1RZ3A

Structure of a possible uridine kinase from bacillus stearothermophilus
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
198
structure length
184
Chain Sequence
MELRDRIDFLCKTILAIKTAGRLVLGIDGLSRSGKTTLANQLSQTLREQGISVCVFHMDDHIVERAKRYHTGNEEWFEYYYLQWDVEWLTHQLFRQLKASHQLTLPFYDHETDTHSKRTVYLSDSDMIMIEGVFLQRKEWRPFFDFVVYLDCPNIQKFINRYWKAEDYYLETEEPIKRADVVFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein RBSTP0775
publication title Structure of hypothetical protein RBSTP0775 from Bacillus stearothermophilus
rcsb
source organism Geobacillus stearothermophilus
molecule tags Structural genomics, unknown function
total genus 60
structure length 184
sequence length 198
ec nomenclature
pdb deposition date 2003-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00485 PRK Phosphoribulokinase / Uridine kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1rz3A00
4XTCS 4ZIRB 1YVDA 3BJIC 2ZYUX 3EZ2A 2IK8A 1OKKA 2WKRA 3MGCA 3SQWA 3DMNA 2ODEA 2QN6A 2YOGA 3K9GA 3NVAA 4BFZA 4FCVA 4JVMA 4B2IA 1EFUA 1W0KA 2ONJA 2C99A 3I8XA 3QKRB 3TSZA 1SXJC 4XJXA 2W6JA 1VG9B 2SHKA 4A2QA 3LFUA 4DUGD 1Z0DA 4EKDA 2ZI5A 2IX3A 1CP2A 4P4UA 2F9MA 2XZOA 1SHZA 5EE9A 2WJHA 4IOLA 4L15A 1JPNA 2HF8A 2ZANA 3P4YA 1BMFA 2K5UA 4QNRA 4OK5A 3WMGA 1AKEA 1E79A 4BFVA 4MRRA 5TY0A 3QF4A 4N0DA 1KI7A 4KFSA 2QE7D 4D2IA 4TQ9A 1E4VA 4KJZA 2BOVA 2WVJA 1SKQA 2CLDX 4TWZA 2FSIA 5K8TA 3KXLA 3I32A 1LTQA 1DVRA 3I8SA 4WZBE 1AS2A 2NPFA 3X1WA 4YLGA 5FL7A 3T1VA 2A3RA 2O8DB 4B73A 4Z8YA 4OHYA 3VTKA 3JZAA 5FUXA 3I5XA 4BZPA 4I1OA 3VKWA 3AB3A 3G5UA 1M2OB 1VCOA 3IHWA 4LPKA 1QVRA 2OAQ1 3EA5A 5DI3A 721PA 4HZIA 3BB4A 5TMPA 4MQBA 4ILEA 1MABB 4PX9A 4DSNA 5K8LA 4PAQA 2CK3D 3EZ9A 421PA 2ZI4A 1SVWA 4KLZA 3HJNA 2YKGA 2ZS8A 4PC3A 3PG5A 2QPAA 2CHGA 3GLGA 5TDHA 3REFA 2MSDB 2ZRPA 1EFCA 3RWMB 5JSZB 3GQBA 4R9UC 4NONA 1RZ3A 1U8YA 3EARA 3SJCA 5E3HA 3VNVA 3B82A 1SHKA 5TVKA 1MR3F 2UKDA 5L3QB 1IHUA 1V43A 3LA6A 2O8FB 1C4OA 2JGNA 1Q3TA 1S8FA 5SZKB 1EFTA 1ODFA 2CL7X 2HV8A 4TTPA 3SEAA 5FH9A 4LJ4A 1E4YA 1T5IA 4Q48A 5BN5A 4EAQA 2V3CC 1OJLA 2W2TA 4BFSA 2IUSA 3SQXA 3OEHD 4US2R 3TGPA 1Z8FA 1W36B 2ZJZA 3RC3A 2EFDB 3CX7A 2BMEA 3WRXC 1CJUC 3NDPA 1X8LA 1MKYA 5FBLB 2ZE5A 1DG1G 3B9PA 3CRVA 1XEWY 4B6FA 1PV4A 1ZVQA 2WSSA 1CJVC 5HKKD 2OHFA 3CKLA 2DBYA 3ETLA 1LF5A 2CCKA 4D4KA 2QSZA 3QE0A 1JNYA 3RRYA 3TW4A 4GMXA 1TU3A 1FOEB 4KVGA 5BQ5A 5JJIA 3CB4A 1JR3D 1P2UA 3SC3A 1D5CA 2JJ2D 2ANCA 4S35A 4QJ4A 2VP4A 1HE1C 1GSIA 4RD0A 3GJ6A 3UWKA 1SXJB 1ZBDA 2R65A 5BN3A 2GCOB 3N70A 2EWVA 4D0NA 4Z51A 1DAHA 3EC1A 3THWA 1I4TD 2IS4A 4A8JA 3P26A 5GVSA 4V0OA 4Z8XA 1NJFA 2PT7A 2EVWX 3ZD6A 3FMFA 3PV0A 5UKDA 2GEDA 3SN6A 1G8YA 1CTQA 1OB2A 3TUZC 4PANA 1E98A 2RB4A 5EXPA 4V0LA 3QY0A 2QTVB 1S96A 5F2EA 2WWXA 2AHOA 5LBIA 3ZIAD 5CM9C 1MO3A 3FKQA 4ZIRA 3X2SA 2HCBA 2BVNA 4ASUD 1NN1A 2QM7A 2BHRA 4AC9A 2GF0A 1EX7A 4V02A 1IQPA 1H65A 2WHXA 1NIJA 3P1JA 1YQTA 1XXHB 4IRUB 4JJKA 3KX2A 3DEFA 4MRNA 1WF3A 2YC4C 3QKRA 4OL0A 4BRUA 4MDEA 2QMOA 2RGBA 2WJJA 3AF3A 2X77A 3QG5A 4A2PA 3F8TA 5KSZA 4LSGA 4B48A 1N6PA 2XJ4A 3TUJC 2Q9AA 4NCIA 3TIFA 3UIEA 1R7RA 3VNUA 3RWOA 4KBFA 2ZSBA 3HPRA 3IO5A 3WNBA 3ND8A 4UNRA 1VG0B 1ZU5A 3C7KA 4GP6A 5JEEA 3IPYA 4LBZA 5E4FA 1JECA 3WNCA 3TAHA 4I81A 4RD1A 2F7SA 1GDDA 2HJVA 2F3TA 5EP2A 5JJKA 4C0LA 4F4JA 2O8DA 2F9LA 5JI2E 1P2TA 3LLUA 2ZREA 1OHHD 1UDWA 4A9AA 4I99A 5ELXA 3RS3A 2GCPA 4ON9A 4B71A 1Z06A 3WRYC 4CIDA 3WBJA 5SZHB 5EQTA 2W6ID 4TT3D 1MABA 5DE3A 3T15A 4WAUA 4LJYA 2NO1A 2AKYA 3PR1A 3QG1A 4QGGA 3SBDA 1F2UB 3NDBB 1X1SA 1Z07A 1IJFA 1AQUA 3HP1A 3IIKA 3BE4A 3W90A 4QM7A 3K0AA 2OBNA 1NF3A 3T1QA 4ITRC 4A6XA 3U7GA 3KFVA 3DM9B 2PMKA 4URUR 2PT5A 5BW8A 4RZUA 1SXJE 2QG6A 3LV8A 1P9NA 4U5XA 3PEVA 2O5VA 3ADKA 1QBKC 2IYXA 3CZPA 2R6CA 5FR1A 5C2JB 4YONB 5KU1A 1R5BA 2BBOA 1XJCA 3TSOA 2G83A 2HT6A 2IBMA 1KY2A 2AR7A 4JLPA 3UG7A 4A82A 4URYR 3UMRA 2OM2A 3K0CA 2VHCA 4JYBA 5JMTA 2ZRLA 2JIZA 5FTNA 2QRNA 1Q20A 2ZYTX 4MYUA 3FMOB 2GWHA 3U3JA 4N3NA 4C7OB 2FEMA 1L7VC 3LD9A 1GKUB 1MO4A 4Q7MB 4TN1A 2BEKA 4JLVA 4WXPA 1P5ZB 2CJWB 4OI0A 2ZRDA 1Z6AA 2QGNA 2WWWA 5AK0A 5B64A 5P21A 1IXSB 1II8B 3EA0A 4PO8A 3W8RA 2ASEA 1N3BA 4BLPA 1G4UR 2BKEA 2V9PA 1I2DA 1XXHE 1D2EA 1XX6A 2J7PA 4Q1DA 3D6TB 4Q9LA 1E9FA 4K81B 1SXJA 1DADA 2GCOA 1VCMA 4JIMA 4KAXA 2A78A 4QL3A 4QBFA 4XH9B 4P32A 4EPTA 2G0NA 4YMUA 4P31A 4DLSA 1HA3A 4W5WA 2ATVA 4BEJA 3AKCA 3IUYA 1VYTA 3U7HB 1GOTA 2OBLA 1JI0A 2AN9A 4JVSB 4Q7KA 3TR0A 1UAAA 5JBQA 3AVPA 1OH5A 3DOFA 4A4DA 4GT1A 1G17A 4DCUA 1XP8A 2QMUA 2IYZA 5EP4A 2IHYA 4HLCA 3L0PA 4WIAA 2IYLD 5A4JA 4Q1EA 1N6HA 2B8TA 3SE0A 2ODNA 5BYJA 2GJSA 2QAGC 2OLKA 1O87A 3CH5A 2GAOA 4DVGA 1X8JA 1XXHA 3K09C 1TTTA 1ZC3A 1TUIA 2FN4A 2QI9C 2B7CA 2FPLA 3A58B 1E3MA 4KCGA 2FA9A 3I4LA 4YMTA 5D3QA 4CGZA 1G64A 2VH5R 4AD8A 2WKQA 2ZYWX 1NY6A 5HCNA 1N0UA 3BXZA 3W6PA 1QHSA 3SJAA 5AUPB 2OXRA 3FTQA 1T8TA 3AF1A 4B44A 3IEVA 2HXSA 2QT1A 1OXUA 4WBSA 3FMPB 4WA7A 5JECA 1VYUA 3K9HA 1G18A 3GEEA 3I72A 2BCJQ 1OXVA 2GZDA 2NGRA 3Q72A 2FDCA 2J3EA 2FZ4A 2QBYB 4LHXA 2CNWA 2XSZA 3A1SA 4ESHA 1YHNA 3MSXA 4XVUA 2BM1A 1WRBA 1N5LA 4LOAA 1NVVR 1G3RA 4RCYA 1KYIA 1OPXA 1D9XA 2GZHA 1XEWX 1LFDB 1COWA 3FDIA 4JLKA 2KJQA 2C77A 1E96A 3Q7QA 2VPPA 4MKIA 4EPWA 4FMDB 4D25A 2Q3MA 3IO3A 4HB3A 3SHWA 3ZVRA 1NP6A 4DLVA 5KUTA 1R8QA 3C15C 1M6NA 4DSOA 4LDJA 1F2UA 1NNEA 3H86A 2ZRAA 4OQFA 3CIOA 2LKCA 4CEHB 3QVVA 2AXPA 2GBLC 3AGPA 4KODA 1E9CA 5EE1A 1KZGB 4Z1MD 1ZP6A 3DKPA 4QBIA 1YZGA 5JS8A 1JALA 3QPUA 3HR8A 4Q5IA 3TR5A 1W5TA 3ZLJA 2ODWA 1CJTC 2OBMA 4RZ2A 1XMIA 1EXMA 3CRW1 1XU4A 4YXWD 1GL9B 1DOAA 1T91A 4BRWA 1JJ7A 1Z3IX 2AWOA 4M1MA 2AXNA 1G6HA 2CDNA 4DXAA 3I5YA 2R6AA 4AYTA 1IOZA 4DEXA 2IW3A 3OHMA 4DCTA 1XTSA 1Z0AA 5FTKA 2C78A 4V0NA 3KB1A 3EPHA 3SFVA 2V6JA 5JZVA 5M04A 1K6MA 1U98A 4JJZA 4Q4AB 3FVQA 4D80A 5CITA 5EXSA 2CJWA 4YMVA 4LK2A 2D62A 3C14C 1A2KC 1II8A 2BMDA 4BECA 2CBZA 1SULA 2DWOA 4MUAA 2N1BA 3QBTA 2I1VB 1J2JA 2QAGB 4MGYR 4L8GA 1KMHB 1W47A 1G5TA 1E32A 1YZLA 5JEDA 3KXKA 1DPFA 1VCNA 1U0JA 4PSKA 4C0KA 1CEEA 1P2SA 1SVOA 4V0ME 2WAYA 4ZV4A 2I3BA 2LWIA 3F0TA 3QPVA 3RRMA 2ORIA 4B3BA 2WIBA 3VR5A 1GKYA 4DRZA 4QHTA 3H1TA 4ERNA 3L43A 3RC8A 3SDZA 1OB5A 5G53C 4KFTA 1OV4A 4Q03A 3W6OA 4M1WA 4QJ5A 1XCPA 4IJMA 3QI2A 2FOLA 5FUYA 3GLHB 1YR9A 2QP4A 4XSHA 2Z83A 2ZITA 2R6DA 1EGAA 1FFHA 2G77B 5E7MA 1PLJA 1R0YA 3BERA 4IXNA 3AVOA 1G8GA 2FV8A 1KI2A 3GP8A 1ZNXA 3HR7A 5EE5B 1GRQA 4V0MA 4PHFA 3I62A 2H5EA 1KNQA 2FSGA 1AQYA 4JBWA 4PHTA 4I4LA 2ZVPX 4IVRA 2QAJA 4PSAA 6Q21A 3EIEA 1UBCA 1E2EA 4KXFB 5JHHB 5HPYB 2QENA 3I3SR 2ZU0C 2IXGA 4JL6A 1NVVQ 2DHRA 4XD7D 2EU8A 2XZPA 3M0EA 4NP6A 4OI2A 4XWOA 1NMYA 3T06B 1E9RA 2DYKA 2QBYA 4IW3B 4UNQA 3OIYA 1ZM2A 2WMOB 2G6BA 3HDTA 4DLUA 1UKZA 2JLQA 1MH1A 2FWRA 4P33A 2ZE7A 2BKUA 1VCIA 2AWNA 3SNHA 4HAVA 4DSTA 4JLBA 3GJ8A 1GM5A 4TQAA 2P6RA 2AFIE 2VP6A 2VIIA 4PAOA 2A5JA 2GJAA 1E1RD 4G3XA 2BV3A 2R9VA 1M1YE 2PX0A 3EW9A 3FWYA 3PUXA 5HZKA 4IFEA 1T3SA 4CEHA 3TRFA 1XMSA 2OAP1 4RKFA 1R2QA 4XOIA 3X1DA 4NE2A 3UATA 2YOHA 3OIWA 1KZ7B 3K9NA 3R20A 2HCJB 1I2MA 4JBXA 4JVNA 4MYHA 1Y3AA 5FOXA 2FPMA 2RMKA 3RSLA 3SHFA 1NBMD 2X2FA 2ZI9A 4XWAA 2QORA 1E9DA 1G4AE 1GKIA 3Q3JB 4JZKA 2O8EA 1HY3A 5F3WB 2E87A 2QTFA 1LNZA 2A5DA 4H9GA 4R7ZA 5C46F 1KO1A 3THOA 3O8RA 3NTUA 1W0JD 4G5QA 4QOSA 3G0HA 4KLNA 2RHMA 4NBSA 2QNRA 2A5YB 2IYRA 2HT1A 3KJEA 4URWR 4URZR 3SJZA 1CKEA 2C9CA 1US8B 3AUYA 3OFNA 4OJKA 4Q4AA 5DGXA 3GLFB 3CBQA 2VA8A 2D06A 3GLHE 3LXRA 3NG1A 1CS4C 1TQ4A 1G5RA 2F1HA 2IF0A 2QT0A 3LQQA 3M4YA 4I1SA 5AUNB 1TADA 2QAGA 4BZQA 4Q4HB 1GRRA 1X86B 3ADDA 1W2GA 4Q66C 4JLMA 1XFAA 2W2VA 3K09A 2PMDA 3A4LA 3RAPR 2XITA 3B78A 1HT1E 2CEAA 3QSYA 2IC5A 4TTQA 5HE8A 3ZS8A 3IBYA 4MGZR 1IJEA 4BFUA 3EPLA 1Z47A 3GFOA 4TSFD 5J5CA 5LB2A 1W4AA 3BFKA 4DLRA 3NKVA 3UK6A 1FNMA 1U94A 4M0LA 4OI4A 1NVUQ 1XJQA 3U5ZB 4GZMA 3MG9A 4PQYA 5D3MB 5HZHA 1WB9A 2ERYA 5DYIA 1U0LA 4AKIA 3H84A 3A6PC 4ESVA 3GLHA 4Q9HA 4MKGA 1YR7A 3VR1A 2GJ8A 4LJ6A 3W34A 5JWOA 1VECA 2V1UA 3B5JA 5EE0A 4EFNA 2FSHA 2FEOA 1DO2A 4NCHA 1KGDA 2CL6X 5CYPA 4URVR 3AV0B 1NSTA 2NIPA 2MMCA 2P67A 3THXB 2GNOA 4IEEA 3BAFA 4C3ZA 1G7TA 4A0HA 4DJTA 3U7EB 3ZZ0A 4PR0A 4A6PA 1ZD1A 1ZJ6A 4PPNA 2ZJBA 4M1OA 4HB2A 2DR3A 1HEIA 2ZI6A 2GBLA 3N2IA 4KBGA 3BH7A 3C8UA 3VQTA 3ICEA 2F43B 2L0XA 3T34A 3VHLB 5B57C 2REOA 4M8NE 4FMDF 4TL7A 5G40A 1ZIOA 1S9HA 2JJ1D 4LWZA 4DSUA 1A2BA 2VSOA 1SVMA 2RCNA 1QZXA 4HUQB 4RCZA 4F4CA 1KJWA 1ZNZA 3NBXX 3A4NA 2A7QA 3GEIA 3IILA 2J0QA 1E2LA 4XVRA 3TBKA 4DDWA 5FR2A 1KDPA 4NYMQ 2H18A 2EFEB 2V54A 2DFKB 2OILA 4XVQA 3R8CA 1NI3A 1JBKA 2JLXA 2ATXA 3W3AA 2FH5B 2HEIA 1XTKA 2EFCB 2VP9A 4PC7A 4B2LA 4ARZB 4HUTA 1SVLA 3VU9B 4E03A 3GLFE 5CB8A 5C18A 1KK2A 1N6NA 1G19A 4TZ6A 4JSTA 1KO4A 1E9EA 5KNBA 4L16A 3F3YA 3Q85A 4D4JA 1HYQA 1XRJA 1DAGA 4Q1BA 3OEEA 1KTVA 3LW7A 1JQLB 3LAWA 2XNDA 5TARA 2PBRA 4Q1FA 1OFIA 4BLQA 4DLZA 3KQNA 3L82B 3A8TA 3GFPA 3KFXA 2H8KA 3BGWA 4DCVA 3AQ4A 3QKUA 1OYYA 1P62B 3U3RA 1GWNA 1T0HB 1TF2A 5KOYA 3I61A 2G1JA 5HCIA 3AF4A 3LWNA 1I4DD 1G3QA 3PEWA 4EJSC 4ACAA 1E2FA 2YC2C 4LBVA 4D82A 2V1XA 1ZCBA 3OESA 1J99A 5KDDA 3KKPA 1US8A 4US1R 3GLFA 3T12A 1R0WA 1Z2CA 4NYJQ 3CW2A 2VHJA 5DO9A 2WPDA 1EFRA 5DHFA 4P4TA 1PVOA 2N46A 1XJ0A 3HU3A 1XMJA 4UNSA 2QPOA 4KYIB 4HAXA 2XOKD 1C1YA 4Q4HA 2QP9X 2RH5A 4AY2A 4UKDA 3CNNA 2EYQA 4BUJA 4FMBB 3CR8A 3OZXA 2OSBA 3D3QA 2A5GA 1NG9A 2G1KA 2IYUA 3U3OA 2Q3FA 1N6OA 4X8OA 2GEVA 5ANRB 4JL8A 1E1QA 1SQ5A 1ZNYA 2YWHA 1HTWA 2C8VA 4X8MA 5B30A 2OEPA 4IDPA 5FTJA 1AIPA 1H8ED 4Q18A 1KDTA 1QHHB 4LBYA 4PQFA 4DKXA 2OT3B 3LX5A 5D3MA 3IGFA 4HLUC 3CZQA 1CR2A 3M6AA 2NQ2C 2JDID 2QY9A 4E09A 4F92B 2ZROA 3KB2A 2QU8A 4L4UA 2V7QD 2GESA 2NO7A 3BFVA 4MKFA 3ZZTA 5GADl 1E0JA 4D6PA 1DAKA 1N6LA 4OK3A 4ZKEA 1KO7A 1Z0KA 2ZS7A 2ZRJA 3THXA 5J4LA 1AZSC 2DWPA 2YNMA 3OAAA 1B23P 2VP5A 3VMFA 3NIBA 1KI6A 2QPTA 2R2AA 1ESNA 3IPXA 2O52A 1CRPA 3LXXA 3B9QA 1U90A 4M22A 4TLAA 2HYDA 4JKIA 5FL3A 2F43A 4F93B 3A36A 1QG4A 3LH5A 5FOSA 4O25A 2RHDA 1RYHA 2AD1A 1IN5A 1NMZA 3TE6A 4YDHB 2ZPTX 4GOXA 3QEOA 3UMSA 5GJBA 1G7CA 4HUQA 1ZM9A 1MRSA 4W5HA 1AGRA 2VTKA 3CF6R 3CH4B 4IFBA 3AVWA 2REXB 4M9SA 2RKOA 2RGXA 1PUIA 2IYSA 1Q12A 1XTQA 2ZR0A 4WW0A 3PJRA 3FHTA 4NU0A 2VSFA 4EPVA 1OT3A 4D4MA 2ORWA 1HUQA 4EUNA 4DZZA 5B2ZA 4EJSB 3UMFA 3U6BA 2GJ9A 4UJ5A 5DN6D 4Q19A 4ARZA 2ZJ8A 3VU9A 1TQ2A 1NBME 1AK2A 1KI1A 5KSOA 5IK2D 4RD3A 1AS3A 3LBNA 4ZDIA 4PQRA 4NHOA 4G01B 1E2QA 3Q8XB 3RYTC 1GITA 1IN4A 1YU9A 2FE4A 3QIAA 4R98A 2QUZA 5CYOA 2Q0HA 3GJ0A 2GKSA 3TW8B 3RNLA 1VHLA 3ECCA 4QBHA 3UKDA 4ACBA 3BC1A 4TLCA 4GI7A 3TVTA 2R62A 3TH5A 2CCGA 1YZNA 3DKVA 4HZUB 3KZ1E 5FFMA 1TUEA 4FN5A 1H8HA 2VSXA 1OH6A 1UBFA 2GTPA 1Q1QA 2GXUA 1GG2A 2IS1A 4BLRA 3D8BA 3NHBA 3EWAA 1Q57A 2C9YA 2D4HA 3A1TA 3IBGA 5DIFA 2NO6A 5AUOB 3EG5A 2JATA 1WA5A 2WWIA 2ZR7A 3PENA 5FPTA 3NBZC 1UFQA 4TTRA 2ZS9A 3K0SA 2IT1A 1JQJC 4LYFA 3AVYA 1CF4A 2OE2A 1BYUA 3BBPA 2YZ2A 4LJ7A 2ONKA 4M4SA 1GZSA 4PPGA 2X8AA 2WJGA 4CT4B 2RGDA 4F4IA 4GZLA 3MMPA 2GDJA 3GLIB 1KO5A 3CNOA 4QG7A 4Q9JA 3L0SA 3RS0A 4DWJA 1OIWA 3N5CA 2XXAB 2ANBA 2YYZA 2YVUA 4LJ9A 1KSGA 2VF7A 2ZIAA 5JSZA 1G7RA 1FUUA 5KDOA 2WZQA 2ZR9A 2J1LA 3I1FA 1CJMA 3DHWC 1W4CA 4IDHA 4BLOA 4M1TA 5L3QA 4WZ6A 2O8FA 1BYIA 2B21A 1VG1A 3QBVA 1YRAA 2PJZA 1CRQA 2ZYVX 1N6RA 4JSYA 4N0EA 4QJ3A 3PEUA 1OIVA 3B8HA 3CRMA 1OFHA 3FE2A 3IQWA 5FUWA 3EASA 1GRNA 3SFZA 1G3MA 2QQ0A 1RVDA 4PTLA 1HV8A 521PA 5B58C 1FPMA 2QQEA 4A0RA 3L0OA 1KSFX 1JXOA 4D4LA 1WXQA 1ANKA 1ZINA 5J4KA 1F3OA 1P2VA 1N5JA 1WDTA 3QVUA 2Y8EA 1II9A 1X6VA 4TYQA 3TLXA 3U60B 1NVXQ 1XF9A 2BC9A 2C9OA 4II7A 3X1YA 2QGZA 4C0HA 4OHVA 1VIYA 2HLDD 3VX3A 4HB0A 1TPZA 1KK1A 2P6NA 5EXTA 4ABYA 1CBUA 1GAJA 2EW1A 1P72A 2FFHA 4BGDA 3ZD7A 2YWFA 3NEJA 4R2IA 3IEUA 1NN3A 3TSWA 2VBCA 4DDUA 4Q47A 1Z83A 2YV5A 4EDHA 3FKSA 4PO9A 1QDEA 4M9XA 4B35A 3NBFA 3RS5A 3ADCA 4EJSA 5J4YA 4ZCMA 2FMXA 5LPNA 2O0HA 3RRNA 5KPDA 5G3YA 2R6GA 4RSGA 3WYGA 4ZDJA 1WCV1 2OCAA 4TYNA 1FX0B 1XTIA 3JZMA 5CJ2A 4LRWA 1UM8A 4Z54A 1LS6A 1GVNB 5IT5A 2WBLC 3A1WA 3LRPA 2D7CA 3FPAA 2BIFA 2P5TB 2J0UB 1QHXA 1SVSA 1DO0A 4TMVA 1TL7C 4LHZA 5DHAA 4AKEA 4IEIA 3GLIE 5EE3A 4KFUA 1UEJA 3FOZA 2VP2A 4AYWA 4P3YA 4LYJA 3K1JA 1W7AA 3R7WB 2DWQA 4XWKA 1HH4A 4MYCA 1DAEA 4X8HA 3EXAA 1JAIA 1AKYA 5EJEA 1S2MA 5H1YA 3IDQA 4TZ0A 1E6CA 2CHVA 3WHLA 3UG6A 1XNJA 4A1FA 3L8YA 4DUGA 1UPTA 2WOOA 4HLUA 3HYRA 2VQSA 2NPIA 2ZAOA 3DZ8A 3OE7D 4OI1A 3AUXA 1OLOA 4B3CA 1BS1A 5JCPA 1N25A 1IONA 3OF5A 3A1VA 4HI0E 4Q1CA 1ONBA 2A2ZA 2IEZA 5A5GA 2QE7A 3Q5DA 1XCMA 4FI3C 1GTVA 1OKKD 3L8ZA 4FXPA 2Z6VA 1FUKA 2XXAA 3KXIA 3AP2A 2PCJA 1W0KD 4R2HA 4FCTA 4M53A 1GNRA 3K8YA 2ZRNA 3MWJA 2VP0A 4Q1AA 3QPWA 3AKYA 2W6JD 4OHZA 4QGHA 5CLLA 1CXZA 4EPXA 3PQCA 1BH2A 1R10A 3CRRA 3HWSA 4DB4A 2ZJ5A 3BFXA 2CK3A 2NO0A 2ZQ5A 3DOEA 3U3MA 1BMFD 4OYHA 2QRZA 2YOFA 1TX4B 1E79D 1MRNA 3NH6A 1U2RA 1IY1A 3NH9A 3RDPA 1JR3E 4FWIB 4MGIR 1W5SA 1DELA 4KU4A 1U8ZA 1LF0A 2KSQA 4C7OA 1OYWA 4HAYA 1FMLA 3AP3A 1RC8A 2A5FA 3WMEA 2ZJAA 4RFSB 5FL7D 1YRBA 3MLEA 2IS2A 2O8CB 1T6NA 1FP6A 4CF7A 4CYMA 1E2JA 1QHYA 2IF2A 3CNLA 1CR4A 4RY2A 1FW6A 1J8MF 1IY2A 2D2FA 1SZPA 2YWGA 2UZ3A 4MITA 4MRSA 3TVDA 2X1VA 4BASA 3OIUA 3OEHA 1OIXA 4F91B 1GNPA 5FUVA 4PHGA 4EFMA 3RABA 2PZFA 3QKSB 2XAUA 4J0QA 3KTAB 2Q3HA 4O2LA 1MOZA 4TMXA 5KDLA 1KAOA 1NG1A 4BE7B 3HPQA 4FINA 2VF8A 1A1VA 2KBEA 4OQLA 5HKKA 2AL7A 1G8PA 1J90A 3RS7A 1EX6A 3ZVMA 3EAQA 4QRHA 1S4QA 1D2NA 1G291 1JR6A 2PL3A 3FYHA 2OZEA 3MJRA 4NMMA 3RS4A 1JR3A 2XTZA 4HB4A 2JJ2A 5FBRB 3W5JA 1NN0A 2GXSA 1ZC4A 1WP9A 2CE7A 4FW9A 3L2OB 5CLQA 1ZRHA 4DLXA 4RJLA 2D7DA 1G20E 4C2TA 1Q21A 2DCUA 4TQUS 3B13B 1W4BA 3MCAA 1NKTA 1E2GA 1FX0A 2H16A 2WWYA 4JT2A 4Q4LA 4ZI2A 1BKDR 5KO2A 4AWXA 3U44B 3BK7A 4DC9A 1K8RA 1XZPA 2N42A 3K70D 4GL2A 3Q9LA 2CVFA 4DEYA 5TXGA 4JS0A 1M8PA 1DAIA 2J0UA 2WSSD 2IYWA 1D2MA 1YR6A 3ZQJA 1N6IA 621PA 4QNMA 4NTZA 2GJKA 3EPJA 4NPHA 2VL7A 3ZIAA 2WJIA 1FQJA 4ASUA 2GHIA 4E22A 3R7WA 3BORA 2VYFA 5DSZA 1Z0IA 3ZVLA 5KHOC 2GK6A 2B8WA 3NWJA 5H68A 3AVUA 1TMKA 3PUZA 3KQUA 2REBA 4V03A 1T3HA 3SR0A 1LB1B 2A9KA 2W83A 1XTRA 3VR6A 2XX3A 1ZUNB 2O0KA 3WYFA 3QOFA 4QHYA 2J46A 4BPBA 1KAGA 4A2WA 2KWIA 2EYUA 4B3GA 1FNNA 2D2EA 4UNPA 2R8RA 4QXAA 4MRPA 1D9ZA 1Z0FA 5DLQC 1WQ1R 4M1SA 2W58A 2B7BA 5LDDC 4NYMR 3MD0A 2GETA 3UANA 2OFOA 5JWHA 1PZNA 3DZDA 4D26A 2OCYC 2JEOA 4C0JA 2DFLA 1TQ6A 3CPEA 1XD8A 2H17A 5FOTA 4C0BA 1RKBA 3EZ7A 2BBTA 3BIFA 1P9RA 5JHGB 1OHHA 4PZLA 3TNFA 4PAMA 4NYIQ 2F3RA 3K0FB 4MGKR 2VLIA 4O2RA 4LHWA 1DTSA 3SU8A 2W6IA 1NRJB 4TT3A 4E5UA 4BWYA 4QFMA 4S2EA 3ZJYA 4DLYA 4O0MA 2JLVA 3ICQB 4YMWA 2PCLA 2ZRIA 3CM0A 2OFXA 5GVRA 1G41A 4L9SA 2E1RA 4AKHA 5K8IA 4IDQA 2QL6A 3IKJA 5FOUA 3RANA 4I1VA 3U6KA 4FCWA 2RGNC 1OXTA 5JJLA 1F2TB 4Q7LA 1KDRA 3E5HA 4Y0VA 3WHKA 2FFQA 3ZS9A 3UPUA 2FFBA 1KSHA 1K5DA 4WOPA 5CJPA 5FBWB 1J70A 1GP2A 4RFSA 2P2LA 3BB1A 2O8CA 1W4RA 1P9WA 1GL7A 4IOKA 1E99A 4M1YA 1VDZA 4JLNA 4KHZA 1P7CA 3F5FA 3N2EA 4ZCLA 2XB4A 3HU2A 4AURA 4K46A 2J45A 3TKLA 2GVZC 1KMHA 1MO6A 4NYJR 4B2PA 1ZW6A 4X8LA 3P4XA 1ZAKA 2IYVA 3QKSA 5F9HA 3KTAA 1E0SA 3ZDQA 2R6FA 4FMCB 3BWDD 3BH6A 4G0NA 3AKEA 3GJ4A 3WXMA 4BZXA 2OXCA 1BO6A 2J5XA 1OE0A 3U3KA 1ZD8A 2WV9A 4NCNA 2WSMA 1W48A 4C0QC 1JB1A 4O3MA 2ZRFA 3AVTA 4ZDWA 2XZLA 4Q02A 5JS7A 2WOJA 1L4UA 1T8UA 1UEIA 2QMEA 1F6BA 5FPHA 2JLZA 4TL8A 4GSYA 3FB4A 5C4MA 1DAMA 4DB2A 2O8BB 2ZJYA 1TAGA 1AM4D 1CULC 3WMFA 4JKYA 3QXCA 2ZVQX 3B1YA 3LNCA 3ZQ6A 5H8WA 1NKSA 2JIZD 2JLSA 4QHSA 4Q7JB 2XB2A 2C03A 4QC2A 1MV5A 1W36D 3U44A 1DAFA 3CRQA 3A1UA 3K53A 1QHGA 4G5RA 2OLJA 4IDOA 3B1XA 4C0SA 4DBLC 1NL3A 4LC1A 3BRWD 3AGQA 1OXXK 4XSGA 1QF9A 1T5LA 4UXHA 3NC0C 3SYLA 5K8UA 4LC0A 1KKLA 1SVIA 2JLYA 1R4AA 4AKGA 2ZSEA 3TK1A 4IVPA 1MT0A 5FOVA 3KL4A 2AX4A 2P6UA 1PLKA 2J7PD 1UJ2A 2UZIR 2AFHE 4KSCA 4C2UA 2BEJA 3D31A 4TMWA 1E2MA 3PITA 4JMPA 2QSYA 1Z6XA 1SXJD 1KJZA 2BM0A 4TL9A 2EFHB 1RE0A 2X2EA 3PFIA 5BXQC 1E0AA 4UQOA 2OO7A 3AKDA 1GFIA 2WTUA 1NVWQ 2ZTSA 1Z5ZA 5FI1B 3VFDA 1CR0A 4BQSA 3ZVNA 5F9FA 2VHUA 4AI6A 2BDTA 5AJZA 2J41A 4P0TA 4TYPA 4AIIA 1RYFA 4RKEA 3ZH9B 4LX0A 5CM8B 2IUTA 4BLTA 4ZDKA 1P60A 1L2TA 1R0ZA 4M9QA 4LV6A 3W5IA 1SKYB 2PZEA 3T35A 1YZQA 5KNCA 3AEZA 3JVUA 1KSJA 2ZSFA 2WMNB 3QF7A 4CRWB 1EESA 3E1SA 1HE8B 2J0VA 3THWB 3CF0A 1XPRA 1KO8A 1S1CA 1CU1A 1UKVY 3T5DA 2B6HA 4JYCA 1N5IA 1YZKA 2WWGA 3KJHA 5E7IA 5SZIA 1Q0UA 2FZLA 4K8OA 4US0R 1E2NA 2R44A 2VHQA 3WNDA 4A0FA 1Q3HA 3CX8A 4KITB 4LJ5A 4TYWA 2YWEA 1GL6A 2BJWA 4JLJA 4OKSA 4DLTA 4Q9KA 2EFGA 3LVRE 4LPSA 1U8AA 3AF0A 3TUIC 2C04A 2ORVA 2KB0A 5CK4A 4LGMA 3K0FA 4AG5A 2KI5A 1U9IC 4YDSA 1ZM7A 3VAAA 2DFTA 4NKRA 1KNXA 1Q44A 2AK2A 3NXSA 5G3ZA 1YZUA 2JASA 4LCBA 1ELOA 2W0SA 3A37A 3GJ3A 4FIDA 1R5OA 1EK0A 3CF2A 4OQNA 3EX7C 4M2LA 1NLFA 2WICA 4LYHA 4TL6A 2G88A 1LS1A 1OFUX 4Z1MA 2OCPA 1F2TA 3LY5A 4KV9A 1W49A 1OXSC 2AD5A 1K5GA 3A4MA 4NZYA 2CNWD 2XSZD 3VR3A 1IM2A 1IXRC 4YXWA 3GLGE 1RRCA 5KPJA 5L3VA 1COWD 4POAA 2QP3A 3U2QA 4OHWA 1J7KA 1S9DA 4M9ZA 3THYB 1KY3A 4TMKA 1ZMXA 4ZKDA 5CDFE 4TYYA 4LHVA 2ZSDA 1BOFA 3S1AB 3FMIA 2FGKA 3W9YA 4MYTA 4NCKA 3SYNA 4OQXA 1RRPA 3QENA 3SS8A 3SZRA 1TF5A 5TB5A 3B1VA 3MWKA 2GXAA 3U61B 1VG8A 1KI8A 3E2IA 2NMVA 1IN8A 2IXEA 5F98A 3NBYC 2BBSA 5KYKA 5JLJA 2WM9B 1DBSA 2JLRA 5SZJA 2V6IA 1IN6A 2GEUA 4W9MC 2GXQA 2MMGA 5HE9A 3P20A 1T9HA 3CX6A 2O8BA 4B76A 1RIFA 1XD2B 4HAUA 3ZZUA 1PLLA 4TLBA 1CIPA 1X8KA 3WP1B 3K0AB 3MWYW 3CONA 2RGCA 4EQ6B 1G7SA 2OV2A 3PCRB 1SKYE 4U02A 3O8BA 3VR2A 1E2HA 221PA 3DDCA 4Q9IA 3KUDA 3EC2A 5CDFA 3AVQA 4C4PA 1BIFA 4CEJB 3CR7A 3GPLA 4MH0R 2VHTA 3U4QB 1E94E 2OESA 821PA 1U99A 1NIPA 1VMAA 3MFYA 4BLSA 1N5KA 2IYYA 1WBDA 2FPKA 1W1WA 5AJXA 4CW7A 4XIGS 2FNAA 3EIHA 4U7DA 4UNNA 5CB6A 1M7GA 4KYUA 1Z6TA 2EQBA 5BYKA 4H1UA 4RD4A 4RZXA 1LVGA 4GFDA 4G1UC 4QKQA 5G41A 2YJTD 4B33A 4LI0A 1RFLA 1IY0A 4LUCA 4MKHA 5EZ6B 3KKOA 2V55B 2DY1A 2ZI3A 3DVLA 2RGNA 1IAQA 4RD6A 2LCFA 1Z6YA 2C95A 2D74A 2GCNA 4AG6A 5FPKA 1Z22A 3LVQE 1YZTA 4WXRA 3K0EA 5GJVC 2YINC 3GJ5A 2J59A 1XEXB 2BCGY 2H92A 4XD7A 4B3FX 2I4IA 3J81k 1P75A 5EZ5A 4GDFA 3B1ZA 4G5SA 4B32A 4JLOA 3BB3A 3HU1A 4B74A 4YMSA 4JVLA 2MSEB 2PEZA 4Q4JB 4A36A 2DPXA 1A4RA 2NTYC 2IYQA 2BJVA 4IOMA 4B75A 3T5GA 1G3UA 1E1RA 1XCGB 2HF9A 4HDQB 5KSYA 1G8FA 1GIAA 3CWQA 1S1MA 2EWWA 2IWHA 2Q6TA 1JEDA 2F1IA 3CPJB 4B43A 4FMCF 2H57A 4HEJA 4A92A 1PUJA 5IRCD 1L4YA 5FTMA 4DDTA 5JRZA 2JJ8A 5DH9A 2AKAB 2NZ8A 1G8HA 1NBMA 1TNDA 3PIRA 4HYYA 2IA5A 3QXHA 2V8OA 3R9XA 4N1AA 4W7SA 2WKPA 3T61A 1IN7A 1Q1BA 2KBFA 1W46A 1Z28A 1W0JA 2WJVA 3H2YA 3THYA 1KK0A 2VO1A 1M34E 1OW3B 4PXAA 3FFAA 1ZM3A 3S1AA 1I4LD 5J4VA 2F1JA 1EWRA 1SVKA 3ASZA 4H1VA 5LD2C 1G5PA 3E70C 2ZU6A 3RLFA 2PZGA 2PX3A 1HT2E 1GUAA 1QHHA 3DO6A 4QGAA 3BD9A 1EFHA 2ODBA 3GD7A 1W2HA 3MJHA 3QUSA 3G82C 5CK5A 3T1TA 2ECKA 3BS4A 3P32A 3LO5A 4QGFA 1XEFA 3RHFA 3PUVA 5H70A 2ZJOA 3EZ6A 2RGGA 4PC1A 4W5JA 5AJWA 3R9WA 3UWOA 1OFTA 2ZJ2A 1XD2A 3C5CA 3I73A 3OIVA 4PPQA 5HR5A 2QMHA 3QXXA 2J0SA 3QXJA 2W2XA 4TSFA 1ETUA 1ESMA 1R0XA 4EQ6A 5GJWC 1FTNA 3IQXA 4P4SB 2YHSA 3OFND 2VRWA 1KK3A 3B7GA 3B2EA 1JPJA 1OSNA 2C2HA 3C41J 3NC1C 1E2IA 2JCSA 4CEJA 2F1RA 1X1RA 4HDOB 4TLEA 5J47A 3KQLA 3U4QA 4IDNA 2O0JA 3PVSA 4KO8A 3ZGXA 1TEXA 3SJBA 1WE2A 4BFTA 3KUCA 1UF9A 3V4FA 1RPZA 5DISB 3DM5A 1U9IA 4JL5A 4IKEA 3M1IA 1ZM4A 2XTMA 3GCGA 1T3LA 1OF1A 4PC6A 4OJQA 4Q21A 2Z4SA 2QM8A 1XBTA 1Z2AA 2C98A 1HURA 3AM1A 1UBEA 4RFVA 4ZO4A 2Z0MA 1ZD9A 1S3SA 1Y63A 2JJ1A 3AP1A 5BWMA 5DNYB 1ZUIA 3RSOA 1T4GA 2GA8A 4NL4H 1CR1A 1VIAA 3KJIA 1XEXA 121PA 4LHYA 3KQKA 1A7JA 1XB2A 2P65A 2E9SA 1UKEA 8OHMA 2G9NA 2RGEA 5J4HA 3LBHA 5E95A 5FTLA 2CXXA 3B60A 1NLZA 2FG5A 3CLVA 5EXXA 5FPYA 4Q4JA 2OG2A 5L3RA 1R6BX 2P5SA 2QZ4A 2ZSAA 4WZAE 4GOJA 3C5HA 1VKJA 4RD2A 2LKDA 2Q9BA 4ZI3A 1D8TA 1FP7A 4MRVA 1A5TA 5TV2A 4IHQA 2ZM5A 1ZNWA 4CT5A 2J7KA 4AK9A 2IHBA 5FBQB 5LD2B 1XZQA 2NZJA 1X3SA 2ZRCA 4HZUA 4B3XA 4GOKA 5IF9A 1M7HA 4QBGB 3HYTA 2HYIC 4LBWA 1F5NA 5FI0B 2UVQA 5C1BA 2AK3A 1E9AA 1DEKA 3X1ZA 2GZAA 2J87A 4HLDA 3RS2A 3W3ZB 3R8FA 2MSCB 1QHNA 4LV5B 3ONWA 4UXIA 1Z63A 4JLAA 1KOFA 2FJUA 1LW7A 5AWFC 5A0FA 1P6XA 2Z4RA 1VPLA 1ZIPA 2CLCX 3B85A 4ZPXA 1E2DA 1UADA 1S3GA 2CMKA 2JLWA 1JXMA 1GNQA 3ND9A 4PO1A 3AVXA 4PZYA 1V5WA 4E07A 3GLIA 1W44A 2ZRMA 2NG1A 2FGJA 2IEYA 2ZUBA 1QHIA 2ZRKA 4C30A 2XTNA 2CL0X 4M1KA 3FGNA 1D6JA 3QKTA 4WVFA 2ZE8A 4IXMA 1JJVA 4GNKA 3LDAA 2IL1A 4CEIB 1S0UA 3OEED 1P3JA 4V0KA 4BFXA 2OUKA 1T0JB 1GILA 1DS6A 1YKSA 1YR8A 2XNDD 2XOKA 4KVAA 3FHCB 1Z29A 4GP7A 3SBEA 3RRZA 2XJ9A 1XTJA 1RRGA 4LY6A 4RZ3A 1XWIA 4NYIR 3CWZA 3MRSA 2F6RA 3ASYA 2WIAA 4OQMA 3H4MA 1P61B 4LV8B 1IXZA 5EUMA 1DARA 2CHQA 4F38A 1ZU4A 2ZEJA 3MAAC 2IS6A 4DLWA 5J40A 1H8EA 4P4SA 1NY5A 1O3YA 1U81A 3DPUA 5AR1A 4DDVA 3TMKA 1RW4A 1NSFA 1E9SA 1II0A 4PPFA 1E0KA 1EFRD 2WPDD 2GILA 4KI0A 2O8EB 1OH7A 4NH0A 2JDIA 2IXFA 3V4RA 2J9RA 3CO5A 1G9XA 4C0AC 1HQCA 2PEYA 2W0MA 2BMFA 2V7QA 3GJXC 4PC2A 3B6EA 3TAUA 4UXJA 5JRJA 3DMDA 1F48A 2C5LA 4KSBA 4C9BA 4IOJA 1R5NA 3QQ5A 2QEQA 2QTHA 4DCNA 1KHTA 4MDFA 4DIDA 1E1QD 1PJRA 5BN4A 1FL9A 5HTKA 4A15A 3SOPA 4LJAA 3PUYA 2FSFA 2ZRGA 4G5GA 5CIWA 4EPYA 3CPHA 2ZETA 1L8QA 4JT4A 3EPKA 1CJKC 4QM6A 4AYXA 2ERXA 4Q01A 4CVNA 3QJYA 1EWQA 2A30A 1DG3A 1AS0A 3QNUA 4PFSA 1NLYA 3TQCA 4GRAA 5AJYA 1SGWA 4CDGA 2CVHA 1KIMA 1UKYA 3O47A 2TMKA 1YJ5A 1FZQA 4OK6A 3TQFA 2IWRA 3NHAA 4HLQB 2ZXUA 2GAAA 2HXYA 1U0HC 1R8SA 4XTRA 4BEBA 2XGJA 5KTYA 3KKNA 1Z6GA 3KKMA 3OAAD 2D3WA 1KDOA 3R9IA 3VKHA 1G16A 1ZCAA 5DN6A 2B92A 5LB4A 3KKQA 3I92A 5E7JA 2WWHA 1FMJA 3QEJA 1NN5A 4OHXA 4DHEA 5EUQB 1WBBA 5IK2A 3CUEF 1ZYUA 2C96A 1UBGA 1AN0A 3LQRA 3AH8A 4A0GA 1AJEA 3SYKA 3DL0A 3EWSA 3TJZA 3O8DA 3V00A 1A82A 2RAPA 3H0KA 2CE2X 3VR4A 3LLMA 1AGPA 3BH0A 5L3SB 4HAWA 1E69A 5FPSA 3MUFA 4B6EA 1KI4A 4TLDA 1XDBA 4Q00A 5KNDA 1RJ9B 1G21E 4R71A 3VHXA 4PZZA 2I1QA 4HSEA 1B0UA 4DT1B 2CLSA 4JBYA 4PSVA 4D81A 5EP3A 3O8CA 4MA4A 3FHOA 3P27A 4MUBA 5C4GB 1P4SA 2DB3A 4JLDA 1XPOA 2ZAMA 3LBIA 3WBKA 1E2KA 2JA1A 3L0IB 2GRJA 3K70C 1E2PA 4CEIA 4NCJA 3C4JA 3AVVA 3JVVA 4YQFA 1UDXA 3VKGA 1P73A 4GMDA 4UJ3A 1LY1A 4EIWA 5L8VA 3U7FB 1DE0A 3ADBA 4L9WA 2OFWA 1Z0JA 3KDSE 3W8NA 5EP1A 1FQKA 2BMJA 3RVBA 1XMVA 4LJ8A 4M21A 3IIMA 5AJVB 1JAHA 2GVDC 3WY9A 3PXGA 4GPTA 4TMTA 2WJYA 2CCJA 2GK7A 2Z43A 2F55A 1TF7A 3KJGA 1H8HD 2H7VA 2HDNB 3GMTA 2WWFA 3Q5EA 4L5BA 1KI3A 3V9PA 1KKMA 3B1WA 3C16C 1XD9A 4FD2A 3W6NA 4ZCIA 4KFRA 4A8JC 1IBRA 1G1MA 4FWTA 2Q21A 1E9BA 3LX8A 5DYGA 4EFLA 1QG2A 3IHLA 1Q1ZA 3ZYCA 4I1UA 1VTKA 3T1OA 1LV7A 1N0VC 2JLUA 3WYAA 2PH1A 3QF4B 2Q9CA 4D0LB 2ZI7A 2ZUDA 5AUQA 4D0GA 2HUPA 3NEYA 4YC7A 4HDCA 1EG7A 4BFYA 2H1LA 4BFWA 4B3DA 3EZFA 4LYAA 2P3SA 1YE8A 4URXR 3FFBA 5JFGA 5IHPA 1MO5A 2OCBA 2JAQA 1ZUHA 3K9LA 5KSPA 3PUWA 5DI3B 1G3IA 3UXMA 1WMSA 4IVQA 5CIQA 2FX3A 1VHTA 1RRFA 2HLDA 2WAXA 4EPRA 2PJRA 4OBEA 1FTSA 1TQDA 3GLGB 5FOWA 4G5OA 2X19A 4F7WA 2QROA 3KQHA 2DFNA 1OH8A 1M7BA 2FF7A 1HQYE 1TU4A 3MWLA 2W00A 3GEHA 3QXSA 5IDVA 2VEDA 1AZTA 4B47A 2FU5C 2G0TA 2NO9A 2ZE6A 2XEXA 4TMZA 4DIEA 5JWRA 2PLRA 3D7MA 4HATA 5JCZA 1Q1EA 4Y0AA 1Q22A 1QVAA 2PLFA 3REGA 4U00A 3K70B 1KI9A 2IYTA 3PEYA 2NOAA 2QA5A 2KE5A 3GFTA 1N6KA 4GBMA 2Z5FA 2G3YA 3VX4A 1J8YF 4PHHA 4DCSA 4CZ2A 5L3SA 5DI9A 5GJCA 1KI6B 1N0WA 3Q7PA 4LZZA 1CLUA 3WP0A 1RJ9A 3FKSD 4RVCA 2GF9A 1NMXA 1NJGA 2P0EA 3AF2A 3LW8A 1AA9A 1KMQA 1F60A 1QRAA 2ZUCA 1Z08A 3X1XA 4DT1A 1G6OA 4NDZA 4A8JB 3K0CC 1VYVA 3GJ7A 2BBWA 4HAZA 2HJGA 4B34A 1W36C 2XNSA 5FBVB 2RGAA 1JEEA 2FFAA 2BWJA 3IIJA 3OE7A 5JI3E 3SI7A 1N2CE 1KJYA 3BOSA 1M74A 2ZRBA 2V4ZA 2ZRHA 3EIQA 1TEVA 1XPUA 1C9KA 2IUUA
chains in the Genus database with same CATH superfamily
3FG9A 2NSYA 4OQDA 4QXQA 3EZ2A 5I47A 1E0DA 3OT4A 5IVDA 3MGCA 3CG4A 4U63A 4MWBA 1REQA 4EHAA 2YOGA 3DTVB 3QM1A 4EWLA 1XDWA 3LPCA 3NVAA 3O90A 5DU2A 4BFZA 4JVMA 1RTKA 4M89A 5DIZA 1W0KA 1UC4B 3PNSA 3MN1A 2J9XB 1JXAA 1UKBA 3TSZA 4KL8S 1YI0A 2ZBEA 2ZDQA 3JASB 1XI2A 1YHZA 1UBNA 3VSAA 5BR7A 4A2QA 4BMZA 1Q16A 4YJGA 1Z0DA 4EKDA 5HWSA 3KVRA 1KL7A 4WOCA 1AY0A 1XAHA 2XZOA 1SHZA 3GN1A 3JQQA 1JPNA 2HF8A 1LC3A 1TCUA 1UFKA 2ZANA 1DCMA 2IP1A 3JYLA 1I3OA 2C8KA 3FSEA 1PHPA 1WCIB 4OK5A 5CLGA 1JHMA 3FETA 5TY0A 2GPYA 1KVRA 4MI1A 1SURA 1EAMA 3EC7A 4W1PA 5ISMA 1KETA 1KI7A 4RTJA 1PNVA 3IPLA 1E4VA 4NPAA 1EHYA 2BOVA 3QNMA 4I1RA 1YBVA 1C7EA 3LFTA 4HTAA 1GT6A 3EMKA 1LTQA 1GUFA 1DUSA 4LWQA 1AS2A 3A4VA 3M4ZA 1OX6A 4WZBE 3X1WA 4EITA 1Q95A 2EWMA 2O8DB 3EHDA 4EJ6A 2BTQB 4IHKA 1X7YB 4BJHB 4UE6A 2D5BA 4BZPA 3I5XA 4MK4A 1ORIA 1VFNA 2GEJA 4FR0A 2VK8A 4R1SA 1PL7A 1M2OB 1VCOA 1WZCA 1XZJA 2IKQA 3GFQA 3Q3CA 3VKVA 4AWBA 3SQOA 3HO1A 2I3GA 3EBLA 2PGOA 5LMUB 1Q6ZA 4DSNA 3JWPA 1T0PA 4AT1A 4PAQA 5K8LA 4YNBA 1S2GA 3N1UA 1SVWA 3HACA 3I2HA 1T4CA 2ZS8A 3AY6A 2BE9A 1Y7TA 2OTCA 4R4JA 4IXWA 3SHTA 4H6XA 5TDHA 2RKBA 5JSZB 2JI9A 3BTSA 3PUHA 4FOSA 4KQHA 1KEPA 4UAJA 1SBNE 3IA7A 1RZ3A 1U8YA 4REQB 1TUGA 3EFEA 4KLCA 2HWXA 3P9KA 3VKUA 4F96A 5KJ1A 4EL5A 3NVDA 4RTSA 3F5SA 1V43A 4IDAA 2O8FB 4JZYA 2WT9A 3PVZA 3ZLTA 5CCBA 1UMCA 1HC7A 5KWIA 1FUEA 1C3EA 4WZBA 2HV8A 2H4WA 1Z36A 1PYOA 3PGKA 4W1QA 1OJLA 3AWIA 5BVGB 1JBQA 4WKNA 4AMZA 2H52A 4Z1OA 3OEHD 2YW2A 3VZDA 5AI8A 2AKEA 1Z15A 2P9FA 3DXZA 1ORRA 4UAUA 1T13A 2RCYA 3ML1A 3WRXC 3U3XA 4AMUA 2WQ7A 5FPPA 1QVZA 2ZE5A 3AEQA 3B9PA 1BHJA 3I23A 4MW7A 5AVTA 1KA9H 3IXMA 4E5SA 3ZWNA 4GECA 1LPBB 4LYYA 3QVGA 3ETLA 4HGPA 5CP8A 2BUBA 4RA9B 5D5HA 5I7VA 3WMRA 3QE0A 3HN7A 3RRYA 3TW4A 1TU3A 1V6CA 4KVGA 3SXUB 2CFRA 2Q46A 3A26A 4CHTA 3SC3A 3ICVA 4QGBA 2QRVB 2GPJA 2QTMA 4PHCA 3R5JA 2VP4A 3GJ6A 1A2OA 5CM2Z 3UWKA 3FPFA 3WLKX 3UJ7A 4AMGA 4X61A 2EWVA 1Z74A 4RMHA 3T9AA 1WWKA 4Z51A 1DAHA 4I19A 5T57A 2Q5QA 2JANA 1QTRA 4MS3A 5ES4B 1OT5A 5GVSA 1YQ9A 3HFJA 3E7WA 2C4NA 4WPGA 3M1LA 4Z8XA 1DQZA 1NJFA 4QU8A 2PUBA 2R751 2Y0DA 3F3SA 2BM9A 1RLJA 1CIJA 1S3IA 1BGXT 2F9FA 4IQFA 1LUAA 4P54A 4TRRA 1GY8A 5UKDA 3UYLA 2GEDA 1OB2A 4D46A 1FTQA 4KE7A 1V8BA 3OWHA 4N4AA 4PANA 1E98A 1YD7A 3Q8MA 1D2AA 5CUQA 4NBVA 3PDHA 3QMPA 3F7TA 3ITNA 3IQHX 1JKXA 3MT9A 1Z7EA 3FKQA 4V3CA 4B1FA 1LV8A 1SC3A 3NBAA 1TUBB 1M54A 1NN1A 4CUZA 1ZLXA 2O3QA 3SC4A 2BHRA 3BGDA 3OPMA 3DTVA 3DOUA 1EX7A 3D64A 3ONNA 4IRUB 1YQTA 3DR5A 1V96A 3M5CA 4DQ0A 4PZUA 3KX2A 5DHRA 4ZI7F 3PCXA 5ALKA 4BRUA 1D04A 2ZR8A 4PS0A 1JJAA 3AF3A 3JASA 4O2AF 4JEUA 3QG5A 4OY3A 1Z18A 4GI3A 4LSGA 3MB8A 1TC2A 3FVTA 1I14A 1A8UA 1G1AA 4IY1A 3WKAA 5K03A 3AUFA 1H5NA 4LK3A 3P9YA 2A58A 5U1PA 1F1JA 1N77A 3H75A 4FGKA 3FPLA 3TIFA 3UHAA 4J7CA 1NBOA 1R7RA 2H0QA 4BP8A 3H5LA 4KBFA 1XTUA 2ZSBA 1RABA 3IO5A 3WNBA 4YRNA 3AILA 1LTKA 2O2ZA 1KZ9A 4UNRA 4Y8VA 4BS9A 2X6RA 5JEEA 5JMOA 5E4FA 1G38A 1WVIA 3TAHA 3PRKE 4J43A 4RD1A 2Y4NA 4TGLA 4EZEA 3ND6A 2HW8A 5JJKA 3V2HA 3TWOA 2O8DA 3EF1A 2BTQA 1X7YA 5JI2E 2VDMB 2A0YA 2ZSKA 1PJQA 1OHHD 3IVXA 5ELXA 4KR6A 2GCPA 2C58A 4IJ6A 4NZOA 4B71A 3WRYC 4CIDA 1M2OA 3AM5A 5KYKA 3ROQA 1U8CB 3KQWA 5EQTA 2NYRA 2AF3C 4KE9A 1GZ5A 2W6ID 4TT3D 2ZKLA 5ESXA 3RF6A 2IRWA 3FMVA 4WV3A 3ZTWA 2A0XA 2J3QA 4GI5A 1JG3A 1I0ZA 4Y7DA 3SBDA 1W6UA 3T3IA 1JLRA 4M0CA 1QZ3A 1U8XX 2VNIA 2XMGA 3C87A 1AQUA 3HP1A 4AJEA 4M6WB 4QM7A 3UPDA 3WO1A 1RQ2A 4A5OA 1C7RA 1NF3A 1RWWA 1Z33A 1DU4A 1VXRA 3HKDA 3LT5A 4K03A 4UC0A 2J3DA 4URUR 3UOAB 4REQA 3WGMA 1CRLA 1XRPA 2WWTA 4UD6A 4M0FA 4Z7QB 1H2EA 1M34A 2ZB7A 3NNNA 2P3OA 5AHRA 5FF9A 4BLWA 4F21A 1R5BA 3KSRA 3MS4A 4LRTB 1QFXA 5JYEA 4GGMX 2JIRA 4JNCA 1YFKA 1KJQA 1NUQA 2PVCA 3ROKA 1L3CA 3L6CA 2OM2A 1K97A 2VDLB 3NM5A 4AN4A 5BMOA 3CMCO 5BVGA 2I2WA 2YYYA 4HNTA 2R8EA 4FZ3A 2ZYTX 4JHXA 1R50A 1CUWA 4WNCA 3IAUA 4N3NA 4JQSA 1L7VC 2ID9A 2JFQA 4Q7MB 3INNA 4HQ0A 2BEKA 3OMXA 4R1OA 4ZOLF 1AZWA 5HUJA 3K1YA 4OI0A 2OV8A 3DCJA 3ZJ4A 3G8CA 4P7BA 4H0NA 3IUNA 2QGNA 4RABA 2WWWA 4MVJI 1IXSB 4RA9A 3RHZA 1II8B 3JV7A 3PFHA 3TLYA 3QE9Y 5I7SA 2Z3WA 3V1NA 3SXUA 3WTBA 4BLPA 3TQRA 4IFIA 4XGNA 3RD5A 2Y1OA 4IGAA 2O0MA 2QRVA 1XX6A 2J7PA 4Q1DA 3D6TB 3KC2A 1O03A 2EW8A 2GLUA 4UVEA 4Q9LA 5TNXA 1E9FA 2WLTA 4AJ9A 1ZSYA 3JRWA 3QNWA 5AVOA 1OBVA 1DADA 4EHIA 5BWNA 3C3BA 3DKKA 4LX8A 1HDOA 1Q7BA 2CVOA 5AI6A 3TM5A 4G63A 3AFNA 1TCCA 4P32A 4EPTA 1UK6A 2G0NA 2QV0A 1CY6A 3AIMA 3EXEB 4KH0A 4Y2TA 1O57A 3DT8A 2EQAA 1AHHA 2FW9A 2P5YA 4IZHA 1SD1A 1VYTA 4B3JA 4KKVA 3U7HB 3P9CA 4J9UE 4GUAA 3SIWA 3PWSA 4GPEA 1OH5A 3DOFA 4WVLA 4P53A 4B7AA 2YX1A 2ACEA 2P2NA 2IYZA 5F7ZA 2C4WA 4LXIA 2X6TA 2QTBA 3E23A 3EZYA 4G9GA 4WIAA 1BVRA 1TUBA 3L7AA 1X87A 1TJYA 2ODNA 2O57A 4RM2A 3S81A 2W6PA 2QAGC 1JDBC 1LPNA 3DAOA 1XQWA 3IEXA 3KR9A 3LOPA 2FX2A 3Q4GA 5E6RB 3OCYA 3L93A 3ZK9A 1KFKB 2B1QA 2FPLA 3C97A 4PLHA 3UT5B 2FA9A 4YMTA 2IQ5A 4MLPA 5A1JA 4CGZA 1R8YA 4K8RB 4UQPA 1QYCA 2Q3DA 3P52A 4HGYA 1WUJS 2VH5R 4AD8A 2WG0A 3FCEA 3UT0A 2YV3A 2WKQA 2W98A 2ZYWX 3K8ZA 3PC7A 2TMDA 1ONNA 1LH0A 2A4MA 5BV2P 1N0UA 5IT9A 2ESRA 3W6PA 5IH7A 3RJZA 3AEYA 3WLHA 1XA3A 5LZ7A 4HS4A 2VJKA 3FTQA 1T8TA 1MNQA 3HFGA 4O4HB 4TRNA 3TLBA 5ITZB 3FNIA 1OXUA 4KN5A 2AE1A 3FMPB 3O21A 4L76A 1SKBA 1J22A 1D7OA 1E8MA 1VYUA 1YK0A 1E3QA 2R47A 1G18A 1YCHA 1BE6A 1RRKA 3JZFA 3I72A 3F73A 4ZCQA 2BCJQ 9MHTA 3NDJA 3FWHA 3R3SA 4F4FA 2GZDA 1S2LA 5JNWA 1WZEA 1QU3A 1UJBA 2PSJA 4UARA 2AJLI 2HNAA 2FZ4A 2FLKA 2PKRA 3L6DA 1M2WA 5F1OA 4BVKA 1GPJA 4GM0A 4ESHA 3M9XA 4OYYA 5CBPB 1OAAA 4EY6A 1IOWA 4OIMA 1E1NA 1FPQA 3MLAA 1KYIA 2B36A 4UBNA 1COWA 2Y6VA 3FDIA 2C77A 3Q7QA 1NU6A 1PIWA 1BMQA 3WRXA 4MKIA 4EPWA 4D25A 5K6AC 3ZXXA 2EHJA 3A2LA 3IO3A 3LLCA 4HB3A 1P0MA 3MQ4A 4F5EA 2Y9MB 3LUKA 4GQBA 3SHWA 1NP6A 5EVCA 4YA6A 4DR4B 1RWMA 1LBQA 4MVCA 1NMQA 3VNAA 1W4LA 2HQSA 3EBPA 5BV1A 3OZBA 4M6WA 4PW0A 3G68A 2AXPA 1H85A 2GZ1A 4FJ0A 5IWAB 4KPFC 4C0WA 1NJ1A 4UHDA 4Z1MD 3C74A 1ZP6A 5LZ4A 3OZVA 3QPUA 4MV4A 4KQMA 3FF1A 4CTMA 3SF8B 2XBMA 3B6KA 3D2CA 3ZLJA 2OBMA 3S2EA 2EBHX 3BZBA 3GZNA 4YXWD 2ZJ0A 1DOAA 5K3AA 3A6HA 4CTNA 4BKUA 1Z3IX 3MT0A 3L6EA 1G6HA 3S4YA 3I5YA 2KW5A 2H3HA 3TOVA 4BNXA 3OHMA 2V9CA 3ACDA 4G41A 3GVCA 1E1LA 5DT2A 4JENA 5FTKA 2QTRA 5K0NA 3EPHA 1U4SA 2XVZA 3C6QA 2V6JA 2OHVA 2AIRA 4FX2A 4BTVA 2QX7A 3KO8A 1T2VA 4JBLA 1KYQA 1Q50A 2WYIA 4Q4AB 4F8JA 2VYNA 2QUIA 2X9VA 1JIUA 2VVTA 3OG9A 5TVGA 1KOGA 1CUZA 3K8QA 4MMXB 1A2KC 1II8A 2BMDA 4CMKA 4N9WA 5C8VA 3G2JA 4N40A 3QBTA 1UPCA 4BB6A 2VDNB 4ZVMA 2QAGB 1JDBB 3I2KA 1YZHA 3L8CA 4L8GA 3O8OB 5TT0A 1B8OA 1IOVA 1PX0A 2AZTA 3EH2A 4P7KA 3I76A 4JLSA 2PMCA 4ZQBA 1WMFA 1P2SA 1SVOA 1HKHA 4GNRA 3RROA 2WTNA 1ZRMA 5JVDF 1BXGB 2P9QA 4BBPA 4B3RB 5IAGA 1T3GA 3RRMA 4IF6A 4OTZA 3EXEA 3ZK7A 3UJNA 1H5QA 4IO1A 2Q45A 4ZT7A 1GKYA 3B53X 2X76A 3S3TA 1QCCA 1IN1A 3G8BA 3Q5GA 3PT9A 1UDCA 4IQ4A 3QK7A 3RC8A 4N8EA 4KFTA 3LFHA 2XCSB 3LHFA 2EFYA 3EISA 2E37A 2HM7A 5IDQA 4XB1A 3VJRA 4UMDA 1L7BA 1J97A 1ZZGA 2NU8B 5FPQA 4XSHA 2QP4A 2HMSA 5B37A 2Z83A 1GNLA 4DILA 4QLAA 3WR5A 4XI9A 1VRWA 3E35A 1PLJA 2JHPA 2GHQA 1YS4A 2O20A 1P0QA 4M46A 2CSXA 3EIFA 1V4BA 1XCOA 2WTAA 2XXBA 1BNCA 2DETA 3FCUB 3F7NA 3WRYA 5ICGA 3UT5A 1CQPA 1SQ0A 3RVOA 3P7MA 2HU5A 2DJIA 5KEIA 3ZHYA 1Y7LA 3PA8A 1GRQA 4D8XA 3BIJA 4E3ZA 2O2DA 3LE8A 1KNQA 3GL9A 2FSGA 3GR6A 4MQUA 2EV9A 4CMAA 2EP5A 4IVRA 1KE2A 2QAJA 1PJ3A 1RC0A 3JZIA 2N3ZA 2QUBA 1BFKA 3RS9A 4RHXA 3IR5A 5DM0A 1JSXA 4XR4A 5C1DA 3C7TA 4CL2A 5ITZA 5JHHB 3UH1A 2NV0A 3HBJA 3HKEB 4CIYA 4GWGA 3RBZA 2XH8A 5DBGA 4AP9A 3VPCA 2RAVA 4JL6A 5EQDA 4ED9A 4F2PA 5FLXA 2EX4A 2NZXA 3GNSA 5KNLA 1R9GA 4YAIA 4LDAA 2GASA 2PSSA 2JAUA 1IVSA 3GAMA 2V65A 2R00C 3M0EA 1K4MA 3O4VA 3PHBE 4MW0A 4NP6A 2A86A 3T06B 1V1JA 1ZESA 4PWYA 3WSWA 3GPCA 2QTLA 1UMDB 4CKBB 4YCNA 5CBPA 5CCEA 2G6BA 1TMGE 2WJZB 1MH1A 5TMBA 3V8NA 4HDMB 2BKUA 2JK0A 1TTQB 4DSTA 4U2GA 3OO0A 4UW9A 2VK1A 3SQDA 3TPZA 3CUUA 5JYDA 1P17A 2Q2QA 3DCNA 4G8JA 5KBYA 2P6RA 1VOTA 1KRWA 2FXIA 5HF9A 4BN5A 2BEWB 1AN9A 3QHAA 4JP3A 2GJAA 3H9UA 3P0RA 2BV3A 3FCYA 4IFEA 1U2GC 3O2JA 1DKPA 1VP9A 4QREA 1NRWA 4H7IA 3GCWA 2ETVA 4WACA 3A3YA 3WLIA 4PCLA 4QPPA 1EVJA 3RPEA 2FDRA 2Z9DA 1Y5MA 4I3GA 5BOVA 1O08A 3H3XA 2YOHA 3R20A 4JBXA 13PKA 1I2MA 3SF8A 3OX2A 5FOXA 4B87A 4DR1B 3W2IA 2AF4C 1Z25A 2ZBQA 4J1NA 3PHJA 3RSLA 2ST1A 5JH7B 3VDRA 2X2FA 5JPIA 4BJ3A 4C07A 1G4AE 3Q3JB 2XUOA 5INTA 4JZKA 4TWRA 2Y1WA 1GA1A 2H54A 3AEKB 4OLFA 4XQ9A 5T4BA 5K3FB 3MAJA 2A5DA 4CF3A 3FOEC 3CZ5A 4H9GA 3IEVA 1QM5A 5HF5A 1NR7A 1TU0A 2Q2OA 3GRRA 2WVAA 3M7IA 3NGLA 4DMKA 5D1NA 3G0HA 3NEPX 3K35A 4HXYA 2KLHA 2A5YB 2VNJA 2BE7A 3E82A 1XHFA 1HL7A 2B0CA 3F90A 2JGJA 3KJEA 4LY3A 5A06A 1OI2A 3SJZA 1C7IA 4Q4AA 3CNHA 4WWHA 1BMDA 1IIBA 1UAGA 2VPZA 1IBMB 3E9YA 4R5HA 5DW0A 1TQ4A 5CEJA 3VR4H 1H2YA 2IF0A 5DBOA 3G7UA 4R9VA 1PW7A 3CU5A 4I1SA 5JO9A 2H4HA 2QAGA 3R5HA 2GFQA 4K2HA 1VGVA 3O8OA 5AXAA 4Q66C 5KNDH 1GTJ1 1KY4A 1VJ0A 2RH4A 3A4LA 3CJRA 1JDUA 3PC2A 5FLKA 3RAPR 2CLIB 4AKSA 2CEAA 5IEJA 3P2JA 2I6GA 3IMGA 1ZJYA 1J42A 1P9OA 1U7TA 1X0VA 2EZ9A 3O2NA 2D5AA 2YQZA 3GHYA 4ZQIA 1BXGA 1CERA 2Y66A 3KL2A 5AKZA 2PMEA 4B7XA 4DJAA 4X62B 1W9MA 3RS4A 8LDHA 2CLFB 3GFOA 1ZCJA 2JFYA 2LCIA 3MCUA 4H31A 1JQ3A 1PJZA 3P8ZA 4K5QA 2XTAA 3FAKA 4CHGA 1FNMA 1U94A 3A32A 1XJQA 5C0OE 3OCXA 5AM5A 1NF8A 1YL6A 3PI7A 1ZPDA 2GK4A 2PVPA 1UJ6A 3QEKA 3IUEA 2ZJFA 3V9AA 3H84A 4HNAB 4OM7A 1NW3A 4Q34A 3PQ6A 4BX9A 4LQDA 1C4XA 1P77A 1DRJA 2R25B 3GLVA 4MKGA 4Q9HA 2NU8A 2QLMA 3A6EA 2Z2IA 1C9JA 5H80A 2H85A 4IMRA 5AVRA 2AMVA 1NNLA 3S1SA 3OQBA 5EE0A 5H3CA 2FSHA 3DW1X 4LNAA 4NCHA 5D01A 3CE9A 5JQGB 2VP3A 2P0YA 4HGNA 5DMHA 1NZDA 2B1GA 4BMDA 2WQZA 4QDUA 3C6XA 5K6AA 4GLFA 2MR6A 1JAZA 4L0MA 1U3GA 1G7TA 5E4YA 4ZAYA 5BPHA 2ZQYA 1YI8A 2NAPA 2Q5OA 2VDUE 4MWEA 3FYSA 1IMOA 2OVFA 1IUNA 1ZJ6A 3CVJA 3JCZA 4J4BA 4A6PA 5DBFA 1GRVA 1UINA 1YBMA 4P81A 2A88A 3PGMA 2REOA 5A4FS 1LGYA 2JJ1D 4LNHA 1VRCA 1M5TA 3HKEA 3GDHA 4Y2PA 3DE7X 4BVHA 4MQMA 2RCNA 1J06A 1U0GA 3ZDRA 1KJWA 1ZNZA 1PKEA 4XUDA 2ECOA 2VN8A 1YJAA 1P9LA 2HY7A 3DMRA 1E2LA 4B79A 5AW3A 2J0QA 3KOMA 4Y1EA 3BL6A 4TKUB 1UMDA 1NWHA 2EFEB 4L5IA 4R8LA 1WKCA 1A96A 1E5LA 3UJPA 1Z4IA 2NZWA 5AXDA 5LMNB 4R83A 1GGJA 4HDMA 1GPDG 3FUXA 3KLBA 3WV4A 4YJ3F 1PFKA 5E9AA 1EIZA 4QLBA 1G8KA 1XTKA 4UVDA 4HUTA 1C81A 2HO4A 1SVLA 4AVYA 4CG0A 3ZY6A 1ZH8A 3AFMA 2JLAA 1QYIA 4O4LB 1EZ1A 2PU7A 5AD1A 1WPXA 5J2TF 3OCZA 4COOA 4JSTA 3REQB 4JI4B 2HBRA 5B4VA 3NWBA 5EIAA 2PUCA 4DR7B 3F3YA 1PTKA 2DQYA 3A6GA 3F98A 3TW0A 4AS3A 2QY6A 1XRJA 3WL8A 1DAGA 5TX7A 3ZBPA 4DLAA 3O9MA 3LAWA 5HOEA 5TARA 1HMPA 1TZKA 2PBRA 2GN8A 4FKBA 2BELA 3ZN2A 4FCCA 1UDBA 2HR1A 2EJCA 2H8KA 3A31A 4I4TF 3LG2A 3DDOA 2IVZA 3FLBA 5GAJA 4P35A 4K9LA 3AEKA 1P62B 1GWNA 5K3FA 1AH2A 1TTHA 2HMWA 1XA4A 1DFHA 3NBUA 3AF4A 4LVOA 5HQTA 3LWNA 3WB9A 4Y6OA 3T0IA 5I3ZA 4D9FA 4KR2A 1H1DA 4MVJG 4ACAA 3EZGA 3VPBA 3RT7A 5CMLA 4LBVA 1V25A 4GPAA 1ZCBA 2HDWA 1J99A 2NX2A 2INGX 3OESA 1UZUA 4GH5A 3PF8A 4KGXA 5BR4A 1MH9A 1FIUA 3OPYB 3S8EA 3L4SO 5IWCA 3CW2A 1S7CA 5ALWA 1N3YA 1DCFA 3KYCB 3ROPA 3FRIA 3N6VA 4UNSA 1VHQA 2AEJA 3DL2A 2GO1A 4JB3A 2HU8A 4F85A 2ZUFA 3FM9A 3FXAA 2B4QA 4B3HA 3IP7A 2YL2A 3R5TA 4Q93A 4XCQA 5AKIA 5DEOA 2I2DA 2QP9X 2OC4A 4LDRA 5A3VA 3WL6A 1FLNA 3D3QA 5CRIA 2G1KA 3U3OA 1SIOA 4X8OA 3U5TA 4JL8A 1OQAA 5D6NA 3L1HA 3RQIA 6LDHA 1E1QA 2C8VA 1VQ1A 2Q5EA 1JF8A 1U8EA 4I8IA 5ESRA 3LOQA 4BO2A 1YIOA 3ND7A 3WFIA 3A9TA 1O9BA 2KQUA 1V8DA 4AQDA 2Q8QA 4DKXA 3FYCA 1BHQ1 3N0XA 1BHSA 2ZIVB 4RPJA 4ME6A 1YRQA 2JKYA 4ZYVA 1CQJB 3ACBA 2XCTB 4LF6B 2DWCA 5DFAA 3IGFA 1N33B 4JC8A 1QF6A 3PVCA 3CZQA 4OMCA 1O54A 4HNAA 4R16A 2WY2D 1ZVKA 3RTGA 4J90A 1LPSA 1M67A 2QY9A 4LXUA 2OCIA 3NB0A 2R00A 2HCFA 1Z88A 4F92B 3L7NA 2ODTX 3H7AA 1U2SA 4K26A 3KQMA 4MPJA 4WLVA 2V7QD 2WTMA 2UZ0A 2CSUA 2VJBA 5ALSA 4MKFA 1BSVA 1M9NA 4U4AA 4C88A 5GADl 4D6PA 4KR0A 4FDAA 1MJ5A 1DAKA 2PR7A 5CT6A 4LTMA 3DT9A 4ZKEA 4BP9A 5JQGA 1QGYA 1QRSA 3N9IA 2HZBA 3ELDA 2E4UA 1LI5A 3I5UA 2QX4A 2IV7A 4BX2A 3EGWA 4KIWA 3D8RA 4UDYX 3O1IC 4AJ1A 3BXHA 4ICIA 2IYOA 4GWKA 4DV2B 3BUSA 5THQA 1ESNA 1SWVA 1PGNA 2O52A 2R7KA 1GUYA 2XWQA 5JY6A 1RAAA 2J3KA 1U2GA 1A3CA 2HYDA 3KHUA 3PSAA 2GARA 5DTMA 2YCLA 4CIAA 2RB5A 5HHTA 4YUWA 4HQOA 4MV5A 3A36A 5FOSA 1H93A 1O4VA 4B9EA 4Z4FA 2B3TA 3IQFA 3P45A 1ARZA 3D2AA 1VXOA 1SXGA 3QEOA 3TX6A 5GJBA 1FDRA 3QUAA 3LO8A 3VR0A 1Q6YA 4LF7B 1QK3A 2DGDA 4W5HA 3CH4B 4B7CA 5CFQA 1A2QA 3BD6A 4M9SA 2RKOA 1PUIA 1C8LA 1XTQA 3ETDA 4WW0A 4TKUA 3PJRA 1Z4NA 2A1UB 2VSFA 3NTLA 3GCXA 4D4MA 4D74A 3HBLA 2VQEB 1N1MA 4EUNA 4L95C 1CP3A 3UMFA 3NV9A 5IHXA 1Q0ZA 3ZI0A 3U6BA 4UJ5A 1GQRA 1QUEA 3QX7A 1T35A 3PDCA 3UAOA 4IIBA 4OKNA 3ORFA 4O4LA 1JQBA 2PXXA 1R64A 2DUJA 5KSOA 1Z0ZA 3H1AA 2R4TA 3DZKA 3REQA 5IK2D 1EFVB 2DOKA 3IB3A 1I6MA 4MI9A 4BNMA 4JR2A 3VGPA 3FY4A 2Z5LA 4WLOA 5EGSA 4CKCB 4P93A 4PLYA 3H8SA 1NDUA 2HLNA 5BV0A 2Q6IA 4NHOA 1QK5A 1B3RA 3UBMA 3UJDA 2C4VA 2TRSB 1GAXA 1TOAA 3EVDA 2EKDA 1YU9A 2FE4A 2R1ZA 3OFSA 4JHLA 4JR1A 5IJAA 2UUAB 3EMVA 3NUQA 5HBGA 4O1IA 4QBHA 4BX8A 2GBGA 3E53A 3LKDA 2VZ9A 3IC5A 3GUCA 1PG5A 3ICPA 1MQAA 2J31A 2HA2A 2CCGA 1EGQA 3HWX1 3O9ZA 4HPWA 3T7IA 3HJTA 1TKBA 4HZUB 1T1EA 1Z62A 1LQUA 1QXSA 1SQSA 4L4ZA 4FN5A 4J0IA 3ZCSA 1OH6A 3TLEA 1E2BA 1O95D 3SHVA 1MGOA 3FBTA 2GTPA 1UPAA 4B5KA 5CVCA 4BC0A 2IS1A 1YQWA 4ENPA 4DUPA 2C3OA 2AS0A 2C9YA 2D4HA 2Z4TA 5E4TA 3SDBA 5KI6A 1DXOA 1PR5A 1EP1B 3EG5A 3H9CA 1HE2A 3OPYA 4FFBB 5HM8A 2IKSA 2ZR7A 1C0IA 4UFPA 5C8ZA 5FPTA 4TTRA 1KPHA 1DPGA 1DP4A 3OC6A 3H5RA 3AVYA 4CJXA 2HWYA 3M5WA 1UZMA 1BYUA 2R6ZA 4IIHA 4LJ7A 1DKNA 2ONKA 3ESQA 4M4SA 4ZC8A 5IJZA 2I87A 4E70A 2X4IA 3FRJA 3MMPA 1RAHA 1IWOA 1Q5PA 1KO5A 3CNOA 4QG7A 1B26A 4Q9JA 5EWMB 3RS0A 1OIWA 2GNAA 2VXBA 4A0SA 5AVZA 5KJFA 1KWGA 1KSGA 1W96A 2JCGA 5JATA 5JXHA 4MWDA 1ZUWA 3Q6NA 3WL7A 4JOCA 4LE0A 4NATA 2J1LA 3WA7A 2VAWA 3DHWC 3HVJA 3L0BA 2ZYIA 1KQGA 5ERGB 5LQNA 4M1TA 5L3QA 1V11B 4WZ6A 3INRA 4M36A 1CQJA 4HMQA 2OOSA 4QEDA 1NI4B 1YRAA 4A91A 1CUCA 2K2QB 2BR3A 3GXOA 5FAXA 1OIVA 2RHLA 1GPMA 2OY0A 3B8HA 1VGRA 3I1IA 3IALA 3P2MA 4HRYA 3NYWA 3EASA 3FRHA 1WDWB 5KC8A 4PTLA 5B7NA 2G08A 4H59A 5BO5A 2QVLA 3FN4A 3WIUA 2X4LA 4A0RA 3L0OA 2AEEA 3D5EA 1BS9A 1ZA2A 3JRXA 4ZVTA 4ZO6A 1XDUA 3WMWA 1A9XB 1CEYA 4ARVA 3GBSA 3VH2A 2OKCA 2D8AA 1F3OA 3W2TA 4B5LA 4RK7A 5HA5A 4KAAA 5HFJA 2HOQA 1N5JA 2ORED 2Y8EA 1X6VA 2A4KA 3OZDA 1XF9A 2BC9A 3LPDA 5A6SB 4U7JA 5BQXA 6GPBA 2GERA 3F5DA 5BV8A 5DGDA 1RXIA 4EHLA 1N9GB 2CY0A 1KARA 1VIYA 3Q40A 1JRLA 5AO9A 2P3LA 4UU1A 4OKIA 5FQOA 3SHQA 5EZQA 4YB8A 1KK1A 4WECA 3I01A 3S2UA 4ABYA 1GAJA 2EW1A 1L9KA 1FDWA 2FFHA 2WKSA 1JZTA 2X9QA 3LCUA 4LZNA 3SZLA 2P9CA 5C7LO 5K0SA 4R81A 4R2IA 4BQPA 4EY5A 3IEUA 3D7LA 1PSZA 4PAGA 1P4JA 4CFZA 2FF5A 3H6KA 5MDHA 3WLSA 5KOHB 4NJOA 2G63A 2BLNA 2ZXEA 4EDHA 2A1UA 4LA4A 3RVNA 1CVIA 3X2SA 2IV2X 4OXIA 3ADCA 3RS5A 4WLFA 1L7RA 3PEFA 2J9FB 1IZZA 4ZCMA 5J4YA 5KPDA 2O0HA 3RRNA 3FSGD 2PH7A 1WCV1 1UZNA 2JS7A 3N8HA 3R8XA 3EJ6A 1MQSA 1R0SA 1XTIA 3JZMA 3FZNA 4LRWA 4Z54A 4NBKA 3TLGA 4BAGA 4K7JA 3SSMA 2NQ8A 2D7CA 4B31A 3KOUA 2BIFA 4MYRA 2AQIA 2P5TB 4O29A 4UHJA 1VMKA 2DVMA 5TE9A 2G8NA 4CKCA 1TO6A 4X54A 3A2NA 1SUSA 2A33A 1ZISA 5HZGA 5L53A 5JMPA 4DSZA 2QUKA 5B4UA 5DBHX 4KFUA 2I7CA 1AUQA 1TJ3A 3E3AA 3FOZA 4Q4DA 3E4CA 2CFIA 5FHQA 4LYJA 1AKUA 1S2NA 4N3GA 3SGLA 2DWQA 4OEHA 3TQIA 3AY0A 4F60A 2AJBA 1HH4A 3CW8X 1DAEA 4Q05A 2YXPX 1LNSA 1AKYA 3HYLA 1NGSA 3EGVA 1EWTA 2Q7DA 1FMTA 4TV8B 4BX3A 5AVWA 3UB3A 3C4VA 4TZ0A 2CHVA 3CH7A 2DKNA 3SY8A 4AUNA 2VI5A 4DUGA 2WOOA 2N47A 4IJVA 4R0MA 4R6WA 4C3OB 4EUHA 2VPIA 4FFBA 1NE7A 5DP2A 5K3DA 1TMYA 3EUWA 1K0UA 4B80A 1NUHA 3V1UA 5JCPA 1VSUA 1IONA 1PE0A 4HI0E 2ZBFA 1MF7A 2AEFA 3P2KA 4JEIA 2PRKA 2QE7A 3Q5DA 3K6RA 2D7JA 2QYHA 1P1RA 2G5CA 1UXJA 1B14A 3V55A 4EOGA 1Q15A 1E8NA 2YJ3A 3NHRA 3OQ6A 5EWMA 3AP2A 1QGUB 4L51A 1NXVA 2MT9A 4W5OA 4HNHA 1YQQA 1FNBA 5GWXA 4M53A 1FDUA 3JALB 3IAS6 3K8YA 4ZMRA 4OXKA 1VLQA 1Y5IA 3QPWA 4J0GA 1PT9A 4WL0A 1W5BA 3WGYA 4ZVSA 4QGHA 1DV2A 2IY7A 3B3JA 4FJ2A 4OG2A 4QE3A 4BBZA 2Q0QA 2QXUA 1NNI1 3CRRA 1V11A 3I9V6 3OZRA 2ZJ5A 4R2MA 4D3FA 1K9SA 4DB4A 1NT2A 3JQCA 3R7AA 3BBLA 3BFXA 4AP6A 1NI4A 3AZPA 3G79A 1MQ8B 3U62A 1NF9A 3D4BA 3LC0A 4WDQA 4D5EA 1U2RA 3ECSA 1U28C 4Z9YA 4CKWB 3KSDO 3OY7A 1D1QA 2FQXA 3AIOA 2B5VA 1J1IA 1W5SA 2VFAA 2C2MA 4I3FA 1RXSA 1U8ZA 4KU4A 4RELA 5IUJC 5JBIA 3O7MA 1N2XA 4D9EA 1FMLA 1Z2NX 2C97A 2WZBA 5JFOA 3DAPA 2NP6A 3O84A 4JBHA 1XKTA 4KXYA 4IMJB 1T6NA 1FP6A 5FWYB 3GT7A 3O4RA 4GOND 4PYMA 4YCCA 2O8CB 1V26A 1WB6A 2IF2A 3G17A 4GRIA 1T10A 3TVYA 4L22A 2B3DA 1SZPA 2Q3BA 1E6WA 2R4QA 3RC7A 1L4KA 4F6CA 1LDEA 1PZHA 1ZDMA 5DTRA 3AWDA 5FLYA 3DBVO 3KEMA 1RI1A 1OIXA 3QVXA 4RTRA 3MB5A 5A6SA 1XXLA 3RABA 1ZGGA 3BMOB 3DNFA 3I4CA 2CLLB 2Q3HA 3IRUA 3KTAB 4J0QA 1N9GA 1BRTA 3DULA 3W7AA 5K8CA 4KKXB 4BE7B 3HPQA 1NFQA 2NP7A 4NLLA 2IIQA 3DEKA 2E0IA 1SD5A 1J90A 1DUIA 1DINA 4QRHA 3SAJA 2JK1A 4C5BA 4DA4A 3O92A 4YJHB 3T54A 2OZEA 4EUFA 3MJRA 5DSTA 1J39A 3AYZB 4F6RB 3QWAA 3HI4A 5KOHA 3DVAB 4G0VA 5FBRB 1LBTA 4KXNA 3ME5A 5CLQA 2IDJA 3N86A 1H42A 3CH6A 3BKWA 2D7DA 2J9FA 1UT8A 3VTFA 4N7RA 1O7JA 5B3LA 5IX8A 1MG5A 3L07A 4QUBA 4TQUS 5F3DA 3ZWPA 3TIXB 2H16A 2XCLA 3HXTA 4Q4LA 2DR0A 4ZI2A 2PN1A 1AC5A 1X14A 2WD9A 4D9KA 3T1NA 5BW4A 1FP4B 4ZVPA 2II6A 3K70D 2WYHA 5FV4A 2FWJA 3LZCA 4JS0A 5DASA 1DAIA 3HJGA 1X39A 5E9WA 4BPRA 3Q9SA 4O2BF 2IH5A 5C53B 4PLCA 3ZDEA 3WE7A 2DQZA 4GX2A 1N6IA 2F67A 4NMLA 1OGJA 1PFUA 1ZI9A 4QNMA 5F5NA 5JDIC 4W5TA 3TTVA 3NM4A 4UUBA 1HO3A 2VL7A 3TPCA 1EB9A 5C3MA 4R0VA 3BFJA 2WJIA 4K0KB 3ZHOA 5DX0A 4S1OA 4IIGA 4N82A 4KNVA 3UY4A 5F78A 2Y71A 4RV5A 4E22A 3H19A 3UFXB 3LQ1A 3VA7A 1U7ZA 3ZVLA 4MQ5A 5KHOC 4LY6A 5GOZA 4WASA 4KZKA 4LHSA 4TV8A 4BWFB 4V03A 3P97A 1DRUA 1T3HA 2FPWA 4E46A 3GU3A 3SR0A 2W83A 1AKTA 1SUEA 3VZRA 2KS6A 5BT9A 1CUFA 2XNKA 3QOFA 4L07A 1OMOA 3KNZA 2J46A 1SH7A 1KAGA 1VPVA 3FZYA 3SSAA 4UNPA 2R8RA 4RGVA 4Q4CA 1GXSB 2P4EA 4F2HA 2VAVA 2CKMA 4M1SA 4BJ1A 3DONA 3EDRA 1S4MA 2VWPA 4K2AA 4NYMR 3MD0A 2PD3A 3ZE0B 4EW3A 1NPDA 1N2IA