2Y1LA

Caspase-8 in complex with darpin-8.4
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
150
structure length
150
Chain Sequence
LDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CASPASE-8
publication title Caspase-8 in Complex with Darpin-8.4
rcsb
source organism Homo sapiens
molecule tags Hydrolase/inhibitor
total genus 56
structure length 150
sequence length 150
chains with identical sequence C
ec nomenclature ec 3.4.22.61: Caspase-8.
pdb deposition date 2010-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2y1lA00
4I1PA 1NMEA 3PCXA 5LUAA 2QLFA 3OD5A 4JJ7A 2H4YA 4ZVQA 2H5IA 2K7ZA 2P2CA 3DEJA 4QUIA 1KMCA 3PD1A 2XZDA 3UOAB 3ITNA 2AR9A 2HBYA 3S8EA 3P4UA 4QTXA 3UO8B 1RWWA 4NBLA 4ZVUA 3R5KA 4EHAA 3P45A 3EDRA 1NW9B 3K7EA 1BMQA 2C2ZA 2C1EA 2WDPA 4QU5A 1K88A 2QLJA 3H0EA 4HQRA 4EHLA 2C2KA 3D6HA 2J32A 4NBKA 4QUJA 5LUBA 5IAJA 4QU9A 4QUEA 3GJRA 1RWPA 1PYOA 1RWOA 2XYGA 4FXOA 1K86A 4IEFB 2H51A 3S70A 3SIRA 1RHRA 4DCJA 4HQ0A 4EHDA 1GQFA 3H11A 4JQYA 4NOKA 4DCPA 1F1JA 1M72A 4N7JA 1GFWA 1SC3A 3KJQA 4NOJA 3V4OA 4FEAA 2C2OA 2CNNA 5H0IA 3R5JA 4N6NA 3V3KA 3V55A 4AWAA 1QTNA 2CNOA 5IBCA 3D6MA 5LU9A 5IAKA 4NBNA 5IC6A 4D3YA 5IBRA 4EHFA 4ZVPA 1RHUA 4NOMA 5IASA 3DEIA 1SC1A 2XYPA 3BIJA 4IYRA 3KJNA 3E4CA 2XZTA 4FDLA 1NMQA 2CNKA 3GJTA 2HBRA 1RWXA 4QUBA 2CNLA 3SIPA 1QX3A 1JXQA 2H48A 4AWBA 1F9EA 1IBCA 3EDQA 1RHKA 1RHJA 1RWVA 2XYHA 4QULA 5JFTA 4AW9A 4ZVRA 2H65A 3H13A 4EHKA 4N6GA 1RWKA 4EJFA 1NMSA 4NOLA 2CJXA 4QUGA 4JR2A 3R7NA 4ZVOA 3V6LA 4N5DA 1RE1A 4M9RA 3GJSA 2DKOA 5IBPA 4QTYA 1RHMA 4EHHA 1RWMA 1I3OA 3R6LA 5I9TA 4JB8A 4N7MA 4QUDA 2FUNB 2QL9A 2Y0BA 4JJEA 4EHNA 4JR1A 4QU0A 4QU8A 1ICEA 2CDRA 2HBQA 1RHQA 3IBCA 4PRYA 2QL5A 4N6OA 3DEKA 2H54A 2J31A 3R6GA 2CJYA 5IABA 1QDUA 4HVAA 2HBZA 3R7BA 1RWNA 2Y1LA 3RJMA 5IANA 4I1RA 4JQZA 3KJFA 4JR0A 3QNWA 3IBFA 4D3XA 3NS7A 2H4WA 4DCOA 4QUAA 4ZVTA 2FQQA 1I4OA 2NN3C 3NR2A 1SHJA 2QL7A 3H11B 1CVRA 5IAEA 2FP3A 3NKFA 3H1PA 4PS1A 2QLBA 4PRZA 4QUHA 5IC4A 3DEHA 4FGUA 1SHLA 2J30A 3GJQA 3V4LA 3PD0A 1I4EB 4ZVSA 5IARA 5IAGA 1I51A 4JJ8A 4PS0A 3R7SA 3V6MA 4D3ZA 4LSZA 5LU8A 2C2MA 1CP3A 2J33A 3D6FA 2H5JA 5K20A 1PAUA 5I9BA 1SC4A
chains in the Genus database with same CATH superfamily
1M75A 1QKKA 4XFKA 1FLNA 1USIA 2HUNA 3QSYA 1RACA 1Q0TA 2GPJA 1SPXA 4M0KA 3VR6D 5AUOB 2FRVA 3I9LA 2BFCB 2IYAA 2KMLA 4O2BA 2BHTA 4M1KA 1L9XA 4TYMA 3TRDA 2OZVA 3U37A 3EGVA 5BWNA 3QX3A 2HT1A 4JKYA 1PGNA 5DP1A 5FL7A 4YREA 4NTZA 1XTVA 3A32A 2F3TA 1U1EA 3PNKA 3O2NA 3RF6A 2ZQ5A 2FHSA 2FFJA 1OROA 3EHEA 3ENVA 3OCCA 3O8BA 3RKSA 3TTSA 5I5EA 1IBLB 3KEQA 3OX3A 1ZN7A 3E70C 3GFRA 1R7RA 1BJRE 1CEXA 1EP1B 1FDVA 2G82A 4UFOA 4ZGBA 5KKCA 2O8BB 3IPLA 5JS6A 1GLVA 3TQOA 3OICA 3EODA 1GP2A 4M0EA 1FX0B 8MHTA 4I55B 3ICWA 2YWDA 1PK8A 1TEHA 4UHCA 4WK0B 5I7FA 4KWEA 4D82A 1E0SA 1Q95A 4BFLA 1T3GA 4LJLA 4K9DA 1Z7WA 4NARA 2OPHA 3GEHA 1PL0A 1UJNA 4MIOA 1JTFA 4COKA 2E0IA 4HQOA 1KZ7B 1J2JA 3ZWBA 5JFOA 1R6VA 4L51A 4ILEA 2RG7A 4PFJA 3RPEA 4CM9A 3PLAE 2NT4A 2WVHA 2A78A 2F3SA 1N7HA 3BAZA 3I2YX 3LSTA 2ZT8A 2VHVA 3AUFA 3GT0A 4ON9A 4OQ4A 4RQUA 2RSLA 2RGWA 3C4JA 4X66B 1SUWA 1RIFA 1CQIA 1K7FB 1XXLA 5ER6A 2OK8A 5IDXA 5JXIA 4JOCA 2CUNA 1THMA 4UHKA 1ZESA 3FFXA 1F3LA 1ZWKA 2X0IA 4K40A 1SKMA 1NKTA 2EV9A 1SOVA 3NX4A 4Q4AA 3TD9A 1UBJS 5G4LA 3SIPA 1RE0A 2XOKD 5JTTA 4MXDA 4W1PA 3HU5A 2P1DA 4P86A 3GAAA 2B99A 4I55F 3OTHA 4OF4A 4URFA 3TL6A 2ZRBA 3U7JA 2HWWA 4TWRA 4LFCB 1X1SA 1NUTA 2A5DA 2DH6A 4R8VA 3TQQA 4D6YA 2Q49A 3JSAA 1YC5A 1DFIA 3F49S 3JVVA 1WDLA 1I5EA 1WPXA 3O84A 4KNVA 4U7HA 3U0BA 3TTYA 3W2EA 4AN0A 5FX2A 1ULZA 1K9VF 3JQAD 4CE6A 4FUTA 5JWRA 2VYNA 4F21A 3VAYA 1DOAA 2XKAA 3PTLA 2EDCA 3W8FA 1ACLA 4X20A 4AJLA 2J9RA 1GQ2A 3ICCA 1GO2A 1W44A 4UM8B 4OLAA 5JT1A 3TQRA 3ETGA 1RYHA 1H4QA 2W6JA 4MSUA 4JMPA 1FW6A 1ND6A 1W94A 2FTKE 3NGLA 2HC9A 1PBNA 1CYEA 2VATA 4KLCA 1WB5A 3MJSA 3M4ZA 4M89A 1U0BB 5D3MA 4KBYA 4YRFA 1HDYA 2R48A 4LTDA 4MB0A 2EGGA 2A5LA 1W73A 2ZUSA 1TK2A 3ELDA 1PR9A 3F4LA 4OM8A 2GYWA 5KS2A 2H8KA 1EBBA 4OLHA 3M2PA 3Q5GA 3UJ9A 2D0IA 3U3JA 3GLHB 3D7RA 1T8RA 5DTMA 1KRHA 2GJ4A 3DD1A 4G07A 4RBNA 5F3WB 5KBYA 1I3NA 5AXCA 3ZDFA 3FMPB 3OIFA 3P9IA 4DTCA 1RYDA 2HU7A 3N76A 2R79A 2PZFA 3Q3EA 3GLUA 1E0DA 4LI3X 5LJLA 3DCJA 4MVYA 5EJEA 2ZOSA 2EATA 4HS4A 1A7JA 3D5EA 4XGNA 1KAMA 5HIMA 2C77A 4JK3A 4AX8A 4HB2A 3R6TA 4NZYA 3M7IA 3UA4A 3L1HA 4KZKA 1KVQA 3SXJA 1KKLA 1R66A 3KTDA 4ND3A 4WNAB 1R0SA 3AG5A 3Q98A 2BFDB 4KH1A 2GCGA 4UPEA 4HYEA 4YACA 5B36A 2IPMA 5D5HA 4EFDA 1JIXA 3OEHD 2YYZA 4DDHA 2VO1A 4HNAA 3IFSA 4IVPA 1M34A 4RENA 1X1CA 4QYIA 3M6AA 1C7QA 1JJIA 1FLVA 1N9ZA 2P0EA 3EYAA 3IAAA 3IT0A 5FHQA 2GNPA 4QE3A 5ILQA 3WADA 5D84A 4WK2B 4ZAZA 3EVDA 4J2OA 2DX7A 1H2AS 4OHRA 5ENDA 1W30A 5ITZA 3ER8A 4H3VA 2V98A 1L4FA 3H11A 4P4TA 1Q1BA 4IHQA 4YPFA 3LVRE 1FFSA 4YO7A 3SSAA 4DSZA 3W78A 5F2NA 4CI9A 3FH0A 4MAFA 2X0RA 3VVCA 2W4QA 2UYQA 4OFXA 3Q15C 1MTOA 2I9KA 3TINA 2J0EA 4GOKA 1NVTA 2KPOA 3CM0A 4BO1A 1EVYA 1LS6A 3L8YA 3QFSA 4OBXA 4QREA 5C4IA 4PO3X 4EEXA 5AFSA 1A8IA 5LQNA 3PX7A 1NNSA 3EDYA 3IUPA 2FN7A 1EWTA 2IXEA 3M5DA 4EPXA 3P2KA 1PS9A 1V11B 5G3ZA 1YMVA 1NQAO 3LY5A 4OL9A 3DHYA 3M4YA 1WV0A 2QYHA 4QRHA 5ER9A 1Y4UA 2NTVA 2Z3WA 3SBOA 4RV9A 5CDSA 4JYAB 1RKQA 3KJHA 2HWKA 2Q5JA 4PZLA 3FOWA 4H1HA 4W7HA 1A82A 2JHAA 3WL7A 3A1FA 3AONB 5CFOA 3VPSA 1FVFA 4EARA 5H68A 1VG8A 4ND5A 3S6JA 3UGTA 1CJUC 3RVRA 2W37A 1WBDA 3MW8A 5EUCA 3A27A 4AZVA 2XB4A 1GTSA 1UCFA 1DXQA 4ZTBA 2VCHA 4KXUA 1HTBA 1W5AA 3HCEA 1EVEA 4R1OA 1O58A 2TECE 5GQSA 2X8LA 2QL9A 1POWA 3IAS1 5ALHA 1QHNA 3PNYA 4M46A 4Q7QA 2P75A 4EY5A 4DB2A 2W8BB 1G291 5EEHA 3TOXA 4YCSA 1LUAA 1TUBB 3AY6A 3EEQA 4K9KA 2X3FA 4NY1A 4QASA 4DMLA 4L0MA 1ESDA 1OB2A 1RWNA 2P9TA 5AM2A 3AKDA 1EH5A 1HTWA 1X9GA 1R9MA 4E0BA 4KHPB 4DLUA 1MC4A 2DE0X 3GLTA 1MAWA 4OFBA 3WNQA 5HKKD 3OLCX 2HMSA 4QA9A 4DV7B 1CZKA 2Z6QA 3RV4A 1KK1A 1QVVA 3D64A 3KBOA 4JC5A 3NOQA 4MGEA 4JBGA 4PGGA 4BGEA 5A6SB 3JYNA 4EY4A 2I4LA 2PIDA 4Z4HA 6LDHA 3MT7A 3OA0A 5IJAA 3K8YA 4YAJA 4WJLA 1JKJB 1WABA 1Y37A 2I71A 4K9QA 4ZOCA 2FZWA 4RSHA 1PJ8A 3TLAA 4CCAA 3AINA 2CDBA 3IAXA 4M9UA 5IZCA 3P9RA 4IOMA 3FCEA 4UAJA 3ZG6A 3SF0A 5BT8A 3P96A 5FBHA 1ZR2A 5TQ0A 2NG1A 4YYEA 1G16A 3LO5A 1RPZA 4GSLA 4UBLA 1Z4OA 4KTTE 4BAGA 2WC1A 4HF7A 4AK9A 2OHIA 4CQMA 3WHKA 2XUQA 2HBYA 1TZCA 3UNXA 2R6AA 4Y0NA 2E37A 2CEKA 1P7ZA 1VJRA 4FYWA 4E5NA 4Y1RB 3GWGA 2YMPA 5DCWA 3FJ1A 5AOCA 1VI2A 4B7CA 2NUAB 1GXSB 2PLRA 3A06A 3W2IA 1KO8A 3OUUA 4J0JA 2CXUA 4INAA 4WXEA 3RWMB 4PZDA 1B7GO 2XNDD 4PANA 5GY7A 1JQBA 2XYGA 5CX4A 1IJEA 2YFQA 1RADA 3MUFA 1JEJA 1QE3A 1T4DA 5HKBA 1BFKA 3DDSA 3CB4A 3I4FA 3NB0A 3TJMA 2J8ZA 2H2IA 3VJLA 3WLQA 3SFTA 1KZ9A 4C7MA 1KI3A 3P9CA 2OMEA 2FUG1 1SC3A 4GC5A 4KIUA 4Y2QA 1SB8A 2CNNA 1QK5A 4B85A 4P53A 4M87A 1OLXA 3INNA 3AVPA 2V54A 3OCWA 4JBYA 1JIUA 2DR3A 1TLFA 2N3ZA 3SR0A 3WY9A 1OI3A 3OE1A 4N0QA 3V8MA 4C4OA 2OO5A 4N40A 3TFOA 5EWJA 3OZVA 4RO0A 2QW8A 3ZPXA 3C5CA 2XDQB 3R6DA 4J0GA 2WJ6A 2ZBGA 4RH0A 4I8DA 1HKUA 3EUWA 3QKIA 4A6XA 3FNRA 2CNKA 4IH1A 1RYFA 4POOA 1YIAA 5A4DA 3OIDA 3NRJA 5C46F 4RD6A 3V7WA 3CVOA 1M5UA 2IU0A 3FHOA 3T7DA 3O7MA 1PVVA 2W11A 3FJYA 3TOZA 3HJTA 3PL5A 4DLBA 2RE8A 4YROA 1QVWA 3E5HA 3OHMA 3TX2A 2Q62A 2OXRA 3IT2A 4JEIA 4QPCA 2QQGA 1OFVA 2JH8A 3ONNA 5DYTA 2R8RA 5HPYB 1LA2A 3O38A 4LC0A 4LC1A 1IQUA 1KSFX 4RM3A 4W7SA 4P7KA 4ZODA 4F5DA 5IYZA 2QMZA 2X86A 3MELA 2YIMA 3PRYA 3WO1A 1YHZA 2NXCA 3M3DA 3WNBA 2G04A 3AR3A 1NTRA 4PINA 5GJBA 3CLSC 3PXEA 1W5FA 3AH8A 3CTPA 3RTBA 3QW2A 4HZGA 4C88A 4QXOA 1GWNA 1WCV1 2DCMA 3DMFA 4TYPA 4ECAA 3HU2A 2W58A 1A50B 1HC7A 2QRUA 2ZYUX 3QU2A 4I3GA 2CXRA 2A14A 2JGRA 3IODA 3HB0A 2V9CA 5TGDA 3O5AA 2QJOA 5JJLA 5B58T 1U3DA 1QPGA 2Q6KA 4ZV9A 1SK8A 1NY5A 2NACA 5BXYA 4B3FX 1XMQB 5K99A 3EGDA 3WJ7A 1ZG3A 2DWQA 2WJJA 2QWXA 3IP5A 5LA6B 3SKVA 5I9IA 3AVWA 1RRMA 4DUZB 1IYZA 2V7XA 4DT1B 1DC3A 3QKRB 2R47A 4ZQIA 3I4LA 5IULC 3HCRA 2J3DA 5K20A 4YEDA 1DAFA 2QQEA 3OJXA 1ISPA 2NZUG 1MIOA 1EZ4A 2ZYIA 3H4VA 3C3KA 4MCAA 5I7EA 5J3JA 1QRTA 2OO5C 4DPLA 2ORWA 2W2LA 2C4NA 3RVOA 3W9UA 1HYHA 3LBHA 4MQBA 4WZAB 5I7UA 2Q1XA 5HRCA 3LRPA 2GBIA 1ECLA 3M9XA 3O93A 4MW0A 4R8SA 1M6EX 3BB4A 3T5CA 4DLKA 1CEYA 3QUCA 3RVQA 2YDYA 2YY7A 4AF8A 3IVAA 4MDFA 4PLYA 1SQ6A 1ZK0A 2D5CA 1Y1KE 4AYTA 3NG1A 4CL2A 1A2KC 1LNQA 3OQJA 4O25A 5FLEX 2ZIXA 4YA6A 2ZJ3A 2PKWA 2WV9A 2LW7A 2FZCA 3ELBA 4XRRA 5JMPA 4EPTA 1NVBA 1CJBA 1C5KA 4JJKA 3KAJA 4C0SA 4CTJA 2OUKA 1WDMA 4EG7A 2EF0A 3V8VA 1WBJB 1CEQA 4NJEB 1O94D 2JFHA 2HF7A 2ZRDA 1Z08A 4MGHA 4HNRA 1E96A 2YXDA 3E05A 4IXTA 1IEVA 2J87A 4E11A 4XLTA 4AVYA 3CX3A 4L57A 2EZTA 4OH7A 4PRLA 1OU0A 4DKJA 4OK6A 1IU9A 4B73A 2XR1A 3FVWA 1G3QA 1G1AA 3AZQA 1OX6A 1MOPA 3X3HA 3ACDA 2ACKA 4JI5B 3LBYA 3VR5A 1KJIA 2ZBQA 2ZPAA 4JLBA 4IQGA 3RARA 4PXAA 4N65A 4TTPA 1XSEA 2MCFA 3MUOA 4LHXA 3I32A 4A0RA 1N1DA 3RU3A 1XTTA 1Z4JA 3KXKA 1OOEA 5ERYA 5JISA 1H0HA 3R8CA 4OLBA 3A11A 2BMEA 4OJQA 1NA5A 2NADA 1W1UA 2HA7A 4AL4A 4Z54A 4F4CA 5L6MB 4MWBA 4GM0A 1BTOA 5SY4A 4S1TA 4DBVO 1VC2A 4JJ4A 5LZ4A 1C8VB 1ZNZA 1KXJA 1MQ8B 2PG3A 2QW1A 1OLSA 4GIBA 4L9WA 2DWPA 3GCGA 2QGFA 3BH6A 1J0EA 3H6KA 3P8ZA 1YZQA 2NTNA 1RAFA 2YXEA 4FFNA 2YHIA 4CQJA 3RJTA 4DR1B 1W6RA 2OUIA 4N5DA 4Z3DA 1QB7A 4NENA 3EEFA 3GOHA 1VJGA 2H00A 3TLGB 3V7NA 1EP3B 4C2AA 4F9GA 1SBNE 4MS1B 3DC2A 4OHWA 1M1ZA 4YDSA 1DAMA 1JSXA 1MIHA 1J39A 3C48A 5HX7A 3W8RA 2QV7A 5CT6A 3RC9A 4WN9A 1QQTA 3PWZA 3NRBA 3X1JA 5IVHA 1TZ2A 1W25A 1ODIA 2H7XA 3A6PC 1FFEA 2OCAA 3NT2A 4PYLA 2FPPB 3SQMA 2HBZA 1QGUB 4BE9A 1Q15A 4MP3A 1IWBB 2QJTA 1XD8A 1XDDA 3ZE7A 4X7PA 1VCMA 1I7DA 4AZ3A 3AZPA 3KTAA 5GZ3A 4MR9A 5G0UA 3F0TA 2B8WA 4BNDA 1U2DC 1UEIA 2MSEB 1C4KA 2PRKA 4KX3A 2MYUA 5LZ8A 3EDOA 3E9NA 2I1LA 5E0OA 5JS8A 3FTEA 3CMMA 5D3QA 2ABWA 4IL5A 1S3SA 2E89A 4ARZA 2IW3A 5IW8A 2VRCD 2VCYA 3L92A 4L08A 4GG1A 3EXEA 1DEXA 3H99A 3OECA 2BELA 5FBKA 3NTQA 4E13A 2HYIC 2C2MA 4B31A 1R27A 2XVXA 1KARA 3CKKA 1SA0B 2QRPA 5CVTA 5A9SB 1M1YE 2I4NA 2Q9CA 1XL0A 1V8FA 3AZOA 1XF1A 3DB2A 3L77A 2QVLA 4RZIA 4QBFA 3AR5A 1N7GA 5HIAA 3VJRA 3VKVA 2G0AA 3WQHA 1F0NA 1PWYE 1Z6TA 1J2UA 4ZPJA 3VPHA 2KYRA 4EABA 1GZUA 5K8VA 4YUZA 4GH5A 4YR7A 5IXYA 3KR0A 1H2XA 4D44A 4D3DA 1JMVA 3CZ9A 1NRIA 2FEKA 4BO0A 1E3SA 5CT9A 2NXWA 1ESZA 1WX1A 3CZRA 5BWBA 4BTVA 3U16A 3LECA 5K3OA 3QTBA 1OIWA 1HG1A 3BJZA 3WGVA 1DRVA 3EN0A 2KBFA 3FZQA 1ONNA 4RF5A 5LUBA 4BATA 1MG0A 1D8AA 2Q6TA 3GJ3A 3OT1B 5TE9A 1G5IA 3WNZA 3ER9A 3USES 4BB6A 2QY6A 1JLMA 1JWAB 3ESQA 4MB6A 4F4JA 4HN4B 3AUSA 1DEHA 3PPWA 4XR9A 4I6EA 1UBRS 5HILA 2PQ0A 4OI1A 2OTCA 421PA 1BKSB 2Q5FA 1W8DA 4CUJA 5DE3A 3WZMA 3ZLJA 4AZSA 3R8FA 2BSXA 5FTKA 3C3CA 5AXBA 1T2FA 2ZITA 4FZ5A 4HXGA 3NASA 1G3RA 3V2GA 2ZUCA 3Q7QA 2QLTA 1QM5A 4W5OA 4F71A 2IY9A 3FTCA 1U0TA 1E9RA 2A1UB 2XY4A 3JZFA 4UUNA 4K81B 1ZONA 4O6VA 4ZZIA 3N2LA 3B1JA 2PYIA 5AJYA 3MWYW 5BNZA 4IZIA 4EO4A 3T5MA 4AC9A 1L5KA 3KD3A 4MO2A 4QGSA 4LGVA 2YKGA 4L16A 2GGSA 1W0KA 3GCWA 2UXCB 2ZSBA 4MZXA 6GPBA 4PVDA 1V6SA 4QUBA 4RDCA 4JC4A 1O4WA 2BW0A 3VTZA 3AR2A 2G83A 3HA2A 5ANRB 4L74A 1IBCA 5KEIA 4Z4EA 3HBNA 3CF4A 1NXWA 3PIDA 5FBZA 5EUQB 3Q0IA 3QE0A 1V5WA 4QJ4A 1DOZA 2ONKA 5CVCA 2OHJA 1Y4SA 4NG5A 2RAUA 1VCIA 1V95A 4M36A 5TPWB 4C4AA 5AD1A 1KK0A 1YB5A 4FSHA 3RCBA 1DRKA 3C7DB 4XYGA 2CHUA 5EJIA 3ZKWA 4BVJA 2UUBB 2IE8A 5ELXA 2IOYA 4NLLA 5A4AA 2QPTA 3MRVA 3RRXA 3ANMA 5FJIA 3T3MB 5KNCD 1JG4A 4U8GA 3M6LA 2JFZA 4B3BA 4ZQFA 2ST1A 5AI5A 1AUQA 1HQDA 3HP1A 1SXJB 4C4ZA 1UMDB 2QTNA 2J5BA 4NCXA 2ISCA 4AJNA 5JY6A 3ML1A 5ILGA 2P3SA 2HOQA 4ARAA 3EFOA 1GPLA 2I99A 1P7YA 2B1GA 1II8B 3SFZA 4JAVC 1IATA 4UU0A 2ONZA 2WYVA 3KVRA 5JS1A 2X8WA 4HVTA 3JQFA 4OSEA 2ZIUB 3TQFA 4Z51A 2G9ZA 4G0VA 4V0SA 4A6PA 1EXDA 1L5MA 4AECA 2OFOA 2ZIZA 3ET4A 3H19A 3ZXSA 1ZUWA 2BP7B 1IOLA 1EJ0A 4BVAA 4TS9A 2ZATA 3K1TA 5BQFA 5J23A 3U7HB 4B6FA 2WIAA 1W49A 5EG5A 3LP6A 1V1RA 4P32A 2H63A 1JALA 4DUYB 3RHZA 4DHEA 2WU1A 3HI6A 4CN9A 4UULA 3DAPA 1F8FA 5AH0A 4OQPA 2WIBA 3G79A 2ZYDA 5MN4A 3E0QA 3JZAA 1HEYA 5D3ZA 4H1WA 1RQPA 2PKCA 2BEWA 4IDAA 3HO6A 2RDMA 4YMUA 4HH4A 3UH0A 3M5PA 1NQTA 3R0XA 4Q4JB 1RXEA 4WY2A 3NW9A 3JAWA 3FGZA 1XAGA 4F72A 5G0SA 1D2RA 4XVCA 5JJIA 4RY9A 1N4AA 2RONA 1SMKA 4A91A 4B1FA 3OOEA 3P97A 2UZAA 3V8BA 2OBNA 2JS7A 2ZYVX 2G28A 4EYQA 1AQYA 2BFEA 2GN1A 1EUQA 4DRXA 1D6SA 3CRNA 1S02A 3GFBA 4MA0A 1SXIA 4H7JA 1F14A 1JSCA 4NEHB 1E2JA 4UAGA 3LD9A 1FMLA 3MB8A 5IX8A 4QM7A 3EIQA 2GWRA 2ZT6A 3BULA 4OP2A 1G19A 1K4KA 1X7DA 2F67A 5JAMA 3DLAA 3KB2A 2C9CA 2YUTA 1J9GA 1XD9A 4RVOA 4MVJP 3FMIA 5I47A 3PGLA 1I24A 4YASA 1DAEA 1HYQA 3NRCA 1E98A 4LEIA 4MRVA 3DE0X 4NU5A 4BX9A 1Z6XA 1XF9A 5MN6A 5L3SA 3RVLA 1VDZA 2XNSA 1MGOA 2PL5A 2QMHA 1VI5A 1EG2A 2JJ1D 2Z1DA 1KEZA 1NKVA 1RHUA 2PUWA 3A6KA 5H3LA 5BNWA 3O1LA 3K0FB 4CEIA 4C0XA 2CL6X 3PS9A 4ZJZA 4YWHA 2HB6A 4HGPA 4F92B 1MW9X 2V6GA 1U6IA 3MCTA 4B2IA 3KYBA 3L6OO 4WOJA 3CONA 3JQFC 3ZY5A 3MVEA 3ZLVA 2HGSA 1R8YA 1DZIA 1S2GA 3RYFB 1E3EA 2H48A 2FXIA 2VKQA 1Z7YA 2QX8A 4PXYA 4PZZA 5FO0A 4TVSA 3T15A 3B51X 1BEZA 5DHPA 4DA0A 5K05A 4XYMA 4I1SA 1HOXA 2ZRPA 3H1EA 2A33A 1JDSA 1YQEA 4FILA 5BR8B 3EGCA 3RUDA 3WKAA 5E6UA 4LWZA 1J8VA 4CBVA 3PB3A 1JFRA 4O5OA 3BB1A 5AJWA 3UN1A 4KXMA 5DYNA 3ZEAA 5A7GA 3GNLA 3LUPA 2XBLA 3LBFA 2G25A 3LY7A 3WDMA 3RYCA 2AW3A 4G0PA 5DEOA 5ICEA 3JAMA 2RGEA 4S1OA 2FWAA 1SQSA 4JJEA 3NIGB 3MG9A 5CDFA 5HHTA 4BPBA 4QU8A 1GSAA 1X1DA 2V9PA 3EQ6A 5CYFA 2QTFA 4KLNA 3PITA 1G6Q1 4PYIA 5FQOA 3Q3IA 3M1LA 3NUZA 3GW8A 5FFNA 3BB3A 3FZNA 1Z4IA 3D3WB 3V2HA 2OCKA 3ESAA 4AB1A 4WMLA 1ENZA 2CUTA 5TV2A 4N3BA 5F78A 4ZI5A 4OX9B 2B1RA 3K9BA 4YLYA 3E5NA 1M8KA 1PG2A 1HLDA 1PRYA 4GPBA 4PO1A 5I8ZA 2BMJA 1IPFA 3MILA 4ALIA 1NSYA 2D59A 2G71A 3X1YA 3N74A 1JPJA 1DTEA 1Y7HA 1N5JA 2LXNA 3GLHE 3TAUA 1KQ3A 4PRZA 2YNMD 2QD4A 5EJ7A 2D8AA 2C5SA 3R7DA 9LDBA 4RQTA 4IXDA 1YCGA 5JCJA 1JZQA 4JU9A 4MO9A 5EKTA 3CGGA 4OHMA 4KPFC 4UBJA 4EUKA 3ZWVA 2DF8A 1G20B 1LI5A 3BKWA 3N0TA 1MEEA 4X1KA 1E1QD 4CMJA 4JC0A 4JYCA 4DMCA 2PUGA 5AVZA 1KY3A 1RCTE 3ZGOA 2J41A 3OIUA 4QUIA 1T9HA 3MRTA 1TUEA 5CB0A 2AR9A 1VGQA 2W70A 2GLUA 1GPWB 4ARBA 4AKIA 1OIVA 1ML4A 3K8OE 4KQKA 3Q8XB 1P9OA 3JYHA 2IZZA 3EDRA 4Q4CA 2FEOA 1QYDA 1QZ3A 1W1IA 1EK2A 3EA5A 4P81A 5FULA 1L7DA 1G0NA 4JZYA 3D1VA 1QLWA 2D1RA 3C5EA 2JLQA 3GGSA 3KIPA 1QGED 3LIIA 4W8GA 1F2UA 2CZQA 1M7HA 5HIKA 5F51A 1VKNA 5B58C 1IQ0A 2YJZA 1FXSA 1X1EA 2JAWA 2JGEA 4JP3A 2CY0A 4QEDA 4D3ZA 3B1FA 4ZHSA 1GRNA 1SELA 3FCSB 2FQYA 3E3MA 1ODCA 2FZKA 1D2GA 1PSZA 2RI1A 1F5SA 3UWOA 4ZP1A 1LV8A 1VKZA 2IP2A 3MWJA 3LKBA 4BMXA 5LNK6 1R8XA 1CR2A 4IGKA 4PV7A 4XOUA 3FPJA 5DYGA 1NG9A 3SF8B 4BN5A 3L6DA 4HG2A 1PFVA 4EP1A 1RQNA 4AF6A 3W9YA 4W99A 4KPYA 2OV3A 1RAGA 3EF0A 4U5QA 1LBEA 3MMPA 4LOKA 4YP6A 3TMAA 3GN1A 3MS7A 3QU7A 1NJ8A 1KTIA 1L5FA 4KO2S 3ZZUA 3JQQA 3OJWA 4G5HA 3OJFA 3L4EA 3RIYA 2VPZA 2JIZA 2OCYC 2K7FA 4XPZA 3A70A 1N8TA 4XCVA 1NVVQ 3ASYA 2RBGA 2RHCA 5EJ4A 1M2GA 3I9V1 2JVIA 1VMEA 2UKDA 3OUZA 2IEZA 1AB5A 3TXAA 4F1KA 5K7SA 3DAYA 2R7AA 3PUWA 3TI7A 2AFVA 2XADA 4RQAA 1WHSB 2Y1KA 2VWQA 3OO0A 4R5MA 5CLHA 4ZJUA 4MJXA 1CPYA 4Y6SA 3H87A 4RX1A 4EJ2A 4C0AC 3H1FA 1VE5A 3UHJA 1HL7A 1L5HA 1SVLA 1YOBA 3CIOA 4G23A 5JD4A 1SZDA 1OC4A 3CPHA 2QSUA 3RVNA 1N9KA 3E9DA 1U8AA 4FOOA 1M8FA 2HMAA 3UUFA 2E9SA 1CHNA 2NV6A 3OPYA 5FOUA 4LMBA 3ENQA 2EBUA 3LKDA 4WWHA 3GEBA 5EYPA 4X90A 5L7WA 1GCOA 4RHUA 1RBYA 2ENWA 1P0FA 1UIRA 1UBSB 3W5HA 2DJ5A 5CLFA 5AQ1A 2CJYA 7REQB 2V7BA 4RLHA 3BFXA 1P2SA 1LFAA 1KI1A 2QUBA 3VU1A 1PLLA 2B4TO 1K66A 3DKPA 1UMBA 1CRZA 2ZI6A 2PGOA 3OBIA 1R6TA 4MW4A 3THOA 4HLCA 4QM6A 2PZ8A 1UL1X 1B76A 2JA1A 1QK4A 2WG2A 3K09A 3N05A 3OZBA 3I3SR 4AXBA 1O5TA 1UDCA 2I1QA 1HZZA 3R3JA 2CJWB 1JG6A 3E1GA 3H65A 3PGVA 3TLBA 3CT6A 3IHLA 4FGUA 3DKIA 1ZM9A 2JLAA 3FI0A 1EK0A 3E8MA 3E3OA 3IERA 3K0KA 3SFVA 2PCJA 3UENA 4G1CA 3ZQKA 4N5LA 5KDDA 3C8ZA 4NPHA 2AHRA 3KEFA 2C3YA 3KHUA 3JQCA 3GRRA 1YQXA 4TWJA 4RH3A 4MKHA 2VNJA 1GGJA 5EZYB 4IMRA 1EFRD 1D2MA 1Z07A 2C4HA 4PTYA 5ALJA 2C42A 3CLUC 4IDDA 3F96A 5FKJA 3IMCA 3QBEA 4MS3A 3TJZA 3T5TA 3JVIA 4EW3A 3EVZA 4IHJA 3FOBA 1OZ0A 4EUHA 4F06A 4CKCA 1ULAA 1PWZA 1XRLA 3K7EA 1ZOLA 3W5SA 3V48A 5DN6D 4DS3A 2J08A 1NXSA 3BMQA 4HDKA 2IGBA 4G84A 1ABEA 5IZCC 2IH2A 3M2TA 2QU7A 2JEYA 1J7JA 1N7JA 2C84A 4E5PA 5C7LO 1GARA 1UOEA 2VZ0A 4QDUA 4C20A 2VPXA 3CURA 4R3NA 3HXTA 4WXMA 3S5UA 3SCZA 1U7XA 3EXFB 4NH4A 2Z83A 4RVNA 2V6MA 4M4SA 2JJYA 1S7CA 2HY7A 4RAQA 3F5FA 5KU7A 3HKDB 3VVBA 1AGRA 3K4PA 3ZE1B 1CE8A 3UK2A 3FCXA 2CBZA 4LHWA 3UMGA 1ETHA 3SR4A 3IS3A 1OGYA 1EUDB 5CEEA 2PJRA 3T9CA 2QUHA 3MB5A 3WSVA 2QUIA 3F5MA 3VKHA 5EZYF 5B6PA 3IUBA 1VE1A 4H4CA 3IQXA 4WVFA 4MPPA 2AVDA 4U2FA 2CKMA 5HVNA 2VQDA 4KE8A 5KQPA 2VQEB 1AURA 2L18A 3D7KA 3P2OA 3UXHA 3WMFA 4ARVA 4BMNA 4K0KB 1LW7A 4FFOA 5FNZA 1QBKC 3A9RA 3HFSA 1QYIA 3K0CA 2AOTB 3LBNA 4KPUB 3WQBA 2COEA 1MA3A 4J91A 4AUNA 2A9FA 5DTEA 1HZZC 2EIHA 4FUQA 4GLJA 2PT6A 4Y2HA 5AR1A 1GNTA 5I9SA 2W6PA 1ADGA 3VKFA 1EX9A 1P1IA 3DF7A 4N54A 4XYLA 3SIXA 2XTZA 2ZYHA 4C3ZA 2XNJA 5I8PA 1H4SA 1O6FA 5DSZA 2PL1A 2ZSJA 3PXBA 3ROEA 1YGPA 1RC1A 2OGTA 3ZDCA 2HU2A 1QS0B 2Y0CA 3BHIA 4FD2A 2IIQA 5GWXA 2IA5A 2PU5A 3UGQA 1HNNA 4RQBA 5KOJB 3A4YA 5IG2A 3IPAA 3ZJ5A 3ILVA 4PRKA 1WP9A 2BONA 1Q1QA 3SWWA 2CLSA 4X3OA 5CHEA 1U8XX 1W34A 4ATNA 1TAUA 5HOEA 3G2KA 1Z33A 5KX5B 4MWGA 1GEEA 2J3KA 4TKUA 1N0UA 1YBVA 5L8VA 1UJ6A 2ATEA 5K51A 4MDEA 3HP4A 4AX4A 4IVRA 5CVUA 3AGPA 2P67A 1SEPA 2FN9A 4K05A 1JSLA 2ZETA 4JLJA 4IIFA 5HRAA 1DT5A 3TOVA 4M38A 1EGHA 4YS6A 2C9OA 2B4RO 1Z06A 1Y3AA 2Q50A 4HDOB 4X85A 5ALUA 1HYBA 2WJZB 4U6NA 4NMHA 1SOAA 5COQA 1CIVA 3RVSA 1PEKE 2CFOA 5FLKA 4EB0A 4H2DA 1LQ2A 4REQA 1UBHS 1XN1A 2WHEA 3JZMA 1G63A 3BXXA 3CJTA 2BMAA 2D00A 3MSCA 3P2EA 1VYHA 1GAQA 1JLLB 4Q4HB 3SEAA 1PNRA 2MSLA 2G5TA 4IX9A 1KYVA 3ABSB 4DDWA 5CEJA 1LX7A 4GI1A 4ZK6A 3QENA 1K6XA 1UDRA 2N0SA 1ZIYA 5KX5F 5EUMA 5JI2E 1AHIA 3VHLB 1Q7RA 2OAP1 4X92A 2WTBA 3K0CC 4CMCA 3KE9A 3QOWA 2JC3A 4V0LA 4EHAA 4EKNB 2W2TA 3AO0B 4I4IA 1ZISA 3F3MA 4I4LA 4RADA 5FEMA 4D74A 2FZGA 4C4SA 5K45A 2LIPA 5FA5A 3C6ZA 2XRFA 3H8WA 3E22B 4P7GA 3RGWS 3DOEA 1H6DA 1PYOA 1YUBA 5AW7A 2IPNA 3E3NA 3BTVA 4S1WA 5KWEA 3TFWA 1YAHA 4LZAA 5C5IA 5JBIA 4XCQA 1KRWA 1XZFA 2NXJA 4YAKA 1L7VC 3I3OA 4F3CA 3CPEA 1AN9A 3F1LA 1XYGA 3I04M 2YIDA 2QN2A 2R3SA 5D5PA 1QTNA 4XUDA 1VL5A 3U40A 2GILA 1MQSA 1GT6A 4QBIA 4QOGA 1QF7A 3FCCA 2VP4A 1C8LA 2WIKA 2XIJA 4EB3A 3X1WA 3F97A 3L6EA 4P3KA 4BFTA 3AWIA 3IAEA 4F04A 2B7BA 3KFXA 1RWQA 3NAMA 4I8XA 4M1WA 1AHNA 4EYSA 4PXSA 4KW7A 3S40A 4YJ2A 4RKEA 4W6ZA 4Q9JA 5HFAA 4Y2YA 3UC9A 1POXA 2QQ5A 3I1JA 2NU9B 4M0LA 3ZGXA 2GEVA 1A4XA 5TPZA 1EVJA 4M8IA 3GRVA 5ICFA 1PVDA 1R00A 2QP3A 1S8OA 4MQ5A 5E6SB 5FHRA 5CVEA 5JWHA 4OU4A 5G40A 2ZBEA 3L7AA 2NSJA 4DIDA 2FPXA 3AEUB 1OFHA 3AU8A 4MCIA 1Z4LA 3P20A 2WD7A 2Z2XA 5DGTA 2ZB7A 4EPVA 1BZYA 4O02B 5JS7A 2RAVA 3GRKA 4KNWA 3G8YA 1BAPA 1JFFB 2NPIA 3WKEA 4DMRA 3KL2A 1YZTA 2OL4A 2A7XA 4XGKA 1NT2A 3RROA 4MCHA 5D1HA 1Q1AA 1H2FA 2Q3LA 1PJAA 4O59O 3KZKA 4FHDA 3ICEA 1JDVA 2CNDA 2G76A 5G4KB 5E7IA 4QX6A 1YIDA 3VBCA 4P36A 4M98A 2OESA 2WU0A 5DM4A 1F2TA 3QMMA 3W4KA 4BNYA 2LRHA 5AESA 3MS4A 1JLHA 2RHJA 1WMEA 1MBZA 1SUFA 3NYWA 4R16A 3T1QA 2FG5A 3AEXA 3BF8A 3GA5A 4QODA 3OAAA 4BIMA 4EG6A 2PS1A 3OQIB 4CV0A 2VHWA 5IHPA 1O8BA 1NPYA 3ZY4A 2WJ3A 4TMKA 5HKAA 2VAMA 1BE1A 1L7BA 3LP8A 4NKRA 2W90A 1LBHA 3K2QA 1JPVA 2JDIA 2V74B 4U9IS 5P8WA 5EJFA 4P3XA 4N76A 4AS2A 4LK3A 1WCYA 1N0IA 4Z2YA 3GJ7A 2VRWA 1V1JA 4RE6A 1HE2A 3DB1A 3NVKI 1EP2B 1CT9A 2R5NA 1A0OA 1Q17A 2XQJA 3N2NA 3BUSA 3NTLA 4KWHA 5AW6A 5H9VA 3A9UA 3GEEA 1U2PA 2Y1DA 2ZWIA 3H6GA 4HY3A 1SPBS 1WXDA 2H7YA 4OGLA 4RJJA 4D26A 4M9ZA 3FWKA 4LHZA 5EY5B 2XGGA 1FCJA 4OUDA 3F6BX 3VZCA 4JS0A 2PLAA 5F73A 5I5GA 3PXAA 1TVMA 1VG9B 2ZTSA 4KI7A 4KV7A 5EOVA 1YCDA 2IFTA 3GLQA 2P9YA 4C08A 5AW0A 3J81A 2DP4E 1OA1A 5CX1A 1V4BA 2B3DA 4IH4A 4U2EA 5HTOA 1UBGA 3R5HA 5EP4A 4CQLA 3O8QB 4LF4B 3KSZO 4ICIA 4QT0A 2P7IA 4TT3A 1OBFO 1OPXA 1OV4A 1CY4A 2XEDA 5IAAA 4WOKA 1SWVA 1JWLA 1XMVA 3ZHZA 4F0JA 3ZE6A 1P7PA 4NU8X 1NM5A 2XAAA 1VJ5A 2JAHA 3VO2A 2OYRA 4RPIA 2ECKA 3TZBA 4B75A 4ENUA 5JZVA 1Y48E 1ZIPA 4N5HX 5CH5A 5HFNA 2W2XA 2XQFA 5HQTA 2YMQA 4EIWA 1KK3A 3AF0A 4YAFA 3H8SA 1EUCA 5DHAA 521PA 3Q4GA 2GD6A 4W4TA 3OA2A 3E4CA 3E4DA 5AVUA 3DVSX 4HRYA 4Y2XA 4F3TA 2K5UA 1SY7A 4FYPA 3WK9A 4BKOA 1LDMA 5DRYA 2QBYA 1IE3A 3EF3A 3HV0A 3QXHA 1JEQB 4IGAA 4TUYA 5B3AA 4BV9A 5CB8A 5JHGB 3N86A 3VU9A 3O4RA 4I5DA 1C9MA 5JNWA 5JDIA 1JILA 5BWMA 3EZNA 3WJ2A 1RI1A 3OZCA 4HNHA 5CA1B 4U7TB 4JI4B 1KERA 2DBQA 2O7RA 2Q4EA 4YAGA 5MHTA 1K75A 3U3ZA 2H2DA 1L9KA 2SKDA 1T2UA 5AW1A 5EJ9A 5HE8A 2A35A 1MZPA 1IZ8A 1PK9A 4RJIA 3EXHB 4DWJA 4PAMA 3GF4A 3TSYA 2LUOA 1REQA 4X8HA 5DF1A 5JQWA 1EK1A 1G2QA 2F6RA 4YR9A 1M0SA 4BP1A 5IJ9B 1AD2A 3I4CA 1W581 1XDBA 3OF5A 4PQGA 4QG3A 2Y99A 3FZEA 1E2GA 3EAGA 3C3WA 3DPUA 2YXPX 4ID9A 3SQLA 4G0UA 2QT9A 3JARB 4I46A 2C5FA 5H3CA 5H7XA 4KLZA 5GM2A 4BDSA 1R5JA 1X94A 3KPWA 4D3XA 3FYUB 3NQ41 2RJNA 3GQBA 4H27A 2VUTA 5CA1F 2YWEA 2X4GA 4PLWA 2V7QA 4JUFA 3RD5A 4W1QA 5THXA 1U11A 3I52A 3QUAA 3TTVA 2JGMA 3GG2A 5IWAB 1JDZA 1V5GA 1K27A 3DVRX 3GMTA 1Y9ZA 1LPSA 3IJ5A 1JFLA 1SUPA 1RABA 2JHPA 4H4DA 1XCPA 4QFMA 1NM5C 3VR2A 4MUIA 5C8YA 2PQ6A 2QAJA 2WE8A 1OFIA 1K3UB 2OP0A 3JZIA 3C6XA 5FLYA 3SHWA 5KQGA 1E5TA 2BHRA 2HXGA 5IF3A 4R2WA 2CF6A 1Y7IA 4IFBA 4WI1A 3K5WA 3SHVA 3BD6A 3HEBA 4D56A 3HL0A 2O2ZA 3ZXYA 1TM4E 1UMCB 3QFRA 5CDUA 4EBBA 2GCIA 2Q2QA 4NQZA 3FD8A 4DCVA 4EVIA 5CNIA 4BRUA 3DMDA 4MWTA 2I03A 1FS4A 1T0HB 4UNRA 5JSUA 1P2DA 3EVBA 1MEJA 3TCXB 5MFPA 3F8TA 1Z5UA 1T4CA 4G5QA 4DQ0A 3Q7SA 5F7OA 2VPIA 1UOOA 4NZOA 3A1TA 3VAAA 2X7XA 3W9SA 4NYMR 2VR1A 3KKPA 3V9PA 2WG1A 3DDZX 3KOOA 1DB3A 3PJGA 3EPHA 1Z26A 2Q9AA 4FJ0A 1KIMA 4KCGA 4KIFA 5KTSA 3F73A 1GQQA 3U56A 5L3QB 5HJ2A 1NBMA 1E18A 1A3CA 4UVEA 4R7TA 1NL3A 3QMWA 5HDBB 1Y6RA 1S2MA 3T1OA 2BSQA 2XB8A 1B14A 4NIMA 3CVVA 2G0TA 3HJHA 4CR7A 2UYCA 2FLWA 3VOSA 1ZDMA 1KEKA 4L5AA 4FD3A 1E0AA 2BEUA 3IELA 1RC0A 1R5BA 2IHVA 4KITB 5JAZA 2YY6A 5CLJA 1ISFA 2XUIA 5CMLA 4CR6A 1ZUD1 4UBNA 1P61B 4CCYB 4HR7A 4UU1A 1NVWQ 1OXUA 3GWZA 5AHWA 2HLPA 4V3BA 2GBPA 5D8DA 1BXGA 4ZT7A 3TRFA 4AULA 3RC1A 2YWCA 4BQNA 4DLYA 5I7VA 1CUBA 1G3MA 3T7EA 2P3QA 5AXDA 3DZFA 5DI3B 2HA4A 4MUXA 3SC6A 4HFMA 4D2IA 1GNRA 1JXQA 2BGKA 5CDFE 1AM4D 1LVHA 4Y2JA 1VCNA 3VGPA 2YVQA 1V3QE 4KSCA 2QMUA 3RFTA 3UCFA 3KZCA 2AE1A 1UC8A 1IJBA 4JLWA 1Q14A 1XWFA 1FL9A 1V16A 2FSSA 3CKMA 1LZKA 5LQDA 2B5OA 1HH4A 3LFUA 2Q2WA 1BS9A 1XQ9A 2EEZA 1Y8AA 1O54A 3NMUF 2EW1A 1H5NA 2NSDA 5EKUA 4DDKA 1DV2A 3RFVA 3K32A 2FY8A 1SBTA 3WIOA 2PGLA 1N75A 4N7MA 5A5FA 3MHPA 4QYMA 3NVMB 5F9HA 3CUEF 1RXWA 2P65A 3GX1A 1IZ7A 3AHJA 3OF2A 5DLDA 3DS8A 4OJYA 1LV7A 1AQJA 4MCJA 3L4BA 1A9ZA 3LQRA 1W2GA 4DR3B 4KWIA 2IDMA 6NULA 2PAAA 2WF6A 4NZMA 4ZC1A 1P4AA 3IP8A 2Y9MB 3DBOB 3UA3A 4C3UA 4CLRB 1W36C 3OQ6A 1S5PA 5EMNA 5BOSB 3V8EA 4HT3B 4KSBA 5F52A 4I5GA 1NVXQ 2MYTA 1FU4A 5F7ZA 4QRDA 3GFVA 1NLYA 3NYRA 3W6ZA 2LKDA 5EPOA 4ERXA 2I91A 4JC8A 2DQZA 3TEMA 3ZJYA 5AKEA 1Z6GA 5E3HA 3ZS9A 1FX0A 1G21E 4HRAA 5LB2A 1JQAA 1X19A 4QAJA 3D8TA 3FWPA 1G20E 3PG5A 4LX0A 4MUNA 4RXTA 4M6WB 5JARA 3GDWA 4Z3OA 3ICOA 4UXIA 4DF3A 3HE3A 2NU6B 4HBGA 4E3ZA 5B64A 3Q2KA 4WXYB 4BGVA 4YK7A 8OHMA 2FPLA 3U6BA 1LDBA 1NMEA 5LUAA 1V7PC 4EITA 2BTEA 4RPJA 3N2KA 1HA3A 1UJBA 3JWEA 3FNIA 4TLAA 2Q4RA 4YCDA 5B3JA 3AEQB 2QMOA 3DBLA 2WY2D 4ZAGA 4RVGA 1QK3A 8GPBA 2P3LA 2O8FA 4EQ6A 1SCUB 2DWCA 4BB0A 1QV6A 3K8ZA 2HXSA 1G5QA 4JSTA 5HBRA 1N36B 4BCCA 3IT3A 5EJ8A 2D3TA 1AGNA 5DHUA 2A5FA 5H81A 2ZJAA 1TB4A 3STTA 3RANA 3VC7A 3ZK9A 1K88A 2YVLA 1AZTA 2XGMA 3DTTA 3HLTA 4RA9B 1NW7A 4ZO8A 3UXMA 4AKEA 2JJ2D 2O1SA 4ZHQA 1I6LA 1Q7TA 5J58A 1P4GA 2ODQA 1AH2A 2OCPA 3PQ4A 4P7JA 4XWGA 5EZQA 1XCOA 3T3PB 2JLYA 3WK4A 2WHXA 3NDRA 1XYVA 1XEXB 4H0FA 3WLNA 4F12A 1AA6A 1YJQA 3G1TA 1LNSA 3K0AA 4B6GA 1PW5A 5FADA 2EC5A 2KS6A 3AFOA 3FOCA 2DY1A 3ZIAA 1AMNA 1F7VA 1ZW1A 3FAKA 5AVTA 1NQXA 1J2TA 1ODKA 2IZ0A 5DJ5A 2OB2A 3RBZA 2CD9A 3OHPA 3QX7A 2A3RA 3L4BC 3PFBA 1NMYA 4TLMB 1H1TA 5EIFA 4NQRA 4CU5A 4R0MA 2IH5A 1B15A 4CFYA 2JEOA 2VLBA 4IRXA 1J56A 3T9AA 3MIZA 2VDNB 1N5DA 4P2BA 3NCTA 4YP5A 4RW0A 1TMYA 1VKOA 4P9NA 3UK6A 2YV3A 3LUCA 5F23A 3AUXA 3KELA 4IJMA 4OO3A 2PBZA 3AFNA 4IGIA 4PG7A 4DIFA 3BWDD 3NHMA 4LDPA 3MCZA 5JD6A 2H0AA 4WCDA 3GDFA 5C80A 3MWKA 5A9TA 4A73A 1HDCA 3ZHSA 1G9SA 4A0QA 2H1WA 1CZLA 1WXXA 4IRMA 4Y6PA 2H65A 5D5QA 3TH5A 3T1VA 2NU7B 3B3AA 3K3PA 3M6WA 3OKCA 4C2UA 1XFDA 2KW5A 1SIWA 1ORWA 4H15A 1QVRA 4D79A 1RD4A 5AHXA 2P6UA 4R84A 1VIVA 3DOCA 2G88A 4WESA 1SBYA 3OETA 4F2HA 3K9QO 2GRUA 2ZSFA 3G3EA 3UICA 2PNJA 3VPXA 5B3JC 3L02A 1G60A 3N53A 5K2OA 1LC0A 3STVA 4ASUA 1KEWA 2PKQP 4C4XA 4QT4A 1ZUHA 4IOKA 1P9NA 3MWLA 4YRAA 4XIYA 1VPVA 3FIUA 4ZC8A 3QEAZ 1NFRA 1T36B 4CHGA 3D7SA 3N7AA 2BISA 4WNAA 5IANA 4I1RA 3CLTC 2D1QA 4UZFA 4J29A 3X1MA 5KKAA 1JT9A 4C29A 4KRFA 2C31A 4G5GA 3DXZA 2ZE7A 5JOQA 3EG5A 1JG1A 5M3BA 4CNBA 2Y2UA 3FMGA 1BMDA 2LZ0A 2ZJZA 1O6CA 4AMZA 3DCYA 1VLZA 3TJRA 3HCWA 3IVCA 4M99A 1QOQB 3NGXA 3Q9SA 4QYWA 3W8EA 3A4LA 2RKOA 1KDPA 1USGA 2ZYSA 1FYWA 2PR2A 2XA9A 3AF4A 3NFYA 4KXWA 1KOLA 4B4OA 2J4DA 2BHNA 5F1OA 4E09A 3B89A 4I0WB 1ZK3A 5KPJA 1ADBA 3KKLA 4E7PA 1I3KA 3TDKA 3DUFA 2AHOA 5MN5A 2XTJA 3P9XA 1XXHB 4BEBA 3VKGA 3BWCA 4A5OA 2PL9A 2GTHA 1P3JA 4YRJA 1U0EA 4MW7A 1JAYA 3QYPA 4FU0A 4GAEA 1WNFA 5A1JA 3G7NA 3VR3A 4B3DA 4BNFA 1JTVA 1V11A 2J0VA 2JZOA 1Y5IA 2VJQA 2ZBRA 4R2LA 4ENTA 4M53A 4TROA 4DABA 3I2GA 4TSKA 2EFHB 4M8KA 3OMXA 1V2GA 4KDFA 4N1AA 1B4DA 3IXLA 3RUEA 4BKQA 3NHAA 1GPJA 1LK5A 4UD2A 4BYGA 5CFNA 4QU9A 5ALQA 2GNAA 3WJAA 4E5YA 1CV2A 3KOUA 5L6LB 1A9XB 3HJCA 1ZSVA 1GTG1 2E2WA 1S9DA 2HQRA 1M0WA 2GZ1A 3BVPA 2P2SA 4QPZA 2XV1A 2DHEA 2WE7A 4FOLA 4RGQA 4XTCS 2BEJA 1OZFA 2E4ZA 2VWHA 3HKBB 4RVDA 2BBOA 4AY3A 1BXRB 1WL8A 3LX4A 1XX6A 2VZ8A 3Q87B 4WA7A 2ZU6A 3ROXA 3A1SA 2NOAA 4G65A 2Q27A 2QQFA 3KCNA 4IJ6A 3ROGA 1UC4B 3ZHOA 4GMGA 5FV4A 4IFIA 5H4HA 4C43A 4R83A 4HUTA 3RT7A 2W6MA 3L05A 2G09A 3QEOA 4G0OA 1MNQA 4LUCA 3VR1A 4EB6B 3WHPA 3QPAA 1XTZA 3NJ8A 2AI1A 4RPCA 1QV9A 1WQ3A 2O7VA 1EEHA 3BKXA 3OESA 3GH1A 3QXCA 4JEUA 3LDAA 4TWAA 4EG0A 2LR0A 4MA4A 3GGDA 4IV5A 2HTEA 3LQ4A 1SWWA 3DTVA 5ENVA 5BSUA 3T4XA 4Z3KA 1C7FA 5I3CA 1PGPA 3K30A 3HA7A 4RS3A 1EAYA 3HBJA 3FVTA 4DNQA 2F43B 2I8CA 1L3IA 3ZW8A 3S5JA 3OQHA 2QX9A 3W6UA 5I9NA 1J42A 1L4LA 1VE9A 2G63A 2ODPA 3E81A 1JKJA 3ZE2B 2B69A 5JADA 4ANFA 3DXYA 2VJOA 5IMSA 2X3UA 2JJ8A 3AUUA 4M0UA 3GFOA 4OOFA 4JB2A 4TL7A 3T3HA 4D4HA 3UK1A 1DG3A 4BUCA 5GONA 4BX0A 1FXWA 3M1YA 5JXJA 2ZP1A 3G85A 2Q1SA 3F1KA 2XCTB 3QWAA 2XD9A 4YVFA 2I7VA 4HWSA 2O52A 1BHQ1 1E77A 1LJ8A 1QHSA 1XRJA 2O2HA 3O4JA 4RA6A 3WGHA 1DDGA 4HNVA 3HYCA 2B8EA 4Y1RA 1BVHA 5LKAA 2CNBA 3VZQA 4RPHA 1H2HA 5CITA 2X2EA 2Z30A 2QE7D 1JEAA 1HDIA 2ZREA 2A2ZA 3DQZA 3IBTA 4H3HB 3VPDA 2P6MA 1JUDA 2JD2A 3WOHA 4EF4A 4FN5A 2O3UA 4QBHA 3LK7A 2VYFA 2YW2A 5CGQB 1BOFA 4BMDA 2R2AA 3WB1A 4BVGA 1OYYA 3HUUA 4NE9A 2WU4A 6ABPA 1FUIA 2HMWA 1P1KA 1PU2A 3M5WA 3C8UA 2I0FA 3NWOA 4JJ8A 3BGOS 3N8DA 3FVVA 4XM2A 1W85A 3OKPA 2I65A 4IMIB 1C80A 5D85A 3UAYA 1ZH2A 2AEJA 3KCQA 4FGLA 3CO0S 3PIRA 4H0NA 4NCJA 4P31A 4TYWA 4N48A 1J8FA 4QARA 2P5TB 3ZBPA 4NP6A 2GPAA 3PUVA 3VV2A 3QSGA 3TIXB 3HY6A 2AMFA 3TLZA 2UYYA 4G1FA 3AY7A 1CR4A 1ENYA 2EFYA 5CYPA 2GTIA 2C7VA 4OGKA 2B30A 1XTKA 2NX2A 3JWHA 4IHKA 2XMGA 4IP0A 4CT4B 3HXKA 2R4UA 1J1IA 5KTKA 1UJ2A 1OA0A 2VHUA 1F2VA 4P4LA 5CNJA 1XKQA 3ZVLA 5PGMA 1R0ZA 1E2FA 2W8ZA 2WT4A 4DTIA 3D1LA 3G02A 1JHUA 5CM2Z 1SVOA 4BRZA 4DIOA 5JVDA 1GTZA 1PT6A 4ODIA 1XTUA 2WMOB 3DC7A 4Y98A 3ZWAA 5FV7A 1WXHA 1OC2A 1NN5A 5HJEA 2B61A 4QSMA 1NUQA 2G0NA 2QTVA 1GQFA 3I5UA 3TPZA 5I9LA 1PJZA 3JQGA 2X1MA 4X93A 2CHVA 3KKNA 2X6RA 3PQ3A 3ZW7A 1ZA2A 3KSMA 4DCPA 3NWJA 2Z2KA 1FS6A 4RZ3A 1S4QA 1FYFA 2HEIA 2IYSA 2X77A 3DP7A 1LQUA 2PLFA 3KJQA 3MWEB 3R5JA 3V3KA 1EVLA 4YFVA 5J9FA 2VPQA 3VKWA 3LNTA 3U7RA 4FDMA 4CUKA 1L4GA 4IZOA 3G5LA 3TSAA 2QQ0A 3VYSB 4EPYA 2VK8A 2WKWA 1IBRA 1NN3A 1W35A 2R96A 3REQB 1KDZA 3RK1A 3STXA 1W5TA 3TRJA 2DETA 3WKDA 4EATA 2Y0DA 4BFSA 1DIAA 2PIAA 3BHMA 5KSOA 1J2YA 3JR3A 1S8NA 3PL1A 4OXXA 1N0HA 3B6ZA 2QTRA 4MQFB 2PJZA 4UCXA 5KTPA 5DFAA 1H0RA 1E9DA 4EVRA 3K31A 1EDZA 2F3PA 3IPCA 4L73A 2A0XA 1ENPA 3UTDA 1M1UA 1NONA 2DFKB 4M9XA 3SJ7A 1KZHA 4R9VA 2WAYA 3DO8A 2AKEA 1MU0A 3CJRA 2BSAA 5AW5A 2WZQA 3G6KA 5I4CA 4ETMA 3QUTA 4HGZA 5LA6A 3OTGA 1PEAA 1U0GA 3U13A 4X91A 4C0BA 2YN4A 3SHFA 4DT1A 3IHWA 2EJWA 3U4QA 1YVEI 1IAVA 5DTIA 3CISA 221PA 3D6TB 2BLLA 2Q9UA 2VK1A 4C07A 4GOMD 2P8SA 4RTKA 3E5MA 1E4YA 1QIMA 3ZC3A 2I4OA 4DREA 4QLOA 2E5FA 4J7UA 3SQDA 4NEQA 4NR0A 4QOFA 4DZZA 1F51E 2MIIA 3A1DA 3BWEA 3DNMA 4IIJA 4RHTA 2EKQA 1IG3A 4AMUA 3FPEA 4AURA 4KQGA 4EELA 1L8AA 4QKQA 2WVAA 2GEUA 4CG0A 1QZZA 4CG1A 1U02A 2AN9A 3F7OA 3OX1A 2JIZD 3ZCPA 4MW5A 4MRAA 3MGAA 5JYBA 3RVDA 3KG2A 3GVHA 8AT1A 4Z4IA 4IIUA 2AFIE 3K96A 3WXMA 3IESA 4TMWA 4PS1A 1KRXA 4NMWA 4J3NA 2ZW9A 3DMGA 1PGJA 2ZT5A 3C4VA 2M1XA 4JI0B 3GJQA 1MEOA 2DBZA 3KOZA 5JDCA 5LQJA 4B8YA 3GGCA 1T8UA 1KP9A 1OVMA 2WKSA 5EMKA 2X7HA 1Q44A 2JHGA 3FUXA 3TGWA 3FZGA 4MINA 4IDQA 1T5SA 3LT0A 5CDTA 4XD7D 1XEWY 2OXEA 5EI5A 1CR0A 2X0FA 4DPKA 4YHHB 3WB9A 3FUVA 3IDOA 2DLDA 5REQB 1DJQA 2IZ6A 3B6KA 3INGA 1OXTA 2B7CA 4C7JA 1QH1B 1U6KA 4WCVA 1P9RA 2DOKA 3KBBA 3NHKA 2H92A 4TYNA 2FNAA 2UV8A 3WK5A 3OWOA 5JEEA 1JE1A 1JLKA 4D9EA 1E79A 1ZVKA 2IKQA 2RG1A 4MKGA 5F2OA 2F1OA 2BTOA 4YUVA 1TZKA 1Z7GA 2ZJ1A 2X0NA 2CKDA 3AJEA 3DQQA 3L9WA 3JWJA 3R74A 1VJCA 4QHSA 2AH5A 5TGTA 4X8LA 2Q5IA 5HF6A 4EH1A 1Y8RA 1G5RA 3WLRA 1ZXXA 1OT5A 2WEKA 4G1EB 3MERA 2LPMA 3NFRA 2FI1A 1HZJA 4RESA 1PQ4A 5JRJA 3L7JA 1GUAA 2P1RA 1ZLXA 3KEOA 4IUBS 2QXTA 2AXQA 4M76B 3W4IA 3KVVA 2HQBA 4XM1A 2D2IA 5ICCA 4J0DA 4XPIB 4Y7CA 1AT1A 4TTAA 1M6VA 5JAUA 3IALA 5JHHB 1ZL0A 4KDRA 3B1ZA 2GN8A 3AF3A 3R4VA 5AK6A 4ZD6A 5HCNA 1KAGA 5DXAA 1GTRA 4E4RA 2XOEA 4GNRA 1L7MA 5IFLA 4RD4A 2IOFA 3C97A 3O95A 4V0MA 1HE5A 1WQ1R 2FPPA 1DAGA 1ZM3A 1QGUA 3AESA 3AQIA 5JE8A 1CS0B 1T0BA 1C3VA 2BFPA 3I0MA 4RULA 3DEZA 3DZBA 4RIHA 1G8MA 2ISSD 4YI3A 4FGSA 3VH4A 1NNEA 3AUKA 2C7PA 4LF7B 1DJMA 4ROTA 5BVGA 4KFRA 1AG9A 1EQUA 2C83A 2GO7A 2BEVA 1L7XA 1R6BX 3U5TA 2CL7X 4XGQA 4EBFA 4REOA 1Q57A 3DHWC 3OU6A 2B4QA 2O1WA 1NMZA 2PT5A 4NH0A 1LKZA 1V6AA 2D1TA 3DGEC 2NTJA 4EF5A 4KOEC 2UZ3A 1P45A 4WERA 4U7FA 3VHXB 3IIMA 4HFRA 2C54A 3UHAA 4A26A 1N5KA 4BP9A 4EHHA 2O0KA 2Q2VA 1IDN1 2O2CA 2PCLA 8LDHA 4FYYA 4O3MA 1K0FA 4DSOA 1TU4A 1XKTA 2X4DA 3PRKE 1P2GA 1OI4A 1XZLA 1HURA 2HCTA 3BBLA 1E6KA 2JH9A 3OF3A 4I6GA 1DUSA 4KQ6A 1DP4A 4NJMB 5AVJA 4BGUA 1UKZA 3DZGA 4JI3B 4COOA 3ZD7A 1XRSB 4MHTA 1ESCA 2B1IA 1JP7A 1TJ3A 2UUPA 4A2CA 3EXIA 4LY0A 4QTTB 3IUNA 4WAUA 1PTKA 4YP7A 1R0KA 2XVYA 3VZSA 2BWJA 5EE5B 4OJMX 1EDBA 2I2AA 4Z1OA 5HOQA 2PGDA 3RUIA 1ECJA 3TE6A 4FX2A 2VHYA 5EGNA 3OLQA 4UBMA 2ERCA 4EENA 3K92A 2R62A 2R8YA 3G7UA 4FKZA 3TW6A 4K8OA 5EHIA 2GPBA 1D9XA 1AKYA 2Z6UA 3WWPA 3TG2A 3U61B 1L5SA 2GBGA 2O4CA 3RB8A 2DFPA 2ODNA 5G0WA 2YJTD 2R6JA 4LMPA 1ZD4A 3SY8A 2IYLD 4ZWNA 4LNUB 2A84A 4FC7A 4YUAA 3IJPA 5TRTA 2Q1YA 1PDOA 1EE2A 1B6TA 2O6LA 5EQDA 1DT3A 2BN4A 4LOAA 2ODAA 3DE1X 4DXHA 5HZMA 1I5RA 1JQLB 5AYVA 3L1JA 3ZQ6A 4AIRA 1H8HA 1U5BA 4D25A 4NBVA 3G89A 3WMGA 3ZDAA 3PRHA 5BSHA 2GVNA 1BA2A 2R1VA 3K1AB 4H17A 1I2AA 1D2CA 3G0BA 4OATA 4O4LA 4KXLA 3IQHX 4WCFB 5KJEA 1K3FA 3QVSA 1NF2A 2WF8A 4Q1AA 5LDDC 1QH8B 1WB6A 3AHGA 4G8DA 2BFMA 2J3QA 3T1HB 3R0QA 3H0EA 5KQSA 1SVWA 4Y8VA 4PSUA 1RXCA 1JYEA 2CMFA 3A31A 4QUKA 3V33A 4L5JA 4CLOA 4IDEA 1GRVA 3C1UA 1ZJZA 1ZRSA 3A3YA 5IKEA 1OLOA 1AK9A 3LOQA 4FXOA 5HCIA 1N6IA 1EA7A 1GDDA 1RWBA 2EZ4A 2GB4A 2I76A 4H59A 3THWA 2ARKA 2IYRA 3PEYA 4OD0A 1MJGA 2C59A 5JSYA 2NUTA 2ZR9A 4JBXA 1UBKS 5IN4A 1OYOA 2Q0SA 4Q21A 1JQEA 2Z8ZA 4HWRA 3D2AA 4ZOQI 4JUAA 2VAXA 4M9SA 2W2OA 4OHVA 3EXG1 3QHAA 5JR3A 3HCAA 2JIPA 2QSJA 2E4VA 5E9QA 2M98A 4IJVA 3FYSA 1ZJ5A 4HTFA 4HWOA 3I12A 3NHJA 3PSAA 4AXXA 4EGJA 3U44B 3C0KA 1C3EA 2MT9A 1SXJA 3AM3A 4WKPA 1CUWA 1JWBB 1PR4A 1T8WA 1DFHA 3LJKA 4ZCRA 1HRKA 2JLUA 1F5NA 2RHMA 4TVKA 4J3JA 3QEKA 5LZ7A 4TTJA 1BMTA 1II8A 3DAFA 5TMPA 1N5OX 4L7VA 1ZICA 2JGFA 4NNJA 3DBRB 1S2DA 1XZMA 2VDWB 3AJDA 3K15A 1U8TA 1XOIA 1AIPA 2QTTA 3RS7A 1AXEA 2HLHA 4EJFA 3ADDA 1IN7A 3QWFA 5A0FA 3RJ5A 4G67A 4GRAA 4E07A 2BGGA 3SJUA 1Q77A 1QHHB 1TJ5A 4NCNA 2SECE 1TLTA 3LT5A 3SDZA 4JIMA 4KFCA 2EKLA 3IIEA 4WACA 1HORA 4CMEA 3EPJA 2IHUA 1Y0BA 2JFVA 2GEJA 2GJKA 1ANKA 1U9IA 2HDOA 1YRHA 3I42A 1B43A 4PLGA 3GJYA 1PNVA 5J2UB 2I22A 4E08A 1I1HA 2VAVA 3JAKB 1G55A 4QWWA 1W1WA 3ZV6A 1ICEA 1IHXA 3A3OA 4UDXX 3V9AA 4HNSA 2FPSA 3ELWA 3L84A 5J4YA 3W7VA 2FSIA 3GEMA 2YFYA 3HMQA 4Q4JA 1VHDA 1UBCA 2WYIA 3CSUA 3W7AA 4DR7B 3KFLA 2ECOA 2Y1LA 4HH0A 1D2EA 1T3ZA 1TMKA 1LLFA 2NTEA 2GPNA 4CEJB 2EX1A 2IH4A 3ND6A 3UG6A 1WCIB 1HQYE 2A7QA 2XQIA 3ABRB 2VK2A 1NVDA 1Q3HA 2CFSA 5FQNA 2JKYA 2XWSA 4DLWA 4MVXA 4KFSA 4YLGA 1ORRA 4P5PA 1FE8A 3ZX5A 2UVQA 3A36A 3BRQA 4MDYA 4JY7A 4KQWA 4F5YA 2I2BA 3DHNA 1MQ9A 3IB6A 3O8OA 3SVZA 1M1NB 5AUNB 1WR8A 3STWA 4ZI7A 3MT8A 4JELA 1M0TA 2RKBA 2CB9A 1KE2A 2E4WA 4QNMA 3BTSA 3GLSA 4L5YA 1XPRA 3HFJA 1D03A 5JZBA 5J2UF 2R6CA 1DRJA 2WHYA 3QX9A 4K86A 5AUQA 1E59A 1L3BA 4GEGA 4YRBA 2DPMA 2DU8A 2FLVA 3R3ZA 4MQ4A 5BQXA 5CAEB 2HHAA 3HDVA 3PD1A 1WZIA 1ZN9A 4H35A 4D8TA 3JD4A 3Q3JB 1FTSA 2F2TA 4X41A 5IVDA 1JIKA 3ZU3A 4JI6B 5CT5A 3DV2A 4JLAA 2C61A 4F3KA 4YRSA 4P82A 5FWYA 4MVWA 3I6BA 2VSXA 1Q7BA 2A1TR 4OI4A 2RGXA 2IEGA 1K7CA 3KTOA 1MD9A 1NNUA 5JH7B 2G3YA 5BO5A 1MOZA 1ZNXA 3OO1A 4QGHA 4I1OA 4LOIA 1YQDA 2XUOA 3R23A 4QUJA 5BV0A 4OP1A 1Z13A 3FDJA 3KQPA 1TCBA 3PC3A 4IINA 2WM3A 2CXNA 2BJVA 3OAAD 2DFDA 4K0RA 2DEUA 1KJYA 4BNNA 2YBDA 5D51S 3F90A 4CMEC 4A5SA 3OBBA 4D9MA 1QGZA 3TIFA 3R0ZA 1A2BA 1U9IC 3HNPA 3ZLUA 2AX3A 4XLZA 3W0LB 1B41A 3TW0A 3PFKA 3SQNA 2J0QA 3NHBA 3PA6A 1SUDA 4IF4A 3WL3A 3KUUA 2Q8QA 2FDRA 1KJJA 3NBUA 2EVWX 2JI4A 4UAVA 4N9QA 1G17A 2WJGA 4BJ5A 2IU3A 4GM4A 4Q3NA 4LYHA 1V6CA 1BH6A 1JR4A 1QUFA 3OZXA 3BWMA 3LLSA 5BORA 3K5IA 1J8DA 3A6ZA 1XNJA 3ZV3A 1OFGA 1XIVA 4XXHA 2PS0A 4DIMA 4V1CA 5JH7F 1Z56C 2QIPA 2I9PA 3U3OA 4ZYLA 3LXXA 1QRUA 3J81k 4IDCA 4GP6A 5CEFA 3PPYA 3SSMA 3EA4A 5DW0A 3IP7A 5EP3A 1U7PA 4JL6A 3IAM1 4BQQA 3HYLA 5SYNA 2GD0A 3L43A 2QTBA 4CF4A 1NT4A 3GRAA 3W7BA 1GG8A 3KR1A 4M7RA 5EP2A 2QB5A 2X9NA 3DYVA 3H6HA 1KEVA 1NMSA 2V6JA 4CKXA 2R7LA 2QZPA 4UTZA 3OSZA 4DBLC 1G6HA 3C43A 4FR2A 1PFQA 4JR2A 2XECA 3VX4A 1UOPA 4BQPA 4TT3D 1Y81A 2H52A 1EFAA 4FMDF 1GZ4A 3GT7A 1WXGA 3HBAA 1LJUA 4W7IA 5JQGA 3BE4A 1IVYA 2EP5A 4TS1A 3GLIA 1LF0A 3N2YA 1TYEB 2GJ8A 4BWVA 1T2EA 2O5VA 3GAMA 3HP7A 5BW4A 5ULLA 6AT1A 3NBKA 4B6QA 1JHPA 1KEEA 4LJYA 2QM7A 3A6FA 4O2AA 2WHRA 1Z0AA 2I4IA 5DBOA 2XA2A 4M1YA 3BZWA 5K01A 2REQB 1TT5B 3NPAA 1FU8A 2WBLC 3HB7A 1MG5A 4MV0A 3OU7A 1K2WA 3LG2A 2FSGA 1KZ6A 1I1OA 4TLLB 5EPUA 3RBXA 3WISA 1UPTA 5ALNA 1TKBA 4PYKA 4AS3A 4ZICA 3U4DA 1Z6AA 3V34A 5CDHA 2BCEA 1MDFA 2V58A 2PSSA 3ZQUA 1MPXA 4C7VA 2AWNA 1PJTA 1U3WA 5FA8A 1VRVA 3L1IA 1UFQA 3QBJA 4UEJA 2COKA 2AQIA 1CUEA 1J33A 1S2NA 2FWIA 2RK6A 1EFTA 2G1JA 3EMVA 3IA7A 4ZRDA 3JW8A 3ZLTA 4UU7A 1RVDA 4X1IA 1NULA 3VXKA 4FDUA 4XARA 4TN5A 5J4VA 1PJ3A 4ZJPA 1M74A 5I8WA 1W9HA 2H0RA 4G86A 3PJDA 1RS0A 4DQXA 3CUTA 2NXEA 3L7LA 4YFYA 1SH7A 3TKLA 1AKRA 2WRZA 2CVHA 4WNCA 4MI6A 2HF8A 1E2MA 2Y1OA 3ECAA 4L1KA 1A71A 3W4JA 5SV2A 1N6HA 3KV3O 5LBIA 3DAOA 2VLIA 4FLFA 2BY4A 2FJPA 3FUWA 4FW8A 4OGGA 1THZA 2P0AA 1DQPA 4HEQA 4U0JA 2C1EA 1E3DA 1WEHA 2BT4A 4Z86A 4AROA 4YCJA 3GXBA 3KQYA 4I50A 4DOMA 1E6CA 4NBKA 1E2NA 3DO6A 2ZKIA 3PR2B 1CU1A 3I6MA 1K98A 2O48X 2V5VA 3HGQA 4YRTA 5JLAA 1W4LA 1WHSA 3AY0A 3GY0A 2XVAA 4C6TA 3UW1A 1O2DA 1W96A 2GKOA 2LNDA 4M3NA 4KQMA 5TEWA 1ZOPA 2CK3D 2V7QD 3OJEA 4CM5A 3I5MA 3W5BA 2IXGA 5IDQA 1FSSA 4UNSA 1U31A 3V4OA 3V4ZA 1CDEA 3QVGB 4J0KA 2NXNA 4H6XA 5U1PA 4R54A 4F9FA 1SCNE 3MJ4A 1I0IA 3RS2A 1YZGA 3VPGA 2R1ZA 4IUYA 5C52B 1GG9A 1U7TA 3SM3A 2JW5A 4YONB 4E4TA 3ZE8A 3U39A 1E6LA 3F7MA 3OLXA 3BTOA 3P0FA 3GJXC 4I9HA 4DQDA 3F4BA 2DUUA 4GGMX 4ZCQA 3UBMA 3D7NA 3OM0A 1L5LA 1FDIA 4JJZA 1RXSA 4AM8A 2QT0A 3BHJA 3TR6A 5FPYA 1JA0A 1U3VA 3RV3A 1PR6A 3G9XA 4BKMA 1R8SA 1RHKA 1ZY2A 3OPXA 3IQGX 3RKRA 1A97A 4XWYA 4CL3A 5EQJB 3HY4A 1W36D 1LSUA 4PLPA 3L93A 1Z28A 2XJ9A 3JQ7B 4Q3CA 5TB5A 1FFAA 1UK8A 1YD7A 3SC2B 4EAAA 13PKA 4J0EA 4JP8A 3HS3A 7ADHA 3HN7A 3ZBUA 4HH3C 1H93A 4LVOA 2VPPA 3E2IA 3HYSA 2E21A 4D97A 4QVIA 1W4CA 3PT5A 4N8EA 3YASA 2A59A 4LVCA 4ARCA 3I8XA 1BQEA 1R6XA 1OWPA 2I3DA 3IBYA 1T1GA 4GECA 1WZEA 1X9IA 4KQ2A 5KYWB 3CRRA 3FWYA 2C97A 1UBFA 2KSQA 1FOEB 5EZYA 3TZ6A 2G36A 2C2HA 3MTGA 3PQ7A 1XCMA 4F4HA 4B33A 1JVSA 1CQWA 3GIWA 1H6CA 2W4IA 1YL6A 4DC0A 3A8TA 5GV7A 1I32A 2H2GA 3AXSA 2PMDA 1J21A 1K0UA 1E1CA 1CUDA 3WJ1A 5FPKA 2P3OA 3BGWA 3KO8A 4NX2A 4LAFA 3M6MD 4X63A 1HYGA 1QTIA 1VBMA 2N46A 2ZI7A 1BEEA 3NEJA 2F90A 5AJZA 1PX0A 5T6BA 2IV7A 1BA3A 1L8QA 1P62B 3MGGA 3GUYA 3EWAA 1GZ3A 4PIPA 3SXUA 3W5UA 5IT0A 2PWBA 1Y34E 1WXWA 1KJZA 2W6ZA 3PHIA 3I45A 1U2RA 3WL8A 1JI3A 5JW6A 3TLJA 4ZARA 1JVBA 5AOBA 4JOSA 3L6CA 1JIQA 2X5KO 2AVNA 1P0PA 4YXWD 2GAOA 1XALA 1VPTA 2ZJFA 3IPRA 3R7LA 3FN4A 4HEA6 4E1AA 5DX0A 2PEZA 1TJ4A 3L07A 1CUZA 4EOGA 3OE7D 4HYYA 5D86A 2FMKA 1RTKA 2RHTA 4HADA 4KV9A 1LB1B 1UEJA 3OIVA 4OK3A 4A8PA 1XK7A 2OCIA 5IN5A 3SEQA 3AJAA 3GPDG 2EDAA 2A5GA 3TFQA 3DBHB 3O8DA 4OFWA 3AG6A 3MCAA 1FYEA 1HK7A 1X15A 3F8WA 4KE7A 4EF6A 3UUGA 4R68A 2R8BA 3WWDA 4AMGA 3FB1A 1VYVA 1RZRA 1UT5A 5G1PA 2ZQYA 3VO1A 3Q3GE 3TLCA 3CW2A 2HJVA 4P5EA 5CH3A 3GHYA 4UM5A 4OOEA 4QAQA 2ZUBA 4OQNA 1ZJ6A 5K3DA 3SG0A 4HZUA 3HCBA 1PL8A 1TQHA 3T0FA 2YWGA 3C6QA 3IE1A 1UJ5A 1VCOA 3PFWO 3HJAA 3PDIA 5JSFA 1F6BA 2BMFA 1WETA 3QVOA 5JC1A 4ETIA 3A6JA 4R6WA 2RJ3A 4KDEA 1NU6A 4KKXB 2VK4A 2ZJ6A 3EGXB 3FPKA 4J9UE 5E3JA 1PV4A 4IG9A 3ZWNA 3WGKA 2V0GA 2PUBA 1LTHR 1N3LA 3TDNA 5B57C 1JU3A 4MROA 4YNBA 1ST3A 1J8MF 3QQPA 4TV8B 5AKJA 2ERXA 3BZUA 2MHCA 3CE9A 3V32A 4UTRA 4MB2A 2C3MA 1ZVQA 3JQ8B 4F6RB 5BP7A 2BF4A 2REBA 2IBMA 3EG9A 3IJRA 4BV2A 1OF1A 1TCVA 2GBLA 4J1QA 3AUAA 4TTQA 5DSXA 5KHAA 2OHVA 2ODBA 1C30B 2WD9A 3E1SA 3C41J 3SZRA 1LLDA 1RYBA 2CLDX 2UVPA 1HSZA 2GCNA 3FCYA 4O4IB 4PPNA 3ZBTA 2IYNA 2PXAA 1UZUA 5I01A 4ESVA 4WBNB 2VHCA 2AN4A 1RJWA 1ZJYA 4W82A 4ENVA 3QFCA 3BIWA 3VTAA 5LP6B 2OV2A 1M2HA 5F9FA 3TUJC 3AU9A 4BPRA 1L4NA 4ALKA 2K6GA 2R8OA 2C4VA 3GVPA 3L41A 2EZ8A 5FNVA 1N5IA 1QCDA 2Q5QA 3IULA 2KWIA 4Q4HA 3H1TA 4RZ2A 5ARCA 1ECGA 1XMXA 5BUCA 1PHPA 1W29A 3E5RA 3U3RA 2SCUB 1B6GA 4TV8F 4GICA 4MLDA 3QUSA 3ZIAD 4PO8A 4Z4QA 1T6BY 3HO1A 4ONEA 4M1TA 5CCEA 2X9VA 4M22A 4HYQA 3UMBA 5B2EA 4HDNB 4PSVA 4QL3A 4CCSA 4FZRA 1U0OC 5DBFA 3SLRA 3NPMA 4PYQA 1GKUB 1OH8A 2WJVA 1JDBC 4BO5A 4CKYA 2F1JA 4ZIRB 3PUZA 4CDGA 4DLLA 3QBVA 2JNWA 1R0YA 1YMQA 2TMKA 1R6AA 5FYQA 1GNQA 4WBNF 2WHPA 1XROA 3FPHA 1BO6A 4Z4CA 1JR3E 1F8UA 3FDXA 3ZDRA 4AYWA 1CY2A 3ESYA 2Q1WA 2FEWB 3GLVA 4RD3A 3ELYA 1DCFA 3QA9A 3DT6A 1FP4A 2FSFA 4PR0A 3P32A 2CMDA 3LO8A 3KHKA 5JAIA 2C4WA 3BMCB 1Z0UA 3VYUB 4OLFA 2OENG 2IZ1A 3OSUA 1BX0A 2QJFA 4RK7A 1A8SA 1PT9A 4XJVA 5DISB 4HQNA 3JV7A 2FW1A 3DEFA 3PC7A 5JSKA 2ZVJA 2QRVA 1Y1SA 2QD5A 3D4OA 4M7OA 3HJRA 3IEIA 4IQ0A 2HA5A 4OGWA 4DNOA 1O4VA 2C92A 3X44A 1WW3A 4ASUD 4QHTA 2JIBA 2CXPA 1WMFA 1E4VA 4E94A 2GBLC 1O3YA 2CFRA 1MO5A 2BFNA 1K5DA 2XE7A 3KLOA 1T13A 3I61A 2P0YA 3ILXA 5ECGC 3FDZB 4KL8S 1ULSA 2IKSA 3ICVA 1HO3A 2R6HA 3DZ8A 1K8QA 1TYBE 2QG4A 3CG0A 3CMCO 3DUWA 4X6YA 3TB6A 1ARZA 3U62A 5I4IA 4QUEA 5LLDA 2FFAA 3G2NA 3O8NA 2DKFA 2P69A 3BOSA 4YJFB 4EI7A 2EFEB 2VYVA 4BBJA 3SAJA 1TC2A 4Q9NA 1NNLA 2GSDA 4EGCB 2JASA 3P0RA 3PC6A 4TKVB 1CR1A 1A9QA 3BXHA 2WPNA 3OT4A 3PTZA 1JFFA 1EINA 2QLNA 1ZU5A 2GZDA 4FQ5A 2DR2A 1LFDB 3M49A 1KI6B 3CX7A 3HB1A 4M7WA 5ALKA 1WOMA 3FI9A 1NXQA 3W5IA 1Z39A 1J6UA 2B3TA 3L0SA 1DC8A 1QFSA 5LIRA 4K87A 1QCYA 1VDMA 5D87A 2HSDA 2VDKB 4EUFA 3U4MA 1ZGBA 3A9WA 2WWXA 1NF9A 2ZUDA 3MTEA 4FDLA 2AG5A 4ZAFA 4E3WA 2RARA 1GOTA 1MVNA 2G6TA 1DBQA 3PEEA 5IM4A 2R25B 3VR3D 4JUIA 2I2CA 2WUFA 3DNFA 1GU1A 1KNXA 4YJ3B 3SQWA 1A2OA 2AC2A 3OEYA 1YASA 2G80A 2ZE6A 1PWEA 1NMXA 4UARA 1OU4A 4IO1A 3PICA 1NE2A 3NIBA 4LX8A 4UMVA 1UUFA 2C00A 2PKRA 1FQKA 3HN2A 3ET5A 4A0GA 1TVKB 4O5AA 3L5KA 3GCZA 1E8DA 5JPIA 1QPZA 1QO0D 1JTEA 1OB5A 1ZH6A 2JCYA 3LYLA 3SJAA 5KQMA 5K1ZA 3ZWPA 2IYYA 3ZH2A 3TQTA 2QKYA 2W22A 1KYYA 3W5CA 1W9MA 4WT7A 3C1TA 1Q22A 4CM4A 2NYVA 2R1UA 3AX6A 4Z7QB 2OAQ1 2OYSA 4MR8A 4BOYA 1BG6A 1DX4A 5C9ZA 5THQA 1MOSA 3BF7A 3COPA 3OFNA 4HDAA 1Q21A 2NYRA 4C6HA 3E7DA 2J48A 5CT4A 3RJMA 1ZXLA 3PDUA 1IN1A 2QR2A 4PTLA 1LU9A 4CLEA 5C8ZA 1GQOA 1H1DA 2QM3A 4MUGA 4NMXB 3F7TA 3TQHA 1XWIA 2E7ZA 2JFNA 3JQAB 4GQBA 4R3UC 4YJ3F 3WSWA 2WMNB 2BFWA 4ZT2A 5C35A 1V8DA 1DTSA 1C4XA 1MORA 1T26A 4L15A 1O95D 4DLAA 1X1BA 2YYAA 4GO1A 3JZDA 3LCVB 4GX0A 4BQIA 2L42A 1HBJA 3ASVA 1YO6A 2JFYA 1CLUA 2RIRA 1BE6A 3HZOA 1AO3A 5DTJA 4ZVSA 1P5ZB 4FFRA 5SZJA 3MOGA 3OX2A 3TG8A 4LSZA 4CR8A 2C8JA 4DCSA 1EXVA 5AMXA 4HDMA 4TMFA 1C8BA 4NJOA 3OJLA 4P58A 3VHQA 1KVTA 2HIAA 4A2WA 2J1LA 3KRTA 3WLAA 5IZ4A 1L1FA 2BRUC 2C8VA 4HFNA 5T67A 4K6FA 4RD1A 1DRWA 2QDXA 5ALWA 2W6NA 3OLZA 4MGIR 4QGBA 3VPCA 2XEXA 3KD2A 4L5CA 4NFSA 1SUIA 1VBNA 3MM4A 3CXRA 4OGFA 4FE3A 4CNQA 3HM9A 3G5TA 4CMAA 4FOSA 4BLTA 4YRGA 2AOXA 3FE2A 5EIXA 4QICA 2AXPA 5HCUA 4QRIA 1CZOA 2RH5A 5F33A 1KDRA 2NO1A 1KVUA 2VOJA 1RWPA 1T0UA 5CA1A 5INTA 3EMBA 3T3DA 5EHXA 4Q34A 1G0OA 3KNZA 3CW9A 3QF7A 1TYCA 4S04A 1E58A 2NW6A 4KQ9A