA 5FAKA 1LDGA 5IT4A 2X4IA 4CMEC 1WPGA 1XMSA 4ASUD 2B83A 1KF0A 3JVDA 2NXEA 2ZWVA 3PJFA 3PUHA 2QJTA 5JS2A 1WB9A 1ZD1A 1ULZA 2BELA 1WMBA 2X8JB 4IR7A 4RPLA 1ID1A 2OHFA 4L0DA 1Z63A 1YTLA 1X1QA 4DLPA 3AR3A 2BIFA 2XMZA 4ZI7B 1BJTA 3KR9A 3L0OA 4JLPA 4W4TA 1C7RA 4RHFA 4NJMA 5FNVA 3AR7A 5GV7A 3LP8A 4X1YB 1BW9B 1MAWA 4RKYA 5JDIC 2P35A 4D0SA 3EIQA 4MYDA 2C1EA 1GYQA 1CUIA 1L4EA 2A9QA 2X0RA 2ROQA 1XL1A 3A6DA 1HT2E 2ZAGA 1OI3A 1W87A 1ZL0A 2XQGA 3KQWA 1T5SA 2OG2A 1U11A 1BQEA 2HJVA 1H6BA 4AW9A 4V1CA 2JFWA 1X7WA 2A88A 1DIAA 2JBAB 2ZCUA 3R3ZA 1D0IA 3EA0A 1E77A 5KTPA 4O4LB 1DQPA 2AUNA 2XQVA 2OCKA 2WPDA 2HBYA 3UBTA 1ISJA 1BMFA 2CBXA 2ZVPX 1JW9B 4B3SB 2Q2NA 4BLQA 2WJZB 1VIYA 1TRHA 4X94A 1RKBA 1SOWA 2IYUA 2O2ZA 3A4NA 4LSGA 4XFDA 4ALIA 4PCUA 2RGNA 2NAPA 4JP5A 4K8OA 1GPDG 4N9QA 5E4FA 1P1RA 1T91A 4MKGA 5JU6A 1MJNA 1VLLA 3BRSA 1YRAA 2R8XA 1TZCA 3A0RB 3E3OA 4RDCA 4BNMA 4JA2A 3TW6A 5SZHB 3QXJA 3R1IA 5FJIA 4DWJA 1A8HA 1MDBA 4BASA 1U2DA 5DNDA 1JAYA 3MOSA 4WXPA 1A8IA 2Z09A 3LSYA 4LK2A 1EA5A 1DO8A 2ZIXB 4O4IF 1B43A 2O0MA 5D7BA 2B8JA 3DAFA 3O93A 3ZVLA 4N48A 3RD5A 1ESDA 3Q7QA 1A5TA 3VHQA 1Z5ZA 5FBQB 1Y34E 4EY6A 1OU0A 4EKGA 1CUUA 4M7RA 1E0SA 4N0PA 3AEXA 5JSZB 3KX2A 5KWEA 2IU6A 4HVTA 3P2YA 4EW1A 2ZCJA 1YVPA 2WTMA 5CXXA 2EBWA 3ZKAA 4C0JA 4YMGA 1NSFA 1WXGA 4DQDA 3W6NA 5CA1A 5KOIA 1CIJA 1T9KA 1OFTA 3OUZA 3U7QB 3N1UA 4IRMA 4PYQA 1M9NA 2Z3ZA 3KKNA 5L3QB 4NCBA 3ZWYA 2C20A 2AQHA 2Y9PB 1DQZA 5AKYA 3NT4A 1XC7A 1T4GA 2YVQA 2DECA 3WKEA 4EJSB 4PG6A 4WCDA 1KI8A 2MYPA 3P2KA 4ACAA 1G4HA 2W4QA 1XF1A 4PSCA 5J58A 1DKNA 2LKCA 5J4HA 1JHRA 2P41A 4MR7A 2B4RO 3I0ZA 2HU7A 3RS8A 1MX3A 2HMUA 4NAUA 2CY0A 1E2PA 3GQBA 2X2OA 4MAAA 3QOXA 1EBBA 3WYCA 4EKIA 1AKTA 3KEGA 1PR2A 5B1YA 1LV7A 1TQDA 1QG4A 2VH2A 1P6XA 1JJAA 1P73A 4YEDA 2VP4A 3WIEA 4UHJA 1DRVA 4XXHA 4Q6BA 3ODPA 3D9QX 2QV0A 1WABA 3PGA1 5B1EA 1JALA 4HGRA 3DPUA 1V47A 4KIJA 4NZMA 3ZWPA 1DPGA 1JVSA 2H4ZA 2ATIA 2ACEA 1L5WA 3OE4A 2B1RA 1V8FA 2D1YA 6PFKA 1Y0BA 3LUCA 3EZ2A 2Q8PA 3TAXA 5J2UB 4GM4A 4R7ZA 2QTRA 2QXUA 2UZ3A 1NVUQ 1BH2A 2P3QA 1ELOA 4YA6A 1EQ2A 3GRRA 4DV5B 3ZI4A 3IE2A 4GXTA 1C7QA 3LC0A 1Q1AA 2NXWA 4G5QA 5KOHA 3RS5A 3B6ZA 1HLPA 2XITA 3W6ZA 4BLPA 1WDTA 4ENUA 5CITA 5IUNC 4P4GA 3OIYA 3FKSA 1HE2A 2PX2A 4CHGA 3LUJA 1KNQA 3H86A 5ALIA 2WWVD 1NI3A 2JJYA 2B4KA 1MC1A 4RVSA 4ZFNA 2FRVA 5D01A 3EXIA 1CR2A 2NM0A 5E9QA 5EPEA 5KYWB 2ZUCA 2XCIA 1RBZA 2C2GA 4WBNF 4K8RB 2GCEA 2P4EA 4S2UA 3BE5A 2VDRB 2FWRA 3O3NB 3AI2A 2Y8EA 4DMRA 1T36A 1BFUA 2J0EA 2QR2A 3U37A 1L5FA 4L4UA 4D6PA 1ZU5A 1TIPA 5KAMA 4N4AA 3OE7A 4I2NA 2QN1A 4C9BA 1W9MA 1ZONA 2VYNA 2WIGA 3T0FA 2PL1A 1XHLA 3KLMX 5DYNA 5HUQA 2AMYA 2REQA 4IXDA 4Q1AA 3FR7A 3PQCA 1RWBA 3FCOA 4P5PA 1P2UA 1HNZB 2OO7A 1VE7A 3GYBA 2VJLA 3N8NA 2Z2ZA 1PDWA 3HRIA 4D3SA 2JAPA 4XVHA 3A6HA 3LCMA 3KZVA 3ML1A 2GESA 4GH5A 4ONEA 3VHXB 5EZQA 4IXMA 1NW5A 1N0HA 3OE1A 4MWGA 5KKAA 1N2GA 2C2WA 3DZJA 4FMCF 1CK4A 3ZQKA 4D6YA 4Z49A 3PR1A 5B58C 5LKAA 4HVLA 3NYIA 4GI7A 3L7CA 1HETA 1GPAA 3OZXA 4V0RA 5EP2A 3A2KA 4OHXA 4HLCA 1QGDA 1J7JA 1EWKA 1D09A 1NULA 1EM8A 2G4CA 1Z0KA 2P2DA 4JSYA 4ZQCB 4YMIA 3ROPA 2AK2A 1MRZA 1LBIA 3RJ9A 3WLFA 3OQNA 1L2TA 1L7AA 3D6VA 4YJFA 1RYEA 1HDCA 1M2EA 3ADOA 3ISJA 4TS3A 4UMEA 3WGGA 1IJEA 2E7ZA 3KE8A 3PUJA 4NIMA 3I2KA 3VNQA 4DUGA 3CF6R 1QMPA 3R7AA 3EBPA 2H1SA 3S28A 1JQJC 4G0PA 5D2CA 1X70A 3WNDA 4S05A 4YONB 2WT4A 5KOJB 1ZLYA 1E5LA 1RRGA 3RS0A 2PRYA 2QAGA 4L3OA 1BHJA 4FMPA 3RHTA 2WM9B 3C24A 3U3JA 5HDQA 3PFBA 4BMNA 5DCYA 4WASA 1QRSA 2ORWA 3SKXA 4WKNA 5JE8A 3EDRA 1MP0A 3R3SA 1T0UA 1T13A 1BJRE 3MJTA 1N4DA 5B3KA 3RUIA 3WGKA 1AGNA 4JJZA 3DAOA 4ZOAA 3T5GA 3VNSA 4CMJA 1WQ3A 4Q19A 5J1TB 1PI3A 2CDAA 4ZRDA 1VLQA 4I0WB 1IBRA 3TZKA 4Q15A 3WKBA 4BIMA 3EZXA 1TOAA 1E5TA 1MOSA 3M3DA 3KIPA 4HADA 2NU6A 2AS0A 2G09A 1XVIA 2TMYA 1SHJA 1BD3A 3GHHA 1C4WA 4I9GA 3E7XA 2MINB 1E61A 1E2FA 3ZLTA 1KRWA 2ZSBA 4YI5A 4G86A 3AUTA 5H83A 1PK8A 1XZLA 2ZK7A 3EBOA 3OCZA 1PFKA 5KYVA 1C9JA 2XJ9A 3FWZA 2J6HA 4ND4A 5LBIA 3PUIA 4IEIA 3KUCA 4O4JA 3SEZA 2Q3HA 3WGZA 2XKKA 5IAJA 1RXUA 1CPYA 3D8UA 4KN5A 4X1IB 3MWGA 1I4OA 3H8VA 3V3KA 4B6FA 4CLRA 1Z0DA 2ZB8A 1WUYA 3G0CA 4I1UA 4PHTA 3F8TA 3PNVA 2G36A 2J3DA 4FX2A 2HRDA 2NUAA 3VDXA 1EUDA 3MQ4A 1SUCA 4QEDA 4X6XA 1D03A 5EJAA 4BNJA 5JHHB 3AU9A 2J5RA 4UEOA 4ZJUA 3FCXA 3TIIA 4BNWA 3DHNA 1PEDA 4JR0A 1G1AA 3K4QA 2FYTA 2Q6VA 4IXWA 4YRCA 5AD1A 1F4LA 1L5HA 5BYJA 3GLGE 2O7QA 4M9SA 4R54A 1NR1A 2B4YA 3TEFA 3DE2X 1TD9A 1TZBA 2Y1KA 3E4DA 3ESXA 3OI7A 3RBXA 1T9HA 4BO4A 5DYWA 3X1JA 3KEFA 4XFJA 821PA 5TPWA 4D9NA 3FUUA 1UIMA 3GMDA 1ST3A 3PYMA 5T41A 1P31A 5ALOA 1TKBA 1YONA 1C1HA 2O2JA 3PC4A 1F0KA 1MJ5A 4UM8B 3OX4A 3QV2A 2Z95A 5FWAA 3WGYA 1AS2A 3ERCA 5DN9A 1WG8A 3HA5A 3QELA 5EIHA 3OVMA 3TQOA 5A02A 3LLSA 1C14A 1FJGB 4H60A 2FAXA 2V03A 4GAEA 1DRUA 1ULTA 3H3FA 2AQKA 1P74A 2EFCB 4JC5A 3F47A 2OZKA 4W5WA 4JVSB 1QRAA 3AUJB 3WV5A 1M72A 1VE9A 4K40A 2RG7A 7YASA 4XIYA 2GZ1A 2IXEA 4PPGA 5DM2A 1ADCA 4IQGA 3DVRX 1JXOA 3RTGA 3N2NA 2EWVA 4BXOB 2O8EA 2OHIA 3WLRA 5AW2A 4H27A 4DZTA 1LQTA 4R8SA 1E9DA 1X39A 4PO1A 4V0SA 1QWOA 1OYYA 2JLSA 2G9VA 5JD4A 2FF7A 4G3XA 3M6IA 1SXGA 2F3SA 3HYLA 4UTNA 1Z4OA 4FCTA 4HQKA 2CD7A 1BVUA 2QM7A 4H2DA 4GLBA 1KK3A 4MW7A 4NK4A 3Q72A 4A6XA 2H5IA 4B8WA 5K05A 5LJLA 4I5DA 4NE7A 1PQPA 4IJUA 4E7OA 3KWLA 5KZMB 1WNFA 4HLUA 2JF0A 3OPXA 4WNCA 4W9MC 2GRUA 3VM6A 5BQXA 4PZDA 1GSIA 2IDKA 3NTOA 4YY3B 3NP9A 5LD2C 1WHSB 1E79D 4ER5A 5IDWA 1N32B 1WKCA 1U0SY 2X9GA 3C3AA 4G67A 2OUKA 5KYKA 1EWQA 5JCPA 5ELLA 4I3GA 3H1GA 3A3YA 2P91A 3LG2A 3ILSA 1UEXC 5EHNA 2EIXA 4ENWA 5LD2B 4OLBA 3GJSA 1OZFA 1TPYA 4AQYB 1APBA 3JD0A 4LVUA 1YJBA 4YCMA 3T3NA 5EKTA 1Y42X 3KHUA 3DZ8A 2ZKLA 4WXHA 2DFTA 3FOEC 4MEBA 4PQYA 1B8OA 2JHCA 1I3KA 3AUKA 3LNTA 4V0NA 1YR1A 3VPSA 4E2XA 3K1TA 3OFNA 4A36A 3Q3EA 3I52A 4BNGA 4MX8A 4ZZ3A 5K5EA 5FTMA 5E7MA 3AR2A 4J0EA 3GMIA 3LKBA 3U4GA 1HH4A 4RETA 5CDHA 1SZPA 4MUFA 1L7EA 4OAQA 2W2NA 5IKEA 3CKLA 3FSGD 3GPDG 1MT3A 2H9IA 4CF6A 4M0CA 1BX3A 3EXAA 1ADFA 2C4KA 2OLKA 3N53A 3ZYCA 1P4HA 2ZIUB 3C0KA 3ZWAA 4AX4A 5LMNB 1LDEA 4WFKA 3SEQA 421PA 4MRVA 2DBZA 1DV2A 2C9MA 3GUUA 5C37A 3MOIA 4JP2A 3KQVA 1GZDA 1HYGA 1YJ5A 2WW8A 4PCAA 1NRXA 2I6GA 2JH8A 4HDOB 1IN6A 2OXEA 3R4VA 2W6IA 3G2KA 1ZNZA 2AYZA 2VPQA 3HM2A 4QDUA 2GRJA 1L5RA 4B17A 2ZQ5A 3FYUB 4JIMA 5EVCA 5I7EA 3GQVA 2OM6A 4RVFA 3W5VA 1PKEA 5JAOA 3QBDA 3W2IA 5J59A 4ARZA 4COKA 1FTWA 4K46A 1ZD5A 2H1RA 1AA6A 4IICA 1PYOA 3ROMA 3H1EA 4GZ5A 1FYVA 1E20A 4NAHA 1MR3F 4TZKA 5EXTA 2PJRA 2PX5A 1Q0RA 1ZO8A 2DR0A 2GX6A 2J4FA 2WYWA 3Q1KA 2ZZKA 4XGKA 3W3AD 5FXMA 5DW0A 5ADVA 1N7GA 4NOJA 3B70A 1ZWLA 2F1HA 4TRRA 3UK1A 1JEYA 3RVBA 1DQRA 5NULA 2TYSB 1LC0A 3L1JA 1PV1A 2CXUA 2RAVA 3T7TA 4B9EA 3QBVA 3GCGA 3E2MA 4EL0A 5BWLA 2XXAB 1W4CA 5AKKA 1OJ7A 2QMYA 3A6EA 3ZQ4A 2ECPA 2OV1A 4QIHA 2ZG6A 3IBCA 4WJKB 5AOCA 2QRUA 4YP5A 2YZKA 2WKSA 1HRDA 1YNOA 1G7SA 3DM5A 3ANMA 3GEPA 1EE1A 3NIFB 2ZB7A 3A6JA 4H0FA 4MUJA 3T3HA 3E70C 4D4IA 3TG8A 5JCJA 1SC4A 2C42A 2NUBA 3LT5A 4M0KA 5KVVA 1H5QA 3NWBA 4R2KA 4PO8A 3P97A 3ZHYA 3PQ4A 4EKDA 1MOPA 2AJCA 3CEHA 5TS3A 1P8JA 4EPTA 3PGXA 4ER7A 1JBQA 1OLUB 3CRMA 3CZQA 3PLAE 1BDIA 3AOGA 2AN4A 4LRXA 3QU9A 2OCGA 4CIDA 1TVKB 4ZCIA 4YJFB 3HGMA 3VOAA 1H3NA 2UYYA 3SS9X 5BV2P 1R6VA 5JAMA 3VC7A 2W37A 1DBRA 1V7CA 2WYHA 3ZXIA 1VXRA 3NUQA 3SXUA 1QRDA 4U3JB 1QCDA 1YH3A 4GMFA 4D9BA 1JUDA 1BWPA 3DE3X 1YZFA 1RMQA 4YLEA 3VO2A 1EE9A 2PZLA 3BA1A 4BGVA 4KQMA 1OZAA 2FMHA 2I6TA 3MNFA 3TUIC 1DAPA 1F3OA 3A28A 2WAYA 4PSVA 2B34A 1LW7A 1GRNA 1O57A 2QE7D 3KZOA 3VR5H 1DADA 4Q4HB 1G4UR 3CNHA 1PNRA 2NP6A 3UPDA 3ETLA 3HP1A 1FMJA 1UC4B 4FLEA 5KNBA 1L4UA 3BTUA 5I7HA 4LG1A 4ZN6A 5ECWA 1HA3A 4NBTA 3VVLA 1NXVA 4Z99A 5DGXA 2Q46A 5EJMA 1EJ2A 4GP7A 4MZDA 1UK8A 4JXXA 3DKVA 5ESRA 2BGNA 1BROA 4WZBA 5I4CA 5C5EA 2I7VA 3Q6IA 3IB6A 3NGMA 4DADA 2BD0A 4YCCA 5IJXA 1C81A 5E7IA 4TKUA 1BU8A 3ZXUB 1H4TA 1QHHA 4DDKA 1CX9B 1OMOA 1XK7A 2WG0A 2Y6UA 3D8TA 3JXEA 1IN5A 2JJ2D 3PF8A 4JCCA 1EVYA 5AT1A 5LQSA 4PE5B 1UQTA 1DOHA 2FG7C 2F3PA 4GSLA 4N1AA 1JYFA 1N1DA 4KGXA 4TGLA 2P4QA 3TCKA 2A9RA 3UAZA 4O33A 4QXOA 3HUDA 2R60A 1CQWA 3K70B 1JXAA 1HTTA 2A30A 1GCGA 2AQ8A 2Y27A 4JJKA 1V1MB 2DVMA 3CONA 1PN3A 3ZCPA 3AVTA 3KXLA 4F60A 4F5EA 3HVIA 5CB0A 4GQIA 3FMIA 4AUKA 3PEVA 3FNGA 5G40A 3UGJA 3UK6A 3R7NA 1P2GA 1E5DA 4R9SA 4X1YA 4AN4A 3Q6MA 4KI0A 1M5TA 4JP3A 4Z1MD 4HRAA 5BUCA 1Z13A 4IDDA 4INJA 1GLNA 4X1OA 1KDYA 4I3FA 1KYWA 5BO5A 4DCMA 4LF4B 1CF9A 4V0QA 1JKMA 1AMNA 4LJ5A 4XW2A 1EB8A 3E18A 2DR2A 5K0NA 1NBAA 3L8HA 4OB7A 4HR7A 1DLJA 1UBJS 4PAWA 4CR8A 1BDJA 2DLDA 5K8TA 2QD5A 5ARCA 4UPDA 3CZ9A 3ZE2B 3B1XA 3PEFA 1M2OB 1PVVA 4NFSA 5CB6A 3QITA 3L4SO 4I5GA 4WKGA 1V96A 4RIGA 4UHDA 2A9PA 2OFWA 5JWRA 1L9KA 4M1ZA 4ZVLA 2ONJA 5DISB 4DR7B 1H66A 1QB7A 3HWSA 3HPQA 1HT0A 1PZFA 2H1FA 3FF4A 3W8RA 1TECE 5GQSA 3ZHTA 4DA6A 5HYVA 1A88A 1FW6A 5M7EA 3OF5A 2O52A 4NRDA 1A2BA 2EP7A 3AUYA 5CT9A 4G97A 1TK9A 2WC1A 1FQWA 1QUFA 3COPA 4MWTA 3B5JA 5EIFA 4D02A 1EFDN 1GWNA 2QLNA 3LXUX 2C5HA 3DXYA 4X44A 3ZWVA 3UUGA 2V98A 1R0SA 1DDOA 5ITZA 1A0OA 3WYGA 2WB4A 3RBZA 3IIEA 5JSZA 1YQ9A 4D41A 4F93B 3S55A 5FUMA 2CUNA 3ZW7A 1O0BA 1DWQA 2B37A 1YI8A 3BC1A 1LDYA 3CRRA 3W5CA 1G59A 2A86A 2DPGA 2J8ZA 1TM5E 1Q0ZA 1ESNA 2HSEA 1OLOA 4G37A 3ETGA 5JNWA 1N1GA 4MLDA 1V0JA 5IYZB 2H29A 3R6GA 4PSKA 1H2EA 4A8HA 4BGIA 3R20A 1CR6A 4XCQA 4YFYA 3UN1A 4AT1A 1RWPA 1VJTA 1O97C 3T5MA 1L7XA 1Q5PA 1MJHA 3E9CA 4GE0A 4Q7MB 4LYFA 4AJLA 1KWKA 5TQ0A 2QT9A 3V48A 1E4YA 5D85A 3ZDFA 1XX6A 2JJ2A 1U9IC 4OQYA 4QAQA 1P1HA 1RAFA 1ULBA 2G06A 2IE0A 2ZYGA 1PG0A 1QQTA 3R5HA 1LV8A 3PX2A 4BDTA 2Z6AA 2B2NA 3VNRA 1KKUA 1THZA 3CGWA 3QUSA 4H08A 5CT5A 2OBMA 2GBGA 3WDKA 3RJ5A 4AZ3A 1E6MA 2Q4EA 4KKVA 4PGMA 1Q3HA 2PKYX 2VAVA 3GROA 3OD1A 4I1RA 5K0FA 3PNOA 5FEUA 2HTEA 4LJ9A 1N2HA 4WKBA 1KQPA 5SY9A 2WZBA 1XDDA 4QYXA 3TLZA 3ZJTA 3H3JA 2J0VA 4CM9A 1VOTA 2A1TS 2HIGA 1HYHA 1Z6GA 1KVQA 2Z56A 3OFND 1AOXA 1NNLA 4JC0A 3GUCA 1M8JA 4BB5A 3ETEA 4QRHA 5B4VA 2QT0A 1QE0A 2HM7A 1I10A 2EV9A 5JCXA 3FTCA 2VFAA 3TBFA 4PCLA 3BXFA 1DWPA 3WLIA 3KJFA 3UW1A 3OJOA 5GIOE 3AP3A 1V3UA 2EF0A 5JAQA 1M0TA 4LFBB 2VHEA 2FN7A 3T4XA 2AFHB 2R6FA 3SLKA 1TM3E 5MGBA 5DHRA 3JD2A 2DBYA 1KI2A 3DMHA 2HHJA 3ESZA 2CE7A 3I28A 3AFNA 2VDKB 2GF0A 4YJ2B 1DFHA 5CLFA 1KS2A 5IC4A 2Y1FA 2CNLA 4Q3AA 5CIWA 4E09A 5CB4F 2XGOA 3NOOA 3DL7A 1R00A 5H3CA 3MTJA 2M1XA 2IHKA 4GOMD 4HAOA 4HUQB 1KS9A 1U4SA 1EK0A 2PFKA 4CU2A 1NFRA 1N2ZA 3QENA 5BUZA 3L4KA 2I0FA 3TZQA 2G6TA 5DCUA 2O7NA 2C3PA 3C6BA 4LCJA 1AKEA 4KTTE 1DL5A 2EJUA 5BVGA 2JW5A 4ZQEA 3QX3A 1V4NA 5EWJB 3CH6A 3WGLA 5IN4A 3UHPA 1YE5A 5IABA 2R87A 3STTA 4Y9DA 3ZV6A 3K09C 3NM4A 4WEQA 3IP8A 4B7AA 4HWSA 2ZWAA 1SCQA 1WCXA 2Z08A 2ATEA 3H1AA 1D1QA 1T6BY 3TSWA 4A0SA 1U0EA 3QE9Y 2A92A 1E2HA 5BORA 3PD1A 2ZR9A 1JT2A 3FGZA 1Q19A 2YTZA 1VG0B 1ONOA 5HS6A 3FLMA 1L1EA 3IQZA 3CN9A 4P3NA 3EPKA 5HOEA 3HG7A 4QODA 1BS2A 2IYVA 5AVKA 5BV1A 1L5VA 1RHJA 4BZXA 2DUUA 1H1LA 5DLQC 4EOGA 4LF8B 2I9PA 5AYVA 4CM9D 5K0GA 1UEIA 1VJDA 3H1PA 1WU7A 4M0LA 4AXXA 5I9NA 4MO9A 1KSHA 2W2LA 1XTTA 1ZC4A 2EL9A 2FX3A 3H4MA 1X13A 3VH4A 3FCUB 3EVDA 3I5YA 2H9YA 4HATA 4QATA 3DUFA 1IN8A 2ZJ3A 1F6BA 2HWYA 1R5NA 4CUZA 5JH7A 3T7EA 4P33A 4N8EA 6ABPA 3OFSA 2QMZA 1H2ZA 5E1OA 1ZICA 1AGYA 1ZPDA 2IH2A 3DSRA 4H1VA 2O8VA 3FFWA 3D54D 3FPHA 3JARA 3TUJC 4BMDA 3KVOA 4IH4A 2O9JA 3OZEA 3EGCA 5A9RA 4JIGA 2UUBB 3HU2A 4KSYA 3AFMA 2WOJA 3IBYA 3W1VA 3KPYA 4NULA 4RVHA 1WV0A 1UJ4A 4XX0A 3KTFA 2GZ2A 4IRUB 4JDUA 4JFRA 3QMVA 4KAFA 2EJTA 2JGJA 2OGWA 4A6PA 5CX4A 2WMNB 4BN5A 4Q4HA 1CEEA 3KKPA 5D51S 2JK0A 4AZTA 1QQ6A 2WF8A 3ANTA 4D9CA 4C0LA 4DLRA 4LPKA 2PPVA 3SBDA 3O0DA 3PHHA 1JAIA 3SR0A 1E2BA 1M67A 1OGJA 5FUBA 2OGUA 4DIEA 4U39A 2O0KA 4RWZA 2RE8A 1I51A 3DP7A 4HMOA 4V38A 2DLNA 3WA7A 1C41A 2OKCA 4XYEA 5JR3A 1PL6A 3R9KA 3KXPA 3OIDA 3OSUA 3I6BA 4BTEA 2E18A 2BDUA 4LXHA 5AJWA 2YV4A 1X8XA 1Z4IA 1E7QA 2W2KB 3TZBA 4YJHB 2LBPA 4MYHA 4QC2A 2E0IA 4E6PA 1KBQA 2YWDA 3B20A 4JASB 4XD2A 4RPHA 2Q5LA 1YL5A 1MXHA 2G04A 5EWLB 3V55A 1KVSA 3VPAA 3L18A 3GFTA 4BEVA 4EHKA 3IELA 3BTSA 5JSHA 1JB1A 3VQTA 4P9NA 4DA0A 4X93A 3G68A 5DGIA 1Z5UA 1HYBA 5AOVA 4PQGA 3S2GA 4R2JA 3K70C 1MDFA 3Q3IA 2WILA 1TM4E 3EZNA 4WZBB 1QOPB 2WIJA 1G1MA 1RRMA 4Y8VA 4O63O 3ADBA 4EDFA 2DERA 3OZGA 1OV6A 4FKMA 2GPNA 1NI4A 1QYWA 4G26A 1YUBA 2X0KA 2XRMA 3JSAA 5AHKA 2NWQA 4GMXA 3WQBA 3CVUA 3BWVA 1Y4DE 1Y7LA 4GXRA 4TWBA 4ZO4A 1XTIA 1J42A 3HR4A 4ECAA 2GPJA 1J56A 3JYOA 3AT1A 3CPHA 1TKCA 4J29A 3MYYA 1PR6A 3I9OA 5HK8A 3C8HA 2A0UA 2ZATA 3RUFA 5JDIA 5EMJA 1BO6A 2ZETA 2Y1CA 3PJEA 3NTLA 4HDSA 1EBUA 2EZTA 2R8PA 5LU9A 1CUJA 3DV2A 3EXG2 4AJ1A 1KHTA 1XDUA 1LWOA 4ACBA 2CXRA 2WIBA 3EVFA 2NX2A 2HF8A 1GUBA 2ORED 1ZMXA 2HZ7A 3A1TA 2N46A 4KFSA 2AOTA 5EP3A 1X2BA 1TEXA 4JH0A 4EP1A 1FQOA 3NBUA 5E3HA 4BUZA 2Y92A 2YVAA 2ZYIA 1RHQA 1ML4A 1N2EA 3E9EA 3EMVA 1Z07A 2FUG1 2FKAA 4NPHA 5JD3A 1NIPA 2PWPA 4BFWA 4C43A 1KFCB 1F0PA 1G5QA 2GUGA 4PYLA 3COYA 1KI7A 1Y1KE 3NIBA 3S81A 2FMKA 1EH5A 1KZ7B 1VE5A 4X24A 3TNDA 2DFNA 3RSSA 5FTLA 1D6JA 4WK6A 5K3EA 1F2UB 3BWYA 2J87A 1QOQB 4IVNA 4BOYA 4QOJA 5C7OO 2ZJ7A 2WD7A 1A5BB 3QMWA 4DR6B 1XMIA 1UOEA 1RCTE 5DCWA 4IIXA 5JCZA 4DV2B 1TVEA 3GP3A 3U19A 4ZGWA 2VA8A 1C4KA 1WCYA 3AI1A 2R65A 3A2MA 5HF8A 1GNLA 1ZOOA 2PUTA 4NZNA 4Z0PA 4OB6A 1YI1A 1DG1G 1BXZA 2GD1O 1C3XA 1FFDA 3EX7C 4TL6A 4C14A 1QO0A 4LJ4A 1PGOA 1YDMA 3IEUA 4PVDA 3Q9UA 4PIVA 1N2CA 1OREA 1WW8A 3KJIA 1ZNWA 1UZAA 3O3MB 4XGQA 3UTCA 1JHOA 4EBFA 2YIMA 3K0KA 3M6WA 2W2QA 2HREA 4WN9A 1P3JA 1UXJA 1II8B 1R6UA 1Y9DA 2RMKA 3EEIA 4CW7A 4WZAE 3OG9A 4GBED 5JNSA 2JGDB 3VTZA 3C2QA 3HUEA 1JAZA 3VA7A 3GZ4A 2VNJA 4UM7A 1FXWF 3O2QB 4IH1A 1JJFA 4C76A 3F7OA 4ID9A 1YZTA 2Q29A 4RMJA 1JYSA 2O7VA 4QTYA 1F2TB 2ZTUA 2E4AA 1SCIA 1VKNA 2VG8A 3GLHE 4C22A 3T7CA 5JYCA 1M66A 5IJ0A 2BCGY 6ADHA 2BMDA 5THXA 3TF5A 4QUDA 2HCTA 4F2PA 4RTOA 3I5AA 4B4DA 4AI6A 3CB2A 1YDFA 4ZT7A 3K0FA 4A0QA 4QGBA 3VAYA 4UTVA 2W6JD 2EKDA 3NOQA 1WULS 2GWRA 4KQ6A 2P40A 4ND3A 5LYYA 1BVHA 1RW4A 2V5UA 4AJEA 5INTA 3THXB 2YFHA 4KAXA 1TQHA 2JFFA 3C6KA 2R6AA 3Q5DA 5C8XA 1HWYA 2FW9A 2PUBA 1QSGA 4IIJB 2WAAA 3KYDB 2BDEA 3AB3A 4MPRA 4AP6A 4F72A 4L6IA 5LQKA 4WUVA 4XPIB 3NOXA 3RUEA 3BYZA 3WNQA 1M1ZA 5EQFA 5KTTA 4RK7A 3O4HA 1U3UA 3VPDA 1RQGA 5BSGA 3C16C 1I3LA 3CLSC 4B32A 2C5FA 1X7HA 1NIJA 1A1VA 2WSYB 1YCHA 1XU4A 3NO4A 3E1SA 4K9DA 1D9XA 4EQZA 3CVYA 5F9HA 3BFXA 4J1TC 4RLFA 1EFRD 1UPFA 2HC9A 2PVPA 2VYCA 4K1XA 3T9FA 3I4LA 4HAIA 5H4HA 1MG0A 1VIMA 5I7AA 4M8KA 4PYJA 1RI3A 1QK3A 2OP1A 1NBMA 3ECSA 5CW2A 1C2YA 3D1LA 1YRBA 4CLOB 1G3IA 2C1XA 2VEOA 1NYLA 5I7UA 5JXIA 3T7SA 2VRCD 3ZBQA 1KMIY 1ESCA 1UBGA 1WXXA 2FSGA 2IITA 4XI9A 2PA3A 5K0SA 1QM5A 1PZEA 2HO4A 3A14A 3FKQA 3I42A 3OIVA 3I01M 2WABA 2WP0A 4UD2A 2E21A 2AG5A 2FCRA 4HNAB 5KHOC 1C9KA 2DT5A 2MMGA 3IS3A