3CEJA

Human glycogen phosphorylase (tense state) in complex with the allosteric inhibitor ave2865
Total Genus 291
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
291
sequence length
809
structure length
790
Chain Sequence
NVAELKKSFNRHLHFTLVKDRNVATTRDYYFALAHTVRDHLVGRWIRTQQHYYDKCPKRVYYLSLEFYMGRTLQNTMINLGLQNACDEAIYQLGLDIEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGIRYEYGIFNQKIRDGWQVEEADDWLRYGNPWEKSRPEFMLPVHFYGKVEHTNTGTKWIDTQVVLALPYDTPVPGYMNNTVNTMRLWSARAPDYIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAATLQDIIRRFKASKFVFDAFPDQVAIQLNDTHPALAIPELMRIFVDIEKLPWSKAWELTQKTFAYTNHTVLPEALERWPVDLVEKLLPRHLEIIYEINQKHLDRIVALFPKDVDRLRRMSLIEEEGSKRINMAHLCIVGSHAVNGVAKIHSDIVKTKVFKDFSELEPDKFQNKTNGITPRRWLLLCNPGLAELIAEKIGEDYVKDLSQLTKLHSFLGDDVFLRELAKVKQENKLKFSQFLETEYKVKINPSSMFDVQVKRIHEYKRQLLNCLHVITMYNRIKKDPKKLFVPRTVIIGGKAAPGYHMAKMIIKLITSVADVVNNDPMVGSKLKVIFLENYRVSLAEKVIPATDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIDDVAALDKKGYEAKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFYHDRFKVFADYEAYVKCQDKVSQLYMNPKAWNTMVLKNIAASGKFSSDRTIKEYAQNIWNVEPSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glycogen phosphorylase, liver form
publication title Thermodynamic characterization of allosteric glycogen phosphorylase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 291
structure length 790
sequence length 809
chains with identical sequence B
ec nomenclature ec 2.4.1.1: Glycogen phosphorylase.
pdb deposition date 2008-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00343 Phosphorylase Carbohydrate phosphorylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3cejA02
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3cejA01
2R66A 2VSNA 4BFCA 1P4JA 3TOVA 4N39A 1FTWA 2QRGA 2IV7A 1LWOA 3VDNB 1WUTA 2YJNA 3FROA 3ZCUA 4LEIA 5DLDA 4N3BA 1Z6QA 2VG8A 5DU2A 1PNVA 1QKJA 4W6QA 3NAZA 4X7RA 1GGNA 1XL1A 3WAGA 3DDWA 9GPBA 2BFWA 4WHMA 1E1YA 4RIGA 1FTQA 4FZRA 2IUYA 4EL0A 3L7AA 2SKDA 3SYMA 1AHPA 1EM6A 1P2GA 4NESA 4YI5A 4EKYA 2PQ6A 3SYRA 2F3SA 1FTYA 4REMA 5IKOA 1IXYA 4M7PA 1JG6A 2QN3A 2WTXA 1L7XA 4EJ2A 3CUYA 3MS2A 2KS6A 4CTNA 1PN3A 2QZSA 3O3CA 2JLBA 3T3DA 1P4HA 2QNBA 2ECPA 1GPAA 1NZDA 3OTIA 5ENZA 3BCUA 4AMBA 2C9ZA 4HWGA 2R4UA 1FA9A 2X6QA 5JTUA 4AY5A 1WV0A 3MT7A 4YUAA 4YI3A 2GPAA 2GPBA 3NP7A 1AXRA 4FKZA 4EL5A 1PYGA 4CDRA 1Y6FA 3CUTA 1C8LA 1UQTA 4GZ5A 1FS4A 3WADA 2R68A 3MTAA 3T7DA 3Q3EA 3OY7A 2VCHA 3CUWA 3G2LA 2XGOA 2R4TA 3EBPA 3T3EA 3S28A 2XA2A 3L7CA 1GG8A 4NC9A 3NB0A 3S29A 4GZ3A 2R60A 3S27A 3MRXA 1Z62A 1WUYA 3WC4A 5LQDA 1L5VA 3VDMA 4MICA 3T3HA 2FF5A 4RBNA 3MRTA 1UQUA 2IYAA 4MRAA 3G2HA 1V4VA 4M60A 1JIUA 4MI3A 1C8KA 1FU7A 3L7BA 2SKEA 5I45A 3PE3A 1XL0A 1RZUA 3BEOA 1FU8A 1K06A 2VSYA 4GYYA 2PRJA 4KQ2A 2OFFA 4M83A 3CEHA 2QLLA 4HLNA 3CEMA 5BNWA 4L22A 4KQMA 2C1XA 1Y8ZA 3TAXA 1L6IA 1KTIA 2QN7A 3C4QA 1NVKA 4GPBA 2PRIA 2VCEA 4F96A 3MRVA 1F6DA 2X6RA 1F0KA 5D00A 4LDPA 1JEJA 2X0EA 3E3LA 3TSAA 4AY6A 3MT9A 1VGVA 2FFRA 4AN4A 2G9RA 1H5UA 1L5SA 1NZFA 2G9VA 2ATIA 1L5WA 2GJ4A 3QKWA 1M5RA 3MTBA 5TMEA 4CTMA 3UYKA 2ACVA 2BISA 3OTGA 2H1FA 3CUUA 3UYLA 3OKAA 4G2TA 4N9WA 3T5TA 1NOJA 1Z6PA 3PE4A 3T3GA 2QLNA 3DD1A 1E4OA 1WW2A 3BD7A 3DDSA 2GEKA 1GPBA 2AZDA 1SXPA 3D1JA 3NCHA 4MI6A 3G2JA 1GZ5A 3IA7A 4AMGA 2GPNA 2ACWA 1Z8DA 2IEIA 2P6PA 3BCSA 4MI9A 6GPBA 3MSCA 1L5QA 2AW3A 3T3IA 2C1ZA 2QLMA 3C4VA 4Z5XA 2BGUA 1YA6A 2ASVA 1WV1A 2IYFA 4MHOA 2F9FA 1NLMA 3MT8A 4XI9A 3HBNA 2F3QA 2QN1A 4N3AA 3E3OA 1BX3A 2G9QA 3CV3A 2H1HA 1NOIA 4CTOA 3GPBA 1B4DA 1SXQA 1P2BA 1ABBA 3OY2A 4GYWA 4WADA 3VUFA 1XC7A 4RENA 2C4MA 1A8IA 3NP9A 2IEGA 3ZCTA 5D01A 4GZ6A 1P29A 2GEJA 3NPAA 4NEQA 1IIRA 2QRHA 3CEJA 3ZCQA 1K08A 5GPBA 1GFZA 5IKPA 2O6LA 1EXVA 3L7DA 2QRMA 5HXAA 2PYIA 4RELA 3D0RA 3BD8A 2HY7A 2QRPA 1C3JA 3C48A 3HBMA 2XA1A 2QN8A 3NC4A 2Q6VA 3G2IA 4RIEA 4RIFA 3COPA 3VUEA 3ZCRA 3ZCVA 5TVGA 4X7PA 1JIVA 2XCUA 3OTHA 4WACA 2ZB2A 4BQEA 3H4TA 4MHSA 3OT5A 1LWNA 3GUHA 1P4GA 3S0JA 2FETA 1RRVA 1L5RA 4QLBA 2G9UA 2XCIA 1NOKA 2QN9A 4BQIA 1WW3A 2X0DA 3MQFA 3CUVA 3MTDA 4KQ1A 3IAAA 4RIHA 1O6CA 1XV5A 3BCRA 3ZCSA 3Q3IA 3RSZA 1HLFA 3BDAA 3G2NA 4X6LA 3S2UA 3OKCA 3QHPA 3Q3HA 2F3PA 3D0QA 3RHZA 3OKPA 3ZCPA 2GT1A 1UZUA 2IW1A 3L01A 3HBFA 3MBOA 2JJMA 1XKXA 2PYDA 2SKCA 2F3UA 4RIIA 2AV6A 7GPBA 2GM9A 3CX4A 5TMBA 3G2KA 1XOIA 4F9FA 2XA9A 1Y6GA 4N3CA 5JTTA 3RT1A 3HBJA 2X0FA 1J39A 1JIXA 2XMPA 3DZCA 3H4IA 2AMVA 1GPYA 3MS4A 4BQFA 3RSCA 1FC0A 1C50A 8GPBA 2BGTA 1RZVA 2IV3A 3BD6A 1QM5A 4PQGA 3EBOA 3L79A 5TMDA 2QN2A 5C1DA 1JG7A 1P2DA 2QRQA 2JZCA 3MS7A 1PSWA 1FU4A 1YGPA 3E3NA 2XGMA 3AMVA 4EKEA 5DXFA 4XIFA 4X7MA 4F97A 2XGSA
chains in the Genus database with same CATH superfamily
2OAEA 1OYWA 4JLUA 3R7WA 1E92A 2C3UA 4YP6A 3KUDA 4DEVA 4R16A 1GN9A 1SZDA 2AOTB 3JWHA 1X1EA 3IESA 4JB2A 1RKVA 3TW0A 5CTJA 1AKMA 1LWOA 4LDJA 3Q6IA 3PICA 4CLXA 4N76A 2FAXA 3ETDA 2VF2A 1YE5A 2PUJA 2CYBA 1NVBA 1SCBA 5J2UB 4C4SA 2DPMA 6AT1A 1HEIA 2PWBA 4K6CA 3UV6A 4WRRA 3LECA 3ZV4A 3OUTA 1LJ8A 3DOIA 4FGJA 1V1MA 1N6HA 3P9RA 1Y6QA 2PGDA 4DEXA 3QIVA 1GGMA 4GSYA 5DU2A 1GTG1 4YP1A 2OK7A 3LPCA 5DIFA 5CIQA 3SJ7A 1IOWA 5EUMA 1FUKA 3E58A 3KJXA 4HAOA 3ZXXA 5BWMA 3CNOA 3QEBZ 1ZNWA 1H6CA 4RD1A 2HWKA 4RZ3A 1TKCA 2PGOA 1LSOA 2OP0A 2WTEA 3N2KB 1FY2A 2LR0A 3AHCA 2AUNA 2E87A 1NW4A 3WGVA 4W5QA 3QX8A 3TK1A 3VOTA 3AI2A 1K92A 3HPRA 3JQPA 2ZJ6A 1N2CA 4ERXA 1TUGA 1ICEA 1DX4A 1V1JA 3AP3A 2HF7A 3OH8A 4OBXA 1XQ9A 2PEZA 3ACBA 3MCTA 4QWMA 2C2OA 4S2UA 3U39A 1DG3A 2H1VA 1PL6A 5SYNA 1BX0A 2XT6A 2CW5A 1WO8A 2AEFA 1KO1A 2B1GA 1PI3A 4KXLA 2WB4A 4BMOB 2Y1CA 3ZVRA 3CVOA 3M49A 4LJ7A 1P5FA 3BMNA 5T8KA 5CXQA 2X23A 2O0HA 2XW6A 1E0DA 3BGOS 3EXHC 2QVYX 4HGNA 5IKOA 3WLFA 4S0ZA 5B3LA 1CP2A 3MVEA 1F5NA 1OTHA 1DKRA 3PFNA 4OB7A 3DZFA 5JZBA 5K0GA 2ZIXB 3KKKA 1R5OA 4V0NA 4CM4B 4ENTA 4ZI7A 3F71A 4FINA 3OPYI 3JD2A 2JLCA 1GQYA 1QYIA 1M7GA 1ZMBA 2VPYA 1PN3A 1HE2A 2ZSIA 3BTVA 3RK4A 4Z54A 1I4LD 3RHTA 2QRJA 4CL2A 2I2FA 2KE5A 2X2EA 4IV5A 1LLQA 1Z4JA 3B1FA 3K2BA 4M6WA 1EYZA 5BYJA 3FLBA 3ROMA 2O7RA 3U3XA 3UTDA 1UM9A 1XPOA 1ZAYA 4N7RA 1PDOA 2QU7A 2ONCA 1WXIA 3BCUA 4LZWA 4W1RA 4PYQA 3K1AA 2CVZA 3M7IA 2GOYA 1N34B 3BK7A 3OEHD 3O4RA 4BGEA 2V4ZA 3PHIA 4R98A 2IYRA 3HM2A 1RM3A 5EPOA 4YJDA 1XQWA 4CLOB 4TZ6A 3RIGA 3SC3A 4DR4B 4YI3A 3F67A 5JY1A 3IJEB 3LYAA 3PITA 1YS7A 4GECA 4I50A 1M0SA 4YQZA 5IDXA 2GM4A 4RJIA 3KSZO 4CM9A 2VDUE 4MV1A 1FNDA 4GZ5A 5I9SA 1U3DA 3T3NA 1ONSA 3B20A 3EIWA 2VK2A 4IMIB 1NQAO 2XNJA 4GXTA 4I1OA 2ID4A 2E4AA 3OY7A 5A7HA 4PLWA 1SRQA 3BTUA 5FNVB 1BQEA 1QS0B 2AZ4A 2HYIC 5SZKB 1BJKA 2PVPA 3FKSA 4O63O 2MOKA 3B9BA 2AXQA 3E23A 4JC4A 2J5RA 5FLEX 3A04A 3IOBA 3Q12A 1TK2A 2C5LA 4FMDF 1T9BA 4LXGA 4YJ3A 1SCUA 4BLQA 2CYCA 4V1CA 1YB7A 4BKQA 5JBNA 1ZJ4A 4MIYA 3CVXA 3WL7A 2UUCB 2VYND 1G9SA 2A59A 3AR5A 3CJQA 3DSRA 4JL8A 4RL4A 3CF6R 4M0KA 4AKEA 621PA 4DZRA 2MTBA 2FZGA 4FBMA 1JIKA 2HA7A 2O05A 3I09A 1OAOC 3HVHA 1JA1A 1XAJA 4H7DA 4JBGA 4F1WA 1HT0A 1TVKB 5LN1A 1ZKDA 1Y3FE 2EIHA 1BW9B 5DP2A 1DLJA 4HDQB 2J5KA 4JSTA 1NJSA 1QO9A 3WO0A 3PIDA 1LY1A 2ZFUA 1R6XA 1AO0A 5FNZA 1S8NA 3UAZA 2G6TA 2ST1A 3JX9A 1OH6A 5B1YA 5JCZA 1K5HA 2C5FA 4FR5A 4EB8A 1NC1A 2CVPA 2YUIA 1JLKA 1HLGA 1GRNA 3FYUA 3T7IA 1NVWQ 1QG2A 2XD9A 2HCRA 3AR9A 3KOZA 4Q9NA 1TJ3A 4V0LA 3UG7A 1CFZA 4UUQA 1G59A 3KHTA 4EZBA 4NNOA 5LR6A 2X41A 1UADA 2H48A 2HRZA 1U2GC 2QUJA 3AQIA 1FP1D 2DJ5A 3BEOA 3GFOA 3HDVA 4IIDA 3CKLA 5E4YA 2IUUA 2R79A 4JOCA 4RLQA 4B4UA 5DOVA 1SGWA 4RK1A 1TFRA 5EYPB 4K9LA 5IZCC 1TB4A 1J2RA 2P4UA 2PKRA 2XUIA 3TM5A 4R9UC 1UPTA 2JBAA 3GWZA 4O4LA 2EW2A 4OJQA 5BMVF 3ICPA 4NYJQ 1AHHA 1GPKA 3RBVA 1COZA 1JXOA 2MSWA 3Q7SA 3UB3A 4AWAA 4PPQA 2J32A 4GMGA 1QIKA 1U5BA 2YKGA 1KE1A 1P73A 4B76A 1NURA 1UKAA 5C18A 4Z53A 1WSDA 3FIJA 4Q3BA 2JJQA 3T4XA 5FV4A 3HJBA 2XBMA 1U4SA 3SHOA 3QKSB 4WZAE 1MB4A 4OF4A 4FR2A 4I66A 2G72A 2YICA 3E2PA 1FSZA 2IF2A 3H2JA 2O8EB 2UUOA 1HF3A 3CBGA 1RJDA 3H9UA 2PNFA 2I8LA 2Z4RA 3KDSE 4QELA 4B34A 5KTTA 3LA6A 4YASA 1N33B 3V7NA 3X1DA 5JYBA 2XDAA 4MRRA 2XX3A 3LUGA 3DO8A 1O6BA 3TPZA 3VYVA 1YZ3A 4KE6A 3A6LA 1IBMB 4V2IA 1P0MA 2DTXA 1YL5A 2O2ZA 3Q87B 2OYCA 4LJ8A 1XLTC 3E3LA 3Q2IA 4P54A 2MR6A 2EW1A 3ZWOA 1Y3DE 3DDZX 4QUGA 4M49A 4B71A 1WG8A 3BE4A 3EISA 4D97A 2OQRA 2FFRA 2GZ2A 4CIDA 5JHHB 4PS1A 2JFOA 3CGWA 1UUFA 4WGGA 1IH8A 1NZFA 1BMDA 3CLUC 1SPBS 4Y9RA 2WAYA 4PLVA 4G63A 3HLYA 1ITZA 1G60A 4TTVA 5KSWB 2QBYA 5GWXA 4QTZA 4PC3A 4QDUA 3H0KA 3KQLA 1TVEA 3SZUA 2XRFA 3UN1A 1KDTA 4J3NA 3DPSA 1A9OA 1XZNA 1GV1A 3FZNA 1XZBA 1IC6A 1K7SN 4KLCA 3M1IA 1KY5A 1JBEA 2EL7A 4HG2A 3JXEA 2TRSB 3IQXA 4DSAA 3NEAA 4FBLA 4LS3A 1CRPA 1WMAA 3DQQA 3GARA 1RS0A 1VDZA 3DW3X 2R2AA 4MDEA 2WEKA 3GZNA 1GGEA 3CRNA 1VXOA 4JMPA 4KQHA 3TG2A 4DR6B 1A69A 5JSUA 1ZXBA 3NCHA 1R9GA 4RPJA 2FMIA 4X95A 4N48A 1U04A 3IDSA 3MA0A 4F92B 2Q07A 2ZT7A 1USKA 2HSJA 4HVLA 1O58A 2QGZA 5JSZA 1JTEA 2OHVA 3IA7A 4KLNA 3WGIA 1GGKA 3IHTA 5AQEA 2OB2A 5CHYA 3ZWXA 4OQXA 4BAGA 2RGRA 1N2GA 3I04A 3AEUA 2RC6A 3OP4A 4NBKA 5L3QA 5A71A 3FCAA 4I36A 5CDSA 3PC4A 2PDAA 3EOAI 1Z8DA 4NONA 4BASA 1VLJA 1Z6XA 4E3WA 5KSOA 4LXYA 2TMGA 3SI7A 1EXDA 5BWBA 1GRCA 1WQ3A 2RJOA 3QPBA 3UMJA 3HXOA 4CQJA 2BMVA 2PN1A 5LSAA 3ZCXA 3IOYA 1CEXA 2FSIA 3HJUA 1SQ5A 3TAUA 1WV1A 2ENWA 4ARZA 2AUTA 4NZ9A 5EXDA 1DBSA 1I2ZA 2J3QA 5J4KA 3MMSA 3U1BA 1N1MA 2OCKA 3AEKB 4QHTA 3Q40A 3O4FA 4FQ8A 1ZH0A 3KR2A 3ILSA 3ZWQA 4DDHA 5KHAA 5HQ3B 1VCOA 2OCDA 2P3SA 4Q9KA 3ZUGA 1N6OA 3ILXA 4RFSA 4RTOA 5FADA 1UDWA 4W8HA 1PEKE 4F46A 3I1JA 3S2ZA 5HQTA 4HZUB 4RJKA 1SUPA 4DWVA 3CINA 3MMZA 5HA5A 1UAYA 2D2XA 5JCPA 1T4CB 1MXFA 1B4DA 1BJTA 1LQUA 1WTAA 2PZ8A 1KYVA 1U0EA 1DADA 3HCWA 3PXEA 4XWAA 4R0MA 5A4KA 3RABA 1NVEA 3C3AA 4OB8A 4CKWB 5DX0A 2ZSAA 4HQ0A 2IXBA 4L0QA 1TZMA 2PQ0A 1UC4B 3OE4A 2XYVA 4RENA 3WIEA 1ONBA 1RACA 1T6ZA 5LD2C 1NFRA 2CZCA 3ZIDA 4IINA 3OG9A 3OIWA 3EIUA 3HO8A 2H29A 4KOEC 1S4QA 2ETXA 2WD9A 3E6AA 1N92A 2HA5A 4XRRA 4D5EA 1XMVA 5GPBA 3ZDXB 2QPLA 3B82A 3SHTA 1L5HB 1DC4A 1S7GA 2B82A 1A04A 2JAHA 5E4TA 5LWQA 2YMPA 1SULA 2C61A 4AN0A 5F3WB 3C3DA 5JR3A 1JAHA 1S1MA 2RHMA 1E6KA 4UVGA 1DL5A 2IUFA 1Q91A 2HK9A 3ZGLA 4KITB 1PJ4A 5DWQA 2ZB7A 4TWBA 4C5BA 1HQYE 1AUXA 2EZTA 4K9NA 4QUEA 1LCIA 4QVGA 3V8EA 3VOAA 4DNFA 4BECA 5FO0A 4PLPA 5CDGA 5IEJA 4L2IB 2EP5A 1C30B 1LBIA 1LS6A 2V6FA 3W5IA 2NXEA 3AK4A 3GVHA 2C54A 2HFKA 2WJYA 3H2SA 3HA2A 4UCQA 1PJLA 2IYEA 2V5VA 1Q95A 4PONA 4GT1A 3C41J 3ROKA 1LDNA 1Q7BA 1RAIA 1NNLA 1RC1A 1SQFA 2F9LA 3DWIA 1HKUA 3DYBA 3O6VA 5CVTA 2IIPA 4CT0A 4LRWA 1VLZA 5AM4A 2CDAA 4BWFB 2B3TA 2QZPA 4FB5A 1GZUA 1KYYA 1WKCA 4Q3OA 1X7XB 4LBWA 4N1AA 3SLKA 5JNTA 4C7JA 3H4TA 3K4QA 4H9GA 4LDRA 3TLKA 4ZOQI 5DMHA 4MDHA 3V80A 2HRRA 3RJMA 1M2OA 2IPXA 2PS3A 2R6GA 4TTSA 1R5NA 4JUAA 1EJ0A 1E6LA 2JFQA 1YO6A 3BXXA 4WESA 4BEWA 5LMZA 1GLVA 1WMEA 5E7MA 2Z4TA 1KQNA 1UBKS 2ZUVA 1CUYA 4JNCA 2X0DA 1UINA 3SZGA 2JVIA 2B20A 1EFRD 3N58A 1E1NA 4ONEA 4R05A 3JD3A 2V74B 2VCYA 2YVLA 3OF3A 3KP1A 3LGXA 4R01A 4MO9A 4RIHA 3RUCA 3R9XB 3L02A 3C6MA 2H59A 3HFGA 4IG9A 3FMPB 1R4MB 3PUYA 4Z51A 2P75A 4G1MB 4G56A 4WK4B 1KQOA 4JIGA 5A4JA 1JRLA 5KYNA 4PZYA 3CLTD 3PQ8A 2FUG1 2YZMA 1GNRA 1FXWF 3OZEA 1QORA 1Z9BA 2QR2A 4Q7KA 1DIRA 3QFRA 2PZGA 2NU6B 3FW1A 3K72B 2E4ZA 4XWYA 4PC2A 2EBFX 2H1LA 4Y0VA 5F33A 1AZWA 3EMVA 1DQSA 5E6SA 2C88A 4F2HA 3L01A 4M1WA 4BFZA 4LRUA 2PYDA 1TCVA 5D85A 2F3UA 3ESYA 3LOPA 1OT5A 2RI1A 5B12A 2IYZA 3CA8A 3LFUA 4KSBA 2RGGA 1PFGA 5JZ9A 1TA4A 1IL0A 2KLBA 2MJLA 3BUSA 3NYQA 1ZI6A 4H3HB 3FVWA 2MINA 1ZN2A 4WXYB 4IVNA 3IAS6 1IK4A 1TU4A 1B0AA 2VA8A 1FUIA 2XA9A 4ZGWA 1U8TA 2CE2X 3FNGA 2ERCA 2W6ZA 3TW4A 3CE6A 5JTTA 1GDTA 5AOAA 3IVXA 3WGKA 2FZEA 4QAQA 2PU5A 3IAFA 1DC6A 1W1UA 2I6SA 2PU7A 5T3UA 2CV2A 2JLVA 1WETA 2EU8A 3OM9A 1G5TA 1X1DA 3SXUA 1AGRA 5H16A 4V0QA 5A1JA 3R7SA 4ND7A 3FOWA 4BNFA 3G9TA 1E2DA 3NH9A 5EE3A 2ZBUA 5I7UA 5KNDD 3GLKA 4MZXA 1NVVQ 4B48A 5IVKA 4KYVA 3R7FA 3OHMA 3WZ2A 3D3EA 3QE9Y 1PFYA 4CKEA 3TQCA 4FEGA 1ENZA 1RQ2A 2ZB3A 2EERA 4F1JA 4MS1B 4LWQA 1UEIA 3BD6A 4PFKA 3T41A 1J4AA 3NWPA 4Z3DA 1DIHA 1H6AA 3EC7A 3UUFA 1V8PA 3K0CA 2XIJA 2G76A 4PC7A 1QQTA 1T5SA 4ZO8A 4F5EA 4CGZA 1E69A 4QQRA 4ETNA 1UWKA 5CLHA 4PGMA 1QVZA 4RXMA 5C1DA 1JG7A 2F3TA 1M6NA 1Z0AA 2XUFA 3FCCA 2EXXA 3U7IA 1YV9A 4LNAA 3MUFA 1KAOA 1FU4A 2X0KA 3OD5A 3PGA1 5F12A 3T9FA 5PNTA 4R1OA 3T95A 2G80A 3TVYA 4R54A 1CC1S 3V8BA 3SR4A 1A5TA 4X1IB 5C1OA 2D5BA 2IPOA 4OH7A 1CPYA 4R9SA 2WV9A 1N8NA 2CL6X 2D5IA 5AIAA 3H1GA 4MJLA 3SS7X 4EHDA 2I9KA 3Q6MA 4N39A 1L1FA 2RHGB 5JD4A 2QQGA 3T7KA 4DSTA 1FYEA 1J5XA 1PNTA 1MAAA 3WLNA 3FSJX 3IXLA 2Q2NA 3P2YA 2CC2A 1I6WA 3MBIA 4Q03A 5TSDA 2HDWA 4L72A 4UZFA 1V6CA 2HMAA 5I7OA 4L4YA 1LJLA 1HH4A 3Q0IA 2VPQA 3WV4A 4A03A 4BE9A 5IXYA 1VM6A 2ZWMA 3S8MA 3BQNB 1T8PA 5FTKA 4KPEC 3UCEA 3L4SO 4HB2A 1GL6A 2M9MA 5HUHA 4RGVA 4B4KA 4BBJA 4R68A 3DZDA 3AG5A 3LXUX 2NV6A 3DLAA 4CIYA 4M1QA 4ZCTA 1JHZA 3UWSA 2WE7A 4CKZA 4PG7A 3OA0A 3QITA 1TZBA 1MGPA 1Y82A 2YWCA 3NGMA 1GILA 3KE9A 4L0MA 2R8XA 2BFWA 4HNGA 4IKOA 3E1KA 5LBIA 4U2GA 2AZTA 4RVUA 5DVZA 3BREA 3A3YA 2MSLA 5EL0A 2W2LA 3DKRA 4OHOA 2K2QB 2GM5A 3CRRA 5JMOA 2JIMA 3GNLA 4LJ6A 4NPHA 1B26A 1NP7A 4WLOA 3BHJA 3WWPA 2FQWA 2ZBPA 1MNAA 2I3ZA 3LZCA 3PC7A 2H7YA 4LSGA 4U8HA 4WLVA 1PX0A 2BD0A 2OO7A 4HTFB 4NFHA 4G0MA 5BW5A 1SPXA 2GH1A 3BXPA 3DDOA 3NZEA 3GDFA 4MV3A 3LBFA 4YBRA 1KYIA 3OZSA 4HPXB 5FXMA 3S5JA 3M1AA 5ALLA 1FRQA 1RSZA 3QX9A 5HILA 3UC5A 1QC5A 2PIDA 4M1MA 1SEVA 3UNXA 2WRZA 4N6GA 5FR1A 1WXXA 5BT8A 1JTVA 1XWIA 3LUPA 3M6MD 5AM1A 3CZRA 1I3LA 1Z37A 2CCGA 3GCZA 3H5AA 5NULA 3WFIA 4DCOA 4DMKA 3LW7A 3BF8A 4ZVNA 2I03A 1SU7A 2XWBF 3ROFA 4EFDA 1CUIA 1X80A 2QLTA 1ZLXA 2FWRA 1SD5A 2JLBA 4KXWA 1P4HA 2QNBA 5ARCA 2OILA 2CMHA 2YY6A 1GTVA 3F2IA 3FZYA 5EJ9A 3S8EA 4AI6A 2VHYA 1E2QA 1Z4PX 3WQQA 2CMFA 2QZJA 3ZY4A 3HZHA 1Y89A 4YCJA 2VDNB 4RLFA 5ITZA 2C9ZA 4DV0B 4ZQCB 2PTHA 4V0MA 4XEHA 3KZMA 3VYWA 5U4QA 2QN6A 3A36A 2GFQA 3LD9A 4RDXA 2D7DA 2O19A 1C7QA 1CIPA 2XUOA 3T3MB 2XCLA 4N5NA 5FOSA 1IPEA 2H18A 2Y9PB 4IMPA 3ZOKA 4YUAA 5KQGA 1PR5A 2GPBA 5FYDA 4R71A 3GCGA 4OVKA 3S7ZA 1P5HA 3C14C 3L8EA 2RHHA 1WXQA 4DA4A 2DFPA 4BLWA 2R1VA 2X0JA 1DU4A 3NTLA 4OYLA 2VP0A 5FHQA 4BL5A 5CBPA 4K81B 4NJMA 4X44A 1QOPB 4G9BA 1XEAA 1OBOA 3AP2A 4G5GA 4KYTA 4C7KA 4UPEA 1U2QA 1DHRA 5JG7A 4TUYA 4CG0A 1IONA 2Q8NA 1AS2A 3F9RA 4GG1A 1QTQA 3FWZA 2C7QA 3RRNA 1E5VA 4MQ4A 5LXTB 5BQXA 4AK9A 1B41A 3LT4A 4MVJM 3SDBA 4ETIA 3L7CA 1XB2A 3DAHA 2BF7A 4FHDA 1Q1QA 4GU5A 6Q21A 1G2QA 2OY0A 1Q83A 2OYSA 5KYYB 1FX0B 3L9XA 1N7JA 4GPIB 3O9MA 4JVMA 5FQNA 3RG2A 5LOVB 1O9BA 3WC4A 2PAFA 3VDMA 1J8FA 3F49S 2ZXUA 4YWHA 1QLHA 1R4ZA 5ALYA 4BLRA 2C96A 1Q1BA 1E4EA 1AC5A 4H6VA 2IYAA 3I53A 3WJ7A 1GL7A 3CKKA 2DBQA 1T36A 2GCNA 4LHSA 4W9NA 4EUKA 3K0KA 3LKDA 1NKVA 2OOKA 2P8SA 3I6ZA 3RIEA 3FPKA 2CD9A 1JIUA 1Y3BE 2SCUA 3JRXA 4KAXA 3OQ1A 3OF5A 4RVGA 3SQOA 3R24A 2LE0A 3RM3A 5FTJA 3T7SA 4ZOEA 4RTPA 3LI2A 2DOKA 4US2R 4K6KA 4I4CA 2H3EA 4XVCA 3NETA 2XYHA 3OTQA 4KXFB 3HP7A 1X1AA 1KDYA 4UKDA 3JWEA 4O4HF 5CFPA 3BIJA 2QVCA 2D1QA 2R7NA 4LNUB 4BCBA 3DMRA 5I8WA 1VRVA 3PD0A 4GYYA 4K8OA 2CV0A 1CIVA 3H5OA 1NY5A 4FIZA 4J2HA 3TUJC 2H9IA 1VLQA 3DZJA 3FPEA 1XNHA 3IYLW 4M0LA 3T52A 3WGZA 4WKNA 1U0NA 3P0RA 4FT2A 4M46A 4UDNA 5BQFA 4NSNA 2GEUA 4MGIR 5GOZA 1RRPA 2B7CA 1EVZA 1BE0A 3HJAA 4QRIA 1ZU4A 4FXOA 5AI0A 2BV3A 3FWPA 4TMTA 3T5AA 1DS6A 4JJAA 3ADOA 1GGFA 5EESA 2QN7A 1BGXT 1YQ9A 3DEZA 1IM8A 4OX9Y 1SUAA 2J3JA 1R5BA 4EF5A 4GPBA 4D9JA 5EEHA 1KJYA 1Y1KE 2GLTA 3ZY3A 1XXHE 3MRVA 2GF2A 3S44A 3VPAA 4QM6A 1U7XA 3PR3A 3I0NA 4BO6A 1H0HA 3TO5A 3AJDA 3M2TA 1JDVA 3CCCA 1B8VA 1QNFA 4FW8A 2HQRA 2H31A 3L92A 4MPRA 2GLUA 3HXTA 4H27A 3I1FA 1SUCA 2YWEA 1L5NA 3AILA 4C0XA 1Y7HA 3WXMA 3FH0A 4S05A 1UCFA 4MQFA 3OX3A 5JJIA 4UATA 3EB9A 4LRQA 5CCDA 2CGEA 4MVJG 2QXYA 3PR1A 3AFOA 2D06A 2VWQA 2A33A 3PU6A 1W88B 4G9GA 4LQDA 4COKA 4F5WA 5A1TA 4RY2A 4II7A 3SBEA 3ZJVA 4UMVA 4NCJA 5IT5A 1KK1A 2HMUA 3V1KA 2H4YA 1E9FA 2ATIA 2CDCA 2HA2A 3VZCA 4WCDA 1QP7A 1J0AA 4F5YA 4AX4A 1KSJA 5TGDA 2I65A 4ENUA 1XLUA 3R7WB 1WSBA 1PJ3A 2QJFA 1KDPA 3E0QA 4KQJA 1R15A 3E18A 3OKAA 3LQ2A 4HB3A 3WV5A 4F5ZA 5I9IA 2P2GA 3HI4A 1E9BA 1IEWA 2EGGA 4PCLA 1EJ2A 2ZAMA 3WGMA 2CF5A 3O4JA 4MR8A 4JL6A 1M1YA 1SA0A 3D3WA 4ZVRA 3D4NA 4OKIA 4XLLA 2KYRA 3G17A 3HI6A 3K0HA 4IZHA 5D2CA 2DQ4A 4RHTA 3HABA 5F2KA 4Z0HO 4C4RA 4W7SA 1ONPA 1V1MB 1WB4A 1G20E 3E7XA 2JATA 2Y93A 4HWOA 3G6WA 3IKMB 1TAQA 3KVNA 5AD1A 1N6RA 1QZZA 1OI7A 5B3KA 5CCBA 2VXYA 2KJQA 1D1QA 2WNHA 3HFRA 1XRMA 3PP8A 3TXYA 1U1CA 1DPFA 4N0DA 3KEMA 4A6XA 4AMGA 4BVFA 1ODTC 4LZZA 4MZDA 2XUGA 3LUDA 1Q7TA 1OFIA 5EWLA 2OXTA 1E5LA 1UK7A 1XK7A 2VNJA 5AKGA 3RAPR 4OQDA 3UFXA 1RYNA 2H7VA 5M5BA 1TZ2A 3GUYA 3VKFA 1QFYA 2W2QA 3UMFA 1CR4A 3DNMA 3E9DA 1KY2A 2ZJYA 4IHJF 1N2CB 2G82A 4CCWA 5CA1F 3TRDA 3VPXA 4F9GA 4ND6A 1PLKA 5AW5A 3DLHA 1UJ2A 1KJ8A 1UMBA 4XDHA 5JRDS 7AT1A 4XPIA 2DLDA 2IYFA 4DMRA 5KMGA 1FFSA 1KS2A 2O2GA 5ARDA 1F8XA 1AGPA 3QSYA 2GA8A 1JH8A 1RXSA 1JXQA 1M7BA 3GQBA 1NA5A 4HS9A 4MWDA 4F21A 5D86A 1ENPA 4P4LA 1E79A 4U7DA 2G08A 2ZS9A 5ALSA 2EFYA 1EXMA 3Q7EA 4IH9A 5GGYA 3BMNB 4CF3A 1G9XA 4M1EA 3V1UA 2JJ2A 1ULHA 3G1TA 4XYBA 5G53C 1DEOA 2BF4A 4B87A 1WOYA 5JNLA 4OQMA 1PFVA 4HNQA 5IC4A 5IYZB 5KZMB 1RPZA 2IYVA 5TNXA 4DDKA 2DUNA 1N57A 4FFMA 5HGJA 3URMA 4N54A 1Y33E 5E7IA 5L7YA 4PGGA 2IGBA 1EGQA 1UBHS 3BSFA 3EEBA 3MC1A 2CBXA 2JHAA 4ZI7B 5LP6A 3MCWA 3NONA 1W4BA 2ZBFA 1JR6A 1HNZB 1B8UA 1NMQA 1OC2A 1Z0UA 2DWUA 3CIOA 3DFMA 2I6XA 3MJHA 3O1IC 3VBEA 3WX0A 4CFSA 4M6WB 1K27A 3OICA 5BVHA 1JWBB 3EVCA 1DE0A 1XGKA 1DXQA 1H4VB 4EUFA 1N78A 2ZI7A 1UM9B 5T4EA 4KQXA 3H5VA 3JYPA 4LVCA 5F7ZA 4CEIA 1Z08A 1L7RA 3BRCA 3OZVA 3R41A 3G6KA 3L4KA 3F4LA 3K1AB 3TI9A 2JG3A 1R0CA 3JTEA 4JP2A 3BK1A 4AP6A 4KXYA 2UXBB 1Y5LA 1CJTC 5SZHB 5IVPA 1EXWA 5EKXA 1ZSYA 5J5AA 5LA6F 1N9GA 4TN5A 2PKYX 3WVNA 1BGVA 1YULA 2NO4A 1L4KA 4LE2A 4ZEVA 4ND4A 4F2PA 1NVTA 3WHKA 4ZTZB 3FPJA 4XLZA 1SN7A 3P2OA 1UBTS 3CNEA 4PX5A 3KB8A 2JIBA 3WK5A 4YRBA 3NBXX 4I46A 2OM6A 3LO8A 1MBZA 3IAEA 3E03A 3D8RA 5GZ1A 4AF6A 1H6BA 1T0JB 2X6TA 3ZJUA 1M2HA 1P2FA 4U2KA 4Q3KA 2OXIA 3HFJA 3LWZA 2GJSA 2HMSA 4O3MA 4XVUA 1H1LA 1U0FA 3R0ZA 2WK1A 5GZ3A 2Y1LA 2BCJQ 3IODA 1H2XA 5ESDA 3ZCRA 1S89A 4NAUA 4YJ3B 1SCUB 4FR0A 3ZU2A 3ENKA 5TVGA 4BKPA 4V1CB 5ADHA 3ZY5A 2RB4A 2XCUA 5FH9A 1JG1A 3V2UA 4BNHA 2JGMA 1NBMD 3G0DA 3I62A 1U81A 2Z6VA 4E09A 1MIOB 2IEBA 3KZNA 1VG0B 4BQEA 3UKOA 1KI4A 1UEJA 1ISRA 3QUAA 1JZQA 1K63A 1QLJA 2V6JA 3NX4A 1G4AE 4H7HA 1HE3A 4FFNA 4HKTA 3GUHA 1B23P 3QYAA 1HK7A 2VUSA 3IE0A 1RRVA 1L5RA 3WAKA 4HDNA 2G3YA 1BHJA 1T29A 2EV9A 5A5FA 9ATCA 1WULS 2QN9A 1UH5A 1P3Y1 4PAOA 1JLLA 2MMCA 1JHMA 4UHEA 1BC5A 4DV5B 1S01A 1UL1X 2BZ1A 3FYUB 2W43A 4XQCA 5FL3A 3TBKA 4CIAA 3EPKA 3NJ8A 3HNOA 2Q7OE 1XV5A 3K0SA 4DIUA 3LPLA 2DH6A 1OTYA 4DCGA 3LGAA 1U7WA 2XMSA 1N2BA 3AQ4A 4GXRA 2RSLA 4TV8A 3ZK9A 2KBFA 2R8OA 3LXRA 3EVGA 3HUEA 4MR7A 1M2WA 1U02A 3ZWAA 1U6IA 2F1RA 1NMEA 2DWPA 4LRYA 3ORQA 5DMXA 4O4LB 4F91B 3U4QA 2OBYA 3CF4A 3M4JA 2GT1A 4IEFB 2P79A 3DOCA 3RVDA 1PTJC 1C7EA 2C4UA 4MV4A 1U5BB 3EMBA 1TRHA 3CH4B 3NUGA 4HD8A 1W85A 4GGPA 5KEIA 3MZ0A 2FKAA 2QLFA 1ULAA 2EKLA 3EGDA 3LUHA 4MYDA 4ZVKA 3EW9A 1EIWA 3OFND 4CLDA 4Z9BA 3TOSA 1S2NA 3IUQA 4IJUA 4KXNA 3FFAA 2KQUA 1V8BA 1SEPA 4LZNA 1P4RA 3A2KA 4BVAA 1W76A 4EBBA 1E66A 2H2WA 2X5JO 3ZD8A 4GPZA 1NXWA 1ESDA 1GYQA 1NJ6A 1WY7A 2PFSA 3NCTA 3CZQA 1GKKA 4Y6LA 2WHYA 3ZLUA 2JFZA 4JODA 3OQJA 3QLVC 1F4VA 2CBGA 3L6CA 1RTTA 1IAVA 2OWDA 3N07A 1E64A 3AR8A 3TX6A 4MULA 1WXDA 4IQGA 1OXSC 3UENA 3UWMA 1J9EA 3DZCA 2A5FA 4DAEA 5IKEA 1T0PA 4F2DA 4TYWA 2AMVA 4I6EA 4S3MA 1VC2A 3LYLA 4XUDA 4BRWA 1NV9A 4M0UA 3DO6A 3FUXA 1QRAA 4KWHA 3RANA 4BKUA 1E3EA 3R3WA 1XJQA 2NU7A 5EFZA 4WAUA 3W7AA 5I8PA 2B2CA 2HADA 3B6ZA 3IMKA 1EB8A 1N2IA 4PNZA 4MVCA 5A05A 3OT4A 3QLUA 2QBYB 1P45A 2J6HA 1XDWA 2PWYA 4RFLA 5ITVA 4MPTA 5FOVA 3WRWA 3OM1A 4H35A 1O7JA 3KKZA 3IBYA 4YMHA 4XVRA 3GD5A 4QXRA 3FMGA 2PXCA 3MOSA 1L1RA 2O14A 4LWPA 2XRYA 3LHSA 4O29A 1J56A 1TKAA 4P22A 4XWTA 3ZZUA 1NW3A 3S2IA 3EYWA 4MUFA 3TZ6A 3QX3A 4KJXA 2OP1A 3K2EA 5DX1A 2FZWA 4EKEA 4Y67A 4XIFA 1COWD 2C2BA 1VJDA 3UMBA 4EPRA 1TT7A 2DXIA 3FTDA 2D0PB 3GZNB 2JBHA 3H9EO 4WW0A 3WRYA 1SKAA 1JJVA 3TKAA 1Z38A 2JGLA 4NR0A 1MDBA 2QMEA 3TINA 1LZLA 1H3FA 4QUJA 1RWBA 4N6OA 2BI4A 1HXHA 1KH3A 1U3WA 5JSZB 5FT9A 4OJNA 3IHLA 1USVA 1S8OA 2VP5A 5FI0B 2R7AA 2PL5A 3KTDA 4E70A 1E2LA 2VZ8A 4MLCA 5DI3A 3F1KA 1O97C 3B2QA 3AEUB 4JVNA 1YBAA 2BP7A 3GROA 3KWFA 3FROA 4FFSA 3C3YA 2O2HA 1J06A 4WFKA 5GONA 4F04A 1TLTA 2VDPB 1E0AA 4QPJC 2DKOA 2VP3A 3R09A 4C30A 1Y63A 2JFBA 4CR7A 1C0IA 3FHOA 2VQ6A 4V3BA 5TEVA 1BRTA 4QD3A 4JJ4A 4L4RA 3OPQA 4IQFA 4WT7A 1DX6A 3DTTA 4OYYA 4G0QA 3KB1A 3NAZA 4DOMA 1IHXA 3STYA 2Y4NA 3RTCA 2IYYA 2V6IA 2AK3A 5AK0A 3VU9A 2X8JA 4H59A 4ARZB 2YC4C 4CV0A 1S96A 4PSAA 2I4IA 3DXFA 2WMYA 5KTYA 3COJA 4NS1A 1FMJA 1RYDA 1FTQA 1J5EB 3IUSA 5BW4A 1ZM9A 4GI1A 2W98A 4RFSB 1JU3A 2H92A 2VDMB 3VDQA 3G79A 4BTLA 1W5FA 2CLHB 1QFMA 5DNDA 3HY4A 3MAAC 4R8SA 5FUWA 1T9GS 3CONA 1BWSA 3QFCA 1THGA 3DHNA 3W5SA 2WU3A 3AUJB 3MLBA 4G8CA 1X87A 1VL1A 4RMNA 1YVEI 3GJ6A 3KOUA 2CWDA 4J1TC 4JC5A 3V1LA 3Q2KA 4GGMX 4X6UA 1ZH6A 1TD9A 1FP2A 1RI4A 1TJYA 1AK9A 4FGSA 4REMA 1CJVC 4M7PA 4C0QC 4YXWD 4E5KA 4ZCQA 1JWAB 1NXOA 3GZJA 2QMYA 3L40A 4IQ8A 5FI1B 2WTXA 4G8BA 4TLMB 3DFIA 3CUYA 4IUYA 2WY2D 3GP8A 4PAWA 3VVMA 4AZTA 5BN5A 2FOXA 5FDFA 4L9AA 5EKDA 2Y9MB 2GHTA 3ISTA 2VQFB 1Z0SA 3M33A 4QTUB 3O3CA 2FR8C 5AM3A 1DOAA 3LH5A 3A2MA 4V1CI 4YRNA 4Z6KA 1JKJA 2ZTUA 1WNFA 2FDRA 3KVVA 2YHIA 2X5KO 3A1EA 5HMLA 2BKEA 2EBWA 3IP6A 1TQ2A 1H42A 1MB9A 3DEAA 1VJGA 4O25A 4L8VA 2WM8A 1ENOA 4I6JA 5MN5A 5TR9A 4AQ7A 5EZ6B 4CQMA 1CQZA 1PT8A 2YH2A 4G86A 2YZKA 1AKUA 3RREA 4HL6A 1ZMRA 3EDCA 4J0GA 2OXFA 2ZWAA 1I4WA 3NHPA 2ZAOA 4CDRA 3Q6NA 1Y6FA 3PJRA 1MFPA 1U0RA 3PQFA 5K8LA 5EIBD 4D7AA 4D9EA 1XAHA 2GVZC 3HWX1 3Q3EA 1AGXA 2BDUA 3NYIA 4B7UA 3GZTB 4X91A 1MGOA 1RIIA 3EQ6A 4KQGA 4O6VA 4EMUA 3G2LA 5TT0A 3TW6A 1Y4AE 3JAKB 3ZHUA 3SR0A 4PGFA 3HC7A 4D3YA 3EBPA 3K9CA 3B8HA 3B52X 5JAIA 1M2OB 1MAUA 2VJPA 4U2DA 1GVNB 4TLDA 1C3OA 2M98A 1RKUA 4Y6SA 4YS6A 3E2MA 1RLMA 3K35A 2RAUA 3P2EA 4KN8A 2QX8A 4NC9A 1D2EA 3SX4A 1AKYA 4Q37A 3T34A 4GZ3A 1PHPA 2R60A 4WESB 4YCAA 3GJZA 1Q77A 1N6LA 3AEYA 1WLSA 4UCFA 4HH4A 2OBXA 2PVSA 1VB3A 2QAGC 1Z62A 4KQEA 2OHJA 3C85A 3HKCA 4RWZA 1K3FA 2ZEJA 2GTHA 1WIWA 2GD1O 2HHCA 2FLWA 1IY2A 2C98A 2FX5A 1OR8A 4KGXA 4RBNA 2NIPA 1E63A 4IO0A 2HJWA 2WM9B 4AJLA 4IXMA 5SZJA 2AI2A 3FDZA 2PWZA 5DTEA 4BMDA 1U8YA 1AUPA 3MUEA 4BUCA 3RODA 1IATA 4P0QB 4UE3S 4FQ5A 4FQ7A 3LYHA 4HLUC 2OBLA 1EQAA 2C4WA 1U9YA 1WPQA 4J4HA 4YMVA 2OBBA 4NPCA 3DO5A 3OWXA 5DWDA 3VTAA 1FIUA 2PMCA 2FPIB 2VOEA 4OFXA 1ZD4A 2JLQA 3MTEA 5E6SB 2CVQA 2O7NA 3L7BA 1W30A 1XFAA 5D3QA 4CM6A 5ENVA 4R81A 1XL0A 4YJKA 1SUWA 4E4RA 4BFLA 1JX6A 4IUDS 3RT9A 4JEHA 1GR0A 1RFGE 4MQLA 4DLVA 1YS9A 2MINB 3UUGA 2HJHA 3BXFA 3F3MA 2J0QA 3GGGA 4MX8A 1GP2A 1KAMA 2RHRA 5AXDA 4EX6A 1NG1A 3OURA 5EGNA 1ZXLA 2R1TA 4DABA 3VKHA 4UPVA 3LP6A 1AKQA 1N6PA 2IUTA 5JAPA 3K4PA 1TM7E 3SXUB 1U3CA 4AJIA 3DOFA 5AVXA 1HT2E 4HNVA 5H4GA 2D2FA 5DYIA 2ZBDA 5JLAA 4ZO9A 3CSDA 3TCNA 2O8CB 2O8VA 4O2BF 5JH7A 3EOBI 4RU1A 4F96A 1I5OA 4EKIA 1R0KA 5KJ6A 4D80A 1L4GA 3MWLA 4BXOA 1M6EX 2J46A 5AKYA 5CJPA 4UDYX 5KJCA 2RGDA 1OX5A 4JJEA 4OBBA 5IBRA 3P7MA 3STVA 5BNIA 2ZUWA 3OIVA 3LJKA 2A3NA 3EXHA 3H18A 4C2TA 3H17A 4L15A 3Q15C 1Z8NA 5AK3A 3ZPXA 5CT4A 1G5IA 1LLCA 1JEJA 1NRJB 3PHHA 4R8KA 3SHWA 1I6MA 3W3AA 4PHHA 4BVHA 1EU1A 4Y0AA 1QFZA 5CK5A 1RYYA 2NYRA 1DC5A 2W6QA 5J4LA 1B76A 5ERXA 4TXNA 4J91A 2WF9A 1G5PA 1H8HD 1FRFS 1CFJA 1X7ZA 2Q4TA 4G1EB 1Z2OX 1X14A 1ECCA 5CYFA 3UVEA 1A77A 1TLFA 2HC9A 1RKQA 1U98A 1R2QA 4D46A 2QROA 3EXEA 3KQTA 4X61A 1M5RA 5A0TA 3OJXA 4B6SA 2R0QC 3ZS9A 5BN4A 1BU8A 1RMTA 1G8HA 3SX0A 1WUIS 4F86A 4QNNA 3PVSA 5DJ5A 3DZGA 1WP4A 2ZULA 3AUTA 4ZV7A 1CS4C 2YHAA 4QOFA 4U39A 1MA0A 2LW7A 4AJHA 2EEZA 4BVLA 2VHVA 3R0XA 3AF6A 3CQ9A 4TWZA 4YJ2F 3GLTA 1JXAA 3EQZA 4AXXA 4TYYA 1Z15A 3UV7A 4BMZA 3OZWA 3KYCA 4PZUA 2FPXA 1J1UA 2RH5A 1B0UA 3JVDA 4I14A 1P33A 1SZJG 1TJNA 1G6HA 1GNQA 1CQXA 2QR5A 4FFDA 2BZ0A 1ZC4A 3WIBA 4A1OA 2HN9A 1OC4A 4OJTA 4P38A 4DIFA 4HAZA 2W8ZA 3PB3A 4KDRA 5G4KA 1TE2A 3VH4A 4DARA 3AF4A 3C3KA 4FLMA 4QQ8A 3AU8A 4KU4A 2GARA 2Y1OA 4YQEA 2A67A 3Q1LA 5KIAA 4QQNA 5HQJA 1E5TA 4R5MA 3ROPA 1V95A 4ZV9A 4CHGA 1CNFA 3WYGA 2JJ1A 2PPLA 4B33A 2IYTA 3V8RA 1GN8A 3KYIB 2UYGA 1ORRA 4B2LA 3AH8A 1DP4A 4W9RA 2AW3A 1Y3AA 5HJ5A 1L7MA 4KR3A 1KP2A 3R7AA 5K0EA 3RBAA 3VO9A 3JATB 4H3VA 2I4OA 1D1TA 3L6UA 5MFZA 2GEVA 4UUMA 5DYGA 4YR9A 4OP1A 5SZIA 2B4YA 3ZC3A 4C0KA 1N8KA 1OAOA 3Q41A 3T9CA 5HF6A 4ZMBA 2VQEB 4RXUA 2GS9A 4F2WA 3MT8A 5H70A 3ON5A 1NQTA 2ZJ5A 4Y6RA 1DMSA 3R1IA 3FCUB 1J0EA 4NK4A 4E6EA 4R6XA 4DLRA 1QC5B 1YCGA 2ASEA 2EFCB 4D98A 4EEKA 1LPBB 1VA4A 3IEUA 4TLBA 3R0IA 2VNIA 1R3UA 1XKTA 3BFJA 1FP4A 2FR0A 3BJZA 5EHGA 1U0BB 2H1HA 2A0FA 2QX7A 3GPBA 3O1JC 5FPKA 1OROA 3PCTA 4YQYA 3VPDA 3HN2A 5ALTA 1X80B 3EDRA 4LDQA 1U2GA 2F62A 3CE9A 4JBXA 4RK4A 1BQ4A 4EY6A 1C0LA 1T1RA 1YL6A 3MB5A 4A1FA 3D6FA 3DLCA 4G6ZA 5IZCA 5GINE 3QOYA 1CULC 1TTTA 4QUKA 2M6KA 3UOGA 5ITZB 1GFSA 3BGSA 1DIAA 3WNBA 1ATZA 3HTXA 1SUSA 1HE1C 2ZQ5A 4UUBA 2Z95A 1MORA 4WCVA 2GEJA 2QIPA 1DAMA 3B5EA 3W90A 2ZI5A 3NTOA 4F3CA 5JNRA 1WMDA 4NEQA 1DQZA 1IIRA 4MCAA 5LIRA 3CEJA 4ZT2A 3GPLA 2C9DA 4XOUA 4D9NA 4D0RA 4UUPA 4D9KA 5F1KA 4U00A 4A7PA 1YTLA 5EIEA 1P7VA 1ZESA 1XKQA 2FPOA 3H7IA 1TADA 2ZJFA 3UT0A 1GT6A 3HP1A 5HXAA 1AV6A 2BRUC 4ZOAA 4K3VA 1J0CA 4R5HA 3MJDA 4KIGA 3ZBPA 5CBPB 4QM7A 2I7TA 4KHZA 1C3JA 2JGNA 2GKGA 1P0FA 4JJZA 4TUYB 1YKSA 4K87A 1DCTA 4ECAA 2QN8A 2GSDA 2YMMA 1Y9ZA 3B3AA 2WWTA 3KJIA 3ND6A 4OKNA 3V1YA 1U28C 4K8RB 5JE8A 3TE7A 4DMHA 1YJ5A 4BPRA 2PT5A 2WR8A 3ZCVA 3TX2A 4EYQA 4YRTA 3AB8A 1XLTA 3PFHA 2GGSA 2R751 4IJVA 2P5UA 5DE3A 1Z0KA 1O87A 1LX7A 2ZTVA 3NEJA 3NO4A 3M83A 3HV2A 5AVJA 3WGOA 4B4OA 3KKEA 5CNJA 2PT7A 3C43A 3GRCA 4QNMA 2UYYA 2I66A 4CL8A 2IP4A 1RRMA 5BVGA 1Y1SA 3U3RA 3T7JA 4JLPA 5FWYA 1WKBA 4E7OA 3H3FA 4KZKA 1E4EB 2WILA 4EECA 2A1IA 2VHWA 3JWGA 4L6IA 4PX2A 1THZA 1EGMB 3ILVA 4MINA 5C81A 2R6R1 4WDQA 2WICA 1X77A 4YRKA 3FI0A 3LOQA 3TD6A 3GJTA 4BQIA 2PUBA 1CEYA 3ZE9A 2SCUB 2Z98A 4C4YA 3MQFA 3HDGA 5AW1A 2Q6OA 4DCPA 3BVPA 1BKSB 1POXA 1JHUA 1NP6A 4NZNA 1O6CA 4YQFA 3PHCA 2P78A 1PDVA 3BCRA 4YP7A 1J0DA 1T1EA 1NVGA 2J3DA 4R9VA 4X63A 2R8PA 2XXAA 1HLFA 2VHZA 3QMPA 2PS0A 3G2NA 3JQGA 3EZGA 1CD5A 2V3VA 3CH5A 3OIGA 3T3PB 5DTRA 1E2GA 4MLZA 1TMKA 3VNRA 2FJUA 4DLLA 1OKKD 4DR3B 3H1TA 4LGYA 3W8RA 4NYIR 1W96A 421PA 721PA 1L6RA 1LDBA 3NC1C 4C22A 1WCYA 3IT0A 1UZUA 1KZ6A 1UANA 1MZVA 1ZOSA 4NU5A 2ECOA 4Z9AA 2XHEA 1XQ6A 3RRFA 1C41A 2OM2A 4BP1A 1EUYA 5AFSA 1HTWA 2J5QA 1PL7A 3AHFA 4WCFA 2SKCA 5F9HA 2CY0A 2VHTA 4Q7QA 3C45A 3EH2A 4NJEA 4XGKA 2CJWA 2PGLA 3KKLA 4F85A 3FTCA 4L08A 5KJ1A 3STWA 5DPMA 2NGRA 2O9JA 4HX5A 4QBHA 4W7HA 5ESWA 2ZI9A 4RTKA 1TYDE 3ME5A 2R8YA 4LMAA 4UAVA 4PG8A 4BB6A 1K7YA 2AXEA 4Q39A 4DCVA 1OXTA 1FSSA 2QRLA 1AM4D 2Z2JA 4QGHA 2XMPA 1H0RA 2ZE6A 4JH0A 4WE3A 3NHAA 4PRLA 4MQFB 5TXGA 3UWKA 3F3YA 3VDXA 1MJGA 1N1EA 4D6XA 5M34A 1EK2A 2WF6A 4NDAA 1VPDA 3M6FA 3S55A 3MIZA 3RAEC 3CWCA 2W4MA 3U7FB 4QDKA 1JE0A 4D42A 4WUVA 4X6YA 2VXBA 2OHFA 2Z8XA 3BN3A 1OREA 3DPIA 4ZC8A 3V4PB 1NIJA 2WI8A 1XR3A 2BGTA 2C5HA 4I4TA 4OA5A 3G2QA 2R87A 5EE0A 3JVEA 3U56A 4U2FA 1BN6A 2V7GA 3O2NA 4F56A 3PD1A 1IUNA 4G5QA 5AW2A 3AVWA 1E62A 3FG9A 2DGDA 3F5DA 3GDGA 3OA2A 4YC7A 3NC0C 4TVSA 2OV2A 4GDFA 3NALA 4AZ3A 2F8LA 1FW6A 1JKXA 4I08A 1RKXA 4Q48A 4CR8A 2WSMA 2W4IA 1WY5A 3DNFA 3K5HA 3BH6A 1JJAA 4IIEA 3RRBA 5FBHA 4DIOA 3OC6A 3PFGA 2BM8A 2V98A 2VT3A 3TEJA 1W0KA 2C4KA 4HQLA 1Q1AA 1V48A 3F8SA 2XGMA 1XZQA 3H6GA 4C21A 1LRLA 4MR8B 1M1YB 1H23A 1SA0B 3D3WB 1E59A 4X7MA 5LBTA 3RI3A 1ZM3A 3VHLB 4DR1B 1ISIA 1Z7WA 1T3HA 4L3OA 3P19A 5EZQA 2AJDA 4BZPA 4DNQA 1MXHA 4UNRA 4BB5A 5HCNA 4ZT3A 4D3FA 1OLSA 4B82A 2QRGA 3WLPA 3RADC 1Y3HA 3GU3A 3EFOA 4KX5A 4NYMQ 3TH5A 1N0IA 4B2PA 1ZNZA 1YWGO 2CHVA 4HAIA 4WJZA 5EWLB 1FP7A 2IEYA 3UFXB 4ZYVA 1IBKB 3OVMA 4KQWA 1QE0A 1T0HB 4I3HA 4X71A 1DNPA 2VYFA 1QRTA 1J2YA 2OAP1 1MC8A 1P0QA 2WF5A 4LYAA 3VAAA 5T7BA 1Y4UA 3LXXA 4N3BA 4BRSA 1YHZA 3G9XA 3L8FA 5C7YA 2EFJA 4I4IA 5TGZA 3UQYS 4W6QA 5KMGB 4O4IA 2H5IA 4GD3Q 1SXIA 4KQ6A 1H22A 2F00A 3GQBB 4RCZA 2O3UA 1W0JA 1Z7BA 4V2UA 1YAJA 1Z7GA 3CISA 2A9KA 1TPYA 1L4FA 2HCTA 3FCYA 3PUIA 4RHFA 3P9CA 2AEMA 4XIJA 4EYOA 2M32A 4UMDA 2W2KA 4J7XA 3IURA 3AERB 3F8WA 3MTGA 2PV0A 1CJSA 4YP5A 4UEWA 4EKNB 1K5DA 4FS3A 1G5FA 2OD7A 4J43A 2SKDA 1K68A 3H3XA 3LP5A 1OZGA 4E4TA 5B2FA 5LP6B 3Q72A 5KAPA 1X6VA 3SFZA 3K9GA 3WLKX 4GEGA 1DUIA 4PVCA 1O9HA 5BVHB 3AXTA 5E7QA 1VBNA 1W9MA 2F90A 2Y6VA 4FJ1A 3LPAA 1GZ6A 4INOA 3UQZA 1SG9A 3AC0A 4IH1A 3BZUA 1NI3A 3DXXA 4B3IA 3QKRB 2WMDA 4UBOA 1TKRA 3SVZA 1L7XA 2PSHA 4HMOA 2PM8A 1CQIA 5EMJA 2A84A 4JT8A 4F84A 1KEZA 1P6QA 5C8YF 1KXJA 5BW6B 4L50A 2ZYUX 1AVTA 1IZ8A 1N9GB 1L5MA 2M6RA 1H9BA 2VDLB 2W2TA 4NKRA 3I58A 3WB1A 5CG1A 4O02B 4PLHA 4I1PA 2QZSA 3NBQA 3C5HA 1KETA 3C6QA 4ZCPA 2AL7A 5IARA 3RU3A 2HLDD 3OIFA 1E9VA 3FCXA 3PRJA 1QG4A 1VBMA 3KZCA 3UT6A 5EJGA 2RCNA 1SC9A 2J0SA 1D07A 3NGXA 4X90A 4IUBS 2W11A 2ZSKA 2C7GA 1DO2A 4GOLD 3GL9A 3IBTA 1SC3A 4BN0A 2W22A 4G23A 3GBVA 4HTAA 4LI3X 4QWWA 4JVSB 4AWBA 1XMOB 4J1SA 3D1LA 5M7EA 2Q5LA 2I78A 2OHGA 1U7PA 1H1LB 4XQGA 1ZN8A 3AVXA 1E5XA 4MAMA 4UUAA 2IBTA 3NP7A 1CU1A 4FM9A 4ZODA 2WTAA 4LWOA 1FQKA 1T24A 1ZOIA 4HGZA 3L0OA 2ENUA 3QVMA 1GADO 3ELDA 1R88A 4MP6A 1HY3A 3OOEA 5E9WA 4KNWA 3KQNA 3BMQA 1N7HA 4DNOA 1B15A 1IHOA 1R10A 2XEXA 3L8MA 4HAUA 2R44A 3EG5A 2VQ3A 3NGLA 4QSMA 3SD7A 2NSYA 4Z2AA 3GUZA 2ZVQX 1XNGA 2DTEA 2RBEA 3FOBA 4JJIA 2ODPA 3SVTA 5KB3A 5CG2A 4HDNB 1JH9A 2O8BA 5F77A 5KU7A 1W4AA 2V03A 5DHAA 4R1PA 4BE4A 1JLLB 1E61A 2VT2A 3D3JA 1DRUA 3C8DA 3HPQA 3EA5A 3KFVA 1U1EA 4OGKA 3GEMA 3IKTA 4PIPA 1XZLA 3GRPA 4PM4A 3WK8A 2PPVA 1KHTA 4HQNA 3FCSB 1WUJS 4PTYA 3PGLA 4EY5A 3GEDA 4UM5A 3I34X 2TMDA 2GCPA 2PANA 1QK5A 3GYGA 3I9LA 2P65A 3L9WA 3PUVA 4FSHA 5KOYA 3OFJA 3FKSD 3P4XA 3B3QA 2CNBA 3I8OA 4UASA 4FZ3A 1XXHA 3PNPA 1G66A 4WJKB 5DULA 3MAGA 4MR7B 2CUNA 3PTAA 4QC2A 1KPHA 2X3UA 1BAPA 2IHZA 2Y4OA 3LLSA 4XIGS 4YO7A 3U4QB 3RFCA 1K8YB 4BUJA 2ZZKA 3O7MA 4Y1GA 4PWYA 1L2TA 1WDMA 2J1LA 3M5PA 4A8HA 1EFTA 5IJZA 5DHQA 4PZAA 2R3SA 1H5QA 5JRJA 1AK1A 1QJCA 3LLCA 1GUFA 1UMCB 2WWVD 1JSRA 1W85B 4K88A 4KC0A 3A1WA 5KREA 1HT1E 4TZTA 3EGDB 2YASA 3LM8A 2B6HA 1Y7PA 3QNMA 2A86A 1NC3A 3MWDA 1RXIA 1NLYA 3LQ4A 3G8DA 4JXKA 3N0TA 5MHTA 1NNUA 4ZFNA 5CH5A 1C1XB 1BMQA 1EFHA 2FF7A 3P94A 2H4JA 4UAUA 3CM0A 2I4NA 1YF3A 1WMSA 5H3LA 3UM9A 3KVRA 4GIBA 4R31A 3X43A 3HYCA 3O4IA 3EWIA 1DVRA 4MW0A 1DAPA 1KVRA 3M3DA 3LUBA 1LNQA 3ZDEA 2P9CA 1D2MA 4ZVMA 3WLMA 3ICEA 3WTBA 3CVYA 1PAUA 2Q4OA 1RAFA 1ACJA 4BRUA 1S3SA 2GK7A 2Z9CA 2PMKA 5DB4A 3ZGNA 1FW8A 1VE7A 2NSLA 2NU7B 3H87A 4TTIA 1NJ5A 3F6SA 3RSOA 2Q7DA 1ZMOA 1H2YA 2RCYA 5BV0A 4CYMA 1G20A 2LWIA 3LBNA 4FDUA 3ZGOA 3PQ4A 1WM1A 3DFUA 1VLLA 5FD8A 1GT91 4B45A 4ZZIA 2X5NA 3FWKA 3QLEA 2IIVA 4DWWA 3OMXA 4TTRA 1M73E 3ROXA 2H5LA 1N5DA 4RY0A 3A9WA 1YK0A 2R48A 2W6MA 4AJ9A 3PNMA 3M5DA 3OQOA 3GB9A 1CZHA 3CX8A 5ENDA 3WDSA 5DTMA 5IRCD 4BNGA 2IEAA 4TMFA 1AH2A 3DD5A 4TRMA 5F2EA 1PVDA 4I1UA 1Z56C 3FPBA 1GFIA 4UEOA 2ZUBA 4LJ4A 1SY7A 3IRUA 1XEWY 4KB5A 4XCXA 4RK0A 3UJHA 1KR2A 3IUYA 2PJZA 2XMZA 1C9YA 4ICIA 4AJ1A 5AW4A 3K9LA 3QOWA 3UA3A 1HFKA 1ID1A 1Z2CA 3PC6A 2EX4A 2WSLA 4MB2A 2J0VA 5I48A 2R97A 2OESA 1UKCA 4LC0A 4PS0A 2WZDA 3SJAA 4A6PA 1Y7IA 3AOEC 4B0OA 2NT3A 1WW2A 3W04A 1N2EA 3GHYA 4WVLA 1EZZA 4YMGA 2NVBA 4KN9S 3I2JA 4CM8A 4Z3OA 4ZARA 5K0JA 1IIBA 2CNNA 1OXXK 1QGUA 4QUIA 1Y37A 2QZZA 2VATA 4S12A 1O2DA 4DWOA 4HB0A 2ZIGA 3SQLA 3STTA 1LRJA 1P0CA 3U26A 3JAMA 3UXMA 4QUDA 5AW3A 3K15A 4EJSC 2CXXA 2PUGA 2KM1A 5K20A 5J59A 1YOBA 1PR4A 1BSVA 2O3JA 2R6CA 3MJTA 2X8JB 3VU9B 4UOZA 5K0ZA 5FUMA 3D02A 1QBGA 1V26A 2FW0A 2JIZA 1J20A 3A05A 2VQDA 2WSSD 3ESCA 3LBYA 4OFBA 3E5NA 5T64A 4P35A 5FPTA 3ZHSA 4DA0A 4PNEA 1XTJA 5DOZA 5E6RA 2BYTA 4DR5B 2C78A 1RC0A 2VJNA 5B30A 3EW7A 3B1YA 1FCJA 3FOCA 4EX7A 4PYOA 3DQPA 1TLLA 3RVQA 4Z5XA 3HADA 2HWUA 1QSGA 5C31A 1P5ZB 2ZB8A 3WMEA 5B58T 2E85A 2VK4A 1J2JA 3T4UA 2C9MA 1KAGA 3W4KA 1SOVA 3LVRE 1ZUWA 1W0CA 3A28A 2ZJ3A 2R7LA 3IP9A 2XWSA 1EX1A 4I8IA 3S2FA 2F8SA 5AM5A 3B9RA 5A7FA 4KH1A 4IIUA 2F3QA 1GQRA 3BGDA 1CDZA 4X6XA 5EJ8A 1A1SA 1BG6A 1KEWA 4IRMA 5IYZF 4TQAA 1XVUA 4N12A 5CEEA 3DBIA 3L8CA 3V8PA 4HT3B 4PSCA 1K9VF 3HKDA 1JE1A 2UAGA 5ALRA 3W5JA 4TMVA 5BN5B 4AL4A 4CF6A 3Q8LA 4NECA 5D8DA 3L1HA 2Q9UA 1SXQA 5CLQA 4WIAA 4KRFA 1E2PA 2BPOA 5JJKA 4AX8A 4JBLA 1XC7A 3PDCA 4AJNA 5AP9A 1JKJB 1Z33A 2OG1A 2VLBA 1H2HA 2RIPA 1W8IA 3AR2A 4KKXB 2YHIB 4RZQA 2VBFA 1W36C 2IEGA 3T9AA 3SIPA 2B83A 3DAFA 4FOSA 4DGSA 5BQ3A 1JKIA 2Z04A 5JARA 2HNKA 3WICA 2C3YA 1GU7A 4G0UA 4CQMB 4ER0A 1G5HA 3I05A 4WQMA 2XHZA 3NOXA 3OTOB 2AT1A 5AIBA 2CXPA 4IL5A 1V1RA 3ODGA 3TF5A 1WZCA 3L7DA 2XZTA 3QLJA 3LPDA 2ZUSA 3NYWA 4J94A 3RS5A 5KYWA 1QMPA 1Z12A 1DDIA 1PYDA 2G1JA 1QHHB 2XUKA 4J0CA 4U1RA 4PYIA 1WF6A 3ZG6A 1R8QA 3A1DA 1E7YA 2PSDA 5CAEB 4AKTA 4HI0E 3P8ZA 4EUHA 3PRYA 2XODA 2XA1A 1TM5E 2PKEA 1I2DA 4HGOA 4LYGA 3DM5A 4G9EA 3UKJA 5AVKA 3DH0A 3AJAA 4G5HA 4MA0A 2JD2A 1C3OB 3DEKA 4A26A 3GEIA 1JSZA 5KSPA 2CVHA 3N2YA 1I6KA 3QE3A 2HIHA 3ZN2A 4BQRA 1RW4A 4K03A 4KFUA 5JD3A 1L7OA 2VT6A 4KFSA 3M8KA 2JLZA 2X58A 1BFKA 1TECE 3TTUA 5HZMA 5IULC 5LKAA 4KPYA 1HX7A 4ALMA 3MXTA 2J9ZB 4QEKA 3PF9A 3ZVMA 1QV7A 3DHVA 1SIBE 4HYTA 4LXTA 2B4TO 5K6AC 4Y9UA 3WGHA 3FUUA 3VU8A 4NOMA 1J99A 2B8JA 4JA2A 3FDZB 5CT5A 3ZE8A 3EY4A 4H16A 5EJEA 2GDJA 4HO1X 1UZNA 1W1WA 2V4MA 2XCIA 2C2WA 2O5EA 3DE1X 3C1AA 4U7GA 1MOSA 1U63A 4BGUA 4R9RA 4C3VA 4DRXA 4BATA 4UPDA 3C5WP 3UMCA 4C01A 3CUVA 4PBTA 2YINC 4ZDIA 4B3RB 5EXEA 1V3QE 1WQ4A 1YS2X 3PFIA 1O3YA 5FUXA 5JOQA 3O82A 2A92A 5DTQA 4LPSA 2GCGA 3V00A 4JU9A 2X1VA 4YDSA 1JEQA 2ODNA 4G1CA 5HKKA 1HNXB 3OEHA 4KCGA 4LVNA 3C98A 4NBLA 3ZD7A 1XZ8A 4M55A 2YWGA 3MJEA 3PUJA 5GJVC 5ALHA 4HV4A 1FJXA 1QK3A 1S2IA 1Z6GA 1FJHA 3O9ZA 2D8AA 3ONNA 3VJMA 4JJ8A 2Z4SA 2NUAA 4OBEA 1GZ3A 4AT1A 2D4AA 1D0VA 4N7BA 5TPWA 4RJTA 2J0EA 1TYCA 4YLEA 3WHIA 1OTXA 3Q7IA 4HDRA 4BMVA 2A5JA 4KFCA 1IVYA 1BGWA 5BRNA 1N9ZA 2FUG6 1BVRA 5T41A 3C3BA 5BQ5A 3ED1A 3HY6A 2R8BA 3PEVA 4AD8A 4FWTA 2DPHA 2ZREA 1K66A 1PFWA 1CUEA 1T10A 5JH7B 3GCWA 1F4LA 1R8JA 2GYYA 3QTLA 3G3EA 3PX2A 1UBUS 3RQSA 5E3HA 4H7PA 5MN4A 2F8TA 4BXOB 1XXLA 4PIVA 3UC9A 1QOZA 5FUVA 4N3CA 4L8LA 3RT1A 3GNSA 1JKFA 4QXPA 2GPWA 3D7NA 3N2EA 2P69A 3EXHB 3ST7A 2PUAA 4F2GA 2G9NA 4BV9A 4BQSA 2BGNA 3ITEA 4KR6A 3J7AC 5J1SB 1DDOA 2AVNA 4I19A 1FQOA 1RKBA 1T8YA 1KI7A 1QHEA 5LQNA 4RSMA 3UJNA 2YWHA 3DV0A 3HVJA 1Y9JA 3HA5A 2XQJA 2IS4A 5GTDA 5JZOA 1IZ7A 1NJ2A 3THWA 1X7ZB 1JQAA 2OWEA 1NONA 4IDAA 4DLNA 3IVRA 2J9RA 5A62A 2IYNA 1RM4A 2IV2X 2RHLA 3SNHA 3WLLA 3H6KA 3EXEB 4EJMA 1OH8A 4LV8B 3UFBA 2P7IA 2Z1MA 2Q41A 1KS9A 4YRMA 1Z36A 3KOXA 3MWEB 3DHWC 3F4BA 2WSIA 4KK4A 1GUYA 4U6QA 5KTOA 5HIKA 1QIEA 2HWXA 5AJZA 1BS1A 3WKBA 3NHFA 1LLFA 4FK8A 5IN5A 2Y1WA 3MJ4A 4MKRA 5A0VA 2BI8A 4J0QA 4RK5A 3GMDA 3EDMA 2OQIA 4GKVA 3KTOA 5KQPA 2E1PA 5HIMA 3KYCB 4C0LA 1CUJA 1U1GA 4TSRA 3K0FB 3BRQA 5B55A 4HUQA 1Z4OA 1DT5A 2R47A 2YDXA 4GE3A 2V4UA 2WABA 4JQYA 4KIFA 4MGKR 3HWRA 4I9UA 4PWZA 2ZIWB 3R8XA 5DN9A 3RASA 1EDOA 1DG9A 1G0OA 2GNAA 3NWBA 2AR9A 4DMCA 1F12A 4WXHA 3KQVA 5G4KB 3NBAA 3QF7A 8ABPA 3RRMA 4C0BA 1KC3A 2WUEA 4Z4HA 2VTBB 1LUAA 5ALZA 3KTFA 1V11B 3ZI4A 4HLQB 4G97A 2AXNA 4MS4B 3FYHA 3LCCA 3OZ7A 5JVDF 3VKGA 3K0BA 3CWZA 4P32A 2WJIA 5GJCA 4C2UA 4J7AA 1RAAA 1CY4A 5DGIA 5IVIA 4BMYA 1Y8AA 4BMCA 1VL8A 3AIMA 1XZFA 3COSA 5L3ZA 1M2NA 1NUAA 4LHZA 3TQIA 3AFGA 3U60B 2PH5A 4E94A 4G09A 2B1IA 1CB7A 1QKJA 3O8QA 7MDHA 1BHQ1 1EP1B 1JIIA 2ONYA 3QFHA 4X7RA 3NORA 3ZBUA 1EVJA 2I71A 5F52A 1G41A 4H0FA 1XZEA 4IGIA 3I92A 3O4GA 3JYLA 1ST3A 4MUKA 3GJRA 2X7XA 3PXXA 4J75A 4NRDA 4WZBE 4UQLA 2YY5A 3BMCA 5M2QA 4DUZB 4QJIA 4RIGA 2CFRA 2QEQA 2IIQA 3L4BC 1C5KA 5HBRA 4BIMA 3G2MA 1FMCA 3QWFA 4IVRA 2RG1A 3RVNA 1KAEA 3CVJA 4CDMA 5B1DA 1XTZA 2Q9AA 1FP4B 3SYMA 4L02A 5HFNA 4TQ9A 3PNSA 2IHBA 2YCLA 3CLHA 4DNPA 3TTVA 3VNAA 1ZL2A 3W79A 4QFBA 3RC7A 5ICMA 5KPDA 1F8GA 2BFBA 2F3SA 2OFPA 4BCDA 3T3OA 4KWEA 3JPWA 3HXQA 4YY3B 4CV3A 3I6QA 3VRHA 1O1YA 4CMEC 2O8CA 4IOLA 1QG6A 2W2LD 2AF4C 5JAZA 2WJ6A 2YX1A 3U4HA 1E9DA 3ZWMA 1PTJA 4D3XA 4DQVA 1EHCA 2D74A 3QVXA 4WKGA 4B3GA 2QD2A 1RQXA 4WOCA 1W5AA 5TE9A 3U1VA 5EMKA 3AVUA 1QFXA 1RT9A 1A0OA 4RZXA 4DEYA 1E5DA 1TZJA 1UJ5A 3G88A 4ZD6A 2QRNA 4IUCS 1KGDA 4GFDA 2B4QA 3KQMA 4K6GA 1QVVA 4JGIA 4K9QA 4NFLA 3KQWA 3EPHA 2XKBA 2DQKA 2FU5C 2WHEA 5ER9A 1Z0IA 2Z8YM 2HMVA 4GX2A 1UXHA 3UWPA 1QRUA 4L9WA 10MHA 4QTYA 2ECKA 2C4HA 1IZ9A 1PD0A 3HO6A 3QLVA 3RSLA 4KO8A 3ZQ4A 4AY5A 3T9EA 4PTZA 4AECA 5F7XA 4NOJA 4JYZA 3X0DA 3MT7A 1ML4A 2FHPA 3DOJA 4F71A 2GPAA 1DEXA 2ZRHA 1DB3A 1XD2A 3ANYB 4KQIA 1QHSA 4MI1A 3EVEA 3L05A 5DW3A 5BQOA 4D4MA 4ZV4A 2VBCA 2OZLA 1Z28A 1RLUA 1RWXA 3Q5DA 4OSEA 4JV5B 4IHAA 4CF5A 1E7SA 1FTGA 1P5RA 1T4BA 2AMLA 2YWJA 1PVOA 5TRTA 1VI5A 4G1FA 1XHEA 4RH1A 3B2EA 4DSZA 5BVGB 2BL4A 3VNUA 2RBGA 3DXYA 1RZRA 5FWYB 4CU2A 5G41A 2YXBA 3D6JA 5FBKA 4UTPA 1Q5PA 2VXCA 5EUCA 2QRUA 3UG6A 1B43A 4YPOA 2NV2B 1AQYA 4XWGA 4RHCA 4EQ6B 2ZI6A 4TMZA 1CR0A 3OZDA 5DFAA 3TZBA 4I50F 5JEEA 3SR3A 4KW7A 3K6JA 2LKDA 4BFTA 4UQPA 1ZCFA 3AF2A 1PS9A 2YWDA 4UEKA 3RRXA 4MVJI 1SNYA 2FF5A 1BROA 2GRJA 5BSHA 1KFBB 3GVXA 1GEGA 3OCXA 3WBBA 3LAWA 1UQUA 3C7CB 3JQ7A 4XW2A 1W94A 4KIJA 2DFKB 3PGXA 2VKTA 1EE9A 1NN5A 3IE2A 3PGMA 4QSHA 4AUKA 5JATA 2VOJA 3JQGB 4I4NA 5TLSA 4DLSA 3S1AB 3I9OA 1A8PA 3RJ9A 2J33A 4J29A 1VIVA 3GP3A 4RPKA 2B8EA 4AY3A 1SOUA 4W5TA 1YZLA 1JAYA 2Y67A 1NBWB 4QBIA 4DJEC 2VJDA 3QEJA 1ZR2A 1Z4IA 3ELBA 3EOZA 1C4WA 1KK3A 1XLWA 1V8ZA 3M70A 2FSFA 4R8MA 3B5IA 1T6BY 2IPLA 4NJEB 4ZXPA 3HB9A 3R8CA 3HQ4O 4PLTA 3D2CA 2CJWB 4JX9A 4NOKA 4Z0PA 1DJNA 4ZVUA 1YACA 5BWCA 3GD7A 2HA0A 4G5RA 4P8RA 1TVMA 1U3FA 1L5KA 1KFCB 4TV9F 2FMHA 4I1RA 4OKSA 2QL5A 1II9A 4R2WA 3B1WA 3I2HA 2QP4A 4PG4A 4CMIB 4HLNA 1GQQA 1RYFA 2GYUA 4U2EA 3BQMB 2GERA 3VV3A 3OCVA 5JS2A 4DDUA 5LQCA 2BFDA 1DKMA 2ZUFA 2H2FA 3MJCA 4KQMA 5AI8A 1CYDA 3AZQA 5AK4A 1ECLA 1KH2A 4OHPA 1KY3A 4OK5A 3RUPA 1RWOA 2XE6A 3SBDA 5L53A 4JDPA 3T7RA 3GLVA 4RKWA 3R20A 3H97A 1G4HA 1T8TA 4P3OA 4DDTA 3O73A 4LBZA 4UZSA 1UK9A 1SUBA 2IOHA 3OQBA 1E2HA 2Z56A 3K94A 4C88A 3W3AH 5LNK1 4I4TB 3P97A 1NV8A 1UMKA 4IDCA 4J1TA 4Q9JA 2WYOA 4D3ZA 4YV2A 4WXEA 4XUEA 4J6FA 4WK2B 2O52A 3RSGA 3KUUA 4CUJA 2R7KA 4DMMA 3ZWPA 5LD2B 2QL6A 4O59O 4EFKA 2DFDA 3T1NA 1ISGA 1B2LA 2Z5VA 4IXWA 3TRJA 2CJFA 4C7VA 3L7KA 3FRIA 4L1KA 2I34A 1SC6A 1O5OA 2BM1A 4DCCA 3IEMA 3ABOB 3VDRA 3WGNA 4PZ0A 1ADGA 4FW9A 1L5SA 3HCPA 4YYEA 4ZHQB 5IAJA 2GN8A 2FR8A 3E9RA 3IAXA 4IGFA 4JXJA 1I1OA 1KVUA 4WUTA 1JVBA 1KO8A 1IZ0A 3KOWA 2BEJA 4MKGA 5TMEA 4DQUA 2JCVA 5UKDA 2RE8A 4PZZA 4TS9A 4QNRA 5ICCA 4OBWA 2ALJA 3S7TA 1GTMA 2XT0A 4HDKA 4WLEA 4ETMA 3AT1A 2IOFK 2QTBA 3EFOB 1PJTA 2EDCA 5EJ2A 1ZRSA 4EW2A 3BXEA 1RI5A 3NHYA 1RQNA 4NJOA 4FN4A 3WNVA 1M6YA 5C5DA 3HO1A 1VLMA 3C7KA 1ZUD1 3EQ7A 2HZBA 1XZHA 1EUCA 3D1JA 1I8TA 5D5HA 4P0TA 3M6WA 1SB9A 3DB2A 3R6LA 1POWA 2OMEA 4QGBA 5AJHA 3VA7A 4ZXFA 4ECEA 1M5TA 4O4IB 5J1TB 1JEYA 3OCUA 1OGJA 3ZW8A 1UOEA 2J3KA 4MUEA 1OZFA 5JQWA 4KUEA 3GLIE 3BIXA 1OA0A 1FUUA 5HCUA 3QVGA 3KD2A 3NBUA 5HM6A 5D3ZA 5JD6A 1E9SA 2W2KB 4EFMA 3IBSA 2GBLC 3KR9A 3NHJA 5EA2A 2GSWA 3NXSA 2ZPUA 1H6DA 3T3IA 4B35A 2PL3A 5P21A 3HSSA 2JAPA 2QAGA 3EUWA 4RVNA 1QHYA 5CRIA 4NCIA 1C0EA 1FXSA 3M81A 3ORFA 1YFKA 3JYNA 1T3LA 1B0ZA 2WKQA 4N8DA 4TMWA 1FFXA 1Z4MA 3K1JA 2O1SA 4CFZA 3O1HB 2P67A 3B13B 3KK0A 3PSHA 3RUFA 4DQDA 4QJ3A 2GD0A 3UJDA 3RSSA 1A9XA 1EP2B 2XDQA 2QXUA 9ABPA 2AI3A 2PGJA 2ON6A 4HXYA 4EB0A 4HLUA 3UATA 3JZIA 4FX2A 4EG7A 2DVMA 3BB1A 2NXJA 1M66A 1CQIB 1U7OA 1ZRHA 3D6MA 4FHZA 4IIJF 4MEJA 1M0WA 4HYYA 2C07A 4QA9A 1PTKA 1W87A 1YA4A 2HAEA 2WWGA 3PUZA 4RM2A 4UHDA 2NZUG 4UM9D 2YHBA 2JFFA 4GOMD 1J22A 4OGFA 3FXAA 3CFYA 4KO4S 1E79D 2J3MA 4DLKA 4RTRA 2IL1A 1AQLA 2R25B 2IXTA 5C32A 4KMSA 1HE5A 4QUAA 2CXNA 2JJ2D 4D57A 2R6JA 1SCDA 4LJYA 3AM1A 3DMNA 1S3FA 4UBJA 1XTSA 3IUPA 4O5AA 3IOCA 3AKYA 4IDFA 3AOGA 4Q15A 1L8LA 1U0HC 1I01A 3ZDQA 5I4IA 1DAHA 1Q0SA 1SD2A 2C5AA 2JANA 2ONKA 3M6IA 3DXZA 1F2UA 3KB2A 3KEOA 4XFJA 3CW8X 2IZOA 4BFVA 3EGWA 1RLIA 2CBZA 1AHIA 3A4LA 2CL0X 2V59A 4Q7JB 1IOZA 1N6NA 3L5OA 3VSAA 2P5YA 3IR7A 2GPYA 1HOXA 3VMMA 3B89A 1EXVA 1Y8QA 1RBQA 4OOEA 4P2BA 1ADBA 4KREA 5I7RA 4M8KA 4P5DA 1SRRA 2IE8A 2HUPA 3HYLA 4HBZA 3ZGVA 2GKSA 3WHLA 1ZRMA 5KYGA 4QPZA 3LX8A 1K4KA 2ORWA 1TJPB 3AM5A 3GFGA 3WQHA 2Y99A 4YT4A 2JIQA 2ZRPA 1NF9A 1KYWA 3OPVA 1FSPA 3AL3A 3BMQB 3BD9A 4XB2A 4WASA 5E95A 4I9HA 1RHQA 1E2MA 5DHPA 4V02A 2NVOA 2FRXA 2Q6VA 4ITRC 5B3AA 4CZ2A 4DIBA 1Z75A 3EZLA 4CCAA 4O2LA 2X86A 1H2EA 4LKRA 3CR3C 4P6VF 1HUQA 4D02A 4LZPA 1F8FA 1XU7A 1YB5A 2AB0A 2ZSFA 4M2LA 4O1MA 2O8BB 3K9BA 1TQ4A 1UEXC 1A8IA 4L8WB 4IEIA 1V3TA 1YC2A 1OOEA 4Y6PA 5JY6A 3IEKA 4V38A 2EFDB 4D4LA 1A7UA 6CHYA 4X84A 2VK8A 1VSUA 3B8EA 1M8KA 2YRWA 1TT5A 2ESRA 1W5EA 3PCRB 4FOLA 4GNKA 5LC1A 1JAXA 1X1QA 4EKGA 3O8OA 4Y2TA 4OB6A 2XCTB 3NNDA 1XALA 3ACDA 1WSAA 1X3SA 1XXHB 1YZNA 3B48A 2GYWA 4OQQA 2CNWA 2XNHA 4BKMA 5H83A 1NOKA 4WZ6A 4BB0A 4Q4CA 5B7QA 3RS8A 1RPNA 3C5CA 1O77A 2XSZA 1ZD9A 1WKVA 1EWVA 2F64A 4PNPA 2DPLA 5LLSA 2PO5A 4GXQA 2JJYA 1KZ4A 2F4NA 2QI9F 3MTDA 2W8BA 1DSSG 2Z2IA 3GOHA 3H1PA 1L7PA 4KQ1A 2WJHA 2BKVA 2QE7D 1KWGA 3LW8A 2ZQZA 2GX6A 5I7FA 4HH3C 2JHFA 3WL6A 3JYOA 4LXXA 2W2VA 3F5MA 4G07A 2FSVC 1YBMA 5ALGA 3U62A 2YFKA 4Y98A 2BUCA 4Y18A 3ZWVA 4G0XA 3MWDB 4C5CA 4JAVC 2OK8A 1IUKA 3HRKA 2H08A 3TR6A 3BS4A 3WYEA 2WJZB 3UCFA 1ODLA 4JY7A 3ZCPA 2IU3A 3PEUA 1P1JA 3P0JA 1M1NA 3I2KA 1HDXA 3OBBA 4NBRA 4XTCS 3EIQA 4BGDA 2IHYA 1IMJA 1HV8A 3FWYA 3VYTB 2NO9A 3QA3E 1RRCA 3GFFA 3D6VA 3HLTA 4QASA 3R5SA 2OEPA 3D43A 2I6GA 5JXWA 1F3OA 2O5RA 5DX8A 4CIBA 2B98A 1LGYA 2JCGA 3BX1A 3KAKA 5I7VA 5EZ5A 1JMVA 4FEEA 3TIGA 4BEJA 5EHXA 4LRXA 3ZE2B 3WL3A 1X94A 3G9QA 1OASA 5DGCA 2BW0A 3LFTA 4OI2A 2WFZA 2SBTA 1QGOA 1U8EA 1G7RA 2NTVA 3Q11A 4O2AA 3TNYA 4EIWA 2OGSA 3QHQA 5LQUA 1HFWA 1IN7A 4FYXA 4ZOBA 1UF9A 3VKVA 3ANXA 1XJ0A 2O23A 2Y68A 3HYRA 4HNHA 1XCLA 1O5TA 2CD7A 1XJCA 4MYHA 4P7KA 1TO2E 4OUKX 1L5LA 4BCCA 4E51A 1DG1G 1U2TA 4X3PA 1KHHA 3A3KA 3WWZA 1T2NA 3PDIA 4C6RA 1FC0A 5A3JA 1VYUA 5HRAA 3GJSA 4KMOA 3F0TA 1PR9A 3I0MA 1T0UA 3UK1A 4QDZA 4M8SA 1DAEA