2Y1LA

Caspase-8 in complex with darpin-8.4
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
150
structure length
150
Chain Sequence
b'LDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CASPASE-8
publication title Caspase-8 in Complex with Darpin-8.4
rcsb
source organism Homo sapiens
molecule tags Hydrolase/inhibitor
total genus 56
structure length 150
sequence length 150
chains with identical sequence C
ec nomenclature ec 3.4.22.61: Caspase-8.
pdb deposition date 2010-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2y1lA00
3NS7A 4FXOA 3P45A 4IEFB 3UO8B 1RWVA 2Y1LA 4JJEA 4QULA 5I9TA 5LUBA 4EHNA 1QDUA 2XYGA 2H4WA 4EHFA 2C1EA 3H13A 4ZVOA 4JQZA 3V4LA 3GJRA 1I4EB 4D3ZA 3DEIA 4M9RA 3DEKA 2H5IA 4QU0A 3V6MA 4EHDA 2HBZA 3PD1A 1F1JA 3EDQA 4ZVTA 4DCPA 4D3XA 3IBCA 1SHJA 4N6NA 2CNNA 4PRZA 4QU9A 4N6OA 4ZVPA 3NKFA 4EHLA 3KJFA 5IC4A 1F9EA 4PRYA 4QU8A 1RHJA 1RHUA 2CJYA 4QUJA 5IBRA 3R5KA 2NN3C 5LUAA 4EHHA 2C2ZA 3ITNA 4AWBA 2CNOA 1JXQA 1RWNA 3H0EA 4DCJA 1I4OA 4N7JA 2CJXA 1PYOA 3GJQA 2K7ZA 3GJTA 5JFTA 1RHQA 2FUNB 1CVRA 1RWMA 1M72A 3KJQA 1SC3A 4QUDA 4ZVSA 2QLBA 2QLFA 4QTYA 3QNWA 2QLJA 5IARA 4JJ7A 3BIJA 1NMQA 2H51A 4JR1A 3P4UA 4N6GA 2QL7A 4I1RA 1K86A 2H65A 2C2OA 4FGUA 1QTNA 4NOMA 4N7MA 1I51A 1RWXA 2HBRA 5K20A 2J31A 5IASA 2H4YA 5IAGA 3D6FA 1I3OA 1IBCA 4ZVQA 5I9BA 1RE1A 3H11A 4JJ8A 3S70A 4EHAA 2C2MA 4QUAA 1BMQA 3R7BA 4PS0A 4QUGA 4DCOA 5IAEA 1PAUA 1RHKA 2QL9A 2HBQA 3V3KA 2FP3A 1GFWA 2XZTA 4HQRA 4AW9A 3H11B 3OD5A 3SIRA 3R7NA 4NBKA 3R7SA 4HQ0A 4I1PA 2J33A 4IYRA 2XYPA 2J32A 4PS1A 1RWOA 2XZDA 3K7EA 3NR2A 3V55A 4LSZA 5H0IA 3V4OA 2QL5A 5IC6A 3R6GA 2H54A 4JB8A 4QUHA 4NOLA 1K88A 1ICEA 2P2CA 1RWPA 5IAKA 4D3YA 3UOAB 5IBCA 2H5JA 3GJSA 3H1PA 2J30A 2Y0BA 1GQFA 1RHRA 4NOJA 1NMEA 3V6LA 3S8EA 1SC1A 2AR9A 2C2KA 3PCXA 4JR2A 4NOKA 3R5JA 3DEJA 4EHKA 3SIPA 1RHMA 1RWWA 2CDRA 2XYHA 1KMCA 2DKOA 4EJFA 3IBFA 2CNLA 4QTXA 4ZVRA 4ZVUA 4NBLA 4AWAA 4FEAA 2FQQA 4QUBA 5IBPA 4JQYA 5LU9A 1QX3A 2HBYA 3D6MA 4JR0A 1CP3A 3PD0A 2CNKA 3D6HA 3DEHA 5IABA 1RWKA 2H48A 1NW9B 3RJMA 5LU8A 5IANA 3R6LA 4QUIA 4N5DA 5IAJA 4QU5A 3KJNA 1SC4A 1NMSA 3E4CA 4HVAA 2WDPA 1SHLA 4NBNA 3EDRA 4FDLA 4QUEA
chains in the Genus database with same CATH superfamily
4YGYA 3A36A 1F06A 4I4CA 2XTJA 4W6QA 4W5QA 9ABPA 2XCTB 1RZRD 2IVFA 4RELA 4FJ2A 1QVAA 3GDFA 5EIOA 3PFWO 3VYSB 1V9SA 1UAGA 4MV8A 3AMVA 2PBZA 3T7EA 4YRAA 1E7QA 2P2ZA 2FN4A 2D2FA 1ZNWA 1ETUA 3UAXA 3PGA1 1DFIA 4C2BA 2C9ZA 1Y8QB 4PSAA 1RMYA 1YRQA 2W98A 3ISVA 2EP8A 1QFJA 2VKQA 1C7JA 1PKXA 1JH9A 2PGAA 3FOBA 2EJBA 2Z4RA 1KMMA 3C5HA 4AKHA 1QQ7A 3FAKA 2GNAA 3CNHA 4IGIA 2DWCA 3QIAA 1LZLA 1MO4A 1C1XB 3FYDA 1O6GA 3IMFA 3LBNA 3ZI0A 2M1XA 4CUKA 2W2KB 4AL4A 4U00A 3GJ7A 3QUCA 2XQIA 2P40A 1KDPA 1V11A 3IA7A 2IYNA 3BIXA 4L7VA 1LTQA 2GJSA 2GPYA 2YWDA 2CLMB 4QUKA 4K3VA 7REQA 1VL6A 3U7IA 2HLDA 4DMCA 3C7DB 4U7WA 4FEYA 2E4YA 2A1UB 3MCTA 4C0HA 3WC4A 1NW3A 1OFIA 1SN7A 2C2OA 3RG2A 2QBYB 2ETVA 2JGRA 1QWSA 1VLMA 3D4IA 3PWZA 1SBYA 4G1EB 4TLLB 3TLAA 4BBAA 3UBTA 1ML3A 1YXMA 2ODQA 2YY6A 1UOQA 4EJ0A 1XPOA 4RJ2A 3RRBA 3BFVA 3R0VA 4ID3A 4KR0A 1IJEA 2VJNA 4AMYA 2HRRA 3ORHA 5C7OO 3HKEB 2JCSA 1WVGA 2IYSA 2ZVQX 3ZOZA 4H7FA 3T5PA 3PPXA 3RFTA 2H7CA 2OUKA 4RZXA 4IIYA 4XSGA 4I0WB 2DCMA 1SM4A 4B4KA 3KFXA 1RWOA 1WV0A 3PL5A 4FGLA 5E4FA 1QR2A 1UP7A 2J0SA 1NU6A 1XB2A 3ORRA 1E2KA 5M34A 4DGQA 2ORIA 1H9BA 3TDKA 2WAYA 4C7JA 2UZ4A 1U0BB 3DA8A 1WZCA 2G0TA 4HFNA 3DB2A 1LDYA 1XQ1A 1AZWA 4ZHQB 3FHOA 3WB9A 4IDPA 3UH1A 3DMFA 5DLPA 3QEBZ 3QF4B 4I5FA 4TKMA 1VKRA 2RKBA 2RHOA 3EVNA 3KZVA 4GPTA 4HATA 3KR2A 3RF6A 3TVTA 1QF7A 3O93A 4A23A 2EGGA 1YS9A 1TT5B 2WTMA 3Q7SA 3LCJA 2AF3C 1QE0A 3PR2B 1Z0FA 2VBGA 2CUTA 2C00A 3P0HA 4MVJD 5DW3A 4LV6A 1JTVA 2IWHA 2IIPA 3M33A 5LQSA 2B4QA 1PBNA 4RHFA 2Q0HA 2OYCA 1EQAA 2QQFA 1QO0A 3IKLA 3JWHA 5GPBA 1AV6A 5DXJA 4X66B 5I9IA 2H2HA 4CLOB 4EHIA 3GRPA 2XBMA 2ZPAA 1M8KA 3SR0A 1AE1A 1NQOA 2AXQA 1E9AA 1PQPA 2OMEA 3VYTB 1QGED 3G2MA 3GYBA 2YXNA 2PO5A 1OREA 2PANA 4BKUA 3MWKA 3ZCQA 5JSKA 5LP6B 2HRCA 2W8BB 2P68A 4O1MA 2VDVE 4TVOA 2CYCA 2FE1A 4I3FA 5H70A 5JD3A 5EXEA 1ID1A 5TRTA 1JLSA 3BFXA 1K1EA 3LQ2A 5E4JA 2JGKA 3VR3D 4BX3A 3JASB 1OFHA 1Z9BA 4X1YB 5LA6F 1L5NA 4QICA 2IY8A 1IHOA 1LQUA 1LH0A 3GZJA 3DCYA 2J9ZB 4KQ9A 4ND1A 1T0IA 2YUTA 2F17A 1V95A 4UNNA 5A06A 5CA0A 3HVIA 2PVPA 4L22A 2WWIA 4N6OA 4C0QC 5BPFA 4TWBA 3NHJA 2JH8A 3RYFA 3G2JA 3PUXA 3R0ZA 4G2TA 3D6JA 4AAYA 2C2ZA 1KR2A 4HDRA 4L8VA 4LHZA 4PPFA 3UW3A 1FPMA 3AJ8A 3C6BA 2ZIXB 1U2TA 4KMOA 4HLNA 1OD6A 1TXGA 2QSZA 3KLOA 3OVMA 4OXKA 4EMBA 4R6WA 4ESEA 3U7GA 4UMDA 5ULLA 2PGDA 3FHLA 4Z1OA 1RFLA 1KBZA 1NXTA 5GQSA 1I4LD 3TD2A 3UBMA 1NI3A 2TS1A 3DE3X 4MKIA 1YVPA 3VNAA 3EJ6A 3AC0A 4TWJA 4NH4A 2WVAA 1C3OA 4TL9A 4DB4A 1M75A 3AV3A 3DOEA 3E81A 4KKXB 4B4WA 2PUWA 1LW6E 3FCXA 3OX3A 4DHEA 1U9CA 1X74A 2YVKA 1NR5A 4RHUA 1ZMOA 3CZPA 1X8XA 2YJ3A 5L45A 4R8SA 4H3SA 1DX6A 1ZK1A 1C7IA 1SUCA 1HF3A 3NTOA 3RB8A 5C1PA 2ZYIA 4IDFA 3U3KA 3Q9NA 2H4YA 4QYIA 3HTXA 2PDAA 2QD3A 5E1MA 3EGDA 3PQ7A 1KDOA 1R64A 1OWMA 4JP5A 1JAYA 1PT5A 2R8EA 4W63A 2X6TA 3GJ6A 4G4GA 5SZJA 4N7RA 4JBNA 5BPHA 1ZPDA 4B3TB 1W93A 3PDCA 1KGDA 3WLHA 1WABA 3ROKA 1JDPA 2PTHA 4FK8A 1XKLA 1L5LA 2RK3A 4TYMA 1WL8A 2C3UA 4P4NA 5HQ3A 3HKCB 2VHVA 4R2IA 2QUZA 1KPHA 1XHFA 2OV4A 4JAVC 3RHTA 3V4OA 2DLCX 3MJCA 3X1WA 4INPA 3R4CA 2WUFA 2BGNA 5EXTA 2QMHA 5DNAA 3VO9A 2P9JA 1EDDA 3VPDA 1EINA 3B36A 4UREA 4XX0A 4XPIA 1RCFA 2B61A 4GPZA 4S1VA 3N0TA 5K3EA 4OHCA 4PV7A 1I9CA 4F2HA 3CLTD 1OZGA 2RIPA 2RHWA 4FI3F 2I3GA 1ZRNA 4XR4A 5I51A 2WI8A 2AFHB 1BXGB 2AT1A 5K0LA 1G5HA 2QM3A 2Y71A 3VGPA 1KYWA 4ARUA 4J0JA 3F3YA 1BVUA 2PL3A 4OY3A 4DADA 4LF7B 4FYXA 4B8ZA 4KRFA 5FPYA 5TQ2B 4Z4EA 2IXGA 2GYYA 2AJBA 2QD5A 5KINB 4OXNA 2QJFA 1RS0A 3ADBA 2X9VA 4HZUB 4IFEA 3C4JA 1ECJA 1QC5B 3DOUA 3O2QB 3DMYA 3ZE0B 2PCJA 5BW8A 2CJWB 4AP9A 4RO0A 2XH8A 4QXPA 4PPQA 2CHGA 5K3FA 4AICA 4Q1BA 4TKUA 2QVYX 1Z6TA 1L5WA 4ITUA 4PXYA 4PYKA 5K6AC 2ZBRA 4PZ9A 2D5LA 3FZQA 1AKEA 2B8WA 2MSWA 1O6CA 2P4SA 4ZYZA 3DKPA 5HWSA 2PGNA 3F2IA 4AJ2A 1NUQA 1TEHA 1LK5A 1MXFA 1TM4E 2DSTA 1O6BA 2P1RA 4JH0A 3VQTA 1H0HA 5EGNA 4KQXA 4P58A 1JEQB 4FR2A 1MC8A 4P6VF 4LEIA 4KN8A 1J7KA 2EX0A 4LE2A 4WE3A 4BVHA 4KR6A 4AP6A 2B30A 1T8SA 1CDOA 1B6TA 4CLOA 2ZIFA 2A8YA 2FW1A 1QH8B 1M9NA 1YZFA 3CKLA 1P72A 2A9JA 4RY9A 1X80B 5K3AA 1JLLA 3WIDA 1CJCA 3IAXA 3INYA 4HUTA 1I7LA 1KJWA 3EGCA 3EN0A 4C20A 3QF7A 4UOEA 4NEGA 2C4UA 3ZJTA 1N7JA 1UM9B 3EXHA 4PZYA 5D1HA 3ZXXA 1E58A 4DNOA 5IZ4A 1Y89A 1QIEA 3NEJA 3TW6A 3ZVMA 5DNWA 4CMAA 2PPVA 4R1TA 1N5RA 2WTNA 4WOJA 5IVHA 3AK4A 2IH2A 5FOQA 1E32A 2ECPA 4JJ7A 3RLIA 1NYRA 5BR1A 2FMUA 5DNEA 1EJ6A 1LSJA 1ZW6A 4NCKA 2LW7A 4IDAA 4CT0A 3W2TA 4S05A 4F4FA 2FFRA 5TS2A 5EWJB 1QCDA 2REOA 3A9TA 3SBXA 1X1EA 1IVYA 1ZQ1A 3PUVA 3W3AA 1TECE 1Q6YA 1Z5NA 5AT1A 4OP3A 5CA1B 2PYDA 4W8HA 2GRUA 2ON6A 4HTAA 5LOVB 4BXOA 1ODJA 1CZNA 4RLQA 1YB5A 2GM9A 3OOSA 3C87A 2D5BA 2HFJA 3CR8A 5KVCA 3FKSD 4XARA 5FHRA 3OC0A 1JKJA 4CLRB 1JQAA 4WBNB 4U0KA 1QGDA 3RBZA 2IU4A 1QG0A 3A0UA 4Y9DA 4LPKA 3CLRC 5GZ6A 3SZUA 1IYZA 2FCRA 5KSYA 2HQ1A 3CO5A 2DGDA 1XMSA 4DDWA 3RROA 4ARSA 2B0JA 4J9VA 2HI0A 1KO8A 3EG9A 4FZ5A 1SEVA 5DIZA 1L7RA 2RHJA 4QSHA 3RI3A 3M6LA 1LS6A 2FDRA 5B1EA 3UC9A 2XQVA 2C4MA 4O02B 2POCA 3WHLA 3UMGA 1CUYA 1K4KA 2ZWOA 4NZMA 3R8CA 4FFDA 3SHFA 4K86A 3UQYS 1AURA 1DB3A 1FLDA 3BRWA 3FXAA 3F8TA 1JIKA 4M1EA 4RMNA 4TN1A 4LHYA 4KOEC 5BR7A 4HDKB 4PN3A 2B2XA 3DJYA 4EVIA 2HJWA 4Z8YA 2CK3D 3W5UA 3I28A 1BOFA 4A1OA 1R50A 2VZ0A 4U5QA 2H0RA 3LI2A 3QKSB 4ZEXA 3LUCA 2A6PA 2NU6A 4ASUD 4HDSB 5IDXA 1GDTA 2B36A 2PV0A 4LZWA 5E7JA 3WGOA 2JD0A 1BCRA 3DOOA 3ZWQA 5A7GA 3ZUPA 4CQMB 6ADHA 4CXMA 4GG1A 1QO9A 1SWWA 1RLOA 2FR0A 2NVOA 1M6VA 1ZIXA 4M3NA 1FP4A 4I4TB 1C3EA 1USGA 4UCXA 5IAJA 3GLHE 3H6HA 3OZRA 1TUBA 3SBDA 4PGMA 1SOWA 4E5DA 5F2NA 4CQMD 1X7WA 1GZ4A 1J2EA 4TTTS 4HMQA 3JD0A 3TM5A 3SYRA 1B0ZA 1RJDA 4DR2B 3OT5A 4XKJA 1DG3A 1EYZA 1PGNA 2QTVA 4KFTA 4PCVA 4Y8VA 3GEHA 4PNEA 3BB4A 1AA6A 3U6KA 1GRCA 5CLFA 1U2GC 2JAOA 5KREA 4OJNA 3ER9A 1O54A 1P2TA 1Z6ZA 3ICWA 4G2NA 4P4SB 3GD7A 1FDSA 1VRWA 4L74A 3VPAA 2HT1A 1YKFA 2CW5A 2DFTA 3W8RA 2CCJA 2VBCA 2VUIB 4D4GA 1V2GA 3BRCA 4NZNA 1YA8A 1KY3A 5E38A 2GZRA 4LDZA 1SUEA 4R9NA 1U4SA 5DI3B 1FFEA 1NBMD 3ENVA 5GJVC 1CQJA 2GM5A 2BYTA 5HS6A 1Q0PA 3D8NA 4L4ZA 1CE8B 4MQFA 4MRVA 5HF8A 2NLOA 4MWSA 1P4JA 1I3MA 3CCBA 3F97A 2G25A 3JZAA 4BN5A 4EUFA 1RJGA 4NS4A 4CEJA 1GZVA 1Z83A 2H4ZA 2WFMA 1WQ1R 2WYHA 3B82A 4QYXA 4N0DA 5D6OA 1PR1A 1DC3A 1BHQ1 2QAGC 4J2OA 4WZ6A 5TDHA 1QGYA 3ZWDA 4GGMX 4D3FA 1UPBA 4IHJB 1TE2A 4AJ9A 1CVRA 1ICIA 2BRUA 2FZKA 1J0DA 2O0KA 2GJKA 2FPOA 4KDEA 3VH1A 2PX2A 3IVGA 3E1KA 4K9PA 2ZRIA 1E7MA 4LTDA 1MABA 3NWEA 5HDQA 2QMUA 5JLAA 2FKAA 2R00C 2XUAA 1RE0A 2NT4A 2C3YA 4OHBA 1X15A 1Y5LA 3SC4A 5AHXA 2QXYA 4B79A 1QNFA 4IG4A 4NYJQ 3FTEA 3MTEA 4JNCA 4TL7A 2VRNA 1DWOA 1LTKA 1MG0A 4FGSA 3MIZA 2EKLA 1BCSB 5ESXA 4US1R 5FO0A 1FXWA 5FTMA 2F6RA 2RARA 4ZV7A 2QD2A 4WA7A 2Z4SA 3HP7A 5AM5A 4BMVA 1PW5A 4NESA 3RS8A 3GU3A 5EMJA 1U2ZA 3DBHB 4KR7A 1S8NA 3L7BA 1EUCA 1LC0A 1QLJA 4LC1A 1E3QA 1KSJA 1N7HA 4FYWA 2RGXA 3FG9A 1K3UB 1J70A 3FMIA 2C7OA 3ZDDA 3K9FC 4F85A 1WBDA 1GPAA 2VC2B 1DAEA 3OQVA 4QBGB 5KSOA 3FYCA 3UOWA 2NTEA 5BMVB 4E1AA 4FC6A 1H2WA 2UZ1B 2HSWA 2VF8A 1JIVA 2ZYDA 3C24A 3JVVA 4REMA 5TMDA 3ZE2B 1A4UA 1ORIA 2GILA 3B2NA 3UK7A 3USZA 3QX8A 3BB3A 4ZOAA 1P1FA 1CVIA 1IWOA 5IBCA 3UVEA 1CUAA 1G18A 4NOJA 1XZLA 2RG7A 1GKYA 3CRQA 3V8BA 5JPCA 1YI8A 5TF4A 4JR2A 2HHJA 4ZK6A 2BHLA 2VJLA 4E6EA 3GJ0A 4LI0A 1Y4UA 3KVVA 1R6VA 3VTZA 4YMTA 4NZPA 1JG3A 1Y5MA 5F35A 1OR8A 2EDAA 1KYTA 1XC7A 1U94A 1QIGA 3EF3A 2P9EA 4F4IA 3CBQA 2GD6A 3RAPR 1PFVA 2KQUA 3L0ZA 3O8RA 4PFSA 5GVSA 2XXAB 4TMWA 1JDBC 5EJ4A 5L3RA 4ZOCA 5BSGA 1UFQA 2FFJA 2JVKA 4EUEA 1ECPA 1V71A 5LFAA 1AF7A 3IOBA 3LQQA 2Q2NA 4L5CA 4FDMA 3RFXA 1I0IA 5IJWA 3C48A 3H1FA 3WYEA 4BWGA 5JBNA 4WVLA 1IATA 3RRNA 1E0AA 2N1MA 3HU1A 4AKTA 1T3TA 1DXOA 1LBIA 1XD2A 3P45A 3QEAZ 2K2QB 4F8JA 3QOWA 3BWCA 5CJJA 1DPGA 3LXMA 4CM4A 3W9BA 5F78A 1KJNA 2B8EA 3N0WA 2PLFA 3G0OA 1FP6A 2EW1A 2BSXA 2Y0CA 3TJZA 4DLAA 4DGSA 3O74A 2ZAYA 4H35A 2H1OA 3VPBA 3I01M 2ZQYA 3CUEF 4N6NA 3Q6NA 4MCAA 2HUPA 4IJUA 3OU2A 3IMCA 2IDMA 3CMMA 2ZUBA 3IBGA 2CCKA 1BZYA 4IZIA 1YR7A 2ZBGA 2OKGA 2YYSA 3UEOA 1CRQA 2AV6A 1YQGA 3JQGA 1UBEA 2OL4A 2UYCA 1WP9A 5A7FA 3TMYA 1KIFA 2F64A 3FPAA 4Y2JA 1Y3BE 2QX9A 2QGFA 2V7VA 4Y2VA 3F90A 3TTUA 4OBWA 4II7A 1NN1A 3L04A 4MB2A 3MJSA 4IILA 2CC2A 1CY4A 2F9LA 4EI2A 1V8BA 2IYEA 2EIXA 3EWSA 4LQ4A 1NE2A 3ZHVA 5H4HA 1AKUA 3CLVA 3DLCA 4XD7A 2J3LA 2VZ8A 3FNBA 1HL7A 3GVCA 1GHTA 1F5NA 2GHQA 2E37A 3TUIC 1KZ1A 3HFSA 3KO8A 4HX9A 5CHYA 2AQKA 1ZKMA 4QYWA 1NN0A 2EF0A 4P2BA 1G2QA 4CUJA 1JT2A 5IEBA 1OI3A 3OPYA 2GB4A 3L46A 4DIMA 2WYUA 3H5RA 4QBIA 4JSTA 1A8UA 5HTKA 2JI6A 4MULA 3FVRA 3QWIA 1WU8A 2IUEA 2NXJA 4DF3A 3GDGA 4OLAA 1W25A 2JFGA 2QOEA 4M8NE 3L41A 1NX6A 1UL1X 2D0PB 4QDZA 4YJ2B 2Z43A 5DHSA 3FCYA 5M5BA 3WGGA 3L0SA 3G2IA 4BLSA 1YGYA 2RIRA 1FQKA 2DPMA 4B3CA 2MSDB 4DIOA 2WJ6A 4FILA 4LY0A 3EXG1 4N65A 3FMPB 1QH1A 4PTZA 4R9SA 4BGIA 2ATVA 1OKKD 3CLHA 5JC8A 2ZRAA 5GP1A 2WHYA 3AVPA 5DWQA 1I4DD 2VAVA 2EF1A 4XTRA 3NNSA 1BA2A 4H7JA 5AXAA 2LIPA 4BNLA 1KMCA 2IUSA 3WL5A 3AJAA 2HPAA 3DV2A 1YQXA 2YUIA 2YWHA 3NNDA 2VDRB 5DBEX 4WFKA 1CU1A 1Y6RA 5IFKA 5LKAA 4EITA 2IKQA 3D6MA 4G8BA 1I7PA 1PN3A 2WSSA 4IJWA 4BNDA 2P4QA 1L8LA 3LGSA 1GADO 4M53A 3TL6A 3FUWA 4CV3A 1OX5A 4MGEA 4BO8A 4GX5A 4AU1A 4BNWA 4Z7JA 1WXIA 2VPQA 3GB9A 4UQPA 1KVRA 5TEWA 1TUIA 2VQ6A 2WYWA 3UOGA 4XUEA 2I9PA 2GEBA 1R3DA 4LK3A 4EVRA 1N6IA 4REQA 4D0SA 3W5CA 1KHTA 1FDRA 3OLVA 5ENVA 4UNSA 1N2SA 1JEEA 5I9TA 2JAHA 5F76A 1YUNA 3AEQB 3PNLA 1QO0D 5AKZA 3V2UA 3TLKA 1GLVA 2ZZKA 2Q5EA 3V4LA 1H6CA 3C45A 2QE6A 2ROQA 3WV5A 3X1XA 1CWUA 4GP7A 2HD4A 4M99A 5HIJA 3RGGA 4AROA 3GZ4A 3KLPX 4I6GA 2ENUA 3W34A 3EZFA 5KNCA 5LIPA 1Y34E 1PD1A 1UQRA 4CV0A 1G5PA 4RFSA 3ZNQA 2YN4A 5IEJA 2ZYTX 1JMVA 1DQPA 4GLLA 3PNMA 1C8KA 1XTZA 3ZJVA 1YS6A 2VJYA 2ZJ1A 3NUGA 3FOEC 2X1LA 2DAPA 2NTJA 3JQ6A 5C9ZA 1ZH4A 3VO2A 4HDRB 2A7QA 4Z9BA 2K7ZA 4WVFA 3PWTA 3T61A 3VC2A 3BE6A 2FV8A 5F9MA 4HLUA 3QYPA 1K6XA 3D81A 1RPJA 4X8HA 5BN1A 2Y0EA 2V4MA 4F06A 1GGNA 1NFRA 4R1UA 2DFVA 1ZU5A 1G1MA 2YZMA 3FPGA 3MNFA 4L5YA 5LP1A 1GY8A 2ZRNA 3R4VA 4HR7A 3DHYA 3ESDA 3QPUA 3PF8A 4MEAA 3ETLA 3L18A 3NEYA 4UVGA 4AK9A 1KWGA 3M3DA 3F7OA 2R6AA 1VKZA 4ENPA 5GJCA 5EJMA 1M73E 4B5LA 3FTNA 4JJZA 1YRLA 1J23A 2PRKA 1JR4A 1Y7HA 3AU8A 3NTXA 4BKMA 1DVRA 4G86A 3NIGB 1EGQA 4HNSA 2IYOA 3A2NA 4LAFA 3GN2A 3MA0A 3H2BA 4NC9A 4OK3A 5EIFA 3QENA 1LBSA 1CERA 1IDN1 4KDFA 4HYTA 2NXCA 1T3ZA 3T3DA 1YRHA 2F3PA 2V6BA 2A1TR 3JQ8A 4FFPA 5DHTA 1HFEL 3QE9Y 1TQHA 5HKBA 5I7FA 3L0DA 4URFA 2ZRKA 1E1RD 4Q3KA 3I04A 3PGKA 4LYHA 5JHGB 1V4VA 4OHRA 4INOA 1IWPB 2LCIA 1P7ZA 3SQDA 2P6PA 5JALA 2ZJOA 5LSAA 2Z9BA 4EQZA 1FSZA 2WKRA 3M3PA 4JJ6A 4NOKA 3LQYA 6AT1A 2GM4A 2ZZNA 1XZDA 3KJIA 4XX0B 2IOYA 2JLSA 4PW0A 4BQSA 2CF6A 1C9EA 4BFLA 2L2QA 3JZFA 1NT2A 3KK0A 3LCVB 2YW2A 3N2EA 1DQNA 3OIGA 4KGDA 2RHTA 2I1VB 1X39A 3RTCA 4MQUA 3K0CA 1RWBA 2OESA 1C2YA 1MJNA 1QKJA 2JGLA 4JB3A 2VRCD 4JR0A 2YIMA 1U1CA 3MBIA 1XTKA 3MEQA 4PLWA 4X61A 3UYKA 1MVNA 1P17A 2JBAA 3D7KA 1N1MA 2HIHA 4XYGA 4OSPA 4I50A 1S2IA 1DJNA 3WXMA 6LDHA 1NMSA 1X8LA 4JLMA 2DQ4A 3HDGA 1MKYA 3ANYB 4L9WA 4UU0A 3TDNA 1FIUA 2X3YA 1NQWA 1QMPA 1NV9A 5I5EA 5JC1A 1LEHA 1AQJA 3K2IA 4YP1A 3IAS1 3U7FB 3COVA 1ATIA 2BPOA 5KYNA 1WD7A 3OWXA 3QELA 4HYEA 3OLCX 2WSMA 3RSFA 5F3DA 3ZZ1A 3EUEA 4XVHA 4M9RA 2ZB7A 3UJHA 3E03A 1J8FA 1WHSA 1Z17A 1JWAB 3Q7PA 4OYYA 4W7IA 3V2GA 1GFIA 3FPFA 2XCUA 5CNIA 3V8MA 1DNPA 4K26A 4PLYA 3WWCA 1DQZA 1UJ4A 4M86A 4QWMA 4J91A 4BNXA 2HDHA 5JH7F 4QU8A 1Z0IA 1F6DA 3MJHA 3ZTTA 3HYCA 3AIOA 3PRJA 3CT4A 5C8YB 5F7XA 1GZ6A 3NBUA 5ED0A 2R7LA 3T7KA 4J16A 1OZHA 4MUGA 3WKBA 2IY7A 2W71A 4YCMA 4OBXA 1SUAA 1FSGA 3QVGB 1UMDA 3I6BA 5GADl 3MTQA 1ORDA 3N8HA 3P96A 1GG8A 4C7MA 3EUWA 3PWSA 2HLNA 5DGTA 3AOEA 4ICIA 3U4IA 1OB5A 4OHMA 8LDHA 2CN1A 1POWA 2WABA 1GAJA 4RA6B 1KFEB 4LCBA 4MNTA 4OXYA 2XRFA 2I2DA 2FWMX 2PGIA 4Y6LA 1N5MA 2FB9A 1JHZA 5KTPA 2HB6A 2TMKA 2H92A 2ABWA 2OB2A 1XZQA 3Q5EA 3CWZA 4PNHA 1QBKC 4JSRA 2GAJA 4MUYA 3GFFA 2DR0A 3VYVA 2IXEA 1JYSA 2J08A 1GGJA 2W43A 3UMFA 3T99A 3N0VA 4BXOB 3W4IA 3GVIA 5FUXA 3GP3A 3NBQA 2GK6A 5CH8A 2D4HA 1EP1B 3G9TA 3OCYA 4JC4A 4P84A 3IQZA 5EMKA 4GSLA 4RJIA 1SPXA 1U98A 2WWVD 1G8YA 1JKJB 2QMQA 3M1LA 1H5NA 3DBOB 3R3HA 1YQDA 1WZNA 3T9EA 1VIAA 2IJGX 1AUOA 2A0XA 3NVMB 4RZUA 1NVUQ 2FUG6 3VR0A 4EUHA 2DQZA 4JFAA 1OWNA 5H0IA 3KSDO 5FAXA 4BQOA 3C5CA 4MIOA 3VR6A 2AQIA 1Y63A 3TOSA 1AGPA 2A1IA 3RU7A 4D81A 1N5KA 2H9IA 1UT5A 2CL0X 2E4ZA 1LFDB 2ZYUX 3AO0B 3KSMA 3PSHA 4LXIA 5IAKA 2WTBA 5HK9A 2NV0A 3HDQA 4MTCA 5JXHA 1Q50A 5F1PA 4WNCA 1B4DA 1HI9A 2ZSDA 1F8UA 4BO9A 5T4BA 1UAAA 1E77A 3PTZA 3UHFA 5L53A 1PF7E 3HYTA 2QQEA 4L0DA 2WTAA 3AEYA 5JS8A 1KFBB 2IYZA 2ZUCA 3AKDA 3DMHA 4WEQA 4CL3A 2A9RA 5CYOA 4DMGA 1NOJA 4BZQA 1NIPA 3GDOA 3OU6A 3EH1A 4MAAA 2AL7A 4MH0R 1JFFB 3T34A 2G5GX 2HM7A 1WUYA 2JDIA 3F7NA 4BAZA 4EG1A 2ZB4A 4OHUA 4DB2A 4LQCA 5LDGA 1G2OA 4XZ3A 4J0EA 1BCRB 1R37A 3UK6A 3D3NA 3K8OE 3R0IA 3TR5A 5JS7A 1EKXA 3GMSA 3OIWA 1VQ1A 4JIMA 4CG3A 3NU1A 2EQAA 3TTSA 3GT3A 1M6VB 3THSA 1XLTA 3KFLA 3TIVA 3TIIA 5F1KA 1BVYF 5J43A 4K6MA 3HV2A 1QGUA 2ECFA 4IXNA 1TUBB 1FNCA 1VXRA 3LGXA 1K92A 4W7SA 4B6FA 1DWQA 2NUBA 2Z04A 3FNEA 3FVQA 4N01A 1XNRB 3THOA 4YRDA 4PRKA 4ZT6A 1P9OA 1OXVA 3FWYA 3L6EA 2W70A 2HA5A 3TD9A 1PG2A 2PSEA 1YCGA 3DEIA 3KZMA 4QOJA 1QGOA 4CLHA 2D4AA 4E5VA 5KDOA 2N47A 5BVHA 2HBZA 1JJFA 5FORA 1SU4A 3I8XA 3KD2A 2PD4A 4D74A 2NO7A 3KB6A 2OZLA 3O0TA 4YT4A 5AUOB 4NABA 3NGLA 3SSAA 3UAOA 4C4YA 6PFKA 5EWMA 1JG7A 1MO3A 2VCEA 3G59A 4OGLA 3UGQA 3MILA 3PFCA 4QFBA 3TW8B 5KU1A 3NHYA 3ITNA 4U2DA 1V8FA 5KUTA 4GVLA 1ZUHA 2OBLA 2WOOA 3H0EA 3BIOA 3U4AA 4BB5A 4MRNA 3IKTA 5BSFA 3VXKA 4ARCA 3IVXA 2VJQA 3ZV4A 3V34A 4D0GA 4BE9A 4HH1A 4PSVA 5BUZA 1T0HB 2X76A 3CEHA 4CEJB 3BGIA 3PQ5A 3EOBI 2GEDA 5K0EA 1E99A 2NO9A 1QRSA 3SWWA 1NRWA 3Q10A 4NAHA 3H17A 4ALJA 2QZJA 2Z5VA 4U9HS 4DV0B 1NJSA 3C3PA 2PFKA 13PKA 5ADUS 2HXSA 2G88A 3DXZA 5HTOA 1MABB 2I71A 1VCIA 2WMNB 3IJPA 2IFTA 4ZKEA 2PZKA 1C0EA 1WP4A 1U0EA 4YMVA 4U8HA 4ND3A 1VPTA 2GAFA 4I99A 4ZI2A 1A5BB 2WD8A 3EW9A 2FK8A 4CIWA 5J4HA 5D5HA 1U6IA 2VSOA 1ZZEA 4D4IA 2DWPA 4KFSA 3U4CA 1FP7A 2TMDA 1T2FA 4UHCA 4L1KA 4MVJI 1JKXA 4AJ4A 2ZBPA 2C5EA 3MPOA 4OXIA 2IYWA 3VH3A 1IJBA 1PL8A 1Y9DA 3GGCA 3I92A 3N2ZB 5COAA 1UC5B 3ROQA 4ENRA 4YNBA 2QVZX 4M9ZA 2BGTA 5IDVA 2GCIA 3FYUA 4NBSA 4Y1FA 3TFOA 2BBTA 3L1IA 4D99A 4L27A 2PZEA 4MUNA 2PMCA 2XA9A 1A0OA 3DPIA 1T3LA 2IEZA 3D7NA 3I6MA 4Z4GA 2ZYWX 3HQ4O 3W7VA 4LJ4A 4I1UA 221PA 1PKEA 1XWIA 2B3DA 4R0NA 4RF5A 5J2TA 4MW1A 2IS2A 3UJ7A 3FCCA 3HZRA 3EIEA 4UVDA 4V0QA 4CR7A 4BFTA 4PX3A 2O0JA 3EXAA 1JU4A 1OASA 3ACBA 4GOKA 4H1VA 4PFQA 3SYNA 1BVRA 5DXFA 2AUMA 1TKCA 2IYTA 1VE6A 4UHKA 3C2QA 721PA 1BKSB 1RI5A 2MSNA 3HBAA 4UNRA 1ZH2A 3ABOB 1VKJA 3E48A 3N2GB 3OQPA 4R9VA 5D1NA 4O4LF 3AHJA 3OO1A 5BWOA 1KA9H 2BONA 2B5VA 3FTQA 1ZGGA 2GRAA 3DS8A 4Y67A 3DL7A 3LJKA 4AECA 1RDFA 2JASA 4XVRA 3ZGNA 4CL8A 4IMRA 2YY5A 4F5WA 4O2RA 1Q7RA 2XDAA 3I53A 1JZSA 3A04A 4MCHA 3G68A 4M1MA 4WZAA 3QGMA 4U2EA 4R41A 2RBGA 1TW2A 1EP2B 2H2AA 3EA4A 3E3LA 4MGZR 1MA3A 3CSSA 1IOWA 1G6HA 1B43A 1XD2B 2FPMA 1O87A 3OE5A 4IVQA 4GI1A 4L75A 4MUXA 2AYXA 3ZZUA 3MC1A 4BQFA 1I2DA 1Q7TA 2K5UA 2Y66A 1GUFA 3AUYA 4L5AA 4QFCA 1W88A 3S7TA 2FGJA 3JW8A 3SEZA 2JKYA 3N74A 4GOOD 1ISFA 3B1KA 5FBWB 2Z2ZA 1TMKA 4P9NA 5MFZA 4FC7A 2BFCA 3IE1A 2G04A 4JXXA 3D8TA 4CYMA 4Q9KA 1SXPA 2ZBVA 1KFCB 5BVGB 3CVWA 3VX3A 2QT1A 1XK6A 4E2ZA 2G9RA 1CR0A 2E4WA 3DDUA 2IUTA 5E1OA 3T5DA 5JTTA 1QQBA 3DMNA 4DM7A 1M0WA 4FT2A 2VPWA 1ZNXA 2CJXA 1B41A 1TJPB 4B1FA 7ADHA 3AKZA 3FUXA 3GJTA 1I01A 5U9CA 3NHZA 4KFCA 5JYEA 4D6XA 4IJMA 1TQ6A 1Z56C 4HTFB 3SYKA 3JQGB 4Y0VA 2VA9A 2OZKA 4DQ0A 2I9KA 2A9FA 4GHWA 1QOPB 4YREA 1J1ZA 2BZ1A 2NG1A 5AVOA 3Q72A 4TRMA 1T8TA 3OJFA 1W49A 2ZTHA 5KYWB 4KDCA 2Q50A 3SI7A 3BQ9A 1ZWKA 3KWLA 2YZ7A 4UBLA 1A9YA 4I66A 1T9GS 1WQ3A 4TX1A 3SX4A 5ARCA 2N46A 1EK6A 1BE0A 1R00A 3H5WA 2CLIB 2MYNA 1I1QB 1W0JA 3VTFA 2CJFA 3V42A 2R66A 3OEHD 4ZQHA 2H9AA 2C7VA 2WM8A 1RHKA 3A6LA 1P7CA 3IV6A 4ZO4A 5JXIA 1ND5A 1FFHA 1TO6A 5KX5F 2OHJA 3OKCA 1QH9A 4XD7D 3E53A 4LFBB 5HCIA 3AR3A 1GU1A 2E4XA 3FLEA 4UTZA 5CR9A 4AJEA 2CXNA 2MU1A 2E82A 1UP4A 5CT9A 2NU8A 3KHKA 3SQNA 3W78A 5IK2D 3T9AA 1LRJA 2BFPA 3DM9B 3U44A 4AS3A 1VJRA 3BORA 2R85A 5JJ5A 1KJ8A 1DRJA 4IH1A 4EF4A 2QPAA 3ZWCA 1SUWA 3FJOA 4L6IA 2WWXA 4FWBA 1NXWA 5DDIP 4UHEA 4WERA 1U63A 1TFUA 4YRFA 5MF6A 4LK2A 3WK8A 4ZYLA 4TV8A 3RQIA 5BOSB 2Y99A 3DOIA 4HAUA 4HLDA 1YKSA 4KSBA 2D06A 2F7SA 3OQJA 4NXMB 3LFTA 5BN3A 4LXHA 1XI2A 1ESZA 1U7ZA 2C9BA 3CY6A 4I2VA 3D4LA 1LI4A 4G4SP 4LSMA 2E7ZA 2G67A 2OQIA 3OEWA 1LBEA 4QASA 5E7MA 1K06A 1OIWA 1KF0A 4LOJA 4M8SA 4XYBA 3C5VA 5CVEA 5K6RA 1G3IA 3FJ1A 1Z18A 3ZKAA 2WFZA 2UUOA 2WWWA 4FBLA 4QECA 4HNHA 5E0KB 4UVHA 4I9UA 3SC2B 3ZU4A 4D9HA 3SDZA 2CXTA 2A5FA 2YZ2A 3AESA 4Q47A 4B0OA 1OW3B 1Z45A 4OMCA 3R7WB 5DU2A 3MT8A 4FR0A 4WACA 4CKCA 1GXSA 1I33A 1Q1AA 3CPSA 1N75A 5JSFA 1DELA 2JAQA 3W2EA 1JEOA 4DRZA 1OXUA 1YZYA 2CUKA 1IIBA 4HYQA 4EMSA 1GGVA 4U9UA 4CZ2A 4WSOA 1TJ5A 2HDOA 2I6TA 2J9FB 2AKEA 1XHLA 4LNHA 1ZMXA 4BNTA 4KIFA 2PL1A 4NU0A 1IZ0A 2WSSD 2FWNA 2C3PA 2REBA 1T36A 2DKNA 2P9TA 3QTLA 3ADKA 2AMLA 2GZ3A 3OI7A 1E1CB 1G0OA 3HXKA 4REQB 5EZYB 3OJ0A 5E9WA 4QGHA 4A7PA 1P4RA 3RRXA 1ID8A 2V7WA 3RS0A 2VF4X 2TSYB 3KBOA 1SC9A 4PYOA 4C03A 2OHOA 2V55B 5K45A 3GXOA 5CCXA 4QHTA 3WAJA 3EJWA 3HLYA 2IP1A 5LZ2A 2PKRA 3HBJA 4TUYF 3UB3A 2OCPA 1ANKA 1S4MA 2C84A 3G8CA 3UJ8A 5A1TA 2O3QA 3GK3A 4KQGA 4A4DA 1JJIA 1SBZA 1N3IA 1NPYA 2FZCA 3FPBA 5FOWA 1N2IA 3V2IA 3GLHB 4RK1A 4F1KA 3NV7A 3HHEA 1FB5A 1N6RA 3SKYA 4DMFA 1FBNA 3MJEA 2XMSA 3TOVA 4Q9HA 3T15A 4MYSA 4MI1A 3TXAA 3BCHA 4FD3A 4F2PA 2YNMD 3GGPA 3T0GA 7YASA 1R9MA 1FP1D 4MCJA 3ZHZA 4E7PA 2YWFA 5FUQA 5GTDA 5CBPB 1DZIA 1FFSA 3LAWA 3VI4B 1Q12A 3OFSA 2GFHA 1VGQA 1BA3A 3A4TA 3HWWA 4PSDA 5JS1A 2HPHA 4KUEA 2RKOA 5CFMA 4YFVA 1U9YA 3PPWA 1GCIA 2CKMA 1XZCA 4A8JA 4R31A 1M2VA 1PEDA 1Y7LA 4GPEA 1Q3HA 4YMIA 2ZQZA 4PTLA 4LJ9A 4WJKB 4AT1A 3H2GA 3WLFA 2QTHA 1NQTA 4L2IA 4R7ZA 2A92A 2C7GA 4HWKA 1V8OA 2OO5C 4ALIA 1REQA 5ITZA 2WTUA 1XZ8A 2J67A 3R3UA 3ZPXA 1G8KA 1TM2A 2HSJA 5AVSA 1NY5A 2OQ2A 5LQDA 1NZFA 3KQQA 3PRKE 2I65A 2X8WA 1P61B 2ZJ6A 1DAHA 3AXTA 5KPDA 4J07A 3ZU6A 3JQ8B 4XLTA 1ES9A 4KP7A 4Z3DA 1J9EA 1Z73A 1ZK0A 2R6ZA 3O7WA 1IAVA 2VRWA 4KNWA 4Q9AA 1KSGA 4BO3A 1IRIA 2GOYA 4ZEVA 1UPCA 2CMDA 3H1PA 1XV5A 5ELXA 3L40A 4PIMA 5KAMA 2H7XA 2P0EA 3ONVA 3QXHA 4HFMA 2WT4A 1G16A 521PA 1EGMB 3GPBA 4BLUA 3PE4A 2Y1GA 4F2WA 5CA0B 5LKRA 3ER8A 1W5FA 2J6HA 3EHDA 3X1KA 1G3MA 1TCCA 3FNHA 3GGGA 3V7YA 3MSCA 2VK2A 3KJXA 1PWXA 1L7OA 1YBMA 3H8JA 4J0QA 1XEFA 2OR3A 5AKJA 4B3DA 4BP9A 4EABA 2JFWA 3A32A 3G0CA 1T9BA 3QNUA 2PXCA 1D2NA 2W2NA 4Q03A 2M98A 4LJRA 2J4FA 2IT1A 3GUUA 1CXZA 4RSMA 3S8MA 1TGYA 3C6KA 3QVVA 4INAA 2J7PA 3OP4A 4QO8A 4YRQA 1NXSA 2I6GA 4P34A 3KSAC 3BT7A 5IDYA 1O4WA 4LZOA 4EI9A 1U9IC 3DE0X 1UWLA 3ELBA 1JE0A 2C0PA 1GARA 1IQUA 4MHOA 5CVCA 4Z4FA 4HD8A 3MWDB 1L4GA 1JHVA 4J3JA 4NYIR 1BMFA 1Z8FA 4XQCA 3I9LA 1Z8HA 3JQFA 1KU6A 4MV9A 1P2GA 5LQMA 3HXMA 2BOVA 4Z1MD 2GJ8A 3E7XA 4FX5A 3BD7A 3N39C 3WLNA 2ZXUA 4L6CA 4MMZB 5B58T 3H9JA 4B7CA 1QTIA 2PS3A 2XRMA 3A9UA 3IELA 3TAXA 4TXHA 3HWSA 1Q1NA 1D5WA 1QYVA 2Q8QA 1XSEA 4R9UC 3ZZTA 5ALTA 2O8FB 3E5NA 1N1GA 2Z95A 3FCEA 5IX8A 1DEHA 2B78A 2OZPA 3BTUA 3CPHA 4AG6A 1WHSB 2EDCA 5FLYA 1UJMA 1QHEA 1KVUA 1HSOA 1G64A 5FWAA 4H1UA 1MOPA 4LUCA 2AKAB 2E4AA 1WPGA 4O1HA 3ZTYA 3JAKA 4G26A 4ZYXA 4BQIA 2OFWA 2JLCA 5HZKA 5BYKA 2Q45A 2CGEA 3LHIA 4U7GA 1GPDG 5EYPA 3T6KA 3T95A 5ADHA 3GFBA 3T3NA 4B3SB 3ZOKA 1RHQA 1XZGA 1S2DA 2EKBA 1U0HC 5BWMA 3AHDA 4GNKA 2WJ3A 4ZARA 3W9YA 4ZCMA 1UMDB 3CUYA 2JJ2A 4REOA 1V26A 2I8LA 1YS1X 2QL7A 1OIVA 5A05A 1OI4A 3N87A 3VSEA 3AG5A 3KQSA 3T3PB 3VX4A 4C5BA 5THQA 3OFKA 1B0AA 1IEVA 1TF5A 3BJMA 4GQIA 4N7MA 1EX1A 4YMSA 2OC9A 3DLIA 1B26A 3FTFA 3E9YA 1H8EA 3K0AB 4H15A 2OV1A 3RRFA 3OCXA 2ZJ8A 2NWQA 3AEKB 3GP8A 1JIXA 3KLNA 1F3LA 1CUBA 1T43A 3Q5DA 5A6SA 5JARA 5C2JB 5GIPE 1U9ZA 1VSVA 2XYRA 3K9CA 4DCOA 5HZMA 3N6XA 4BFCA 4FN4A 1EFPA 2GEKA 1GFZA 1P18A 2VAMA 4IXWA 4U2FA 2J0VA 4BFWA 3T5AA 1LC3A 2WQZA 4CNBA 4Z8XA 1DC6A 1AU9A 3W1VA 3IX7A 3AY6A 4LHEA 2ODEA 3UUFA 1EM6A 4QUHA 4ZANA 3ANNA 4E70A 3MJTA 3ICEA 4PSKA 3FTDA 1ORTA 3LKVA 5EXPA 5A9SA 5GOZA 1VHWA 1FNMA 4Q4JB 1SKQA 1S89A 2YQZA 2OCDA 3PNOA 3WLMA 1UEIA 4KV7A 4M0CA 3CO0S 3Q40A 1UMBA 3JQRA 4BTVA 2AFIA 3LHDA 5IC5A 4DV4B 4OGWA 3OPQA 1RHMA 3RU2A 1T4DA 1T9ZA 1SBHA 4HRVA 2ZVPX 3DV9A 4J43A 4BFXA 1ZZGA 1GT91 4Q1VA 3VR6D 1Y9JA 1XD9A 4PG5A 2E48A 4W9NC 5B4TA 3KKMA 1C7RA 1CQXA 2I7XA 1PS8A 2JW5A 1U8XX 4LQLA 2K7FA 3HO1A 1GTZA 2XXBA 3HB1A 5JHHB 3MOGA 5U4XA 3A3PA 3RLFA 1UKAA 1POXA 5DX8A 3CISA 3A6HA 1VC2A 3ORYA 1LPOA 1KEZA 3FPJA 3UG7A 5IFLA 2V6MA 3LPDA 4CM4B 1RYNA 1ZNQO 2V0NA 4TYPA 3BXZA 5DGHA 3QPAA 4DPLA 2AW3A 3KE8A 2ZYVX 1Y1TA 3BWBA 4NBUA 1DAMA 1SPBS 2CKDA 4YUVA 1P0MA 3TNYA 1QQTA 5K0FA 3WGNA 2WAXA 1QDUA 3OT1B 1CZKA 4EGAA 1AQNA 1Z0JA 2HU5A 3HBFA 1H6AA 3HJNA 2JDID 2AN9A 2D7JA 4OQQA 1XDDA 2YKGA 1QCYA 3CUKA 5BR4A 3ENZA 4EOGA 4EHDA 5JLJA 4B83A 2BP7A 3AZOA 4KQWA 3TLMA 5BUQA 5IKMA 2D3TA 1TU4A 3B8EA 1YL7A 2X3UA 3D54D 2FJUA 3ACDA 3EGXA 4XVQA 5KAPA 3AHEA 3ZLUA 3ZHUA 4DMHA 1JSZA 1SVWA 2OWDA 3AKCA 5AW0A 5KKCA 2XRYA 4JQOA 5KJCA 2Q3DA 2OZLB 3LFHA 3DHEA 3GAFA 3OM8A 1DTSA 3I9MA 4HWTA 3IP8A 3SQWA 1QIFA 4M89A 1H5QA 1RKXA 1Z4JA 1FLNA 5EE5B 1Y33E 4FMDF 2GEFA 3WYAA 4AZTA 4ER5A 5FAKA 4M60A 1HYEA 2VNJA 2FPPB 2VJPA 2GCPA 5H9WA 5EEGA 4PBSA 3OO0A 3DKVA 5GGYA 1N9ZA 2IYVA 1NVMB 4QDOA 1GKIA 4FNAA 3VNBA 2NZJA 3I9NA 1GTSA 4KH1A 2RCNA 9GPBA 3UAVA 4JYMA 2GBFA 1EVEA 3MERA 3QOXA 1NHGA 2CNWA 2FEWB 2HA3A 4KX3A 2XGSA 3ZNNA 3H5NA 4AY3A 3H3JA 1C4OA 1T10A 3W5AA 1V1MB 1RRMA 3ZS8A 3ZLJA 3AHIA 1VE9A 3ZDCA 1PIWA 5AW4A 2WT8A 2XYQA 2X23A 4OFWA 1T9CA 4DDMA 2IVZA 1BXRA 1IN8A 1EFVA 2QDKA 1O1YA 2W4MA 2W6OA 3KKLA 3M1YA 3HR7A 4H27A 5AJVB 2QL9A 4KUHA 2BKLA 5DOVA 5I6DA 5A3SA 2FZGA 2BFFB 1XTRA 1CS4C 1G3RA 1NN3A 3KIPA 3LVQE 3KR1A 1HRKA 1NUTA 3IV9A 3NW9A 5FTKA 3JXEA 2EX1A 5C80A 4GOJA 1N2HA 2C1XA 2C42A 4NEQA 2D1RA 1PFWA 2NUPA 3NUQA 4YJGA 2IDJA 3M81A 1VXOA 1HTBA 2YIVX 3G02A 3N1UA 4FOTA 3STWA 3QA3E 5EVCA 2P2CA 3KT6A 1V41E 4QXOA 5JQGA 2EFGA 4WKNA 2WF8A 2VDUE 3SIXA 2Q5IA 1BQEA 2HDWA 3TCXB 4ERXA 5A62A 3QPBA 3LQFA 3T1YB 1YMUA 2BTOA 4HV4A 4EKDA 3L02A 4BZPA 4FEEA 1JECA 1D5CA 1GGEA 3GARA 2C2XA 4ZHQF 4ERNA 2F3QA 5IWAB 3MWJA 4MVJF 4GWGA 5EZ6B 3D1JA 2GZDA 4KFUA 4LY9A 4OYHA 1G291 4JUFA 5FPPA 2H08A 2WD7B 3X3HA 4K0RA 3K5IA 4OPMA 1GA4A 3RRJA 2QVLA 4MPRA 2GS9A 5J2TB 1U0SY 4RPGA 4FVTA 4HVLA 3ANMA 1PCXA 1TJNA 3SXJA 3UCEA 2LDBA 4RS4A 3CX7A 3ETEA 2EJCA 1VYHA 2IWRA 1B8OA 4I1IA 4IOMA 3RS2A 3VVLA 1H2FA 4FFOA 2HW8A 1GZ5A 7ABPA 2AH5A 3KT3A 5KWSA 4DWWA 5GMOA 5CA1F 2AN5A 1D6MA 3DFUA 2DWUA 3OCCA 4KV9A 3EVBA 4M0FA 3FOAA 3GQVA 1GQQA 3GROA 2H4JA 1HDEA 3X2EA 2FSVA 3NTVA 4BVLA 3ZWOA 4N3BA 2JGJA 2ZIVB 1EB8A 1H4TA 2XQGA 4MYHA 3GPIA 4Y3UA 3DWGA 5E9AA 3VBEA 5JO0A 2FPRA 2Y1LA 2FRVA 2OVBA 2W2TA 4B43A 2XI4A 3JWIA 2IV3A 1YQTA 3C0KA 4D46A 1IEWA 1NULA 2DR3A 2G4CA 3SR4A 7MDHA 5LP6F 3VO1A 2BFNA 4TKZA 3QXGA 1K6IA 1QU2A 5T3UA 1I94B 1FFAA 2O2ZA 4AZ3B 2ZDGA 4PGAA 4UM8B 4RK6A 2VJKA 1XROA 5FTWA 5C1IA 2Y76A 1AKYA 3RUIA 3ZX5A 4ND7A 5G41A 1K66A 3KQHA 2BHRA 3CLUD 3LUAA 5B1IA 4BFUA 1DKRA 1GDHA 4JP3A 2XB9A 3ZDYB 3DOFA 3D4BA 2O8BA 3ZBTA 1OFUA 1V45E 4PLTA 1HWYA 1M2JA 3EPRA 4RTNA 4C4OA 4GM0A 3ESRA 4CL0A 3GNTA 4HFRA 5REQA 4JBXA 4EAQA 3KTAA 2BKEA 4J0CA 4GD3Q 1Z38A 3P2JA 4KU4A 4IXDA 4JR1A 5EIWA 4ZJYA 1FJ2A 1E63A 1M2EA 4L0QA 1RCTE 1A8PA 1Z0AA 3EXHC 2VDJA 2OD2A 4DSUA 2GEJA 2AIRA 3SE7A 1M2OA 3SK0A 4ZQEA 2R9VA 1B7GO 1PLKA 1NURA 2P65A 1P81A 3IPAA 5AH0A 3MTJA 2EG5A 3NP9A 3UT0A 3PUKA 5DBGA 2HCBA 3SJAA 1F2UA 1WPXA 4S1NA 1MO5A 4ND5A 4QRDA 5G3YA 3WSVA 2ZRMA 1XNHA 4X8OA 3SGLA 2Y05A 3I1JA 2XNDA 4YJDA 2O0MA 1RJEA 1HLPA 5K4GA 3HB5X 2KSQA 1ZD1A 3RDPA 4CIBA 4DEXA 3VR4H 3CH4B 1G20E 2BBOA 2EATA 2QR5A 3I5MA 2HMSA 2ISSD 2ZVDA 4A6DA 3KHUA 4GPAA 3L7OA 4ZALA 2EU8A 2OC4A 3TUJC 4BNHA 3FZYA 4FDVA 1W0JD 2GJ9A 3IHWA 4HDOB 2Q1UA 1WD5A 3CTMA 5K8LA 2I99A 5L7TA 1HFKA 4MOWA 1A9XA 1RMQA 5SZKB 1RJ9A 2EJTA 2W00A 2D74A 3U44B 4C88A 1SRRA 1GZHB 3KB1A 3SLRA 1BN7A 1SVSA 4BJHB 2B7LA 1GTG1 3LVBA 4GR9A 2ADMA 1S7GA 1II9A 2DUUA 4V0RA 5ELMA 3AI1A 5ENDA 5LZ7A 2ID9A 3LTNC 1ZCJA 5MN5A 3VM6A 1HG1A 1A9SA 3BHJA 4UMEA 4B5KA 2RGRA 1EG7A 4BQRA 1JVBA 3F8SA 1M10A 3T1HB 5DHQA 3HUEA 4Q48A 3WBBA 4MWBA 3HJCA 3U2QA 1NFQA 3P0JA 3BBPA 2ZYGA 2QJOA 1BWQA 1C1DB 3EEIA 4K6OA 3FYHA 4KAJA 4ZQBA 4MIEA 1DIBA 3RVMA 1P4AA 2QM8A 5KOYA 1G42A 1K27A 4XQGA 1ZCZA 2IZZA 5BQPA 1Y80A 4HVAA 2WDPA 4EZIA 4QTTB 2PUHA 4YLEA 1CEYA 2QR2A 4IGKA 3ROTA 4X84A 4CKCB 1RTTA 1O8BA 2JGDB 2PH5A 5K3BA 1EM8A 1EGVB 1I32A 2BGJA 1FX0B 2IX9A 2RONA 3DAHA 3FGPA 3TSYA 1KQPA 1R9NA 1SCDA 4FGJA 4I1OA 1TK3A 4QYTA 4FWTA 3GRAA 4OX9B 3WMWA 3BJEA 3OETA 4X54A 3PC8A 2B4KA 1H2YA 3T3HA 3O3NB 1D09A 1LSOA 3LDAA 4X8MA 2HU2A 2O2XA 3ZX4A 4C0SA 3OOYA 3MS2A 1KC3A 4R8MA 1L8OA 5HM8A 3DAOA 1M8GA 5HRCA 4DR4B 2HCJB 3TL3A 3OBBA 2Z3VA 4H17A 2UUPA 3HN2A 3ZCSA 1IQ0A 1E4YA 3QWHA 3SICE 5L3SA 3MLAA 4GUAA 2FCAA 2JFUA 4QOSA 1T5HX 1GYQA 2CWDA 4C30A 1FC0A 2A0WA 3VHQA 2W37A 2BFDA 2WE7A 4DTCA 1WMDA 2IBTA 1RADA 3V9AA 1ATZA 4RKWA 2GAOA 3AF3A 4NCHA 5FUYA 5F23A 3WP1B 1ISIA 4U7TB 2HZBA 3B60A 3QTTA 5AW6A 1JFRA 3MZ0A 5AMXA 5EPUA 3T7SA 3L0YA 1MIOB 3KUCA 2PYZA 5FOUA 3ZCRA 4X3CA 3C3YA 2ZEJA 4NPCA 1C41A 2XEDA 4IQGA 3SCZA 1A2OA 1SC3A 2HHAA 2IELA 4QUDA 3R7FA 3V8EA 1MZVA 1UM8A 4E46A 3SVTA 1QP0A 5MHTA 3LZ6A 4BWFB 2WEKA 3DF9A 1ADCA 4NL4H 1YTUA 3ZBQA 3AZQA 4PAQA 2N9UA 1VI2A 4YT2A 4KJXA 2P6UA 1K97A 2VPZA 4J9UE 5M29A 4QIHA 3M6XA 5CW1A 3W5HA 1JEAA 4DMMA 4LYEA 3TLJA 5FTNA 3P5BA 4RQAA 5JY6A 1TVKA 2BRUC 3H4MA 1F8FA 4LHVA 4TROA 4ZVQA 4BX9A 2ONCA 4LOHA 1SQ0A 1TNDA 3LS2A 3DCJA 4OLHA 2V98A 1P2BA 3HYRA 4RK7A 3SZ3A 3PFKA 2WBLC 3LVFO 2OCKA 1DXQA 4WD3A 3EMKA 5B2ZA 2BELA 3WYNA 5FPKA 1CUZA 3VNUA 1ZVJA 5FNVB 1GOTA 4WADA 3VSDA 4JVSB 1JVSA 3NIWA 3CF4A 3P9YA 2BGLA 4CNQA 2JB9A 1E62A 2OHHA 2ZIWB 4WBNF 1JDJA 3T7JA 3RIXA 3BJRA 4HS4A 4X1IB 1F8XA 2PX3A 3N8GA 2X1VA 5KWJA 1JEYB 2RSLA 3W2GA 1JL3A 1GUAA 4TKVA 2AJ8A 2TMYA 3HEAA 1KZHA 2HF9A 3AUTA 3I42A 4K88A 4WK6A 4W1RA 3QEMB 1T4MA 3VAYA 2PRYA 1G9XA 2WYIA 5IKPA 1HT3A 4KQCA 2P5TB 1S02A 3EZGA 3ICCA 2J3HA 4UZFA 2HO5A 4H7DA 2D5AA 5J1SB 1YQ9A 1QHIA 4BLOA 3H2ZA 4E13A 4ROSA 1F3OA 2WKSA 4Q7LA 1NF3A 4D7AA 1ZXXA 1ULSA 1AS0A 1SBNE 2XDYA 1XDUA 3EDYA 3EISA 3LGAA 4FX2A 3OLQA 4HWRA 3H6GA 4P38A 4ZT2A 4S1OA 4CQLB 4A6PA 2G08A 4MVJP 2B0CA 3TI9A 3BG5A 1NY6A 4FINA 4IJ6A 3SN6A 4WLUA 4EDFA 1RQPA 4A2WA 4YV7A 3HDJA 2XODA 1XVAA 4ZVUA 3E1GA 4EKIA 1G66A 3PHGA 4P33A 5HKAA 3DONA 1YB7A 4OJYA 5HA5A 3BBLA 3CR3C 3Q1LA 4D8YA 2GHTA 4K0KB 1WY5A 1ZK3A 2VPTA 4RSRA 5IJ0B 1IUPA 2GZ2A 1L9KA 1BE8A 1XCPA 2OFFA 5AM3A 5AKHA 1Z6GA 3KJNA 5DASA 1UJNA 3JYNA 4L0CA 3OZDA 4ZQFA 1J0CA 1D9XA 3R44A 3IOEA 2WDZA 2OPBA 3JTEA 1QS0B 5IT4A 5KDLA 2OEPA 4UFNA 5FADA 2WU0A 5BNZA 4CJXA 1Q0ZA 5TVKA 5ICFA 1UBNA 4EB8A 5CYGA 3R9XB 1SHTX 1E4OA 1X0XA 3NBYC 4P5EA 1U3TA 4H1HA 2PZAA 1M6WA 4RJTA 3RUHA 2ZJBA 3QFHA 1L1RA 3N8NA 1JHDA 5HKLA 4Y2SA 2F1HA 3QEKA 4UMFA 5GINE 3RFFA 3PUHA 1VSTA 4L72A 2J7PD 4M9UA 4ZXPA 3CIOA 3FY4A 1JPUA 3O8NA 3QPDA 4NATA 3VZBA 2QQGA 6REQA 4KXWA 3Q9SA 4PY2A 1XZPA 3GGJA 1I0LA 1XZIA 1H1LB 1BMFD 2I2BA 3QVWA 1MJ5A 3K0HA 2W58A 1NKSA 2HGZA 2WF6A 3O2NA 2DXIA 2C98A 3WFJA 2OCBA 5DZSA 2O6HA 2V0GA 1CUUA 1KYVA 4I19A 1E7SA 2BFEB 1E60A 4IF6A 5A5DA 3PU6A 4AO7A 3IP3A 4JLWA 5E8RA 3KCNA 4V0OA 4TVSA 2WF5A 2QVCA 1TADA 3V2HA 4EPRA 5CLHA 2BHTA 2FQWA 2VHQA 4IHJF 4JI1B 4BJ6A 4DIFA 4CGYA 3IESA 4CFYA 2H51A 3M8KA 5EZ5A 1R5NA 1AO3A 2IQIA 4WCFC 1IUKA 2GHIA 2GPWA 3PI7A 5DJ5A 3FDJA 5IHXA 3K9BA 2VYCA 1ZLXA 2O8NA 4UTVA 3DYVA 1U4OA 2J3KA 2PKQO 3LU1A 3G6KA 4KAAA 5JCZA 1OWPA 5JJKA 2JJMA 2HBRA 1U2SA 2EFYA 1ECCA 2RCYA 3GNSA 3NAGA 2W2QA 3NP7A 4WNAA 1H22A 2PEYA 2NOAA 1BFUA 3N0RA 3AB7A 5C5EA 3HY3A 2WAAA 3FNIA 4N49A 1USUA 3MXOA 3SSMA 1FMCA 1Z6YA 2AE2A 2EEPA 2CHQA 2JJ2D 4GP6A 4EGSA 5AHOA 3UFBA 1L5GB 3PDUA 5DCUA 3CRNA 3B8HA 1WEHA 3LW7A 3LLSA 4S2UA 2X8JB 3ECCA 4KI7A 4C9BA 4TMTA 1NNUA 1N0VC 3LYLA 1RWQA 4IDHA 2Q7OE 5D84A 3TXXA 2HWXA 2FMXA 3QP9A 3KKEA 1A2KC 2BGMA 3FIJA 3ZLVA 4DUPA 3B6ZA 1E2MA 5BMVF 2Q6VA 4F1WA 4Q4AB 2BTEA 4QX6A 4KYIB 4LSGA 4EJ6A 3VSBA 3RHSA 1PJCA 1Z4MA 2HIAA 2CUNA 3I9JA 4QPCA 4Z9YA 1SU8A 3TAHA 2YWEA 4XRRA 4Q19A 1FDVA 1YI0A 5GJWC 4CHTA 2P4UA 4MRSA 2P6MA 1XZFA 2EL7A 3VMMA 3DO6A 3O73A 4HSEA 4MB6A 4MO2A 4F5YA 4TWRA 1N25A 3VU1A 4BO0A 1W47A 4DLZA 3G0IA 2QROA 3T5MA 1DKPA 1VZ2A 3O47A 4E6PA 2X5XA 4F4CA 2AFIB 1F9AA 3W0LB 2J3EA 3ZNOA 1EVJA 2OV8A 3H5VA 3ENKA 1IWBB 1JALA 2DBZA 1IK4A 2PZMA 1G8GA 1MFZA 4IF4A 4Y2YA 1NATA 3UPDA 3TQOA 3LPAA 3CLSD 2PQ6A 4ZAZA 5BORA 5DPMA 1RLIA 2NSJA 4GPIB 4LJAA 3GFVA 1A9OA 4X65B 2JG3A 1OU0A 1VA4A 2ZJ4A 2C2GA 3CVVA 2JZOA 2GKOA 4JITA 3INRA 2HA2A 5AM0A 2FUG1 2O5CA 3JVUA 4Y6QA 4TL6A 2XYGA 3L0PA 4HMOA 1GUYA 3TW0A 1JA9A 1QTRA 3H9GA 3NHUA 4Y2PA 1KXJA 4HDNA 2ORYA 2V5AA 1E66A 4PAWA 5EE3A 4DQXA 1LDMA 4FLMA 1CY7A 1K7FB 4EPWA 3EIFA 1UUFA 5FIUA 5FXMA 1LQTA 1BXZA 4ZVTA 2A14A 1YT5A 1WUJS 1H9AA 1U0FA 1UJCA 2DUJA 2HJ9A 2W2XA 3C74A 4IGEA 1SXJA 2P9HA 3MOSA 3SZRA 3DGFC 1U2PA 3PKIA 4L5IA 1S0UA 4BC1A 1COZA 1SKAA 2VJMA 4FFNA 4QNRA 3AEXA 5ALPA 4C06A 1A96A 1R1DA 3FVVA 5CDSA 3WDMA 2BP7B 1WCV1 1MJGA 1ZKDA 1W8IA 4TTPA 1ZEMA 5EHGA 4RTSA 1NM5A 1XMVA 5LMUB 2P6OA 4MQEB 1RI3A 4X63A 4R1OA 2XZLA 1ZVMA 4X3PA 1UOOA 2BR4A 3JQ9C 1YE3A 3FB4A 2CFSA 1OBOA 3LP5A 3LPNA 3ECAA 4MS4A 3GMDA 5GAJA 4BLWA 4RTOA 1YJXA 1U7PA 4LYJA 5KTOA 1UXKA 3MWEB 2NX2A 1ZSNA 1J6UA 2YZNA 4MJ7A 3UAZA 1K8YB 1N6NA 1QK3A 3SF0A 1H2EA 4JLBA 2R751 3Q8XB 4EIWA 2IEYA 3B1JA 1MQ9A 1EZ4A 3H9EO 3MW8A 4MW4A 4DY6A 4DJ5X 5LNK6 3C3MA 5JISA 1IZ7A 2WSBA 3I2GA 3JRXA 3KPUA 4E5YA 4ZTZB 1H2HA 2PH1A 3GGDA 2H63A 2CB9A 3CQ9A 5BSHA 2F55A 4HLUC 5CDHA 5DLYA 5I9BA 1NPDA 2Q8NA 1R74A 4BQPA 3DDHA 2PKXA 4EB0A 1SUIA 1PT6A 1PK7A 1PO7A 1ZN2A 3ETDA 1MGPA 2C4TA 2I8AA 3L4BA 3GF4A 3R8FA 4PZCA 2G0AA 3LC2O 2ZETA 2OQRA 3MGCA 5CDUA 2IHYA 1KQNA 2J33A 3PT9A 3VC7A 3EXIB 2P6RA 2CNWD 1BXRB 4DLUA 4OQDA 3TTTA 1EQ2A 3ONNA 5U4QA 4XJSA 5B36A 1LPNA 1Z39A 2R6HA 1F8GA 1FUIA 2QX4A 2VDOB 4G1MB 2FRDA 3BGOS 4JOQA 4YJ2F 3LBHA 3PC7A 1CUFA 3P7MA 3MAAC 5DK4A 4BZWA 3O3OB 4X20B 3AF1A 5F3RA 2ZJAA 2PN1A 2R79A 3UOAB 3ADDA 4QXRA 4EZEA 3P2OA 2CSXA 1L5FA 3K92A 3G8BA 1PTKA 4MRMA 4P93A 4R2WA 4DLTA 3BZBA 5JQGB 4CHGA 4KXUA 5F4ZA 3GRYA 3L8FA 2YICA 1XZNA 4KR9A 4JJGA 1SIWA 1U02A 3GH3A 1MDFA 2VPIA 3AKEA 3K31A 3LUDA 1D6NA 3QG5A 1JQJC 3IAAA 1RXVA 1TA4A 2IEGA 3BIFA 5J23A 3B9PA 4NPHA 5J1TB 1MC4A 2FEKA 2I6SA 1LJUA 4TT3A 3EBOA 1ZUNA 3NYWA 3IE2A 1QIDA 3QA9A 4FYKA 1GRQA 3FUCA 2ZSIA 3EIOA 3IKVA 4ZQIA 1HMPA 1DZ3A 1GVNB 1MTOA 3NM5A 5DFAA 4M6WA 2Y67A 3MS4A 2FRXA 1VFPA 2V8BA 4JOCA 1N8NA 1UFRA 2E21A 5C8VA 1ZL0A 5E9JA 4YMHA 3OSZA 5AICA 5A5VA 5JNVA 4MQ5A 3F4BA 2GWRA 4GE3A 2NO4A 3E9ZA 2GUGA 2E4VA 3BHNA 3JD3A 3ZQ6A 2QUHA 3K0CC 3C7TA 1P19A 1XEWY 4U0JA 2AG1A 4KVAA 3O95A 3P9IA 5IH7A 4I6EA 1Q57A 1X9HA 1C3XA 1CUHA 4GKBA 1C0KA 1RT9A 2X4GA 4HLCA 4JKYA 4ZU6X 3Q98A 5C7IO 4UULA 4IKEA 3RASA 5IPFA 1JLMA 1ST2A 2O1XA 3TRJA 2DHEA 1Z34A 3HKDA 3O4HA 4NYJR 5JRZA 2ACKA 3EDQA 2MT9A 5L3VA 3KKZA 1PV4A 5KOHB 1T5LA 2CNNA 5SY9A 4EX6A 5C8ZA 3KFVA 3QM1A 2UUBB 4HB2A 4RZ3A 3GWZA 4PX5A 3RT7A 4JEMA 1B2RA 3TDMA 3GLQA 3RS7A 2I2WA 1YIDA 2YHAA 1S6YA 1MZPA 2NT3A 3B13B 1OI7A 2VDQB 2V65A 4Y2GA 1OT5A 1I2CA 1E2BA 1L3BA 2BGUA 4WESB 2R7NA 3DYBA 3L93A 3TYXA 1GNPA 4HJRA 4B7ZA 4DJTA 3KOWA 4QQFA 1H4VB 3ABQB 4S04A 3NIFB 3EOAI 5P8WA 4CMIB 5BWLA 3IAEA 4NU6A 1JN0A 1K2VN 4RLFA 4J16C 2JJ8A 3KTAB 1OMOA 3AR9A 5TPWA 2DFLA 4U3JA 4O25A 3GEMA 4YP7A 4KBFA 2XF8A 3CEMA 4F3RA 2QTBA 5IAGA 3DWIA 2JIRA 3AOEC 3R6TA 5G3ZA 4RPLA 1GTVA 4CI0B 5C5IA 2FR8C 1FTWA 4POOA 3IQFA 3AVUA 2OBYA 4XUCA 4ZQCB 1V7ZA 1TD9A 5IF3A 1K8ZB 2PL5A 2B5OA 1USIA 2FF7A 1KZ7B 2J46A 4AJHA 3E58A 1BWPA 4G23A 1N2JA 4UHJA 3PX7A 1LPPA 3C5EA 1W52X 1OHHA 1SVOA 1R5JA 2CCGA 4UEKA 1Y8ZA 1P0FA 2ZRLA 4HN4B 4IJQA 4LQDA 4P4GA 4QDTA 1BWRA 4ZODA 1XR3A 3KZ1E 1TVCA 2PV7A 1NI4A 4BNJA 1QZ3A 2ODTX 3BWMA 5IJ9B 1NDHA 4RKEA 4GMFA 1N33B 3UB4A 3DKKA 1ZUD1 1FFXA 3H05A 3DC2A 4FP9A 5FQNA 4BYMA 4BP1A 1OBHA 1NVAA 2AEFA 2QRGA 3ZE7A 5A5GA 2XNDD 2BUBA 2EHJA 2YWCA 4H6PA 3V5NA 2P7IA 3SZOA 3I2FA 3X44A 2WJGA 1N2BA 1E9BA 1OLUB 4K6KA 5KNDD 1P91A 3NAMA 1P9LA 1NUAA 5KVQA 2X5KO 4IICA 1QAOA 1UXHA 2AMFA 3NATA 4Q3AA 1KZGB 2H9YA 1RIFA 4F7WA 1RM3A 4ZZ2A 5B3LA 3W9UA 3AI7A 3KYBA 2J0UA 1V8ZA 1THMA 3LCRA 2R4TA 4JVOA 2M6RA 5K6TA 1ZCAA 4N0QA 2XUPA 4BEBA 2ZAGA 3FCOA 2X0FA 3PJFA 1ESNA 5DTIA 5CDGA 3RKRA 2J5XA 5B64A 2EP5A 2J4CA 3SLGA 1Q7CA 2YS6A 2AFRA 2VHCA 1BS1A 4ZYYA 2XZOA 3GG9A 4IH9A 3UGJA 4GKKB 2R1TB 1X7HA 4P80A 2P69A 4OKSA 2QRVA 4RGVA 3LT5A 3HDTA 2DM6A 3HB4X 1WPRA 3HNPA 4N1AA 1ZUWA 1OFGA 1R0SA 2H1LA 4C4SA 3U4DA 3IPRA 4YUZA 1HH4A 1HG0A 1EWYA 4I7EA 5BW6B 2YOGA 5C8DA 2VAPA 3LMKA 4LNUB 2Q7XA 4JJ4A 1ZNZA 2X8AA 1XBTA 3NZEA 1KKUA 3SDSA 1LDGA 1JLRA 2LR0A 3MINB 4JL8A 4Q18A 4KZKA 4BNUA 1XEAA 3UAGA 1RKBA 3IOMA 4MHTA 4KXMA 4RC9A 3IAM6 1BE6A 3TQQA 4OH7A 1IMOA 2JI9A 3DZFA 1FUUA 2EKQA 3ZC3A 2HY7A 2Q4RA 1ZWLA 2E55A 5DLEA 4EUNA 3PZBA 5JDCA 1ZESA 5C8YF 5HNKA 2LP4Y 5ABPA 5IMBA 4HGPA 4DPMA 1LQ2A 4L16A 5CIWA 2BFDB 4IQ8A 3ZHSA 3VZSA 1SCBA 4Y2HA 4WXHA 4FCCA 1GGHA 1DIHA 3K2BA 5K03A 3VPGA 2PXXA 2ZJ7A 3IMEA 3KLMX 1FNNA 3GGOA 4FLFA 5KVVA 2NMVA 4WY8A 1L7DA 5ESRA 3H83A 4PYRA 4EYKA 1FS4A 4PG7A 5ALYA 2IZ7A 4ND8A 1FNBA 2QN9A 3CLKA 3EZ7A 2AGVA 2A94A 5DNUA 1UKBA 2O3SA 1NZJA 2HCTA 2AZ4A 2WQ7A 1QLHA 1DLJA 4BYGA 2I91A 3DKRA 3EAFA 2OYRA 3IEIA 2C96A 4WZZA 4N0EA 3WSWA 4TZ6A 3C3XA 3D3WA 1PS0A 4X45A 4IS3A 4JCCA 3IVAA 1QUFA 4D9EA 2YZKA 1OVMA 3M4ZA 3ZR4B 1DAKA 3GPCA 3P4YA 4HMPA 4YRIA 2R6GA 4GNRA 2I33A 3CNBA 2D62A 1ZH8A 3GRRA 1W4RA 1F2DA 1RQNA 5AW9A 3MYYA 3ZE9A 5HR5A 2OXFA 2FW9A 3UUWA 2ZSUA 1F7VA 1QE3A 2XXJA 3I3SR 1PFQA 3CNOA 4B3BA 5CFLA 1FE8A 3TMKA 4TKVB 1WOMA 3AJDA 3GJSA 5FOVA 1YDHA 4IFBA 5EUMA 5H82A 1ZS9A 5HW0A 2YDYA 2G8LA 3TNDA 1N0IA 4JIGA 2IS6A 5EMNA 2QGZA 4OJQA 5DWDA 3W6PA 5JH7A 5A04A 3FYUC 1X3SA 2XUIA 3CFYA 4PZAA 4Q4DA 1AKWA 2R8OA 2WJIA 3PSAA 1NQ5A 4QOEA 4QTXA 4ZVRA 2LD4A 4BJ5A 2WWFA 5JCOC 1HT0A 2H2DA 2VDWA 1PSZA 1HKUA 1C8LA 1NRXA 4Q3EA 4TZTA 3VUFA 4RETA 1L0BA 4A0FA 3K35A 4XFDA 4TS9A 1EJBA 2QY6A 1GL9B 3L8YA 2FXIA 2HF2A 3LQ4A 4NF2A 2HWWA 5FLXA 1VMKA 3L2OB 2HT6A 3GO4A 4FONA 3HNRA 1GNTA 1U81A 1G7CA 3H1AA 5D3MA 1SG9A 2EG9A 1QYWA 1FYVA 2FMHA 1ZM2A 2R5NA 3BRQA 3HC7A 4ON9A 4U8GA 1YZGA 1UF9A 2XMRA 3H8WA 4UBKA 1ZMRA 2X0EA 1DJMA 2JFVA 4JJKA 4R1MA 2DETA 5IKOA 1A5TA 2B8TA 1KQ3A 3ZWMA 4EW1A 3NM4A 1SUPA 2HMAA 2WFLB 3DAPA 4Q6BA 4TV9A 1WQ4A 1GDDA 1UXJA 5I01A 2XGGA 5KJEA 2Q6OA 6ABPA 1H23A 2QM7A 3VPFA 4DFDA 5T3YA 4IQFA 1HK7A 3AUSA 2MMCA 1VI5A 2ZW9A 3TR6A 1TYZA 3LA6A 2WC1A 4Z5XA 2LVBA 5IDQA 4R5HA 5KBYA 1PNVA 2CMKA 3C6ZA 2VHYA 1KZYC 1F9EA 2J6BA 4ARIA 1OE0A 3BXGA 1SGWA 1H8HA 3FMOB 2EGUA 1C8VB 2GZSA 3EOZA 3R5FA 5TJHA 4O08A 5AVRA 1O8CA 5MFPA 1W4AA 6REQB 2DB3A 1J09A 3R9WA 1HT2E 2BZGA 1TRKA 4LYYA 4X3OA 4MV4A 2BH2A 2VCYA 2WRZA 4NK5A 3UJAA 1JPVA 3CB2A 3B3GA 3WMEA 4D8TA 5LIRA 3TGLA 1O94C 1XTUA 4BVBA 3WOHA 2X86A 4HADA 3AY7A 4KHZA 1MHTA 2GBIA 1OX6A 1NUPA 1PT7A 1YZVA 4MV6A 1NDQA 3WICA 4DWJA 4LKRA 3DBLA 4PLFA 2AOTA 5IARA 4FE7A 3A6ZA 2W2LD 1W94A 1IG3A 3IDSA 4CF5A 3RM3A 4N54A 2QVGA 4TVKA 5DNCA 4YCNA 2VJDA 4XDZA 1OX4A 1TCVA 3LG2A 5TMEA 3TOXA 5LR6A 3ZIUA 2CEAA 2VHEA 1RQLA 3MRXA 5IKEA 1KY5A 2GH1A 1MORA 3IV7A 3K9QO 4D92A 1Y7PA 1Z5OA 4GE0A 4BC0A 3AVYA 2XOXA 3SXUA 3IODA 3E15A 1SD2A 5D8DA 2HU8A 4YH1A 4XOIA 3ZGLA 4IVPA 1FVOA 4L7QA 3S2UA 1B1AA 1KVTA 4GOXA 1LK7A 4UAJA 4FQ5A 3UC5A 3WWZA 2OAEA 3NWPA 4CVNA 4DREA 5JROA 4Q3DA 4F6CA 1CZLA 2KLBA 1K3FA 5ALXA 1MV8A 4G89A 1BX1A 3T4PA 1FXWF 4Q16A 4R40A 3VJMA 4LSZA 2H0AA 4WOPA 1AZLA 1J1IA 2VXOA 5IBQA 4E5KA 3KLBA 1BHO1 3L1HA 4ENSA 3Q88A 5DGCA 4IIJB 4DY4A 1VP3A 1ILEA 2NQTA 4QGBA 1Z2EA 4ZO9A 4EYQA 4X71A 2VSYA 1QPBA 4OUDB 4GX1A 1P7PA 2G06A 2DP4E 1I7NA 1O96B 3PVZA 4KEAA 3TZ6A 1NN5A 4JLAA 1MHPA 2I34A 2A4KA 2XE6A 1N7GA 1YO6A 3SOPA 2RHBA 1VE5A 1Y1KE 4RJKA 2E85A 3DXFA 3U3ZA 3OHPA 1DKQA 1TZMA 1HE3A 4NBLA 1NRJB 2FMTA 4CFZA 1CEEA 1LW7A 2BFWA 5DM70 4XGKA 3BQMB 3FWKA 3X2SA 4YVFA 3CE9A 4HY3A 2CDAA 1I6WA 1NG1A 1XU4A 2ZT6A 3RVPA 3WK4A 1R0LA 2NXEA 4ZREA 4DCMA 4X00A 3GLFE 3JQ7B 2QORA 3L49A 1GVHA 4D4KA 1NP6A 3NMUF 1E18A 1NLZA 3CC8A 4J7AA 5CJ2A 5DN9A 3U3DA 2HLPA 1KI4A 2YRFA 4OUKX 2PUBA 1G20B 5ITVA 2BCGY 1T1RA 4PLZA 1R6TA 1UR5A 3E9NA 3IBSA 4PVCA 4M21A 2OXIA 5KEIA 1CUWA 2H4WA 1IY9A 5IW8A 4BO7A 1E79A 4B4UA 3M6WA 3N7TA 5HMLA 4CDNA 3K70B 1NXOA 1MVLA 1H2XA 4UJ3A 3H16A 4WXYB 4H77A 4RTRA 3JQCA 1CIVA 4FCVA 4GXQA 5AJZA 1C9NA 1H94A 2Q28A 2XOKD 1MRZA 1XTSA 3FR7A 4N5HX 1TCAA 3EXFB 4B3FX 4LY3A 1JXMA 3K70D 3R40A 3TWOA 4NJMB 4B31A 3H5TA 2A57A 5EMLA 3AP1A 1JI3A 1E6UA 3HABA 3HA7A 4JLJA 3EUFA 3OJLA 1NVVR 2FSPA 3FNGA 4RZ2A 4AWBA 3QZUA 2IQ5A 2WT9A 4DLWA 4N7JA 2VJMB 1UQTA 1E1MA 1ADYA 1A97A 2HLHA 4N40A 2ICAA 4KLNA 1L4NA 4HAIA 4ZQGA 1OLSA 1R0ZA 1B76A 2R8YA 3HI4A 3RNLA 3ZGZA 1YDEA 2QLBA 4P08A 3C4QA 1QIJA 4QDUA 5FKJA 1NVDA 4YRLA 5TIIA 1NDUA 1DARA 4IDGA 4AI6A 4NH0A 4ZCRA 4MPDA 5EA2A 5KHLB 2JLVA 1DAGA 2JRLA 3PNQA 1B93A 4NBRA 1ZICA 4RHXA 3Q0TA 4QWWA 2AB0A 1J2TA 2D1TA 3ZQ4A 1MV5A 4EG3A 2IPMA 1LWNA 1JQ3A 5CIYA 4AY6A 4O5AA 1Z2DA 4GFDA 3HJHA 3S40A 4IRXA 4H18A 1WOYA 4O4LA 2G9UA 1WXDA 2GN8A 2KPOA 4DC1A 1SELA 1C30B 3B3QA 2VSFA 1KHHA 1AB6A 1X2BA 3BXOA 3MJDA 4FUTA 1R7RA 3EH2A 4S2EA 4XUDA 2HKIA 2OBBA 2R84A 3DV0A 5B3KA 4GXRA 1PZHA 4U7JA 4XTCS 3J81A 4UE3S 4HVCA 1V43A 4BEWA 1N7IA 1HQDA 2O5EA 4ZVMA 4AF6A 1KYZA 4A8JC 4J0KA 3C85A 4Y7CA 1YUBA 1N5DA 5ALRA 1NMZA 1XVUA 1RWPA 1C9MA 2D7CA 2ZOSA 3LQRA 4E21A 4P0QB 2DPXA 3SYLA 2IDZA 4EDHA 4LJ7A 1DTWA 3OQ6A 4G3XA 3Q3CA 3GA7A 1T25A 3IOCA 2MJLA 1HE8B 3PCXA 3PFHA 1GQOA 1UODA 1KFKB 2WJYA 5ECYA 5I9NA 5JZVA 1PVVA 4E3WA 1EE2A 1S2NA 1SHZA 1ULHA 2C3MA 3GNLA 3K1ZA 1EAYA 1KC1A 4JGGA 5K7SA 5EE1A 4MRMB 3WIBA 5LQRA 4G25A 1R6DA 1XE3A 2H1CA 5JZOA 1A3CA 1P9NA 2XR1A 2QNIA 2OSVA 3LWNA 4BKRA 1L7MA 3ZD9A 3P9SA 4JSYA 4DLBA 1JRLA 2ZJZA 5IZCC 3AM3A 2NIPA 1XLVA 4PR0A 4PZLA 3QU9A 1W76A 3DDOA 3MXTA 4V2UA 2WMDA 3W2HA 4YPFA 4A1FA 4ENTA 2OT3B 4QPDA 4I8XA 3QVOA 5ITSA 2R6FA 2V7QD 5AVJA 1A69A 3QH4A 4DSNA 2F48A 1BGWA 3EWAA 2DLNA 3AV0B 1T35A 5I48A 5JI3E 1I24A 4FHCA 4DUZB 1KDYA 4KLCA 1E2DA 1Q17A 2BM8A 3S5UA 3M83A 1AN9A 1E7YA 4F2GA 1QVZA 1VRCA 3D7LA 2BZ0A 1X1QA 1DLIA 1YR8A 3MB8A 3OZSA 5EZYF 3L7KA 4QG7A 4I36A 2PGLA 3K05A 3UHAA 5JDIA 1T0PA 5KX5A 3HKDB 1OZAA 2ZB3A 3M6IA 3JQFC 1JIUA 4LXTA 4YK7A 3LLUA 2D8MA 2QZ4A 4V0ME 1H93A 4XXHA 3U1VA 1A4RA 5KYUB 3RYCB 1UC8A 2PUJA 2YMLA 5JAMA 3RRYA 1N3YA 1HQKA 4JJAA 3MWGA 2QS9A 3IMGA 3VDXA 3SDBA 4ALNA 2JFZA 1DQSA 3BD8A 2YVUA 5B58C 2Q49A 2OO3A 1DEXA 3OFNA 4J4TA 4JWTA 1RBZA 1OXBB 3QNWA 1W59A 1DXYA 5HOQA 2BLLA 3L9WA 3L0CA 3UIEA 1FOEB 3HCEA 1JR3E 3E0XA 1T9KA 4OQ4A 4PYNA 2LE0A 2FGKA 1KK2A 3WNVA 3ZWBA 4Q4CA 2AUNA 5GZ1A 3WGIA 3OE1A 3T0FA 1SD1A 1WPQA 2NVBA 3AR5A 4IV5A 2X15A 2ZATA 5FBRB 4C3UA