3CEJA

Human glycogen phosphorylase (tense state) in complex with the allosteric inhibitor ave2865
Total Genus 291
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
291
sequence length
809
structure length
790
Chain Sequence
b'NVAELKKSFNRHLHFTLVKDRNVATTRDYYFALAHTVRDHLVGRWIRTQQHYYDKCPKRVYYLSLEFYMGRTLQNTMINLGLQNACDEAIYQLGLDIEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGIRYEYGIFNQKIRDGWQVEEADDWLRYGNPWEKSRPEFMLPVHFYGKVEHTNTGTKWIDTQVVLALPYDTPVPGYMNNTVNTMRLWSARAPDYIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAATLQDIIRRFKASKFVFDAFPDQVAIQLNDTHPALAIPELMRIFVDIEKLPWSKAWELTQKTFAYTNHTVLPEALERWPVDLVEKLLPRHLEIIYEINQKHLDRIVALFPKDVDRLRRMSLIEEEGSKRINMAHLCIVGSHAVNGVAKIHSDIVKTKVFKDFSELEPDKFQNKTNGITPRRWLLLCNPGLAELIAEKIGEDYVKDLSQLTKLHSFLGDDVFLRELAKVKQENKLKFSQFLETEYKVKINPSSMFDVQVKRIHEYKRQLLNCLHVITMYNRIKKDPKKLFVPRTVIIGGKAAPGYHMAKMIIKLITSVADVVNNDPMVGSKLKVIFLENYRVSLAEKVIPATDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIDDVAALDKKGYEAKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFYHDRFKVFADYEAYVKCQDKVSQLYMNPKAWNTMVLKNIAASGKFSSDRTIKEYAQNIWNVEPSD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glycogen phosphorylase, liver form
publication title Thermodynamic characterization of allosteric glycogen phosphorylase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 291
structure length 790
sequence length 809
chains with identical sequence B
ec nomenclature ec 2.4.1.1: Glycogen phosphorylase.
pdb deposition date 2008-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00343 Phosphorylase Carbohydrate phosphorylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3cejA02
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3cejA01
3DD1A 1WW3A 3MTDA 1YGPA 1E4OA 2R60A 2FF5A 4REMA 2IEGA 4WHMA 1L6IA 1JEJA 1P4JA 4N3CA 2C1XA 2BISA 5LQDA 2G9UA 2IUYA 3DDSA 4NESA 4AMBA 3OKPA 3VUEA 4NC9A 2O6LA 1GGNA 1UQUA 4F9FA 2AV6A 3E3LA 1Y8ZA 1Z8DA 4CDRA 3MS4A 2IW1A 1P29A 4BQFA 2R66A 4RELA 1WV1A 3MQFA 3ZCPA 2PRIA 1V4VA 4N3BA 5TVGA 4X6LA 3Q3IA 4FKZA 3QHPA 1L5SA 3S27A 1Z6PA 2QN2A 4N3AA 3S0JA 3TAXA 3T3IA 5TMDA 3GPBA 4RIEA 2WTXA 4FZRA 3ZCUA 3L79A 4YUAA 4BQIA 3Q3EA 3E3OA 2ASVA 4Z5XA 4YI5A 3BEOA 4PQGA 1L5RA 1RZVA 3NCHA 3D0QA 2KS6A 3MT8A 2AZDA 3EBPA 4EL5A 3DZCA 3S28A 1BX3A 1XKXA 3CUVA 2X0EA 3OKAA 2GPAA 2QRHA 3CEHA 4GYYA 3VDNB 1SXPA 1JG6A 3NP9A 2IV3A 5DLDA 1FTQA 4X7PA 2QN9A 1XC7A 2JJMA 4CTMA 1VGVA 2Q6VA 3OTHA 5IKPA 2ACWA 2PYDA 2QRQA 4GZ6A 5BNWA 1GPYA 4EKYA 4CTNA 3MT9A 4HWGA 1LWOA 4AY5A 1QKJA 3HBFA 3C4QA 2G9VA 3NP7A 3T5TA 4MRAA 2VSYA 3TOVA 1FTYA 3T7DA 4M7PA 3G2IA 3O3CA 2XGMA 4RIFA 1L5VA 1NZFA 2C1ZA 4BQEA 2QN1A 3OTGA 1M5RA 2GEKA 3ZCSA 2IEIA 3MRXA 2F3SA 3G2JA 4G2TA 3BCRA 2FFRA 2XCUA 4GZ5A 3D1JA 1FU8A 1NVKA 1Y6GA 4GPBA 2QN8A 4RBNA 3T3EA 1JIUA 1XL0A 2QN3A 2ACVA 3OY7A 1AXRA 1FC0A 2GEJA 1NLMA 4XI9A 4YI3A 2VCEA 4RIGA 3FROA 3OTIA 2FETA 2QZSA 1C8KA 4LEIA 3RHZA 4N39A 1WV0A 1B4DA 5DU2A 2F3PA 3PE3A 2PQ6A 2GPNA 2SKDA 2X0FA 1XL1A 3T3GA 2JLBA 2VG8A 3CUYA 2G9QA 1P2BA 2H1FA 1HLFA 3BDAA 2ATIA 2IV7A 5C1DA 1A8IA 1WW2A 2AMVA 1NOJA 3AMVA 1GPAA 2XGOA 3MS7A 3VUFA 2GJ4A 1FTWA 4WADA 1J39A 4X7MA 1K08A 4AMGA 3MRVA 5D00A 3C48A 4MHOA 5JTTA 1LWNA 2H1HA 4EJ2A 2AW3A 3IAAA 3T3DA 3NPAA 4EKEA 2QLMA 2PYIA 2XCIA 1P2DA 3ZCVA 4F96A 3OT5A 1PSWA 2HY7A 4AN4A 3CUUA 3G2HA 3HBMA 1Z6QA 1KTIA 2YJNA 3TSAA 2QLNA 2ECPA 4GYWA 4MICA 5ENZA 1NZDA 3Q3HA 2C4MA 5TMBA 3RT1A 1P4HA 4N9WA 3SYRA 1E1YA 3MSCA 2XGSA 3MTAA 3MT7A 2IYAA 1FU7A 3MTBA 5JTUA 1XOIA 2R4TA 3H4IA 4MI9A 2VSNA 4MHSA 3T3HA 2GT1A 1ABBA 3CUTA 3OKCA 1C8LA 3UYLA 1EXVA 3L7DA 1P4GA 5GPBA 2R4UA 3RSCA 1JIXA 4MI3A 3WADA 4CTOA 4EL0A 3PE4A 2QLLA 1WUYA 2XA1A 3CV3A 3S29A 3HBNA 1F6DA 4W6QA 1YA6A 4GZ3A 4AY6A 1O6CA 5DXFA 3E3NA 3MS2A 2XA2A 3WC4A 3QKWA 2SKEA 1WUTA 1L5QA 1RZUA 1GPBA 3CUWA 4WACA 1GG8A 4L22A 1P2GA 3CX4A 2C9ZA 5I45A 3C4VA 2G9RA 3BCUA 3DDWA 2XMPA 2QRPA 3G2NA 4M60A 1FU4A 1RRVA 5D01A 2F3UA 4NEQA 1JG7A 2BGUA 1PN3A 3ZCTA 3CEMA 2F9FA 1GZ5A 4KQ2A 5IKOA 4BFCA 1QM5A 3COPA 2GPBA 4RIHA 1Z62A 3L01A 2QRGA 3MBOA 4RENA 1UQTA 4M83A 1F0KA 5HXAA 2QNBA 3BD7A 3G2LA 3WAGA 1EM6A 1XV5A 1GFZA 1K06A 3ZCRA 1L5WA 2X0DA 1FS4A 2BFWA 3NC4A 4KQMA 9GPBA 3VDMA 2ZB2A 3G2KA 3ZCQA 1NOIA 2JZCA 3RSZA 2F3QA 3NB0A 3OY2A 3EBOA 1PYGA 3L7BA 3BD6A 1SXQA 2VCHA 1C50A 2OFFA 4LDPA 2IYFA 3NAZA 2GM9A 2XA9A 1FA9A 1L7XA 5TMEA 8GPBA 3IA7A 4HLNA 2PRJA 3D0RA 6GPBA 3L7AA 3HBJA 1JIVA 4F97A 1H5UA 2R68A 3MRTA 1AHPA 2BGTA 1C3JA 3UYKA 2X6QA 1PNVA 4KQ1A 4QLBA 1Y6FA 3GUHA 2QN7A 4RIIA 3H4TA 3BD8A 1UZUA 4X7RA 4XIFA 7GPBA 3S2UA 2P6PA 3SYMA 2SKCA 3BCSA 3CEJA 1IIRA 2X6RA 3L7CA 2QRMA 1NOKA 4MI6A 1IXYA
chains in the Genus database with same CATH superfamily
2XQGA 2CXUA 1IN6A 4C7XA 3KL4A 4OHRA 4FMCF 2ZRJA 1GEEA 1UBOS 1L4KA 2YASA 3OWXA 4R9RA 3GN1A 1EESA 1FJXA 2ZI3A 1U0NA 2FF5A 1B0ZA 4Q66C 4REMA 1QIEA 1IHXA 2BGMA 3PEVA 4U2KA 3SFZA 4FTWA 1HL7A 1DG9A 1JEJA 1P4JA 3PXDA 1IBLB 4Y1FA 1DWUA 4BPBA 5BUCA 1VLMA 3N3AC 4IZ6A 3BSWA 4CN8A 4XUGB 5LQDA 1KJIA 3LW8A 3HE3A 2FMXA 1G17A 4IMIB 3F4LA 3GUUA 4LHVA 1C9EA 3F5FA 3PXAA 4KWCA 2PMKA 1M0WA 3HV2A 3I04A 4RYLA 4ZDWA 4M6WA 1J25A 3HA3A 1CR0A 1VDMA 1SM4A 4FWTA 3QEAZ 2YYZA 4GSLA 5D8DA 1YBHA 2YJ6A 4HEHA 1UQUA 5T8KA 5TSDA 4E5MA 1Y4UA 3ADPA 3LQRA 4DR4B 3D8NA 3ZHVA 4C20A 4XWWA 3I0MA 4Y30A 1E1MA 2WTBA 1GZ7A 2XMRA 5J2UA 1W93A 2HCTA 2NZYA 2IH4A 2YQZA 3ITDA 1GFWA 2B4AA 3VKFA 5HX7A 4HYEA 1A9QA 4D6YA 1YR6A 1ZCZA 2IE0A 3PJDA 4YPOA 3K31A 2GUWA 1ZOOA 1J0XO 3U0VA 4DLVA 1DIAA 1P1HA 2BR4A 1C7JA 3ECSA 2NSDA 4JJFA 4BNMA 4CG3A 2R7LA 2C8JA 721PA 3PDIA 1IEQA 4KYUA 1O5OA 2XHZA 4U1RA 4TKMA 3WK4A 3ZVKA 1PO7A 4HT3B 3W5AA 1R7RA 3N87A 4FYWA 2IOFA 3DH0A 3LQ1A 5F76A 3UKOA 4AWXA 1RYMA 2JH3A 4MEJA 1L5SA 2PKQO 3MCTA 1IY8A 2IPMA 2XLBA 4JB2A 1R0ZA 1PUJA 3DE4X 4AX4A 2FMTA 2I87A 3KD3A 4X90A 4XCQA 2PT7A 3S0JA 4IMRA 3TRDA 3WIDA 2J9ZB 4QXAA 5IJZA 1Q7GA 4EP1A 2X3FA 5BSMA 2QG6A 1CF9A 2OG2A 1V6CA 4JMLA 1C7IA 1UKAA 4K6GA 4FFRA 4DDMA 4EB0A 5I8PA 2OSVA 4ER3A 1Z73A 1RBQA 2I4LA 4YAEA 2QDKA 4M99A 1NWHA 1RVDA 4PC7A 3R4VA 4ZT5A 1KDVA 3THYA 1K6IA 1I7LA 1E4EB 2JCVA 4Z7NB 1VM6A 5K3FB 4YUAA 4DL9A 5DHRA 4E51A 5LQAA 4NEHB 4EHKA 1T9GS 4AYXA 4CKZA 3EWIA 1OTHA 3D5QA 3TE7A 1GTRA 1OLUA 1RZVA 1E3WA 2QQEA 3AVOA 4J0CA 3UHJA 4DBLC 3VPCA 1G20A 4A0FA 1PQUA 3UHOA 1T35A 1KH3A 2EL9A 1IXKA 1I2ZA 2RJOA 1JHMA 4IGIA 1YF3A 2FEPA 4LDJA 3FRJA 2H0AA 1J9GA 3O0TA 4OIMA 4DA6A 2ZI6A 1DC4A 1XMVA 2CJXA 3COWA 4PC2A 3INRA 4I0WB 3UTCA 1P2VA 2FEAA 3GJQA 1CJUC 3CGGA 1XKXA 5E1OA 1PLKA 3DPIA 3CVOA 2ZUWA 2X77A 1Z4QA 3AT1A 4RJ2A 5EMJA 5LP6C 2H7VA 3S70A 3JD0A 2BEUA 3LQKA 4IFIA 5KUTA 1E2KA 4GYYA 1M72A 1T0BA 4G0VA 4M49A 1TQ4A 3GZTB 1JKFA 3RRBA 3NTUA 1B3RA 2QN9A 2H2FA 1N7IA 1N6OA 2CWDA 4BRSA 2RMKA 3GJTA 4D81A 5LZ8A 2XUGA 4Q3NA 4AN0A 2HR1A 1FFHA 2FWMX 3BMOB 1YBVA 2B2NA 1UDRA 3B1KA 2WIAA 4YMIA 3SF8B 3MSXA 5FTJA 5GY7A 3JXEA 4TTTS 1AQ6A 3BQNB 4GSKA 4KSCA 2HZBA 5K8CA 5JJIA 4C5CA 2VAPA 4GPD1 5TXGA 2FFBA 1UC4B 4RA6A 1JEAA 3SZ3A 1ODLA 3DBOB 4TKVB 1PHPA 1QOZA 2BYTA 2VDVE 3LW7A 1HT2E 4CODB 4G0WA 4MPRA 3P0JA 4BEBA 1DIBA 3AERA 1XQXA 3M2PA 1VJRA 2X7HA 4GMXA 3VPDA 3JD4A 2N3ZA 3ZW7A 1UBMS 3LX8A 1DIRA 2PBZA 2IZZA 2QSYA 4ITVA 2QN1A 3OTGA 4OHVA 4BQEA 3V4ZA 3VSBA 4O2AA 2O2DA 4LW8A 2ID7A 5FOUA 3WYEA 4IDHA 2YRFA 4YQFA 1A95A 2FZKA 3RS4A 2VF2A 4KWHA 1BRMA 2E4XA 4DMLA 4YXFA 5DH9A 5ADUS 3FMOB 5EIEA 4M9SA 4KU4A 1HQYE 2WMOB 4FGSA 4R3WA 1NDUA 5HZKA 4HAZA 3K0BA 2IYYA 3D9QX 3U39A 4CM9D 5J9FA 1MJNA 1K3UB 4JNKA 5FWNA 1NVKA 1GA4A 4DLUA 4G4GA 4LECA 4EW6A 4YUWA 3FX2A 2JA1A 3TTUA 3ZHRA 4BZWA 1R9GA 1PUXA 1MAWA 2AVNA 2IEBA 2X4GA 1T3HA 3C41J 3KSDO 3R9IA 2Q2OA 2P4UA 3DB2A 1JIIA 3K05A 3NVAA 3GFBA 4GHWA 5FOSA 1U7WA 1VPEA 5DTJA 4C08A 3RUDA 4P3NA 3KHSA 1JDBC 1K3FA 2R79A 3WIBA 3L9WA 3BB3A 3BJRA 1F6WA 1KOFA 4XI9A 3VZQA 1FVXA 2P35A 4IWYA 1X0VA 3P2OA 2LDXA 3W0LB 1E6EA 4DABA 3HLYA 4JU8A 1ZRNA 4KH0A 4P1ZA 5JEDA 3E18A 3UPTA 5JXWA 2WT4A 3CU5A 4N5HX 521PA 3N8DA 2IYUA 4D4MA 1E0JA 2PHZA 2R6HA 2FRVA 4LSWA 4EUNA 3QKTA 2O4CA 1D0SA 3OQIA 4N82A 4B4VA 4F4IA 3RYIB 1JQKA 4EM6A 1RKUA 2IIBA 3OTOB 1Y6QA 1E5DA 1Q44A 2R11A 3WLKX 3DFZA 4G6ZA 3PYXA 1KGDA 2IRWA 4WWHA 3B38A 2O0HA 5DN6D 3A31A 4YCBA 4P7KA 4MWGA 5CYFA 3C1OA 3ZHZA 2WUEA 2PL5A 2V8BA 4MMXB 4OY3A 4X1KB 2WUVA 2YZMA 4BC1A 1QB7A 2WU0A 3C16C 2FX5A 3IHLA 1QHYA 3GWZA 1MVNA 2DUNA 4L4SA 1E3EA 5JD4A 2JGDB 2GB4A 3FWZA 3GO4A 1UIRA 4C0XA 3KZVA 1UPXA 4RETA 4D9IA 3VM6A 3ZCQA 2WQZA 1XJ5A 1YUMA 2W5UA 3GJSA 3ZGOA 4JD5A 3EUWA 3S99A 4BBAA 2W98A 2YHAA 4IJMA 1RFGE 4B6SA 1F1BA 4D3ZA 5BR1A 1E66A 1T1EA 3MRVA 3OZTA 3GMDA 3HCEA 4L8LA 5EXTA 3O38A 3T1TA 1YKFA 4G4SO 2PH7A 3K09C 2VUUA 4UU8A 3CVYA 4MKIA 1GKIA 3KAKA 4X97A 4KV9A 4GO1A 3R7LA 3B53X 3N75A 1PGPA 1TADA 1WHTB 4XM1A 3BXXA 4ZO8A 3ITNA 5JAUA 4UATA 1SK8A 1T8TA 4YMUA 4LHYA 5AJUA 1PX0A 1D9ZA 1JN0A 3G8YA 1VSQA 4B46A 4F8YA 3ZJTA 2HA0A 2I3DA 4HLCA 3I76A 2QP4A 4OHKA 4P4TA 4TOIA 4UHEA 4X93A 3RJ5A 1ZOIA 5HKOA 1JH8A 2YOGA 5KSPA 3K5HA 1YUNA 1R27A 2Y8EA 3DZ8A 4RGVA 2ZKIA 1Z6QA 1ULBA 4DQKA 3R6DA 2PIDA 3SS8A 2K4MA 5ICMA 1A88A 3K0SA 2Y4NA 4OKSA 1MABB 4BKMA 3DOCA 4DF3A 1YNSA 4OB7A 2Z8XA 4ZKEA 3KE8A 1A7AA 1C7ZA 4O4LF 4YRZA 2X2FA 2A1UB 1JXOA 1AQJA 1HYHA 1P2FA 3BZUA 4BFWA 3R41A 1CDEA 1JHAA 2KQUA 1MJGM 3QSGA 3OEED 4KUHA 2P5SA 5U9CA 3CPJB 4KQEA 3MTAA 4JLJA 3OM9A 1NL3A 4W5WA 2K5UA 1UXKA 2PAFA 2AHOA 2BBWA 3QVTA 2AG5A 3V2IA 3Q7QA 3EQ7A 3REQB 4EJSA 4ERNA 5T7BA 2WWFA 5F78A 4OFWA 1XNRB 3VJMA 1LW6E 2O2ZA 2CE2X 2R6AA 3B78A 1LV8A 4FK8A 1RM0A 1XIVA 4WZBE 2CUNA 2JA2A 2PKYX 5AKJA 2Z9CA 1EXVA 1J7JA 3M5DA 2H16A 1GV0A 1XRSB 2JHCA 5B4UA 3EEOA 5EHNA 4JYAB 5AFSA 3S1LA 4OFBA 1Q5PA 4PRKA 4L07A 1MAVA 2GARA 4WOJA 1E7SA 4RCVA 4RTLA 3DZHA 3UK2A 2Q3JA 4CTOA 4EL0A 1G8MA 1AMNA 5JSQA 5IDYA 2WWGA 2QUKA 2YWXA 3OIFA 4GAEA 3MBIA 4LI0A 4NBLA 2XVZA 4AUEA 3GVCA 5TVKA 1UM8A 2FPGB 2IYQA 3TW4A 4E5NA 1YRYE 1E1CB 1R9NA 1DXYA 1FF9A 2R1TB 3F6EX 1W5TA 1Z06A 2ZBGA 1U0GA 3JQAD 2LRHA 1H0HA 1UK8A 2DFPA 3A4NA 3K0FA 4KGDA 4QQRA 5JCOC 4FOLA 4OLBA 1GQQA 1H1TA 3D43A 4XZ3A 3WWYA 5LYJB 1MZPA 5JD3A 5K4AA 5A9TA 3KALA 2OVFA 2V7UA 1E3IA 3CWQA 2GPYA 2F8TA 1CEYA 1E1DA 4J4HA 1L8XA 4FGUA 2OMKA 2XA2A 3T1HB 2ODNA 1DTWB 1GPWB 4WFJA 3QKWA 4RVGA 2CZQA 4D42A 3OT1B 4BNIA 1A4RA 4P6VF 5A6VA 1RZUA 3FFAA 2AFHA 4UTOA 2YN2A 3CUWA 2B8TA 4Y6GB 5FFNA 3HSSA 3WRXC 3GNQA 3ZE0B 4A8JA 2YVUA 3GLHA 2RI6A 5K8LA 2NU9B 1RJDA 4HS9A 2Y4OA 4WUTA 1R2QA 1ZGCA 2HSJA 1T36B 2REOA 5G4KB 4I6JA 3NT5A 1E32A 2D1SA 2ZUCA 3PQEA 1VECA 3OLWA 3NIDB 3W7VA 5I45A 4OMFG 1RWBA 4U8GA 4K6MA 4HG2A 2Q9UA 2XOKA 4V39A 6Q21A 3P9IA 4LOAA 4U7FA 3RRNA 2FMUA 1AK1A 3EPPA 3UTDA 4BLOA 3FYUB 3X3HA 2ADFA 5CDFE 4JGGA 4I8DA 4NAHA 4UOZA 4MA5A 3OLQA 4I55F 3TFWA 5HR5A 2YRWA 4XJSA 1UK7A 2GX6A 3OMXA 3UVEA 3QITA 4BFUA 5SICE 4CL2A 3O8OB 2BBOA 3Q0IA 4C0KA 1N33B 4TWBA 4WN3A 3ZVNA 1RYNA 3FZNA 2X41A 2DKFA 2O9JA 1L4UA 2YINC 3FLAA 3JWGA 1EFCA 1L1QA 5EA2A 3RFFA 1G7SA 1VRVA 4EB6A 2GCNA 4QE3A 2A5YB 5CPBA 2QTVB 1JQDA 1GM5A 1QHXA 1EIZA 1WF3A 4B2IA 1XA3A 3TNYA 1ULSA 1K8XB 4E5SA 5DULA 3DLTA 4OSPA 1PDWA 4M83A 1FBTA 1MP0A 2WJVA 2Z3ZA 2C97A 2OSBA 3LY5A 4I1PA 1YE8A 1VL1A 2QSZA 2HSGA 3ESDA 1QS0A 1TT5B 3KUKA 4MUXA 3VC7A 5DHSA 3OOYA 4I9HA 5H1YA 2H2GA 4OMDA 3F8SA 4Y2QA 4LYEA 3EGEA 1JFFA 1K06A 2CVHA 5HQJA 1YJBA 3IXQA 2WM3A 3MLEA 1MUUA 1MB3A 2ZJ3A 3AVQA 1COWD 1DAPA 4KNWA 2B36A 3BSYA 3IEMA 1BMFD 2E5LB 4EPYA 4KTVE 3IOCA 2AD1A 3EH2A 2EKQA 1AF4A 5IXSA 3NHWA 2EIHA 2H59A 2NU6B 2QR3A 2VYND 4PWYA 3ZGLA 5BWMA 1JAIA 3BMQB 1HKUA 4LY9A 1DOHA 1HC7A 2OM6A 4JLNA 1NQTA 2I03A 2QX8A 3DQZA 5ICCA 4OG2A 4KSYA 3CMMA 1S8NA 3TCXB 4GQIA 4M76B 5K3AA 4DIUA 3LPAA 5JAZA 1X80B 1GZVA 1ZX1A 4IS3A 4UXHA 3W3AH 2V5VA 3EVGA 4JUBA 3DFMA 3OICA 5ALPA 5HOQA 4IRMA 4NJEB 3OE4A 5LCXA 4Z53A 3CFYA 1SXQA 2FU5C 4A6XA 1V7PC 1NM5C 3P96A 2WRZA 4JL8A 3NBMA 4XQ9A 3VVLA 4B5KA 1C2TA 5LJIA 1C50A 3PDWA 2B8EA 1G41A 3BORA 1C1XA 3S8MA 2JGJA 4PY2A 5E9JA 4V24A 3SC4A 1LI7A 1WXDA 1ZM7A 2R751 2YS7A 3KKOA 2G4LA 1B8PA 1T1SA 1IEXA 3DB1A 1M6HA 4YT8A 2IU6A 3HKCA 1DTSA 3TSCA 1QO0D 3T52A 2C4TA 5DVZA 5C7LO 2ZR7A 1EUCA 3PPXA 4HVTA 1IUOA 4DY6A 3N39C 3VC2A 1R0YA 1H66A 3M89A 3EXHB 2NU8A 3U3OA 3UT5A 3SLKA 1OBFO 4KAFA 4R41A 4BNGA 4R0NA 4HLQB 4MVWA 3WFIA 2O0JA 4Y1RA 4G0UA 1T0IA 2QNRA 4K46A 5F3DA 5GMOA 1N2IA 1GGMA 3EGVA 3IQHX 1M6VA 3O82A 3ED1A 4LKOA 4IJ6A 4IHJF 4AROA 1KK3A 2R8RA 2H5LA 3C6XA 3FF4A 2IVZA 2B4KA 1QK5A 3U81A 4WJKB 3QE0A 4IIUA 3RSQA 5I7HA 5IJ9B 1DX4A 5K0FA 2O59A 4IUYA 3U44A 5B6JA 5BVHB 3Q40A 1WZEA 2CLEB 4DIDA 3SOPA 2WKQA 3IQDB 4BUCA 3Q2OA 3BJEA 3OETA 1QRRA 2EFGA 3L0CA 3NHBA 2BDUA 3DEKA 2GZ1A 5BR8B 3NBFA 1L7RA 3CEJA 4PG8A 1GRQA 2RIRA 3KTFA 3DZKA 4HQLA 4MVJI 3ORSA 2YWCA 3ONDA 3ZHQA 2QTGA 3L7CA 5ITZB 2Q49A 3AY3A 1B8OA 4YV2A 1NOKA 3PFKA 4UTNA 5FJIA 1JEDA 4CCAA 4J76A 5C5DA 3I3SR 3UB4A 4H7HA 1K7EB 1E9EA 4CKCB 1W73A 4RTRA 1QU2A 3CH4B 2ZRIA 3L4EA 5A5FA 2IEGA 2PUAA 3DLCA 4CLRA 2P9GA 4K26A 1XEXB 1GCUA 4CM6A 1Q17A 2BISA 3NEPX 3VPHA 1RAAA 2F62A 1I5EA 3HUUA 5A71A 4F12A 4EA7A 1VZ2A 3FUVA 4PAWA 2GZ3A 2YW9A 2AMFA 2DFTA 3C3WA 3QFTA 1QQAA 4UDOA 2B92A 3LDFA 4OVKA 5FO1A 5A2GA 5MGNA 2F1IA 1KI9A 2EL7A 3P9YA 10MHA 4TLEA 4C7OA 1OV6A 1S01A 2IUSA 4NZMA 1WUJS 3QBDA 1CFJA 1YDWA 1G21B 2FX2A 1T24A 3PEWA 3K30A 3VTAA 2AFIB 3L6UA 2SNIE 3G5LA 2PFGA 1JA1A 5FEUA 1HDGO 3GP5A 3HRIA 4KVAA 2PUVA 1XZDA 3LAWA 1PFGA 3FOAA 2AQ8A 3D3WA 4GI7A 4QECA 4ROTA 1OE0A 1KPGA 1NBMA 2WYHA 3VYTB 1KMCA 1NVDA 1TAGA 1VP3A 1XQ1A 2EV9A 3F96A 2X40A 1M2FA 2DT5A 4QU9A 2BTOA 2IY9A 3GOQA 5HILA 3A4VA 4AJIA 4N48A 5F1PA 3DTVD 2NGRA 1P0CA 4Q18A 2IXDA 3EPHA 4YLEA 4NI5A 1Y33E 2J41A 3CNBA 3L6OO 3OM0A 3KHKA 4DLLA 3VNUA 1YD7A 1CTQA 3H13A 3V55A 4EB3A 2C92A 2YHBA 1RKBA 2H8KA 2WD7B 5ITVA 1YFKA 2G83A 3GEHA 1JGTA 3OZSA 4N0EA 4YRGA 5LOVB 5HKAA 1OUMA 3QKSA 2ATXA 1DEAA 4HN9A 1EYZA 4DG8A 4E1AA 3S27A 4YNBA 4WZAA 1LI5A 3OX1A 1W88A 4BX3A 4FE7A 5K8JB 2X9VA 1KFKB 1E4VA 2QMQA 1J7KA 3K0CA 3L8CA 4BZQA 5KC9A 3AFIA 4P08A 2DRIA 1Z22A 4ZK2A 1ZR4A 3NHSA 3BJMA 4V0QA 3VNSA 4IJVA 3UW3A 4BTVA 1AGPA 4N8SA 4M6WB 4JLOA 3A06A 3LV8A 3QTBA 1ZXBA 3NLLA 4E5KA 5LDHA 1KZ6A 4RKFA 4GRDA 5JC1A 2QENA 1N34B 4YAKA 5YASA 3O8BA 2O8DA 3Q3EA 5J2UB 4DA8A 5AVTA 1IN4A 3PWKA 3QLJA 3B5IA 4Q47A 5HF8A 4ND7A 1X1RA 3I61A 1FTNA 1V3QE 2HK7A 2P62A 2QLFA 4Y0NA 1KIMA 3U17A 4CG1A 1NQ5A 3ND9A 1RC8A 1UZMA 1S7GA 3AEYA 3ASZA 1H9BA 4PC1A 3NOXA 4PG5A 2AC2A 4BV8A 3NCHA 4YJ2F 4B3TB 1F06A 2WA1A 5FB3A 3UNXA 4BFTA 5AM0A 4G5QA 2G9ZA 3PDIB 2R85A 4R3NA 5IJAA 1U2GC 4AJPA 4J9VA 3PNBA 3UGTA 5SZJA 1J22A 2P7HA 2ZR0A 2QQ5A 4ESVA 2PTGA 2X3YA 5KQLA 2J0VA 2Y0PA 3G3EA 4URYR 3D8BA 4N3GA 2Q4DA 3RRXA 4C78A 1WOMA 3KPWA 4MROA 2OXEA 5DLDA 1K7XB 3P5SA 3LX5A 2XSZA 3MLBA 1KEWA 1JXMA 3I9FA 4EECA 4HQKA 3ZIUA 2PUEA 1E1LA 2QVYX 3ZYZA 2VNSA 3THYB 4L78A 2MSLA 4UEOA 1DEKA 1QIDA 2XB9A 3KJFA 4RUKA 3R7NA 1PGOA 1X7ZB 3B89A 4JUIA 3PJEA 1NTRA 4LVCA 3W8DA 2CLSA 2IDJA 2ZLBA 3CE9A 5CFZA 3RHSA 2AXQA 1LWOA 4EY3A 4F6RB 1DDGA 2I22A 3E8XA 1E3WB 1N57A 3FWPA 4IJKA 5AJWA 4CIAA 3R7DA 3B9BA 1G20B 4J94A 5EJ9A 5LIRA 1YB1A 3NHRA 3LUCA 4C2UA 3KOYA 3STWA 4BFSA 3K6JA 3W8RA 3O47A 1ECLA 4N3NA 2FZGA 4X1IA 1YCFA 2W4MA 3SGLA 3TINA 4CLEA 2JKZA 4H7PA 1QH0A 4P4GA 1RHRA 3DXZA 1APBA 3CS3A 3LHDA 2PJDA 1N5KA 2XVYA 4ZTZB 2CVPA 1A7KA 4MVJG 2ZYIA 2QM7A 2B3DA 3NM5A 1KWGA 3VBEA 1UXIA 3ICWA 5EVJA 5HF5A 2BEUB 1TD1A 2D7JA 5KCZA 3PIRA 4YMWA 4A0QA 1V2GA 3GGDA 3PC6A 4IDDA 5THQA 4C21A 4NARA 4ITRC 5EJ4A 3RD5A 3I9KA 1AF7A 2FZWA 4JQSA 2F8SA 1U2QA 1U2ZA 3F6CA 4IDGA 4BDSA 2ILVA 1ADFA 3CRQA 3NKVA 2NUTA 4D3DA 1G5PA 2ZVPX 1PJ2A 1T5HX 2DG2A 2IUEA 4K05A 4E5YA 2Q0HA 4ZDJA 4CIWA 3TIIA 1Q16A 1S2GA 2JI7A 3WIOA 2QN3A 3SKVA 4B3CA 2X76A 2ODQA 3R5SA 1B2RA 5DCYA 1QF9A 5KNCD 1PR1A 3ZR4B 3V8PA 4BP3A 1FC0A 4R9VA 1RWPA 1PLJA 2Z2ZA 3E27A 1NLMA 1SG9A 4RA6B 3UV7A 1ZMXA 4V0NA 4G9BA 2PWZA 4EPVA 5CT6A 1JJAA 3R0QA 1M8JA 2PVPA 3LC7O 3X2SA 2PUGA 5K2MA 1I7QB 3C39A 2FETA 3LDHA 2O8VA 5CH8A 4Y3UA 3DEAA 2PZAA 3W6UA 3KR9A 3ZE1B 3LMKA 1EFDN 2C5SA 3GLTA 3ZPXA 3DCYA 1I5OA 4EA8A 4ERXA 1P2TA 4MKHA 4S35A 4YN3A 1I32A 1YDHA 3ESZA 3LLUA 4KIWA 3CNNA 2YICA 4W7IA 5EUMA 3TMAA 4RDIA 3CLSC 1II8B 3OOHA 1QWSA 3DNFA 4DCSA 3P7MA 4M0KA 3W9YA 1TUBB 4TT3D 5C3MA 1J8QA 3RT7A 1SRRA 1OT5A 2TYSB 5KTTA 1JJFA 1U28C 3FCXA 5AM1A 4YONB 2EKBA 1HURA 1AB6A 1Z5WA 1EK1A 3MUFA 4ZZIA 3UATA 5B55A 1WSDA 1HLFA 1HE1C 3IVMA 5C1DA 2XMQA 1O96A 1J0BA 2G25A 2Y1GA 3AYZB 3HJAA 3KBOA 3EC7A 3P2MA 4F8EA 1LPNA 1NUUA 5KTSA 5AKKA 2PD3A 3W8EA 4DV2B 2CMKA 3ZN2A 5EPOA 1VJ1A 1RHQA 4ZOLA 1OWPA 3A26A 5HA5A 4WADA 2F1RA 1M6WA 3Q8LA 2G1KA 4O1IA 3LUGA 4TV8F 3M34A 4D79A 1JDPA 3QWIA 4DPKA 1OZHA 4X8MA 3HFRA 4D46A 4ZHSA 1QGDA 2Q5FA 2QTNA 2VYVA 3NDJA 4U63A 1GRRA 2LE0A 3H2JA 1FDTA 1GKLA 4B3XA 4WAUA 2ZT6A 3RKRA 1CQZA 1LVGA 1T8UA 3L0BA 3NPAA 1SC6A 3OQIB 1EE1A 4WD3A 2P1DA 3MWEB 5GTDA 3BJZA 4CRWB 1PL6A 1KK1A 1UBLS 2E5WA 4X62B 3UJCA 4D82A 1W87A 2N1MA 4DQLA 3DEFA 1E1QA 2HK8A 3ESBA 3HR8A 3CQ9A 1QTIA 4UZFA 4Q3BA 5DHTA 1AGNA 3NNDA 1X7XA 1G21E 2B98A 2TMYA 4CMEC 5BPHA 5ADWA 4LVOA 4MR9A 1D8TA 1U9ZA 2AFIE 1R3UA 5K7SA 1YACA 2HYIC 3ZDBA 2PBRA 3D2AA 3P4XA 3NWEA 5CT8A 5F7JA 1NPDA 4AKTA 4N9WA 5IUJC 1Y5NA 3MUOA 1E7WA 4EW1A 1JZSA 2LKCA 4QYMA 3W5DA 2TECE 3F6BX 2CLDX 1X6VA 1J2YA 2B9EA 1JR4A 2OD2A 2XCOA 2ZS9A 1YC5A 1FU7A 4MCJA 4ASUA 4KRGA 4MVXA 5I4KA 3G17A 1C7QA 3JVEA 4L9RA 4POOA 2HSDA 1UKCA 3T3OA 3PX3A 3EY4A 5ES4B 2C2WA 3EIHA 1C8LA 3KTOA 1H5QA 2DPGA 3PDUA 3LQ4A 3VISA 2D62A 3CTPA 4US1R 2A35A 3NU1A 1S5PA 1X19A 4LBZA 4LXGA 1NX9A 1KP9A 2A14A 3VZRA 3H87A 3HZRA 1KSGA 4XYGA 3E2MA 2PX0A 4R2WA 1N7GA 2QZZA 1AHHA 3LUBA 3PF9A 2JFNA 4CF4A 5J4HA 3K0KA 5HP4A 2XA1A 5JCPA 5EMHA 4AF6A 3GEBA 1Y5LA 3STYA 3EIQA 1A5BB 3ELBA 4AO7A 2XB4A 3K5PA 2VSOA 2VO1A 1VE9A 5F5NA 4XWAA 4EYQA 2PMEA 2XUQA 2PH5A 1ZU5A 2AYYA 2W43A 4I1UA 4L95C 5EE9A 4AZVA 2XRMA 4BPRA 5AJZA 2W6PA 3IQEA 3JASB 2XVAA 5H4HA 3DBRB 2R8EA 3FZEA 3GQBA 5BMVB 5EE5B 4EPWA 3DBLA 4CFYA 5ILGA 3R9WA 1UDXA 1PCXA 4EJSB 1CZLA 4S1NA 5HJ5A 4UULA 5LFAA 3ZHCA 1S1MA 5FPPA 4UDXX 4H17A 2ZBUA 3EEYA 3IB6A 3WR5A 1G8PA 1CQWA 3NQ41 3HI4A 3ICOA 3TLBA 5CGZA 3QBEA 5ALMA 3KHUA 3FTFA 3U4MA 3LHSA 1Q7TA 2PQ0A 1XEWY 3FSRA 4PFQA 4XVUA 1P18A 1XDGA 2LCFA 5B3AA 2WWWA 3VHXA 1UXJA 3UAWA 4CT0A 3EHEA 5BV1A 4R1TA 1GUYA 2P6UA 4E70A 5FQNA 4B7XA 1GG2A 2R3SA 1O97D 2NO9A 6ADHA 1G4AE 3RVJA 1BA3A 1F20A 5D01A 4EGQA 2O2EA 4KVFA 1JG7A 1TDJA 4OI4A 3S2EA 3H16A 4ZEMA 4OREX 4G5HA 5J4LA 1HDRA 3K0FB 1NIPA 2NZWA 3R5XA 1E3QA 3B8HA 1FX1A 5FTMA 4EHIA 2WVHA 4J91A 1Z33A 1RDFA 5LMNB 4CQNA 3PIIA 3Q8WA 4L9SA 4NWIA 5JXGA 4DIMA 1ZUWA 2XWQA 2ZEJA 3DE6X 5K1ZA 1C9KA 1G20E 2GTHA 5IT0A 3LKBA 3IPXA 1Z4IA 2BEJA 3KKLA 1KOJA 4UFPA 3NAGA 3OF2A 3X2EA 1EFTA 1X14A 1Z2EA 3O2NA 5KPDA 2QIPA 3SC2B 3L41A 3A05A 4V03A 4AT1A 2OO5C 3C7DB 4BTLA 1NGSA 3CG4A 4DM4A 3UICA 3FLBA 1XRLA 4MQBA 3RK0A 3OEYA 3ZU3A 1L7QA 1DQPA 4A8JB 5CA1F 4URXR 2J32A 3LTNC 3GLHB 3USZA 3PNKA 4ZODA 3W6PA 1ND6A 3P9RA 2FSVC 1Y3IA 3WS7A 3BXHA 4FFPA 3D2CA 2DBQA 4DUGD 1H6DA 3L46A 4B4UA 4CFZA 1XCGB 4TLBA 4U2CA 2NTVA 3G8CA 4QDXA 1SC9A 2YYAA 4XVQA 5TF4A 5KTKA 1M2EA 2DH6A 2N75A 3A04A 4J6EA 1I30A 2QM3A 4TLDA 4R8RA 1WZ2A 4DDWA 5DBOA 1A96A 1MB9A 1MX9A 1POXA 2ZB2A 3PNYA 2VPXA 3TR6A 3LLCA 1AJEA 2GD0A 4RF4A 1NOIA 1Z39A 5FNZA 1I13A 3D1VA 3WB1A 4LJLA 4H7IA 3QTTA 4LXIA 3BRQA 3I9LA 5DNEA 3WLOA 4CEHB 3UMVA 2C1EA 3BGWA 4UJ5A 5LVAA 3N0VA 2Q99A 4HLUA 5I4BA 1L7BA 2O3QA 5T5QA 4HX5A 5TS3A 5E1BA 2C96A 3OZAA 5EE3A 4KFUA 5EJEA 4EO4A 4FB4A 1PT8A 2AZTA 5B2ZA 5D2CA 4JQZA 2X6TA 3T15A 3V00A 1SKUA 1E0DA 1G8JA 3PC2A 5EEGA 1JHOA 2IJGX 2X19A 4KEAA 4BRUA 3LU1A 1IVNA 1JFFB 4Z0PA 2Y92A 4YLGA 5ILQA 1ADGA 4O63O 1Y8CA 3FWHA 1Y4AE 2IDMA 4G56A 4KQCA 2EKLA 5CB6A 1PG0A 4IMJB 3ZBPA 3NDBB 2IPXA 3MRTA 4LE2A 4NS1A 1GADO 1JHZA 4LOLA 1UKYA 3H97A 4MLZA 5AK3A 1GR0A 2AC4A 2HNAA 1W581 3A3PA 3DMPA 3NATA 3C4JA 2WOOA 3RBVA 2YDXA 4ZI5A 3UJ7A 3X1XA 1N36B 1UXHA 2X1MA 2YC4C 1C3OB 2MYUA 2PKCA 3OAAD 4Z54A 4ZMSA 3SP1A 3R0VA 3KU1A 2FOLA 2OXFA 3WGNA 5JR3A 1RWMA 1N9KA 1LDNA 3O6VA 4GGMX 1THMA 3ZIAA 4LHSA 1XQYA 2CHQA 3DT6A 3IQGX 4DMRA 3R3YA 2COUA 1OXMA 2YNMA 2Z4RA 1EDOA 3EVDA 3L4SO 1AUVA 3LBYA 1XRQA 2JVJA 1Q0LA 4CF6A 4UQLA 3WMEA 4DC1A 2UZ4A 1S0UA 1C1XB 5J5CA 3AVWA 2JH8A 2Y71A 4ARVA 1QVWA 4BP8A 4ENPA 4HDSA 1BH6A 1A8SA 3GVPA 3EXEA 1U1EA 4K8OA 1AZLA 4BIMA 3FI0A 4MI6A 3L43A 4GW3A 3J80A 2HCFA 1TEZA 1USKA 1EUCB 1GTSA 2A5LA 2B83A 4TM8A 1EDDA 4G5RA 1BXKA 2NU8B 3UT5B 4ZGWA 3V4SA 4LJKA 1T34A 2VRCD 1EGVB 1F3OA 1OHHA 2HHLA 2R60A 2ATEA 2V7VA 4D0GA 3P27A 4L5YA 5TJ9A 3D8HA 4B73A 3SPXA 3ENNA 3A3NA 4WOKA 1ISFA 3FKSA 2LUOA 1CX9B 5EN4A 4YJFA 3E0XA 3IJRA 2C1XA 4HO1X 4LK2A 3V8BA 4UCWA 1RPZA 2ACEA 5KYXB 2YW2A 1DBIA 1RMTA 3B2QA 4Y0VA 3RC3A 3SYTA 3TDKA 1WB6A 2AOXA 2MSEB 4JUAA 5GONF 1GN9A 3R8XA 2PS9A 4TRRA 1G98A 1ZSNA 4ND1A 2MOKA 4R8KA 4DCOA 5J2TB 1E8DA 5LB4A 1EBUA 2A86A 1YKGA 2AV6A 1NXXA 1RRMA 2NXWA 1DWQA 1ACLA 3DM9B 3QXXA 4BE7B 4DYVA 3H2GA 3BC1A 1OXVA 1WVIA 1P7PA 5H9VA 1Q14A 3G23A 3FXAA 3VJLA 1EA7A 5K0NA 4KXYA 1JDTA 1U8FO 3GZNA 4AM8A 3H9CA 2C3PA 1Q6YA 1FYWA 1P29A 1Z2DA 3P5BA 3R7AA 5HMLA 5IFLA 1CF2O 1NJFA 2OV4A 3AY6A 3H5NA 3MJDA 4ZJYA 1Q20A 2BY4A 2X2OA 2E6KA 4GPEA 4OI2A 1H2RS 1NVMB 1U4OA 3M6FA 4FGKA 4M87A 1VA4A 1ENYA 3F7OA 1L4EA 1TMGE 2IOQA 2KHZA 2X13A 4C07A 1F7UA 4KHZA 5KTNA 4ZCRA 3AHJA 1QTQA 2UYHA 4E2WA 3WIUA 3CIFA 1QCCA 2LW7A 5TT0A 4Q4HA 4IHQA 4W7HA 4N3AA 1UFOA 2CBGA 2X1HA 2EATA 3AQ4A 3N7AA 4EGFA 4QBGB 5BSEA 4J4TA 4F60A 4A2PA 5AOCA 3GIWA 3U4HA 4C0BA 5L9AA 2DPHA 3DXFA 2IVFA 3ZWAA 1PWZA 3SMQA 1Z4MA 3ZJ5A 3X1KA 4YCCA 4D8XA 4XR4A 1XTBA 2OAGA 2AJLI 1MRNA 5UKDA 4YQYA 1YK1A 4TLLB 1KO4A 1EGMB 3LT1A 3RVLA 2JBHA 3B60A 2CNKA 2B0JA 3GLRA 1ZD3A 5I4IA 1CEEA 2J0EA 1CG6A 3AKCA 5B1IA 5B1EA 3TLMA 3MGGA 2OESA 1U5BA 3M0EA 1MEJA 1Z07A 7ABPA 4Q1AA 4OQLA 3KZOA 5C7YA 1B00A 4J0GA 3RM3A 1Y8AA 4Y2HA 5GZ3A 2EFJA 5AI8A 1R10A 2BT4A 1SKMA 4KDRA 4REQA 3BSSA 4JP2A 4Q1VA 3WYCA 4EL5A 1RJEA 4ZICA 1UMCA 2WDPA 4F4CA 3RTGA 4OGLA 5LUBA 4L5AA 5CLFA 3WK8A 2C2MA 4PZAA 1IZ9A 1QCDA 3TNLA 1SCJA 4GVPA 1YJCA 4QOIA 3ZZ1A 3QX3A 1ZN2A 3O1IC 4LY6A 3E9MA 5CIWA 5FOTA 5JFGA 4YV0A 4M89A 5F9FA 4WZAB 3FMFA 1W88B 2CXOA 4IXNA 4UTXA 2AI3A 3KWLA 4YP5A 3U5TA 2EP7A 1OFUX 5DFAA 2J5QA 1JG6A 1M3SA 4EDHA 1CUSA 4O4HB 4DEVA 3EXAA 3I6YA 1R74A 3GARA 1TMYA 1L4BA 1K75A 1M1YA 2YX1A 3D2BA 2W6IA 1FP4A 2QTFA 2P9HA 2W8BB 2BONA 2QRLA 2ZATA 5DF1A 5F4BA 1KQFA 1IWBB 2XYGA 1KK0A 2I0FA 1Y98A 4MVJH 1FS6A 3EUEA 4N6NA 3R7FA 1RBYA 2HSWA 4CTNA 5IAAA 4XAQA 2WHQA 1J8VA 4I4TA 3R6GA 2DLDA 5G41A 2AOUB 4IDBA 5I7FA 5IAJA 5C7OO 4B3RB 2AFHE 1ZCBA 2DC1A 4JI0B 3WK9A 2G9VA 3GLHE 3MWKA 2J46A 3TLEA 3OZIA 1P8JA 3N0WA 3ROEA 4TZ6A 3T5TA 3UOGA 4MRAA 5LKRA 5A5EA 1HLGA 2R2AA 1K2VN 1IPEA 4JROA 3P52A 2YFQA 5DHQA 4JEIA 2I80A 1NC3A 1SZDA 2WJZB 2NZXA 1L5OA 1J1ZA 2ISQA 4TRMA 3I2KA 2RD2A 4G8CA 3O1JC 2NYUA 4BNDA 2IY7A 1KVTA 1YNOA 2QE6A 3GRZA 2XNKA 4N41A 1N0IA 4JJIA 5JLJA 4DWVA 4KWTA 1TIBA 4O4IF 2QL7A 2ZU0C 3KJHA 3OJWA 5IVKA 1OASA 1PNQA 3NTRA 4XCXA 1KR5A 2CEAA 3S4YA 2HPVA 2XEDA 1G7CA 2P6OA 1FU8A 3KQNA 3NDRA 4FFVA 5DZSA 2OHIA 2I65A 3B9PA 1P9WA 2VLIA 3GVXA 3ZU5A 2HC9A 2HSZA 1U8YA 3N8KA 1DBPA 1UEJA 2GTIA 4GP7A 2I62A 1J99A 5EE0A 3RJ9A 3T3EA 5FPSA 1WXHA 4MA4A 4XR9A 1R8SA 1RPAA 1QNLA 2E82A 3TB4A 2Q8NA 5ITWA 4QT0A 1U8AA 5HYVA 3OQMA 1FPMA 2LPMA 4E14A 1YA4A 5CDHA 4LGMA 3UT0A 1QQ5A 2HN9A 2WU3A 4RIGA 4X1IB 3TI7A 1WDKA 2WJ3A 2YHUA 4A8PA 4ON9A 4PGFA 1I10A 4RHUA 1YB2A 2J3MA 4D4LA 1C8BA 5JT1A 3ENVA 1AE1A 3UMSA 4E5DA 3Q1LA 3QUCA 4MARA 1PEAA 1KNXA 1CNEA 1X1DA 2NIPA 2FWIA 2QRUA 2QSUA 5DNCA 4RHYA 5EZYF 2I9PA 1EP9A 1RCUA 4FX5A 2HQRA 4YT5A 1CPYA 2SKDA 3W2EA 4IZHA 1LRJA 2D6FA 2ZWPA 1TJ3A 2M32A 1O9BA 1S2LA 1Y1KE 2NUTB 5LQJA 2VUHB 1WQ4A 5LBUA 3HJUA 3N7UA 5BW8A 5L3SB 2HDHA 2UYYA 3KZNA 3H2KA 5KQGA 1P5RA 2XH8A 1E2GA 4Y2RA 1G6OA 2R6ZA 1XZNA 3KKPA 3NTOA 3AMVA 3B1WA 1RAIA 2BN4A 3KQSA 3ZV6A 1AHIA 3AI7A 4N0PA 5KHLB 3I1YA 4OXQA 4U7DA 4YCAA 3ROFA 1FTWA 2HMUA 1G9XA 3H17A 3ENWA 3ICPA 4HFMA 1PS8A 3KR2A 2RB5A 3KC2A 3LP6A 1X1AA 4N0MA 4BWYA 3JCZA 4IVRA 1D2NA 2ORIA 2PBLA 1SCIA 3HO6A 4OIFA 1IXSB 4XQCA 4L5BA 1FW8A 1NMYA 1WCYA 2Z04A 2I2WA 3S6JA 3FGZA 4JZKA 2NXEA 4LRYA 2A30A 2I6QA 5DV9A 1E3DA 1PR4A 5KSYA 3PC7A 5EFZA 3M9LA 3G9XA 1KMQA 4H16A 3ZHTA 3CUUA 1CT9A 4IHAA 4RACA 4YRLA 1D4ZA 3HHEA 4Q9IA 4BMPB 4HS4A 1D04A 4D5EA 4HB0A 5F5LA 3ANLA 1RJGA 2PX5A 2Q0SA 3KCNA 2GJ8A 3ZWPA 2BFOA 4WKPA 2B7LA 2E4YA 3LCCA 4LNAA 1M7GA 2V4MA 4FBLA 3HA7A 4L4RA 4LSMA 1E0AA 5IZ4A 1ZNXA 1CY6A 3ZS9A 4LWQA 1CKEA 2IXBA 2UUBB 2MSNA 3KNZA 3SI7A 5BOVA 3QELA 3QLUC 1S4MA 4A2CA 1QH1A 4ENSA 2RGNA 2GN1A 5BQXA 1SBIA 2FXVA 2GYVA 2YFHA 2YJ4A 3D4NA 5G1OA 4AJ4A 2YN0A 3K8OE 3OE5A 1FTSA 3AHFA 3C3JA 3KTDA 5GM1A 3UBTA 3PQ7A 1KOLA 1JJ7A 1M1NB 2QVLA 4P80A 4YRPA 3TTVA 4GR5A 3OEHD 3UCFA 4WPGA 3RGGA 2PANA 5CVEA 3JQRA 3C3PA 3L7DA 1CUWA 2LV8A 5B1HA 2P65A 2DTEA 3UN1A 1ESNA 3M6LA 1JIXA 4B87A 5BWCA 3R4CA 1Q74A 4P53A 1P44A 5AHKA 2IF0A 5ECDA 3OOJA 1T1JA 4JVMA 4WMLA 4OP2A 5JALA 1B16A 2D00A 3JATB 4K9MA 5JANA 3K0AA 4Q9HA 2HU7A 1EP2B 1IHOA 5BQPA 1X7XB 5L95A 1K89A 1IB0A 2FSGA 4MR9B 1N5OX 3MWDB 4GZ3A 3FUXA 1OI3A 2PSHA 5EWLA 4V1CI 2LP4Y 3DL4A 3IEVA 3KPUA 4ZQGA 4LF4B 5IDWA 1IB6A 5BYAA 1NBME 4QXRA 1R6AA 1GQYA 3QV1A 2VEDA 2WPDA 4I7EA 4ZT2A 1W4LA 1DV2A 3D7KA 3LXMA 3CG0A 3PCXA 4H4DA 5DBHX 4BQOA 2BGGA 1H3NA 2Q2NA 4UCFA 1WPXA 2NVOA 5SZHB 2ZM5A 3EA5A 1RWQA 4TGLA 4JQCA 1R18A 1IUKA 2OCGA 3CN7A 4P0TA 1O0CA 3CEAA 3GUVA 4R2MA 1JHRA 3BMCB 1QHGA 5IZCA 4P4NA 4Q9DA 4WZAE 4XQEA 4OAPA 4ER0A 2GPSA 2G07A 3HWX1 4PYMA 4FEYA 1RI3A 2Z6QA 1R66A 2W37A 1F8FA 1L4LA 3MRSA 2R4QA 2AGVA 3N8NA 1KNQA 4O2RA 2AF3C 1WBJB 1TJ4A 4MP3A 4FYMA 3VMFA 5KWVA 4JLMA 3AV0B 2WUGA 3K8QA 1VKZA 3V1UA 1E1RA 2XKAA 3EQZA 4BE4A 5KOYA 3NBZC 5ITSA 5KSZA 4R84A 4WTOA 3KKNA 2H65A 2XDYA 1EJ2A 2OLJA 3NRJA 3SHFA 5C5CA 3AF6A 4BFCA 3K94A 1I2AA 2GPBA 4LVUA 3O73A 4UBJA 2C5FA 5EERA 4F85A 4WFKA 4LZAA 4YJGA 1O7JA 1T15A 1OAOC 2VZ8A 3C98A 1OKKD 3EDRA 1F60A 5CT5A 2ZXEA 2A58A 2NSHA 4MQEA 1TC2A 2JLUA 2E2WA 1SA0A 2CNNA 3AI3A 1OY1A 5BN5A 4B3HA 3RADC 3CLRD 5HOEA 3FPAA 2XZDA 1RHKA 3L04A 4FYHA 3VR6H 3IVRA 3BYZA 5EJIA 1ADYA 5CA0A 1FX0A 1XV5A 2AUTA 1GFZA 4NP6A 3WLEA 4JSRA 4NCXA 1H65A 4JVLA 4O1MA 3VKVA 1YIAA 1GDHA 1U94A 1QDEA 2D5CA 2HRCA 3E2IA 3Q8XB 4UMDA 1IVSA 1XK6A 2B3TA 3JPWA 4HUQA 1FSZA 1SXGA 3RUEA 1U9JA 2E0IA 1CJSA 1I33A 4IX1A 3TD6A 3VDQA 3BHNA 3DEZA 1FNBA 3GELA 3C8ZA 3PXEA 4OBXA 2A1TR 1J8YF 2QAGC 1N3IA 4RY8A 5E8RA 1LVHA 4ZFNA 4LV5B 3OQNA 4PG6A 5JD5A 1XPJA 2P3LA 2JZCA 4UAVA 5HGXA 3TIFA 4LGYA 1UC5B 3OG9A 5AXAA 1ICIA 2X8WA 2IX9A 3SJUA 1N2CA 3V7UA 3HTXA 4CMHA 1U3CA 3GLFA 2Z09A 4IKPA 4YWJA 3QK7A 2JFGA 1TPYA 5T4HA 1NI5A 2WHPB 3JQBC 4TS3A 3ICEA 1MH9A 4O4JF 1Z6XA 1CLEA 2ZTMA 3BIFA 4G5YA 2XBLA 4U5XA 4HNAA 3IR5A 4HUTA 5A02A 3K6SA 4PR0A 4R54A 1SGWA 3DHYA 1OWOA 3FNBA 4G8BA 3ASUA 5COAA 5MN5A 2GXQA 1TTHA 1M1ZA 1P81A 4IAOA 1UZLA 2O2CA 2YVLA 2CLFB 3O84A 2P2NA 5DYYA 5A1TA 1DWOA 3HBJA 8OHMA 4EMBA 1D6MA 2YIDA 2Y9PB 2P2CA 1YL7A 4J7CA 1UC9A 4HDMB 4Z0NA 1TM1E 3GH1A 5IVHA 2V1UA 3I2HA 1J49A 4B6OA 4NCKA 1JSCA 5CW2A 2ZSDA 2IC5A 4EMUA 4F4DA 2PGJA 5JRZA 3GFGA 4FC6A 4ALMA 1ZW6A 5MF6A 1EJ6A 1O54A 4RIIA 2FEOA 1X74A 3RDPA 2WAAA 2FHSA 3OESA 3THWB 2QXUA 3W78A 4C3OB 1YI1A 1VJCA 3SLGA 1A9YA 1KJYA 1EKXA 1O6FA 3ZBQA 1G60A 3WMXA 4XIFA 3EFBA 5JZ9A 2Z6AA 2I6SA 4PZZA 1P6QA 5DYNA 1X7WA 4LPSA 4Q39A 5FUWA 1V45E 2OV2A 1KKUA 3BJIC 3WQSB 2HF8A 4AUMA 4M1OA 2H06A 5IJ0A 1FJ2A 4DAEA 3FVWA 2Q62A 1Y7LA 3M1IA 3MJCA 4GX2A 4U7TB 3SDBA 4BC0A 1HORA 4ZZ1A 2R1UA 4NZOA 2F8LA 3ZD9A 1DO2A 3R76A 3VZDA 3Q41A 4R9UC 2DPMA 1QBKC 2FMKA 3AFGA 4X91A 3E05A 5ICEA 1VHWA 1E2EA 3K1JA 2ZRNA 1T8WA 1FP6A 1ZGGA 4Q7EA 5JBNA 1C9YA 1L6RA 1HSZA 3AXTA 3C14C 4ZT4A 1J1UA 2XIJA 5JSHA 3IH5A 1Z25A 1WLSA 4S3MA 2OENG 4HAUA 4P34A 4A1FA 3WWDA 4UARA 1HDCA 3IRVA 2LIPA 3K1YA 2KLHA 2Q46A 1ZMBA 1IG0A 3NHFA 3UJ3X 4CZ2A 3SSAA 1SEVA 1TIPA 2CD9A 2ZTLA 4D9MA 2IU4A 1BIFA 1OZGA 2P1RA 3IAM6 5H80A 4I8IA 4C5BA 2ZYSA 4OB6A 5D86A 2DFKB 5CEEA 3MVEA 4HXGA 3TJRA 3EH1A 1N2JA 1NMSA 4PINA 5LIPA 1ENPA 1MO5A 221PA 4C22A 4PNEA 3D4IA 2W2XA 4LJAA 4FU0A 3HDQA 2PKWA 4GIBA 4XIJA 3E4CA 1EK2A 1U0FA 2OBBA 3KKMA 1P0FA 1DZIA 1GAQA 1MO3A 1ZJ5A 3OZRA 4MSUA 3E3LA 4QXPA 2GGSA 4UFOA 1K2WA 4OF4A 2JK1A 1VBMA 3NXSA 3RS0A 2UXBB 4ABTA 1HTBA 4J2OA 3GJ0A 2H85A 4PO9A 4B8WA 2H4JA 4FD3A 1S9HA 1VG1A 2R25B 4JT4A 5CK4A 5HUHA 4LJ6A 2AS0A 2QPLA 5B4TA 3KOWA 1ZD9A 4CI9A 1X1QA 3INGA 1BD4A 3ZNQA 2CGEA 4P5PA 4WASA 3WYBA 3VO9A 3ZEIA 1AA6A 3G1WA 3MQFA 3O2QB 4TTJA 3ZCPA 2IGTA 1LI4A 1XRNA 2PRIA 2Z9BA 4OHBA 4TWAA 5DCLA 4B3GA 3VYRB 1EI9A 1SIWA 1USWA 3OA0A 4OXRA 5FJJA 4Q9AA 2CJWB 3V2GA 4YRTA 4II2A 4C2TA 3JQ7B 3C74A 1NR7A 4BB5A 4YJFB 1Z5UA 4ND6A 4W63A 1Z6PA 4QOGA 4Y18A 3WWCA 1OAAA 3GF4A 4HDNB 3TTTA 1SVLA 1UBTS 3IPYA 4QRHA 4BE9A 3TAXA 4C7MA 4O2AF 3DOEA 3MCWA 1V9SA 3DCNA 5EAIA 5GWXA 4KE8A 3TKAA 1PTJA 2H2DA 2NPOA 2PLNA 3C5EA 4ETWA 3A7EA 3O0DA 5DLQC 1M9NA 4EEZA 2I7TA 1M6NA 1EH5A 1NWCA 1NUHA 2OK8A 3ESCA 4OJKA 4BNZA 1X3LA 2REXB 2A1IA 3VZSA 2WKSA 1L5RA 3EF3A 4GGPA 2IHBA 3W5JA 4YRBA 5TJHA 1IBSA 3GZNB 4HRYA 4RF2A 4G41A 4U7GA 4Q19A 2ZS7A 4RDHA 2JGRA 1Z2OX 2G0NA 6PFKA 3C7TA 4B6RA 2QIOA 4F45A 3THRA 3MT8A 5D3KA 4P36A 3AY0A 5CBPB 2BTQA 4GMHA 4ICIA 4QQNA 5KAPA 1B43A 3ZOZA 2DWCA 1BX3A 4MGYR 2WSSD 2X15A 2CFIA 3P9XA 4QUKA 1Q7BA 4RO0A 2R7KA 3WGHA 4ECAA 2F3RA 4FHEA 4GOND 4U9UA 1GTZA 4J03A 1TIKA 4J4BA 2NP6A 3BFPA 4UUAA 4Q9NA 4DWWA 3NP9A 4HEQA 3WRWA 4DR2B 1FZTA 2FPKA 3MMSA 4NBRA 1MB0A 1M1UA 3EOBI 4TSRA 4UHJA 4LTDA 1TECE 1CUZA 1DUSA 1HDOA 1JPUA 2P77A 2Q6VA 2VZ9A 2A0WA 1PJBA 4IDNA 5EZ5A 3R8CA 2PYDA 2QP3A 1NLYA 3EZLA 2K7FA 4KPGA 1YS4A 1LXCA 2GUGA 4GZ6A 1NP6A 1AY0A 5CXQA 3WX0A 4F56A 2ZJ7A 3R1IA 4Q1BA 2DSTA 2FEWB 4RTJA 3HBFA 1C9MA 5TQJA 5JAQA 1BROA 3EGDA 1UXOA 1OQAA 1U5BB 3ZUPA 2QHXA 4DCMA 3H11A 1KSHA 3JQGA 4QNRA 3ZI7A 3ZDCA 4ARAA 2P67A 1FTYA 4M7PA 5EHQA 1ZIDA 3G2IA 1F48A 2EX0A 4REQB 3G0OA 3VPXA 1J23A 4EVQA 3L05A 3X1WA 3QVXA 1UMCB 5KX5A 2VJMA 4CU2A 1BVYF 3TG2A 3C87A 3HQ4O 3KEQA 3R20A 4JU9A 3WGGA 3ZCSA 1JHPA 4DDTA 1Q91A 3ANTA 4YPFA 1UMDA 4KLAA 3TQSA 3KIPA 4C6RA 4EAAA 1B73A 4QODA 1LFDB 4YCDA 1WZUA 2WTEA 1FVFA 2WV9A 5BSRA 1U6KA 2XWJI 3OCVA 3U3DA 2BKAA 3VV3A 2DHRA 1RW4A 3HKBA 1W96A 1GQ2A 4KLNA 2DQSA 4E46A 1M1YB 1FP4B 5BWNA 1RLIA 1YZNA 4IYRA 5HGJA 3FNEA 1O4VA 1UXGA 2MSWA 4I4TB 4KQ9A 1KORA 2IHUA 2IDZA 2P79A 3WNQA 3H9QA 3JZFA 4F8JA 5AJTA 4KUGA 3OQPA 5E4FA 2QX6A 4RCYA 5EXPA 1XRRA 4KL8S 4BLSA 4EJ6A 4KO2S 1RXWA 4WI1A 2P75A 2WYWA 2YFKA 2PV0A 1RQ7A 5FR2A 2XPCA 3T9EA 4Q3CA 1UR5A 4R1OA 4BNLA 2VCEA 4Q9KA 2YN4A 3B2EA 1GSAA 1USVA 1EINA 2OAQ1 3ASVA 3PD1A 4MWBA 3ZHBA 4BKQA 2TMKA 1P91A 3VR2A 4DM7A 3O83A 2XE7A 1DQZA 2O3RA 3TVYA 1H0SA 3U1BA 3JWJA 3E5RA 3ZWYA 3EZ2A 5CB8A 3HR7A 2RBEA 1RQXA 5FL3A 3PE3A 3LECA 2XYPA 4CCWA 1LW7A 2J0UA 1C0EA 2F4NA 2PH1A 3K4HA 1SXJB 1IRIA 5TEVA 4YR7A 3A6FA 3JVIA 3Q7SA 4UJ3A 4JHLA 2GAIA 3R3VA 4BV3A 2R87A 3DHNA 2OP1A 4D8VA 1M74A 1THTA 4WA8A 2OXRA 2FPLA 3A7DA 4G36A 2C99A 3LBIA 4UDYX 4N8EA 4LE0A 1FEZA 3H9BA 3H5TA 3DWEX 5ALQA 3PC8C 1KJQA 1ODFA 3LJKA 3Q5DA 3PUHA 3CRRA 4XYMA 1EEHA 2Z8YM 5FV4A 5C18A 2WJPA 2IZ6A 3ZD6A 2WUFA 4QSHA 4KN9S 4WN9A 3DTYA 1CS4C 2ECFA 1W30A 2HV9A 3F6SA 2BSXA 2HT6A 1TU0A 1T8SA 1NMQA 2ZETA 1F0NA 1FXWA 3EDQA 4XARA 3U80A 1HYEA 5A7FA 3PEYA 3K9NA 1PS0A 5MN6A 4X7MA 1X1SA 1CVIA 2B69A 5IAEA 4CIBA 1QG0A 2XOKD 4LGCA 1FDIA 4BLPA 4MHOA 3TOXA 2I4MA 1SQ0A 2RARA 4M8IA 3DMGA 4TV9F 1Y4DE 4KE7A 4M38A 2HU8A 3FRHA 3WGTA 4EY7A 4XRGA 4TMFA 2B2XA 2ERYA 3ZDFA 2NADA 5EFOA 4FS3A 4A9AA 5LU9A 3IEKA 4EENA 2O7SA 3AJDA 3RR2A 2DETA 5D3MA 1PZHA 4JVOA 4PZPA 4EABA 3BWYA 3OT5A 4UCQA 2DFLA 4D25A 1P75A 1ZMRA 3SYNA 3I5YA 3PL1A 3LXUX 5E3IA 2JGMA 3OZ7A 2BFFB 3IDQA 3B1ZA 1KE1A 2ECPA 3ABZA 1ZL2A 1LC3A 1JBQA 3DZIA 4GYWA 4V0LA 2GAAA 4PIPA 3DWGA 2GMWA 5IYZF 2A59A 2XMZA 3FTCA 1Q0UA 4JK3A 4R6XA 1II0A 1GNLA 1SZPA 1UDWA 2FG6C 4ZU6X 3UMGA 4TSFA 2Z0MA 1GQRA 2OLKA 4LISA 3JVUA 4L3OA 5CFMA 4U00A 4DCNA 1CQIB 3H4IA 4LRTB 2FW0A 4GKBA 3EZGA 4KI7A 3IT2A 1VB5A 4MHSA 3TGPA 4YDSA 1M66A 5C53B 2K87A 2EWMA 2WFAA 3K1AB 1R4NB 2OB1A 1US8A 3UYLA 2DQ4A 2GEBA 2MTBA 1KL7A 4YB8A 2Z2XA 3L92A 4C2BA 1U65A 4KIJA 2G8NA 5CFRA 2QG4A 3M9XA 1DJQA 3G82C 5IABA 1EVIA 1G8AA 1IBCA 1W9HA 1ZUD1 3IQZA 4FGWA 3G7SA 2EX1A 5JSZA 3LK7A 1PHRA 1DADA 5ECWA 2F8MA 1ZCFA 1ZM2A 2IEAA 2CEKA 3GD7A 4F4HA 3E48A 5G3YA 1C9NA 1S3GA 1U0TA 5ALSA 1F7VA 1EFAA 4F1WA 1QRUA 1VLLA 4C14A 3I6ZA 3FE2A 1YVUA 3HY3A 4MRMA 4P33A 4W6QA 4UXJA 4LAFA 4AF8A 4MLCA 3IP7A 4A82A 4ES6A 1LDGA 1RCFA 2K6GA 3GLGB 5ECGC 2Q0QA 1KY4A 1FBNA 3RUCA 4EVSA 1QH1B 5C80A 2A9RA 1UJ4A 1U1FA 1N5RA 5F2EA 2P4QA 1GT91 2ECOA 1TJPB 1XI2A 1ZG3A 3TW8B 2M98A 3D6HA 3RVMA 2GVZC 1D09A 3FPGA 3PIDA 1XTSA 2SKEA 3IR7A 3KKZA 1AUQA 3OBIA 3PE6A 3WOVA 5L53A 3PKIA 4IUBS 4Q1DA 1QPBA 2Q9CA 1OFHA 4F0JA 1XTKA 4DR5B 1SBTA 4N5LA 3G0BA 4KQIA 1OX6A 2ZPAA 4TQUS 1X8JA 5LZ7A 2PYZA 2RK6A 1IC6A 1RRGA 4QBIA 2NUPB 4PTLA 3MEQA 4W8HA 3UF0A 4D9JA 4RKYA 4A0SA 5E7QA 3FYCA 2VWQA 1QZXA 4JT8A 3MCVA 3NHKA 1SUWA 1JNXX 2CUZA 2QRPA 4DHWA 2PY6A 3K0AB 5KOJB 4PGMA 2VDNB 3ABOB 3LDAA 1ZXXA 2GBCA 4K6KA 4L8GA 2BHTA 1RT9A 1EWQA 3ERCA 3WJ2A 1PN3A 5B36A 1FIUA 2ACKA 3ZCTA 3COSA 5LXTA 3CEMA 2P6RA 4MO2A 2QEQA 5TF0A 4EY4A 7REQA 1Q50A 2HBZA 4RPLA 3USES 1KYWA 2W2TA 4Q93A 4WCVA 2WD8A 4MQFA 3RUIA 3I2JA 2DTXA 4IINA 4E09A 4J43A 2JVKA 3A1CA 4K3UA 1JHYA 4RTSA 4RENA 2L69A 1SVNA 2JIPA 5HDQA 2HCRA 4I5IA 1IPHA 3CLUD 2W0MA 3ZEAA 2WI8A 4J0IA 1W5EA 4Q9LA 1CJCA 1N9GB 1O77A 4NHOA 1OYWA 4A27A 1LCIA 3SICE 4YEDA 4W7SA 4Q24A 4KLCA 4B82A 3NM6B 4G25A 3E9NA 5TPWA 3TQHA 3UJHA 3KZ1E 2WE7A 4G0QA 5C31A 2GFHA 1OGJA 2QUJA 3WBKA 3UJ6A 1M1YE 2PXCA 3RUFA 4URHA 4RDCA 4Z9BA 3ND7A 4D6XA 4BIIA 3V8NA 1GXSB 3ZH9B 3VDMA 2C77A 3T7TA 4V2IA 3W05A 3G2KA 1Z0UA 4KDFA 1PG2A 1KMHA 1BQEA 3Q7IA 1FUKA 4D45A 4KC0A 1XCBA 2WEKA 1NBMD 1XTIA 3IOBA 2GYUA 1ZIYA 4WXHA 4B0OA 5BWOA 4Q1CA 1W49A 2OBMA 3SIRA 1YK0A 3WGMA 3WO0A 4O25A 1XELA 2A33A 2CB0A 4YCJA 1IUNA 2RGYA 3VKGA 9ATCA 2QBYA 5IMSA 2I3AA 2PZJA 4PXAA 4IEFB 2Z6UA 1DC5A 3WP0A 1UADA 2IT1A 4IV5A 2HWWA 4L0QA 1NUSA 2JEYA 3FFBA 2XA9A 4OKIA 3HFGA 2CYAA 5KYWB 3WSVA 5A4KA 2QV0A 4ZV7A 5BN5B 3HXMA 2FZ5A 3TQCA 2ZKLA 5EXDA 3OIWA 5IRCD 2J9GA 1MIHA 4W9MC 3CKYA 3DPSA 1FX0B 3B3FA 1IY9A 3OM1A 4D74A 3WGZA 4F11A 1XDZA 3SHOA 4DVGA 3SX0A 3U4CA 3NHZA 1SVKA 4MVJF 2UUAB 3DF7A 4TMWA 3LGSA 4OLHA 1SXJE 4ZHQF 5AW8A 4ARIA 5FWYB 2PWBA 1I6MA 3FG9A 4BHTA 3V4LA 5JNWA 1B93A 3UYKA 1QZUA 3TTSA 4TN5A 4RD3A 5KYTA 5JJCA 1E2QA 4WX2B 1AKTA 3ABIA 4PQFA 1R00A 4PPNA 4DJTA 4CF7A 2NTYC 5AVUA 1GG5A 4RL6A 2ZJ1A 3WYDA 1IJBA 2O2JA 3WKDA 4UUNA 5EGSA 1N6NA 3KAQA 4S2UA 1U2PA 1N2CB 4GGOA 4R2HA 4YJ3F 3RS3A 3HXOA 3GLFB 1KJJA 3JYHA 4G1BA 1IN7A 4EG6A 3LUHA 1LA2A 1BS1A 2WLSA 2PJRA 1BFDA 2P6PA 1U2SA 2V7GA 1ZEJA 2WM9B 2PFKA 1U7PA 1WMFA 4HNAB 4MUYA 3K6SB 1IIRA 1XD9A 5E9AA 2FJPA 4RABA 1LK7A 1WM1A 2FSFA 2GVDC 3H18A 3KYCA 2HH9A 5ECYA 4RD4A 5B1DA 5IBQA 3CCBA 3FBTA 1PW5A 3OQOA 5H3CA 4DLZA 1KJ8A 4KXFB 2V7QA 2XSZD 1D4AA 1C7RA 1NYQA 1USIA 3DO6A 2VRNA 1YGPA 2G36A 4EPXA 1W1WA 1QONA 5AHXA 4OO3A 1XTPA 1U5AA 4WHMA 3WE7A 2ZSAA 4V3BA 2DHDA 4MUNA 4OHFA 4YH1A 4KHPB 1Q11A 5BN3A 1LDEA 2XMSA 4UOQA 1BJTA 3FDJA 2ZSUA 1RXUA 2IUYA 4G9EA 3NC0C 2GHQA 2V7PA 5GV7A 4JYBA 3TRHA 4RY2A 2Y1CA 1JTEA 3PJRA 4CDGA 3AM5A 4J0EA 4O29A 2RONA 3M4XA 1JAXA 4PZDA 3VUEA 4KPFC 4OQ4A 1OYYA 4B44A 3QU5A 3OQBA 3OPYB 2NACA 2P0AA 4MV7A 5AW2A 1U7TA 1X7WB 4C06A 1V8DA 2P2DA 4E2XA 1CK4A 4P98A 4IF6A 5BSUA 4LNUB 1K8QA 5BR7A 1ODCA 5G4LA 1TLFA 1VKOA 1FE8A 4BX0A 2NV2B 4KRXA 3QPVA 4MIEA 4EFKA 3HJRA 1JFSA 1YRWA 5I5EA 1XEFA 4MS3A 1Q19A 5ES3A 5GP1A 1ZHHA 4R0VA 3GD5A 1WP4A 2A57A 2HMTA 3H1TA 3NZEA 2IDKA 4JN6B 2R5WA 3JD1A 4RNCA 1FDVA 1SKQA 5LU8A 3D7LA 4IXTA 2ORVA 2JIOA 3B20A 3HACA 1IDN1 4HDQB 5JCXA 3IFSA 5LMUB 4KFCA 2DUMA 1DE0A 3CZ4A 1SIBE 3E5MA 1O9GA 2G6BA 1BYIA 1K5DA 3CNLA 1FMTA 1DPFA 1RM4A 3NHYA 1SOMA 1XAHA 1ZOLA 1HFEL 5KNDH 3SQNA 1OC4A 1KYZA 2J4DA 2ZJ4A 1P0IA 2ZB8A 3CNEA 3PHGA 4NPAA 4BYGA 4LPKA 4EYGA 5B7NA 4CMIA 3IDOA 1O8BA 3F5MA 1DC3A 1JAYA 1RQGA 5JZVA 2HFJA 1J0AA 2PSDA 3A27A 5I7WA 4X00A 2VI5A 1JNYA 5D87A 3SEFA 1HH4A 1MB4A 3K1ZA 2PS1A 1NF2A 1ORWA 1C80A 2VK4A 2VA9A 1KI8A 4FR2A 2HJWA 4AWBA 3GQVA 1ZLYA 2BCJQ 2B1JA 4J7AA 4OHOA 3RVSA 5J2TA 1ZIOA 3R3SA 4P93A 3S8EA 5CDSA 3IVGA 4Z7QB 5HKBA 2QVZX 4ACAA 4AB1A 3IBTA 3LRTA 3QWBA 2PCLA 2GYYA 3UMRA 3VNQA 1JVBA 3WMWA 2C57A 1K6EA 3DVSX 1RC0A 4OQDA 5E7IA 3SS9X 3G0CA 2IYSA 1SUEA 3ABQB 5F5XA 4RYDA 1CULC 1MG0A 5A1JA 5KVAA 1L8AA 3OPQA 3LVFO 1MFPA 2JBAA 5BY2A 1XF1A 4C05A 3IAEA 2IYTA 2NNLD 2ONKA 3T1YB 3EQ9A 3FCOA 1W5FA 4K9SA 1A97A 4JY7A 2M1XA 5IKXA 5B3KA 2R84A 3BWVA 3M8KA 3KO8A 4N5NA 1K6MA 1U1DA 3AZOA 3H8WA 2XWBF 3FBWA 1M6EX 3K5WA 5CYPA 1PZXA 4KR6A 2ENWA 4MWSA 2PZFA 2I4OA 4ER6A 2BKLA 4FJ0A 1ZJYA 2HL6A 1ACJA 1MNAA 1RWKA 3LPNA 4X3CA 5CITA 1YHYA 1W52X 3L3BA 1AZSC 5ED0A 1XXHA 5KWJA 5AVSA 2VYVD 1K5HA 4ILEA 3G5UA 1VE3A 2G71A 3PD0A 5EJ2A 4F2WA 3VKHA 4XQ0A 1U0EA 1HPLA 3KEGA 3RIYA 3R77A 2WF5A 1U7HA 1BH2A 4N18A 1PKXA 4PLHA 3ZWWA 2A9VA 5CM2Z 4IW3B 4OBWA 3DO8A 3EN0A 4MV9A 3U40A 1MN6A 1YRLA 2C29D 3D6NB 1L5KA 4GP6A 3VSEA 1E1QD 2BTQB 4RIFA 4DUPA 4CUKA 1C8VB 1K8ZB 1L5VA 1TT7A 2O2GA 2VP9A 2VDLB 3LK6A 4JLSA 5CIYA 4ZOLF 1KBQA 1KETA 2AE1A 2PZMA 5GZ1A 1UP7A 3NTQA 4U7WA 2Z2IA 3BG5A 1DEXA 3F8TA 3J81A 1QJ4A 3PGKA 2JLVA 4HB4A 5FOQA 4LYJA 4S12A 3BM5A 4A3SA 1JJIA 3N2YA 4F2GA 2FEXA 4NQZA 1NM5A 4L5JA 4DCTA 5TGZA 4MCAA 1A2KC 2HRDA 2OORC 4AKSA 4F3YA 1Q0PA 2X5XA 4RQTA 2QTZA 5AJXA 3A9CA 1D0VA 1SIOA 4ASUD 5MGBA 4UHHA 1AGRA 1UJCA 1EDBA 1V47A 2Y1KA 3AYXB 3CF6R 4L75A 2QN8A 3AHDA 2VK8A 3NJ4A 3LUPA 1JIUA 4DBVO 1EWRA 2P9JA 1WXGA 4Y2PA 1N92A 3SZOA 4P54A 1J09A 3EGDB 5ERYA 4PRZA 4FZ3A 5H82A 2PU7A 1FUEA 1BEEA 5KYKA 3H11B 5K0TA 2L42A 3GWGA 1BVUA 3OCZA 5CLGA 2EP5A 4R31A 4HDOB 2WMDA 2XMGA 4L16A 4EH1A 2WWVD 1SIUA 1T2FA 3K70B 1H2ZA 2GEFA 2JB9A 2JCGA 5EC8A 5KX5B 2VJMB 2VNAA 3MD0A 1FVHA 3CRNA 3DBHA 3PLRA 4FILA 3IT1A 3MQ4A 4Q03A 2IZOA 5HMMA 5AVXA 1DGQA 2TRSB 1WTAA 4K6CA 4EUEA 6CHYA 5FX2A 5P8WA 3BMNB 3Q0TA 2ID9A 3KLNA 3DL0A 4M21A 4UW9A 5GIOE 2A78A 1EAMA 5AVJA 3DAFA 4AWAA 4Q7LA 4FIZA 4EY8A 4FDLA 4MUIA 1GUDA 1I4OA 2YWDA 5FNVB 4GVLA 4WJLA 1EGQA 2ZW9A 3TZBA 4EY6A 4RTNA 1BA2A 1OBCA 5CVVA 4CG0A 3AI1A 2C3OA 3HKBB 4DXAA 2QL5A 3AINA 5EIFA 4ZTUB 1N2CE 3KEOA 3T0IA 3WMFA 5BURA 2V6JA 4W5JA 3GLFE 4EMTA 5DK4A 1DEOA 1I80A 1ZITA 2PA3A 3EK2A 3WDSA 1VIVA 4QL3A 3T7EA 1LEHA 4ZAFA 3D54D 3DQQA 4CXMA 1N6KA 4P0QB 1AGXA 1RI1A 2PWAA 3HZOA 3U44B 1PNRA 3KWFA 4KBYA 4OXYA 2IXEA 1H4QA 4HP8A 2XD4A 2CW5A 3W4KA 2Z83A 1P45A 1NXVA 4QUJA 4HEJA 3RT9A 5KU7A 5AI0A 4I36A 4LZNA 1PVDA 2B20A 2J87A 1Q3KA 1TZCA 2ONCA 2W4QA 4EPRA 5HJEA 2VTBA 3A4IA 1J39A 2J6CA 2XUKA 5CPFA 1R6DA 4AXBA 1M0TA 3PHBE 1K08A 1DBRA 4H7DA 4MQLA 3FNIA 2ATVA 4BRZA 2NVBA 1XPUA 1IHYA 4A0GA 3WLAA 1ZAKA 3MIZA 5GJWC 3LC1O 2QQGA 4RPCA 2C2OA 3EA4A 1NSFA 3NIGB 4DC0A 4RXTA 4F3KA 1T2UA 1Z17A 2XW6A 5FA5A 1VI5A 1QRAA 2XCIA 3WIEA 1I0ZA 1MOPA 1QGOA 2VNIA 4XSHA 5KYYA 1SOAA 1P1KA 2J0UB 4HB3A 1JLRA 3PQ3A 3E3AA 4HL6A 1AKEA 4X1YA 1YJQA 3TEJA 3HBMA 3L8FA 1O94A 5M34A 3U2QA 4EA9A 3DLAA 2QLNA 2JAXA 3I32A 4HPXB 5KDOA 3BHIA 4TT8A 4BTEA 2QW8A 2AXNA 4FNOA 4OMCA 4TQGA 3RVBA 2J5XA 4TTSA 1ZJWA 3H1PA 4OD0A 5A2QA 3HXPA 3O4JA 2AKEA 1G6HA 4OLAA 1U63A 1K63A 3F5QA 2O5CA 1YCGA 5LLDA 4RU1A 5JWHA 4YRRA 1X1TA 1RBZA 5EZSA 4CF3A 2QT9A 3MT0A 3TFOA 4AUNA 2R44A 2QV7A 4FNGA 2W8ZA 2AX3A 3M6VA 5BOSB 4CNQA 3TQRA 2VJLA 3G9QA 5KCMA 4FGZA 3PNQA 5TX7A 2MYTA 1A76A 3BOSA 4EUHA 3GEIA 2Q3FA 5EJ8A 2PZLA 1ZNWA 2BM0A 4I55A 1LSOA 1CUIA 3K9BA 2HX1A 1ZRMA 3QEOA 4XRRA 4LJ9A 3WYAA 4B75A 3ZHSA 2CLIB 1RQNA 1AO0A 5JCZA 1P7WA 1Z35A 5LB2A 1N32B 1XE3A 2VFAA 4GI2A 4F1KA 3VX3A 3X1ZA 2GFIA 1KO5A 3B6MA 3UXYA 1E2IA 5D3MB 2ZJOA 4K0RA 4NFLA 4WESA 3OLXA 1F4LA 1RVV1 1U0HC 5IG2A 2R6CA 1Y5IA 3U9TA 1ZS9A 2EX4A 1U3UA 4MJ7A 3NMUF 2D2EA 4RV9A 5TNXA 4ZZ0A 5IN4A 4DV4B 3LQ2A 4L85A 1ESEA 3A11A 2V9ZA 4IILA 1WVGA 3KU4A 1YA6A 3ZVLA 3EGXA 5KREA 4J8PA 3L1IA 1IK4A 3VDXA 2ON6A 1DKMA 2C9BA 1VTKA 2ZYTX 3MTJA 3Q5GA 4P7JA 4RMIA 4PQYA 2DU8A 1POWA 3DA8A 1WY7A 4X3PA 1O6CA 1JKJA 1XJWA 1YIOA 3FOCA 3KSMA 3K96A 3MA0A 4RK6A 1Z47A 4JJAA 2CK3A 4OOFA 4YP9A 1XZGA 1GZ3A 1U2GA 4DWJA 1DMRA 2E4WA 1DX9A 1Z7EA 1L4HA 2OD7A 3MPUA 4O8CA 1U8TA 3HU5A 2HFKA 4Q7JB 5SYMA 5DX0A 3WGLA 4QFMA 4DJAA 3RAEC 3ISVA 4LJ4A 2GK7A 3NDPA 2D1YA 4I4LA 4B8ZA 4UAUA 5CK5A 1US8B 4IIBA 4MB2A 4ND4A 2ZDQA 3BZWA 1QHNA 1KK2A 3D3JA 4FFSA 1J5XA 3V6LA 1PQPA 3VVMA 3ACBA 4RAQA 4GM1A 5C5IA 3X1JA 2MYPA 2PZKA 2DBRA 3C8HA 1JFTA 3SSOA 1Z88A 3CX4A 3BA6A 4MUMA 1QO7A 3NV9A 5JSZB 1OJ7A 1UAYA 5CFQA 4EVIA 4IP0A 2JFZA 4PYRA 4YCNA 3LWNA 5BPFA 1Q95A 1G8YA 2NXJA 5DW0A 3HK2A 1AHNA 2YNMD 4U6QA 4IUDS 5TGTA 2X8LA 4LDNA 1PR3A 2H57A 1RRVA 2ZT8A 4OJNA 5LBTA 3HMKA 1ZD2P 3INYA 1ZWKA 3WSTA 4ZIRA 4MRMB 4RZIA 4IQGA 1R12A 1RM3A 1BHQ1 3HCPA 3EF1A 5AXBA 4ATNA 2F9FA 5K0EA 2LXNA 4JBXA 4UNSA 4NBNA 4WLNA 4LSGA 1T4BA 2VDMB 3DOUA 3NC1C 4OFZA 1NUPA 3LUAA 2OAP1 5J63A 4CEIB 4U0KA 3ZD8A 2W22A 3BX1A 3TLCA 5KJ1A 3GRRA 3HFJA 4RX1A 4WUVA 4B34A 1XGKA 3A4YA 4ZT7A 1KQNA 1NG1A 1OHHD 3K6KA 2A9PA 4ZP1A 4B3FX 4CDMA 1QR2A 2CDAA 4FMDF 4IKEA 4IHJA 5P21A 3UAGA 5HXAA 2Y2VA 4DQXA 4EBFA 4EG5A 3FKSD 2VQSA 4WXYB 3H6HA 1O58A 1KDPA 4ZYYA 2YHIA 4PONA 2FR1A 2Y1EA 4ZC8A 2DSNA 3L4BA 4MK4A 4Y7CA 1AXEA 1G3UA 1J21A 1U2DA 4JWTA 3CPHA 3CW9A 4OB8A 2CFOA 3O8DA 5CLIA 5EJGA 1I2BA 2WP8J 2WVGA 4GLBA 4KYIB 1RP7A 1OBHA 1QYWA 3IUSA 3G0IA 3KKQA 1TK3A 4PG4A 4C9BA 1FNCA 1TK2A 3FDXA 2ASEA 3B51X 1QH8A 4YREA 4BJ1A 3WKCA 5EEHA 4A03A 3V1MA 3SBEA 3NRCA 4QIHA 3HKDB 1VJDA 2AB0A 1VL0A 4GPZA 3EBOA 2UVDA 2O2YA 3DE5X 3D59A 3MTGA 2R48A 4GXRA 4MQFB 1AKRA 4NZPA 3KQOA 2NUAA 1X15A 5FXMA 2BKUA 1WSAA 3O4GA 4ZAVA 2F1JA 4L9AA 3WLPA 1IHPA 2W48A 2VQ6A 2B25A 2JLYA 5DCUA 1L9KA 2WMYA 1DRKA 3BH0A 2B4YA 1XBTA 5HIKA 2P5TB 3SF0A 4INOA 3VQTA 4D9HA 4ALJA 2EBFX 2QPOA 3JYPA 4FSDA 5COQA 3U26A 4L7VA 3O03A 5ALRA 1Z9BA 1HLDA 2OBLA 4G5XA 6GPBA 5LLTA 5HQ3B 3DAYA 4C3VA 1VHQA 2WIGA 1SCUA 4D9FA 2L2QA 4J07A 1UM9A 1Z0SA 2BGTA 1GG9A 5DTQA 4K9PA 3HXLA 3FCEA 2IHYA 2JH9A 2Z5FA 3OJFA 4DCUA 1QSGA 4QJBA 1Z4KA 2CLLB 1KMHB 3BN3A 5K0ZA 1Q57A 4K40A 1EJ0A 4DQDA 2RHLA 1V2HE 1WO8A 3VYSB 3ZXXA 1QAQA 4MI1A 5LC1A 3BH6A 3EYWA 3CSDA 1XQ6A 4HNGA 4FMCB 3D8TA 4PR3A 3OLZA 3WV4A 3GAZA 3PEUA 4DM3A 2QBYB 1YFJA 2WV7A 4KP7A 3WK7A 3CR3C 4OBEA 3S40A 4P8RA 4MV4A 4QAJA 2JI4A