3CEJA

Human glycogen phosphorylase (tense state) in complex with the allosteric inhibitor ave2865
Total Genus 291
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
291
sequence length
809
structure length
790
Chain Sequence
NVAELKKSFNRHLHFTLVKDRNVATTRDYYFALAHTVRDHLVGRWIRTQQHYYDKCPKRVYYLSLEFYMGRTLQNTMINLGLQNACDEAIYQLGLDIEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGIRYEYGIFNQKIRDGWQVEEADDWLRYGNPWEKSRPEFMLPVHFYGKVEHTNTGTKWIDTQVVLALPYDTPVPGYMNNTVNTMRLWSARAPDYIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAATLQDIIRRFKASKFVFDAFPDQVAIQLNDTHPALAIPELMRIFVDIEKLPWSKAWELTQKTFAYTNHTVLPEALERWPVDLVEKLLPRHLEIIYEINQKHLDRIVALFPKDVDRLRRMSLIEEEGSKRINMAHLCIVGSHAVNGVAKIHSDIVKTKVFKDFSELEPDKFQNKTNGITPRRWLLLCNPGLAELIAEKIGEDYVKDLSQLTKLHSFLGDDVFLRELAKVKQENKLKFSQFLETEYKVKINPSSMFDVQVKRIHEYKRQLLNCLHVITMYNRIKKDPKKLFVPRTVIIGGKAAPGYHMAKMIIKLITSVADVVNNDPMVGSKLKVIFLENYRVSLAEKVIPATDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIDDVAALDKKGYEAKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFYHDRFKVFADYEAYVKCQDKVSQLYMNPKAWNTMVLKNIAASGKFSSDRTIKEYAQNIWNVEPSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Glycogen phosphorylase, liver form
publication title Thermodynamic characterization of allosteric glycogen phosphorylase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 291
structure length 790
sequence length 809
chains with identical sequence B
ec nomenclature ec 2.4.1.1: Glycogen phosphorylase.
pdb deposition date 2008-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00343 Phosphorylase Carbohydrate phosphorylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3cejA02
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3cejA01
1Y6FA 1FU7A 1P4JA 2BGTA 1GPBA 2G9RA 1JIXA 3DD1A 1C8LA 3EBPA 4WACA 4CTMA 5BNWA 1FU8A 1LWNA 2F3SA 1RRVA 1FTWA 2SKDA 3BD6A 3CEJA 4F96A 4LDPA 2F3PA 1L5WA 4MICA 3MS7A 1J39A 3CUUA 3C48A 2X6RA 3BEOA 1P2GA 2QRPA 2P6PA 2IYFA 3ZCSA 3CUTA 3MQFA 3UYLA 2JZCA 4GZ5A 2F9FA 2H1FA 1GPAA 4AY5A 3G2KA 2QLNA 4RELA 2QNBA 4W6QA 3ZCTA 2QN7A 2HY7A 2G9QA 2XA2A 3S0JA 4M60A 2GT1A 3BCSA 5D01A 2VSYA 2X0DA 1FTQA 3NPAA 2ACWA 2FETA 1HLFA 2XGOA 4NESA 1C8KA 1JG6A 4GYWA 4GYYA 2ZB2A 4REMA 3MBOA 1PYGA 3MSCA 3Q3IA 1L5VA 4EKEA 3BD7A 3QKWA 2PYDA 1O6CA 4X7PA 2AV6A 3ZCRA 4MHSA 1EM6A 4KQMA 3D1JA 3O3CA 5JTUA 4WHMA 1IXYA 1L5SA 1K06A 3BCRA 3H4TA 3L7CA 4NC9A 1WV1A 3BDAA 4BQIA 2QZSA 3T5TA 3NC4A 4RENA 3CEHA 3L7DA 4QLBA 3WAGA 1XC7A 2R68A 4YUAA 1KTIA 3T3DA 4HLNA 4EJ2A 3E3OA 1PSWA 4N3CA 2IYAA 2IV7A 4L22A 1L5RA 4X7RA 3RSCA 4EL0A 3AMVA 3Q3EA 4EKYA 1L7XA 1NOKA 3UYKA 2GPAA 5HXAA 3RHZA 3OTHA 2G9UA 2QLLA 4MHOA 4YI5A 3H4IA 4F97A 2IV3A 2R4TA 3DDSA 3CUVA 3EBOA 3CUYA 2AW3A 4WADA 2QN8A 2C4MA 3G2IA 4EL5A 4PQGA 3ZCQA 5I45A 3DZCA 4MI3A 3IA7A 3OTIA 1XL1A 3G2JA 2XCUA 3S29A 3VDNB 3HBJA 2JJMA 4XI9A 3T3IA 3MT9A 2ASVA 2Q6VA 2R4UA 2GEJA 1XKXA 2GPNA 1L5QA 3PE3A 4GPBA 2XCIA 5IKPA 3L01A 4HWGA 3G2HA 3OY7A 4GZ3A 5TMBA 5DXFA 3QHPA 3NB0A 2JLBA 2ATIA 1JG7A 1SXPA 1NZDA 1WV0A 2R66A 1Z6QA 1P4GA 3MRXA 1GGNA 2VCEA 2GEKA 5JTTA 3BCUA 1C50A 1F6DA 3FROA 4GZ6A 1M5RA 4MRAA 5TMDA 1K08A 2IUYA 2WTXA 2QLMA 1WUTA 4MI9A 5ENZA 2X0FA 3L79A 8GPBA 2QN2A 1GG8A 2AMVA 1XV5A 3VUFA 2X0EA 1JIVA 3OT5A 4F9FA 4RIIA 4BQFA 4RBNA 4M7PA 3OTGA 4N3BA 2PRJA 1NZFA 2PRIA 1AXRA 2G9VA 5IKOA 7GPBA 2YJNA 1E1YA 4X7MA 5TMEA 2VCHA 1Z8DA 3CX4A 3L7BA 4RIHA 2QN1A 1P4HA 3ZCVA 1GZ5A 1UZUA 1QKJA 1B4DA 1NVKA 2IEGA 2FFRA 2R60A 3DDWA 1P2DA 2GJ4A 3OY2A 4RIFA 1NLMA 3GUHA 3VDMA 2QRGA 2ACVA 4N3AA 3RT1A 1GFZA 3WC4A 1SXQA 2BGUA 1GPYA 3TSAA 1F0KA 2VSNA 3MTBA 3L7AA 3E3LA 4X6LA 1FS4A 4N9WA 1WW2A 1H5UA 3OKPA 4AMBA 5LQDA 3T3EA 2O6LA 3MRTA 2PYIA 2F3QA 3NCHA 4XIFA 3VUEA 3S28A 4RIEA 1PNVA 2C9ZA 3C4VA 3SYRA 3TOVA 4AN4A 2XMPA 4N39A 3MTDA 3CV3A 3G2LA 3TAXA 5DU2A 4CDRA 3MRVA 3COPA 1UQTA 1Z6PA 3CEMA 3MT7A 1YA6A 1XL0A 1WUYA 2SKEA 3Q3HA 2PQ6A 2AZDA 2BFWA 2H1HA 3NP9A 1P2BA 3SYMA 4LEIA 3NP7A 2X6QA 2BISA 3D0QA 3S2UA 2ECPA 1LWOA 4AMGA 1C3JA 1FU4A 1JIUA 1FA9A 1L6IA 3HBNA 4BFCA 4YI3A 1A8IA 6GPBA 9GPBA 4NEQA 3RSZA 4KQ2A 3ZCUA 1FTYA 4BQEA 1Z62A 1NOJA 3HBFA 5DLDA 3T7DA 1VGVA 3MS2A 3IAAA 1YGPA 4CTNA 1Y6GA 3OKAA 2OFFA 3HBMA 3MT8A 4MI6A 5TVGA 1FC0A 2KS6A 1E4OA 3ZCPA 3E3NA 1XOIA 4KQ1A 2XGSA 4RIGA 1QM5A 2XA1A 1EXVA 2C1ZA 2XGMA 1NOIA 4Z5XA 2QRQA 2IEIA 4FKZA 2QRMA 2F3UA 3MS4A 5C1DA 3G2NA 1Y8ZA 4G2TA 3GPBA 3D0RA 1WW3A 1JEJA 2XA9A 3OKCA 1RZVA 1AHPA 4M83A 2QN9A 2IW1A 2GPBA 5D00A 3S27A 2VG8A 1BX3A 2QN3A 1PN3A 1V4VA 2FF5A 1UQUA 1ABBA 5GPBA 3PE4A 2SKCA 3BD8A 3MTAA 4FZRA 3CUWA 1P29A 1IIRA 3T3HA 3WADA 2QRHA 2C1XA 3T3GA 3C4QA 4CTOA 4AY6A 1RZUA 2GM9A 3NAZA
chains in the Genus database with same CATH superfamily
4YP7A 2HQBA 3WYDA 1I4TD 3A11A 3LFUA 3U3XA 3A6FA 4G37A 4C2AA 2INGX 3DM5A 3O3MB 3GLFA 1W47A 2A9JA 2QAIA 2YHSA 3H75A 4PGGA 4M38A 4FDVA 4EB0A 1YVPA 4FDTA 1JKMA 2G5PA 4NEHB 5HCUA 3BJRA 2X4GA 1Z7YA 2YINC 3GRUA 3PDWA 2JIDA 1UJ4A 4D3SA 5LOVA 1WOMA 1E5QA 5HM6A 1IJFA 5CH8A 2WHEA 1N6KA 3FPSA 1Z12A 3C1TA 3DMRA 4GMKA 4MICA 2ZUBA 1FTNA 1JQ5A 1YJ8A 2WV7A 3FPFA 4UEKA 3A70A 5GM2A 3HB1A 4B2YA 4XX0A 1GL6A 3NBXX 1AXEA 3HSSA 5AJZA 2IU6A 2W2QA 2HJWA 5FJJA 4HNGA 2P9CA 4CCWA 2YC4C 1L5MA 1MEOA 1MX3A 5AHWA 1WMEA 2I8CA 4RL4A 3L6OO 3TPFA 2RH9B 4DC0A 1SXHA 2OFWA 4IFTA 2EKZA 1SXJE 2QJTA 2Z8ZA 3CINA 3NC0C 3JVUA 3NHBA 4RKRA 4V0NA 1FVFA 4D9EA 2WM3A 3U44B 2DFLA 4EB3A 2P78A 3TZQA 4Q7JB 4OH7A 1QFXA 5KYYB 1UAAA 1M3SA 3FB4A 3THRA 4M86A 4N8SA 3AHDA 3FPLA 3M2TA 2VJMB 3R3YA 1AKUA 1PGOA 3B1YA 2IKQA 1LJ8A 4LWQA 2IWHA 3S2YA 3WQRA 3WFZA 1IXZA 3MD9A 5JVDF 3HADA 3KSBC 2A9FA 1EAMA 3V8VA 4P7JA 3N5KA 4MV3A 5EHNA 3M8KA 5BUCA 1QPBA 1K4YA 1ZK2A 5K01A 3UWPA 3N2NA 2COUA 2ZYHA 1IPHA 5KC9A 2PA3A 3IX7A 2D8AA 3SSOA 3LPNA 3I3OA 1XLVA 2CUZA 3BFJA 4NRDA 4UD6A 4UU7A 1IZ7A 4W99A 3BCSA 3H7IA 4BFXA 5IXSA 4HNHA 3WRWA 2WWWA 2X86A 3RFXA 4R1OA 3W5JA 1N2CE 3N8HA 3TLGA 1E32A 2JZOA 3PYXA 1E1MA 1DJOA 1FX0B 4JC0A 3UUEA 3NOQA 4OLBA 4IWNA 1XJ5A 3QJ5A 1ARZA 2RGRA 1D6MA 1UEXC 2JFPA 2WAMA 4IDDA 4Y2SA 4Y2XA 5ADWA 4QVIA 4RPKA 3IPXA 5FA6A 1X3SA 2DCMA 1QHIA 1RBYA 2NZJA 2HWWA 3H11A 3AR5A 2FWRA 3K20A 3LFHA 4KW7A 1KZGB 3U9TA 5B4UA 2DWCA 2QJWA 2HHAA 4Z86A 2FOIA 5H4HA 3NHYA 1JI0A 3HUEA 1P9NA 2HRBA 1RLIA 2NPIA 1GO2A 4WZAE 4K9LA 1WP9A 3ADCA 2WJHA 4PANA 4TS9A 4O3FA 4D26A 2Z4RA 1YDEA 3KQQA 2RIRA 5ALSA 2I6UA 1B26A 4IMRA 3WXMA 4CQLB 3PENA 1JLKA 4AYWA 1M2EA 3TM5A 5JSUA 1V16A 2W98A 2FZ4A 4I9UA 4D46A 2QX8A 3JARB 3EXHA 3RS0A 3UHOA 3W5IA 2ZUWA 1Z25A 3OUTA 4LS3A 4KNWA 4S2UA 3BWEA 1JKFA 3CW9A 4R1PA 3K9FC 2K6GA 3HJFA 2I99A 1M66A 1SIUA 2Q3EA 1I6KA 3WYGA 4WY2A 5HWSA 2O8FA 3SM9A 4IFEA 1NQTA 3AQIA 4TTTS 4PINA 2Q45A 2IYUA 4BMPB 1ZAKA 1NW9B 1ZKDA 4G5OA 2I80A 3EW7A 1X8KA 1EG2A 4ZJPA 2QZSA 2AKYA 2H2DA 2QRLA 3PX2A 4OHKA 3OPYA 4BEVA 1XRNA 1HTWA 4Z8XA 5BN4A 5IAKA 1C2YA 2H65A 2DQSA 3WLKX 4CF6A 5JIBA 2KYRA 4P31A 3F97A 5C2JB 3V4SA 1H3EA 3OEHD 4QQNA 2VUHB 3RG8A 5ALOA 1O94C 2AG5A 3P2IA 4ZAXA 4BVBA 4HNTA 4ZQEA 4KCGA 5A06A 4EJ2A 1S8FA 4KVFA 2NXNA 5EHIA 2QYTA 4C89A 1OMOA 1GPUA 3B9PA 1ADCA 1O6BA 4FCTA 1QHXA 1FS5A 3AIIA 2HZBA 4P3KA 4YJ3F 3ZIUA 3LC0A 2PE5A 3TIIA 4DMUB 1HG1A 4G1BA 4IRXA 3NH9A 1FDUA 4YMWA 3ORSA 1RYFA 2JG3A 2CVPA 1QANA 1N3YA 3RYIA 1L8OA 4IVQA 2CBXA 4IWYA 3K94A 3V97A 5HXAA 1X1SA 3OQ1A 4OFZA 2XV1A 1NNSA 3IR5A 2NUPB 2PRKA 1PEDA 3B1FA 1JWAB 3M2PA 4MWZA 2P1RA 3OQNA 3PT5A 4UKDA 3CEPB 4EJMA 3L0CA 3OWHA 1GUFA 3G2IA 4RZ2A 8AT1A 2Y2VA 3U0VA 4OA8A 1BD3A 1XD2A 2A57A 3H2SA 4E51A 1RHRA 4A2PA 4GYJA 2I2DA 2HJRA 3DZCA 1LB1B 5J4VA 1W36D 1T0PA 5T3UA 4C6TA 4JNCA 1X38A 1CFJA 1KSJA 2Q9BA 3IA7A 1A50B 1A88A 2V74B 2I67A 2WM8A 2X5NA 1CJCA 2BCGY 2JHCA 3K5PA 4XDGA 1R18A 2CLLB 4OHYA 4JC4A 2VK8A 2MDTA 3M9XA 1KK0A 2E6UX 2IIBA 2AX4A 2JASA 1D4ZA 3SYTA 5ALWA 5IASA 3QK7A 2YFYA 1DO2A 4JJGA 2G7ZA 3JX9A 5ADVA 2GN9A 1TI7A 4RY8A 3WFJA 1W87A 2YMLA 3GJ6A 3TKYA 3OQJA 1ZK1A 3RTBA 3O3NB 2ZT5A 4BO2A 4EWLA 1M6WA 1C30A 1XCJA 2H08A 3NNNA 1QGDA 1SHUX 2BV3A 3HVIA 1TEVA 1GU7A 3DZFA 1PJAA 3DWGA 2ZM6B 4BIMA 3R9KA 3IB6A 3QY0A 4IMPA 1WPGA 1KC3A 2MT9A 4F71A 1VSVA 3QUBA 4IY1A 4QRDA 2Y1WA 5IULC 3GPLA 4FYIA 2JK1A 1WV0A 3MK31 1E1CB 2FQYA 4W7HA 2FHSA 4DQ0A 2R66A 3HCBA 2FUG6 4L1KA 3D5QA 4RPLA 3EIUA 2I33A 2GEKA 4B82A 5JTTA 2VRNA 4NS1A 1QWOA 4DQUA 1NY6A 4MVJD 4ARCA 3CXUA 2EOAA 2O6HA 4GZ6A 5E6UB 5EESA 2I4NA 4PTYA 1ILWA 4B6FA 3W4KA 2NU9A 4FDUA 1EX6A 3LYLA 2WJWA 5C7OO 1S6YA 3OQOA 3SJAA 1NR7A 1U3DA 1L1RA 2GZSA 4ND8A 5EHZA 1GY8A 1I2MA 1UF9A 5ENZA 2R3SA 5F2EA 3O4RA 4YK7A 4LDJA 4RXMA 5DM0A 4E5NA 4ZV9A 2OCKA 4GI7A 3UWKA 1H22A 2QN2A 1H0RA 1M33A 3A9TA 3I1IA 3IP3A 2WP8J 4QYMA 2OY0A 3DPSA 3QUQA 3IIIA 1RD4A 2VUUA 2L69A 5H0IA 4BRWA 4BNXA 4R05A 4KAAA 4X63A 2UUBB 2OL4A 4LRUA 3AY6A 1PG5A 4ZWNA 3W6ZA 5E1DA 1RYDA 4M54A 2FVYA 4L07A 2BF7A 3HJUA 1HT3A 4PSKA 4FWTA 5AOVA 1QKIA 4Q93A 4D96A 4INAA 2AN9A 2UXDB 1GL9B 3A6KA 2C2BA 1OWOA 1SIWA 4F11A 1TQ6A 2XWPA 3HQ4O 4E6PA 1IBCA 1MF7A 1DBQA 1E1YA 4PR0A 1IWPB 5ANRB 1O03A 4JC5A 4WXHA 1SVNA 3G7UA 4C5CA 2C5GA 4ZOCA 4BNKA 3URMA 1NXXA 4C3UA 2P9EA 2Q3BA 2R1UA 1L5OA 1UKYA 2WG1A 3F4LA 3UMCA 1TK2A 1G9XA 2PZEA 4HX2A 2OT3B 4TUYF 5HMLA 3VBCA 2VYNA 3TRDA 5CCEA 4KC0A 2HF7A 3AB8A 3HCAA 2OECA 2NT3A 3JR3A 2XKJE 2IP4A 1KJZA 1UEIA 2RGNC 1J8FA 3D3WA 3N9IA 1SCKA 2AW5A 3NATA 3VSCA 1AS2A 4KPUB 5FWAA 1EH5A 2C20A 4TVOA 3TRIA 1CVIA 3KFXA 5CDHA 4M9SA 4G4SO 8ADHA 2FY8A 2CLOB 5BWOA 2JI6A 5JCOA 4F56A 4NYJQ 3SIRA 3E18A 5F23A 4PX3A 5LDDC 3DC7A 4BN5A 1DKMA 1OFIA 1RNLA 1XXLA 1X9IA 2H31A 2X9LA 3W8FA 4E94A 2Q4OA 1U1GA 1OBOA 2BFMA 2FR1A 3CMCO 1Q0SA 4NI5A 3NOVA 4KQXA 4TRMA 1INLA 5KNBH 2A14A 3ELWA 2J33A 2ODEA 3JRNA 4MO9A 4O1MA 3KETA 3PR1A 2C4VA 2DY1A 3F5FA 1JU4A 2QU7A 3EUEA 4TYNA 5A0VA 5T6BA 3KXIA 1PZXA 3S55A 1G20A 4ZOEA 3E3LA 1AZTA 3S8EA 4KRXA 2Z6QA 1UKZA 2HF9A 1OI4A 2JLCA 1DADA 3UBTA 3LX5A 2WWTA 4NATA 1WB5A 1U3WA 4FZJA 4HWTA 2QVBA 3ER9A 5JATA 3LD9A 4FNGA 3WGIA 3KV3O 2K87A 2OGTA 2HPHA 2JFUA 2Y1DA 1JR6A 2HEGA 3D4LA 4YMSA 4E30A 2I65A 1Z4QA 3IDOA 3NCHA 5B5SA 1QP4A 2FRDA 3PC3A 3QNWA 5DBHX 3TCXB 4BB9A 3S28A 4C3VA 5KJCA 5FUMA 3UANA 1RWKA 3AFNA 4CQJA 4EA9A 4GR4A 4ED9A 5LZ2A 4K6OA 5ELMA 1KY2A 4R81A 3VO1A 4EKNB 1LZLA 3V8BA 1KEEA 4V0LA 2FZEA 3GLUA 5BV2P 4OMCA 1HZZA 4LG1A 3AU8A 2PX0A 5KPDA 5K99A 2NZVG 4YC7A 2AXEA 5LP6A 3JATA 5HDBB 4FUTA 2LVBA 3GUVA 2BZ0A 4MVXA 1Z08A 2IXAA 3C14C 3G7NA 2O3QA 2XD9A 3HBAA 3IP5A 1AIPA 4IZ6A 2ZXFA 1SUWA 3DE1X 4QFDA 4TX1A 2IV2X 2RJOA 2ZBPA 2HGZA 3OTWA 4A0QA 1QGZA 1W75A 4QPDA 4UDXX 5FA8A 3G0HA 5KYGA 4OB7A 2GPWA 3JAMA 5CIWA 4PONA 1BWPA 4TL9A 1E3DA 2GBLA 3UH0A 1RCFA 4DB4A 4QUAA 2VPIA 2B98A 3AZQA 4PRKA 4QA9A 1E2PA 4BLUA 1NMQA 1F7VA 1ZOPA 1L5NA 1U9YA 2CK3A 1KL7A 1C8VB 4RCVA 4I3FA 3E7DA 1E1RD 4QICA 3LCJA 3F3MA 2GPJA 3WQQA 2CKMA 2WFLA 1SJ9A 2H11A 1BGXT 2ZI6A 3FTQA 3LVRE 4YBZA 2R2AA 1GZ3A 2YIDA 2GDZA 3L8EA 1WSBA 4G8CA 4WESB 5EJ6A 5K0CA 3U4QA 3UJHA 3HCCA 4OQDA 4PC7A 4WK0B 5SV2A 3OKAA 3S2FA 4BVJA 4D41A 5BMVB 2JLZA 1EFPA 2QQGA 1EFVB 3FYCA 3IEIA 5DXJA 6CHYA 3WGUA 1JEAA 4M53A 4UZEA 1MDBA 1OI7A 2CZCA 2FFJA 2WWRA 4B09A 4C0QC 1IHXA 1NUSA 4MROA 3FM9A 1UKCA 3LQKA 4M0KA 2A0WA 2YXNA 3FCOA 2XGSA 4RIGA 4W6ZA 3CNNA 1WDKA 3UAZA 3Q9NA 2WD8A 3R0ZA 4CGYA 5MHTA 4HNUA 4AUNA 4RSMA 4ZYVA 2FCAA 3I5UA 1SHJA 5HRUA 1D2EA 2ZIUB 1U0HC 4EA7A 3OLZA 3L77A 4F84A 4ZZ3A 3SNHA 3B51X 1NJ2A 1I3MA 2Y1OA 1MA3A 2QM7A 2QYOA 4XIGS 1XYYA 1HNXB 1RM4A 5FHRA 2C8LA 4Y2TA 2BJHA 4FT2A 5H7XA 2QD5A 4QVKA 1C9MA 2AEJA 2XCQA 3G2NA 3BZUA 4L0CA 5K0JA 3VNRA 3AL0C 3GPBA 3JQ7A 3R0JA 3OQBA 3IAUA 1L4HA 1QGUA 2WAAA 3KQTA 4ISBA 2YHIB 2PZFA 1NP3A 1W59A 1O9HA 4G8DA 5FDFA 2JCXA 4MR8A 5JO9A 2WF8A 1LBTA 2IIPA 3N07A 1JR3D 3T7JA 1NVWQ 3THSA 3V7FA 2I8AA 1P9RA 2IOFK 1K4MA 5HCIA 2JI4A 1XWIA 4R8LA 5EEGA 4W9MC 4OXXA 3BORA 2XB9A 4YASA 1KO8A 4TZ0A 2QN3A 2HPAA 4ZKEA 2C99A 1A2OA 4QJ3A 3WIEA 4DF3A 3UN1A 2O54A 2CJYA 2FXVA 4MAAA 3KXLA 1TU3A 4MQFB 3ZJ5A 3PE4A 3HBLA 3EXEA 3N70A 3OU7A 2R7LA 2VF5X 3U4IA 4H15A 3CUWA 4LKRA 3CZ4A 3SJBA 1DKNA 3GOHA 4Q4AA 5EWJB 3WSTA 4D0GA 4M0FA 4EYOA 3M1YA 5ALUA 1NZJA 4AS1A 4YCBA 3TI9A 3THXA 1C9EA 4CN8A 1CUDA 3AHGA 4LE2A 1Y42X 3AR3A 3CNBA 4QG3A 4M6WA 2XQGA 1A5AB 5HUHA 3S68A 4RJIA 1JPUA 1T9HA 2PGIA 4I5FA 4OM7A 4OJNA 1XZHA 1RJGA 2E1RA 4R9UC 2AC7A 1L1QA 3LNCA 4J0CA 5NULA 5DPMA 3RRFA 1EZ4A 1IK6A 1II9A 3Q3VA 3DEZA 4TSKA 3RHSA 3Q0IA 4IXTA 1OXKB 4Y3UA 4R2JA 2WAXA 3V34A 3PTZA 2Q3LA 4NV0A 4DLTA 4KR0A 2XQFA 4K86A 3AR2A 3EVEA 3IV6A 2J4DA 4BOYA 1QNLA 4XIYA 4NQZA 3SKVA 2HA0A 2H1WA 4F2GA 4LXQA 1YZGA 2EQ5A 3BWCA 3I2KA 4L8FA 2C57A 2PZKA 3FCCA 2FHPA 2WC1A 4HOYA 5JMOA 4I1PA 2XY4A 3V7NA 2WD7B 5AW7A 3B8HA 3Q9LA 4J6EA 1PR0A 1U65A 1YI1A 1QONA 4LRTB 1GT91 3CRZA 1G4UR 1U7UA 4GBJA 1M6NA 4QL3A 1Z8NA 1US8A 1E8NA 1SQSA 3GELA 3I9V6 3C45A 1QNFA 1JALA 4OO3A 5MDHA 1DFGA 5CGQB 4JT8A 3K9NA 1MNQA 3VNQA 3JR7A 4DBLC 2WHPB 1ORHA 1X77A 3C3KA 3CUTA 3MQFA 3PS9A 4QODA 3REOA 3RUFA 5B7QA 5JDIC 2GM4A 4EHNA 2CLEB 1TTPB 3CNEA 3JASB 3M0EA 2WIKA 3OCXA 3SXJA 4R2WA 3EZ9A 1GPAA 3JV7A 5F9MA 3V4LA 2QMYA 1IHYA 3DVSX 4TL7A 3PI7A 2YYYA 2ZTLA 4L51A 1UBKS 3QWIA 2QTHA 4GQBA 5AKGA 5DTIA 3ZTYA 3RT7A 5L6MB 2JLYA 1W5TA 1OSNA 1WCXA 4LF4B 3ND9A 3UG6A 4Q9JA 4ZI7F 1Y8QA 4YCCA 1YBFA 1XDSA 4D9CA 3W05A 4ZK2A 1XCGB 1RKXA 1V1RA 3NEJA 1MEEA 2XCTB 3TZHA 4RHTA 2BBSA 5I4CA 1FFSA 5D01A 2IF2A 2VTBA 4YONB 1FYWA 5HF6A 3GQBB 1Z6ZA 2ZSUA 3STTA 3LX4A 1FJHA 3CF6R 4NYIQ 1IY9A 2EKDA 2PZMA 1WF3A 3R76A 3OJCA 1LH0A 4RV9A 3R41A 4DV3B 2Z9BA 2NV2B 5G4LA 2WVJA 3PNMA 1X39A 3UV7A 3HU1A 5YASA 2ZB7A 1P3JA 2HWXA 1S2LA 1QH9A 3R6GA 2W2KA 1VL5A 3FWKA 1PL0A 1DU4A 1KF0A 2WJPA 3HXKA 4ZAGA 3UB4A 5L4SA 2FMTA 3ABSB 4J4TA 4O5AA 5HF8A 4JVNA 1QRAA 3II6X 5CD9A 2QAGA 4MAMA 5JS2A 2R84A 3FMVA 4QSHA 1NVMB 3F3KA 5BR1A 4KHZA 3K4QA 1LUAA 2HSDA 3ID6C 3GWGA 3FUUA 3QTTA 1H2RS 4GEGA 4II2A 2C4NA 4HTFB 1N3LA 3I2GA 3MWDB 3LDHA 5AR1A 1YS7A 3KUXA 3FUWA 3Q3JB 1EM6A 2ZWOA 4I9FA 4FM9A 3PC4A 1MB3A 1WCIB 4YRKA 2GM3A 3EISA 4DMHA 5BMOA 1KH3A 3O8OB 1VKHA 5LOVF 5F1KA 1PWXA 2N42A 5JBQA 3L7CA 1MENA 1WTAA 1TM1E 2H5EA 3ELUA 3ELYA 4IF4A 4NAHA 4PHGA 3T3OA 3RC9A 4OYHA 4S2EA 1MB2A 3OTOB 3I2YX 2W22A 3EIEA 2PWBA 2JVIA 3W5SA 3HI4A 3Q9SA 4LJ7A 4C4AA 3L7DA 2XAUA 5IBQA 5CFMA 2EFDB 3WKEA 1RFGE 1YONA 1A71A 2OV1A 5IJ0A 1HYBA 1NVEA 2XDYA 1UL1X 4B76A 5HIJA 3GLHA 4UM9B 2BZ1A 1CZHA 2PBLA 2X76A 1XYVA 4Q1AA 4D9BA 1T8RA 3ZZUA 3C3WA 5IFKA 1VKRA 2OXRA 3EFEA 2YJGA 4MB0A 4WDRA 5COAA 2VT6A 3S99A 4FYJA 2HMAA 2O2EA 3KTFA 4R9SA 4RE6A 1YR3A 5C8YB 1MO6A 4Y2HA 1U31A 5K4HA 2BEWB 4YY3B 4GR9A 1GEGA 4WBNB 1TADA 4CM4A 2XUDA 3VJKA 3VOTA 4QM7A 4KYIB 5DCLA 3RUCA 5KOJB 1SBHA 2AI1A 4K9OA 3RHZA 3PXEA 2BKLA 4MEBA 2QLLA 5WRFA 3K0FB 3DOJA 5EIBC 3ITEA 4X6UA 4BCBA 3LPDA 3M3HA 2ZSIA 4CR7A 5CX1A 2Y0DA 4OKSA 4Q21A 3T5MA 1W88B 3W90A 3DTVD 4MA4A 1D4AA 3ZLBA 3ZHRA 2C4WA 4DJJA 4Z0TA 5HIMA 3RYCA 3FOFC 2UYGA 5IWCA 3I37X 3QOFA 4IHJA 1PT6A 4FHDA 4IHAA 4JBNA 4BKOA 1H0HA 2HWYA 4JEIA 4ZO6A 4CDMA 1NDQA 3ZWPA 3FDIA 3LNTA 1AKYA 4DLUA 3QP9A 4C01A 4QYTA 1Q0LA 3HMQA 3CF4G 2AR7A 3TZCA 1E9FA 4ZIRA 1DXOA 5LPNA 1TPYA 1MC5A 2FPGA 4KE9A 4BE9A 1W0KA 1QIEA 1U02A 2IHZA 3E9EA 1Q16A 3HZOA 3STYA 5HK9A 1JFSA 1FIUA 4UE2A 2PUCA 2RHGB 4YRLA 3HGQA 5A3VA 2Q5LA 4MS3B 2EX1A 3ZE6A 4R51A 1LBSA 4RDXA 2HLNA 2B94A 2IXFA 3SR0A 4ZXPA 4OF4A 3QX3A 3TW8B 4A0HA 4RDIA 3TI7A 1TK3A 4HQLA 3L6CA 5CFLA 1X8XA 4UU1A 3RK1A 4L78A 3DLPX 4JELA 4BN0A 2QL9A 3OY7A 2I3GA 4B81A 1VKOA 2HA2A 1ZMTA 4MUEA 3V8MA 4F45A 3CW8X 4UTRA 5AW1A 1VFPA 1UFKA 3FN4A 4MH0R 9ATCA 2OMKA 1JWLA 3ICQB 4IR7A 5SY6A 1DIBA 2YJ3A 5C7LO 1TOAA 1P5HA 4PR3A 1K1EA 3L8CA 3AM1A 3PL5A 3QJGA 4XVRA 1DQZA 4HK4A 4PFJA 4IIUA 3GJQA 2UYHA 4MJLA 3CLHA 4BL5A 3ZGLA 1JSCA 3EIXA 1RAHA 4ZCRA 2AI2A 3GLIE 3O26A 3BCUA 3IBCA 2VDQB 1F6DA 1Q5PA 2Q1TA 3I64A 3QE0A 2WSIA 3TJMA 2VXBA 2XMDA 4AQYB 3U2QA 3ZXYA 5JJBA 3JQRA 3DCIA 4HDKA 3R4VA 3TN7A 2PD3A 3NDRA 2XE7A 4X71A 4QUDA 2FI1A 3KD3A 1VJ1A 3OZCA 1ANKA 3IUNA 2QTBA 2PGOA 2QZZA 3V4PB 4UDOA 4B3XA 1IZ9A 3D0OA 1LJLA 4OY3A 1JFRA 1XAHA 3ORYA 1P1IA 2WKQA 1U7OA 2XUKA 3BULA 3UO8B 4ES6A 3DEKA 1HBJA 3M82A 3UAGA 1EWTA 4QOHA 5IUNC 2C07A 4NH4A 3UIEA 2AMVA 4BTLA 1B8PA 5TT0A 4A3SA 3TB6A 1P5RA 3N5CA 3P52A 3JQGA 4J2HA 5EZ5A 2Q2OA 1FPMA 1IQ0A 1O5TA 1NRWA 4L76A 3OF2A 2Y93A 3PKZA 1MVLA 3GFPA 5B2ZA 4CF4A 3IULA 1V11A 1XBTA 2JIBA 1SK8A 1JJAA 2W7TA 3KKEA 3Q98A 2QLBA 2P30A 4MW6A 4XUDA 121PA 2Y68A 2ZIVB 3PJDA 4N5MA 1YASA 3WL7A 3A0UA 1AXRA 1ZRSA 5AHOA 5B4TA 5L51A 2Q29A 4F38A 4Z4HA 3LOPA 4NH0A 3TLMA 4F72A 5JO0A 4GNKA 1HT1E 4YH1A 3PA6A 2YJNA 5EMLA 4DJDC 3ROEA 4LQDA 1ADBA 1YTLA 2AN4A 1PR6A 1XA0A 2EYUA 4K6FA 4C76A 3UXHA 5B57C 3O2NA 4KP7A 1V7QA 5AW2A 5JQGB 1N8KA 1PBNA 3GZTB 3P9PA 4JLAA 4TV9A 3WGVA 3H05A 4ERNA 5CD1A 3LHIA 4UASA 1CHNA 1L5FA 1PK9A 3C2QA 3ROQA 4GT1A 1YVRA 4LN1A 4IJMA 1BCSA 4ZV7A 1PTJC 3DONA 4YGYA 2JIZA 2P8JA 4MGZR 3V46A 4C4ZA 4F9GA 1X9HA 2PX4A 2HU8A 3D8TA 3GARA 3O8QB 2XUGA 1QKJA 1BXZA 4K9KA 1TMGE 4V3BA 3WSWA 3DDWA 5J4KA 1EUYA 1K98A 4CQMA 4QHTA 1SU6A 1OFGA 3KUKA 1YOVA 2OCDA 3F9IA 3PB3A 4LK2A 4DNQA 3AT1A 2C3PA 3PHLA 1R4ZA 5DYIA 1VZ3A 1ZMOA 2BFEB 2HB6A 2M32A 4GMXA 5AKYA 4ESEA 1POWA 1RKVA 3EF0A 4XWWA 3D6HA 1U1FA 2B2XA 3FRJA 1R27A 1WUJS 1POXA 3W5DA 3PDCA 3GG2A 4HJXA 1M34A 3HA2A 3SIWA 1I32A 2BGUA 3WL4A 5A5GA 4DR2B 4OBXA 4JP2A 3TG8A 1V2HE 3DFUA 2VXCA 1VPEA 4JZKA 4QXMA 5T57A 3TFQA 4EPXA 4KPGA 3NBUA 2FSGA 4ZYYA 5HUQA 4CKZA 3A26A 4I0WB 1NM5C 1R9NA 3LLMA 4L2IA 1EP2B 3IEVA 1ZC3A 4JJAA 1U3TA 3VC2A 4CKXA 5EHXA 3FSJX 4C0WA 2A5JA 3NWPA 3GZNA 5DSTA 2XW6A 4MEJA 2H2AA 1SXJC 3GJ3A 1AUXA 1UBJS 2VJNA 3ABOB 1XPOA 1RQXA 3INYA 2TRSB 4FYWA 4HUJA 4UVIA 1SBQA 2J9GA 1C29B 2A58A 4F93B 1KOGA 1H3NA 4KQCA 4UEWA 2VAXA 1ISJA 4Y2JA 3MN1A 3SY8A 3ETEA 1RQNA 2IPOA 3E7PA 3NUQA 4YA6A 1DKLA 3W7BA 4D80A 4XRGA 1XNHA 3JALA 1Z17A 3C6MA 5LC1A 3J80A 3MAJA 2R8PA 3L6EA 5B1HA 4F46A 3LYHA 4YRMA 2QUIA 3DQQA 2H4XA 5A0FA 2D4HA 3LUAA 1CDOA 2F64A 1QWSA 3FMPB 2PPLA 2AXQA 5D86A 1FSFA 1V8OA 4JLMA 5BYAA 2UUAB 3L9WA 5SY9A 5D87A 4RQUA 4M1OA 1II0A 3W6PA 3SC3A 5J4LA 3ZDXB 3JU3A 5L3ZA 3AEZA 1W4BA 5DXAA 3HKBA 3UV6A 2V7QA 3K16A 4UUMA 2R8ZA 1EGVB 1W9HA 1M0SA 3CE6A 3MBKA 3ZY5A 1H0KA 1WSWA 2GR9A 1MQ9A 4X7BA 4UFPA 3EIFA 2QBYA 1M6VB 5LQAA 4YV0A 1I2ZA 3K2QA 4N03A 5CXQA 4YUXA 1MW9X 4YGXB 1PUJA 5H3CA 3L8DA 4LC1A 2AFHE 4FTWA 4FI3F 1FU4A 1W93A 4BNFA 4M1ZA 1L8AA 1I1HA 2DC1A 4JZYA 3D4IA 4OQEA 3EWSA 1L6IA 1QJ4A 4KAFA 4MRNA 4D97A 2E4ZA 2OCBA 2YVLA 1KZ4A 3CX7A 2VZLA 3RFFA 3D7RA 4OSPA 2O8BB 3OPXA 3HXMA 1XZDA 3A1FA 2J5BA 4S1PA 4UVHA 5FYDA 3FYUB 3MJCA 4HQ0A 4MS4B 2DMRA 1D1QA 2QX9A 5CURA 2DZDA 2HWUA 3H1FA 4LYDA 1ZH8A 2AQKA 2YCBA 4OV6B 5AK3A 2RGCA 3HBFA 3O1LA 1XE3A 4TKLA 1NBEA 1F6BA 1G3MA 2GGSA 4B5LA 4FB4A 4ZHQB 5A4DA 2YV2A 1UBGA 2YV1A 1JPJA 1PNOA 4E2WA 4X8LA 2PM8A 1LQUA 4MI6A 5TVGA 4C03A 1PR4A 2V03A 1YIDA 4LXIA 5E1MA 1EXWA 1YDGA 2HIHA 3OJOA 4KQKA 2YN4A 3P9XA 1Z73A 5K8TA 1B7GO 1P0PA 2DFPA 1YZTA 1QH1A 2H8GA 2PT7A 2H06A 1TUEA 3DXFA 3K5IA 4HS4A 4PNZA 2FQWA 4QFBA 1I1QB 3QA9A 5EGSA 5M3BA 1Q0TA 3HO1A 5FOQA 2GARA 1QF7A 4L57A 4Y6PA 5FEUA 1Y4UA 1T35A 2JKZA 2IX3A 1UDRA 2ECOA 2VJMA 2ZG6A 3ZGNA 1KAHA 1B8NA 2W83A 2B1QA 3WHPA 1Y4DE 2D6FA 2O2XA 3FPBA 1MA0A 1ZXLA 1X1AA 4GOND 5AM2A 5A7FA 4C22A 3VJRA 1PLKA 3DLIA 4FFMA 5C1DA 2BLLA 1UBFA 4PLYA 2R8BA 3ZHSA 1H66A 3V4VB 2O3SA 3EBLA 3U09A 1IOZA 5F9FA 4L6CA 4GC5A 4LAFA 5F98A 3S2IA 2ERXA 1OBVA 4I2NA 4R8RA 3CX6A 1USGA 1VSTA 2HO4A 3GUYA 1W36B 4PYIA 4QBIA 5A3RA 4MCJA 2WU0A 4GQAA 1Z2OX 5T4BA 2Y6UA 2HEIA 2QHXA 3MERA 6ADHA 2IEYA 3DKRA 4ALKA 3ZDRA 1IXRC 1S1MA 2QN9A 5LP6F 1RTKA 5HJEA 3GPIA 4B9EA 2F62A 4FE7A 1E9SA 1SOAA 2VTBB 3DMFA 4EO7A 1R64A 2DH6A 1IB6A 4AI6A 5DEOA 1JDTA 3PA8A 2D2EA 2G6TA 3OU2A 2QPOA 2OR3A 4FN5A 3ZI7A 2JVJA 3SLRA 1P5JA 2GTHA 2HDOA 1RJDA 5CT6A 3R0VA 3GY0A 4F8EA 2X4DA 2BGJA 1KK1A 3PNBA 4QATA 3U4CA 2Z2IA 5J23A 3B2NA 4BY9E 1S1CA 3E15A 1I7SB 4ITVA 5AK4A 3K70D 1VHLA 4N7BA 2WHQA 3WHIA 1RJEA 4C0HA 4MGHA 4OFWA 4ZAYA 5AVOA 1CXZA 3BQNB 3ZDBA 1VHDA 3U19A 4V0MA 1U6IA 4WASA 4NZNA 2UZ3A 3HDVA 3I0ZA 2OWDA 4ODIA 4DCSA 1BSVA 3CSSA 4WV3A 3SZLA 3KU1A 4EMSA 1XNQB 4MUKA 3D7MA 3OD5A 821PA 1HQYE 1UK7A 3DE4X 3RRYA 2DWOA 5KKCA 2VHJA 5DZSA 1E92A 5ALRA 4KSYA 4EFMA 1O96A 2DQ4A 3KYCB 1P4JA 2Q9UA 2VA8A 3CA8A 2BKVA 3GP3A 1A9TA 1MXHA 3ZD6A 1C7EA 1B6SA 1H9BA 3NV7A 3GB9A 3ONDA 1HOTA 4OHXA 1GL3A 1BIFA 1YRAA 2R8RA 4Y9DA 4CIBA 1T24A 5DDIP 2BY4A 3SOZA 1M8JA 1BYIA 5CYGA 1OKKA 4UBNA 2WB2A 3KXPA 5DW0A 2X1MA 1DEXA 2FMFA 3EUFA 5CLLA 2CL6X 3CEJA 1RSZA 4ON9A 5CCDA 2F1JA 3CE9A 3UAOA 1R9JA 1FW6A 1U2DC 4B47A 5CBPA 5FXMA 4QBTA 3TO5A 4R68A 4EGFA 2DETA 3O31A 4Y6QA 1ZM3A 4OUDA 1A98A 2OLEA 2FSSA 2ICAA 1ITZA 3C48A 4PYRA 3DWFA 1DEAA 4QTUB 3GIDA 4UFNA 2NTJA 4FBLA 3FTEA 2E5WA 4IOJA 5TPZA 2A9RA 2QR3A 1P33A 4I1UA 4EMTA 2NADA 1HDXA 3MTIA 5HBGA 1E98A 2FK7A 2H2WA 1RI4A 1W1IA 2Y67A 1DZ3A 2ZAGA 3C24A 1IN8A 4PFKA 1AJEA 1TTHA 2Z09A 3OLXA 1SU4A 5CEEA 1LPPA 3D4NA 2OORA 1E7YA 1ACJA 1OXXK 4XWAA 2PZAA 2I76A 3H5NA 3RAJA 2HJVA 2WIDA 4FSXA 1WXXA 2WU3A 3UTCA 1LTKA 2QYHA 4X91A 2NMVA 2GCEA 3G2KA 2JCYA 4U7DA 4FNMA 2ZE5A 5B37A 1E62A 4KQ6A 3BM5A 5SYAA 3I28A 3T1HB 1PF7E 3ESRA 3UMVA 4ZXFA 1BROA 4RV4A 1FSSA 4P7GA 4TYWA 1ATIA 5KOYA 1S9DA 4UEOA 3WIBA 4LRXA 1CPYA 1BNCA 4G84A 3KU4A 4FMCB 1DX9A 4YMHA 4F6RB 1LLUA 1U1EA 3BHJA 4R5HA 2FU5C 2XA2A 3TTWA 1OH6A 2EARA 5ENVA 2BAGA 1RPNA 2GT1A 1WWKA 1Y6ZA 3DZGA 1UM9A 2CHEA 4M60A 3GEMA 3CEAA 4KODA 5BN5B 5I8WA 1T1GA 2AZMA 4UXJA 1DBWA 2P6OA 4CN9A 5BNZA 5HQ3B 3A6HA 5KIAA 3ETCA 3JZDA 4RPJA 5EMHA 4R31A 3WOVA 1EPUA 2WFZA 1PDVA 3QE4A 4M1YA 3F47A 4E31A 2O1SA 5CTJA 3NIWA 5F9HA 4CCSA 4M1MA 1C7FA 3WO1A 4PS0A 3RAEC 4IIXA 5BN3B 2OM2A 2XEXA 3VQTA 4DDTA 4ZMBA 4PZCA 5KSYA 1QIMA 3O9VA 1E2IA 5JOQA 4REMA 4QX6A 2IYTA 4MYRA 4JEMA 1OLUB 1E7QA 4LF6B 1QZXA 1IEXA 4YS6A 3VSAA 1W76A 2H92A 3TSWA 5A4IS 3MOIA 5I3ZA 3SQNA 4F0JA 5AVVA 4YECA 1EQUA 2P5SA 3ODPA 1TRKA 1L5VA 4BFZA 1HUQA 1O6CA 4X7PA 1EHYA 3RV4A 2QMEA 5C5IA 2M9MA 5AH0A 4ADSG 2XH8A 3H7AA 1RJ9B 2B20A 4OHMA 3ZCRA 4RTLA 2PJZA 3RIMA 4J90A 2OFOA 4JWKA 1QP7A 2I4RA 4P93A 3PNYA 2VT7A 1PJ4A 1Q84A 1JVBA 4EVIA 4JI6B 2FWMX 5D3ZA 1K2VN 4R6WA 1I2CA 3QI7A 2EWWA 3H4TA 1ABFA 1R6DA 2Y6VA 5BVGB 4MNTA 1EDOA 1Y4AE 1E59A 1RR6A 4RVDA 5H80A 3PHGA 4RGQA 3PEYA 5JCPA 5JEEA 1P62B 4JSYA 4RKFA 3KB2A 1QAMA 3H84A 5LZ5A 1HNWB 4DJ5X 1GNQA 4HDCA 1ZNXA 2JBHA 1V39A 1G8GA 2FA9A 3LUCA 4H1WA 2IYAA 1NMEA 1ZD4A 3S1AB 2F55A 3NHAA 3D6VA 1T3TA 1DXHA 4A26A 1HO3A 1L7OA 3IE2A 3OWXA 1SUEA 2AMJA 3FKQA 5DE3A 3WRXA 4AJPA 3FF4A 3ZDYB 4CR6A 1T2CA 1TUIA 3Q2OA 4EL0A 3RIGA 1A5SB 4JI1B 4G0OA 4HWOA 1HYHA 4LJ4A 3TAHA 3L3BA 2PV7A 3KOWA 3UHFA 3MILA 1W29A 2BL4A 5KHLB 1NJ5A 4JJZA 3NTUA 1ND5A 1FRFS 2G9UA 2QTVB 4S24A 3WISA 3WR5A 4D8VA 3RYTC 1C2TA 4BO7A 1N2HA 2DWPA 2B0JA 3RFVA 4DIEA 5E0KB 5DI3B 5JFTA 3I9NA 1GAXA 2Z3WA 3KXKA 1CB7A 4WOKA 2P75A 1EK0A 3L7BA 1L3BA 3U40A 4AP5A 4I9HA 4B4UA 4DRXB 5F3WB 1T6BY 2RKBA 3IQIX 1XZBA 3I52A 1N7JA 1OLSB 4W5WA 3TXXA 3EPRA 2B3DA 1Q74A 4W5OA 1XZNA 1HY3A 2OD7A 2ZBUA 3ESBA 3PZRA 4UTOA 5BQOA 3VISA 1U7TA 1WVIA 4E2ZA 1Y5IA 1YS1X 4PYQA 2UU9B 4XSGA 2YUTA 3KR2A 3W8DA 5EQJB 1ZOSA 3K53A 1GZDA 3M6VA 5LMNB 2BW0A 4AJOA 3BH7A 3RNOA 1U0NA 1DC8A 1E0SA 1AOXA 3DV0B 3F8TA 1Q7BA 1TYCA 3ONEA 5FAKA 2Q0QA 1U9CA 2J48A 3DXZA 3MUNA 1A72A 1WVGA 1L4LA 2WI8A 4INZA 4UE3S 2RCYA 3DA8A 1RCUA 3A2LA 1W5SA 1XMXA 1MZVA 2OK8A 1WXGA 1PGQA 4RTKA 4KDFA 3GJ8A 3H1BA 4G5HA 3GJTA 3GRPA 1JS1X 2D2VA 3VHQA 1MQAA 4BNDB 5BW5A 1NI5A 1PW7A 2JIQA 3FRHA 3H2IA 4FBMA 3T41A 2BMFA 1CRQA 3L01A 4DLAA 1V7PC 2CFCA 3R6WA 4WIAA 5AVSA 2FCRA 2GILA 4NYMQ 4Q9NA 3WQBA 1H4SA 3IAS6 1GPMA 1O9GA 3E7FA 4CEIB 3IEMA 4KNYA 1QS0B 1QZZA 3QHPA 4ZT3A 3H99A 4XWOA 2FJPA 5DLPA 3PDHA 1SO8A 1ID1A 4D9HA 5TPWB 1DJPA 3DLTA 3FJYA 4BVFA 2OC4A 1I30A 5F5XA 2X5JO 2XZTA 1BDBA 3RLIA 4F85A 4EG1A 5K09A 4RHEA 1SCUA 2YMQA 3EZNA 3K96A 4HDNB 1WZ2A 5KCZA 3HCNA 2H54A 3LM8A 4JUIA 3GDFA 3H86A 2ZP1A 3RSHA 1O94A 1NWCA 2F59A 3BAFA 5EXSA 3V7UA 3X2FA 4F5DA 2FLKA 2C4KA 5EMNA 3BRWD 2H4ZA 3R09A 3FUCA 2O50A 3DE3X 1YSCA 4ARZA 4BVKA 5IVPA 3N0TA 2FR8C 2M6RA 2PQ0A 5FD8A 4AZWA 2QPLA 4AJIA 3BKWA 3WWZA 2IY9A 4DSZA 3FPGA 2YW9A 5EWLA 4B3IA 4N0EA 3MLEA 4NBKA 5AI6A 5IH3A 4FMBB 4LC9A 2FE1A 1UODA 1MJNA 3GLTA 4R9VA 5COQA 4MK4A 3TD9A 3DTYA 3ZHQA 2V59A 4KR9A 5LL6P 4II7A 2XJ4A 4I50A 1NW6A 2V45A 3GJXC 4GI1A 1PV4A 1CY2A 3PXCX 4CFZA 6Q21A 2C8JA 2IU0A 4ZCSA 4IHKA 4PZUA 1LDEA 3Q10A 3QENA 4HGZA 5IKOA 1PV2A 5C5EA 2ZM5A 1I2DA 1JW9B 1OHHD 3WWCA 3HJAA 4Q03A 2X8BA 1B00A 1PFKA 5FFNA 1OZHA 2RGWA 2V7UA 2WA1A 2JFWA 1U7XA 2HMUA 2QGFA 3FWPA 3FR7A 3PRKE 1LRKA 4R0NA 4BU0A 1BA3A 1JHQA 3CY6A 3V1UA 2BSQA 4IHJF 2JD0A 2AUNA 2VFAA 4HAWA 4A1OA 4DR3B 1TO1E 4JJKA 4JX8A 3GVXA 4R9RA 4DVGA 5BW8A 3KBBA 3PCXA 3J81k 4FHZA 4DIFA 1VJRA 4HGRA 1DUVG 2VL7A 2X1VA 3V8RA 1EFVA 2XMQA 3ZJUA 2XUFA 4R5MA 3AY3A 3UWSA 2C59A 3FI0A 2AEFA 1ZEJA 4G5SA 2BOVA 2I71A 1JMKC 2QD2A 3OT1B 4H3HB 1AF4A 4Q19A 5H1YA 5BSKA 5FUQA 2ACVA 2I4TA 5HKKD 3GJ5A 4OLAA 3FTNA 4P35A 4MYDA 3ZHOA 4RZQA 4GM4A 3A1VA 1NLZA 4EZIA 1RC8A 1LPBB 1ML4A 2GBIA 2V7BA 1SOVA 4YCJA 1KZ9A 3K32A 3NASA 5FUYA 5AXDA 1RI5A 1VCHA 4R3NA 1MB9A 4OQNA 1W85A 4ZT7A 5ITZB 3G5TA 5BT8A 3UPDA 4DTCA 4NYJR 5LLSA 5G4KA 3V8NA 4CKCB 2EHDA 1ESDA 3O8BA 2MSNA 2F1KA 5KOHA 3PXUA 1FYDA 1USVA 1HEYA 3ZWCA 1F5SA 4LF8B 1Z26A 1V9SA 1ZA2A 3K1JA 4EI8A 1K3UB 3I61A 2XR1A 3QV1A 4ZPXA 4MDHA 1Q17A 3F1KA 4ZGBA 5BT9A 4P4SA 3CLUD 1E2HA 4L15A 4LYFA 1P45A 3ABZA 1QHFA 3B7GA 4JODA 1PL7A 4RY9A 3DBRB 2WTBA 1U11A 3I2HA 1B6RA 5KO2A 4XW2A 3BG5A 1XZGA 2PYIA 2OBNA 1TM4E 4Q9DA 3W0LB 4DUPA 1Y1SA 4QZVA 3IAFA 5ELLA 3ANYB 1SURA 4G2NA 1XELA 2P77A 4LWOA 4NULA 4TQGA 1K2WA 2F00A 2JBWA 4EMBA 2GZHA 1KFKB 2EX0A 3BE5A 3JQFC 4KIGA 1MTZA 4EYSA 2QX4A 5FEMA 4NCIA 2X2PA 1CIPA 1U9IA 2N1BA 3PEEA 1SM4A 2QQEA 3W8NA 4AS3A 3CV3A 5FLYA 3DKIA 1R3UA 3D4OA 2JI8A 2GM5A 3TAXA 4MWGA 4NARA 2H57A 1ECLA 3GJZA 4R1TA 3JQQA 3HP7A 1CP2A 4RAQA 1NJ8A 1SZJG 4HSEA 4B32A 1Q12A 4IVRA 4BXOA 3SGLA 2JBAA 2DT8A 2P9HA 2I0FA 2WLSA 4FSDA 2Z1MA 3WTCA 4BFYA 3L40A 5DHSA 5JCJD 4XB6B 2GFHA 421PA 3PLNA 3UJPA 3L2OB 1XB2A 4IDAA 4N49A 1PG2A 4QNNA 2XNDD 4XASA 3C6ZA 1RKQA 3QHQA 4ZI2A 2QTMA 5ELXA 5IWAB 4GS5A 2G5TA 3EEYA 4TV9F 2AD5A 2G4LA 2BE9A 2PJDA 4IO1A 2O7SA 4PG7A 3T7CA 2IEZA 3U3JA 1IQUA 4PZ9A 4A6DA 2R85A 1UIRA 4FCCA 4E5PA 2PV0A 4QOJA 1QFSA 3PC8A 4S1OA 1J2TA 4AO8A 4TYYA 2OFPA 2EZUA 3N2IA 3QPUA 3VX4A 5ITVA 2ODWA 1ZGJA 2B4AA 3A3YA 4YJ2A 2P65A 1MGOA 1U28C 2HCFA 1RVDA 2P27A 2RGNA 4MVJE 3NCTA 2MR6A 3F4KA 4LYYA 3RSZA 3E82A 2ZRCA 1T29A 1DXQA 4MUYA 1IM5A 1LBQA 4RA9A 3DZHA 3WGZA 3OE1A 4WDQA 5IM4A 3NT4A 3HB0A 5JYDA 1IOLA 4URXR 2PCJA 3KUCA 2DLDA 2VKQA 4MB2A 4ECEA 4M8KA 5C7YA 4TTRA 5AVZA 2P91A 3IVAA 2H6EA 1MU0A 4KXYA 3AF2A 3PJFA 4BAUA 4OHCA 5CJ2A 5EKSA 2NT4A 3X1XA 4C1NA 2QRKA 4UE6A 1E0AA 1U0LA 4RFSA 2D7JA 5C1OA 4UVGA 2WHPA 4LJ9A 4KYUA 5T8KA 1ENYA 3KCNA 3LBFA 3T4PA 1C3VA 1GQ2A 2ZIFA 1KVUA 3SEQA 4CG1A 1KQOA 4ETNA 5KS2A 4XQCA 2QG6A 2X9GA 3K0CC 4X66B 4BV2A 4EB8A 3B8EA 3FSRA 2ZR9A 4HQOA 4DA7A 4UTVA 2PX8A 2EG5A 3EZ2A 2NVOA 4DHWA 1ISSA 1G4AE 1I33A 2H2FA 2I62A 3M89A 4ESHA 3RTAA 3C39A 4D3XA 4ZEMA 5BSVA 3HU2A 1ES9A 4LSMA 1BE0A 3ZWYA 3BK2A 1A2KC 1HSOA 1J42A 1JFVA 1QP8A 2YVUA 1NVVR 4JHXA 5P21A 3IB3A 1ECPA 4NOLA 1ESZA 3L6UA 4IVPA 3UKOA 1GFSA 1ZQ9A 4DW8A 3A6PC 1JEJA 4BKQA 1YR8A 2W58A 2C29D 2EF1A 2FZWA 3ELBA 3AFOA 4D9NA 1AHPA 1IN1A 1J6UA 2PR7A 2WTEA 1PS9A 1UT8A 1SZDA 2Z1NA 4B87A 3FCUB 2PGJA 2P90A 3GQBA 3HL4A 3NM6B 4HAUA 4LMRA 1AS3A 4EQ6A 1SG9A 3NTXA 1ORTA 2YICA 1B14A 2RK6A 3TQHA 4CEJB 3TX6A 2V54A 3L6RA 4CLEA 1VLQA 1D7OA 5LQMA 2R6AA 5CJPA 1E3SA 4BVGA 1J9EA 3Q9UA 4PX2A 1KPIA 1NBIA 4XX0B 2PS1A 2I3BA 2V6GA 2DLCX 1ULZA 2FPMA 4OHVA 5KU7A 3ACDA 3P2MA 2FPKA 4Z49A 5J2TA 1TAGA 3AR7A 3IXLA 4DIUA 1XMIA 5FJIA 2QUBA 4WBSA 2NNLD 4QD3A 3VZCA 3VKFA 4B3FX 3OZIA 5AP9A 2AQ8A 5GAJA 4QUGA 4B3HA 1M2OA 1W35A 5C31A 4WLUA 1XDDA 1ADFA 1DRJA 1KSHA 2PKEA 1X14A 1O4VA 1Q1QA 2KJQA 2WSYB 3NHRA 5DBIA 4AF8A 3ZD9A 5D1HA 4BGEA 1PR5A 3LTNC 2HU5A 4YCSA 1RXVA 1IHPA 3PQDA 4JOBA 4AJHA 1G5TA 2ZSJA 3VNAA 4ZI3A 5LQRA 3THYB 1EMDA 1SVMA 3KTAA 2C42A 1JA1A 2JFFA 1NU6A 2CHVA 5D3MA 5JW6A 3O8OA 3HB7A 3S2SA 1XQ6A 4H59A 1L5KA 3U4GA 5F78A 3F49S 4JK3A 3ZVNA 1SEVA 2NU7B 3AJ9A 3CZRA 3AWDA 1PT9A 4AAYA 2I5PO 2J8ZA 3JQ6A 4IP0A 1CUIA 4JWTA 1KMCA 5KAPA 2UXBB 3GNQA 3HVJA 5CFQA 5AOCA 3H0EA 4LYJA 3DOOA 3LIIA 1VYHA 2RH4A 3CCFA 1XAGA 2VPXA 2F3PA 3DB2A 5LYYA 3ZW7A 3ZWWA 5LQUA 4C2UA 3U5ZB 2ZUVA 3FGOA 1CJKC 2IVZA 2ES4A 3KSRA 2KW5A 5FL3A 1NA5A 1DWPA 1A77A 3R8XA 1JE1A 1SUPA 3DTVB 4NF2A 3RJZA 1S2DA 2TMDA 1JHZA 3B1WA 1YUMA 4REQB 3IEUA 3WRYC 1SKUA 2PG3A 3PXGA 1ESEA 3HU3A 1DSSG 2P6PA 1OTHA 2Z5FA 1DUSA 2ZTVA 1W6UA 4QDXA 3V9AA 3ZCSA 4WBNA 4XQ9A 3H6KA 5DYGA 3GCXA 3MM4A 3UB2A 2VDWA 1EUDA 2G76A 1QZUA 4HC4A 4DCTA 2A84A 4XJTA 4A9AA 1LPMA 4IKPA 3TRHA 3Q88A 5LXTB 4FGZA 2C4HA 4O4JB 1G8FA 2DPXA 3Q7EA 1YRBA 1RIIA 3WZLA 1B8UA 3QPBA 1TC1A 1W73A 3INNA 3ZZTA 4AL4A 4PNPA 4CKBA 1R16A 4Z2YA 2XUHA 2J3HA 3O0TA 1SMKA 4XGKA 1NDUA 5CB4B 2HJHA 3JAWB 4XD2A 3H9UA 1D3AA 5CYFA 3CGWA 1JXOA 3RDPA 2OXIA 3EOAI 1EVJA 3LL4A 5KWSA 5LBTA 2YV3A 1CB0A 3WHLA 2WWYA 2A5GA 4XX1A 1A5ZA 2BP7A 4LHSA 1CK4A 4PZZA 1P61B 1PEKE 3EUWA 5BNFA 1FFBA 2O3TA 2V4MA 1R0LA 5CDUA 5BUZA 1PRYA 1FTQA 1Q1ZA 4CCYB 3GJSA 3N8DA 2OK7A 3ZVRA 5SZJA 1IUNA 5AQ1A 1JE0A 3A1DA 1MG5A 2YMMA 3DMGA 2R1ZA 4GYWA 4ILEA 4JVMA 1Z2EA 3AC0A 5BUSA 2AWNA 4YPVA 1FNNA 1RHQA 1YQDA 2CWDA 2KWIA 3GG9A 5EKTA 3VZRA 3WY9A 3EAFA 4I4TA 1NNI1 4GI3A 1DT5A 4BCDA 3GJ0A 5C81A 2QXYA 3FKSA 5FUXA 4CUKA 1JQEA 1ZD1A 3W5VA 5CLIA 4DG8A 3I6QA 1H6AA 4D99A 2PGDA 4M8LA 4AO6A 5B2FA 1HNZB 4NWIA 3WA7A 2ZRQA 1TM2A 3N6XA 1KIFA 4MW0A 4D43A 1K0UA 5CTAA 3Q8LA 5B3JA 3KZOA 3ODGA 4TKVB 2XHZA 1JAIA 2JGEA 3PDJA 3IBFA 2FV8A 2PYDA 3LHDA 4JBWA 4XLTA 2O4UX 3WGNA 4AF6A 3E4DA 3V1LA 4KRGA 2RBGA 4X95A 5KYVA 4BO4A 2ZIAA 1RQ7A 4G5RA 4J1NA 4ARSA 3CR3C 1NKSA 3NXKA 1K75A 1VLHA 3KTOA 1IH8A 1CLEA 1YFKA 4IVNA 2O8NA 1UWLA 5JALA 5KU1A 1IXYA 3ITKA 3DTTA 1FXSA 4D9JA 1K06A 5KSWB 1JR3E 1G3QA 5E7QA 1ZR2A 4L6AA 4GP6A 1T4MA 1M2NA 3PDIB 4XWKA 2WB4A 1XNJA 3WDMA 4CG0A 2CT8A 1XMQB 1H1TA 4C7VA 4AWXA 3NC4A 3LY8A 3ECAA 1OX4B 3M6AA 1BU8A 2FSPA 5CT8A 2GPSA 1JYFA 1YULA 1NATA 2QVYX 3UT5B 3LY9A 2H2IA 2H5JA 4AM8A 1P6QA 3ND6A 1VA4A 2JLQA 4ZYZA 3RVQA 1OXUA 3SYLA 4F06A 2IS2A 5TVKA 4NG5A 2Y99A 4N3CA 2X0RA 4DM4A 1KP3A 3QITA 2IV7A 3KLNA 1WJGA 3RREA 4C7BA 3HUTA 2ZS9A 4L22A 5EZYB 1UBMS 4YRNA 1NW3A 2ST1A 3IAXA 3AMVA 2PQMA 3UJBA 1L7XA 1T8SA 2V3VA 3DGFC 1E58A 4QG7A 2E5FA 4ECAA 2D5IA 3NXSA 4EW6A 1EUCB 1QPGA 3D8HA 4JYZA 4YMUA 1FFCA 4OXYA 3B2EA 2PWYA 3BPSA 3HCEA 5AHKA 5U4XA 1YVEI 1OC2A 2DFDA 3ROGA 4KLRA 4MHOA 3H16A 2IV3A 1FDIA 3EBOA 4DLKA 5DTMA 3RGGA 5ALNA 1R5NA 3O2SB 5JAHA 4IUCS 1NJ6A 1UXHA 1XU7A 2XOKA 1ZI8A 1RMYA 2PLWA 1P7PA 2FUG1 2C5FA 4R1SA 4YRPA 1R0RE 2IYZA 3CVXA 5C8DA 13PKA 4LK3A 2IYVA 3F1LA 5HIIA 1RM3A 4NIMA 5HFJA 4ENWA 5IANA 5KTOA 3B78A 5ILOA 2F8SA 4TMYA 2Y92A 2X0NA 4C7JA 5K6AA 1E6UA 4WLOA 3L7YA 1ILEA 4QDZA 2YNMA 4UHJA 4E2XA 5IHPA 3UK7A 4DN6A 2I4OA 1I36A 2OZEA 3GMDA 5EIWA 2OBBA 5ICFA 1E6CA 2D06A 2VOEA 1Z4NA 2PH7A 3E1KA 3RVSA 2AT1A 4CM3A 2HMTA 2VK4A 5CDSA 2KM1A 2OUKA 2I7XA 2QJRA 1TT5A 1N6HA 3FX2A 5K2OA 3L0IB 3A7EA 4NCHA 3S8MA 4RLQA 1E5DA 1KI6B 1I80A 1QF9A 1QG4A 2QTRA 2HXSA 3UGJA 2HMYB 4F1KA 4IEEA 3HHPA 1I4DD 3OPVA 1CQZA 2FN3A 2J46A 1Z2PX 4P4NA 4EHKA 3C3BA 1ISIA 4OXRA 1DIGA 3ZXUB 2A9QA 2GPNA 2PLFA 3LQYA 3M5WA 4TKZA 1EFAA 3N2ZB 3HCOA 1PCXA 2BF4A 3AI1A 1QHYA 3R8FA 3C8UA 3T4UA 1GU0A 1GKKA 3GRRA 5TMBA 3RPEA 3STUA 3EGDA 1S96A 3GCWA 1KE2A 2YVKA 3KALA 1U6JA 4A2CA 1E8DA 3DO6A 4A73A 2DHRA 1XLTC 3PUHA 4CV0A 4LXGA 2KBEA 2ZAIA 4POOA 2D7DA 1SR8A 3JD2A 3B20A 3RUHA 3KPUA 3N58A 1XQYA 1A8SA 1DNPA 3I12A 4HNAB 4OXQA 4WZZA 3BSYA 5LUAA 1SCAA 2J5RA 5MGNA 1NMXA 5EP2A 2REQB 4KGXA 1SCJA 3FNQA 4LZAA 1DJNA 2G77B 3ZNOA 3U0BA 2X9VA 4BMXA 1IQRA 2JI9A 3AVPA 3HPQA 3T5DA 5BYKA 1JDBC 4H7FA 1FQWA 5E2BA 2RGEA 3TCNA 4FR2A 3ZOZA 1WKVA 3VYWA 1DMSA 4LBVA 5LQSA 1VSBA 8GPBA 3NQ41 1J70A 3DEJA 4DMLA 1RZRA 2BHNA 3NTVA 3IEXA 3ZGYA 3C6XA 1EFHA 3BJEA 4ZD6A 1J20A 2P2DA 4AX4A 4NK4A 4EJ6A 4B6JA 3AV0B 2JFHA 1XVVA 2AEMA 2BTQA 1FUEA 3MF4A 4LECA 4EUFA 5D2CA 4R16A 1H05A 3SJUA 3C3JA 2OBXA 4O4IB 3U4AA 1M6VA 3BBPA 4OD0A 5EE5B 1CKEA 3ZQUA 2QV0A 4DEYA 4WJKB 3LT5A 1Q1EA 3CVWA 4U9IS 5FTLA 2JNWA 4PXYA 3RRZA 3L43A 4HLCA 5GONA 2Q5OA 2LWIA 4I5GA 4G89A 4Q1BA 5L6LB 3B9RA 4FPXA 1VFNA 2ZIXB 3KUUA 4Y2UA 4F4IA 4MQ6A 5KYXB 2O8BA 3G0CA 4AO7A 4K0RA 5BV8A 3OQHA 1CNMA 3P26A 2NVUA 3OZSA 4I81A 2YASA 4G9GA 3P1JA 1J2RA 5LCXA 4AJLA 1AO3A 3GLGE 4UPEA 2X2OA 2ZDQA 1JG1A 1ZUIA 5EUQB 1LRLA 1P1CA 1AMNA 4OHUA 4QPZA 5ADHA 3G85A 2CV1A 4PC3A 3PX7A 4ZHQA 1RWNA 2PANA 1DOHA 2F8TA 3FUXA 2ZIWB 4E2FA 1NVKA 4PIPA 2NO4A 4Y1RA 1XRRA 1ZXXA 1T25A 1PE0A 1PKXA 4BE4A 4CDNA 3BQMB 3LQQA 2EKPA 4YR7A 2VDLB 1J8DA 3I5MA 1F4VA 3RCBA 4BATA 2BI4A 3TLYA 1LK0A 5IT0A 2B35A 1TDJA 2IVFA 1FYEA 4CT5A 3NWEA 5CVVA 3H5OA 4H0FA 2J6HA 4KYTA 4BB6A 3N7AA 4DMMA 5KEIA 1W46A 3PGJA 1Q0RA 3EG9A 4UHDA 5FQOA 1W44A 4FW9A 4O6VA 1F0KA 3L9XA 3VVCA 3GRZA 3WWDA 1Y6QA 5K0GA 5LWQA 4LV8B 2Z2YA 1TO6A 5ALQA 2QRUA 1N32B 1C3OB 1TAQA 2SICE 3T54A 3ZW8A 4B4OA 5CA0A 4C5AA 1GDTA 3K70B 3T35A 3UOWA 1QYRA 2X7JA 5TQ0B 1A5TA 1SU7A 2O20A 5TARA 1HT2E 3FJ1A 3K1ZA 2PCLA 4JR1A 4KG7A 3SG0A 4X5OA 4GL4A 4H0CA 3TDKA 3FVVA 3HVHA 2NZ8A 1LV8A 2F3QA 1GUYA 2P2LA 4E13A 1QQ5A 1J2JA 2HIAA 1BOFA 2EGUA 4XM2A 1VG9B 3JWJA 3QVUA 5FI0B 3S5UA 3U4DA 4G6ZA 1QU3A 1ZGHA 1ZNWA 4JJ8A 5HQTA 3D5TA 3H18A 2EZ4A 4ZTBA 3QWFA 1EXDA 3CKMA 5FTJA 4LYGA 4QOIA 3GP8A 2IE8A 1P31A 4QPJC 1ZNZA 4M8SA 1ZSYA 3EFOA 1VCIA 4I50F 3FCSB 3LCVB 2O5RA 1EHIA 1URPA 5AVKA 2XF8A 3GGSA 5P8WA 1QFJA 3IQWA 3MT7A 3ECCA 3Q7TA 1XR3A 1KWKA 2RBEA 3JAKB 3KDAA 1I4WA 3MBIA 3GF4A 2WM2A 2J9FB 4B44A 5EL0A 1BCRB 1S3GA 2IF0A 3C6YA 3HGTA 5B30A 3D2LA 3HV0A 1SCBA 1P72A 3AU9A 3ZIDA 1HGXA 1WXHA 2WJVA 3G6WA 1XTZA 1U3FA 1RAIA 2BISA 2JGDB 5E3JA 5BYBA 4A8JA 4F86A 4C0JA 1LWOA 4AMGA 1TUGA 1NVXQ 1YQ9A 4G24A 4BMSA 4D2IA 2PRSA 4XWYA 3KYCA 2GJ8A 2PSDA 1SKQA 1C9DB 1DBSA 1MABA 2F3TA 4Q6WA 2IXEA 5JBIA 5A5DA 1KAMA 1ZOIA 4FFRA 2WSSA 1N9ZA 1CY0A 4INOA 1WDTA 2PPVA 4QYIA 3V4OA 1ZHFA 4ZVOA 3A6DA 4P83A 3PVSA 5J9FA 3AHCA 3PR2B 1N57A 3BMOB 5CA1B 4QRHA 4LRSB 1IG3A 1DC3A 2OCIA 1UJNA 1O54A 2GN1A 2WDZA 4ZMSA 1NKVA 3IAAA 5JVDB 2QP9X 4RDHA 1UZAA 4NL4H 3BE4A 3N2YA 3LQFA 3GRVA 4UDNA 5THKA 2NO1A 4QNRA 3TE7A 1WBDA 3B6IA 1E4OA 3ZJTA 2OBYA 1FUYB 3FRIA 4MWBA 1UMBB 2WMNB 2ZRFA 3L7LA 1OXSC 3BFXA 4KPYA 4E4TA 4NICA 4UM5A 3NAMA 4QUBA 5CPBA 5EPEA 4A5SA 3ON5A 5ISMA 4PX9A 1U0SY 3QBVA 1QM5A 3GPDG 3I23A 3P5BA 3TNDA 3EA5A 4FZ5A 4TZTA 2IY7A 5FBWB 2KHZA 4FJ2A 4A8PA 1UC5B 3RAPR 5FCDA 3IVGA 3Q8WA 1CUXA 3FOWA 4DM3A 2VJQA 5GP1A 3G8BA 2PUGA 2GK4A 3FYHA 1L0BA 3LZCA 4A7PA 3GDWA 2V7PA 1E1LA 1YZUA 5LIPA 2P4SA 2VWGA 2R62A 2XVYA 5BORA 4TKUA 1VJTA 5CLQA 2C2GA 3EWNA 3LV8A 5CPFA 4E1AA 1A4IA 4H3KB 1KDOA 4QXOA 2J3IA 3MPUA 4CFYA 2GO7A 3SF8B 5CVCA 3SEZA 4Z3KA 4WLNA 3VMMA 5HQJA 1ICIA 2EIHA 2I4LA 4HDQB 1KH2A 1X13A 3HG7A 2AOWA 4B4VA 3KQWA 3T38A 3BJIC 2H7CA 2ZVQX 1EQ2A 2J3MA 3QBTA 4PG4A 2IKSA 1P7YA 3GPCA 1I7PA 1GGHA 1E61A 1Y7TA 1ZQ1A 3FDZB 1C0EA 1VE1A 2GUWA 3QVGA 2XLCA 1U99A 4GMGA 5EFZA 4P98A 1XZIA 4OKNA 4CE6A 1N2CA 1R0KA 4HAOA 1HORA 5B4VA 4MHTA 1BX3A 4MLPA 2HN9A 5EWMB 1PN3A 4J1SA 3OEEA 3BH0A 5CAEB 1EINA 3NRCA 3I9V1 1YE3A 4JLJA 4WN9B 5GPBA 2NACA 3BMCB 3R9WA 4PAGA 3UW3A 1Z33A 3U17A 2ZQZA 4GX5A 4KN8A 5I7FA 1JR4A 4REOA 3ZS8A 1QZ3A 5KJ6A 4LGVA 3VVMA 2AUTA 1OLUA 4TLBA 2QRHA 4Q1CA 4QPPA 4PNHA 1QV6A 1WUKS 5DM1A 3ASZA 1H69A 3N6VA 5MFPA 2IPNA 1W1WA 3QF4B 4FNAA 4M1WA 4DCOA 1UP6A 4HNRA 3DWIA 3FMFA 3GLQA 4AKHA 2HSGA 2ZBGA 3Q2IA 4JKIA 5L8VA 4UU8A 1RJ9A 2FW7A 5L95A 2HHJA 3HLTA 1FNCA 2IE0A 3NOXA 4G1EB 4ARAA 4MINA 3FWZA 5K0BA 5LVAA 4FILA 4YJ3B 2GETA 4YJ2F 5AM0A 3GX1A 3PWZA 3ROKA 5ICEA 4INPA 4LSWA 1TZKA 3IHTA 2Z5GA 3BDIA 3MUEA 1E9DA 1GPBA 4Z4FA 3EUAA 5ALJA 1ZINA 4Y2VA 5DP1A 1U8FO 5BVGA 3OURA 5JR3A 1I3OA 1T6NA 1RAEA 4FX2A 2DKOA 2LPMA 1S8OA 2FAXA 4JB3A 4MB6A 3AETB 3OTQA 5DJ5A 3BD6A 3DMDA 1YAJA 5ULLA 2B92A 4CFSA 1DGQA 4QLAA 3HKEB 3AF3A 3JVEA 1VIMA 3U3RA 4CM9A 4J2TA 4KE7A 2AZ4A 2BEUB 1G8JA 1BS1A 2GVZC 2W6CX 2HK8A 1GN9A 3FOBA 3NHKA 2LGJA 4O4HF 1NLYA 4YQZA 3R0IA 3TEFA 1UDBA 3VH4A 3RKRA 3ZHTA 3J81A 1SBTA 1K7EB 3S1AA 3R6LA 5T7BA 3D6JA 5HGXA 3LT1A 1W4ZA 1T6ZA 1YH3A 1DAKA 4IL5A 1ZN2A 4BZWA 4KQIA 4D56A 5JD4A 3ZLJA 2GD6A 1J0CA 2HLPA 3C3CA 4NU6A 3ZDAA 3AZPA 1G18A 3UYLA 3K7EA 2XWSA 4UAGA 2B4YA 1BS9A 2ON6A 3G0GA 3QTLA 4U7GA 1BHSA 3TOCA 4FWIB 1QCZA 2VJDA 3RQIA 4EY5A 4CLRA 3HK2A 2H1FA 3CG4A 4AY5A 4C05A 4BP8A 4X44A 4DBZA 3DBHA 4BJ3A 1Q83A 2QIPA 3NETA 3CTPA 1DUIA 1ND6A 2O48X 3KPYA 4EP1A 4YAUA 1B0PA 1PZNA 3B70A 5DI3A 3HCWA 4ESOA 5ALFA 1P3DA 2SHKA 4GMDA 3JWHA 4DRXA 4Z54A 3IUQA 1V7CA 3WP0A 4B5KA 5IJ9A 3L1KA 1C1HA 3SOPA 1OLSA 2C3UA 2AMLA 3E3AA 3GUUA 2IHTA 2P9TA 1V48A 5JC8A 3L0BA 2YVQA 5L7YA 3CX8A 4B85A 2HIMA 5ESWA 4EUNA 2F2TA 1AKMA 1UFQA 2VSYA 1JEQB 2DQYA 4NS4A 4AY2A 2VDRB 1HE2A 3BTVA 3EPPA 4QTYA 3SHVA 1CUGA 3DF7A 4H6WA 2W48A 5DYNA 5FH9A 1FP4B 2VF4X 5J2TF 5KNBA 4B3TB 2B7CA 1YRHA 1WULS 3DPIA 2F1OA 2HJSA 3AHEA 4MVJP 4A27A 4RH1A 5EJ4A 1TD9A 4K7JA 3ITNA 5JQGA 2F4VB 4M8IA 3L02A 2BR5A 3BGVA 1QG0A 4PFSA 4X92A 4GYYA 5FBZA 3UENA 1A8PA 4O2AF 1RRKA 5JXJA 3PUKA 3M6FA 1L7MA 2RMKA 4FW8A 4MQUA 4AJ9A 1CZUA 1UT5A 3CVYA 4KO1S 3L4JA 2VVTA 3TECE 4ZEXA 5CCXA 2DPYA 2Q5IA 1EJ2A 3OCJA 1EJ0A 3I5AA 4MVJI 2QENA 3RASA 1DAOA 4V39A 3H4MA 3FKJA 2QTNA 3KZVA 4DJFC 4RF3A 4YX9A 4TN1A 1OR8A 2QD3A 3BXZA 3JZMA 5JADA 2FRXA 1FDWA 2GK6A 4KKXB 3WI7A 4JEUA 1EM8A 1OD6A 3AOGA 4H1UA 2D62A 2C0CA 5DCYA 3N59A 1G291 4NY1A 2ZVJA 1HRDA 2MSDB 3KWFA 2CN1A 5CM2Z 3ZQ4A 4FEAA 4HRYA 1YJ5A 4X20B 3FCEA 4NDAA 3W6OA 4JBYA 5J4HA 4ZDIA 1DP4A 1U8UA 2BFDA 3DNPA 4J0FA 4KX5A 4LDNA 3VR3A 2R2GA 3LSTA 3UJ3X 1HQKA 4WKCA 2AHRA 3FDXA 4GXRA 1JHOA 4QLBA 4PS1A 4MO2A 3WB0A 4Q7LA 1DDOA 3DKPA 2YWJA 1W36C 3T3DA 3UMSA 2F7SA 3KK0A 4GUAA 3OZWA 3ZHZA 3O91A 3NV9A 4US2R 4TTJA 4WBNF 1BA2A 3A3PA 3EVZA 3C1UA 4FN4A 1YQQA 4GWKA 3IALA 3U48A 1HE5A 4TUYB 5DBGA 1SPBS 1JEDA 1USUA 1X87A 1YOBA 3EGCA 2AG6A 2AG1A 2BEJA 2XQJA 3AB7A 3ESQA 3VU8A 4PAWA 4Z9AA 2VWHA 2AOTA 4MUXA 3A9SA 1CNFA 4H4DA 2HA6A 2Y77A 5KTMA 2GEBA 1NX9A 1UMKA 2BGKA 3EQ9A 3AP3A 3OH8A 1AHHA 1JT2A 1R0XA 3SQMA 3TLZA 1TL7C 1ZJWA 4O08A 4BECA 3O90A 4YI5A 4F3TA 4Q3CA 1WW8A 1WSDA 2VHEA 2ZANA 2OP1A 2GO1A 3QHAA 1T9AA 2W00A 4OBEA 4Z8YA 3NKLA 5EP4A 3L7IA 4QOEA 2YC2C 3IVMA 1XAIA 3AGQA 4DYHA 1LDYA 2RHMA 1SH7A 1UZLA 1GNLA 1YQGA 3K8ZA 4K6CA 5ESXA 3R8CA 5A04A 2VWPA 3PGKA 1TVKB 4HBGA 4OCZA 4DMKA 1F0YA 1CNEA 4RGYA 4RLFA 3OZBA 2NUAA 3OQIB 4CF7A 4K9QA 2YRXA 1M8PA 2I66A 3K6SA 1U3GA 5HBRA 2V5VA 3CW2A 3OTIA 1XL1A 3TNJA 1U4NA 1TCBA 3OT1A 4HEQA 3EIWA 5T41A 5KMGB 4JX9A 2GF2A 2YH2A 2JJ8A 2ZT8A 4I4TF 3U39A 2PSEA 4BFWA 3NOOA 3HBJA 4Z0HO 3QBDA 1GVHA 4U1RA 4R7TA 4KXLA 2JJMA 2BM9A 4ENUA 2CCGA 3KJGA 1YJAA 1NE2A 1Z0JA 1PQWA 2JGNA 2OV4A 2ZBVA 3JWEA 1F6WA 1CQJB 3BXXA 3JYNA 3JYHA 4QECA 5ITZA 1DV1A 4EGAA 5DBOA 1LS1A 3NKFA 1IJKA 1G8AA 2ADOA 3K1YA 1JFTA 4KN9S 1VBKA 4N3NA 4ZTZB 1V3TA 4ZJUA 3MWGA 3H19A 2FE4A 3NHUA 2FPIB 1ADYA 1O6FA 1E3EA 3I5XA 1NFRA 1A5BB 1P1FA 5ALTA 4BUCA 1RKBA 2O19A 2W6ZA 4NYMR 5CR9A 2IXDA 5EUCA 4BNNA 1N2GA 2IP2A 5LDGA 5F1PA 1MJFA 1UBNA 3I92A 3QV2A 3RJMA 1PHRA 3C70A 4I08A 4WSOA 1Y98A 2X23A 1C50A 5GV7A 1M73E 4HQ6A 5J5VA 1TF5A 4D45A 4Y6RA 3S2EA 5B1EA 5TF0A 1D6JA 1K7CA 3CNHA 1WDMA 2BM1A 1X94A 2H0QA 4OH1A 5BV1A 1VOTA 1X7WB 2HT6A 1CEEA 1WZUA 3C0KA 3R20A 5B6JA 3RYHA 1WMFA 2H52A 5FLEX 5BSWA 4XOUA 2BRUC 3QOXA 3W9SA 1WNFA 2J30A 5DCWA 4EY8A 4K5QA 3X1YA 1VL0A 1PU2A 4U3JA 4XWTA 4FDMA 4DQVA 4DTIA 2HBZA 1WU7A 3VHXA 5FTWA 1LNSA 4E21A 2B30A 4CKEB 1HZJA 4JYPA 4E3ZA 5KVCA 3CG0A 1EI9A 2GPYA 1Z13A 4GGOA 3SJCA 1XI2A 4CUJA 3FGZA 3GMSA 3ABIA 4KE6A 4M0CA 1T0UA 4ZP1A 3VPHA 3ILHA 2FP3A 3QELB 2FSHA 5KQSA 2PRJA 1VHTA 1JDSA 2OBFA 1AZLA 2H2GA 2V97A 1JI3A 2XYQA 4JFAA 4Q82A 3SF0A 2WTUA 4DAEA 4ABTA 1D2GA 1J09A 3I09A 3L4BA 3QG5A 3WA6A 4XJVA 3L4KA 2ZSHA 1O6ZA 4AZ3A 5JXIA 4DR1B 1B8OA 2ZI4A 3C43A 1AK1A 4NPAA 5FOUA 3GEEA 2P4QA 3H1GA 3OM9A 4O25A 1KI1A 1FDOA 2BFFB 3JWGA 4DSAA 5K45A 2ZR0A 1BXKA 2PH1A 1VCOA 1PFQA 3M5PA 1JZQA 1CDDA 2F48A 2XE8A 5DEIA 4OP1A 4FFBB 5IAEA 1KFEB 4LYEA 5K51A 3UAWA 3PWTA 1J0XO 1N78A 2GSDA 2V7VA 4KAXA 3SZMA 3ZCVA 3C3XA 3HFJA 1QHEA 1FW8A 1FQKA 3I30X 5DMXA 3TXYA 1BKDR 2Z4TA 1WABA 3LLCA 1W0KD 2O2JA 2IEGA 2LP4Y 2W6MA 1NSFA 4ZOQI 2Q4BA 1D5CA 1K5GA 2JFVA 1XTUA 3F6RA 4HWSA 3QUCA 2YJ4A 4M3NA 2W6ID 3KHTA 4JP1A 1OB2A 3RVPA 1E7MA 3K9GA 1UBOS 3MWEB 1Z5UA 2E1PA 3BXOA 4JBLA 1AKWA 2D5AA 1QHNA 2R65A 2YWXA 5EMKA 5IVIA 1HYGA 1AHNA 3U61B 1WMAA 3STWA 5JASA 4OK3A 2OBMA 4MTCA 4PZDA 2AMFA 3DBLA 4L73A 3AFHA 4FHCA 4U63A 1GPJA 5BQPA 4MIYA 3FA2A 2BBOA 3SXPA 4F6LA 1Y8RB 1GV1A 3RG2A 5K4GA 5HRAA 4Y9TA 1SIBE 2WF7A 4BB0A 1IN4A 2VSNA 2EW2A 4OQMA 3BMNB 1I3CA 1GTG1 3AF0A 5AW0A 4HYQA 2Z04A 3ZK9A 2XUQA 5INTA 2JHGA 5DT2A 5EEHA 5EMJA 1BN7A 1EVZA 1A82A 5HKLA 1KU6A 1U2EA 1JTFA 3OX4A 3L4SO 5JSZB 4QTXA 1LCIA 1N1MA 2J9RA 4OLFA 2ZIEA 3CH6A 5LFAA 1CE8B 1SA0B 2GK7A 2CD9A 2OP0A 4WCDA 3ICWA 1P6UA 2WPDD 1UANA 2BDTA 2YMPA 2X0KA 2FLVA 1QYVA 4S0XA 1J8VA 3N7TA 3RVRA 3SX4A 3W78A 4YJGA 1F8GA 4GPTA 4EA8A 1K63A 1IYZA 4LIPD 4ENSA 2V6BA 3OX1A 4DLYA 1M2FA 3IRUA 1DTWB 2Q5CA 1J8QA 1XKTA 1DE0A 1DAFA 4Z9BA 4P0PB 1B1AA 1YKGA 1E60A 1F60A 1EBFA 1NPYA 1T6YA 2GERA 2QRVA 2UDPA 3IV9A 4OHBA 4UJ5A 3PFFA 1LVUA 2OHFA 2B1IA 3EMDA 4GRDA 3ZHUA 1M1YB 5LQNA 4JL6A 3RRNA 1BC5A 1RT9A 4OTZA 1CWUA 1Q6YA 1SQ0A 4GD3Q 3D8UA 1R66A 5EC8A 2WWIA 3VR6H 2WSMA 4HXYA 2DR3A 1VMKA 4AY3A 3HEBA 2FEOA 2X13A 5GONF 4GVPA 5DTEA 1T26A 3SYMA 4CODB 2XE4A 3MT0A 2KBFA 2XT6A 3T4EA 4YRRA 3UMFA 3E2IA 4YROA 3TFOA 3FOEC 1A9PA 1N1DA 1OGYA 3L8FA 1FFDA 4L0DA 2Q50A 1XA4A 3CUEF 2Z30A 1N2BA 2ZITA 1I6LA 3AP1A 2M6SA 4O4LF 4CV1A 2WR8A 3B1ZA 4DLBA 2JIZD 3AOEC 4DNPA 4TWZA 5CNIA 4ZHQF 4NJMB 4EG8A 5BNTA 1L3CA 4P7FA 4FFPA 1JDPA 3D81A 2HSZA 4YV1A 2BMWA 2FPXA 2X40A 4CQMD 1W5AA 3ZCUA 4R9NA 4WZ6A 2WYOA 3SEFA 1TQDA 2VO1A 2ZLBA 2IOHA 1SC6A 5K5EA 3CVUA 4ZPJA 5H68A 1KVTA 4RL6A 5ALLA 5JSFA 2RJ3A 5F21A 5J63A 2PUDA 1S2OA 3D54D 4LJSA 1FC0A 3BGWA 5EJIA 1NLUA 3O92A 4POAA 3DTVA 4KITB 1QRTA 1ULBA 1XJ0A 3QVXA 4ZI7B 1XOIA 3AG6A 3NVAA 3OJXA 4REQA 3WLLA 2O2IA 2J0UB 2H1IA 4H17A 1U5BB 4CT0A 2JLRA 3MJEA 3LKDA 4NOJA 2G04A 2OHOA 3O1HB 5CFRA 3E84A 1JZTA 3ZWAA 2PUEA 5JECA 3AUAA 2GNOA