1RZ3A

Structure of a possible uridine kinase from bacillus stearothermophilus
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
198
structure length
184
Chain Sequence
MELRDRIDFLCKTILAIKTAGRLVLGIDGLSRSGKTTLANQLSQTLREQGISVCVFHMDDHIVERAKRYHTGNEEWFEYYYLQWDVEWLTHQLFRQLKASHQLTLPFYDHETDTHSKRTVYLSDSDMIMIEGVFLQRKEWRPFFDFVVYLDCPNIQKFINRYWKAEDYYLETEEPIKRADVVFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein RBSTP0775
publication title Structure of hypothetical protein RBSTP0775 from Bacillus stearothermophilus
rcsb
source organism Geobacillus stearothermophilus
molecule tags Structural genomics, unknown function
total genus 60
structure length 184
sequence length 198
ec nomenclature
pdb deposition date 2003-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00485 PRK Phosphoribulokinase / Uridine kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1rz3A00
4QRHA 1K5GA 3TVDA 4C2TA 1CKEA 1WCV1 1GZSA 4EFNA 3IDQA 4G5QA 1Z2AA 3C41J 2AWOA 1KNXA 2BEKA 4BECA 3BOSA 4GMXA 3UMSA 2C9OA 5EQTA 4CEHB 4BLSA 1U9IA 2ZRNA 4NCKA 3TR5A 5JSZA 1GSIA 3IEUA 2OXRA 2V4ZA 3LBNA 1G3RA 2CBZA 2WWWA 2ZRCA 3CH4B 3MJHA 2XEXA 2AX4A 1KOFA 5JI3E 1QRAA 5KTYA 4IOJA 2WJHA 4AWXA 4QC2A 2ERYA 3RRZA 1ZCAA 3KB1A 3AGPA 4G01B 4NMMA 2R44A 1TMKA 1HT2E 2VP9A 2ZR0A 4NHOA 4GOKA 4B44A 3TE6A 1DAMA 2BBSA 1KSGA 1G3IA 4Q4JA 3U7FB 3JZAA 5F3WB 3RDPA 4A0HA 5C2JB 2O8EB 4B2PA 4KVGA 1E4VA 4TN1A 5JRJA 1DAGA 1OF1A 1R0XA 2A9KA 1E4YA 1UPTA 3ND8A 4QG7A 1E0SA 4Q9HA 1XWIA 1FW6A 4NKRA 3BB3A 3AVUA 1YZQA 3QKSA 3KQKA 3SE0A 5CJPA 5JWHA 3J81k 2FFAA 2WJJA 4B43A 4LC0A 1EFCA 2IEYA 3QF4B 2AL7A 1J99A 1E0KA 2EFGA 5B30A 3K0AA 1ZD8A 3TGPA 4I99A 4PR0A 1W2HA 3B6EA 1N5JA 3DOFA 1G8PA 2QSYA 2GILA 3CUEF 3A6PC 4M9ZA 2WKPA 1AS2A 2VF7A 2CJWA 1W5TA 1XX6A 2PJZA 1XEXB 3CLVA 4RCYA 4TYNA 1AGPA 2DYKA 4TMTA 4ZDWA 1KIMA 2NTYC 2PJRA 2ZU6A 5GJBA 3L0SA 1T5IA 1DVRA 1E1QD 2WIBA 2GDJA 3TR0A 4M1SA 3RAPR 5FOVA 2PBRA 1GIAA 2EFHB 1A2BA 1E2GA 1Z28A 2H92A 4H1VA 4TLBA 1WA5A 5F98A 2Z83A 2QP9X 1OFUX 1T8TA 3B1VA 3EZ7A 3TSWA 1XTSA 1ZIPA 2W00A 4IW3B 2B8WA 2FA9A 1N0WA 3B1XA 2CE2X 3QXSA 2QNRA 3AVQA 4PPNA 4DUGD 4A8JB 2KWIA 3AF2A 1LV7A 3QPUA 4IKEA 4ACAA 3TK1A 4K81B 2IS2A 4CDGA 4XD7A 5G3YA 1GM5A 3CB4A 4R98A 2XB2A 3BH7A 1YU9A 1GKUB 3PUVA 4Q02A 5CIWA 2A5GA 2WOOA 1OLOA 4WZ6A 4TTRA 1GILA 1RJ9A 1QHSA 2N42A 2YWFA 1W4CA 2QGZA 3QQ5A 1E9FA 1PUJA 4V03A 1KO1A 2QZ4A 3PUYA 5J4VA 5BQ5A 2JLYA 2C03A 4IOKA 5FR1A 2XNSA 3DKPA 1OH8A 1D9ZA 1NJFA 2F6RA 5FUXA 4QHTA 4PC7A 3F8TA 2HYDA 3DMNA 4HB2A 4CEJB 1YR7A 4G5OA 2ATXA 3QY0A 4OK6A 1ZNZA 1H8ED 2E9SA 3ZQ6A 2XSZA 1IAQA 2BMFA 1EGAA 1C4OA 2OFOA 4YMSA 3PJRA 3BH0A 4OHVA 3VFDA 4ZI2A 4E5UA 4A2PA 3E70C 4BZXA 4LJ4A 4A82A 4D0NA 5AJZA 3K0EA 3C15C 1KY2A 1TEXA 2H17A 2Q21A 2CVHA 5FFMA 4BQSA 3BS4A 4PSVA 2JJ2A 4Q19A 4PHGA 2X2EA 1E9RA 3GJ5A 1U99A 1P61B 1WB9A 4IXMA 3L0IB 4Q7MB 1G41A 2PLRA 3EX7C 2ODWA 3DMDA 2CNWD 3FFAA 2HJVA 1KYIA 4ZV4A 4GZMA 1X6VA 1HQCA 3I61A 2CL7X 3MSXA 2DBYA 2EFCB 5EP1A 2VHQA 4CIDA 3THXA 1LY1A 2PL3A 5DN6A 4HAYA 3WYAA 5G53C 2Q3HA 4BZPA 5JBQA 3ZVNA 1JBKA 1OKKA 1UKYA 2QA5A 2QP3A 4JVSB 2OUKA 3REFA 3GLIA 1TNDA 3K09A 3T1VA 2IX3A 1XEWX 3OAAD 1WBBA 4DDVA 3U3KA 3QG1A 4Q7JB 3QKTA 4RVCA 5J5CA 4US1R 1Z08A 1W0KA 4HAVA 4HUQA 4KI0A 1KO5A 1L7VC 3UANA 2ZE8A 5C4GB 4Q1AA 3LXRA 1QBKC 2XGJA 1N6IA 4HB0A 4LOAA 1AA9A 4KYUA 2AN9A 3DVLA 2ZSBA 1S9HA 4NU0A 3KDSE 4EQ6A 2GCNA 3W3AA 1VHLA 4ZCMA 4OYHA 3T1TA 2O0HA 5B57C 5CB8A 4L5BA 4TSFA 4GI7A 1WF3A 1XF9A 4TL8A 1FUKA 2HV8A 4YDHB 1CULC 4P4UA 1LVGA 2XOKD 2YWHA 1VCIA 2GEVA 4DBLC 2HCBA 3V9PA 1RPZA 4JLDA 1FNMA 1KZGB 2A5YB 1E2HA 3OF5A 3KFXA 2Q9CA 1BMFD 2F7SA 1P2TA 1H65A 1RKBA 1E2FA 4I4LA 4QBHA 4CT4B 3U44B 4NCHA 2BDTA 1P9WA 2J5XA 1KK3A 3WRYC 3LQRA 2KBFA 1UADA 1PLKA 4IJMA 4NZYA 4GOXA 5FBLB 2ZRLA 1J7KA 4TZ6A 2QY9A 121PA 3D7MA 1N6HA 4DEXA 3IKJA 2X1VA 3VU9A 1NNEA 5FUVA 2F1IA 3K53A 4QBFA 3I62A 2NOAA 3WNBA 4DLSA 5SZJA 4R9UC 4Q47A 1NP6A 3QXXA 5HZKA 1CR1A 5CYOA 2AK3A 3OEHA 3IBGA 1IY0A 4PHTA 3C4JA 2VBCA 1IM2A 2CHQA 1TX4B 1D6JA 2FF7A 3D8BA 2J0SA 2ODNA 4BGDA 3K0SA 3GCGA 3FMOB 5L3SA 4JVNA 2F43A 5JS7A 1GNPA 2JJ1A 1PVOA 5FOWA 5JI2E 4CEIB 1OXVA 1G19A 4NYIQ 4BFSA 1IONA 2NO1A 1HY3A 3QF4A 4Q18A 3FB4A 4HLUA 2HT1A 2DPXA 3EZFA 4KSCA 4R2HA 3W6PA 4DLYA 4NCNA 5H8WA 1VIYA 3KKOA 4JLJA 2W0SA 5D3MA 2BBWA 1F3OA 1X8LA 4JYCA 4WXRA 1R7RA 2QORA 4Z8XA 1JNYA 2V7QD 2G83A 1EX6A 2NMVA 3SZRA 3Q7PA 1UBCA 1JPJA 1QHHB 1G9XA 2H8KA 2O8BB 4OHYA 3CWZA 2VO1A 3I8SA 4DT1B 1FPMA 1ZUIA 4CT5A 3SQWA 1GTVA 1LS1A 3RS2A 1DG3A 4TMKA 4ARZB 3B1YA 4JLKA 2PMDA 4PAMA 4D81A 4LRWA 1GL6A 2ZTSA 5F9FA 5DH9A 2A30A 3W8RA 3KQHA 1P9RA 2O0KA 2RKOA 3OE7D 3K8YA 4Y0VA 3DOEA 4A8JA 5JZVA 3LNCA 4DIDA 2ZJAA 3CX8A 2IYQA 3UKDA 3NC0C 3RS4A 2ZVPX 2NZJA 2QTHA 5EZ6B 3AH8A 5B58C 1C9KA 4LY6A 2PX0A 1NLZA 1WP9A 4URZR 3S1AB 2ZSEA 1NN5A 2GA8A 2WMOB 2VIIA 4Q1DA 4W5HA 1Q0UA 4U7DA 2QTFA 4PQFA 1CR0A 3HU3A 2WVJA 3LD9A 4JMPA 2OM2A 5CLQA 4C0QC 3VAAA 2O8DB 3CH5A 4MDFA 1PJRA 1QHNA 3SYLA 2RB4A 2VYFA 5GJVC 5C46F 3EZ2A 4M22A 1NMYA 1AZTA 2J3EA 1CEEA 4FMBB 2BMDA 4M2LA 4HAZA 3MD0A 3UXMA 3QIAA 4MITA 1II9A 3DKVA 3H1TA 4Q66C 2I4IA 4W5WA 1S3SA 1T0HB 4TMWA 2JCSA 3W5IA 3NDPA 3PENA 4CGZA 2ZYUX 1T4GA 4KAXA 5KPDA 3FGNA 2Z4SA 4WW0A 1M34E 1J2JA 3AVTA 1KJZA 1G64A 2BM0A 1DG1G 5J4YA 2F1JA 3E1SA 4KBFA 2IF0A 3EC2A 5EXTA 2F1RA 2ZJYA 5JFGA 4B75A 3NH6A 1WMSA 2W6JD 1FOEB 3GLHA 1J70A 5JJIA 4A9AA 4KJZA 4G5SA 2E87A 4WBSA 1U0HC 2QPOA 2VP6A 4BEBA 4ERNA 4DDUA 2CLSA 2XZPA 1AIPA 4JLPA 4E22A 2SHKA 4FMCF 1JR6A 1P3JA 1PLLA 2QUZA 5CDFE 1A1VA 1HT1E 1T0JB 1JXMA 1WRBA 3B1ZA 3FMPB 3PITA 3QBVA 4IEIA 4JKIA 2ZYWX 4CYMA 3AVWA 3P1JA 1N6OA 2JLQA 4MYCA 2RH5A 4Z54A 4ZIRB 3H4MA 3KQUA 1CRPA 2WWFA 1KZ7B 1ZNWA 3LW8A 5JRZA 4B47A 4RD3A 3SJCA 3BD9A 4TWZA 3GJ8A 4A92A 1ANKA 3GJ0A 3TBKA 4WZBE 1ZD1A 1BYUA 3HJNA 3KZ1E 4YMUA 4C2UA 4QJ4A 2AXPA 3AM1A 4LHXA 1UDWA 2VP5A 4I1SA 2EYUA 4Q9KA 3TH5A 2RGGA 4AK9A 3AVPA 2ZRKA 4Q4HB 4B74A 2VSXA 1RRGA 2VL7A 3U5ZB 2AD1A 3AV0B 3O8CA 1Z6XA 5FPYA 3A4MA 3FHTA 2EWVA 1DELA 3SC3A 4EFLA 2JLVA 2XSZD 2WHXA 2ZYVX 4F7WA 4RD2A 2GHIA 4EPXA 1B23P 4XWAA 3EWAA 2PZFA 4Z1MD 1E1QA 2GJSA 2ZE5A 2OESA 3DZ8A 3MMPA 4GT1A 1DO0A 1U98A 2QU8A 3UPUA 2XTNA 4ZI3A 1OJLA 1Q12A 4O3MA 1G7CA 4RCZA 1QHIA 3C5HA 1OIXA 2BHRA 2JJ2D 3QENA 2VSFA 3WP1B 4OKSA 1DAFA 3EIQA 3NBXX 4OQXA 1R0WA 2P5TB 1L4UA 5FTNA 2FU5C 1W48A 1NN0A 1NLYA 4DUGA 4NCJA 5AR1A 4A1FA 5JMTA 4U02A 4G5GA 3BXZA 3K9LA 2GF9A 1CJVC 3BFKA 3RSLA 5FBWB 6Q21A 2FZLA 4Q01A 2BBOA 1U2RA 2XNDD 5K8LA 1ZC4A 1XD2A 3L43A 4MKIA 3RS3A 3AGQA 2ZAOA 1X8KA 2I3BA 4BE7B 5KSYA 4M1KA 1KI9A 4UKDA 2R6CA 2GAAA 2D7CA 2YC2C 3TUIC 3ZS9A 3JVUA 3HYRA 1E9DA 1X3SA 3QPWA 1IN7A 1XBTA 3NVAA 3LY5A 3EIHA 2ZRPA 4MRSA 2C9CA 2YHSA 3ASZA 3E2IA 3B7GA 1ETUA 4IDOA 1C1YA 1ZM4A 3A4NA 2JLRA 4WZAE 2RCNA 5JECA 2CJWB 1GWNA 1OIWA 1SQ5A 2X19A 1JB1A 4B48A 1R0ZA 4LDJA 4OQNA 3OIVA 2YOGA 1PZNA 4XSHA 5CIQA 4CEIA 3L82B 2MSCB 3QE0A 4AG6A 2BM1A 4M9XA 1E9EA 1KI8A 1FNNA 2JLWA 4LYFA 2WIAA 1NBMA 1NSTA 4TLEA 4OI1A 5KO2A 4DRZA 4BFUA 1G8GA 3WP0A 1OFHA 1YE8A 3QBTA 3RS5A 4KFRA 1YR8A 1VCOA 4QBGB 1NRJB 1S1CA 4S2EA 3Q5DA 3B2EA 4AKGA 2XB4A 4PZZA 1RYFA 2CNWA 3RRYA 1QHHA 2F9MA 1XTKA 2OCBA 4URYR 1YR9A 2IXGA 1W5SA 1F6BA 1FQJA 1G8YA 3AP3A 3TIFA 4DT1A 3QVUA 4LJ8A 521PA 4KVAA 5HCNA 2EU8A 4G5RA 2LWIA 1IN4A 3LXXA 4ON9A 1BKDR 3PV0A 4R7ZA 2NG1A 3W3ZB 4B71A 1CJKC 1N5KA 5J4HA 3ETLA 1OT3A 3EA5A 3OAAA 3QF7A 2FGJA 3K09C 2V3CC 2NQ2C 1W0JD 1E9SA 4IVRA 5BN3A 3OEHD 4HAUA 4DJTA 5JJLA 4ABYA 5B64A 4CW7A 3PQCA 4B34A 1IJEA 1SXJD 4DB4A 3UWKA 2H7VA 2P2LA 3RABA 1E0AA 3Q9LA 3MLEA 1NKTA 4M1WA 4M8NE 3CPEA 1WQ1R 2ORWA 4HLDA 3PUXA 4GPTA 2XXAB 3U61B 2ZI6A 1RVDA 3RRNA 4LYJA 3U7GA 3CRVA 4UNPA 2OAQ1 5DO9A 5KNDA 5KOYA 4GP6A 2J0UA 3DHWC 2ZR7A 5DNYB 2ZJ8A 4BFVA 5HR5A 1XMSA 5CITA 2G88A 4KV9A 4RFVA 1W44A 1UBFA 4BEJA 4TMXA 5CDFA 2ZI9A 3M6AA 1P2VA 3SBDA 3WXMA 3BFXA 1G291 2Z43A 1BMFA 3Q7QA 4M53A 3UATA 2ZUDA 3M0EA 4JLVA 1T3LA 3OHMA 2ZRBA 2C2HA 3PEVA 1GNQA 3EIEA 2FPLA 5AK0A 5CM9C 1E2KA 4DCNA 3UMRA 1KJYA 1GKYA 5TV2A 2BOVA 3CX7A 2JJ8A 4A0RA 1HE1C 3GLIB 1W4RA 2Y8EA 3BFVA 1R2QA 4JL5A 5EP3A 3TKLA 1V43A 2FGKA 5EE0A 1VIAA 4B2IA 4IHQA 1PLJA 3GJXC 3D6TB 4C3ZA 4HUQB 4W5JA 1QVAA 2E1RA 2W2XA 3Q72A 4ZIRA 3IPYA 2KJQA 2DWOA 4XWKA 1CP2A 5KYKA 3A37A 1BH2A 1TADA 2CMKA 2F9LA 2AFIE 2FX3A 2ZREA 3H86A 4P0TA 2VHTA 2PCJA 5AUPB 1EWQA 1ZJ6A 3WNCA 2OLJA 3I1FA 1DAEA 4EQ6B 1Z29A 3F0TA 1AM4D 4PSKA 1LFDB 4C0KA 3GLIE 1YZGA 4MKHA 4RZ2A 2DCUA 3AF0A 4HLCA 4TLDA 4RJLA 2C5LA 4JBYA 5KPJA 4Q4HA 1JEEA 4FIDA 3KXKA 4TL7A 3H84A 2G9NA 1YRAA 5BW8A 1Z0FA 2ZROA 4B2LA 5KU1A 2QT1A 1G3UA 2ANCA 3L2OB 4KO8A 3SJBA 2IXFA 5LBIA 4NPHA 1GDDA 4TYPA 4RZXA 2V7QA 4YQFA 3B78A 3PXGA 1FTSA 2CVFA 5HTKA 3FE2A 3QXJA 1Z47A 2ONKA 2QTVB 1NIJA 2EYQA 1TU4A 3A1VA 1F48A 1E2MA 5KSPA 5SZHB 1CR4A 2QAGA 4JLAA 2ZS9A 1X1RA 2OBMA 2V1XA 1XMIA 4ZDIA 1WBDA 2A3RA 3SOPA 2QGNA 4XTCS 3KJGA 4Q4AA 1LTQA 1CRQA 4IDHA 4ZDKA 1NY6A 1OYWA 2ZI7A 3VU9B 3W9YA 1T3SA 1DBSA 3EPLA 1Q1EA 4H1UA 3RVBA 3OE7A 4NDZA 1JJVA 3AF3A 4OHXA 2UZIR 3BERA 1Q1QA 4PQYA 3QJYA 3QKRA 4A8JC 1OB5A 1RRCA 4OI0A 4EIWA 1OFIA 1JR3D 1SXJB 3MCAA 3SFZA 1NI3A 5L3SB 2P3SA 1FZQA 2F43B 2Q9BA 2VSOA 2UVQA 2V54A 2VP2A 3T15A 1ZM9A 5FUYA 5LB4A 4WOPA 3KTAA 1JI0A 2L0XA 2QQ0A 5EUMA 3FOZA 5CLLA 4L4UA 1BO6A 4DDTA 2VA8A 4FCVA 4B76A 2F1HA 1IHUA 821PA 1ZM7A 2OLKA 1TU3A 4RY2A 1LW7A 5DISB 3RSOA 5D3MB 3T5GA 1SXJE 2FFHA 2WMNB 1ZU4A 1ESMA 1UM8A 2FMXA 3FHCB 4EDHA 2Z0MA 5EXXA 3GMTA 1J8MF 3A8TA 1BOFA 4R2IA 2K5UA 2W0MA 1L2TA 1FP7A 3FTQA 1T8UA 1R8SA 2IL1A 1JAIA 2ONJA 4G0NA 3KKNA 4AKHA 1GL9B 4PHHA 1CTQA 3UMFA 4JLMA 2W6JA 5TDHA 4GZLA 4UJ3A 4LC1A 3NDBB 4HB3A 4C30A 3TAHA 1Q3TA 4FMDB 1MRNA 5DLQC 2UKDA 4AD8A 1KAGA 4JVLA 1RW4A 1EG7A 1LS6A 1S96A 1EFHA 4TLAA 3I92A 1QVRA 2Z4RA 2C78A 4M1TA 1XP8A 1ZNXA 2FEOA 5FL7D 3O8RA 2ZM5A 2A78A 1E2QA 4D4JA 1GAJA 221PA 2PZEA 5CJ2A 1SGWA 1XTRA 1NG1A 2QMHA 4IEEA 4BFZA 2D06A 1YZNA 1COWA 4URWR 1KO7A 1Z6YA 2DFTA 2Q3MA 3OFND 1I4TD 4IFEA 4JL6A 5BYJA 1KK1A 4CVNA 3EXAA 4QGHA 2RGXA 4BUJA 1UKZA 2XAUA 3KFVA 4JKYA 2ZRFA 3K0CA 3LV8A 5FBVB 2CK3D 2CCJA 2ZI4A 3SNHA 3SJAA 3BB4A 4L8GA 3VTKA 4X8OA 4FI3C 1XDBA 1GOTA 2ZRIA 2ZR9A 3C7KA 5C18A 4GP7A 4POAA 1PUIA 3AVXA 2NO0A 4QHSA 5FOUA 5FOTA 1KHTA 3O47A 4MUBA 1I4LD 1XMJA 4P4TA 1NMZA 2FG5A 3MAAC 1D8TA 4M9SA 1S2MA 2OBLA 4C0AC 2CHVA 2IYVA 3IBYA 4Z1MA 3L8YA 3PCRB 3NBFA 2XXAA 1EK0A 4LHWA 3NWJA 2GEUA 4LZZA 4WA7A 4C9BA 3GLHB 2ECKA 3EA0A 4M0LA 1BS1A 2ZQ5A 4LHYA 3IO3A 1NL3A 1E3MA 1NBMD 4JLBA 4A2QA 1ZAKA 1XCPA 4TQAA 2QMOA 1M6NA 2C77A 2ZANA 3CRW1 3OEEA 4NYJR 1GG2A 1KDTA 3R7WA 2OXCA 2Q3FA 1T5LA 4MYTA 1A4RA 3RNLA 5TMPA 2JAQA 4LGMA 3OIWA 4QGAA 1XU4A 4Z8YA 3UG6A 3JZMA 4LWZA 2EFDB 2J1LA 2CCKA 4BLQA 4F91B 2R6FA 1KO8A 4C0SA 3P26A 3GLHE 1HEIA 1TPZA 2YNMA 2XNDA 4KU4A 4D0LB 1Z6AA 5H1YA 3ADKA 3R8CA 2JLUA 1Z5ZA 3F5FA 3NBZC 4IOMA 4HEJA 3U3MA 4IDNA 1QHGA 1IBRA 3T12A 3HDTA 3TVTA 3VHLB 3I5XA 1Z0KA 2ZSAA 4X8HA 4C7OB 3CONA 1G3MA 4OK3A 3AQ4A 4FCTA 1JR3E 4LV5B 5B2ZA 4GOJA 1F2TA 1CXZA 3QEOA 3I73A 1N0UA 2D62A 4MYHA 4PXAA 4FWTA 3PUWA 1D2EA 1Q20A 4Q7LA 2NO9A 2GKSA 2PZGA 1AN0A 4G1UC 1RIFA 2VLIA 2WAYA 2QQEA 1DS6A 2D74A 3CR7A 5H68A 1KSFX 1U81A 4FCWA 4C0JA 5AUNB 2EVWX 2GVZC 4LYAA 3RLFA 4EFMA 2WWGA 3CF0A 3ADBA 1E32A 5IDVA 4II7A 4AKEA 5IT5A 3LVRE 2R6GA 4MGIR 3WNDA 2LKCA 3THWB 2CLCX 2YJTD 2OFXA 4YMWA 3ZD6A 1OFTA 3HWSA 3U6BA 5DSZA 2ATVA 1DEKA 1U94A 3MWYW 4BLOA 3LQQA 4AI6A 3V4FA 3EZ9A 5GJCA 1W36D 3FHOA 1G5TA 2G1JA 2R6DA 1XD2B 5EUQB 3QG5A 2QAJA 2ZYTX 3FKSD 4Q00A 1KI4A 4ZCLA 4GMDA 1ESNA 1ZP6A 1ELOA 1S9DA 4ZO4A 1QG4A 4EJSA 4HLQB 4QNRA 1DAHA 1N25A 1UFQA 1VCNA 2WOJA 1W0JA 5GVSA 1E98A 2P6NA 4PPQA 5SZKB 1GITA 2P65A 3CIOA 2FN4A 3AP2A 4EPRA 2KBEA 3WYGA 5GJWC 5C1BA 2FH5B 4XTRA 1SXJA 2J59A 4RKFA 5E3HA 4DCVA 4F92B 4LJ6A 1MV5A 2ZJ2A 4IVPA 1FQKA 1ZD9A 2OFWA 4PZYA 3QPVA 2JLSA 3VR3A 2AWNA 1G4AE 1ZUHA 2P67A 3P4YA 1E2LA 2WJVA 2WM9B 3AEZA 4G3XA 4FWIB 4JJZA 2DB3A 4MKGA 1UF9A 2RGNC 4NP6A 1P2UA 3W6OA 4D4KA 3VKGA 1MT0A 3ZQJA 3SYKA 3AVVA 2BKEA 3NXSA 4P32A 1MH1A 3NKVA 4RD6A 2HUPA 5L3QB 3PFIA 4EAQA 2WWYA 2JLXA 2GWHA 4QOSA 3ZDQA 2QT0A 3RRMA 3I72A 4CZ2A 1W1WA 2IS1A 4DEYA 1CJUC 4FXPA 1NBME 2CEAA 1IQPA 4PX9A 2WSMA 2WAXA 1HH4A 1XPOA 2TMKA 2WWIA 4DKXA 3EPHA 1SZPA 4XIGS 4UNRA 3DZDA 2PX3A 3GQBA 3A1WA 2PEZA 2WTUA 1KK0A 2B21A 4P4SA 2GETA 4IVQA 4ESVA 2XTMA 4UJ5A 1O87A 4MA4A 2DWQA 1ZM2A 3UIEA 4PTLA 5FTJA 4ITRC 2FOLA 5DI3A 1JXOA 2WPDA 3WY9A 5J4KA 2G6BA 2RGBA 4B6EA 1E9BA 4UNQA 5AJVB 1NKSA 3LAWA 3FMFA 1V5WA 1YVDA 3K70D 2DFNA 1AK2A 4EPTA 5BN4A 3L8ZA 4DHEA 1M1YE 2J0UB 1S0UA 2AK2A 5FI0B 4Q1FA 3SN6A 1HA3A 4JBXA 4QM7A 5FBQB 1HYQA 3B8HA 4XJXA 1AKYA 4ZPXA 2VP0A 4A6PA 2B7BA 2I1VB 2G77B 1JQJC 4V0KA 2AKAB 4PO1A 1Q22A 1KAOA 3K1JA 1NLFA 1KJWA 1FUUA 4QHYA 2IYLD 1U9IC 2ASEA 1OYYA 5CB6A 1W36B 2YINC 3VR4A 1W4BA 1N6NA 3BBPA 1IY1A 1L4YA 4NTZA 1RFLA 3QEJA 1RRFA 3CNNA 2QEQA 4Q9IA 5IHPA 5FH9A 3K9HA 5AUOB 3W8NA 4A0FA 4E07A 4A15A 2WJIA 4L16A 4IDQA 1TUIA 4LJYA 4S35A 3SYNA 2V6IA 4TTQA 3THOA 2HDNB 2YOFA 1JR3A 1COWD 1JQLB 3B5JA 2J41A 3N5CA 2J87A 3CW2A 4QJ5A 4MRVA 4Q21A 2ODEA 2W6ID 2ZETA 2V8OA 3IIJA 3VR2A 1I2DA 2GXQA 4AYWA 4DWJA 3Q8XB 4TQ9A 4M4SA 3ZJYA 1SKQA 4V0ME 1KSHA 4BLTA 8OHMA 3EG5A 4URXR 5HE8A 1TF5A 4K8OA 3RHFA 3GJ4A 4LPSA 1AS3A 5G3ZA 1D5CA 1GRRA 2XJ4A 4K46A 4XSGA 4FD2A 4XVUA 4C7OA 1TQ2A 1M7GA 3HR7A 2OG2A 3R9XA 3C14C 1IY2A 3EPKA 2ZRAA 5EP2A 3VR5A 2DY1A 1KI6B 3I8XA 3M4YA 2VTKA 4YC7A 4GRAA 4YONB 3VMFA 2IA5A 3E5HA 4F4JA 2QAGB 2GJ8A 3HYTA 4EPWA 4RD4A 4DSUA 4KLZA 3KUDA 1DAIA 4WVFA 3GD7A 4PAQA 3AP1A 1RC8A 1ONBA 3PUZA 4Q4AB 1U8ZA 1DO2A 3TRFA 2FNAA 2R65A 4V02A 3B85A 4NL4H 1Z3IX 4KSBA 3AKYA 1XFAA 4JZKA 5EE5B 4QGFA 4AURA 3OEED 2BV3A 3KKMA 1KKMA 3THWA 1UEIA 5FL7A 3ZLJA 3LFUA 5GVRA 3QKRB 2CDNA 2HJGA 4AYTA 1W7AA 1N6PA 4OQFA 1E2IA 1IJFA 3IHWA 3KL4A 4DC9A 3NHAA 3VR1A 4LJ9A 3P4XA 3OFNA 4HSEA 1P2SA 2GF0A 1NVXQ 3RC8A 2FFQA 1E1RD 2GZDA 3KTAB 4LYHA 2DWPA 3THYB 4OHWA 2XJ9A 3MWLA 5KDLA 4KHZA 2CL0X 3K70B 1CR2A 1D2MA 1E2EA 2P6UA 4HI0E 2CK3A 1OB2A 1E0JA 1DOAA 3SDZA 4PHFA 5HKKD 3LBHA 1M2OB 1WE2A 4DLXA 3AVYA 2C04A 5A5GA 3UK6A 2IUUA 2HT6A 3GFPA 3U6KA 1W49A 4ZKDA 2JIZD 2QM7A 3GJ7A 2J0VA 2BMJA 4M9QA 4LPKA 4U5XA 1XJCA 2P0EA 4P3YA 1LB1B 3ZVRA 2REXB 3DDCA 3GEEA 5LPNA 1W47A 3GLFB 2AXNA 4A4DA 4EKDA 1VYTA 4LHZA 4I81A 3TUJC 1Q1ZA 3LLMA 2FPKA 2GXAA 5BWMA 3A58B 5DHAA 3ZVLA 4KFSA 5AJYA 2W2TA 2REOA 1N5LA 3SI7A 2DHRA 2O0JA 3T5DA 2JDIA 2GAOA 2QRNA 3LRPA 3D3QA 4ESHA 1NSFA 1WDTA 4OJKA 1SVWA 2HCJB 2C8VA 3NBYC 4BFYA 1NMXA 3UG7A 3SU8A 5L3QA 3ADCA 2A7QA 4MGKR 3GLFE 4RD1A 4X8LA 4LV6A 3B9PA 2GNOA 1NIPA 1CU1A 2ERXA 1ZUNB 2OILA 2ZSFA 4FINA 4JS0A 1J90A 1G8FA 4TQUS 4QJ3A 2A5JA 2N46A 2RHDA 1HURA 4HB4A 3WBKA 4AG5A 2WZQA 4B3XA 1X1SA 4B73A 4F38A 2CE7A 2OZEA 2ZRDA 3HU1A 2VH5R 4MGYR 1XXHA 3QOFA 1YQTA 2EFEB 4A2WA 3AKDA 3LWNA 3QKUA 5D3QA 1KDOA 4RKEA 4LCBA 1R5NA 3SS8A 3ZIAA 4OQLA 5KHOC 2YKGA 3P27A 5L3RA 3WMGA 4TTPA 5JJKA 1KKLA 1Q21A 3SR0A 1Z83A 1BIFA 1IXZA 1DPFA 2OSBA 4PPGA 4E03A 3RWMB 1E6CA 4KFUA 1Z6TA 1G6OA 1K5DA 2IWRA 1G1MA 2PH1A 2ODBA 1DTSA 3T1QA 3CF6R 2VEDA 2PT7A 1MO3A 3Q85A 2RAPA 4BLPA 4XWOA 4Q7KA 3ZZ0A 2QBYA 1I2MA 3TLXA 3R7WB 2IS6A 4US0R 4F4CA 3PVSA 4AIIA 4D4MA 2V6JA 3KB2A 4P31A 2QPAA 2ZJOA 3LW7A 4B35A 3GEIA 2VP4A 2C9YA 3BRWD 1BYIA 1XCGB 2OE2A 2ZRMA 4ILEA 4C0LA 1Z0IA 4YXWD 3FKSA 5IF9A 3NC1C 2IW3A 4EPVA 1NVVR 2KSQA 5SZIA 1KI7A 3WBJA 2NGRA 4V0MA 4HZIA 1KI1A 3LX5A 1Z22A 2BC9A 4QFMA 1XZPA 2DFKB 4L9WA 1HQYE 3CNOA 3B9QA 2J0QA 2H5EA 2VQSA 4NCIA 1FMLA 3ZH9B 3IHLA 4LJAA 4NYMR 3IPXA 2ANBA 3FVQA 2J7KA 3NIBA 4JIMA 3EAQA 5DYGA 1F2TB 2WSSA 4GDFA 1SXJC 2BJWA 4O2RA 2IUTA 5FBRB 1FP6A 4FN5A 4O2LA 3L0PA 3ECCA 2XITA 1MO6A 1UKVY 2WPDD 2HF9A 2AD5A 1UJ2A 2BKUA 2H57A 1G6HA 1ZINA 4RFSA 2NPFA 5J47A 1N0VC 4BRWA 2LCFA 4HLUC 4OK5A 4V0LA 5TXGA 1OIVA 2A5FA 2PLFA 1SHZA 2OCAA 1M8PA 4OBEA 1KO4A 1OHHD 1LF5A 2GEDA 1P60A 2D2FA 1XPUA 4MKFA 1KMHA 3A1SA 3GEHA 3OZXA 4DDWA 1KI6A 4NONA 3K0FB 4B33A 5JHGB 5EE3A 4NH0A 2ZAMA 3A1TA 4D82A 4A6XA 1MO4A 3W34A 4D0GA 5FPHA 4DLUA 1Z0AA 1G17A 4EPYA 4GFDA 5JCPA 3K9NA 4BFWA 2ZS8A 4YMTA 1P72A 1T91A 4IDPA 4C0HA 1ZBDA 1B0UA 5JEDA 4JBWA 4EJSB 3TSZA 1G4UR 4UXHA 1R5OA 2FSIA 1R8QA 2J7PD 3GJ3A 3VNVA 3X2SA 3DPUA 1GL7A 3EW9A 4PFSA 4HYYA 2QG6A 3PR1A 4KITB 3PEYA 2VHCA 2V55B 3NG1A 5LD2B 1KSJA 2V9PA 2GBLA 2OHFA 2NZ8A 1TF2A 2IBMA 1KI2A 1VG9B 5HCIA 3THYA 1AGRA 2JASA 3HP1A 4B6FA 4IFBA 3EWSA 2DFLA 1JECA 2OT3B 2RGCA 1F60A 1JAHA 2YOHA 5EJEA 4DXAA 2IXEA 3OIUA 5C4MA 4NYJQ 1FL9A 1OH5A 2JEOA 3B82A 4LBWA 1SVOA 2FSFA 3WHKA 4PAOA 1HV8A 3GLGA 2O8CB 4U00A 4J0QA 1EXMA 3B1WA 4HDCA 3WMEA 1U8YA 1OW3B 4D80A 1KMQA 2R8RA 1XEFA 3U4QA 2XZOA 4V0OA 3AKEA 3I5YA 3NHBA 3GLFA 2KB0A 1E96A 4Q1EA 5L8VA 1U8AA 4DSNA 4MGZR 1OXXK 5FI1B 2ZJZA 4OI4A 1GRNA 2O5VA 4DLRA 2QRZA 1Z0DA 5AJXA 1ZC3A 1QDEA 2EW1A 2IHBA 4B3FX 3AUXA 2FSGA 3A4LA 3CRMA 4W7SA 2BBTA 2OAP1 1EFTA 1N2CE 3MJRA 2BJVA 2AR7A 5FTLA 3FYHA 5ANRB 1US8A 2FWRA 2VHUA 2IC5A 2BMEA 1GNRA 2WBLC 2HXSA 4JYBA 1RE0A 4KCGA 4P4SB 5EP4A 5H70A 3RWOA 1MABA 1UDXA 4RZ3A 4DSOA 3NH9A 1NN3A 1YZTA 3X1XA 2W6IA 5DI3B 1KNQA 3ONWA 1U90A 2G0NA 2ZVQX 4QL3A 4QXAA 1NG9A 2QROA 3K9GA 2NPIA 1EFRA 2QMEA 2DR3A 3PIRA 3NEJA 3H0KA 3TQFA 2IHYA 2ZRHA 4PC3A 4UNNA 1QHXA 2YYZA 4BASA 1Y63A 2NO6A 2ZE7A 1CJMA 4B3CA 3DM5A 1S8FA 4QNMA 3N70A 1E79D 3FDIA 3P20A 4KODA 2HXYA 2OV2A 4FMDF 1OXSC 1S3GA 2IYUA 1YZLA 3ADDA 2PCLA 4DB2A 3BH6A 1NJGA 1XD9A 1WXQA 1CJTC 1XPRA 721PA 2BCJQ 2IEZA 3L0OA 5K8TA 1P5ZB 3RANA 1P73A 2BIFA 2JDID 2ZE6A 3ZZTA 1ZNYA 3SEAA 1G8HA 1UEJA 4R71A 3QXCA 4BFXA 1G7TA 4PPFA 3PG5A 1TQDA 3O8DA 2J46A 2GESA 2GK7A 1XTIA 3VR6A 2EQBA 4JT2A 2MSEB 4MUAA 4YLGA 4Q9LA 4JVMA 1I4DD 4DLTA 4QM6A 4LJ5A 1P62B 5EZ5A 3KKQA 4AYXA 1Z63A 2FSHA 2RGEA 5E7MA 1E1RA 3N2EA 4E09A 2AFHE 4KFTA 4JL8A 5AJWA 1SKYB 2N1BA 4RZUA 4YMVA 3CR8A 1FMJA 4PANA 2JGNA 2YZ2A 4JSTA 2FV8A 3CKLA 1G16A 5HKKA 2WWHA 2H18A 2NIPA 3BJIC 3T34A 2ZRGA 4D4LA 3R8FA 4GNKA 2F55A 4F4IA 3QI2A 2ZU0C 2W83A 4OL0A 3ZIAD 2YV5A 3VNUA 2JIZA 1G21E 4QGGA 4Z51A 1QF9A 2ZIAA 1IXSB 1YZUA 2IYZA 1SKYE 2CL6X 2A2ZA 3ZD7A 2WJGA 2REBA 5JEEA 4ZKEA 1N3BA 4TL6A 2XTZA 1DE0A 1QG2A 1II8B 2XX3A 4HUTA 4YDSA 4HZUA 1VECA 5TB5A 2UZ3A 4A36A 2FFBA 4BLRA 3SQXA 4MDEA 4DLZA 3GFOA 1KGDA 2XZLA 3ICQB 4FW9A 1VCMA 2CHGA 4MQBA 5DE3A 2BVNA 1JEDA 3U3OA 1SVLA 1SVIA 1S1MA 2ZUCA 3K0FA 2RHMA 3EZ6A 4KBGA 5A0FA 4DVGA 1VG8A 5KNCA 3U60B 2VPPA 3OIYA 1E94E 3VHXA 1VG1A 2O8FA 4DCTA 2MMCA 4AKIA 3BWDD 2IYWA 3CZPA 3KUCA 3BIFA 3NTUA 5DGXA 4D6PA 3GPLA 2X8AA 3CBQA 1JPNA 1GKIA 5FR2A 3GJ6A 2X77A 5JWOA 2MSDB 5HE9A 3R20A 1ZYUA 1KDPA 3VQTA 1SULA 2B6HA 2GXSA 4C4PA 1II0A 1H8HD 1XTJA 1M7BA 3FPAA 3RS7A 4CEHA 1KI3A 1A82A 3W90A 5K8UA 2WSSD 1QZXA 3HPQA 4OHZA 4GBMA 2I1QA 2C98A 2ZSDA 3BB1A 3ZGXA 4DZZA 1PV4A 2GJ9A 1GRQA 2QSZA 5BYKA 5JS8A 5GADl 2FE4A 2R2AA 1CIPA 2HLDD 1RRPA 1N5IA 3IEVA 4M1OA 4Q1BA 4KLNA 2G1KA 1VHTA 5EXSA 2O8EA 4DCUA 4CF7A 2O8CA 2FPMA 1M7HA 4ASUA 2WV9A 4N3NA 3T61A 3SJZA 3MG9A 1G5RA 5BXQC 2WJYA 1Q1BA 4TL9A 3I4LA 3PEWA 1UBGA 5J40A 3ZYCA 3VKWA 1X8JA 4WXPA 5E7IA 3QNUA 1JALA 2FJUA 3KJEA 1P7CA 2JA1A 1MRSA 1SHKA 5K8IA 1M74A 2GZAA 1W36C 1IN5A 1W2GA 4Q1CA 4YXWA 2D3WA 5IRCD 2GVDC 4TT3D 3CWQA 2QE7D 1FX0B 3CRRA 1YKSA 2FZ4A 3IIMA 4GL2A 3KJHA 2BEJA 2ZEJA 1Q3HA 1VPLA 1VDZA 1XEXA 1F2UB 1K8RA 3LBIA 4PSAA 1TL7C 4Q48A 5L3VA 3R9WA 2CLDX 4PQRA 4I1UA 1XXHB 1HTWA 2IK8A 2Q9AA 3IILA 3TJZA 1AJEA 4Q4LA 3AUYA 1GP2A 4WAUA 621PA 1E99A 1OXTA 4IXNA 4MH0R 3RYTC 2G0TA 2Q0HA 5IK2A 1YZKA 3BC1A 1D9XA 3EPJA 3EASA 4Y0AA 3X1WA 2JLZA 2O52A 3LO5A 1CF4A 1VTKA 1Z0JA 4TMZA 2J9RA 1CS4C 2BCGY 4M1YA 5BN5A 2YWEA 2ZITA 2A5DA 3MRSA 4LSGA 1UKEA 3HPRA 1VYUA 4L9SA 1XXHE 5FTMA 2R62A 4FMCB 4XOIA 4W9MC 3CF2A 4BRUA 2WKQA 1OHHA 1XJ0A 4LK2A 1D2NA 3PEUA 1VG0B 3X1DA 4X8MA 2QBYB 5F9HA 5EE1A 3IUYA 1DADA 1YR6A 2LKDA 5J4LA 1GFIA 2IT1A 3BE4A 3CRQA 3TSOA 4OI2A 1DARA 2ZUBA 5LB2A 1E2NA 1R6BX 4PC2A 1VMAA 1A2KC 1VKJA 3V4RA 4QBIA 3CPJB 3IGFA 2QAGC 4HAXA 5JLJA 2X2FA 1IN8A 1R10A 1LF0A 3MFYA 4CRWB 2YWGA 2F3TA 2MMGA 2QP4A 2OO7A 3C5CA 2VRWA 5E95A 5AUQA 1O3YA 5HZHA 4TZ0A 1R4AA 4CEJA 4UNSA 2IYSA 5DHFA 2ZXUA 4RSGA 4H9GA 3ZZUA 3N2IA 5JCZA 2AKYA 2J7PA 1OE0A 2GCOB 2W2VA 4AY2A 1T9HA 4TYWA 5CK4A 2C99A 3TW8B 2PT5A 1XZQA 3FFBA 1J8YF 1MKYA 1YRBA 3H2YA 3ZVMA 4F93B 4M1MA 4NYIR 3KXIA 3WHLA 1QHYA 2GBLC 4LBZA 4L15A 3QXHA 5KDDA 2QM8A 4JSYA 3ICEA 3CM0A 4OJQA 1IN6A 1EFRD 1RZ3A 4RFSB 4US2R 5E4FA 3A36A 1K6MA 2ZI3A 4D25A 2B92A 3K70C 4TYQA 1XEWY 4DLVA 3T06B 1AQYA 2QENA 1RYHA 3ASYA 4B3GA 4UQOA 4XD7D 4N0EA 1ZU5A 3KQLA 3AVOA 1NN1A 3TAUA 1KMHB 2C95A 3DL0A 5ELXA 2IF2A 1EX7A 2CXXA 2D7DA 3WYFA 3T35A 1R5BA 2IYYA 2B7CA 2JATA 4LHVA 1OSNA 2QMUA 5TY0A 5EE9A 4A0GA 1TQ6A 1UAAA 4UXIA 3R9IA 4GSYA 4RD0A 4TMVA 4MRNA 3FKQA 3DEFA 3TQCA 4JLNA 2OCPA 1TQ4A 1W46A 3MGCA 2YC4C 2ZJBA 4JLOA 1II8A 5JHHB 2RGAA 2W58A 1R0YA 4LX0A 4ACBA 4JT4A 2HEIA 1E2PA 3HU2A 3TW4A 2GJAA 4NE2A 1E69A 3M1IA 4MRRA 1EFUA 5E7JA 2IUSA 1MOZA 3G5UA 3Q3JB 3RS0A 3F3YA 3DO6A 5AWFC 3U7EB 4I1OA 3TMKA 5JSZB 3CX6A 4B3DA 1FFHA 3LVQE 1CLUA 2PEYA 4LV8B 4V0NA 1Z6GA 3VKHA 3D31A 5FTKA 4AC9A 2OBNA 5TARA 1Z06A 1ZW6A 4PZLA 5G41A 1UBEA 3MWJA 4Q9JA 4LBYA 1G3QA 2AHOA 4KXFB 1ODFA 3C8UA 3U3JA 4D26A 2P6RA 3B60A 2QL6A 5FUWA 2ZJ5A 3KX2A 2OEPA 5CK5A 3K0CC 4B32A 2H1LA 4HAWA 4Q4JB 1ZIOA 1ZMXA 1YJ5A 4XH9B 3W6NA 3O8BA 4BZQA 3U2QA 3SFVA 4BPBA 3GFTA 1YHNA 5DIFA 2QPTA 3GLGB 3U44A 2QN6A 1A7JA 4UXJA 3GP8A 2ZPTX 4I1VA 3U3RA 5DN6D 1DAKA 3TUZC 2BWJA 4N1AA 1GUAA 3QKSB 1TF7A 2GRJA 1OKKD 3NEYA 1E79A 2OCYC 3U4QB 3QVVA 4LBVA 4MYUA 1TAGA 1G7RA 1NVVQ 1ZCBA 2GTPA 2GK6A 3CO5A 3AF1A 1XCMA 3TNFA 4PC1A 3K0AB 5LDDC 2H16A 3CZQA 1W0KD 2IYRA 5KDOA 4TYYA 3GLGE 5CM8B 5KUTA 2IYTA 1H8EA 2NO7A 4NYMQ 5FL3A 1KTVA 3SHFA 4URVR 1TTTA 1G20E 3BORA 5HPYB 5F2EA 4MRPA 2D4HA 2RGDA 1CBUA 1US8B 2P5SA 1LNZA 1U0LA 3WMFA 4ZCIA 1Q57A 4KYIB 1XMVA 3BAFA 4XVRA 4PO8A 1MABB 3X1YA 4Q03A 3G82C 4M21A 4TSFD 1XTQA 3I3SR 4DIEA 2V1UA 1AZSC 3IQWA 3G0HA 1XRJA 5KSZA 4LUCA 4NBSA 1FX0A 3LLUA 5P21A 3CNLA 3C16C 1P75A 1A5TA 3U7HB 3OESA 2B8TA 3P32A 1T3HA 3T1OA 3SHWA 4DSTA 1F2UA 1Z2CA 5CYPA 2CCGA 4DLWA 2O8BA 4IOLA 1ZVQA 4OQMA 1NF3A 4D2IA 3DM9B 1JJ7A 1OV4A 1ZM3A 3IQXA 4XVQA 4HDQB 1Z8FA 2Z5FA 4HATA 4O25A 2KI5A 421PA 4ARZA 1AS0A 2R9VA 1Z07A 1N6KA 3AKCA 1RJ9B 2ORVA 1Q44A 2D2EA 2EWWA 1S4QA 1Y3AA 1KDRA 1XB2A 4P33A 1NVUQ 5UKDA 2KE5A 5TVKA 2G3YA 1E2DA 3HR8A 3BK7A 2R6AA 3LDAA 2GCPA 3KQNA 1SVMA 2WKRA 3FWYA 3KKPA 4ASUD 1IOZA 4PC6A 4TLCA 2HYIC 2JJ1D 3S1AA 2HF8A 3QUSA 2YVUA 2FDCA 2ZS7A 2WWXA 2GXUA 3JVVA 1E9AA 1L8QA 1SVSA 2GJKA 4EUNA 3UWOA 4PO9A 2O8DA 5KSOA 5FOXA 2RMKA 5FPSA 2RGNA 1G5PA 1KK2A 1NY5A 1X86B 3LA6A 5DYIA 3ND9A 3AF4A 4ZDJA 2XOKA 2ZRJA 1SVKA 3Q5EA 1AKEA 4N0DA 2C96A 3I32A 3KJIA 1MO5A 4EJSC 5KNBA 3REGA 2GCOA 2VHJA 5FPTA 3ZS8A 2GZHA 3VX4A 1H8HA 1N6LA 2IS4A 3THXB 1E2JA 1HE8B 4JJKA 1MR3F 1EESA 1AQUA 5FOSA 5A4JA 1G18A 5IK2D 1XNJA 1TEVA 4QKQA 4LI0A 2FEMA 4IRUB 1P9NA 5LD2C 4Q5IA 5EXPA 3QSYA 1EWRA 3BGWA 1OH6A 1F5NA 1P4SA 3IO5A 5M04A 2Z6VA 3A1UA 1XJQA 3LH5A 5JWRA 1VYVA 4C0BA 3IIKA 2PMKA 2WICA 5G40A 2HLDA 3SBEA 1NVWQ 2VF8A 1OXUA 5DI9A 4HZUB 2QI9C 1OPXA 1HUQA 4BWYA 4BFTA 3CPHA 1G7SA 4URUR 2IWHA 1ZRHA 1GVNB 2J45A 1U0JA 1IXRC 3FMIA 2F3RA 1TUEA 4DCSA 3EARA 1XD8A 3X1ZA 1OH7A 3MUFA 3LX8A 3VX3A 2IYXA 3EC1A 2O8FB 4HDOB 1E9CA 3MWKA 3V00A 3W5JA 4WIAA 1N6RA 3KXLA 3B13B 2Q6TA 5FPKA 1T6NA 4B3BA 1P6XA 2ORIA 3WRXC 3RC3A 4LJ7A 1FTNA 1KY3A 1W4AA 3AB3A 4TT3A 4O0MA 2QE7A 2ZI5A
chains in the Genus database with same CATH superfamily
4E08A 1K5GA 2V4UA 4DE5A 2X86A 3G2NA 3R09A 5FI3A 3ZV7A 4C2TA 1U0OC 3IDQA 4G5QA 2FZCA 5K0LA 1L5YA 2Q5FA 1V8FA 1KNXA 2Q5JA 2ZT8A 3MHPA 2F2TA 4GWLA 5ERXA 5JQGF 4CMAA 4ZJYA 4ZVQA 1YRLA 3BOSA 4GMXA 3NS7A 1JTEA 2C9OA 4KPEC 1IWBB 1RXVA 2I99A 2BZSA 4DBVO 5JSZA 4D9KA 3QXGA 4FGUA 1GSIA 5HIKA 1C14A 2M6RA 3IHTA 1KMMA 4XR4A 1G3RA 4JT9A 5JCOC 2I4MA 1HQKA 3PFCA 3K7EA 4RH0A 4H2DA 2AX4A 2VATA 1QRAA 5KTYA 3I58A 1P1RA 4H4CA 4CM4B 1IBKB 4A8PA 4AWXA 1J00A 2CZGA 1CRWG 1OFVA 2VZ8A 5DNWA 4JJ8A 3W5VA 4C0XA 4E46A 1X77A 1RXWA 3ZJUA 1TMKA 1XDDA 4RV9A 3I4CA 2WU0A 1DIOB 1TYAE 2BBSA 5H82A 3LFTA 1XVTA 3U7FB 3JZAA 5C2JB 4KK4A 4ZVTA 4A23A 5FAXA 4LVNA 2H4FA 1GLNA 4TKZA 2O0MA 1DAGA 1OF1A 4TN1A 4NBKA 3V6MA 2E6KA 4EL5A 1EXNA 3ME5A 1Z13A 2I91A 3IVMA 3LPDA 4F56A 4JEHA 5L95A 1TC1A 2Q1TA 4I0WB 4RA6B 5FXMA 3LY9A 1FW6A 5A0VA 4LOJA 4JP1A 4PQGA 1ZGHA 3RK1A 5FA6A 3IKTA 3IEKA 2BHTA 2BFFA 4AN0A 1EM6A 3A6LA 3H4TA 3VVMA 3BGIA 1EFCA 2IEYA 3QF4B 4DJDC 5CA1F 1F7VA 3B70A 1KC3A 3AIKA 4FONA 3WXBA 5BNTA 4FBMA 2VQFB 2W2KA 1E0KA 5H02A 3K0AA 5SICE 4KQJA 3ETNA 3L02A 2VRCA 4MWCA 3QRWA 4CGYA 4AUEA 1C1HA 2QUAA 1XTVA 2Q2WA 3CUEF 4IDCA 1ISGA 2NLOA 4R6XA 2IZ6A 5CX4A 3SK0A 4BNMA 2CJWA 1W5TA 1OUMA 3S2UA 3HCNA 2X5NA 3SHQA 3KVRA 1AGPA 4N9QA 4TMTA 5IJ9A 3NIWA 5LSAA 3IPAA 4JY7A 2NTYC 1B8OA 2ZU6A 4IG9A 1DVRA 3EXFB 4G67A 1LUAA 3TR0A 4G41A 5IJ0B 4P3OA 2BFCA 3EXIA 3HO6A 1B16A 2PKEA 4QPJC 2IU3A 1A2BA 3Q10A 4TLBA 3R7AA 3TYXA 2VAXA 4YQYA 1M1ZA 1JFTA 2Z83A 4HVCA 4YUWA 3VDNB 3BEDA 3BHJA 1XTSA 1ZIPA 2W00A 4X3CA 4BKUA 3AOEC 2DU8A 3F97A 3B1XA 2QTMA 3H5LA 4LNUA 1SRQA 4QPNA 1MAAA 5I8ZA 3VNAA 4CG2A 2C3YA 4DUGD 2HPZA 1P4AA 3D4LA 2B1IA 2KWIA 2LDXA 3HKDB 4BWVA 5KVQA 1LV7A 3IELA 3SBOA 1ZIXA 2ZSUA 1QU2A 3CE9A 4R05A 5BNZA 1I3OA 5JBIA 4DV4B 3UCFA 2BL4A 3R3YA 3H19A 4JN6B 3FMVA 3CB4A 5IYZF 2QZSA 4LE0A 3PUVA 1GKUB 5HX7A 1J21A 1Q50A 1FSGA 3PE3A 3NBMA 4L4YA 2WOOA 1OLOA 1V71A 4TTRA 2VT3A 3EF1A 4WZ6A 2XQFA 1OA0A 1XDUA 5LLTA 1E3DA 2QGZA 3E2PA 4QDKA 5IBRA 4HADA 4IJUA 4V03A 1KO1A 2W71A 5CVVA 3PICA 1RXYA 2AUMA 4AP5A 4OP3A 1XNQB 1PIWA 3FCSB 1OH8A 1RYDA 4YO7A 4R8MA 1ZX1A 4PC7A 1XDWA 3COYA 1SBCA 2FX5A 2HYDA 2JAXA 2R0QC 4OMCA 4RHCA 1MXHA 3C6MA 2D0PB 3G2IA 2VHZA 1QVVA 2O8NA 1IAQA 4RY0A 5DHRA 1E7YA 1Q7GA 1EGAA 3EIXA 2VF5X 3KR2A 1OX4A 4JFRA 4MVJM 4MWEA 5K3FB 4F85A 3BH0A 1SHTX 1VMKA 5KINB 3S7ZA 1QV7A 3LCVB 3H1FA 3E70C 3UBTA 4HXYA 1EXDA 1U7HA 1S6YA 3P9QA 1SCDA 4WADA 3GK3A 2B3TA 3K0EA 2J9ZB 3BD6A 4GR9A 1TEXA 3GGOA 1AN9A 2Q21A 1Q17A 2CVHA 2E55A 2ORED 3BS4A 4BYGA 1FNBA 3N7AA 4PHGA 2EBWA 3G5MA 2RHTA 4BAZA 1GQFA 2GK3A 2H06A 2P9QA 1I7QB 1WB9A 4N03A 3L0IB 4MWGA 2Y99A 3U4HA 2SNIE 3HSYA 1G41A 1SEPA 2PLRA 1K66A 3NP7A 1KYWA 1OLSA 3EB9A 4PLTA 4QDTA 4DYVA 4I9UA 3FFAA 5HIIA 1M33A 2EDCA 4BB6A 3CINA 3PQ3A 4ZV4A 4HS9A 3CTMA 2CL7X 4H7KA 2EFCB 3QGMA 3R1IA 1PZEA 3VC7A 3ZWWA 1LY1A 1SZDA 4ROTA 3AX6A 2PL3A 3JALA 4HAYA 3T9FA 2QLLA 5G53C 5GP1A 4IGIA 5FHRA 4TQGA 3I8OA 4J2HA 2IUFA 1AV7A 3NAMA 2OUKA 3REFA 1W85A 1LX7A 1TE2A 4BZZA 2DUNA 3K09A 2IX3A 3U09A 1WBBA 1XEWX 1GGVA 4DDVA 4DCNA 4OKIA 1MW8X 4UCWA 3QG1A 2X3FA 2FUEA 2PGOA 2Z8XA 2C9MA 3A9UA 4QSMA 4EG0A 5JOQA 4BNDA 4Q3BA 3DJFA 2QUJA 3KPUA 2ZPAA 1MNAA 1KAMA 1JHMA 2YMLA 3LXRA 4Q1AA 2E2WA 1ODLA 4LOAA 1NMSA 1AA9A 2XQKA 3C8HA 2B94A 2IIVA 3TXXA 5H4GA 1NYRA 3QFSA 2ZSBA 2D5AA 2FSPA 4NU0A 5KKNB 4EQ6A 4ND2A 3OCYA 1FYDA 1VHLA 1KETA 2O0HA 2PUWA 2J9YB 3E7FA 3UGQA 5AOVA 2V0CA 4G1FA 4GI7A 4PG5A 4E70A 1QH8A 2X4DA 1N2XA 1ZW1A 4MZDA 2HPHA 1MX1A 3EQ2A 4YDHB 2D13A 3RTDA 2XBLA 1Y7LA 1KPGA 4GX0A 4HBGA 3HXKA 5AVTA 2H1IA 2JIDA 2YWHA 1B3RA 1VCIA 4CQLA 2QN8A 3KQVA 1Z8HA 3WSTA 1UBLS 2HQBA 2QR5A 4J76A 5GM1A 3O4HA 1FNMA 1KZGB 4CFSA 4O2AB 3H4IA 2RFLA 4UDOA 3RAEC 3VDRA 3UPDA 1NT2A 1XZHA 2Q9CA 1BMFD 1DSSG 1T9CA 4JGBA 2N75A 1N33B 1ND6A 1J9EA 4HQFA 1Z4OA 4RHTA 4S1WA 4CT4B 1Z7GA 2BDTA 2G1AA 1WP4A 3JASB 4MCIA 1KK3A 3JSAA 4MHSA 1YI0A 2WD7A 1UADA 3O03A 3IQHX 5JO0A 4GOXA 2UYQA 1QK3A 5FBLB 1JQEA 3M6MD 4CCYB 1TJ4A 5H9WA 3W7AA 4EY5A 3NEAA 5AW6A 1FDOA 1I5RA 2QY9A 4NY1A 4MUXA 2II6A 2X1VA 4OU5A 5E9QA 1OI4A 5EKXA 3VU9A 2P2CA 5DHQA 5CHYA 1ORIA 4YP9A 2QRHA 5EHZA 3L8GA 2JC3A 3EEQA 5CYOA 3OEHA 1I30A 1L3IA 2XDYA 1USIA 3NASA 3HUEA 2VBCA 3VC3A 4AJPA 7ADHA 3K9BA 4OXYA 1VL8A 5IT4A 2WQ7A 2FPGA 2PFKA 2VT7A 3D8BA 3OUZA 4L5JA 4GBGA 5DHUA 3V1NA 1QV9A 3VVLA 3FMOB 4IPTA 4BGDA 2EEZA 5L3SA 2YW9A 4JVNA 1JYSA 3X2FA 4EHHA 1GCAA 1R4MB 1Z6ZA 1R8YA 2JJ1A 1PVOA 4TSRA 4OM8A 1A5ZA 2DUMA 3PQ6A 1OXVA 4NK4A 3FYUC 3K9WA 5DTQA 4NYIQ 3AETB 1IONA 1HNXB 2NO1A 1HY3A 2W2QA 1JFFA 5AKKA 2HT1A 4Z9FA 3LGXA 1UMBA 2DPXA 1CUAA 4CHTA 1HG0A 1PL0A 3TNYA 3W6PA 1Y3BE 2UUCB 3RYHA 2YZNA 2X1LA 4A8JA 3OLWA 5H8WA 3IA7A 3KKOA 3QBJA 2H2AA 4OA5A 2GYYA 5E8JA 1FYXA 5D3MA 1F3OA 2WSLA 4JYCA 4UMFA 1E7SA 2QORA 2C58A 3LCRA 2V7QD 4X1IB 4ZCTA 1L7MA 4HQNA 3ND7A 4HEA6 3L93A 1FFWA 1N2JA 2H7CA 2HJSA 5IVPA 2G36A 2PMFA 1YSCA 1UBCA 2ZJ7A 3FY4A 1GD1O 3CRZA 3CWZA 1ZRMA 4FYXA 2FHPA 2GZ1A 1FPMA 1P8AA 4JP8A 3DO5A 3CPSA 3AG5A 1UMDB 1NR7A 1H3FA 1GADO 2H1WA 4TVOA 4XFJA 1MC8A 5DV9A 1LKZA 1AH2A 5EMKA 2VDJA 2ZT7A 3LMKA 3VJRA 3JYLA 1UXOA 1ISPA 4G23A 3ETGA 4H7JA 4TYMA 3UC9A 3ZHSA 3VXKA 2JFHA 3VSBA 3K8YA 4C22A 4OHUA 3FNEA 4V38A 4I4TB 2QF7A 3LUHA 3DOEA 5JZVA 3LNCA 3K5WA 2YCBA 4PV7A 4RH3A 2ZJAA 3ZGYA 2IYQA 2AG0A 3DW3X 3E53A 4WNYA 1SCJA 1KF0A 4EY6A 3NBAA 3G5TA 1V35A 3AH8A 4BS9A 3V7FA 4IINA 4LE2A 4LY6A 3W2FA 3O3CA 5DCUA 1WP9A 4G1CA 2IV7A 3FFTA 3ZV4A 1BFUA 2ZSEA 4FHZA 1EA7A 4O1IA 4BGVA 3I04A 3ITKA 3Q8LA 1W6UA 3AERA 3JY6A 1CR0A 1M2VB 3GMSA 5DMXA 2P79A 2YH2A 3Q3GE 5DNUA 3AEQB 2O8DB 2W22A 5KNDH 5EJGA 1CEEA 4M2LA 1CDDA 4HAZA 4DMGA 3LXMA 2P6OA 4G36A 1QMGA 3PNVA 3QIAA 4MITA 1II9A 4NESA 3CQ9A 3SYMA 2I4IA 4X92A 5A6SB 3EMDA 3SSAA 4FOPA 3O8OB 3H3XA 1CDEA 4PRKA 4YCLA 4MUFA 1GN8A 4PBRA 3BHIA 4GYWA 1M34E 3E1GA 5JD3A 3I9NA 1E58A 1G64A 3OA2A 4RELA 4TXJA 5PNTA 3KYJB 2RI0A 1KTIA 3NP9A 1SU4A 2HU8A 4ZO8A 1XYYA 2AF4C 4MUYA 3UEOA 4BO9A 4J0IA 1Y48E 4UZSA 2ZJYA 5FUBA 1TKBA 3UB3A 3JAWA 1P81A 2W6JD 3KVNA 5DWQA 4YY3B 3QIVA 1JDSA 3CZ9A 5EIBC 1TM1E 5NULA 1HQDA 1PR0A 2IH2A 4IY1A 3C3JA 4J7UA 4MWOA 2JD1A 1PWXA 2VP6A 1YFJA 1BKSB 3HWX1 3AEXA 3V4OA 4MCHA 4QUKA 3RRFA 4X6LA 3TVYA 5C7YA 5HUQA 2QTAA 1UBUS 1LI4A 1PLLA 3B6ZA 2QUZA 4P7GA 3ZCTA 2ZB4A 1BCRA 3ZCVA 3B1ZA 1D2AA 1TM4E 3PITA 1AKVA 3QBVA 4RHUA 3R3SA 4JWKA 4UVHA 1QP8A 4DARA 3AVWA 3OLXA 4GZ6A 1CRPA 2RH5A 4Z54A 3H4MA 4LCJA 4D56A 4X65B 1QF7A 4QE3A 1W4ZA 4W1SA 1ZNWA 3ZOKA 4B47A 2H2DA 3GCZA 1ZFNA 3D0OA 3KDPA 3BD9A 4MAFA 3PHIA 3LLVA 3OM9A 1RBMA 1HZZA 1YB6A 1EK6A 1ZD1A 4PN3A 3H75A 2WNIA 4BYMA 1ZJWA 1I1HA 1H2XA 3BYZA 5JXIA 4G2TA 3WWDA 1QJCA 2NO4A 2H1SA 1GUDA 2XHZA 2VP5A 1NPTO 3KSMA 2EYUA 4LHXA 1GTG1 2RGGA 2W5UA 4HCJA 3N9IA 4Q9KA 3RYIB 1XWFA 4Q4HB 5J63A 4HNTA 4B74A 5JMPA 1Q19A 2VL7A 1KA9H 4JENA 3O8CA 4JOCA 1PGJA 1Y4AE 4M8SA 3IMEA 5IEBA 4HJXA 2EWVA 2NVUB 4EFLA 3OCVA 5BR1A 3TEMA 5E1MA 1RQPA 1W1IA 2WHXA 1XAHA 4F7WA 1SH7A 5HBRA 4D3FA 2JB9A 4XWAA 4LQDA 1YDWA 2PZFA 5KQLA 3U60B 1E1QA 2GJSA 2JZCA 1YUNA 5AJUA 3MMPA 2BHSA 4H7IA 4URFA 1XQ9A 1AO0A 1U98A 4NJEB 2JRLA 2FSSA 2XTNA 1OJLA 1AE1A 4UUNA 1G7CA 5E6SB 4I6GA 4ND8B 4AF7A 2X1MA 3WOHA 4RU1A 4K40A 4ALIA 3OPNA 2EG9A 3IRVA 3E9NA 3QUTA 3ZK7A 5HM6A 3AJDA 2P9EA 4O4HF 2PN1A 1SB8A 4MW4A 1BW9A 3KPWA 4OQXA 1R0WA 4ZYZA 4V1CB 2CFSA 4P58A 2EZ9A 4FE7A 1NLYA 4NCJA 3E3AA 1DX4A 4G5GA 2DTEA 4QPZA 4BB5A 4DM7A 4EUHA 1J7JA 1WTCA 3K9LA 1PT5A 2AN5A 1KBZA 3JRXA 3RE1A 3RSLA 4WZAB 5FBWB 1IHYA 1PW7A 1X7GA 2BBOA 3GEPA 3S3TA 5K8LA 2A0XA 2PLAA 3LKZA 1ESCA 2ZAOA 1WDMA 1X8KA 1XZAA 3AGQA 4QASA 2V6BA 3O0TA 1GT91 4X5OA 2C82A 1ZXBA 3KQQA 2QW0X 1CW2B 2V9CA 1E9DA 1X3SA 3QPWA 4GAEA 1IN7A 1XBTA 2H2IA 2PWPA 5B3AA 2PUCA 4W6QA 2IIQA 2I22A 5ALFA 2FRDC 4JITA 2G8LA 3UFXA 2AI1A 4KXLA 2QPLA 5IMSA 2C2GA 5JYEA 1XMXA 1ZM4A 3A6EA 3A4NA 1RQGA 2A59A 3NUZA 4IDOA 5M29A 5JECA 3M4NA 3A6HA 1JB1A 3LCMA 1RC0A 4KL8S 8MHTA 4OQNA 1RLJA 1WXIA 2Q2VA 4YTEA 3DWIA 1FP1D 4DV1B 2QLMA 4DHWA 4XSHA 4QJIA 1UDRA 2BTQA 1O57A 1AX9A 2XECA 3CZCA 4ZOCA 1V41E 5HXAA 3C6ZA 3JTMA 4YRAA 5JJBA 4LYFA 1YQUA 2QTLA 3LSYA 3TLGB 3U9LA 1Q7CA 1WCIB 1HT3A 3BMOA 4TV8B 3IAHA 2Q8NA 4H6VA 5HTOA 2E5LB 1D0VA 3CMMA 1R0SA 2Y0BA 3H9QA 3UW1A 4C4TA 4QBGB 4DXHA 1NRJB 4BY9E 3I2IA 1I3LA 1Y8RB 3A06A 3B2EA 4S0XA 5BQOA 2XB4A 3RBZA 1XSEA 3DOIA 3K71B 1IVSA 3AFOA 2O3JA 4CT0A 2CNWA 3BXXA 1RP7A 1QHHA 4XUDA 3IIEA 1SD1A 3RRYA 1XTKA 1HXHA 1W5SA 1GUFA 1FQJA 2E4ZA 2QTNA 5CVEA 5BURA 3PKIA 1JHDA 5CT9A 2XQJA 2MTBA 2EU8A 4HFMA 1IN4A 1Z0UA 2J08A 4L8FA 4M89A 3W3ZB 4JUFA 3IP9A 4ICIA 4TROA 3OJFA 4LQCA 3T7SA 2CVQA 1OT3A 4OSOA 4G0MA 4N7MA 1IH8A 2BGNA 1OU4A 3K09C 3ZCUA 3BSSA 4MARA 4QIHA 4NJMA 2C83A 3S1SA 3RB8A 1JT9A 1QNFA 2BSXA 2GN4A 3PWKA 2PUHA 4OREX 5CFZA 3PQCA 3NGMA 4DCMA 4B34A 4ZAGA 2IYOA 3AHGA 3KT6A 4P80A 1N9KA 1E0AA 4N4AA 1QPZA 3Q9LA 3OQ1A 1Y1TA 2R1UA 3IEIA 4HD8A 4M8NE 4A10A 1T2UA 4CN8A 1WQ1R 4LTMA 3D3EA 3TUZC 3E5MA 3BZBA 5EIHA 1PNOA 2A7XA 3U61B 2EHJA 2ZDQA 3KKZA 3RRNA 3U7GA 5A7FA 1MNQA 3CZ5A 1YRHA 5KNDA 1UC8A 1ULUA 2UZ4A 1C1DA 3Q7TA 3TZHA 2ZG6A 4BFVA 1QE0A 4EZBA 2CD7A 1C1XA 2G88A 1JTVA 2WINI 2Y66A 4RFVA 2AMLA 1TJYA 1SCQA 5IF3A 4QGBA 1V9SA 1E4OA 4ND3A 1N1MA 4FC7A 1MP0A 2Y0EA 3S1LA 1P2VA 3OWXA 3SBDA 4AJLA 1BVUA 3WXMA 3BFXA 3BKXA 4CIBA 3UATA 3RYCB 2OO5C 3W4KA 4L28A 4W5QA 3M0EA 4N5MA 1T3LA 2JCVA 2JVIA 3OHMA 4UVIA 4PG7A 3HCDA 4CMHA 3COPA 3HBLA 3LQ1A 2FPLA 2AFIB 5JQWA 2O9JA 2WUEA 3RFXA 2SECE 5C34B 3CR3C 3UMRA 5FQOA 1KJYA 2AUTA 3SZ3A 4CR6A 1XPJA 4DJFC 1ICIA 3FR8A 2J9XB 3E58A 2JJ8A 2P9JA 4A0RA 4EM6A 4MVCA 3LUDA 4LXIA 1Y4UA 1W4RA 3GLIB 2YWDA 1L5WA 1P4HA 4OTZA 1N8KA 1V37A 1VIAA 3N58A 3QM1A 4IHQA 5KBYA 3MMSA 3H11B 2WYUA 3F7NA 2OXFA 5A5FA 1KAEA 2E1RA 4OP1A 1KARA 1JWBB 3IPYA 2DWOA 4KUEA 1RBQA 1CP2A 1JHYA 3MMNA 5I9MA 1TADA 4HMQA 2PUBA 2F9LA 3CZMA 1JDNA 2VP3A 4CU5A 3A9VA 2C7RA 2PCJA 5COAA 1RRMA 1OX6A 3ESXA 3SXPA 3I1FA 3ELDA 1DAEA 4TTJA 1JLSA 2B9EA 4UUQA 1AM4D 4PSKA 4BWGA 4GLLA 1MFZA 1YZGA 5HHTA 1GLVA 2YV2A 3OZDA 3JYHA 4BQIA 2GTIA 3GNQA 4G2NA 5ALQA 2QQ5A 1ZD2P 3AV3A 1R0LA 1EWTA 2VTDA 1T2DA 2C5LA 3D6FA 4OHKA 1U0BB 5EWLA 5CAEA 4FFWA 4M0DA 1ZGJA 4R1QA 3USCS 5KJCA 3H84A 3Q1KA 6ABPA 3NIGB 5BV0A 4UBJA 3GBVA 3NM5A 4B2LA 3JVIA 3WKBA 1I1NA 4IIFA 3LDFA 1Z73A 4MW1A 4NPHA 4WLEA 4TYPA 4G0XA 4L8YA 5SV2A 3SX0A 4M0PA 2EV9A 2HJRA 2OQVA 1C9EA 3SE7A 3FE2A 3NTVA 4UEJA 5A4DA 4B45A 5KC8A 4ZTUB 1QBGA 3A1VA 1F48A 1E2MA 2AG6A 5KSPA 3LYHA 1CR4A 2MYNA 2CWDA 3CCCA 3LSTA 2BHLA 1VE3A 2WP0A 2N3ZA 3P0HA 4GUDA 5FFNA 4JLAA 3EODA 1PE0A 2CVZA 2R7LA 1X1RA 2ZS9A 5EQFA 1N1EA 2RSLA 3JATA 3H9GA 1O8CA 3MUNA 4IGFA 1ONSA 3HMKA 1LD3A 4C7VA 3FLMA 3SOPA 3ZWXA 4BN5A 4XTCS 1SUFA 4OLFA 4MUKA 3H1EA 4MYRA 4ZDKA 1IL0A 1DG9A 2ZI7A 3AFMA 2YVLA 4H1UA 5CCDA 3RVBA 1AKQA 1ZGCA 3G8YA 2A9FA 2FRVA 1KQ3A 3BERA 3DMYA 5JDCC 1JIQA 1QFJA 4CDNA 1E6KA 2ID7A 3KQYA 1A50B 2LBPA 4MS1A 3ZJ4A 1AC5A 1NBAA 2P3SA 2F43B 4D3XA 1YS9A 3NWOA 3AFGA 4LWOA 2UVQA 5CIYA 4G0WA 3VR2D 3HJBA 4HEQA 1JEQB 4WOPA 4PFKA 5ICSA 1JA9A 1DRUA 1JI0A 3DOHA 4ZEMA 2DERA 4HNRA 1EK5A 1Q95A 3L8MA 4OB6A 1U6IA 1BO6A 3CZRA 1UFKA 3DLCA 1PW5A 3RUAA 3S2ZA 4RVGA 1NV8A 3ZD8A 4ES6A 4B76A 4MLZA 4UOQA 5HF5A 821PA 5DM2A 1ZM7A 1LW7A 2O3SA 3ZWBA 4YDRA 2H9YA 5IU6A 3DUFB 2CMHA 3RSOA 4YJ2B 3CKKA 1EVIA 1UM8A 1BH6A 6GPBA 4R3WA 4KO1S 3GMTA 2JI4A 1CQJA 2ODTX 1BOFA 4R2IA 5FB3A 1L2TA 5GIOE 5EINA 1DBPA 1T8UA 3DZCA 4EKEA 4JEIA 3RREA 3AUFA 4OY3A 3KKNA 2ONJA 3OQVA 1DINA 5DMHA 1EFAA 4XJTA 1CTQA 3UMFA 1ZZEA 1XK6A 2FEWB 2VVTA 4DPMA 3CUTA 3E7WA 3ND6A 3GH3A 2A9VA 4PZAA 3REOA 3KT8A 4FMDB 1Y82A 1MRNA 1GDHA 1P1KA 1RPAA 3T99A 2ZTHA 2UKDA 4HZGA 2PVSA 1LS6A 1WMAA 4WCVA 1H6DA 4TLAA 2XUZA 3TLEA 1QVRA 4RTPA 1UH5A 4WN3A 1NBOA 4QUIA 4RK0A 2JKVA 1ZNXA 4UTOA 2Z57A 4XM0A 1QP7A 1O4VA 1E2QA 1VOTA 1GAJA 2R8XA 4D4JA 3WVNA 3M3DA 1XTRA 1NXSA 4J0CA 1P3Y1 4XQGA 1I7NA 2D06A 3ROGA 1APBA 2DPHA 4KDCA 1SOUA 3CVWA 3E9RA 4URWR 4MVXA 1YZ3A 2DBQA 4M60A 1KO7A 4AROA 3W5HA 1NOJA 1I4TD 2DQ4A 2V7XA 4V1CI 3ETCA 1BTOA 2PWBA 4IFEA 4Z7NB 5BYJA 5CCBA 1HZZC 2I1LA 4IQFA 3SSNA 3DO8A 4XIFA 1NU8A 1D4AA 3KFVA 2XAUA 5K0JA 1LDBA 1RWKA 4MQEA 5FBHA 3K0CA 1L4HA 4L85A 3ZOZA 3AY6A 1KH2A 2AN3A 2DSTA 3SJUA 5EG5A 1I3NA 2HK9A 2HC9A 3OTHA 4FI3C 3SSMA 2SKEA 3C7KA 3GT4A 1PU2A 3B9BA 2NO0A 1VJ1A 1XMJA 3O3MB 3QVWA 1V0JA 3ORQA 3PFNA 1QYRA 4YP7A 2L18A 5J2UB 1QFYA 4CR8A 3IBYA 4KE6A 3V48A 1EK0A 1UZUA 4C9BA 1BA2A 3GLHB 2ECKA 2UV8A 4I1IA 1Z4JA 3I09A 1NBMD 1G1AA 4MPDA 3AUTA 2VNSA 3QOXA 4GX1A 3H8WA 5REQA 1L7QA 1ZAKA 1NR1A 1NLMA 4R0VA 4BKPA 3VO8A 1WW8A 1XRLA 1M6NA 3GRRA 4TVBA 1A9SA 4BU0A 1DOZA 3A4YA 3R7WA 2NZYA 3DEYX 1I32A 4NS1A 3RNLA 3ASVA 1FSPA 3GN1A 3OIWA 3PQ7A 2JAUA 4ZREA 1MAVA 2PBLA 4JR1A 4LTDA 4QWWA 2J1LA 3JQFC 5CT6A 5AW9A 2QVGA 2V5VA 1OAOA 5JY6A 1A69A 1WVGA 2DHDA 4XLTA 2XNDA 2P40A 1Z6AA 4L0CA 3I28A 4TPKA 5JADA 4J9VA 3R8CA 2Y0DA 4KQKA 4Z3DA 4WSOA 1Z5ZA 3NXKA 1XZFA 5ALOA 4X62B 1FZTA 3U3MA 1SBTA 1PTKA 1AGYA 3W9SA 4KJXA 3FYCA 1QHGA 3N74A 3TLYA 3W2HA 3HDTA 5F5LA 1EB8A 3VHLB 1J09A 1WL8A 4DS3A 1YT5A 3PQ5A 3FN4A 1MIOB 4ZV9A 1XCOA 1V4NA 1U0EA 4IXDA 4PAGA 4UBMA 4ZCQA 4MYDA 4DA4A 1JR3E 5HF6A 3TIVA 2WI8A 3MHTA 4GOJA 1CXZA 2WTAA 2VTVA 3EGDB 4QU9A 1WBJB 1Y7IA 4B4KA 4XYEA 4JFAA 1JKXA 1BHJA 2D62A 5LLDA 2YV1A 2XA1A 5KYXA 3Q15C 3PUWA 5K6AC 1EX1A 5C1IA 3CX4A 1Q20A 3JQAD 3NDJA 1A9XB 1HG1A 1T2CA 3LZDA 4R1MA 3VHQA 3KJNA 3BAZA 2NU7A 5CTAA 2WAYA 2VBFA 5C5CA 4H7HA 3CR7A 4BCBA 4EI8A 2EVWX 2GVZC 4LYAA 3CLUC 1B1CA 1HO3A 1D07A 1UMKA 1W8IA 1ZOPA 2KLBA 1E32A 3DNFA 4NBTA 3PGJA 5CXXA 2EF0A 5IDVA 5IT5A 4OLBA 1KXZA 2BEUB 4MGIR 1X13A 3WNDA 2YL2A 3HJRA 5TQ2A 5JNRA 3EVTA 1S2DA 1XV5A 1YDMA 1VPDA 2ZB3A 4EVRA 1JDTA 2TMYA 1OFTA 3DZBA 2EJUA 3SHVA 3RRXA 2PBZA 4B7CA 5BWCA 5JJ5A 3U6BA 3RSHA 2LTAA 3QLJA 2FPUA 4NMLA 4WACA 4EJFA 3V4FA 1Z4PX 4HX5A 4D97A 1ZAYA 1W36D 3FHOA 1V95A 3B7WA 3S27A 2CV1A 1RQRA 1UOEA 1XD2B 4V3CA 1LLQA 5E6UA 3DOOA 5E4JA 4EGFA 4F9TA 1ZBQA 1TUBA 2QAJA 3DYIA 3KTFA 1KI4A 2C1ZA 3R7DA 4GMDA 3RC9A 4CLRA 1ESNA 4HNAB 1ELOA 2SKDA 1VPVA 4GMFA 4XGQA 1FXUA 4WN9B 1PDWA 4X95A 4ZO4A 2WWRA 5ARBA 3U5TA 3HI4A 5CDUA 2WUDA 4CM6A 1GL3A 3CZAA 3GGJA 5JPCA 1KMCA 3F47A 1W0JA 2AZDA 2QWXA 4JGIA 5A4IS 3S8MA 1Z4MA 2ID8A 1NF9A 2ZUEA 1IRXA 1IN1A 4HUJA 4A6EA 1R0BA 1XP5A 3AP2A 4R41A 3LPLA 5AM5A 1FDIA 2FH5B 4F6LA 2J59A 4DCVA 4F92B 1BXGA 1TMGE 1Y7TA 4LJ6A 3KYIB 1E3QA 3NR2A 2ZJ2A 2HTEA 4PYQA 5FHQA 3G9TA 5KC9A 2NNWB 2NTJA 4IIBA 1PNTA 3BIXA 4OMFG 4E11A 1PSZA 1YBVA 2AWNA 2JLSA 3L8HA 1ZUHA 2P67A 4UTXA 1DC7A 3R41A 4WNAA 1T2EA 3CTPA 1UM9A 4HFJA 1S8NA 3U7RA 3JQPA 2PYDA 4GYYA 4FWIB 1AHPA 1JEYA 4B6SA 3KOOA 4M1ZA 4HVTA 4MKGA 1JGTA 2IDKA 4O2AF 3VKGA 3LC1O 1YR3A 3L7OA 1CUGA 1ODCA 2WIGA 3MLBA 4TVKA 5G1OA 3ZQJA 4CI0B 4F4DA 5C37A 3F7MA 4NNPA 4N7RA 3ZXYA 1NX9A 3AY7A 2WFLB 3F49S 3UGJA 3FRHA 4X20A 5IARA 5AVQA 3WL5A 4RD6A 5I7AA 4HOYA 4R6WA 2VDOB 2OQ2A 2JJYA 2AA3A 2YVQA 2P9FA 4H1TA 2GWHA 3DZJA 1C3VA 2QT0A 1R0CA 4QOSA 3ZDQA 1ZLXA 2EP7A 3ESZA 3I72A 3ORYA 4RGVA 4DG9A 5IYZA 1W1WA 2IS1A 1QUFA 2V7TA 1YQQA 3C6KA 3HGMA 2DHEA 5GGYA 3GVHA 4CM9D 1Y6FA 4LF8B 2CEAA 3WRXA 4EHBA 4EB0A 5IT0A 2WSMA 1L8OA 2C2ZA 4E5NA 2GPBA 1XPOA 5F21A 1AA6A 2Q4TA 2PL5A 4G63A 4BU1A 2AUNA 3P0FA 4ZT3A 2OECA 3MS2A 4FYVA 2G6TA 1D03A 3H7AA 1SZPA 2GHTA 1OCEA 4E5VA 5BVGA 3DZDA 2IHZA 3LU1A 2NWQA 4PLWA 2VXCA 1UC9A 3AQIA 3L0BA 3HB1A 3A1WA 5BN3B 1QZZA 1KYZA 4GNRA 1O94A 3O1IC 1DL5A 1T35A 3FRJA 1NC1A 2SICE 1KPIA 3PTZA 4KEAA 1XUOA 4JUBA 5IULC 1FMFA 1IEQA 5IUJC 1V4BA 2OGSA 3OUTA 5F5NA 2D3TA 1ZM2A 5I9TA 3U4CA 4ZCPA 2VJYA 2FOLA 5DI3A 1RCTE 2J3HA 3MT0A 3FJOA 1P5RA 3R6LA 5G0VA 3SYRA 5J4KA 4B6EA 5LVAA 1I33A 4CMJA 1E9BA 1GEEA 1IEXA 2JHFA 3PSAA 1EZZA 5MGBA 4AQYB 3FMFA 4MHTA 1TAQA 3C3PA 1W5EA 4FFLA 4WE3A 2FPRA 3TL6A 2HSGA 4FKBA 1JFRA 7AT1A 1ITZA 1A9OA 1HYHA 3L8ZA 2J0UB 4DHEA 5K9ZA 2AK2A 1J8QA 4FB4A 3W1VA 3QWAA 3K8ZA 2ZOSA 1HYQA 1FUYB 1WPQA 4KFCA 1AKYA 3BF7A 4H27A 3PZRA 1HEYA 2I1VB 1DZ3A 1JQJC 1RPNA 1HDIA 4M38A 4V0KA 2AKAB 2N47A 5TX7A 2QX6A 3D2AA 1XJWA 1XRNA 1YZYA 3K1JA 1CUFA 2IPMA 1NUAA 2DECA 1JMYA 5J1TB 3SX4A 4DW8A 4BBPA 1FUUA 4JDUA 3N0TA 4Y9SA 2FJ0A 1U9IC 4YUAA 5CB6A 5DGDA 3JD4A 2AJTA 1IQUA 1T29A 3R44A 3ZUGA 2UXBB 2NYAA 4F04A 1VJ5A 2VUIB 3WGJA 5B36A 3BBPA 3F6BX 1KMNA 1L4YA 2EX1A 1RFLA 3UGTA 2AV6A 2RK6A 4I4TF 4IS3A 4DYHA 2D1TA 2Q28A 4PG8A 1BEZA 3S2YA 1X7YB 4F1KA 3U3XA 1RRFA 4D57A 1MAUA 3Q88A 1BX1A 3OE5A 3EVAA 4LYEA 5FH9A 5IHPA 1BDHA 1DNPA 3TF5A 1JX6A 3W8NA 1XQXA 4LVOA 1WLYA 2ZPUA 1WHSA 1A5BB 2G07A 4IYRA 1CVIA 2BR3A 2PK3A 3G3EA 1D5WA 2CFOA 1AY0A 4JI7B 1JR3A 3G0DA 1A0OA 1T26A 2VQ3A 1RHKA 3EUFA 3H8JA 3IUPA 3CW2A 1Z45A 2QRGA 3KHSA 4G97A 3UMCA 3E7XA 4BO4A 1OILA 2V8OA 3LKDA 4WRRA 3ZV5A 3R5JA 4NENB 3D3JA 5HQ3B 2JFXA 1O7JA 1SKQA 2HL6A 1KSHA 2J8ZA 2Y71A 4V0ME 5ECYA 1BC5A 2GUGA 3UOWA 4PNEA 1YQ9A 3BMQA 5KTRA 1M76A 5KWEA 4JJFA 2AEFA 3A32A 3VPXA 3CJRA 2L69A 2VK1A 3PRKE 4LRSB 5G3ZA 3BJEA 3WK6A 4K46A 2YJNA 4ITUA 2Q62A 4HH3C 3BZWA 2JGJA 5DTRA 3ZH2A 3V2UA 1M7GA 4J43A 3DFKA 2XNJA 2XUQA 4WMLA 3PKZA 4YLEA 1L7XA 4PRLA 3C14C 4N6GA 4NOKA 1SQGA 2D8AA 3EPKA 1S2IA 2JL1A 3C8MA 4GVXA 2BUCA 3QZUA 2OYRA 2JIBA 3L7LA 2VZ9A 3I8XA 2X5JO 5BO5A 5DP2A 2XUGA 3NMUF 3G1WA 3IBCA 2H5IA 1S7GA 2FLWA 3E5NA 1F9EA 4YONB 3VMFA 4RSHA 2AJLI 4J6FA 4YALA 2E5WA 3E5HA 4C5CA 4MUJA 2WDZA 1C8LA 2GJ8A 2QVXX 3D1LA 3I9JA 1BD4A 1QKJA 2UXDB 2DWCA 3SF8A 2X22A 3GD7A 3AP1A 1TVMA 3GPIA 3ILSA 4I6EA 1RC8A 4Q4AB 4R40A 1U8ZA 4OHOA 4EK9A 3R74A 2FNAA 1SIBE 4V02A 4G85A 3AKYA 4JZKA 4QGFA 1Q15A 5LP1A 3PNMA 2WDPA 4P22A 1FDTA 1RU3A 2AR0A 5IVHA 4BUCA 1BJTA 4AYTA 4BC1A 3RSFA 1N6PA 4MLDA 4OG2A 3BXHA 1DO8A 1IJFA 4JJGA 3PYXA 3HVRA 4R8LA 3MTIA 4MRMA 1P2SA 5ALXA 1R74A 1NVXQ 1QJ4A 3RC8A 3ROTA 3BIJA 3KTAB 2DWPA 5CX1A 5TNXA 5KDLA 2ZWPA 3HHPA 4UULA 3LO8A 3E7DA 3DBIA 4X1KB 4YAJA 4CMIA 2NYVA 2P6UA 4YCAA 2CK3A 3DWEX 2COKA 3QYFA 4DILA 1YONA 2DZDA 1T43A 3DHYA 4YLYA 4NARA 3ED1A 3LBHA 5ED4A 1WE2A 4DLXA 3AVYA 2UYYA 2JFNA 3UK6A 3F1LA 2HT6A 1RPTA 3U6KA 3D6HA 3DV0A 1PJ8A 3HJAA 3UQYS 5EPOA 3G8CA 4TRRA 5KU7A