3CEJA

Human glycogen phosphorylase (tense state) in complex with the allosteric inhibitor ave2865
Total Genus 291
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
291
sequence length
809
structure length
790
Chain Sequence
NVAELKKSFNRHLHFTLVKDRNVATTRDYYFALAHTVRDHLVGRWIRTQQHYYDKCPKRVYYLSLEFYMGRTLQNTMINLGLQNACDEAIYQLGLDIEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGIRYEYGIFNQKIRDGWQVEEADDWLRYGNPWEKSRPEFMLPVHFYGKVEHTNTGTKWIDTQVVLALPYDTPVPGYMNNTVNTMRLWSARAPDYIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAATLQDIIRRFKASKFVFDAFPDQVAIQLNDTHPALAIPELMRIFVDIEKLPWSKAWELTQKTFAYTNHTVLPEALERWPVDLVEKLLPRHLEIIYEINQKHLDRIVALFPKDVDRLRRMSLIEEEGSKRINMAHLCIVGSHAVNGVAKIHSDIVKTKVFKDFSELEPDKFQNKTNGITPRRWLLLCNPGLAELIAEKIGEDYVKDLSQLTKLHSFLGDDVFLRELAKVKQENKLKFSQFLETEYKVKINPSSMFDVQVKRIHEYKRQLLNCLHVITMYNRIKKDPKKLFVPRTVIIGGKAAPGYHMAKMIIKLITSVADVVNNDPMVGSKLKVIFLENYRVSLAEKVIPATDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIDDVAALDKKGYEAKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFYHDRFKVFADYEAYVKCQDKVSQLYMNPKAWNTMVLKNIAASGKFSSDRTIKEYAQNIWNVEPSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glycogen phosphorylase, liver form
publication title Thermodynamic characterization of allosteric glycogen phosphorylase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 291
structure length 790
sequence length 809
chains with identical sequence B
ec nomenclature ec 2.4.1.1: Glycogen phosphorylase.
pdb deposition date 2008-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00343 Phosphorylase Carbohydrate phosphorylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3cejA02
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3cejA01
1JIUA 2QRQA 1B4DA 4FZRA 1PSWA 1FTWA 3EBOA 1BX3A 4EKEA 3HBFA 3T3GA 4EJ2A 1XL1A 4X7RA 4N3CA 1XKXA 1F0KA 1K06A 3RT1A 4AN4A 3CX4A 3OT5A 1L5QA 3VDMA 2QLNA 3CV3A 3G2LA 1P4GA 3MTDA 3E3NA 3OTIA 1JEJA 3OTHA 2SKEA 4PQGA 2X0DA 1C50A 1RZUA 3G2KA 2G9UA 2G9VA 2BFWA 2PQ6A 1FC0A 2PYDA 4QLBA 3MQFA 3S29A 2ATIA 1RRVA 2IW1A 2ACVA 2WTXA 4EKYA 3MTAA 2F3UA 5DU2A 1GPYA 1J39A 1NZFA 2X0FA 3T3EA 1YGPA 1AHPA 5IKPA 1C8KA 4BQIA 4RIEA 2GPNA 3C4VA 2X6RA 2G9RA 4RIGA 1JIXA 4AMGA 4LEIA 3L79A 2XA9A 4M60A 4KQ2A 3QKWA 2VG8A 2ECPA 1JG7A 1FTQA 1UQUA 4CTMA 1IXYA 1NVKA 3L7BA 1Z8DA 3Q3IA 1XL0A 3NB0A 4GPBA 4RIFA 2YJNA 3HBJA 3CUTA 1P4HA 1PN3A 1GPBA 1NOIA 3COPA 3HBNA 2KS6A 3DZCA 3IA7A 1GZ5A 1GFZA 1GGNA 2ASVA 2QN7A 3Q3HA 3ZCPA 4X7MA 3OY2A 3CEJA 4AY6A 3MS2A 2X6QA 4N9WA 2GEKA 1Z62A 2GEJA 1EM6A 4AY5A 4N39A 2QRHA 3L7CA 4X7PA 2F3QA 2HY7A 1FU4A 2QN3A 1QM5A 2JLBA 2QRMA 4BQFA 1ABBA 4RENA 2GT1A 3D1JA 1NOKA 1C3JA 3EBPA 2ZB2A 3VDNB 5TVGA 3L7DA 1GG8A 1P4JA 4XIFA 3OKCA 4CTNA 3QHPA 4WHMA 1K08A 3T7DA 2AMVA 5C1DA 2IUYA 2C1ZA 2JZCA 1LWNA 2XA1A 2C9ZA 3VUFA 3VUEA 2QN8A 3WC4A 2XMPA 5TMEA 1O6CA 1XC7A 2PRJA 1FS4A 1E4OA 9GPBA 2GM9A 2FFRA 2QLMA 1A8IA 2XGOA 3WADA 4MRAA 2R66A 4MICA 2BGUA 1JG6A 4MI3A 4EL0A 2BISA 3GPBA 4YUAA 1WV1A 2BGTA 3BDAA 3PE4A 5ENZA 4WACA 1RZVA 3BD8A 1L5RA 4CTOA 3L01A 1KTIA 1PYGA 3ZCTA 1SXPA 2VCHA 3AMVA 5I45A 3E3OA 3G2HA 4MHSA 1Y6GA 1WV0A 4N3BA 2VSNA 3OKPA 3OY7A 4AMBA 3T3HA 1NOJA 4RBNA 4KQ1A 3UYLA 7GPBA 3MBOA 3MTBA 1V4VA 4MHOA 5HXAA 2O6LA 4YI5A 3MS7A 3MRTA 2XCIA 4GZ5A 1PNVA 3BCRA 1YA6A 3S2UA 5GPBA 3E3LA 3UYKA 3G2JA 3S27A 4G2TA 1FTYA 2IEIA 2XGMA 3BCUA 1AXRA 2PRIA 4BFCA 3T5TA 3BCSA 3IAAA 1L6IA 3MRXA 4WADA 4GYWA 6GPBA 3WAGA 2FETA 3CUWA 1P2GA 1UQTA 4XI9A 3DDWA 2H1FA 3TAXA 2AZDA 3H4IA 3BD7A 3S0JA 3SYRA 1L7XA 4EL5A 3ZCRA 3GUHA 1FU8A 3DDSA 1WUYA 1Y6FA 1Y8ZA 5DXFA 3SYMA 4N3AA 3NPAA 5LQDA 3NC4A 3C4QA 4HLNA 3S28A 1L5VA 3MS4A 1XOIA 3OTGA 2Q6VA 2IV7A 2F9FA 2SKCA 5BNWA 3MSCA 2QNBA 4GYYA 2G9QA 8GPBA 2F3SA 4BQEA 2R4UA 1WUTA 4MI6A 1SXQA 2VCEA 5JTTA 2QN2A 3T3DA 3FROA 3H4TA 5TMBA 3G2NA 2QN1A 4YI3A 4F96A 2FF5A 4HWGA 1EXVA 3RHZA 1JIVA 3ZCUA 2C1XA 3RSCA 2IEGA 1GPAA 2C4MA 2H1HA 3D0QA 1WW3A 1Z6QA 2GPAA 1L5SA 3D0RA 3CUVA 3CEMA 1LWOA 3NP9A 2QRGA 2IV3A 1L5WA 1E1YA 1HLFA 1XV5A 4NC9A 4F97A 3NCHA 2R4TA 4FKZA 1WW2A 3T3IA 4NEQA 3NP7A 2OFFA 3RSZA 5DLDA 3ZCVA 3L7AA 3MT8A 1FU7A 3DD1A 2AW3A 2R68A 2GJ4A 4M7PA 2GPBA 3G2IA 2R60A 4RIHA 4RIIA 3HBMA 3Q3EA 2IYAA 1F6DA 1Z6PA 5D00A 1QKJA 5D01A 1NLMA 3CUUA 2X0EA 4W6QA 1NZDA 3MRVA 1IIRA 2AV6A 1H5UA 3OKAA 4REMA 2XCUA 3MT7A 2QLLA 3BD6A 4M83A 2SKDA 2QN9A 2VSYA 4F9FA 3CEHA 2JJMA 4LDPA 4RELA 4X6LA 1FA9A 4NESA 2PYIA 1P29A 2QZSA 4MI9A 4KQMA 2P6PA 1VGVA 2XGSA 2IYFA 3C48A 5JTUA 3O3CA 4GZ3A 5TMDA 1P2DA 3NAZA 3ZCQA 1P2BA 3PE3A 4Z5XA 4GZ6A 3TOVA 3TSAA 3BEOA 2XA2A 2ACWA 2QRPA 4L22A 1M5RA 1C8LA 3CUYA 4CDRA 3ZCSA 3MT9A 1UZUA 5IKOA 2F3PA
chains in the Genus database with same CATH superfamily
2QU7A 3TZEA 1MAVA 2YZNA 4IQ4A 2QPAA 3HCWA 1FJGB 2ZYGA 4R1TA 3HDQA 1OV4A 2Q6KA 5KUTA 3HJFA 1L4MA 2VSQA 4BKQA 1EA5A 1JDBC 3FOZA 1YUBA 2QROA 3IKJA 1KVQA 1V5EA 2CXPA 3F5DA 4FCCA 3FMOB 2DWUA 4I5DA 1RAIA 4Y2PA 5ARDA 3ZXIA 3GJ5A 1I4OA 3Q8WA 5A06A 4PO1A 3WLRA 1GEEA 4DY4A 5JEEA 4GVXA 1R88A 4BMXA 4CMJA 5F3DA 3MERA 3L8YA 3TQFA 3UH0A 1GPJA 4IOJA 4I50A 5FP0A 4TXHA 1MG5A 4QU0A 3AERB 1TJ3A 2UZIR 2RCYA 3HV0A 4HDMB 4XXHA 1OI3A 3V32A 4QTTB 1UDXA 2RHWA 4G89A 1MV5A 2YS7A 4Y6RA 2RIPA 1GCUA 2H07A 1PS0A 3E7FA 3EZFA 2IW3A 5M2QA 2C9OA 3TWOA 1OILA 4N7JA 4BMDA 1EEXB 3WKCA 4D46A 3JALA 1WPXA 1Z6YA 2FUCA 5FFFA 4CM8A 3QX7A 4XX1A 1RZUA 2QVLA 3KOOA 5LBUA 2R96A 1AKUA 3LY8A 1PNQA 1GU1A 2XZTA 1WE2A 3Q3CA 3Q5DA 4AX4A 1OASA 1QP8A 2PCLA 3AHGA 3IILA 5JSFA 1JR6A 3AHJA 3MJVA 4ENPA 1PR2A 3TTSA 4BGEA 4ZRDA 1CVLA 2BLLA 1ZA1A 1U90A 3IMGA 5EZYF 5AKIA 3RRJA 2HBYA 4MPJA 4US2R 5I4IA 3MTAA 1QTIA 2AKAB 4RMHA 4M8NE 1DKUA 4EEZA 4OL9A 5AJHA 1IE3A 1WU8A 4UU1A 1Y8AA 2SICE 2IYZA 1RLIA 3C74A 5EY5B 2GVZC 2XNCA 1THGA 1XLVA 2BTQA 4E6PA 4X66B 2QGZA 1E3DA 3PYXA 4EO9A 1DC8A 2O5RA 2ZIAA 3N0TA 4HX9A 3AEKB 4QPPA 5ILGA 4LYYA 3HWWA 5FPKA 2TMGA 5IUNC 3TEFA 4GP9A 3IVCA 4MS3B 4CGZA 3KKMA 1X0VA 1SHLA 2WWVD 1RADA 3EXG2 1PDOA 4JSTA 2HRZA 2GN4A 5DP2A 2F55A 4OMCA 3A6LA 3IS3A 3NANA 2OP0A 5J5VA 4NBKA 4RJLA 3TOSA 3AFNA 1LDBA 4ZOLA 1AT1A 1KEZA 4KCGA 1P1RA 4GH5A 2E4YA 1BE8A 3LRTA 1N5IA 2O8DB 4D9IA 1IXYA 3IALA 4BC0A 2GNAA 1EXMA 5KNLA 1Q7GA 1N0UA 1P5ZB 3WBFA 1XA0A 4LUCA 4S1NA 3UK7A 4F2GA 3P45A 5EQTA 2D3WA 4H6WA 5B7NA 2HW8A 3DKIA 2I7XA 5GTDA 1UBFA 3WK6A 2QAIA 3M6VA 2J0EA 1S3FA 2JH3A 4R31A 2J9RA 4P98A 1YUMA 1DX4A 3U48A 3AJ8A 1B0ZA 1WCV1 5AI9A 5C37A 2R2AA 1X7HA 2KS6A 5J4VA 3LTEA 3QFFA 2PUBA 3LO5A 4DR4B 1M34E 4XRRA 4CTKA 1PT8A 3CLVA 3HXLA 2AYYA 5D5HA 4IMRA 1Y7IA 4Q5IA 4BBAA 1G8SA 2O4UX 3LPAA 2NXJA 5CT4A 5DHSA 4DL9A 3AEUB 2WM9B 2GWRA 2XQVA 3OCWA 4ZVPA 3T1VA 2A78A 5EIFA 1SK8A 2YRXA 3KEQA 1FRQA 1SXJB 1XDUA 1GQSA 1U0NA 3FRIA 3I12A 2O8EB 1GWNA 5FADA 1DAFA 4Y0VA 2ZR7A 3REGA 2AS0A 2RK4A 4HYQA 5FIUA 1L2TA 2GEKA 1Z62A 1BS9A 2OHFA 3JTEA 4QZVA 2FWJA 2DC1A 1YFKA 5DSXA 3SDBA 3TDKA 2VH1A 3BEDA 2QSUA 1ZQ9A 5KB3A 5BQ3A 2R5FA 2REBA 1I2DA 1H8HA 4OREX 5E6UA 3DMDA 4KIUA 2DPXA 5COAA 1XNQB 4MW2A 1TU0A 3LDUA 5F21A 5AK6A 2JLCA 3VR2D 4ETMA 3WRXC 1B16A 2DETA 1ABBA 1P1KA 3WLSA 2O7QA 3F3YA 4I5EA 3TBFA 4DGQA 5A4KA 1I10A 5I01A 1JVNA 1KRWA 2VA8A 4GE3A 4BNIA 3V9AA 4F7WA 5IM4A 1K8XB 1G6KA 2B21A 1G66A 2AOWA 2VP5A 2APJA 3AK4A 2QUKA 3QW2A 1VLVA 2G0NA 4FT4A 4JLMA 4PNPA 7ABPA 5TVGA 2HDHA 5DBFA 2FK7A 4QASA 3TRHA 3UUGA 4HLUA 4IRXA 2QP3A 1DP4A 3F1KA 5DYYA 3HI6A 1CZKA 4NABA 1WY5A 4ARZB 3A9UA 3V2IA 3QHPA 3LP5A 1PP4A 5MGNA 4E51A 2KWIA 4U2FA 1K08A 3ZHUA 2OZLA 1DVRA 2FPMA 3O4GA 1ULBA 3W4KA 5JDCA 3T7TA 1JA0A 3PQFA 2OCAA 2AMVA 4XX0B 1L1RA 3DT8A 4K9LA 3TM5A 3WL7A 3TECE 2A59A 1KJ8A 2DCUA 4UXHA 1AUOA 3GLGE 2J3IA 1FJHA 1C4XA 3WQQA 3RTCA 2C2YA 3RBXA 4HWPA 4RKFA 1KO7A 1U0OC 3WC4A 2D2EA 4ZQCB 4DNFA 5GJVC 1ZHOA 2EGUA 2OZEA 4H3HB 3LV8A 3U7HB 1GM5A 1M8JA 1W44A 1ZNQO 1SKUA 4OYYA 1XN1A 4MGZR 4QYMA 2AEEA 3MMZA 1E4OA 1H42A 3OOSA 1NUQA 3E3AA 1A4RA 1IZ8A 2HSZA 4AZ0B 5T6MA 4W8HA 1CUUA 5D3ZA 2OG2A 2IPXA 1OJ7A 2JJ2D 1GTMA 3S2EA 3VO9A 5KYKA 5LL6P 3UN1A 3ZZNA 3AHFA 1NA5A 1QYWA 3CRNA 4MICA 4LY0A 4P35A 2XCLA 4Q3AA 4Q37A 5CLJA 1ST3A 1U7XA 4BNGA 5A5EA 4BNMA 4XVUA 4DQUA 5E3IA 3CM0A 1I2BA 1UKVY 4KQEA 4EEKA 5H4HA 1KC1A 2B2NA 2G7ZA 5B2ZA 4G4JA 4JYZA 2P2ZA 1A5TA 2OY0A 4KK4A 3ET5A 2P62A 4HV4A 5AM0A 3PGJA 3U7QB 3CURA 4GLOA 4NHOA 4TMVA 2XUGA 2OR3A 4HQLA 3SQMA 3PUWA 4MHSA 5ILOA 4OLHA 2Q8QA 1HF3A 4FOOA 3JQ8B 3OPVA 3K0AB 3DC2A 3GWGA 1K75A 1Y6GA 2R11A 3O38A 3ZE9A 2IEDA 1TM2A 1SELA 3V4ZA 3I6QA 4LXIA 4AMBA 5C5DA 3C3MA 1SXJD 4DJDC 3LP8A 5KOHB 4TPKA 5A0FA 5LD2B 5JFGA 3QKIA 4BBPA 3FAZA 2J1LA 2EG9A 1P3Y1 2OZVA 5JISA 1CNMA 4P4GA 3TUZC 2CNOA 4RESA 4C4XA 3WS7A 3PU6A 1Y9JA 2ZG6A 1II0A 1PTJA 2R8ZA 3DBLB 1OZAA 2EWWA 4HNVA 3WP0A 1KY4A 1JVBA 1NVTA 3QKUA 1ST2A 1QQ7A 5K6TA 1QV6A 4JLAA 1H2HA 2V9ZA 4PHCA 3PGMA 2DBQA 1MQ8B 1ZM7A 4IKEA 4UE6A 3SJUA 3VR6H 3Q6MA 1E3WA 3QVWA 3FYTA 4MGKR 2KQUA 4V0ME 1IQUA 2NTNA 3E7WA 3OM0A 5LQKA 4C0LA 4Q4AB 3M82A 1ENOA 4HADA 2A0XA 1P75A 1ZRNA 1XZDA 2PZEA 3KETA 3NYQA 2W43A 1E2HA 2Z56A 3EDMA 4F46A 1WDLA 1T8SA 5C32A 3ETLA 1GUDA 1Q7RA 4IDNA 2CVFA 5I8WA 4IFIA 3FGNA 4C4ZA 4UBNA 4Y2VA 3AT1A 5JS2A 5BV2P 1WMFA 3QKRA 2AR9A 1U02A 2KX7A 1RTTA 2F6RA 3C6ZA 2XIQA 2ZIXA 3CUKA 3JVIA 3PFCA 4PRKA 4PR0A 1N6KA 4S2EA 2A0WA 1ADCA 3GLFE 3S0JA 3OU2A 5HCNA 1HTWA 1TKRA 2WSYB 1NXWA 2G7MC 3B6KA 3NO4A 4LJ5A 4X84A 5B1SA 3CPHA 3PCTA 4EL5A 1P8AA 2F1HA 2JIDA 3WXMA 4CCYB 4HNAB 2UKDA 5IAGA 2W2XA 3JYNA 1Y6FA 2EZTA 1E1DA 5EQJB 3WLTA 6AT1A 1X7YA 4M1TA 1CY0A 1H65A 1ZJZA 2HV9A 2PL9A 3FUVA 3I2FA 2OOKA 4JB2A 3NPAA 1MB3A 4LQCA 4NV0A 4DMKA 5JH7B 5BYKA 5ECWA 4D0SA 1HQCA 1K86A 3IDFA 4M55A 4HLNA 4ZAVA 1NKVA 4GOLD 2Q0HA 2PSFA 5F51A 3UNXA 5FD8A 4LF9B 2RK3A 3I52A 2EWMA 1Q3TA 1VLMA 3DONA 1EK0A 2IV7A 2IODA 2WWHA 4WCFB 1X39A 3SX0A 2I29A 1EVYA 2GSDA 4GYYA 1DCFA 2EG5A 5FL3A 1BX0A 1KOLA 4OXNA 2DR3A 4H7IA 5DEIA 2DHCA 5EKTA 1G38A 3C5CA 4DLRA 4BQEA 2VIIA 3R7BA 1Q50A 2A67A 2XNKA 3MPUA 5C1IA 3WIOA 4EITA 2PVCA 5JTTA 4G0XA 4O2LA 2DUNA 1XE3A 4NOJA 2CNLA 2JLXA 3AYZB 4NBRA 4C7OB 1DRWA 1JPJA 1YONA 2QSJA 1UBSB 3EVTA 5B3JA 3J7AC 1EFRA 1X14A 3EA4A 2GX6A 3W9YA 3URKA 4EY7A 3QYFA 4KTVE 1UF9A 1SKMA 1XZBA 2BBSA 3BSFA 5BP7A 2Q4BA 2XB2A 1R8YA 2YYAA 4RTSA 4EB8A 4HVTA 2WTEA 1HNWB 3UWMA 3OZSA 1FLNA 4HDQB 3GP3A 1BX1A 3EIXA 4P31A 5EJ9A 4EA7A 4MS1A 2FW8A 2A1UA 1X7GA 2OL4A 4YJGA 4QARA 4B32A 4G5GA 1B42A 1BQ3A 1ECFA 1TK3A 3K2QA 3RIXA 5BVHB 5A71A 4OA5A 3UWPA 1UMCB 1YRBA 4ZQHA 3FHCB 3RSCA 3RKSA 1O94C 4U00A 3Q1KA 1WL8A 3HYSA 4Z3DA 1ZJ4A 1GXSA 2F48A 4NS1A 5E1DA 5TR9A 2BZ0A 3JQ9A 5LU8A 3WKEA 1HL7A 3NIGB 2G8LA 2JIOA 4JBGA 3H9UA 3RVNA 1E3QA 3MWFA 2XNJA 1TCVA 1KYYA 2G0AA 2EFDB 1E9RA 4EQ6A 2XRZA 4PF1A 1EDZA 5F2NA 2RGUA 4Q9AA 2G0TA 3BB3A 5ARCA 2JCGA 1UBHS 3OQ6A 4M0LA 4RDCA 3UG6A 1XV5A 4KE9A 3I6IA 4RHXA 3WRVA 3F6CA 3Q0TA 3T9DA 4K8RB 4N4AA 4D0RA 2AKEA 2CKMA 1I0IA 4QXMA 1N1DA 5KNCD 4TYWA 3VU9B 4AMUA 4E2WA 1IY0A 2OYSA 3HB1A 2BFNA 1GGVA 3OUUA 1YOVA 1LF0A 5F9MA 4XWWA 4C2TA 3ZH9B 3H1PA 3N8KA 3N75A 4JLWA 3C8HA 3WVNA 1MG0A 2FU5C 4H9GA 2OHXA 1H2AS 5FKJA 5AFSA 5HOQA 3KUDA 2QGNA 3RFXA 3HU5A 3OQIA 2GVDC 3PC2A 2QA5A 4L76A 4UOQA 2FLVA 1G60A 4UCXA 1OIVA 4RZIA 4X60A 3VM6A 2FPIA 2GWHA 3BRCA 3UXHA 3IVXA 1TU3A 5AJXA 1T9BA 1RM3A 4TZ6A 4Z4EA 1JJAA 3S44A 4K87A 2UZ1A 2YCBA 1ZH4A 2ONZA 4WFIA 5E9WA 5JZSA 4GOMD 3KB1A 4NG5A 1EFPA 4B44A 2DEUA 2HK8A 2NYAA 2WTMA 3GT4A 5FWNA 3ZWNA 4RK4A 2I6FA 3JQAA 2ZRKA 1NQ5A 2RHDA 3K30A 3MPOA 3T34A 3ZG6A 4AS3A 4E1VA 5CB6A 4IJVA 1XCPA 2ZRLA 2XUKA 5HIIA 3HXTA 4QLAA 1QB7A 2HYDA 5DOVA 4AQYB 5IH3A 1BO6A 1NBMA 3TW0A 3WWDA 4OHCA 4GHWA 1ZK4A 4TRMA 1PEYA 1A1SA 3FAKA 1MJ5A 4PLWA 5TARA 3HB4X 4R0MA 1VG8A 2BF4A 3PV0A 3KWFA 3GYBA 5JQWA 2G1PA 3RRZA 2BKLA 1YB2A 3HDHA 5KPJA 1ZIPA 2ZUWA 4TS4A 2CYCA 4IH9A 4I4TF 1SK9A 2HZBA 2JBHA 4OHXA 4ZOCA 2IGTA 5IDXA 4YRQA 3FMPB 2QN9A 3DHEA 1R8QA 4NL4H 4PU0A 4GMKA 5EMHA 1X7XB 2FVXA 3CEHA 3EY9A 5J3JA 1FFBA 4J0QA 4UVDA 4MRVA 4JLVA 6ABPA 2V7TA 1XAIA 4FZ3A 4MKFA 3DS8A 3EA5A 4WNYA 3C7CB 3MIZA 3P0EA 5CX1B 1IXSB 2PYIA 4XVQA 2ST1A 5J2TB 3NAMA 1DINA 4RX1A 4EKNB 3UO8B 4HPWA 2ZUDA 2OO5C 3G9TA 1TMKA 1TX4B 4YJ3A 3OEHA 3LUDA 4PVDA 4ZO9A 1M54A 4E46A 1AJEA 3W5BA 1CUIA 1PR9A 4UDOA 2CDNA 3VYWA 2HF9A 5KKNB 1QV9A 4XYMA 5A7GA 2F7SA 1T2VA 4MB6A 3WYDA 2ZB7A 1GGKA 3HFSA 1RM5A 2EX4A 1K0UA 4CT5A 5JBIA 3KVOA 4IIJA 1K9SA 1Y34E 3DD5A 3EWSA 4UU0A 3KE9A 3QBEA 2X3UA 3K9NA 3L7YA 4Q00A 5G2OA 2ORYA 3I9OA 1Y1SA 2I76A 3PSAA 4BO6A 2R6AA 3O1LA 3O03A 5HM6A 2WBLC 1N8SA 3QI2A 3RC3A 3RSGA 1C0KA 2QTBA 4GM1A 4Y9UA 4R2WA 3GAAA 4WESA 1E3LA 4YPOA 1DXQA 3OP4A 2G9ZA 1F8GA 1KK0A 1ZCFA 4MP3A 5F35A 2EJWA 1XXHB 5CYOA 2IZ5A 3FPCA 1WG8A 2JJ8A 4NG4A 5FUVA 4A16A 3IEIA 4NFSA 4QXOA 3VU8A 3EPLA 4M36A 3ABSB 5INTA 2JGRA 3KUCA 4FJ2A 1ZZEA 2IHYA 1GV0A 1BROA 1U9IC 1VHQA 3CIOA 1LLQA 3ROGA 1NU8A 3GRYA 5KYXB 4BPRA 3ZXSA 4KMRA 2XITA 1SKBA 5ALEA 3AR9A 4CKYA 4FINA 1YCFA 3HVRA 2HJSA 3B20A 3HKCA 4AG6A 4B74A 3FUXA 4TRJA 4BYMA 2R6GA 5EE5B 3HY4A 4OMFG 3ZXXA 5EJ5A 2DB3A 4X7RA 4FK8A 2HL6A 1UUFA 3NW9A 1AA9A 2RGNA 4GG1A 3V1YA 3K9FC 2CVOA 4LGMA 4ROTA 3LW8A 4D0GA 1X1BA 2C5BA 4PHGA 5I9BA 2YY5A 2J0QA 4Y1RB 2QD2A 3VNSA 2CYBA 2FJPA 2XLBA 4LISA 2VTBA 2VCYA 4NHEA 4RDIA 1HFKA 4J7UA 4UFOA 3T7AA 4CT0A 4AAYA 1ESNA 1ZN8A 2HU7A 1YFZA 1IXRC 4CIXA 4OKSA 1CUBA 2RGCA 1EBFA 4A4DA 5EJGA 2OCDA 1QHXA 3F6EX 3LC7O 3LF2A 3G0IA 3O1HB 1O89A 4Q4JB 2HMTA 3FDJA 2X1HA 3M6AA 3ZVLA 1ZJWA 3UH1A 3DTVB 3AM5A 4AIRA 2WB2A 3MK31 4ZEXA 3PEYA 3H5OA 4G5FA 4O33A 2R2GA 4PQGA 1SHZA 3I30X 1TQDA 4WOJA 5KTMA 2O19A 1Z5WA 4DMRA 5JWRA 1JH9A 1U0JA 2DMRA 3ESBA 3I4LA 1FMLA 2NVUA 4TQGA 2PQ6A 1FC0A 2FWMX 4UOZA 3NTXA 2PZBA 4LV6A 3E5NA 4NBUA 3EVEA 2V7QD 2RGRA 4QFDA 2B8JA 1D07A 2PUEA 3UJ7A 4YGYA 2GO7A 3K0FB 3I64A 3WQHA 4JL6A 5K3OA 1KE2A 3CVJA 2B34A 4GZMA 1XEWX 3NVDA 3ZGVA 3I5YA 2IU6A 3BRSA 2ZSKA 1QHNA 2NO5A 3K9GA 4YLGA 2W6ID 1Z15A 4OGLA 1Z39A 3IVAA 2C4WA 2HWWA 3PVSA 4IOMA 1GUBA 1G6HA 3HYTA 1ZEJA 1USWA 2GS9A 3L1UA 5GZ1A 2VN8A 1RWPA 2QYOA 5DEOA 2JASA 4GPEA 2D59A 4PZ9A 1YS9A 1Z45A 2NVOA 3UUFA 4OAOA 3D2BA 4PC6A 4B73A 2BR3A 3AEQB 3BAFA 3NV9A 4FYJA 4DRXA 4EGFA 4YRAA 5B4VA 1VXOA 2NUTA 1KWGA 3S2ZA 3GLIB 4D45A 2XMSA 3COJA 3JZAA 4LXUA 5JDIA 1L4UA 4GL4A 4A0HA 1IBMB 3D3JA 4TT3A 1JG7A 1EE9A 1LTQA 2NTVA 3N70A 4HYYA 2NO9A 1IN6A 2QENA 2XUDA 3QWHA 5AVZA 3UPTA 1N75A 2BM9A 2VPWA 2ZXEA 3GUCA 1VCIA 4PQEA 3SI7A 4D4JA 3ELDA 1Z8DA 1OXTA 1ZPDA 4KWIA 1P5HA 2X0NA 9LDTA 1UEIA 3NB0A 1DRUA 1E9VA 3PKJA 3DTYA 2Q3FA 2VYVD 2FW7A 2QSYA 4PWZA 3D64A 1E63A 4X8MA 3CUTA 1YS2X 2QTZA 3QNMA 2HA0A 5I9TA 1HE2A 4M7WA 4FWIB 2QTRA 4KXNA 5AKYA 3M2TA 1E9DA 4J3FA 2WIAA 1N57A 3M8KA 4U02A 5HEKA 1PE0A 5A4DA 1J5EB 1IBKB 4ACAA 2AG6A 1UXKA 2AFHE 3RJ9A 2BT4A 4RH1A 2OV8A 4W5OA 4MGYR 3THOA 3MVEA 5CITA 4WZZA 3JW8A 4N8SA 2JFHA 4R1NA 4EO4A 1E7SA 1TMGE 3D8RA 3E9EA 1UJBA 1W4RA 3HFRA 1N4AA 4BMYA 2XZLA 5FOTA 2RGWA 1EX1A 1LNQA 3IDOA 4FDAA 2P0AA 2OB2A 1IATA 5WRFA 5JV5A 2RAFA 3PI6A 3A7DA 4ZMSA 5L51A 2EU8A 5BUCA 2QN3A 4LSGA 2OT3B 1TLFA 2QRMA 1IJFA 2OXTA 2VP2A 1RRMA 4CKEB 4OBXA 3U3OA 2CWWA 1M2KA 1HY3A 3DTVD 3VPAA 5HQ3A 4TKUA 4ALIA 5CFLA 3HVJA 3PUHA 3BFVA 4QVIA 1MOSA 1NOKA 4XSVA 4YCLA 3M6UA 3TLJA 5CIQA 5I7AA 3UB3A 1NDUA 1GZ6A 1EJ2A 2VLIA 1JDVA 1GNRA 1TLTA 3LBIA 3QBDA 4JX9A 3KHSA 5D3MB 1U5AA 4PCVA 1UXJA 3OKCA 4TWAA 4YBZA 2X15A 1AF7A 3B1YA 4YPVA 1HK7A 1JQKA 3K53A 4IDHA 1QK3A 3OF3A 3CZQA 3T7DA 1P5RA 1D4OA 1K88A 3EWIA 4QGHA 1E2DA 4KBGA 1CY6A 3PNPA 3PUKA 3WSTA 1E2LA 3R3XA 1G63A 1DV1A 1CLUA 3QH4A 2AOTB 2WIKA 2HH9A 1ZKMA 4MQEB 2V6JA 1Z2DA 2OGSA 3QF4B 5DTQA 3G8DA 4Y67A 3UAXA 4AK9A 3BMXA 3U5ZB 2JAWA 2RCNA 2WYHA 4NYIQ 1O6CA 3UWKA 3ZQ6A 3GFGA 3QBVA 1T9KA 3EPRA 5ICGA 4XFJA 3LHDA 5LCXA 4YFVA 3PICA 1Y6JA 3E27A 3GZNA 2JI6A 4GLFA 4A5SA 4BNUA 2EX0A 4W63A 4UEOA 3SEFA 5IVPA 1RQ7A 3IOBA 4RY9A 3ROQA 1E64A 4JU9A 2XGOA 3VYUB 1WDMA 3QKSB 5C7YA 4OJQA 4XZ3A 4KO4S 1C3EA 3LQRA 1JHMA 3G1UA 3WLLA 2O8FA 3O2JA 1XMQB 4QDKA 3WSVA 4OM8A 1YC2A 3NOVA 4J0DA 1MH1A 1JHXA 4IYJA 2EYUA 1WXXA 1SVWA 4J6FA 1U1EA 2YV1A 5FBZA 1C9MA 1L5RA 2CE2X 2V55B 4LJ6A 4DMHA 3QQ5A 4NK5A 2XJ4A 3Q6IA 5GMOA 4IF4A 1H2BA 2PJUA 1GNLA 1LTKA 3RVMA 2Q21A 3UUEA 2WWWA 3X1YA 1PWEA 1WV0A 5J5AA 1Z36A 3IIEA 1P4RA 2ZDHA 1XVUA 3BBLA 1HRKA 3I4FA 4K2AA 4QQKA 4JX8A 1YTLA 3P9IA 3OPYA 3M3DA 2YYZA 5KCMA 1ZD1A 2QM3A 4N6NA 1RPZA 1CEXA 1UIRA 1VI2A 3VPSA 2H5JA 1QE0A 5C18A 2FG7C 3I05A 1YAJA 5EIBD 2IHTA 4ZCQA 4AYTA 4ZAZA 4CKWB 1D7AA 4EDHA 1Y9EA 1DKNA 3FX2A 4GZ5A 4NJEB 3DMNA 3UGTA 1VMIA 4S1TA 3B5JA 5B6IA 3U09A 3VTKA 5JT1A 4O2AA 4WN9B 3BK1A 4ARCA 1MPXA 3OG9A 5I3ZA 3C41J 3BS4A 3IESA 1CX9B 4M0MA 1SUEA 4WVFA 1C3OB 3HDYA 5LU9A 1V7PC 2VJCA 3LBNA 3PNVA 1A8SA 4B7AA 1MGPA 4QJ4A 2A6PA 2IEIA 4EY8A 2P5TB 3ZVMA 1L3CA 3U6KA 5KQRA 2WZCA 3NDPA 2Q07A 1V16A 1VSVA 4DXAA 1J07A 4LIPD 1TZ2A 4CKCA 4MQ6A 4IO0A 4MWOA 4EG4A 4IIYA 1CU1A 2ATVA 1YZTA 1Q22A 1XCBA 1HT1E 1EHIA 2ATEA 4GYWA 2C4UA 1GSHA 1IN8A 2J0UA 4UTZA 1SVUA 2IKQA 3SIWA 3A4YA 1W5EA 3KWMA 2Q3LA 1C9KA 2CDCA 4JBLA 1GFWA 3AY6A 3NBQA 4K28A 4LJ8A 5DHTA 1AKRA 2VJYA 5K3BA 3VKVA 3H9BA 3GMIA 3T4EA 2P77A 2WMOB 3K2BA 4R9NA 2C98A 1TCAA 4MO2A 1T26A 4N5MA 2GCOA 2TS1A 2D8AA 8ADHA 2L19A 2NYRA 2VOEA 3EZ6A 2R1VA 3ACDA 3EDRA 1PUIA 5TNXA 4RD6A 4F38A 1WMSA 3KYBA 1ZJJA 4LNAA 2ZI3A 4JP2A 5C51B 4IWYA 1RI3A 2BYTA 5I9NA 3D3KA 3LFTA 2WQ6A 3K9CA 3R3WA 2FPGB 4LHXA 3UMVA 5F5NA 4L3WA 4WQMA 2NU9B 3GBPA 2QTNA 1ZD8A 3ZIAD 3UB4A 3CGWA 1Z4JA 3PFHA 3R3SA 4GU5A 5KHLB 2BJHA 3PIIA 3SHTA 4G1EB 4FW9A 1FX1A 2Z8YM 3EULA 4KZPA 2EIHA 3OTGA 4P58A 4Q7KA 4X8OA 4BYGA 3LX4A 4MGHA 1SEVA 1OXVA 3PC8C 1XNJA 4D57A 4AJNA 1JAYA 1FF9A 2QR2A 3GH3A 2GOYA 4NMMA 1OPRA 1T1EA 2BFCA 4KQ6A 2IOHA 3P5BA 2F3SA 3NRCA 4L6CA 3H2ZA 4DANA 3THWB 4FC6A 1T3LA 5FUQA 1S2IA 1ADBA 1N6LA 3ONVA 3TD9A 2VT6A 5IEJA 2AN3A 4L72A 1E96A 2VCEA 1ZRMA 2R6CA 2VQFB 2P2GA 4GR5A 1EVLA 1DJPA 3FROA 4BX3A 1KR2A 1FVFA 1C0PA 1GKIA 2E4AA 2I34A 2UVPB 2FWAA 1GITA 2V98A 4IIFA 4MWZA 3D7LA 2JLQA 1UFKA 2ZTUA 3KJNA 3L0SA 3A4MA 3RGWS 4C3ZA 3TQHA 2ZZNA 3E82A 3SVLA 1Z0ZA 2J5BA 4GP7A 5K0NA 1HLDA 2CLHB 2P6UA 4ZYYA 5C8ZA 1HDIA 1TNDA 2XYRA 4K9OA 2GHIA 3K70D 1BWRA 2O20A 2W98A 3LCUA 3V6MA 4UUQA 3WK8A 3U44A 1YQWA 2ORVA 3EIQA 3RK4A 4ENUA 5LWQA 1I4WA 3PQEA 2GPYA 3ZBTA 2V96A 3ZZ1A 1WVGA 2H06A 5M29A 1EVEA 2CXTA 1WW3A 2DBZA 3MZ0A 2I7TA 3SYKA 2GYVA 1OR8A 1ZM2A 1TQHA 3IKMB 2IOFK 2V45A 5B30A 1GZ4A 3FZQA 3GVCA 4UAJA 1JP7A 4DB2A 1G9XA 2I1LA 2FG6C 4DR3B 4FXOA 1P1JA 1JXOA 4JLKA 3VNRA 5GJWC 1P19A 3L6OO 4LQLA 2C0CA 2C7VA 4JUBA 4NC9A 2QRVA 1CR6A 3EXG1 3JWEA 5E9AA 4GX1A 4LRXA 3GT0A 3AUUA 1M6HA 5FBWB 3WLEA 2H1SA 1U3FA 5BV7A 1XMSA 3BGSA 4R40A 5FWXA 1NYQA 1WOYA 4L78A 1UFQA 4TMYA 5F7ZA 3BG5A 4C21A 2C7OA 2JFZA 2C82A 1X3SA 4NZNA 3UBTA 3OQHA 3V42A 2O3RA 2QVGA 4FHFA 1GAWA 2TRSB 1GQFA 1NPDA 4JGIA 3HHPA 1CUCA 5G0WA 3U7JA 3V4LA 3MT8A 3S1AB 1KYVA 2CBZA 1QMGA 3KP1A 4YJHA 4CG2A 4F4JA 4W5NA 1DBSA 3L92A 5CNKA 4PZLA 1XU7A 4RTLA 2W58A 3DD1A 2I6UA 2L18A 3CEAA 3EGVA 3LOUA 4HUQB 3PUZA 4D5EA 2R60A 1NR5A 1JBQA 2E4VA 4IRUB 4PWYA 4YXWD 4D1YA 2C8JA 3ILSA 1UKZA 4TQUS 3LC2O 3K4PA 5H4GA 2HA5A 4G3XA 4R1UA 5ELLA 5JASA 1XTTA 3BWEA 1N25A 4I2NA 3I1FA 3DE5X 1Z6PA 1WB6A 4QXAA 1DQYA 4V38A 3V8RA 1YO6A 2XWBF 2B7BA 5EMLA 1QU3A 4ZTZB 1J90A 2HD4A 1NC1A 1SBTA 2F8LA 4TVSA 2VYQA 2AZXA 2KMLA 5FWDA 3X1DA 4CL3A 4URFA 3G3EA 4NH4A 4MUMA 5DM1A 3BXXA 2VWQA 1X80B 5TE9A 1MR3F 1Y4AE 2MTBA 1TMOA 4FDUA 1KERA 4KJZA 2NYVA 2X40A 4TWJA 4K8OA 3HCEA 2ANBA 4QBTA 3KQMA 5CU7A 1NV8A 2VFAA 3VR5H 2QL6A 4WK6A 1CNFA 3A06A 4N48A 5DK4A 4OQXA 2BFFB 1WBJB 5KBYA 3MWEA 4Y1FA 4TTIA 3OOEA 1EFVB 1E62A 2WZDA 3LA6A 4X63A 3N3BC 2VZ0A 2ORIA 1CJBA 2OBYA 3H5NA 3R3ZA 2AR0A 5EZYA 1V48A 2PRZA 5F3RA 3NHFA 2ZTMA 3ECAA 5DGDA 5BYBA 4MV9A 2X1LA 2GGSA 4C0WA 5IZ4A 4ME6A 3WLIA 3ZGZA 1ESCA 2J3KA 3IEXA 4JNKA 2UYCA 4L8WB 5JG7A 3S4YA 2OECA 2W2VA 4R81A 4F91B 3ENQA 1JWBB 4KFSA 3UGJA 1U81A 3IUQA 4MQFA 2C2KA 5H3HA 5CB4A 1HE5A 1Z5ZA 1KMHA 2EX1A 2VHJA 4TWZA 1P9OA 3V4RA 1CDOA 1EINA 3RNLA 3KVRA 5ALQA 3WZLA 2AG5A 2QVZX 2ZRNA 2FYTA 4UDNA 3ASUA 4PLYA 1WVMA 5HOEA 3RE1A 4Q4DA 1N2GA 1H1LB 2HUNA 3F9RA 2A5GA 3CRW1 4UMFA 5AM5A 4KR9A 3WYGA 1QPBA 3O73A 4KYIB 1IHOA 3VC2A 4F1WA 5MGBA 2Y9PB 4ZEOA 1MVOA 1U11A 5JNRA 3U4AA 1XJ0A 2UXCB 1C8LA 2B0JA 2GTPA 2Q8NA 4ALKA 2DTDA 3JARB 3ODPA 5TX7A 1BVHA 1K5DA 1IM8A 2FLWA 3BA6A 3LLVA 3GIDA 5AJWA 1JIUA 3WYFA 2PFSA 4P3PA 5EPEA 3DAPA 4K6CA 5AJVB 3DEYX 3DO5A 3RCBA 2IIBA 4DJEC 5I8ZA 2XAAA 3AERA 2JJ1D 3ZDYB 4HDMA 1BDIA 1X7WB 1AMNA 1DTWA 5KU1A 1QKKA 1P45A 3IIJA 5CRIA 1KFJB 3S8MA 3VV2A 4L8VA 4B43A 4AMYA 4BB6A 3VR2A 3B7WA 3DCYA 3UB2A 2XUOA 4YAEA 1X94A 4G85A 4D92A 4X95A 3V4SA 5KIAA 3L5OA 4V0SA 1J7JA 3Q8LA 3VPFA 3AU8A 3HN6A 3E18A 2CL7X 1JQBA 4W5RA 4KN6A 5GJBA 4EYKA 5ENVA 1PNRA 3KYIB 4L4SA 1NJ5A 2AI1A 3LS2A 1JLSA 3R3UA 3SC2B 4D9HA 4Q39A 1W1UA 3D0KA 4RXMA 1G5TA 2D0DA 4PZAA 1QGED 5EERA 4FIZA 3LPLA 5KOYA 4HWKA 4PTYA 3C3PA 3PTLA 5ES4B 1ECCA 1BGXT 1MJGA 1NVBA 1NSTA 3ELWA 4CU5A 2IUFA 1ZK1A 2CDRA 4KHZA 4KQGA 3I0ZA 3H2BA 5CLHA 1Z5GA 3LT0A 4LXQA 5M7EA 4EP1A 3STHA 3PQ2A 2VT2A 4Y30A 3GGCA 2HK9A 2CLMB 2GPTA 3X44A 3VPCA 4GI2A 5K0CA 4EFMA 1M1YB 2ZJYA 3D7SA 2IW1A 3DZIA 2QX8A 1JR4A 3G6KA 3QXXA 4KMOA 1TAQA 4TSKA 4EY3A 3LPDA 4TLEA 5CUQA 1GL7A 1NJ8A 4MS3A 3SNKA 3RVJA 2ZYHA 4CMBA 5K8CA 2X5NA 3FOBA 2Q29A 3CUEF 4XR4A 3DM9B 3O4JA 2PXXA 3DZHA 1U2PA 1U9JA 1E3SA 4UHJA 1WHTB 2JJ2A 1BXZA 1YE8A 2C9MA 2CNDA 1COWD 2D0PB 2GPNA 4NVRA 1VBMA 4H7EA 1DTSA 2B94A 4ND8B 3TRDA 1A9OA 4ZARA 4BIIA 1Y9AA 2PH3A 2AEMA 2DSTA 2EBHX 2FP4B 2B83A 3FKSD 1KK2A 3HZZA 4FONA 4ILKA 4HB3A 4P3KA 3VU0A 1X1EA 2XA9A 3R2JA 4FX5A 4G0YA 4GMXA 2AW5A 3EZ9A 5EE3A 4DNQA 4YIHA 4DCJA 3ZDXB 2CVZA 3Q0IA 3QE2A 3UCFA 2I0FA 1Z2AA 3F7MA 4HEA6 3DE6X 1DPGA 3NEPX 1QYDA 3OEED 4EJ6A 2V7XA 3FCCA 1PFUA 2QX9A 4XOUA 4IDOA 3S7TA 3AEUA 4YRBA 1A9YA 3ANLA 3OZUA 2XT0A 4LJ9A 1LJ8A 3PT5A 4IX1A 1TVKB 3NONA 4FT2A 4FEAA 5FOWA 3ZV7A 1SXJA 3BSWA 3L8EA 4KC0A 2HRBA 1S02A 3DHYA 1W2WB 1W59A 3X1MA 5AK4A 5J4HA 5KNDA 2O8EA 5C4IA 1AKWA 3SS8A 3COPA 4PFQA 1MC5A 3KJIA 1A5BB 3G02A 2YTZA 3GRAA 2XB8A 5GGYA 4I8XA 3OWHA 1KBOA 3ZCPA 2FOLA 4GC5A 3ZE7A 1MCZA 3N86A 1RXUA 1YD7A 1KEEA 4G1MB 4YMLA 1ZGZA 3IAM6 1OTYA 4QUHA 5DVZA 4KRFA 2O7RA 3IHTA 1GPLA 4FGKA 4DGSA 4HNQA 1XU9A 4WEOA 4P0PB 2DGDA 1H9AA 4G9GA 1DIGA 4HWSA 2UAGA 1U7WA 3OETA 4KAFA 4OXKA 3ETCA 3VU1A 1FNMA 4D42A 4NE7A 4AUEA 1PJQA 5I5GA 1VC2A 3Q87B 1FU4A 1E1CB 3DWEX 4MCAA 3D6VA 4PG8A 5IKMA 3KKLA 3RSHA 4R01A 3LE8A 2DR0A 2HQBA 3A1NA 5EHGA 3D5QA 1XYVA 3HL0A 1UK8A 2X4LA 3KPJA 4LDAA 3WFIA 3LL7A 3KL2A 4B8ZA 4ZYZA 5KNBA 1NXQA 3TNJA 1UK7A 3NKLA 1SKAA 2WV9A 3OCJA 2YOFA 4AJLA 4R71A 3K1YA 5IJ0B 3WQSB 5MHTA 1KXZA 3M5CA 3H1GA 4M1SA 3ZDBA 4Q1VA 4K6OA 1H4SA 3B2QA 4A1OA 4B3SB 4IGKA 1XJQA 3FMIA 5J1SB 2ZIUB 3N76A 4LOKA 5JXWA 2P35A 4TKVB 1W30A 5HUJA 1N0VC 1SG0A 1NXTA 3MXOA 3DMTC 1SH7A 3HJAA 1CP3A 1ZN9A 3BXHA 1P1CA 1KI1A 1DMRA 3RUCA 3KOWA 5BMVF 2BFBA 4BNFA 3KD2A 1H66A 2AOXA 2JZCA 4UCFA 2Z9BA 1RRKA 4OH1A 5AI0A 5HILA 4U2GA 2GK4A 1QBKC 1FSSA 2BCGY 3WI7A 4AZ0A 1VSUA 2VUHB 4EENA 1NBEA 1RHQA 2AN1A 3O83A 5DI3B 4RVDA 2IU0A 4BUZA 1XVTA 1YBFA 1VCMA 3EGIA 5FEMA 5L45A 4UXIA 3R9XB 2QI9F 4JDUA 2R1TA 2ILTA 3WLKX 3ZY3A 1R50A 3HGMA 3GLKA 1L7RA 1JAZA 1R4NB 1ZBQA 3RW9A 2RGGA 1MC8A 1M76A 1TEXA 1RAHA 1BW9B 2HAEA 4HDRB 1G0OA 4X61A 2ZP1A 3NHKA 4UULA 3U7QA 1M2WA 2R66A 4GWLA 5K0BA 3HU1A 4OGGA 3EXFB 4TMKA 3PKIA 3N2EA 3K0AA 1LI5A 1ODCA 1ZLYA 2MOKA 4GSLA 4HQ6A 3U4GA 9ATCA 4FDTA 4RF2A 4UHKA 4MVJF 3Q8KA 2BEVB 2J59A 4YAFA 4TV9B 2ZSUA 1O6GA 3IQHX 4QOEA 4MGIR 5KOHA 3QEMB 4HKTA 4NMWA 1JKFA 5I9IA 4QPZA 1P60A 2VXOA 3G79A 4JUFA 2OM6A 4QG7A 5DYNA 2BELA 3HV2A 2QL5A 2RSLA 1FXSA 1P6XA 1F9AA 2NT4A 4J43A 2JC3A 2W8BB 4Z8XA 2YWCA 3DBLA 1IQPA 1CP2A 4B5LA 3T3HA 4QM7A 3Q7RA 4PYKA 2W7TA 3K94A 3L8GA 3RUPA 3TTYA 1H8ED 4Y1GA 4KLZA 3FMVA 5E1BA 1ULUA 3ETGA 3V2HA 4G24A 3D4LA 1FVXA 1AO0A 1RD4A 3IYLW 4PIPA 4M9XA 4MS4B 2HCFA 2IGBA 2O6LA 4QHSA 5FNVB 4EHJA 5L7TA 4KX3A 1IEXA 1U3TA 1U7HA 3AGQA 3NJ4A 4FR2A 1B6SA 2EQ5A 4JLNA 3G5LA 3FLMA 3KD3A 4RUKA 1ISHA 3LF1A 3RVQA 1WQ3A 2RKBA 4OGWA 4Q4AA 5B1IA 4CKBB 1XEFA 4GX2A 4LWQA 5C8DA 2XBMA 3MG9A 1UPUA 2CVHA 1VJTA 4A82A 1E8DA 1TLLA 1YQXA 3IXLA 1ODIA 3KR2A 1A82A 2WKSA 1Y9ZA 2M98A 3NHYA 1WXDA 1V3VA 1V7QA 3KTFA 3O9VA 3IAHA 3TKAA 1TPZA 3DXXA 4H59A 5KNCA 4C1BA 4HZIA 1U2DA 3GFVA 4TTQA 3E9RA 4N9QA 2WFMA 5EPUA 3DDNA 4LPSA 4BP3A 2PRIA 3WRWA 2LE0A 2Q1TA 2MSKA 4DIUA 4PX3A 2ZSFA 3SK0A 1ZM3A 2E3JA 1ULHA 5F12A 4RD2A 2XCOA 5HIKA 3KTDA 2C20A 4Z4HA 3I0MA 2I8AA 3IMFA 4LE2A 1PJRA 4WFKA 4UQOA 4MA5A 4CCYA 3O84A 2CJWB 1FLDA 5JYEA 4HNAA 4BVHA 4CM4B 4DCNA 3O93A 3U7RA 1Z8FA 4DSNA 5CM8B 3MGKA 2GRJA 3HA7A 1VPLA 1TUIA 2C4NA 2N9UA 4ZANA 4MR8B 1QVZA 1J9GA 4DCGA 4I55F 3ZZ0A 1GL6A 3JD4A 5JH7A 1TVMA 4B80A 3JQBA 1GPNA 3CR8A 5G02A 1KAQA 1GGJA 1EWTA 2DBVO 2WRZA 4E5SA 1X86B 3GELA 1H22A 3OLZA 4XA8A 4L0DA 4UHBA 5T3UA 5FV4A 1P8JA 2GESA 4WCFA 3MTQA 1HUQA 2HI0A 4NV1A 1OLUA 2UZ3A 4GVLA 5FBKA 1UWVA 3DOJA 4PR3A 3AJAA 1GA1A 2DFDA 5LQDA 2DCMA 4EVRA 3N7TA 1WNFA 3QMWA 1AUPA 1PJCA 2B4TO 3OM8A 3MS4A 3QFTA 4COOA 1ZK2A 1VTKA 4B8YA 4YUXA 1MBZA 4KODA 4C7OA 1AGPA 2P2SA 3OQBA 2PEYA 5AM3A 5ILQA 1ECBA 3BILA 4G41A 5BNWA 4YAUA 2G9QA 8GPBA 2GYYA 5CH8A 2NNLD 2IXAA 2YFYA 3F6BX 4YV7A 3L6CA 4MPDA 2QZZA 1AGRA 2P6MA 4EUEA 2YN0A 1WSAA 3ZQKA 4ZZIA 4W5QA 3ESAA 3GJ8A 3GT3A 3GMDA 4QELA 4WKGA 3ZKWA 4ZC8A 1U0EA 1L8QA 3G23A 4GGOA 1ULZA 2OV6A 3UATA 5BN1A 5AVUA 5BVHA 4O4JF 2ZKLA 4I4TA 4L2IB 1LZKA 1UMCA 5IXYA 2OFXA 1LJUA 3KQOA 4O63O 5JS6A 4UMVA 2P7IA 4K9NA 2XMGA 4DDWA 2ODTX 3OM1A 4KACA 3H17A 4OI4A 2PJZA 2EKDA 3OP1A 4MWSA 3WWEA 4BTVA 3SIPA 3W0LB 1WCWA 1ZESA 2RH9B 3V8NA 3WB2A 1SVMA 2CLEB 1JHPA 2CXRA 4FYHA 5K3EA 1OI7A 3IP6A 1ZOPA 4MV1A 5A05A 4EW3A 1GPDG 3T35A 4YRIA 1PIWA 2ZZKA 3IAXA 3LUKA 4J9VA 1SR8A 3UC9A 4A91A 5H59A 4AT1A 4MRRA 4B81A 2H1HA 4CCSA 3D0QA 3I9LA 3OF5A 4BGDA 5EIWA 1ODLA 2IHJA 4K9RA 4JP8A 3SCZA 3SJCA 3M6IA 2A5DA 3A32A 4DG5A 4V0QA 2EBWA 3A4NA 3G59A 3VU9A 3KFXA 1U8FO 1PGJA 2D5IA 4YCDA 2ENWA 2OPBA 2PMCA 1SN7A 1H2WA 1UOOA 2KHZA 3QZUA 3V1MA 2C94A 2D2IA 4DCVA 3H5AA 3ITKA 1ZUWA 3JWIA 4URVR 3ORYA 1DZ3A 1OGJA 1JQJC 1N2JA 5DBIA 4HN4B 4BV2A 3VZBA 3RIMA 4JQZA 1VMDA 1QLJA 2IPNA 5FPPA 3HP7A 5CH3A 3L0PA 4BEBA 4BVEA 1QG4A 2HJRA 3HGQA 3D9QX 2CV2A 1GJRA 2NZYA 3SJZA 1IOWA 1Z4LA 3JU3A 1QWOA 3P0IA 4X94A 3WV5A 5IYZF 2Q1WA 3QA9A 3F74A 1ISRA 2HQRA 4IMJB 4JLOA 3SZLA 4GBED 3EPJA 4QTYA 2W2MA 3LUJA 1RLMA 2YJ5A 2VJQA 3REFA 3RO7A 3RSZA 3ZGNA 3FDZB 4BE4A 5DLDA 3MFQA 1HKUA 4DSTA 2GXAA 4WZ6A 1AB6A 2AK2A 5AVTA 4HYEA 2YDXA 5BUSA 2ZB3A 4G5RA 5TMPA 5CDSA 3V4OA 1YDWA 2IHBA 3QE4A 1Z0SA 3L8CA 4PZUA 4WN3A 5CLGA 1NASA 1Z9BA 2G4CA 4DLYA 2ZBDA 3IKVA 4RIIA 3GJ6A 2YIJA 4BATA 1U2GA 2DF8A 1MD9A 5EP1A 3QWBA 5EE1A 4MW0A 2W4QA 5FQNA 3JQPA 2ET6A 3BUSA 1F6DA 4IW3B 4QYTA 4D6PA 2R5NA 5A2QA 4F8EA 5HZHA 4G5QA 2JGMA 4L5BA 1X7XA 4PNZA 4V03A 5DLQC 2UUOA 1OA0A 2V7QA 5AW7A 4DV1B 4W6QA 1X9HA 1VIMA 2VDVE 5ALFA 5CX1A 4G5OA 3RG2A 3SF0A 3ZV4A 1P0CA 4EHFA 4C2AA 4JEIA 3MT7A 5J2TA 1YVPA 4NI5A 1CUYA 1Y37A 4M83A 4Z86A 2W6IA 4LV8B 4QT4A 3ESRA 2YV5A 6NULA 3QTLA 2VDRB 3RVOA 1LPBB 1XB2A 2ZTVA 5A3VA 3EQ7A 4NU0A 4CLRB 4ZZ3A 2JJMA 1TEZA 1O95D 2BFAA 2BKUA 1EZZA 2ZBGA 5DK6A 3PPXA 5HKLA 2BFEA 1BCSB 3SHFA 1LBEA 1QQTA 1XVLA 3LUAA 3T95A 2X4DA 1TU4A 2JLAA 3TGLA 3RFCA 2FE4A 2Y1FA 3Q4GA 4MW4A 3T8YA 3VR3D 2FUKA 1T3HA 4YCSA 2ZREA 4EBBA 2CXXA 2DPYA 3K3PA 4X3PA 1VGVA 3TRKA 4AKGA 3LYUA 4L75A 2EKQA 5JAHA 3LK7A 821PA 1P74A 4XLLA 5DNEA 1WPQA 5KVVA 1MVLA 2Y0PA 1P44A 5FJJA 1XXHA 1UFRA 4XUDA 3MUFA 4DZTA 4R9SA 4H35A 3ZCQA 4GZ6A 4W7HA 3M33A 2ODWA 2BC9A 3A6GA 1QH0A 2VYVA 4G5YA 3RFUA 1V9SA 1T6BY 2IF2A 2YJ4A 3QSGA 1QPZA 4ZT7A 3H1FA 3TW6A 1EESA 1V6CA 1JG2A 4IJ6A 4LZAA 2HPHA 5T41A 4CBVA 4DAEA 2A3NA 2IP4A 3N58A 1E2IA 2FP3A 3O8BA 1KU0A 2AI2A 4G6ZA 4MMXB 5AXBA 5EGSA 3U5TA 3KE8A 2REOA 1H6BA 2AZ4A 3ISVA 3ORSA 4MV5A 1KQOA 2GK7A 1R0CA 5D5QA 3ZK8A 1IG3A 1UL1X 5CHEA 1U6KA 2PZAA 3I9V6 3NOXA 1LX6A 3BL5A 1W6UA 4D7AA 1N5LA 3WP1B 1P2SA 1PBTA 2Y0EA 2Y67A 1DKLA 1XZQA 5ECDA 1GZ7A 2CHQA 4RQBA 5DRYA 4EW1A 4YTEA 2EP7A 1SPBS 2ZAMA 4M0KA 2BH2A 2H1WA 4H0NA 5SZKB 1PJ3A 3SY8A 3HADA 5BNIA 3GRVA 3WBJA 4OQDA 1AZSC 4IY1A 4HLCA 5FJIA 4OXIA 3CWZA 4QYIB 2V5AA 1CRQA 1BN7A 2FX5A 4G8DA 4Q4JA 5CXSA 4ZMBA 1QVAA 1T0HB 3LXXA 1X8KA 5AP9A 2OBNA 2BV3A 3DTVA 4OHZA 5DI9A 4TMFA 1ZGJA 4PRLA 3X43A 3RT1A 3WKBA 1E6LA 2Y77A 5LIRA 4P34A 1CJUC 1ZYUA 1JHOA 1U6IA 1DMSA 4PQYA 3T4XA 4LDQA 5BW8A 4YO8A 1O6FA 3N2YA 4JB8A 4GXRA 4MYRA 4Q0MA 5E2AA 2R6JA 3QUSA 5FWYB 3TAUA 4YX9A 4HNHA 1OXSC 3W7AA 4LKOA 4B84A 4LXYA 3UXMA 2FDRA 5IWCA 3K0BA 3PEEA 3C87A 3VOSA 1GQYA 4DJAA 5C3MA 3BIJA 2IOFA 5IAJA 1GTZA 3T3OA 3PHHA 1I36A 1SQSA 2GBFA 2BMVA 1KH1A 3PHIA 2GUWA 1PZFA 4JDPA 5ANRB 3OE5A 3T99A 4LDZA 1GRQA 1E7YA 1VJ0A 1Y8RB 1EXDA 2GJ8A 4K03A 4JB3A 4L9SA 2F59A 5KJ1A 4FE7A 2ACVA 2EEPA 4H4CA 4EMUA 1UPFA 2RHGB 1H6CA 3CO0S 1QE5A 3MFYA 5CBPA 4EKYA 2O48X 5A9TA 3AEQA 4YAKA 4MUIA 1T43A 1OFUA 1BNCA 4HH3C 4M1WA 3GLIA 2VQSA 3L8MA 5BN4A 4DUGD 1CF9A 3T0GA 3GJ4A 2Q2QA 3HCAA 2X9NA 4S24A 4K9QA 4EF5A 2V4ZA 4AMVA 4B6OA 4KYVA 4RIEA 5COBA 4M38A 4ND1A 3RVRA 4BTEA 5A3QA 4Q7QA 5BWMA 4IXNA 4MWCA 4AKSA 4LHEA 1M2OB 3GZJA 5I48A 3EODA 4AL4A 3KTAB 1EAYA 1WKVA 4KFUA 5LB4A 2Z6QA 4E33A 2XH8A 4DG9A 1WCXA 1AN9A 4F1JA 3F6RA 3JSAA 1YZKA 4PIMA 4RTRA 1L4NA 4LGCA 5JRJA 2PSEA 2ECPA 5JSQA 2PR2A 4P32A 4X1OA 4REOA 3SBDA 1MP0A 1HNZB 2B3TA 2P2CA 3LIIA 3ZLUA 3NZEA 2UZAA 1WZUA 1MF7A 1Y3IA 4KPFC 3OJ0A 4S0XA 4I08A 4KR7A 2OBFA 3VU3A 3AY0A 2PLAA 3LY5A 4HLDA 4MZXA 2UYHA 3PUXA 4DR1B 3BF8A 3ME5A 3ECSA 1WHSB 4DHEA 1GPBA 3LGXA 3GL9A 4DPMA 4AC9A 2A5JA 3MJRA 2UVQA 3FCUB 4JD5A 5E4FA 4UEQA 1OU4A 2QN7A 2VJBA 3HCDA 2EW1A 1KMMA 2JK0A 5K0GA 3IRUA 3RSFA 4DT1B 1RE0A 2PH7A 4BX0A 3WWYA 4Z49A 5HJ5A 3AI1A 3WTCA 4YEDA 4HBGA 4V0RA 4UVIA 1WB4A 5DHAA 3PYMA 5BOSB 1NTOA 2I3DA 2VNSA 3H6GA 3W8RA 1TYBE 3O1JC 4CKEA 1N2CB 3DVRX 1TQ4A 3MS2A 4I3GA 1D8TA 4FD2A 1CY2A 1FE8A 1ZI6A 3V46A 2WFZA 4DIFA 4GAEA 2IEZA 2J45A 5LDGA 1QZUA 3SZOA 5BRJA 2QLFA 4F4FA 1VIYA 2B78A 2D1TA 1T4MA 3QFRA 1NVAA 3W2GA 4Q3NA 4DNXA 3U4MA 3FFXA 5AYVA 2JLBA 4CI0B 2FHSA 1D5CA 4U5XA 3GHYA 4GX0A 1JTEA 3TIVA 3BJZA 1Q57A 5AVKA 4FCTA 4DSZA 4Y98A 5F33A 2PWPA 2Z6UA 3C85A 1UINA 1SVSA 4MAAA 1J2EA 1ILWA 5CVJA 1RYYA 1VIAA 1NQUA 1TUGA 2ZB2A 2AOTA 3GEIA 2W0MA 2XYQA 3W5IA 1KEPA 3GW8A 4MQEA 3O91A 3QF4A 5DIFA 3K6SB 3BXOA 5DPMA 3S2FA 1EM8B 2PQMA 5JPDA 1UBLS 2HLPA 3C24A 1WX1A 3UHFA 4CR7A 3TRFA 2R5WA 1AKEA 1DI0A 2J3LA 3O5AA 4OQZA 4RC9A 5C1DA 3C6XA 2IUTA 4H3VA 5FLEX 5JAQA 3WGMA 3GOQA 3FJ1A 2VPXA 2VEOA 1LVGA 3N3AC 4EYOA 3WGYA 1DLIA 5SYMA 5IFKA 3P9QA 4WXHA 2C9ZA 4F3RA 3FVVA 3QKSA 4MO9A 4N54A 4PQRA 5DLEA 4O5AA 4FFNA 3PENA 3U4IA 1YR7A 3CF2A 3D8SA 3DL4A 3KPVA 4J94A 1T10A 4Q3OA 3W5AA 1C4WA 2OGTA 4LXTA 4QO7A 1W0JD 1FS4A 2VWPA 4B3BA 4C89A 3D3WB 2AWNA 2G1UA 2VUIB 5JR3A 1X8XA 3C7AA 3E2PA 3HPQA 4TKLA 3CNNA 4AF8A 1BXGB 3NORA 2H92A 4S35A 4EG6A 3VI4B 3NHWA 3HYCA 4QWMA 3WL8A 1WMDA 4HFNA 3EG5A 1GZDA 4Y9RA 3DQZA 3KS9A 2YYYA 3WK7A 1TTTA 4ZRMA 4DAOA 4M8IA 4PG5A 3U37A 1JWAB 3AHCA 4DLSA 1XLTC 4D26A 1ZH8A 5AMXA 1Q0QA 3IDZA 2I4LA 1K92A 3EXHB 3F71A 2JFUA 1IN7A 3OCZA 4UASA 1KY5A 4I1IA 5IMSA 1A2BA 2GF9A 1QC5B 5BRAA 2P6OA 4QYWA 3UC5A 4B34A 2BTEA 4CKWA 3SSMA 4Q3LA 3UAZA 5DYWA 2YOHA 4NJEA 1V9CA 4N3BA 3KEOA 3ZY5A 4D96A 3S8EA 4AJEA 4WN9A 3NXKA 3FOCA 3FSEA 5JVDF 3B2EA 1X74A 4D79A 3DT9A 2ZSAA 3R7LA 4ZICA 4JT9A 3TD2A 4JJ8A 3MS7A 2IDMA 1U2TA 5FPSA 4QQNA 5BO5A 3N2KB 4FOPA 1V5WA 4GSKA 3FNQA 4K6MA 4Z3KA 5CX4A 2J6IA 1IY9A 2BFMA 3BCRA 2PS0A 3JAWB 4RPLA 3S2UA 4UU8A 1RJDA 5J2UB 1L4EA 2JFXA 3ANTA 1BVUA 3TX2A 5I7RA 4KP7A 3ZWBA 2BR5A 4QRHA 5HM8A 1UMDB 4YXFA 5HZGA 5J4KA 1ISFA 3QIVA 4J6EA 4U39A 5M34A 5IVDA 3SXPA 5GWXA 2K5UA 2MR5A 3N5CA 4QGSA 4A1FA 3NOQA 5FNZA 2IIPA 2HA3A 3AETB 4TWBA 1X77A 1JJFA 1QCYA 1FVOA 2PTGA 3B1FA 1U2ZA 3FMFA 3L04A 1ZJYA 5DDIP 4EAAA 5B7PA 2JLYA 4R1SA 2IBSA 1G5PA 3PXCX 3P4XA 1MVNA 2WYIA 3LC1O 2Z4TA 2ZIEA 3BULA 1FYXA 3D6JA 1AZLA 1RQXA 1S2MA 3RNOA 4CODB 3ZX5A 2B5WA 5MN5A 3CC8A 3CUWA 1WZEA 3VKWA 5IZCC 4W9NA 2CXUA 3AYXB 5FI3A 1G98A 2FPGA 1YZ3A 1SPXA 2NU9A 5EKXA 2J85A 3LVFO 2UYQA 2FEXA 1SZDA 1YKFA 4WD3A 1KYXA 1NQTA 2O2GA 4ZVRA 2XRYA 4NAHA 1FOEB 4HHEA 4RE6A 1U4SA 3FUWA 5HCUA 1R16A 2ZETA 3E5MA 1T9DA 4FYMA 4WH0A 3ZCRA 1EVJA 4CQMA 4D3DA 4TLCA 3TDMA 4H4DA 2R00C 2QLBA 1IAQA 1P5FA 3LLSA 4OA8A 3B5EA 4Y6LA 2ONJA 1LA2A 1YQDA 3EQZA 3RSSA 3TIXB 4CIWA 4ZAYA 1L7EA 3THWA 2VDNB 4ZQFA 2HIHA 4TTSA 3UJ3X 4A7PA 2EW8A 1HEUA 3C4QA 3CZPA 1M7BA 3IPAA 4GR4A 1DFIA 4P6VF 2QAGB 3IH5A 1HE3A 4L8LA 1F38A 1NHWA 2AE2A 4M8SA 2LCIA 2WSLA 1T35A 3NALA 4PAOA 1WXIA 1D6MA 3UUWA 3MCZA 2CE7A 1HH4A 1HYGA 1M74A 2UVPA 1Z18A 3MGCA 3AP3A 4JMPA 1RP7A 1RZRD 4C4YA 3LSYA 5CLFA 1EA7A 4S2UA 4OO3A 1XZGA 3NHSA 2R4UA 1NF3A 5BSMA 3G5UA 2VHUA 4K1XA 4MI6A 1JA1A 4KVZA 3S40A 4M21A 4WMLA 3ZW8A 1TJ4A 4LC1A 2PD6A 3H2SA 5IHXA 3LBAA 2G8NA 5ALSA 3LOQA 3PXXA 1KY3A 4AX8A 1XJWA 3H4TA 2AXEA 2NO1A 4PIVA 1JIQA 5AH0A 4CN9A 2SCUB 3BQNB 2QD1A 4HDCA 4OXYA 1XTJA 4HPXB 5LQMA 2HMWA 2VPPA 4NICA 4W1SA 2IEBA 5DCUA 4HGRA 4U4AA 4BMCA 1SHKA 2E5WA 2C2MA 3KYCB 4KI7A 2PGIA 4M0CA 3VR6D 4EM6A 4L4ZA 3ZBQA 4O0MA 5F4ZA 3WNCA 3PRYA 1EVZA 3MJDA 3AVPA 3PQCA 3ZJUA 3B51X 3W6NA 5AXAA 4YMTA 3G5TA 1TZMA 1XQ1A 3O0DA 4YQFA 5F2OA 3G2MA 3B6JA 1F1BA 3FIJA 2IEGA 4JFRA 1KIFA 1ZVQA 1PVOA 3FWYA 2ZVJA 3R75A 2NZ8A 4WT7A 1SOUA 2MMCA 2WJ3A 5ENDA 3TNDA 1NW9B 2AUMA 1L5SA 1WWKA 2C00A 4PGAA 4FEGA 4RKRA 3PFNA 5DT9A 3CW8X 1JFSA 5EWMB 4LGVA 3NHJA 3HI4A 1UIMA 2FWIA 1HLFA 1HETA 2I2WA 1G7CA 2PT7A 3I73A 3KKPA 4MULA 1W5TA 1WOMA 3UJ8A 2JJ1A 2TECE 1HKHA 2ZUSA 3FPJA 4N5DA 2ZSBA 4RLHA 3DPSA 4YQYA 1M75A 2V9PA 5DLYA 1EH5A 5FX2A 3EVFA 4QUBA 1VRVA 3QEKA 4D4KA 4DARA 1YCDA 2FPSA 4TUYB 3H7IA 2JDID 3QENA 1PZXA 3G0BA 1T4BA 3VSAA 4C08A 4TZ0A 1GFSA 3PGLA 3FBTA 1WY7A 1QIKA 3AP1A 2QX7A 3QU4A 2J9YB 1DRKA 3A6KA 3DF9A 3AH8A 3OMWA 4OMDA 4UM9B 7REQB 2JLZA 4OK3A 4CMEC 2C04A 3ZEAA 3DZKA 10MHA 3ZCVA 4BCCA 3BORA 5JNUA 3KJHA 5LXTB 1OYVA 4WY5A 5EIHA 1JEDA 2I54A 4NCIA 2VRBA 1XNGA 1FUUA 1M0EA 1MEEA 2OCIA 4EPYA 1BHQ1 1GCGA 3FPHA 1P7PA 2X7HA 1NSFA 1GAXA 4FOSA 1X80A 4HRYA 4B85A 4O1MA 2V6GA 2WKPA 3QLVA 2OXCA 3DCNA 4B0PA 1YIOA 3KJEA 3ND7A 1RDFA 4MP8A 3O4VA 3GY0A 1TCUA 2BFFA 2VH5R 3D6TB 3PXGA 2V0CA 2YZ2A 3C6KA 2QZJA 2QTVB 1EFVA 2PMFA 3MRVA 1M7HA 1H5UA 2A14A 3WKDA 3BL8A 3E48A 3BWCA 3FYHA 1KVUA 1RQLA 2DHDA 2FN4A 2W0SA 2WHYA 4GYJA 3WMFA 2ZJ3A 2QQEA 2AFVA 4MINA 2FN8A 5LOVF 3W2EA 2I6XA 4KQXA 4F9FA 4Q7EA 3U61B 2AEJA 1W76A 5B7QA 1COWA 1DG9A 3IPYA 1ZP6A 3LFUA 1NW6A 3TN7A 4U2BA 4X6LA 3S3TA 2IQIA 4A0SA 2BBTA 2G40A 1ODJA 3F9CA 3U7GA 5IXSA 3R09A 3WMRA 4H08A 3RRYA 4NTZA 5C35A 4DA4A 4A2CA 4U6SA 1LTHR 4YCMA 3O9MA 1NVDA 4HMOA 5H82A 1BEUB 3ICVA 1VHTA 1JNXX 5JY1A 4RTNA 2PPVA 2OD2A 2M2IA 4XDGA 5G40A 2E37A 1H1LA 3AVOA 4DQKA 4JI2B 3R9WA 4YP1A 1IZ9A 1CUDA 2B1JA 3GNSA 2QY6A 2BZGA 1IY2A 4GGMX 1GV1A 1F5SA 3TM4A 8AT1A 4QGAA 5CLLA 4GMDA 3OE7D 3BTVA 1Y6QA 3JARA 1HSOA 2HUPA 3EGCA 3F7TA 1JEEA 4U3JB 5FR2A 5A62A 4FWBA 4FWTA 1G19A 2C2OA 2ZJ7A 4HLQB 4MQMA 2PUAA 2RHTA 3FNIA 3LQQA 5B36A 1U28A 3I8OA 1NUPA 5SV2A 3U19A 2EEZA 1H0RA 4ADSG 3DGEC 5LXTF 4ZYUA 4NCAA 4HQ0A 1DQZA 4C6TB 2ZR8A 5E1MA 2FCRA 5LP6C 3MUNA 4LSMA 4EVSA 3PR2B 3E1KA 4HDAA 4NQZA 1X7WA 4NAVA 1PGOA 2GO1A 2Q5JA 2QRJA 2OG1A 4XASA 1JGTA 2C4KA 1KDVA 5TY0A 3D6NB 4CDRA 2EFJA 5IC5A 4B6JA 3BXPA 1RZ3A 2C3PA 3E70C 1GDDA 3WK4A 4BASA 2QRQA 3AF4A 3VZDA 1JLRA 3NFYA 2Y4OA 5LNK1 4UM9D 1JQAA 4C6SA 1PW5A 3TZKA 5KC9A 1YK1A 3S6JA 4MVJG 4C4PA 5ALMA 3AVWA 3N9IA 3SC2A 3UAOA 2QNIA 2Y99A 1TKCA 1VIDA 4YUWA 4IHAA 1AMOA 1T2EA 3WLQA 2C92A 3PHCA 1J70A 3ROPA 2RHJA 3SE7A 4IS3A 5HFNA 1V11A 5EIAA 1JQ5A 3LPNA 4CRWB 3WIUA 2ZYWX 4JNCA 1BVRA 5DT2A 1K06A 4R54A 4YS6A 3W7VA 4RZSA 3U13A 1RPNA 5EZQA 3KKKA 1X1TA 2OYRA 5CA1B 5JFTA 3PNSA 2PZKA 2CV0A 1H4TA 2A0KA 4XQEA 2MSCB 4LVUA 1VYHA 4OHUA 4WXYB 1O03A 1M1YA 1VRWA 1JB1A 5T8KC 3RT7A 5HR5A 4B4KA 2L42A 1F6BA 3ONDA 4R9UC 1K98A 1T2AA 1T4GA 1EFTA 1Z2CA 2EFHB 2YQZA 3T9CA 1Q0UA 2QTWB 1YB7A 2SKEA 4IVQA 1BA3A 4JIGA 4A0QA 3LNTA 4BLSA 4EUKA 1FMJA 1FS6A 2QUHA 5BV1A 1IVYA 4M7OA 4MEJA 3R7WB 4KO3S 1X92A 1CUVA 4C4OA 1RC1A 1PK7A 4AY4A 5C81A 1MORA 4HQNA 3VNAA 5DGCA 5JYDA 2BEJA 4LVCA 1XN4A 5AM1A 4B8WA 3WOVA 2GKGA 5CVCA 4ND8A 4F6CA 2I9KA 3TCXB 2DP4E 2ZRFA 4NYJR 2FP4A 1SQFA 2XSZA 2Y0CA 3DOIA 5DHQA 3T94A 3VYSB 1QV7A 3EIHA 4PLTA 3BA1A 1JKJA 3W3AA 5DX1A 5L53A 4LFBB 2CXNA 5AWFC 2FRDC 1YGPA 2Z2KA 3FI9A 1C1DB 4DXHA 3DEZA 2R9VA 1W85A 2XCRB 2ZS8A 3LI2A 2Z0MA 4P80A 5G3YA 3TO5A 1JU9A 3ZTTA 3K6JA 3VNBA 4IEEA 4FE4A 5F7OA 1E5VA 1K6EA 4YCCA 4CM1A 2Y1XA 3T7SA 2XOXA 3U9SA 2HNAA 3H0EA 3EUFA 4QRDA 4V39A 1I9CA 3ZGLA 4C7MA 1B1AA 4J1SA 3M9XA 1KI4A 1USKA 2ALJA 2AE1A 1UBNA 2IJGX 1QVVA 2LCFA 3GUZA 2GNOA 3K1JA 4IQ0A 2QMYA 4ARVA 4JL8A 3AV0B 1AY0A 1QOQB 4P5DA 1IPEA 1KK1A 1O5OA 2OTCA 3WZ2A 5CDFA 3WDKA 2DPHA 5LFAA 1WXQA 3ZI0A 3PRKE 5T5QA 1WIWA 1TF2A 2ZAGA 2FZKA 3HVHA 3RODA 1MRNA 2YJNA 1YSCA 4MVXA 1IMJA 3TTXA 4KOEC 2FPRA 3PFGA 3V8VA 1H8EA 2R8XA 2P8SA 1M8KA 3RD5A 3IAEA 3ERCA 1C9JA 2RBEA 3D7MA 1W4AA 2ZTLA 3DZCA 4UD6A 4DRZA 3TQSA 4K9SA 1PL6A 1GGNA 1P33A 3EQ8A 4I9FA 3ZD6A 5L3QB 3V8BA 2DZDA 1Y5LA 1W88B 4Y6QA 3C6YA 3AF1A 2CCGA 3L6DA 1E2BA 3T7JA 2CJFA 4NKRA 2QPOA 4RANA 3PJFA 2JF0A 3GEPA 5AOVA 2ENUA 2PHZA 4EZIA 1EGVB 2BDUA 2I33A 3RG8A 4MMZB 1PR5A 3SICE 1LK7A 2FWBA 2JAHA 1BJKA 2HT1A 4WZAE 1FS5A 4MDYA 4NJMA 4O0LA 1YE5A 2Z4SA 3Q2OA 3CTMA 4L6AA 4W4TA 3KKOA 2XRFA 1M34B 4AY5A 4IH4A 4NAUA 2Z8ZA 1ZSYA 3IQEA 1X38A 2PS3A 1T2NA 2FR8A 4II7A 3PQ4A 3A2LA 4AP5A 4TKVA 1IY1A 2CL5A 5ADHA 1BD3A 1F7VA 3JSXA 2VSXA 2XDWA 2OE2A 1NY6A 4D81A 1W5FA 3E58A 4YMIA 2JLVA 4MV0A 3HRHA 1DIRA 1C4KA 3CKMA 1GT6A 4ZODA 4LF8B 1QFJA 1RCTE 2BM0A 1I8TA 1S8NA 1CRLA 2YWXA 3A58B 2ZM6B 1NDQA 2H1VA 3C5HA 4DKXA 1ZD4A 2VOJA 2OLJA 3I58A 3LDHA 2Z8YA 3FTFA 1RPTA 2X4IA 2GMWA 4XPIA 1XTUA 2IZ7A 1SVLA 3DE3X 1JSLA 3T9AA 2WKRA 1UKEA 2XWPA 3NBAA 3DVLA 1W9HA 1O87A 3TL2A 3R9XA 1VL1A 3KZOA 4QDUA 4YO7A 3RANA 4QUDA 2BVNA 5D5PA 1YCHA 1MH9A 3K73O 3FUCA 1WZIA 4E4TA 3U0VA 1XRQA 4OX9Y 1R4NA 4PLCA 4QOIA 5ALDA 2D4HA 2GCNA 3USZA 4CL2A 3HTXA 4CEIB 3C70A 4GECA 1BW9A 4IILA 3VUFA 1U99A 5SYNA 4HDRA 1JEQB 4ITRC 4CM7A 3BXFA 4W7SA 4UVGA 1A95A 4LDNA 2QIPA 1RYMA 1B14A 1S89A 5IS2A 2CEKA 3EXFA 3NWBA 1D0IA 4RAQA 4C0HA 4KPYA 5IRCD 4EOGA 2QYHA 4TV9A 3C8DA 3OFJA 1TO2E 3K70C 3JQFC 3QEMA 4KRGA 2IY8A 1U0FA 4POAA 2JIZD 2LP4Y 3L4EA 2CVQA 2VP6A 4MTCA 1WF3A 2WVJA 4G1BA 4N18A 3SWWA 1L5FA 4EJSC 5DN6D 2CZGA 1U7TA 4IYRA 1LK5A 1JLMA 2FB9A 2QZPA 2ZVDA 3BF7A 4YUAA 2XZDA 2H1OA 4KHPB 4BX9A 2J3EA 2YZ7A 1DJLA 4BKRA 1VHJA 1N6RA 4XD2A 5BQ5A 1GTL1 2WIDA 2VZLA 3AXTA 3DNFA 4R8SA 2GD6A 3TJRA 4F4DA 3RUDA 4MR7B 3T15A 1GL9B 5C8YB 3RH0A 1SXPA 1HX7A 1I6LA 1B26A 1Q0LA 3AMVA 4L0QA 1ECGA 4MS4A 4WDQA 4F6LA 5FNVA 4RVNA 4DLVA 3A10A 1CF4A 1PGPA 3KNZA 4UE2A 2WTUA 1EQAA 3IDQA 4QDJA 1CW2B 1FDTA 2Q5OA 1BE1A 3DBRB 2R3SA 3NYIA 2R7NA 3QVJA 1T8YA 3RRXA 4BCBA 4BFTA 1PFVA 2DBRA 3JQCA 1CF2O 5DM2A 1S5PA 1Z38A 4GVPA 1JPUA 4Q21A 2PJRA 4C20A 4OD0A 3VGJA 3MTBA 3TNFA 3BXGA 5K4GA 3AJ9A 2CZCA 3GMTA 2IU4A 3BZWA 4O4LF 1N7IA 1EBBA 3FD8A 4W9MC 4G4GA 3UGKA 2Q5FA 4JVLA 2A9VA 4RY0A 4JQCA 5G0SA 3SSOA 4FYYA 1YA6A 5GPBA 3CJRA 2ILVA 1KJJA 2I66A 2PUGA 2JIQA 3DMFA 3I2YX 1FYDA 4NPCA 1DQSA 4OQPA 4UBIA 1VJCA 1RQ2A 3RWBA 3UYKA 4A6PA 4I5FA 2QTLA 2GN8A 2IP2A 3AUTA 1ND6A 4LE1A 4GRDA 4TQ9A 3KEFA 5K3CA 3RUAA 2CJWA 3WYAA 5HZKA 4CM4A 2VK4A 1CETA 4IDFA 4RDHA 1D2AA 3AQ4A 5TJHA 4BN4A 3OJWA 3R5XA 1QX3A 4NECA 3EA0A 1BAPA 4MR8A 4TQAA 3T5TA 2BUBA 4MSUA 3IAAA 1QHEA 4LFCB 3TR0A 1SXHA 2PRSA 2Q5QA 5IKXA 1E98A 5U9CA 2GHRA 2W9XA 4O2BF 4ON9A 1KQGA 5L4LA 1A27A 1F20A 2ECKA 3E1GA 1KGSA 4LTMA 4WNAB 3ZDFA 3PLAE 2XKAA 5C3UA 3HRIA 2BGGA 1R5NA 3N6VA 4L15A 4Y2QA 3IJEB 4RTQA 1CY7A 1YBAA 2X5XA 3BKWA 3WY9A 4BVJA 1RRCA 1Q11A 1Y89A 2BDTA 2P3LA 2HK6A 4PYRA 2ERYA 3TSYA 4BLVA 3KWLA 3ABRB 4PC2A 2B20A 1BKYA 4IDDA 1GTSA 4UMDA 3ASVA 3TPZA 3ULKA 4EARA 5KQLA 3R24A 4CLDA 2GZ2A 3IEVA 1D2CA 1CD5A 2QTCA 1XK6A 3HO8A 5CJPA 5E0OA 4YECA 5C7OO 3ABQB 4FNMA 1HLPA 3O47A 4JJ4A 1MGOA 1UDRA 4YP7A 3UAVA 4AQDA 5C8YF 3W2TA 3IP8A 4Q9KA 4ZGBA 1UH5A 4DV3B 1LF5A 1WXEA 4RGBA 3LT5A 5EXDA 3CN9A 2GFHA 1JYEA 1HPLA 2UYOA 4LDRA 5H16A 2EJVA 3AX6A 3FVQA 3R40A 3WRYA 2O4CA 4L7QA 3W6ZA 2ZWAA 1NQOA 1E1QD 3GLFB 2PXCA 1KSHA 2FZ4A 3JZMA 3HEBA 2H1RA 4FGSA 3KK0A 1R5JA 4CF4A 1RJ9B 2D54A 2IRWA 3H8WA 3A11A 4AN0A 1W29A 4L2IA 2VHVA 5EJMA 3IP1A 5G4KB 4ASUD 2I67A 1SUCA 5BSKA 4C7XA 1P9RA 1RWVA 3M9LA 2FFQA 1B41A 1TZCA 3WNBA 1G5FA 1R0YA 2WM8A 4MQUA 1PG2A 1HQKA 2C97A 3A6FA 3ZYZA 4CYMA 4I6GA 1FJXA 1LQUA 1EP2B 3PTZA 5U4QA 2NSYA 3C1TA 3DE1X 3ZZMA 2QRNA 3IE0A 4HDKB 4URYR 4RFVA 2ADOA 1P1FA 4ZVVA 3KCQA 2PR7A 2IS4A 4HAVA 2JAUA 3DAYA 4FDMA 4FEEA 4TM8A 4AJIA 5K6AC 3UJ9A 1KJNA 1PTKA 3S2YA 1OH5A 1YQTA 4Z7QB 1DAIA 1F06A 2PLWA 3E5RA 3CB2A 5ALIA 2FZ5A 3V3KA 4YI3A 3EBLA 5KPDA 1PLJA 1T25A 4BJHB 1FCJA 2GZAA 2MWMA 1PS8A 1JDJA 1GSIA 1L9XA 2O9JA 2YXDA 3E03A 1K7CA 3NV7A 3EXEB 4MVJP 1UC9A 5THXA 3VHLB 3NATA 4I0WB 5AUNB 2Q0QA 2YVUA 2VH2A 5JZOA 3IL2A 1QU2A 1PZGA 5ITWA 3L8DA 5HCIA 3EWAA 2AD5A 3K2EA 1T36B 5C8VA 1RWQA 2E0IA 3C5EA 3FPKA 4PAMA 2OP1A 4M1MA 1SMKA 2WU4A 2VAPA 1G17A 3D0RA 4K26A 1YT5A 3GGJA 1N8TA 1ADGA 2B5VA 3IPCA 3IDSA 5GONB 4ZCIA 1IEWA 1FFAA 4O4IF 2H2AA 2HR1A 2HC9A 4PNEA 2XQFA 2XWJI 1NF2A 3WMEA 1QORA 1NMSA 1L5WA 4NBWA 1ESZA 1T0BA 2X14A 3IBCA 2HSWA 4CV2A 4Y7CA 5DNCA 4LK2A 3FDZA 3LCCA 1GLVA 2E55A 2C9DA 1AIPA 3EIFA 1OBVA 1QGYA 3LK6A 5JAMA 4BLOA 1EPUA 3NHLA 1L1FA 1J6UA 1QIFA 4A3SA 3UJNA 5FH9A 2LVBA 4ZDWA 2PGOA 4N5IX 4WXRA 5FL7D 5CW1A 5H8WA 2RBKA 1CUSA 4PHTA 2ZQYA 1PGQA 4N6OA 3IULA 1M7GA 4TN5A 1U7UA 2OYCA 3RS7A 1QQAA 2E6KA 3FSGD 2VP9A 1NURA 1WSDA 4ID9A 1JPVA 4I19A 1BWPA 5CIYA 1Q1AA 2WJWA 3SR4A 2AC2A 1NXVA 1T1SA 5ALHA 4OATA 1R6BX 1TJPB 1SVOA 3OBBA 5A5FA 5JCJD 3K96A 4TN1A 2P2LA 1MO3A 2QF7A 4FS8A 5DV9A 3ZD7A 4RV9A 3N53A 1XZIA 4PAQA 4LZNA 1O58A 3SLRA 1X13A 2M1XA 2RHMA 5ELMA 5LP1A 5FB3A 3GRKA 3ORQA 4LCEA 5AHWA 1U7ZA 4DIKA 1JDBB 2IYAA 3T1OA 5CJJA 2V5UA 1R10A 1OWMA 2VDPB 2FPKA 1D2RA 1SB9A 5AJUA 4LHYA 1U2QA 1NNLA 4CLRA 4E5DA 1CY8A 3KPYA 5EEHA 4PLHA 4RJIA 4ZD6A 1SY7A 2CZQA 4L5CA 1BCSA 3K5IA 4QFMA 5E6SB 4RD3A 1O8CA 1QGUB 1WB5A 3P9PA 2VKTA 3R6TA 3DR3A 3TSWA 5KHOC 4UNSA 5LA6B 1JE0A 3ST7A 1YS1X 1SVIA 4UPDA 5B12A 2Q1UA 2SKDA 1TW3A 2OHJA 2H6EA 2WYVA 1OIXA 4YMSA 4F4IA 4E5YA 3HPRA 3PC3A 3WTBA 4ZI3A 2PD3A