1RZ3A

Structure of a possible uridine kinase from bacillus stearothermophilus
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
198
structure length
184
Chain Sequence
MELRDRIDFLCKTILAIKTAGRLVLGIDGLSRSGKTTLANQLSQTLREQGISVCVFHMDDHIVERAKRYHTGNEEWFEYYYLQWDVEWLTHQLFRQLKASHQLTLPFYDHETDTHSKRTVYLSDSDMIMIEGVFLQRKEWRPFFDFVVYLDCPNIQKFINRYWKAEDYYLETEEPIKRADVVFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of hypothetical protein RBSTP0775 from Bacillus stearothermophilus
rcsb
source organism Geobacillus stearothermophilus
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein RBSTP0775
total genus 60
structure length 184
sequence length 198
ec nomenclature
pdb deposition date 2003-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00485 PRK Phosphoribulokinase / Uridine kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1rz3A00
2ZVQX 1OH6A 1WBDA 5G53C 3P1JA 1KDRA 3MAAC 2IUSA 4B74A 1YQTA 4KSCA 5GVSA 3EZFA 1KK1A 5AJVB 3NDBB 1UFQA 3OE7D 5G41A 2OSBA 2ZXUA 2JLUA 3AKYA 4YDHB 4F92B 3C8UA 5J4HA 3GLFE 3WMGA 1YZGA 2R6FA 4XVRA 4MUAA 3TK1A 5HPYB 1MABA 2DFNA 3GJ4A 4JSTA 1P9WA 3DEFA 1KO1A 3O8BA 4UXIA 1M8PA 3MWKA 1SXJB 5P21A 1KSJA 4DEYA 1IQPA 2BV3A 4L4UA 4PTLA 4DSNA 3B7GA 2N42A 5LPNA 4AG6A 2DYKA 1IXSB 2X77A 1XX6A 3MG9A 4I81A 3B85A 1T4GA 1OFHA 5DISB 2Q3FA 2ZRAA 4YMTA 3NDPA 4TLBA 4KSBA 1US8A 3ADCA 4Q47A 2RHMA 1VG1A 2ZRPA 1W2GA 2IYYA 2WZQA 5FBVB 4C0KA 4G5RA 1E2KA 4DLYA 5M04A 3K70B 2QMHA 1UKVY 3K9NA 1NJGA 1UEIA 3RC8A 3DKPA 3TAUA 1D9XA 2IWHA 1OV4A 2WJVA 3B8HA 5HCIA 1ZD8A 1ZUHA 3WRYC 4HYYA 3TSZA 2QP3A 5FUVA 3WBJA 4ERNA 5AUNB 3REFA 3C4JA 4LBZA 1YR9A 4QJ4A 5IRCD 4Q5IA 2MSDB 4ZCIA 5JI2E 3E1SA 5JJKA 3ZS9A 2BJWA 1NKSA 4C0QC 4P3YA 4RSGA 1OT3A 1E96A 1MOZA 5BXQC 4G5QA 1SXJC 2QPOA 4XD7D 2GCOA 3BAFA 3EX7C 2GEDA 3QQ5A 1M7HA 4IDOA 2YC4C 2ZANA 4RCZA 1JAIA 3ZGXA 4GL2A 1WXQA 1Q44A 1WB9A 1NVVR 2IUTA 1IN7A 4L9WA 4BASA 3A4LA 1TADA 2DWQA 2FMXA 5EXTA 3KQNA 5F9HA 2J5XA 2IA5A 3K1JA 4LHZA 1T8TA 5DIFA 1JJVA 5HKKA 2XXAB 2YKGA 1Z63A 3QF4B 1GZSA 1UBFA 4AKHA 1HURA 5FOVA 2IW3A 4QBIA 1OXUA 5GVRA 2NO9A 4JYCA 4CVNA 4JBXA 4M2LA 4LJ9A 4JKYA 1NMXA 3IILA 2CBZA 3MJHA 1OKKD 1W5TA 1U9IC 2ZRDA 1ZD9A 2HV8A 4R9UC 2ZI9A 4PQRA 1XTIA 1E1RD 5K8IA 5JHGB 1Q1ZA 1Z0AA 2O0HA 1KMHB 1XEWY 1U81A 3BGWA 1ZBDA 1MT0A 3PQCA 4DLUA 2RGDA 1DBSA 1J2JA 2AWNA 4FCTA 4Y0VA 3V9PA 2FOLA 2O8BB 4Z1MD 1Q1QA 1N5KA 1CP2A 4FMDF 5L3RA 4D82A 3W3ZB 2YWGA 4DLTA 3W90A 1MRNA 2QY9A 3GFOA 4LYHA 4MYHA 3B9QA 2A7QA 1W1WA 1U8YA 1P3JA 2XB4A 2WMOB 3AF2A 1VIAA 1C9KA 3BE4A 3U7FB 4HLDA 1NRJB 4DCUA 5CB8A 5F98A 1EWQA 5DN6A 1MO4A 4TT3A 3VHLB 3VFDA 3WYGA 4QNMA 1YZTA 4M0LA 4MGKR 3SS8A 2ZYUX 1XMVA 4DXAA 2PMDA 3CRW1 2D2EA 3QOFA 1B0UA 121PA 2AK2A 1Z0KA 4WVFA 5TARA 3ZIAA 1O87A 4Q9KA 1CXZA 4UXJA 4RD4A 4XJXA 5GJBA 1SVSA 3EPHA 2NMVA 1WA5A 3NKVA 4JLBA 4MUBA 4MRSA 4UNPA 5J4KA 5L3VA 1EFRA 1CJKC 2ZRGA 3LBIA 5CYPA 3T5GA 4OQMA 5JEEA 4TTPA 1NP6A 4AG5A 2VH5R 3GJ8A 3W8RA 5JS8A 1X6VA 3P4XA 5FOSA 4ON9A 1OW3B 1N6LA 2ZJOA 3W6PA 1S8FA 2PLFA 4QC2A 4RCYA 3S1AA 2A2ZA 1II8B 2WAXA 2JJ1A 1P7CA 3QUSA 2VEDA 1EFTA 4QHTA 3LW8A 4A0GA 1E98A 8OHMA 1Z3IX 2CL0X 1N6RA 2PCLA 2FX3A 4XSHA 3TIFA 4DHEA 2P0EA 2C95A 2GA8A 4PZYA 2LCFA 5GJCA 3CRQA 2I3BA 5CM9C 1E69A 4LX0A 1OHHA 3SHFA 2GK7A 1WMSA 2N46A 4HDOB 3KQHA 2EU8A 3VKGA 1VCOA 4Q1AA 2AFHE 3CBQA 5BYKA 3ZD7A 5KUTA 1W36B 2KB0A 1G17A 2GJSA 3VAAA 3HU1A 2FEMA 4URWR 3MSXA 2FE4A 1Z0JA 3RLFA 2C96A 2AKAB 4A9AA 5J4VA 3ND8A 3U4QA 4BZXA 1DELA 1PJRA 4WBSA 2ZI5A 5IF9A 4M9SA 3TBKA 1E2QA 4OK5A 4X8MA 1V5WA 3H0KA 3IEVA 3T61A 2X8AA 3SNHA 3BB4A 4TL7A 2IS2A 4LJ5A 2IK8A 3KQKA 3H86A 1ZNZA 4ARZB 2JJ8A 4AI6A 2RGGA 1U94A 3A1TA 3AV0B 1FMJA 5KPJA 1Z0DA 2ZS7A 4DVGA 4ZCMA 2XOKA 1L4YA 4HAXA 1A4RA 1D9ZA 1QF9A 2WJHA 5AUPB 3SBEA 5FL3A 3PUWA 2V1XA 5KDDA 4BLRA 3R8CA 1N0UA 3H84A 4B34A 4F91B 1VCIA 1CS4C 3TVTA 4JS0A 3HJNA 2I1VB 2XTNA 4RVCA 4RZ3A 3B78A 1VIYA 5IDVA 4EQ6B 2A5GA 2WJIA 3ZZUA 3EZ9A 3UMRA 4D4LA 1W0KA 1NY6A 1PV4A 2JATA 4XH9B 1Z6GA 2NZ8A 3WRXC 4GI7A 4JL6A 1R5NA 5LB2A 2ANBA 5FTNA 4YLGA 1W7AA 1WP9A 4NU0A 3HU2A 1DO0A 3U6KA 4KU4A 1GKYA 1G9XA 2QRZA 4GMDA 3WY9A 1Q12A 2WOJA 3FFBA 3CPHA 4HI0E 4F4CA 2C04A 3U3RA 1T3SA 4ITRC 1M34E 4BLOA 1G3RA 4LK2A 4C30A 4M8NE 1IXZA 3WNDA 1MRSA 2WWYA 2HJVA 4PC1A 3CX7A 2F1HA 5GJVC 3RAPR 2J9RA 1MH1A 4OHZA 2R44A 3L2OB 4KVAA 4A4DA 3R9XA 4HAUA 4G0NA 5HZHA 2O8FA 2GBLC 1V43A 2RGNA 4PHHA 1SVIA 1U8AA 4X8HA 5KNCA 3SZRA 1EFHA 2FA9A 3NEYA 2JA1A 1GDDA 2MSEB 1XEXB 3DOFA 2XSZD 3I8XA 4UKDA 2ZJ8A 3C16C 3MWJA 3SJZA 3FHCB 1E0SA 2QI9C 4JJKA 4GRAA 4S35A 2J87A 3KB1A 4OHWA 3AGPA 1KO5A 1P2SA 4TYPA 2ERXA 4K81B 1GNQA 2WWHA 3LAWA 1N6KA 4JLAA 4M9QA 1XPUA 4AY2A 3P26A 4BFSA 1DOAA 4E5UA 1DAMA 1FQJA 1ESNA 3DVLA 3UWKA 2D7CA 4BZPA 4JVLA 4O3MA 3A36A 1ZC3A 2BJVA 4B32A 5A5GA 4QXAA 1T5IA 3BH6A 4IOMA 2GEVA 2DFKB 4GPTA 3AVXA 3ADDA 4CEIA 2X1VA 5D3MA 4DB2A 2XEXA 5JMTA 4NCKA 4RD2A 4RD6A 2C9YA 4FCWA 3FB4A 2VTKA 1AQUA 3X2SA 3I8SA 2W00A 4L5BA 4MGZR 4WW0A 4DT1B 3GMTA 3CH5A 4IVRA 2QQEA 4TN1A 4CW7A 1NG1A 3THYB 4BFVA 4DDUA 4XVUA 3KJGA 2VSOA 4HUTA 3TVDA 2ZQ5A 3WYFA 5KU1A 4PO8A 3VNVA 1Z29A 3KB2A 3OEHD 3R20A 1CR0A 2GRJA 5D3QA 1W0JD 3KUCA 3K0EA 1BMFD 2ZM5A 4YMWA 5DE3A 1E79A 1I4LD 3VQTA 5FBLB 4IRUB 2NO1A 4D0LB 3B82A 3CKLA 2D7DA 3K0SA 4ZPXA 4DDTA 1IJFA 3AKEA 3GD7A 3LD9A 3EZ7A 3NH6A 3AGQA 3FGNA 4FMCF 2NZJA 2VIIA 2VP4A 4LSGA 1IM2A 3L0PA 3CIOA 2RGEA 3LA6A 1A1VA 1AN0A 4YDSA 4TT3D 3GFTA 1KI6B 3TLXA 1AJEA 5CITA 4NPHA 4LUCA 4B3XA 2GBLA 1YKSA 4GZMA 1II9A 4CYMA 1KO7A 1XWIA 1KO8A 3C5HA 4M21A 5FOUA 2VSXA 2ZAOA 3CONA 5DHFA 2PT5A 2O8DB 2IEYA 4NL4H 4XWKA 1R10A 2RKOA 3RRMA 4EFMA 1XJQA 2QTVB 2JIZD 1EX6A 4KVGA 5CYOA 2GVZC 2WAYA 4U5XA 5CLLA 4L16A 3ZYCA 2AN9A 4DT1A 4F4IA 4PHFA 3SBDA 2VPPA 2YJTD 1E9EA 2HF8A 1XPOA 5KSZA 3ZVNA 4IOJA 1HE1C 4O0MA 3FPAA 1JPNA 3VR6A 1W36C 1D6JA 1KNQA 4M1YA 1SXJE 1HH4A 2VHQA 3K70D 2I4IA 1JR3A 1UJ2A 5BN3A 2GAOA 2WOOA 4GBMA 3V4FA 1LY1A 3LLMA 4CT5A 5JECA 3KKNA 4GOJA 4LJAA 1CIPA 4C3ZA 1GP2A 5E95A 2H8KA 5CJPA 5DH9A 4DRZA 1AS0A 1G19A 3K09C 2A5DA 2YOHA 1KDTA 3AEZA 4LPSA 1OH5A 1VDZA 1M6NA 1T3LA 4BE7B 3ZQ6A 3C7KA 5EE0A 1NN1A 5KHOC 4PAOA 1E2EA 1R5OA 3IKJA 1KHTA 1KOFA 5AJXA 3TSWA 2XZLA 1US8B 1SULA 1FX0B 4M4SA 1A7JA 4OHVA 4JKIA 4QHSA 3R7WA 2RCNA 2V9PA 2YV5A 2IL1A 1FTSA 2O8CB 4Z8YA 1ZD1A 2GHIA 2VSFA 4QBHA 3KQUA 4M22A 1QHNA 1AM4D 4G5OA 3PR1A 3KZ1E 4JVSB 5F9FA 4V02A 1HYQA 4L15A 4H1VA 4ABYA 2EFEB 1RZ3A 4KXFB 4PHGA 3UANA 1KKMA 4BFZA 2QTHA 3WMFA 1S1CA 3A1SA 2OV2A 2HXYA 1U98A 1Z0IA 4N3NA 2QN6A 1OXVA 2YWEA 4QG7A 1NMZA 1RRCA 1M74A 1VKJA 2PMKA 3O8DA 4LV5B 3WHLA 3A58B 3B9PA 3SQWA 1M2OB 1CU1A 2Q9BA 1Q21A 4AKGA 2IS1A 1XMJA 2D06A 2J0UB 5DGXA 2HLDD 4O2LA 3UG7A 4PPFA 3QNUA 1OIVA 2Q9AA 4AURA 1RRGA 1JEEA 4HUQA 1CLUA 2ZU6A 2JLZA 3KDSE 1MO5A 2YWFA 1JQLB 1AS2A 1JI0A 1E9BA 1G64A 1YU9A 1NBMA 3U6BA 2CE2X 4W7SA 2F9MA 3EC1A 4E03A 1N6PA 1W0KD 1MV5A 2AD5A 3B1ZA 4X8OA 4HUQB 4M1MA 4BECA 1UKYA 2HUPA 2A30A 3C5CA 4OHYA 2NO6A 3I5YA 2GEUA 2VHCA 3U3KA 3TQFA 2WWWA 4ESHA 4HATA 2VP6A 3SI7A 1GAJA 1RYHA 2OAQ1 4ZIRA 1SQ5A 2OLJA 1FNMA 4A15A 2BBTA 3QBTA 4W5JA 2B7CA 4L8GA 4U02A 2UVQA 3HWSA 4BLSA 4KYUA 4Q1DA 4EPRA 1NN3A 3THYA 3VHXA 1TNDA 3FVQA 4IVQA 5L3SB 5JEDA 4A2QA 3THXA 3EWSA 3BOSA 1KZ7B 5H8WA 3I3SR 4CZ2A 4OQXA 3GLGE 2XNSA 2V6IA 2C98A 4N0EA 4V03A 1GOTA 3NC0C 2WTUA 1TX4B 2ZRCA 4GOXA 2OESA 421PA 1J7KA 4WAUA 2BM0A 4TQAA 4US1R 1ZYUA 2A5JA 1G8GA 1Z07A 2GILA 5EP1A 2XB2A 3AVPA 5HE9A 1MR3F 2C8VA 2JLQA 3ASZA 1W49A 4A6XA 1G8YA 2IYUA 1QDEA 4FWIB 4RD1A 2Q9CA 1GIAA 3BXZA 1P4SA 2WPDD 1SHKA 3NXSA 4JL8A 3A8TA 5LB4A 4PPQA 3Q72A 4Q1FA 2PZGA 1K5DA 2ZRHA 2K5UA 4BEJA 2PJZA 2ZE8A 2RAPA 2VA8A 3CNNA 3B1WA 5J5CA 1KZGB 1E3MA 2R6GA 2G83A 2PEZA 4NBSA 4DBLC 4MQBA 3QSYA 4PC2A 1E0AA 1JBKA 4TYYA 3EG5A 3GEHA 1IBRA 4URZR 3F0TA 4KAXA 5DHAA 3EAQA 4BFYA 2AHOA 3IBYA 4EJSC 3ZLJA 1IN4A 1KJYA 4EPWA 2WV9A 2GDJA 4D2IA 4FCVA 4I99A 2BEJA 5JJIA 1G8FA 1CR1A 2QP9X 1ESMA 4Q03A 4NTZA 3W6OA 1Z47A 3VU9B 1TQ6A 4PQFA 5SZIA 2WKQA 2RGBA 4O25A 5FL7D 3X1ZA 3NBYC 2WIAA 4LYAA 1BMFA 1R7RA 5BWMA 6Q21A 4ZI3A 4MKFA 4NYJR 2O8BA 3TJZA 3ZZTA 3DZDA 5DI3A 2ODBA 5BQ5A 4MGIR 5BW8A 4GNKA 1P2VA 1TQ2A 2GAAA 2BVNA 4CT4B 4OI4A 2IXGA 2RGNC 5AR1A 2E9SA 1FP7A 2C9CA 3AF4A 2ZS9A 1T5LA 2REOA 4FIDA 4F93B 1DAHA 3K9LA 4AIIA 2FZLA 2B92A 1Z8FA 4TLDA 4MKHA 2ODEA 1M1YE 4NYMR 5FTKA 2H17A 1SXJD 3E2IA 4G1UC 4IDPA 4CIDA 4B44A 4TSFA 4C7OA 1IHUA 3L0SA 2CCKA 2VHUA 3RYTC 2IHYA 3KUDA 3DKVA 2Q21A 3IPYA 3QPUA 1K5GA 3TW4A 4D80A 5DYGA 4XTCS 5E3HA 2IT1A 4PX9A 2CJWA 3PCRB 4ZDJA 4KFSA 4Q66C 5L3SA 4J0QA 4KJZA 4EPTA 4LC1A 4MYUA 4PC3A 1II8A 4WXPA 4OQFA 4ZI2A 4CEHB 3B2EA 2AKYA 2BWJA 1KMQA 3JZMA 1FQKA 1TF2A 3JZAA 2J45A 3WBKA 4DCNA 5J40A 2CVHA 4LWZA 1RJ9B 3CPEA 5CLQA 5AJWA 3MCAA 2ORIA 821PA 1XEXA 2JDIA 5J4LA 4MITA 1YZUA 3KJEA 4EJSA 3GJ5A 2FGKA 3RSLA 1G291 3PEUA 2KBFA 4NCNA 4NYJQ 4EPVA 4HZUB 1KO4A 4A0HA 1JR3E 4YMSA 4M1OA 4DSTA 2OCPA 2F55A 2REXB 1VG0B 2ZIAA 2F1IA 1XCPA 3QXSA 2ZYTX 2LKCA 3RS5A 4PPNA 2WSMA 3FMOB 3RSOA 2NPFA 4LHWA 3SDZA 1W0JA 3N2IA 1ZCBA 1CULC 4A0RA 3T34A 2G77B 1PLKA 1NLZA 3QKUA 4Q4JB 5FPHA 2P6UA 5A4JA 4WZ6A 3AUXA 4EIWA 3X1DA 2WJGA 2NIPA 4HB4A 2B21A 1XFAA 3A4MA 1IAQA 5JWOA 1C1YA 4PQYA 1FZQA 1Q0UA 4P4UA 1ZMXA 4DLVA 2Z4SA 4AKEA 2WIBA 1QHSA 4JZKA 5DYIA 3HPQA 1XMIA 3BORA 4PANA 1SVLA 1GG2A 4NZYA 3D31A 4C0JA 4B48A 1YZKA 2GNOA 1X1RA 2VF7A 3A1UA 3VX4A 4LBYA 4A36A 3KJIA 4DSUA 1XU4A 4IJMA 3W3AA 4B33A 3LWNA 1COWA 3OAAA 4LV6A 1UBGA 1IY1A 4Q4AB 4AYTA 2BBSA 4ZDKA 1F2UB 4W5HA 2FSHA 3DM9B 5JJLA 4F4JA 1PUIA 4CEHA 1JXMA 4OJKA 3ZH9B 5FUWA 3ZD6A 1GVNB 1EWRA 1KK2A 3IO5A 4IDHA 3PJRA 2JLRA 5HKKD 1VTKA 3IHLA 1W48A 2Q0HA 3L82B 1W44A 4FMDB 4NONA 1KNXA 1ELOA 2H5EA 2WWFA 1Q3TA 3WP1B 4Q7KA 4H9GA 1PUJA 1KIMA 1E9RA 1VPLA 2GVDC 4WA7A 5AUQA 3RS4A 2D2FA 1SKYE 3PUXA 5UKDA 3R7WB 2XITA 2GXAA 1ANKA 2FN4A 2P65A 3DO6A 5FBRB 3B1VA 1BO6A 3QIAA 4QOSA 1R8SA 1E1RA 1ZNYA 5TXGA 1RRPA 1W4CA 3U44A 2YHSA 3IPXA 5FR2A 3GLHB 1NN0A 4M9XA 3ZS8A 4NKRA 4CEIB 3U7GA 2MMGA 2GJAA 2B7BA 1OYYA 3D6TB 1R0YA 1BOFA 4Z1MA 2AX4A 3UATA 1LF5A 3CW2A 1S96A 1J99A 1XEFA 2FU5C 1TEVA 2RH5A 3CRMA 2J7PD 1Y3AA 1UDXA 2J46A 3KKPA 4DDWA 1P6XA 1GRRA 3I1FA 5FBWB 1XD2B 1X1SA 3DDCA 4NHOA 3BWDD 5IHPA 2DR3A 2H92A 4BZQA 1FUUA 4HB3A 5JHHB 2X19A 1ZU4A 1NLFA 4WIAA 3KX2A 5JRJA 2PEYA 5KDOA 1OF1A 4B3BA 3VU9A 3FTQA 5FTLA 1AK2A 3K53A 3EIQA 5D3MB 3HR8A 5SZJA 3CH4B 5JWRA 1LVGA 1TAGA 2KBEA 3BFKA 5EP3A 3H4MA 1RKBA 4HAWA 5F3WB 2HJGA 3THWA 4JYBA 2C78A 1GNRA 3SJAA 2BMDA 3HYTA 4QBFA 3FFAA 2X2EA 4QNRA 1N3BA 1XTQA 2ZS8A 1X8JA 1E2JA 2R6CA 1A82A 2VP2A 1ZIPA 5HCNA 4DCSA 5CDFE 2R6DA 3CX8A 4B35A 3SQXA 3IUYA 4RD3A 2ZVPX 2PZFA 4C4PA 4OKSA 1Z6XA 2OFOA 2ZSEA 3BERA 4HAYA 2CNWA 2F43B 4JLDA 2IUUA 1E2HA 5B58C 4UJ5A 1F5NA 2IYSA 1Z5ZA 2NQ2C 2YOFA 4HLUC 4UNQA 1Z83A 3IDQA 2BMJA 1OHHD 3AP3A 4RZ2A 3FOZA 2OHFA 1NSFA 2TMKA 4Q21A 4B2PA 3RRNA 3LRPA 1L2TA 3AF3A 4IEIA 4HAVA 2JJ2D 3GJ7A 5FPTA 3PEWA 1E2PA 4B71A 2VBCA 1XDBA 3B60A 1II0A 2YYZA 5CDFA 2ZR0A 4ZCLA 1OFIA 3VTKA 1OE0A 2ONJA 1FNNA 3OFNA 2HF9A 3NG1A 2Z43A 5JBQA 2PH1A 3KJHA 3BJIC 4Q00A 2JEOA 1Q22A 5E7IA 5TDHA 1SVWA 4R7ZA 3ETLA 4QL3A 4RFSA 2BHRA 1GKUB 3J81k 5EXXA 2OCBA 1N6HA 2CL7X 4GT1A 3AVOA 4ESVA 4PC7A 5C1BA 3EWAA 4N0DA 4ZDWA 3F8TA 2ZSBA 4DLSA 2ZREA 1YE8A 1DAFA 4CDGA 4D4JA 3GLGB 3I73A 3LQRA 3TMKA 3GQBA 3E5HA 2WSSA 2OCAA 1FW6A 2WMNB 1D5CA 3OIUA 2WWIA 4ASUA 1EFCA 2QGZA 3FKSD 1Q3HA 5J47A 3QXXA 4NCIA 4P32A 1N5LA 2F1JA 1OSNA 1T91A 1ZM9A 5B2ZA 1G4UR 1S9DA 4B2LA 2CLDX 3K0FA 4JJZA 4LOAA 4UNRA 4ZKEA 2O8FB 3IGFA 3TQCA 3ZJYA 1DVRA 3Q7QA 3WHKA 3TUJC 2IEZA 2CE7A 2QROA 2G0TA 2WKRA 5BYJA 2R2AA 1WE2A 2QT0A 4Q18A 5FPSA 3L8ZA 5FL7A 2Z5FA 5EE1A 3ZDQA 1UKZA 5BN4A 4Q7MB 2IS6A 4TMZA 1G7CA 3U2QA 3B6EA 1YRBA 2IYWA 5EZ5A 1NF3A 1FPMA 1TUIA 1U2RA 4FXPA 1E2GA 2ZJYA 4Q4JA 4RFSB 1P2UA 2ORVA 3CR8A 2ZSAA 3UXMA 4JLJA 2QSYA 1W2HA 5JS7A 4QFMA 4KO8A 3V00A 1RE0A 2P6NA 1XD8A 1FUKA 2IXFA 5LD2C 4P4SA 4DIDA 2ZTSA 1AQYA 4AYWA 3CO5A 3IQXA 4B6FA 2FFAA 4KYIB 3AM1A 2FSIA 3TE6A 3TR0A 4E07A 1DTSA 2BMFA 1X8KA 5E7JA 2ZPTX 3CF6R 3K0AB 4PR0A 4DUGD 2XSZA 3W9YA 1KK3A 1F6BA 1G41A 2G0NA 2ZRNA 1N2CE 4BFWA 2AFIE 3MUFA 2UZ3A 2CL6X 5E4FA 1DAGA 2BKEA 2ZE6A 2JASA 4LRWA 1N5IA 3GLGA 1E6CA 1KYIA 1QHYA 4BFTA 4TMVA 1G3QA 3CZPA 2GCPA 1JNYA 3ADKA 3KTAA 4PO1A 2GESA 3ASYA 2H7VA 2QORA 3D8BA 3THOA 5K8LA 3FKQA 1KSHA 2AD1A 4B3FX 4XIGS 2QEQA 2JDID 3JVVA 4HEJA 2W2VA 2QAGB 2IS4A 3CNLA 4JVMA 4R71A 4DLRA 1CR4A 1NVWQ 2DFTA 2YINC 1ZU5A 1QVAA 2GJKA 2O52A 1CJTC 2V8OA 4D0GA 2YOGA 4IDQA 1GWNA 1UM8A 2V55B 5B57C 1S3GA 3AP2A 1XCGB 1J8MF 3RC3A 5C46F 2JLYA 2GZAA 3I4LA 4V0KA 2OBLA 2RGCA 1S0UA 1HEIA 3ECCA 2FPMA 2EQBA 2KI5A 5AJYA 1XPRA 2OEPA 2EVWX 4DJTA 2HT1A 2ZSDA 2GWHA 3LV8A 1G5RA 3UG6A 2W6ID 1TQDA 3S1AB 2ZR7A 3A4NA 3AQ4A 2A3RA 3CPJB 4JBYA 4WZAE 3SHWA 3QEOA 2XZPA 4HDQB 3GEEA 2WJJA 4AD8A 1G7TA 1KI3A 4YMUA 3A1VA 5CK4A 1AZTA 3AF1A 1LB1B 4TMXA 2QRNA 3HYRA 3KTAB 3PV0A 4LJ4A 5CJ2A 4NCJA 4E22A 5JZVA 2WICA 4A82A 3QKSA 1S9HA 4JIMA 2OILA 1XZQA 1G18A 4I1UA 1EGAA 1OIWA 4LZZA 1COWD 3OAAD 4YMVA 1I2DA 3KKQA 2F6RA 3AVYA 1E2MA 4M1TA 1TF7A 1E99A 1YRAA 2ATVA 4K46A 1F60A 4M53A 5JCZA 1D8TA 4TMWA 4R98A 1LV7A 5EP2A 2QP4A 2ZUCA 4CEJB 2ZUBA 2VLIA 4URXR 1JR3D 4TYNA 2YWHA 2W0SA 1KI6A 5JFGA 3KKOA 2YZ2A 2PL3A 1VMAA 3K8YA 3SJBA 4FINA 1RYFA 2P5SA 3AVVA 1P9RA 1GILA 1WQ1R 4FMBB 1XB2A 1QHHB 3MGCA 1KDOA 1YVDA 1XXHE 2KSQA 2FFBA 4TMKA 3V4RA 3AKDA 4B43A 1NVXQ 4LI0A 3LLUA 5KSYA 4S2EA 2B8TA 2ZJBA 4WZBE 5EJEA 3CUEF 4DB4A 3VKWA 3OESA 5TVKA 2CXXA 4TTRA 4V0MA 3OEHA 2QT1A 3FDIA 4EPXA 4HAZA 3TRFA 1E94E 1BYIA 2XX3A 3ND9A 3L0OA 3TGPA 4RFVA 3U7EB 1LF0A 1ZM4A 1HA3A 2AR7A 3CF0A 3C41J 3WNBA 2IBMA 2DBYA 5EUQB 4MRNA 2V6JA 2FFHA 3LXXA 3GP8A 2J7PA 2H1LA 1Z2AA 3NHAA 3T35A 4JLVA 1NNEA 3UWOA 4DLWA 1R0XA 2R62A 2I1QA 1VECA 3CRVA 3LVRE 1G4AE 4UNNA 3B13B 5FOTA 5JRZA 4ZIRB 5GADl 5KPDA 4MDFA 4DKXA 2IYLD 2LKDA 4PC6A 1E1QD 3LVQE 3GFPA 3NBZC 1OH7A 1GRQA 1ZW6A 2V4ZA 1AKYA 3RWMB 4ASUD 2FH5B 4U7DA 4NYMQ 1F3OA 2OBMA 4V0ME 2FJUA 5EUMA 2GTPA 5DNYB 3EZ6A 2QM7A 1H8HD 1UBCA 2D3WA 3PENA 3VMFA 2A9KA 1LFDB 3IIMA 3LX8A 4RJLA 3PXGA 5KYKA 3BFXA 1VYVA 2NG1A 3K9HA 4EFLA 5FI0B 3A1WA 1F2TB 2BKUA 4A8JA 1A5TA 2C9OA 5H68A 2ASEA 1N6OA 4C0LA 4M1WA 1N6IA 3VR1A 1KI9A 4TL6A 4DWJA 1GNPA 2XJ4A 1ONBA 2AWOA 3AF0A 2LWIA 3OIVA 4IHQA 3K70C 1E9CA 4R2HA 4EQ6A 3NC1C 1U0LA 1W36D 1OFUX 1RW4A 3OEED 2HXSA 2NGRA 4D4KA 1OB2A 2ONKA 2WWXA 3WXMA 1SGWA 3ZQJA 2RGXA 2QM8A 2RGAA 4Q01A 1L7VC 1XTRA 2GJ8A 2JJ2A 2WJYA 1NVVQ 1CJUC 1VHTA 1XCMA 4YQFA 2BEKA 1M7BA 4QGGA 4V0OA 5KSPA 2DCUA 5CB6A 3OFND 4W5WA 2IX3A 4X8LA 2FSGA 4MH0R 1UDWA 1ZRHA 1NBME 4JSYA 4MYTA 2J0UA 3KXLA 4DCTA 1E4VA 4EKDA 2QAGC 1QHHA 3M6AA 1KAOA 5FTJA 2QBYB 4OI2A 4KV9A 4QBGB 3UPUA 3NTUA 3TNFA 4DCVA 1BH2A 1VG9B 3I61A 3BC1A 1ZUIA 1UPTA 2CDNA 3CR7A 3MWLA 3U5ZB 2NPIA 4PHTA 1VG8A 5EE9A 5L8VA 3P4YA 2GCNA 3MD0A 1D2EA 4OQNA 2WSSD 2RMKA 4US2R 4AKIA 1T0HB 2FG5A 3AVUA 4MRVA 2QSZA 621PA 1XTKA 4RD0A 1DEKA 1Y63A 4Q1EA 5KSOA 5KNDA 1RRFA 3LQQA 1EESA 1CEEA 3QXCA 1QVRA 4IDNA 1U8ZA 2BCGY 2G9NA 3I5XA 4US0R 1D2MA 3M0EA 4JBWA 2R6AA 2DPXA 2ZETA 3FE2A 3JVUA 1D2NA 5H70A 3PEYA 1MKYA 3HDTA 3PEVA 3RRYA 2E1RA 4ACBA 2WM9B 5TY0A 2PJRA 1HQCA 1I4TD 3M4YA 1Z06A 3BH0A 3W34A 2GXQA 2VQSA 3RS2A 1IONA 4UQOA 1W4RA 5DSZA 3FYHA 2CEAA 4I1OA 4IKEA 3TUZC 5FOWA 3QENA 4Q02A 1P2TA 3EPJA 4DZZA 1G8PA 4Q48A 5EZ6B 5DI3B 3RDPA 4OJQA 3D7MA 3KXIA 4P31A 5AUOB 3QG5A 1SVKA 3NIBA 4G3XA 1IY0A 1W46A 5AJZA 4E09A 4KFTA 1KK0A 2F3RA 3CF2A 3AUYA 1KMHA 1R0ZA 4IXMA 1BKDR 1ZJ6A 1OIXA 4JLNA 3BBPA 4PSKA 5JCPA 1S1MA 1SXJA 3SE0A 1BS1A 2VP5A 4YXWA 1N0VC 1VCNA 3GLIE 3OIWA 221PA 1R8QA 4IFEA 4Z8XA 4DUGA 3U7HB 2AL7A 1U0JA 2GETA 4TZ6A 2A78A 1Z22A 4FD2A 4G01B 2VP9A 3T1TA 2RHDA 2KJQA 2DWPA 2YNMA 1LW7A 4IOKA 4LY6A 1OXTA 1JXOA 3I92A 4AC9A 3KFXA 4NP6A 4ZV4A 4CF7A 5KDLA 1FTNA 4ARZA 1P75A 4F38A 2JAQA 3HPRA 4EUNA 4BRUA 1U90A 4BLTA 1XJCA 3EW9A 3EC2A 1BYUA 3IO3A 2ZYVX 3DMNA 4CEJA 1FP6A 2J59A 4Q1CA 1Z6YA 3OF5A 3WP0A 1GRNA 1XNJA 4B47A 2ERYA 2OXRA 4ILEA 4LPKA 2PLRA 3VR4A 4M1KA 2VHJA 3DMDA 2BDTA 2C99A 4B3CA 4LDJA 5FUYA 2WHXA 2OAP1 1TL7C 1XZPA 2F7SA 2OBNA 1X8LA 1IN8A 3LH5A 3LBHA 1N5JA 4MA4A 4U00A 2P5TB 1J8YF 2G6BA 3NH9A 2A5YB 5EP4A 4TLCA 4RKEA 4KI0A 3HU3A 1YZLA 3ONWA 3EA0A 5B64A 4PAMA 2JLXA 3BH7A 1L8QA 2ZUDA 3BS4A 3IQWA 2O0KA 4LJ7A 2QG6A 1DS6A 1PVOA 5IK2D 3KXKA 3R9IA 1F2TA 1XMSA 4Q19A 5ELXA 3BB1A 1Q20A 1XRJA 5C4GB 3EASA 2ZI6A 2R65A 2J3EA 3UMFA 1JAHA 1MO6A 2IHBA 1CJVC 4JT2A 3EPKA 2V7QA 3RS7A 2DWOA 1ZINA 1GUAA 2W2TA 2IYQA 4Z54A 4Z51A 4TSFD 3PUYA 4MGYR 4B73A 1LS1A 5EXSA 1W47A 1XEWX 2FPLA 3IBGA 4URUR 5FPKA 2V3CC 2RB4A 2EFCB 1GM5A 4BEBA 3QI2A 5ANRB 3QVVA 521PA 3U61B 2B6HA 1P5ZB 4HZUA 1NN5A 1G20E 5HZKA 1NY5A 1AGRA 3GLFB 1QHIA 4XD7A 1OYWA 2DHRA 2OZEA 3F5FA 5EE3A 2DFLA 3GLHE 4F7WA 1ETUA 2BMEA 2ZRJA 2Y8EA 2ZITA 1TF5A 5LBIA 4GZLA 2ZI7A 4TYWA 2IYXA 1P72A 1R5BA 2QQ0A 1KSGA 3REGA 1JALA 4Q7JB 1UEJA 2ZRLA 1SZPA 1AGPA 1E4YA 2OFXA 3WNCA 5FOXA 1XP8A 3U3MA 4PO9A 2J0SA 4HB0A 1XF9A 5JI3E 3QF7A 3Q85A 1YHNA 4P4TA 2QU8A 5E7MA 5BN5A 2C77A 1GTVA 2CMKA 3VR5A 4ZO4A 2XTMA 1Z28A 2IYRA 1NSTA 3GJ6A 2GXUA 4B3DA 3NBFA 2Q6TA 2JCSA 2ZROA 3ZVMA 3WMEA 3BFVA 4BFXA 3LNCA 4H1UA 2VHTA 3GJXC 4QRHA 2J0QA 1S2MA 1S4QA 2ECKA 1Z2CA 3U4QB 1DADA 1E32A 4LHVA 4OHXA 5J4YA 2ZU0C 3T1OA 3QKTA 1IXRC 2C5LA 2QL6A 1DAIA 1BIFA 2W83A 2YC2C 3GJ3A 1DARA 4HZIA 3H2YA 2CCGA 1G16A 4TZ0A 1OXXK 2ODWA 3PG5A 4OI1A 4GDFA 1TQ4A 2OLKA 2ZRBA 4GMXA 5C18A 1X3SA 1FFHA 5LD2B 1AKEA 1NLYA 3MFYA 2ZRKA 4B6EA 5IT5A 4D25A 2G1KA 1P73A 2IYZA 2P67A 4XVQA 2CJWB 3SN6A 2EW1A 4D0NA 4LBWA 5LDDC 2Q3HA 1ZIOA 3QKSB 5FPYA 3DZ8A 3Q8XB 2ZRFA 2ZJ5A 3T1QA 1HY3A 4HLQB 2PBRA 3TUIC 1FMLA 4OK6A 2KE5A 3DOEA 1KI7A 3ZIAD 4C2UA 3BRWD 2O8DA 2BIFA 1N6NA 5KTYA 4FWTA 5HE8A 3PFIA 1OLOA 3O8RA 4GP6A 4BFUA 1H8HA 3D3QA 1JJ7A 1I2MA 1R0WA 5CK5A 4A2WA 1RIFA 4EAQA 4I4LA 4POAA 3EXAA 4OQLA 4RKFA 2XNDD 1TU3A 5JWHA 1HV8A 4NCHA 1G7SA 3QG1A 2FFQA 4DLXA 4A0FA 1T8UA 2SHKA 3FMPB 1JPJA 4MKIA 3X1WA 1RPZA 3W5JA 4A8JC 1QRAA 2FNAA 1UBEA 5FBQB 3QVUA 2QZ4A 5KO2A 1HUQA 3G0HA 4URVR 1KY2A 3FMIA 2O8CA 3BB3A 2GF0A 1KI4A 4N1AA 2IYTA 2GZHA 3O47A 1Z6TA 4TL8A 2IF0A 3HP1A 3ZVRA 4LBVA 2IXEA 2CHVA 3X1XA 1IN6A 4TL9A 3T06B 4EPYA 5DLQC 2R8RA 3FMFA 4XWOA 3VNUA 4Q9HA 2AXNA 2P3SA 3O8CA 1TMKA 1W4BA 1RC8A 3SFZA 1Z0FA 4Q9LA 1FX0A 1DG1G 3SC3A 1KTVA 1QZXA 2WBLC 2QUZA 3L8YA 1UAAA 1CTQA 3LW7A 1RFLA 2FV8A 3QY0A 5AK0A 1G1MA 2BBWA 1G21E 1Q1BA 2ZJZA 2OM2A 3LXRA 4HDCA 4QJ5A 4CRWB 3EPLA 2PX0A 4GOKA 3VX3A 2VYFA 1NJFA 4D4MA 4PSAA 1E0JA 2VRWA 2EFHB 1E2NA 2OUKA 4G5SA 5CIWA 3AVTA 3X1YA 3OZXA 1G3IA 3G82C 4HSEA 2EFDB 4AWXA 2ZE7A 1MABB 3FHTA 1E2LA 5L3QA 5G3ZA 4URYR 2H18A 1CRQA 4B76A 1HTWA 3T15A 4TWZA 4A6PA 3TKLA 2ANCA 2FGJA 3BK7A 4JLMA 3QE0A 4LYJA 4LC0A 1E9AA 1CJMA 2FF7A 4A8JB 2DB3A 1F2UA 2QGNA 2XOKD 2QPTA 2PCJA 2JLVA 2GF9A 4PZZA 2B8WA 4TLEA 1KKLA 4JLPA 3L0IB 1U9IA 4YONB 4PFSA 1KJZA 4IFBA 1GSIA 3VKHA 2ODNA 2YVUA 4RZUA 4DEXA 3Q5DA 2L0XA 4NDZA 1ZM7A 1JB1A 4JL5A 2CHGA 2PX3A 3THWB 4UNSA 2G3YA 5C2JB 1J90A 1EXMA 4RY2A 3Q7PA 1KI8A 1Q1EA 1P61B 4NMMA 1OB5A 3K0CA 3VR2A 1NIJA 5FH9A 5JSZB 1ZP6A 4JT4A 2QENA 3U60B 2JLWA 1E9FA 2ZSFA 4P0TA 4UXHA 1NVUQ 3RABA 1W4AA 2CLCX 3QKRB 3LBNA 4C9BA 4P33A 1P60A 1DG3A 3UK6A 2P2LA 2Q3MA 4Q9IA 2NO7A 1E79D 2W2XA 4C0AC 2OFWA 2CNWD 1ZUNB 4Q4LA 5IK2A 1T9HA 2OO7A 1P9NA 1ZC4A 1YR6A 1ZNXA 2FZ4A 5HTKA 3UKDA 2FPKA 5B30A 4K8OA 3P20A 1AA9A 4NYIR 2HCBA 2XJ9A 3LO5A 1UKEA 2BM1A 4MRPA 4TLAA 2FDCA 2UKDA 2Z6VA 3K0FB 2HYIC 3SYNA 1XJ0A 2V7QD 5H1YA 2QPAA 1A2KC 3LX5A 2VP0A 2GKSA 3CWZA 3ZZ0A 2CHQA 3GJ0A 1OXSC 1OFTA 2O5VA 4L9SA 4M9ZA 1NIPA 2VL7A 1KY3A 3PITA 2ZEJA 2XXAA 4IOLA 2JIZA 4XWAA 2QE7A 3EA5A 3RS0A 3H1TA 1DAEA 1H8ED 4WXRA 5DI9A 2MSCB 3TSOA 3QEJA 4II7A 2E87A 1TUEA 5A0FA 3RNLA 2W6JD 2F9LA 1GL6A 1VHLA 3EIEA 1Z6AA 4M1SA 2PZEA 2WKPA 5FFMA 4YC7A 2O8EB 4B75A 4D81A 3UIEA 3OE7A 1ZAKA 1HQYE 1VYUA 4B2IA 1J70A 3CB4A 1ZNWA 3SFVA 3B1XA 4DSOA 2H16A 3GCGA 1LS6A 1ZM3A 2C2HA 3FKSA 2ZRMA 4Q4AA 1I4DD 1TPZA 2QBYA 1E2IA 1E9DA 1YZNA 5G3YA 3A6PC 1IOZA 1U0HC 1XTSA 3T12A 3NWJA 4LCBA 3CWQA 4BGDA 3TR5A 2WWGA 2IWRA 4GFDA 2HDNB 1SVMA 4MRRA 4JVNA 1LNZA 5JLJA 2JLSA 3QBVA 1GITA 4UJ3A 3W6NA 4XSGA 1R6BX 2D62A 2QMUA 1P62B 4V0NA 3RANA 3EARA 4IXNA 2X2FA 3CLVA 2QNRA 3ADBA 2BC9A 3SOPA 4JLOA 2VO1A 1A2BA 2ZJ2A 3WYAA 2W6IA 1PZNA 3GLIB 1N25A 5KOYA 4TMTA 2BCJQ 4LJ8A 5CIQA 4PAQA 4OBEA 3PIRA 5SZHB 2VF8A 2FEOA 2GJ9A 2CK3A 1X86B 4R2IA 3W5IA 3N2EA 4LGMA 1CR2A 4KITB 3NVAA 2IYVA 3MMPA 2EWWA 5JSZA 1XTJA 1CBUA 3QPVA 2A5FA 5AWFC 1CRPA 3QXJA 1VCMA 5CM8B 4D26A 1XXHB 4LHXA 2REBA 4TTQA 1GL7A 1KAGA 2R9VA 3RVBA 5HR5A 4NH0A 2ATXA 3AB3A 4BWYA 4DIEA 1YR7A 4KFRA 1HT2E 1QBKC 2CVFA 4C0HA 4GSYA 1PLLA 1NKTA 2ZI4A 4MKGA 2C03A 3CX6A 4Q9JA 4ACAA 3IIKA 3CM0A 4JMPA 2G88A 2O8EA 3U3JA 2ZJAA 3Q3JB 4FMCB 1AZSC 4PXAA 4GP7A 3B1YA 1WDTA 1QG4A 2XGJA 2QAJA 5TV2A 3RRZA 3G5UA 5L3QB 5EXPA 2N1BA 3FHOA 4O2RA 4TYQA 2BOVA 2UZIR 3PUZA 1T3HA 1ZM2A 3DHWC 4KBFA 2NO0A 2Z4RA 3SYLA 1FL9A 1JECA 1KJWA 3LY5A 2WVJA 4Y0AA 1RVDA 4Q4HA 1PLJA 2F3TA 3K0CC 4LJYA 2O0JA 3VR3A 3I62A 2HT6A 2ZE5A 4WOPA 2J1LA 3AVQA 3EIHA 3M1IA 3RWOA 4EFNA 2FSFA 3NHBA 2CCJA 3THXB 3I72A 2F43A 1K8RA 1EFUA 1EG7A 2MMCA 3SR0A 1S3SA 3N5CA 1N0WA 1E9SA 4LHYA 5DO9A 2P6RA 2ZAMA 5FI1B 4BQSA 4DLZA 4V0LA 1G7RA 3NEJA 1SHZA 4KFUA 1EX7A 1QHGA 2G1JA 5KNBA 3SEAA 3AP1A 1L4UA 3UMSA 4OI0A 3IIJA 4IEEA 2IF2A 2KWIA 1RJ9A 2QA5A 4AYXA 3B5JA 1KDPA 2XZOA 1CF4A 1JEDA 2OG2A 4XTRA 2HLDA 3GLFA 2FWRA 4IW3B 2HCJB 3KFVA 1FOEB 1SKYB 4EDHA 4C2TA 1E0KA 4ZDIA 4QM6A 1U99A 2GCOB 2EFGA 2J7KA 3FWYA 4KODA 5FTMA 3OIYA 1QHXA 4BLPA 4LJ6A 1G6HA 1NBMD 3R8FA 1EK0A 3C14C 1O3YA 4KHZA 1DPFA 2BBOA 2ZI3A 3E70C 3N70A 4QGHA 5TB5A 1DO2A 1G5TA 5K8TA 2EYUA 2XNDA 2JJ1D 2J41A 3K9GA 3Q9LA 1B23P 1HT1E 2IC5A 2XTZA 3ICQB 1WRBA 1ZVQA 3IHWA 4OL0A 1GKIA 3W8NA 4QJ3A 2J0VA 5FR1A 1G6OA 3RS3A 1JR6A 2HEIA 2OCYC 4OK3A 2H57A 4QGFA 3DM5A 4AK9A 4BLQA 4HLUA 3AKCA 3OEEA 3CRRA 2D74A 1VYTA 1JQJC 1HE8B 1M7GA 4I1VA 4C0SA 3SYKA 2D4HA 1SVOA 1OKKA 2ORWA 3F3YA 1GFIA 3OHMA 4FI3C 4QHYA 4DDVA 3QF4A 1OH8A 1UADA 3KKMA 1DE0A 3T1VA 1T6NA 4C0BA 1KGDA 4OYHA 4KLZA 721PA 3TAHA 1XD9A 2AXPA 4LYFA 4PSVA 1TU4A 2OE2A 5C4MA 1H8EA 1QG2A 2Z0MA 3PUVA 3CZQA 2W0MA 1ODFA 5FUXA 2EYQA 4EJSB 4HLCA 1C4OA 2W6JA 2WPDA 3IEUA 5SZKB 1UF9A 4TQUS 2W58A 2GK6A 4CGZA 3KL4A 1KI2A 1K6MA 2XAUA 3DPUA 4PPGA 3BD9A 4Q7LA 5DN6D 3RHFA 1G8HA 4BUJA 3BIFA 4NE2A 3TW8B 2ZRIA 1E1QA 4IVPA 1E2FA 3NBXX 1TTTA 1T0JB 4C7OB 4P4SB 2EWVA 3EZ2A 4KLNA 1CKEA 2QMEA 2ZR9A 2DY1A 2QAGA 2CLSA 4QM7A 1G5PA 1EFRD 1SKQA 4B3GA 5G40A 3MWYW 3ICEA 3K0AA 2GXSA 3PVSA 1MO3A 2NOAA 1LTQA 5EQTA 1NMYA 4Q1BA 3T5DA 3TH5A 4W9MC 1H65A 4PZLA 3GPLA 1W5SA 4RZXA 2V1UA 3GEIA 1YJ5A 2PT7A 3AH8A 3K09A 1GL9B 2GZDA 3MJRA 4G5GA 3SU8A 1IJEA 1XD2A 3LFUA 1R2QA 1KSFX 4A2PA 3C15C 1OPXA 1YZQA 4MDEA 1WCV1 1DAKA 4QKQA 3AVWA 1WF3A 2QTFA 3I32A 5F2EA 1G3MA 1R4AA 3QJYA 1ZCAA 1AS3A 4DC9A 2JGNA 1IN5A 4MYCA 1Z08A 3U44B 2V54A 1KI1A 1NG9A 2ZYWX 3QPWA 3GLIA 1G3UA 3HR7A 3SJCA 2CK3D 3GLHA 1YR8A 1TEXA 4FN5A 1F48A 2F1RA 3A37A 4KBGA 4LV8B 3R9WA 5TMPA 2OT3B 4A1FA 2AK3A 4FW9A 3ZVLA 2OXCA 3DL0A 4JLKA 1XBTA 3QKRA 4BRWA 4KCGA 1AIPA 3L43A 3Q5EA 1NI3A 4YXWD 3P32A 5GJWC 3KQLA 2NTYC 4Q4HB 1NL3A 3QXHA 2QMOA 4TQ9A 1XXHA 1Q57A 4NYIQ 4D6PA 1OJLA 2QE7D 3P27A 4HB2A 1E2DA 3MRSA 3CNOA 3U3OA 4A92A 3MLEA 5EE5B 4BPBA 4I1SA 4QGAA 2Z83A 4XOIA 3LDAA 1WBBA 2HYDA 5K8UA 4ZKDA 1IY2A
chains in the Genus database with same CATH superfamily
1OH6A 1ZFNA 3B8EA 5G53C 1TKRA 1Q1AA 3P1JA 1VMDA 3FXAA 3MAAC 2K7ZA 4RIHA 3ILYA 3NHFA 4U39A 4IHKA 1UFQA 3PT5A 1F4PA 1T2NA 2WJPA 3KZCA 4BNZA 2ZXUA 1IVYA 2I71A 3N7AA 3L02A 5KMGB 3C8UA 4FM9A 1IEXA 4B5LA 3QWHA 4LWPA 2WYOA 3VZQA 3H5VA 3O74A 2Z6AA 4D9KA 5AM0A 1VHWA 3WMGA 4HHEA 1YZGA 3VZDA 5HPYB 1HL7A 3IB3A 2OP1A 4F4DA 1MABA 1SRQA 4H3VA 2N3ZA 4JSTA 3CSUA 1JHQA 3DEFA 2JFXA 2C7VA 1KO1A 4TTVA 3VGJA 1M8PA 3MWKA 1DC3A 1SXJB 4RJIA 5EXDA 4HS4A 5HF9A 1KSJA 4BNTA 9ABPA 1COZA 1Q11A 2HFJA 1RKXA 3DXXA 5EIEA 4MEAA 2PWPA 3DO8A 5DTQA 1X7GA 1S8AA 5G0WA 5LPNA 3ORFA 3AJ9A 4H7EA 4AG6A 2X77A 2XYVA 3UBTA 3H1BA 4OG2A 4I81A 3K15A 5DHSA 3U0VA 4BRSA 2Q29A 4LDNA 5DISB 4DGQA 5ALQA 4CCSA 1B2RA 3EFOA 1US8A 2VJQA 2RHMA 5HFJA 3WLJA 1W2GA 3UJ8A 3SE7A 2LPMA 1R6TA 1GY8A 2IYYA 2WZQA 1KMNA 1OGYA 3TN7A 3VYRB 4G23A 1BTOA 3R9KA 1RWMA 5CFOA 1HFEL 3FRJA 1U2QA 1FS6A 3FPCA 2I0FA 4ZREA 5IABA 3RFVA 3SEQA 3JZFA 2XVAA 3RC8A 1Y4UA 3IUJA 3QPCA 1BROA 1WB4A 5JSKA 5C4IA 2DMRA 2A9VA 4HYYA 2VPTA 4X9XA 2NPOA 3EDQA 5IDYA 1HORA 2ACKA 3RF7A 2JGAA 1TJ4A 4UUQA 5B4TA 3HXOA 1UP6A 1KYZA 5IRCD 1GT6A 1WDLA 4JR2A 3KT8A 2AJTA 1DT3A 4RU1A 1A9OA 2K6GA 3ANLA 4M8LA 2Z2KA 4RMHA 2JIRA 2P4HX 5FLYA 2JB9A 3RTGA 4YFYA 1Z4NA 3WBFA 1BDBA 4XR9A 3PDIB 5JJKA 3Q3HA 3VVBA 3IKTA 1VJ0A 3FTDA 5BXQC 4PO3X 1R4ZA 3N7UA 4AY3A 4GHWA 4B81A 1W76A 4J4HA 4UEJA 3T5MA 4LDZA 2GEDA 4R9RA 2B3TA 1M7HA 5BT9A 5THKA 1SPBS 3LY7A 2YC4C 1RC8A 4RCZA 2ZVDA 1WXIA 1MDBA 1WXQA 3QE2A 1OWMA 1Z15A 4QEZA 3RNOA 4CV3A 1R3DA 1IN7A 4JA2A 4YRAA 2DWQA 2ASVA 3DOUA 5EXTA 5L6MB 3KQNA 1XQ6A 3H1GA 4KXXA 1JJVA 4X20A 5HKKA 4ID3A 5DYYA 4QU9A 5KREA 2P1RA 1TK3A 4RF3A 5IBPA 4EI8A 2G1UA 5H4HA 1PK8A 3KSUA 5JZ9A 5FOVA 4AKHA 3MS4A 4B4UA 3TAXA 1K4YA 1OXUA 4LXYA 5IYZA 3LX4A 2NO9A 4JYCA 5BQXA 2X22A 2RIRA 3LY9A 3UMVA 4JBXA 3GUYA 1V5FA 4JKYA 3DMHA 4N9WA 1NMXA 5IM5A 4EA7A 4EG3A 2ECOA 1KBQA 1UT5A 3A6EA 3G2LA 3IILA 4ROSA 1FRQA 3UWDA 1DBPA 1XP5A 3K2IA 4KRFA 5CLIA 3RIMA 1WUTA 2D8MA 1XTIA 5K8IA 1X42A 3KVYA 2RD2A 1MB9A 1Q1ZA 2VWHA 2HNKA 1R64A 2O0HA 2FEPA 2XECA 3AY7A 1U81A 2O19A 1Y6ZA 3LYHA 3DTTA 1HK7A 1TIBA 1JJFA 3WQSB 4DJAA 2AWNA 4AZ0A 1PKXA 4K05A 2HCFA 5JD3A 2IW1A 1C7ZA 1Q1QA 3FNBA 2EJWA 5L3RA 5C9ZA 3OPQA 1E6KA 3PZBA 2YWGA 4FGJA 3W3ZB 1M67A 1F4LA 4XX0B 4DLTA 4YFVA 1DWUA 2C1EA 1TKAA 3MCUA 4BWFB 4E3ZA 3M4ZA 4LYHA 2IHNA 4ZC8A 4PVCA 2A7QA 3STYA 1DBRA 3STHA 3R3VA 1W1WA 4IWYA 1LDMA 1P3JA 1U8YA 2FQYA 2FXIA 1ML3A 2WMOB 1UZMA 5HJ5A 1VIAA 2XB9A 3U7FB 1PSDA 4HLDA 1EWQA 4KK3A 5CB8A 1GGNA 3N58A 2XEDA 4G1CA 4C14A 4QNMA 1VRVA 2IEGA 2VBIA 3AI7A 3HLKA 5F35A 4BE4A 4Z53A 3NT4A 2ONCA 2ZYUX 4BO0A 4BPRA 4EYOA 1F4VA 1U0EA 2ZJ4A 4MSUA 2D0PB 4I5DA 4ID9A 4OQDA 2K87A 2YVKA 3QOFA 3WGJA 2ISCA 3KSMA 4QPNA 1CHDA 1Y4SA 5EJGA 5FADA 4NOMA 3LGAA 3W6UA 3GGPA 3HXTA 3OFVA 1SVSA 2I7TA 3OZDA 5B3JC 4NMHA 4QDTA 3DZCA 3NKVA 5LM3A 2I22A 5JCJD 1ND5A 5EEHA 2BGNA 3PEEA 1Q7RA 4NECA 5CYPA 3OQHA 4FDUA 2B5VA 2P4UA 4URFA 3T5GA 1AKNA 1BN7A 1ZXBA 1IIRA 4ETIA 2VH1A 3FZQA 3G13A 4Y9TA 5EPOA 1N6LA 2ZJOA 1S8FA 4QC2A 5ABPA 3ADOA 3DT6A 5B1SA 2A2ZA 3PE4A 3BTVA 3C7CB 1P7CA 4O4IA 2GM3A 1PG0A 2VEDA 3KPJA 2Y92A 3LW8A 1KPGA 4A0GA 5J2TB 3ILSA 3VDNB 2LVBA 3ZGVA 1RAAA 4G0MA 4OQPA 3BXHA 3P45A 2EBWA 3DTVA 5ULLA 4URHA 3OZ7A 4OIMA 2GA8A 4PZYA 4Y1EA 5GJCA 5KYGA 2NLOA 3CRQA 3SF8A 3W7VA 1A9TA 3H9CA 4IDGA 3VH2A 2Z3ZA 5CLFA 3EDYA 2YKGA 3SHFA 2BE9A 4HDOB 5TEWA 3V8EA 3EXIB 4Q1AA 4YT8A 2OPBA 2PFSA 3WZMA 1IN1A 3LQFA 4E2YA 1MF7A 1Q1NA 3C6ZA 1G17A 1GUFA 2NM0A 3OTGA 3PQ5A 2A86A 3QRWA 2FEMA 5CA1F 2FE4A 1P17A 3ZC3A 1QCDA 4BV3A 3LA8A 3O2JA 2JLBA 1JG3A 2GLTA 2Z6QA 4WBSA 1O6BA 5HUJA 3O3MB 1JDNA 1SMKA 3R9WA 3FOFC 1ZR4A 3H0KA 5TT0A 1XDWA 1U3CA 3NATA 4JUFA 1KH3A 2BFPA 2AF3C 4OB6A 5KMGA 1FS5A 1FDUA 1R0BA 1QOQB 2X5OA 3KQKA 5EKTA 4AI6A 2IUFA 1CUIA 5KQGA 1P2GA 1HYGA 1Y4DE 2XD9A 4K26A 1QYVA 4LOIA 3AV0B 1FMJA 5KPJA 5HIMA 5EZYF 1RLTA 2XOKA 5DLPA 1PGJA 1A4RA 2ISQA 3NAMA 4LXHA 4U2EA 1PL6A 1QF9A 2ICAA 4LHEA 3ZU5A 3HWWA 1R37A 4KQGA 4LMAA 2O07A 2VP3A 1VIDA 3KWFA 4YRRA 5I3ZA 1N0UA 2UYOA 3H84A 5DBGA 5H59A 2PRSA 1CS4C 4RYLA 3MLBA 2FHPA 4LQLA 4MX8A 4JS0A 3TVTA 3IHTA 3RGGA 1ZL0A 3W4KA 4EYKA 2XTNA 3OQJA 3OZGA 1TK9A 4M0DA 3PNSA 4RVCA 4RZ3A 2WILA 2AGVA 1VIYA 5DWDA 3OCZA 3G59A 3PXEA 2PUBA 3EODA 3KZKA 3UMRA 1NI4B 1W0KA 2AW5A 4D4LA 4ABTA 5G0SA 5BY2A 1N77A 2DKOA 4GYWA 3UWPA 1NW7A 5AQ1A 1QR2A 4IS2A 3GEDA 1Y3HA 3RO7A 3U6KA 2H1WA 1G9XA 1NX6A 4GAEA 1DKOA 3KEQA 4IXTA 4MI1A 1Q12A 5L53A 3C39A 1WKBA 3FMGA 3KE8A 1I32A 5ALGA 2WNIA 3QMVA 2X3YA 3I83A 4DS3A 4WT7A 1O7JA 3GRRA 2HO5A 2BM8A 3P0JA 4LK2A 4M8NE 4QFCA 1FXWA 3WNDA 4C89A 4GF5A 1MRSA 3LT2A 4GX5A 4AMBA 5A9RA 4PFJA 2AMLA 4EPYA 2EZ9A 2J9RA 1ORTA 5B53A 2DVMA 2R44A 4A4DA 4G0NA 4E1BA 3PNLA 2GBLC 1ISRA 2ZBPA 1KKUA 5CNMA 5BSGA 1N9GB 2V5VA 1ZHHA 3AR7A 3MJTA 3V32A 3WSTA 3SZRA 4UZEA 2MSKA 3NEYA 1GGKA 4KIWA 3O8NA 4WLOA 1JHYA 2W4MA 2JA1A 2YMMA 4ARIA 4DRXB 1XEXB 1W8IA 5JPIA 2CYAA 3OKPA 2W90A 4K6GA 1V1RA 3QU9A 3JRWA 2XBLA 2WUDA 4AP5A 4BVEA 1KEEB 2VJCA 3GEBA 6CHYA 3JQ7B 3VA7A 3OZEA 4MP6A 4PFKA 4AULA 4YAKA 4QDZA 4LF5B 4OY3A 3GIDA 4HDAA 4Z2YA 4AJJA 5CR9A 3KL2A 2ERXA 2XQJA 4K81B 3LAWA 1HNZB 3IIEA 4JLAA 4M9QA 2GPBA 1JQ5A 1N8SA 1DOAA 3P26A 3DG9A 1ESNA 1N1EA 4RFLA 1MG5A 3BSSA 3HJUA 1I51A 4O3MA 2JRCA 5A5GA 1FEZA 3HVIA 4W1RA 1NU8A 1T5IA 1Y1SA 4CL2A 2GEVA 2HTFA 2PKXA 3H0EA 4GPTA 4AJIA 3PX7A 4INZA 3O38A 4CEIA 5D3MA 1FVOA 4B31A 2XWQA 2YIDA 2BGRA 5CXXA 2HLPA 2YS6A 1SN7A 4HWRA 4RD6A 5AVQA 5AKKA 3HSYA 1EFPA 1FFEA 2VTKA 3HADA 3X2SA 3AL0C 3ND6A 1G0OA 4ZQBA 1M54A 4CW7A 4E1VA 2QQEA 3A9WA 4AO7A 3THYB 4H59A 5GGYA 3IE2A 2D0DA 2ZAYA 3FG9A 2VXOA 3TVDA 3CEPB 3EXEB 4H7IA 3I6QA 5TGZA 1Z29A 3WYFA 4XRGA 2Q5FA 2VHXA 4PNZA 4II3A 3V7FA 3ZKAA 3ZWNA 2UZ4A 1YMQA 3OEHD 3R20A 1CR0A 2RCYA 2GRJA 1WHSB 4HDKB 3R8XA 4UHCA 2OZKA 1D1TA 3QGMA 5ITSA 4FYWA 4LF4B 5DE3A 1YUBA 1R15A 1DFGA 3GMIA 1I4LD 2O7SA 3SQOA 4HRXA 3W9BA 4C5BA 5BSFA 2WIKA 4GYKA 4L75A 1EDOA 2NO1A 1HFWA 5CW2A 4D0LB 3B82A 1ORHA 3TIVA 1AQ6A 1AX9A 4RQBA 5EIOA 3K0SA 5JXIA 5EFZA 1KY4A 3GD7A 4JH0A 5C1IA 2RG1A 3EZ7A 5FNVA 2JAXA 2O4UX 3AGQA 4C5CA 1H0RA 1VBNA 2VIIA 4D3FA 3LA6A 2RKWA 1A9SA 1X0XA 4YLEA 2NO4A 4EK9A 3TDKA 3M6LA 1ECGA 5IMBA 1KI6B 2NWQA 3UJ9A 1FK8A 2QB5A 4GG1A 3V3TA 3AHHA 1E63A 3CVYA 4QOGA 1QYDA 1TCUA 3NM4A 4KQEA 1NXVA 1II9A 1H6BA 4CYMA 1KO7A 1AQNA 1DNPA 4MTLA 2XUHA 3CONA 5FOUA 3IAM6 1FJXA 2PT5A 4RKYA 5BUQA 4NL4H 1R10A 2RKOA 2QTVB 4TWJA 2GVZC 1KA9H 3C6KA 1YIAA 3OP1A 5BW4A 3UH0A 5A5FA 2AN9A 4F4IA 1HR0B 4Z4EA 3QUBA 4FDAA 3K8QA 2CMDA 1HE1C 2B1JA 3LYUA 4O0MA 2M2IA 2O8DB 4S12A 1AUVA 5EZSA 1CF9A 1HH4A 3PXCX 3EJ6A 5BN3A 1T3GA 3ONFA 2WOOA 4GUAA 3WGZA 4L50A 4ZVLA 1LY1A 4CT5A 2A1UA 5LCXA 3KKNA 4KAFA 2Q4DA 4GXNA 1B3BA 1PR9A 5E95A 2H8KA 5CJPA 1GQSA 1MC5A 3IUBA 4JX9A 4MGHA 1KE2A 1R27A 2YOHA 3D8RA 1KDTA 4LPSA 4X7MA 1T3LA 4BE7B 3VOAA 1FIUA 3FGZA 3O6VA 5EHZA 1TK2A 5EE0A 2FW6A 1NN1A 3UJ3X 2BELA 2JHGA 4CCYA 4REOA 2WQZA 3IKJA 4JR0A 2C2GA 2CB9A 5AJXA 5LU9A 3GYBA 1A7JA 4EBBA 4OHVA 4PLVA 3HVJA 4H08A 3DAOA 5ERGB 1YA4A 3HSKA 4MVYA 3R7WA 4A23A 5KHAA 1ADGA 2V9PA 5E1BA 4QO8A 1DEOA 3RAEC 1QTIA 2NVBA 4Z8YA 2XZDA 4Z7JA 3ESZA 1V5GA 2B9VA 4Q3LA 2VSFA 1KBZA 3L7NA 4ZCSA 3UB2A 3PR1A 3KZ1E 4LMPA 4PZ9A 5IJAA 3I9MA 3NAQA 1I6LA 1XG5A 3K5IA 1KKMA 1M2HA 3LECA 1U3TA 3OMXA 5CA1B 2DEUA 1EP3B 3SC2A 3ZE8A 4AY6A 5TQJA 1PJ2A 5CVJA 1RSZA 1FSPA 1U98A 3ESYA 4P92A 2QN6A 1OXVA 4HH4A 4LMRA 4J7UA 4YRGA 5BV7A 5M29A 1IBMB 1M74A 1VKJA 2HSDA 3OCWA 5A4KA 5ECGC 3KEFA 3RVRA 1A1SA 3BCRA 5CH3A 1L5NA 3B9PA 2FN3A 5AKZA 1CU1A 2Q9BA 1RI4A 4MTCA 1ULZA 4V0QA 3R7DA 3FYUA 4F2HA 3UC9A 4KQXA 3C6BA 3O4HA 2HLDD 3Q3CA 3GFGA 4O2LA 1ID8A 3QNUA 1OIVA 5JADA 1RRGA 3WL7A 4ZT5A 4EW1A 4C7BA 2NZWA 2LDBA 3D0RA 4HN2A 3LY8A 1UXIA 3KDSE 5FFNA 1MO5A 2C4UA 3LBAA 2NTJA 4MVWA 4NDAA 1F38A 3RJMA 5KTTA 3V1NA 2VCHA 2F2TA 1AS2A 1JI0A 1E9BA 1MB4A 3I3OA 4HQ0A 3T9CA 1YU9A 3CN7A 1NM5C 5A3VA 2XRZA 2P9EA 4FOSA 1UQUA 3PFCA 3OFKA 2ADOA 2GPJA 4LTMA 3TL6A 2VRNA 3TEJA 3H16A 1W0KD 3T3IA 4P8RA 2C4KA 4X8OA 4M1MA 3LZDA 3SXUA 4E4YA 1UKYA 2HUPA 1A9XA 2AOTB 4MZXA 2FZGA 3GRVA 4UUNA 1J25A 3IL2A 1S2OA 2VHCA 4WZAA 4YJDA 1ZMBA 4YCBA 1XVAA 1FBNA 1V16A 4QATA 4HATA 2VP6A 3KETA 2OAQ1 2VLBA 4TSRA 1SQ5A 2OLJA 1HE5A 3MQFA 1FNMA 4YJ3F 5FQOA 3QBTA 4BMNA 2PUDA 2Z2JA 4L8GA 4RKQA 3HWSA 5K8CA 1TRHA 2BY4A 3Q7IA 5P8WA 4KYUA 1NN3A 3VHXA 3THXA 4BB5A 4IGFA 3IDOA 4DRXA 1H6CA 3OA2A 4IDFA 4XGKA 1WJGA 2V6IA 1KEZA 2C98A 2TECE 3KPYA 4PX5A 3OKCA 3UAXA 1F0PA 1RMYA 1SXHA 5BSMA 1R4MA 1RQXA 1TX4B 3LHIA 2OGWA 4K1XA 5F9HA 2HEGA 1J7KA 5K6AC 5HS4A 2F17A 2O1SA 4YGXB 3FOWA 4BGVA 1MTOA 1G8GA 1Z07A 5BP7A 2XB2A 5HE9A 4F96A 1MR3F 1NJSA 3CA8A 2C8VA 2POCA 3UGTA 1KAHA 1L1EA 4A6XA 5E1OA 5EQJB 2FW7A 3KTFA 4FWIB 5E4YA 4RZSA 1RYDA 2Q9CA 3BXZA 1CYEA 4Y9SA 3NXSA 1SHKA 4I9UA 4JL8A 5HM8A 4GW3A 3A3NA 4Q1FA 2QHXA 4MUMA 1K5DA 4GGOA 1JHDA 1AKTA 2ZRHA 3G0GA 3WGGA 2PJZA 4BEJA 2RAPA 4HNVA 2GM4A 3TDNA 5ED0A 5DMHA 4AU1A 4DF3A 4HXFB 1DKRA 3BK2A 3KEOA 3UAVA 2R6GA 2WM8A 2DGDA 5FULA 4YJFA 3RAFC 5KAPA 2G83A 1XZJA 9LDTA 3CVJA 4NBSA 1XJ5A 4MQBA 3QSYA 1VLJA 1ZMTA 3CX3A 4MUFA 1JBKA 4BBJA 4JC8A 4Z3OA 2DXIA 1Y9EA 4URZR 3F0TA 4KQHA 3AR9A 4ETWA 1KDZA 5DHAA 2CUKA 1CUJA 1D2AA 2AHOA 3EB9A 3OPNA 3D8HA 3EH1A 4RF4A 4YJ2A 4EY5A 4EYSA 2BEJA 3F4KA 4AN4A 2FPPB 1G8FA 4O2BA 1EEXB 4PS1A 1ESMA 2B5WA 4MV8A 1D6NA 3DHNA 1ENYA 5B6IA 3VU9B 1N4AA 1T8YA 3O94A 5BV0A 2CVPA 2FPGA 3BIOA 4IGIA 4YJHB 4MW5A 5FL7D 2ZUWA 3ZTWA 2V6FA 5EKSA 2IHZA 3KOOA 3MGBA 4RGYA 4PIVA 3TXAA 5IT9A 4ZJPA 1HXHA 3WWDA 3I9OA 3INRA 1EGMB 4DEVA 5BQ5A 1GO2A 1T3TA 1WPGA 3MWFA 3PQ7A 4KRYA 1LK7A 4GNKA 1TQ2A 2BVNA 2OZVA 4QU8A 3CU5A 4YROA 5TS2A 4CT4B 5AR1A 2FZ5A 1X1EA 2RGNC 3PWKA 4DV0B 2R6HA 2E9SA 3KLOA 2FPXA 5IJ9A 4YJHA 1D6SA 2HUNA 4XAQA 4BO4A 4EG5A 4L02A 1MX5A 5ALJA 2HRBA 3BF8A 3K9LA 3I2KA 4E2ZA 1EFDN 3PUHA 4RADA 2QVZX 1EDZA 4RCVA 1FMCA 1I4WA 4FOLA 1BA2A 4JP8A 1NXTA 4TLDA 4CN9A 1P7WA 2ODEA 3PPIA 4HX2A 4Q16A 4RA6B 3PUKA 2JVJA 5ECYA 4DA0A 5CTJA 3FWKA 2EDCA 3SQLA 3IQGX 3QXGA 4UMVA 2B36A 5F3RA 5GIOE 1HI9A 3ISJA 1CG6A 5C81A 4LNHA 4MDHA 4Z4CA 4Y0NA 5CDSA 5DHUA 1OILA 1QE5A 3PEFA 4ZIRA 1OX5A 1V16B 1D1PA 3TW4A 3NOXA 1PFVA 2OXTA 4JI6B 4BB6A 4W1SA 4XTCS 5E3HA 3PWTA 4PX9A 2CJWA 3PCRB 1N7HA 2BLNA 3NHUA 2FP4B 1NTOA 1JGTA 4Y2GA 4Q66C 2DLCX 3QTLA 1GJRA 4KJZA 4ADSG 4EPTA 3SZOA 4KEAA 1AKQA 4PC3A 4RK5A 4ZI2A 1RQLA 2P3OA 2CGEA 2JLCA 3FRHA 3LPAA 2L19A 2EKBA 3STWA 5GONF 2O59A 4ECEA 5CA0F 1E7RA 2HBQA 1PJLA 1X3LA 3OJ0A 1A7KA 3C7AA 2DCMA 4DJDC 4LWZA 5BVGA 1X7XB 5AJWA 4I8DA 1BS2A 1C29B 3BM5A 3MCAA 1O9HA 4AF7A 821PA 4ZI7A 1XEXA 1K88A 1L6RA 4FR2A 4G8BA 4MITA 3F78A 1Z4PX 4BFLA 4EJSA 2IGTA 1KEEA 4HD8A 1U6KA 3PEUA 2KBFA 3OQ6A 4NYJQ 5TGTA 2IV7A 4B3HA 4C76A 4A0HA 2R1UA 2XBMA 3F5SA 4DSTA 4M1OA 2OCPA 3FAZA 2ZIAA 3QXSA 4MPTA 3W2TA 2FYTA 5MHTA 3T7EA 4DABA 2LKCA 3RS5A 2XXBA 1GL3A 2GN6A 3OU6A 1VL2A 1EIWA 5K4HA 1TZMA 3G5MA 1ZCBA 1WXHA 3OCXA 3E18A 2XUFA 4YCJA 3VZRA 1QJ4A 1NLZA 5I9SA 3VNSA 3OUUA 3ETDA 4M88A 3IP1A 1TB4A 2FWAA 2H4XA 3NNNA 4HPWA 2BF4A 1ZUNA 1Y5NA 4MJ3A 2NIPA 3TIGA 4N3GA 2B21A 1IAQA 4NC9A 1JR2A 4FNOA 1J8VA 1B6TA 5DK6A 5FJJA 1C1YA 1YVUA 5AM5A 2W6CX 5BWNA 4DLVA 5L45A 3TTWA 1QHSA 3JYQA 3KYCA 5DYIA 3SLKA 3BORA 3W78A 4AUMA 3IMKA 3DE4X 4ZO6A 3BMCB 4P53A 2V03A 3INYA 4L08A 4X1IA 4NZYA 5JBIA 3L8FA 4HG2A 3DHYA 4K6KA 2VF7A 3BE6A 1LCIA 4P2GA 1BXGB 3W5AA 1NWCA 1PQYA 5JQGA 3KJIA 3CLHA 1VXRA 4FI3F 4RK0A 2VNIA 2QUIA 5DTRA 4FTWA 1A0OA 3IOMA 4NE7A 1I3LA 2E2WA 4PGHA 3LWNA 4U7PB 1X2EA 4HDSA 2H00A 2VYND 1E8NA 4AYTA 1ZR2A 3PQ6A 4ZYXA 1T24A 2BE7A 1F2UB 1QAQA 2X23A 3GHHA 4W5HA 3S8YA 5JJLA 1Y9JA 1GCAA 1XWFA 2Z3WA 2VF2A 4CMGA 4EW3A 1S2DA 3PHGA 4RM2A 4CEHA 3O82A 3NPAA 1VRCA 4OJKA 3LCCA 3PNOA 5EIAA 3ZH9B 3IP5A 3ZD6A 1QIGA 2NACA 4ZJZA 1KK2A 1T36B 2DM6A 4H16A 4UTOA 4RMJA 1QOPB 5COAA 3IHLA 3L82B 2A33A 4NONA 1VI5A 2A5LA 2CHUA 3CH7A 2Z95A 1Q3TA 1M2VA 2E4AA 5A6SA 5HF6A 4XFJA 4LOKA 5K0BA 1QX4A 1ZMRA 1UOQA 2WPNA 2AE1A 3WRWA 4PYQA 4EA8A 3SVLA 5UKDA 3QOYA 1ISPA 1ORRA 2WDPA 1ANKA 2FN4A 1KHHA 1ZGJA 2Z56A 4F1JA 5J3JA 2HTEA 1BO6A 3D6UA 5EPUA 5HTOA 3QIAA 4MV0A 5A9SA 1ZNYA 4MW9A 3FBWA 4ATNA 1M2VB 5D7NA 2YHSA 5A6SB 4CLXA 3GLHB 3WLHA 1HEYA 1RJEA 2H7CA 4JN6B 4M9XA 1KC3A 4FW8A 4X0EA 4BO5A 2I9KA 1U2PA 1ZN9A 3BZUA 3H9QA 4CCAA 3P9RA 1PFKA 2A1TS 2AX4A 2GTHA 1YA6A 4EJ0A 2FJPA 4BU0A 1J99A 2BZGA 4JI3B 1P4GA 2IZ5A 2RH5A 2PDAA 1P9OA 1UBRS 2J46A 3E8XA 1EINA 4DDWA 1GRRA 3I1FA 4C6HA 3PA6A 2AFIB 3EGDA 2JFFA 5EHNA 3KSDO 2IKSA 4CM4B 3VR0A 5JHHB 3SAJA 4JB3A 1ADBA 1ZU4A 3MTJA 4WIAA 5DF1A 1VSVA 4AW9A 4YIHA 5J58A 2Y4NA 4DUYB 1NQTA 1CE8A 1JMVA 1JJAA 1D5WA 5KDOA 4MVJE 3WNZA 1AA6A 3Q8KA 4B3BA 1D1SA 2ZPUA 1E7WA 2BFFA 1XSEA 1AK2A 3ICOA 3VU9A 1QIHA 5CFLA 5JXGA 5IVDA 3U5TA 1PS0A 5T41A 3VJLA 4J49A 1XIVA 3CH4B 3VNBA 1WB6A 3V2IA 1LVGA 2KBEA 3PQ4A 1M34A 4N40A 4X7BA 3TGWA 5K6AA 3HTXA 4F5YA 1DG9A 1WDMA 4YQEA 1G0NA 5HZGA 4KH0A 3H0CA 3OG9A 1Z37A 3RS8A 3SJAA 1QGED 1U7TA 1Y9ZA 1CRLA 2BMDA 2Y3IA 3HYTA 3PQFA 3RYFA 4D9EA 4TN5A 3WJAA 3QX3A 4K6OA 5D5QA 1QUEA 4RX1A 2ZS8A 1UBHS 1DRVA 1X8JA 3VMMA 4B9AA 4D74A 1GRVA 2R6CA 2C4NA 1MNQA 3EUAA 1U5CA 4LRSB 2YXBA 4FGLA 2R6DA 1BFUA 2I65A 3CX8A 4LTNA 5D6NA 4B35A 1J9EA 3SQXA 3IUYA 4YXFA 4RD3A 5C3UA 1ZO8A 3P9CA 2B61A 1LBSA 1UQTA 4OMUA 1EH5A 2OFOA 1NOJA 5E6SB 4ARSA 4BIMA 1JFFA 4BB0A 4J2TA 2IUUA 4LCJA 3O90A 4Y9UA 2VWQA 5LZ5A 1H2RS 1EXVA 4Z49A 1TUGA 2YOFA 3N74A 5IVHA 1Z83A 3IDQA 3L7YA 4WDRA 5A05A 3AP3A 3ZWYA 2Q62A 4EA9A 3FOZA 4TTAA 5L4SA 2FWIA 3DVAA 3L6BA 2QMQA 1JDTA 3KCNA 4Q21A 4R1MA 3LRPA 1HDEA 3PSHA 4D56A 2UUCB 1GAQA 4NHEA 2PKYX 5HKLA 4TV8B 3GJ7A 1HNXB 5D51S 2RAUA 3ZDAA 2WVHA 1XDBA 2PRYA 5B12A 4OLAA 5JNRA 2HSJA 1II0A 1XZEA 3W8DA 4AJNA 1IZ7A 3AFOA 5COBA 5CDFA 1TUBB 2BTEA 3K2BA 1GLGA 1OFIA 1OE0A 2R00C 5LOVA 1Y1TA 3OLYA 1FNNA 1N75A 1RBQA 2XGSA 5HKBA 1A97A 3C8ZA 2A92A 2I3AA 4G89A 4L5YA 4R3NA 3BJIC 1YL7A 3L7MA 5E7IA 1KQFA 1SVWA 5C1DA 2CD7A 2Z09A 4RFSA 2RGUA 3P4UA 2Q46A 1Z6ZA 1SG0A 4BTLA 3ZCPA 2HH9A 4LIPD 4QRDA 1X7DA 2HU5A 2P62A 4IR7A 4CKXA 2Y1OA 4GT1A 4B7CA 4PYRA 5SICE 2CT8A 1GSOA 3L5OA 3C3DA 4YPFA 3W7AA 5IMSA 3UZUA 1RQRA 3A31A 4NJEB 2YMPA 4OMCA 2Y0DA 2ZSBA 3GUHA 1HWYA 5HKAA 2ZREA 3ZJ4A 1DOZA 1A72A 2GBIA 1Z75A 4M99A 3TQHA 3JQAB 3GLGB 5G1OA 3W05A 1XT6A 5DCLA 1IEVA 3E5HA 3H75A 4N47A 2Y0EA 1F8YA 2OCAA 5JO9A 2WMNB 3RV4A 3JQRA 4NBRA 1NJ2A 4BMOB 3OIUA 1EFCA 2A0UA 2XCOA 2W71A 3A2LA 4LGYA 1R0KA 2DBVO 2O3UA 3A6HA 2MU1A 2BDEA 5DCWA 1OSNA 3M9XA 2QR5A 1S9DA 4Z3DA 2CLDX 1DXQA 1TZJA 2RI6A 4JJZA 1GKLA 2CMFA 4ITVA 4LOAA 1T6XA 4UZFA 5BRNA 2O8FB 4TQGA 1KEPA 2FZKA 1W8DA 3VR2D 2D4AA 3TUJC 3C3MA 5FYDA 2CE7A 5AVZA 2FDRA 5BYJA 4KXWA 4MUJA 4NNOA 5DX1A 4C06A 2ZP1A 1K3FA 4ZQFA 1Z0UA 2H2AA 4Q18A 1T4CA 4YGYA 4YIKA 3BF7A 4INOA 2JFNA 5FL7A 5FPSA 4YAGA 5BT8A 1IHDA 2V1UA 1A71A 4DV6B 2XODA 4FBLA 5LU8A 1UK8A 1ORWA 1RI3A 4BBZA 2IYWA 3ZE1B 1REQA 1T0IA 2ZJYA 4UEWA 4ZO8A 1YR2A 5A03A 5CAEA 3BD6A 2AFRA 3DDSA 1AT1A 1BU5A 1EUDB 1R18A 3EVEA 4M0UA 3N8HA 1Y5MA 4BVJA 4QVGA 1YJXA 2J07A 1RE0A 5CDTA 4AMVA 2P6NA 2DUMA 4GIBA 1ZJJA 4F0JA 2P9YA 2JJYA 3Q3VA 1NR5A 1OC4A 3U9LA 3SLGA 1YV9A 3W8FA 3ZU4A 3EG9A 2BFMA 2C4HA 2XUPA 4KYIB 4OTZA 3TR0A 4G8DA 3WDMA 3NM6B 4CUZA 1DTSA 1F6DA 2XPCA 2BMFA 4FNAA 4WPGA 5E7JA 2ZPTX 4XUGB 1GTJ1 4PR0A 3OZRA 4RJTA 4PTZA 1UJ4A 3C5EA 2GBCA 3HA5A 4I08A 3WWCA 2AFIE 4KDEA 2G6TA 4YLYA 5JZMA 3ETHA 3C85A 2X0KA 1DAGA 4BLWA 5B1YA 2J4DA 1MO2A 2JASA 3T7SA 3GU3A 4LRWA 5AI8A 4ND3A 3FNEA 4J1SA 3UWSA 2Q5QA 2P2GA 3RUAA 1N1DA 1GQOA 1QHYA 4BFTA 2H48A 4TMVA 2I3DA 3FZNA 4BQIA 2ZGVA 4OD0A 2QRKA 3T3HA 3NV7A 3P8ZA 1JDBC 2JAHA 2VT3A 4FFLA 2GESA 2XUIA 4IDBA 4KPGA 2Y2UA 4Y6LA 1ULTA 2D1SA 2P35A 4ZRNA 3VVMA 5A1TA 1L4LA 2EP8A 4JI5B 4EHDA 1KSHA 2AD1A 4XIGS 2B2NA 2JDID 2IEAA 3TZQA 3Q41A 1MAHA 2QAGB 3ELWA 3HNOA 4ZPJA 2WHEA 3CLSC 3QX7A 5AOAA 4P5DA 3BXEA 3F6SA 2FLVA 3L05A 5JFOA 1LGYA 4QECA 3WC4A 1TJPB 2IOFA 1U2DC 1ZK1A 4WEQA 3F1KA 1QVAA 2TMYA 2V8OA 2V6BA 4OAOA 4RA9A 2EF0A 2GVNA 1VYHA 3KS9A 2V55B 1QZZA 1QB7A 5B57C 1J8MF 1O95A 1WMEA 5C46F 1YB6A 1E62A 4X65B 4DM4A 2RGCA 2ATIA 1HEIA 3P2IA 2FPMA 3L8CA 2X9QA 3NEPX 1E1CA 5LZ7A 3U3XA 3LUPA 4ZVMA 3UW1A 2HT1A 1NVBA 4FXOA 3OLQA 1NASA 1PJAA 3MS7A 4YJKA 1S5PA 1G5RA 4G2TA 3L7LA 4QASA 3S1AB 4G4SP 4QLBA 1XDGA 5BN4B 3X1KA 1GPWB 4HDQB 5EPEA 5HQ3A 1Z73A 2A14A 3IAS1 1UAGA 4Z3KA 3HV0A 3L8HA 4OP1A 1JDVA 3A1VA 4I36A 3WL6A 5BOSA 1OC2A 1P0PA 2CV2A 5KVSA 2GN4A 4KQFA 5CK4A 4RNCA 3KG2A 1CFJA 1AZTA 2RHBA 2YL2A 3DFMA 4QDXA 4Y7CA 2VJNA 5AKLA 1EHCA 5CTAA 4JFRA 4K87A 2YJ6A 4WZZA 1V5IA 3IPCA 1S2GA 2WICA 1U8TA 1WF6A 2RH4A 4KO3S 1Q84A 1S9HA 2X0IA 3FDXA 1YH3A 4CF5A 3OD1A 1LLDA 1OIWA 4CV1A 4EEKA 4NDNE 4M1ZA 4LZZA 4YMVA 1I2DA 1BJTA 4M1TA 4RVUA 1E99A 3RFXA 4IX1A 1F60A 5JCZA 1D8TA 4TMWA 1NHWA 1KZYC 4JJFA 1XKTA 2QP4A 2Q6LA 4R98A 5EP2A 4ZVNA 1A76A 1H22A 2ZUCA 5AK4A 2ZUBA 4URXR 1JR3D 5JCOC 2YWHA 1N57A 5C8YF 2W0SA 3L7BA 1A95A 4EMTA 4BYMA 1CUYA 2YZ2A 1VMAA 3OT1A 4FINA 1DKMA 3URMA 3AVVA 3IRVA 1WQ1R 1EBBA 1PR1A 2ZBVA 4GOMD 3Q7EA 3MGCA 4LKOA 1XXHE 3QBEA 3V4OA 2DQSA 2VUUA 1P4RA 1U3UA 1J6UA 2EX4A 2KSQA 1RYEA 3PIDA 4NABA 4QA9A 2RJ3A 1SIWA 2JGJA 3VR5D 1USVA 3DFZA 4R41A 5CH5A 1ONNA 1DIAA 4LI0A 3EF0A 2C5BA 1KQPA 1GPDG 1R4NB 2ZJBA 5EY5B 4HYEA 1NW4A 3B9BA 3NLLA 1O95C 3KUXA 1NW9B 2HXGA 1M6EX 4WY2A 4ZOLA 4ER7A 5JNVA 3I5MA 5E6RA 3KTOA 5ARCA 5BVHB 1ODSA 1RRMA 1OFUA 2XCLA 1LLUA 1W34A 3WFZA 4RY0A 4CKYA 2HK8A 1BMDA 1ZUD1 1ODCA 2JBAB 2UYQA 1XLTA 1VE5A 3GA7A 1X7ZA 4J8PA 4M9UA 1DC7A 4EPXA 5BV8A 5LQCA 3TRFA 5F21A 1J5EB 2PO7A 1H2XA 2X4LA 3ND9A 2XKAA 2Q6VA 1R9MA 3QLTA 5DIZA 4L73A 3WLIA 2IBMA 2DBYA 4DA8A 2RC6A 5EWJA 1JQAA 2FFHA 3QLEA 2ZUTA 4CMEA 1LKZA 3GP8A 3TTUA 1USWA 1Z2AA 4R1NA 1T1JA 3T35A 1C41A 1PZHA 3V42A 4YJ2F 5B36A 1SUIA 4DLWA 1R0XA 2R62A 1ISHA 4JR1A 4ZYTA 3LVRE 2QV7A 3B13B 5JRZA 3N8KA 5LA6F 4DV4B 1MNAA 3PJDA 5BW5A 2CMHA 5FPQA 5GADl 2EIHA 1XZCA 3C3EA 3H11A 3GRFA 1K7EB 3GPBA 3WYEA 4MDFA 2I6UA 2I2FA 1NVMB 5TQ0B 3OZAA 3HB7A 2OAGA 4CMCA 4G0PA 3IPAA 2FH5B 5G4KA 4RPCA 4L74A 4NYMQ 4W6ZA