2Y1LA

Caspase-8 in complex with darpin-8.4
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
150
structure length
150
Chain Sequence
LDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Caspase-8 in Complex with Darpin-8.4
rcsb
source organism Homo sapiens
molecule tags Hydrolase/inhibitor
molecule keywords CASPASE-8
total genus 56
structure length 150
sequence length 150
chains with identical sequence C
ec nomenclature ec 3.4.22.61: Caspase-8.
pdb deposition date 2010-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2y1lA00
4JB8A 1NMSA 4AWBA 1GFWA 3R7NA 5JFTA 4EHHA 1IBCA 4ZVPA 4JR1A 4N6GA 3RJMA 4N6OA 3NS7A 4QU5A 1QDUA 5IABA 2XYHA 4FXOA 5H0IA 1I3OA 1SC3A 2CNOA 4DCPA 2HBZA 4QUAA 2HBYA 4JQYA 2H65A 4NOJA 3IBFA 4QU8A 3UOAB 4D3ZA 4FEAA 3PD0A 5IC6A 4EHLA 2H5JA 4ZVQA 5I9BA 4NOMA 3SIPA 1RHJA 3KJQA 4N7MA 2QL5A 2CDRA 3S8EA 4PS1A 2AR9A 4QU9A 4NBNA 2WDPA 1CVRA 4EHKA 3V4LA 4IYRA 1SHJA 3PCXA 1RHKA 3D6FA 4QTXA 4DCOA 3H11A 1CP3A 1PYOA 3KJNA 4HQ0A 3GJRA 4NBLA 3GJSA 4QTYA 1NMQA 1GQFA 1RWOA 3R7BA 2K7ZA 4M9RA 2CNLA 2J33A 1PAUA 2C2OA 1RWKA 1ICEA 2H48A 4QULA 3H0EA 3H11B 3NR2A 2QL7A 4FGUA 1I4EB 3V6MA 1RWNA 2H51A 3ITNA 4JR2A 2XYPA 3P45A 3S70A 3V55A 2QLJA 2CJYA 4I1PA 1I4OA 3EDQA 1JXQA 3H13A 1SHLA 2FP3A 4LSZA 3BIJA 2QL9A 2HBRA 2FUNB 4JR0A 3SIRA 5LU9A 2C2KA 2H5IA 4ZVRA 4N5DA 4QUHA 4AWAA 2J31A 2CJXA 3E4CA 1RWWA 4HQRA 2Y1LA 1RHQA 4PRYA 1RHRA 4ZVSA 2XYGA 1RWMA 4NBKA 4EHAA 1QTNA 3DEKA 2CNNA 1SC1A 1QX3A 2J32A 3R5JA 5IAJA 5LUBA 3K7EA 1I51A 4QUEA 2Y0BA 3DEHA 3DEJA 5IC4A 2QLBA 3EDRA 4EHFA 2QLFA 1NMEA 5IANA 3KJFA 2C1EA 2XZDA 5IARA 4QUBA 4JQZA 4ZVUA 1K86A 5LU8A 1K88A 1NW9B 3R7SA 1F1JA 1RWXA 4IEFB 3UO8B 2C2ZA 3V6LA 4PRZA 4AW9A 1M72A 3DEIA 4QUJA 4QUGA 5IASA 3IBCA 3V3KA 3R6GA 2H54A 1RWPA 4NOLA 1RWVA 3R5KA 3GJQA 4QU0A 4ZVOA 4DCJA 3P4UA 2H4YA 4QUIA 4JJ8A 2H4WA 4N6NA 1SC4A 5IAKA 2HBQA 2CNKA 2P2CA 2DKOA 2NN3C 3PD1A 4N7JA 5IBRA 4EJFA 3OD5A 1RHUA 3QNWA 3D6MA 3H1PA 1BMQA 4JJ7A 5I9TA 4ZVTA 3GJTA 4JJEA 2FQQA 3V4OA 4D3YA 4D3XA 1RE1A 5K20A 4HVAA 4PS0A 1F9EA 4I1RA 5IAGA 4EHNA 5IAEA 4EHDA 3NKFA 5IBPA 4FDLA 1KMCA 3D6HA 5LUAA 2XZTA 2C2MA 3R6LA 5IBCA 2J30A 1RHMA 4NOKA 4QUDA
chains in the Genus database with same CATH superfamily
3ZTYA 1FDOA 1V5WA 2X23A 4IIFA 3UHOA 4B85A 4DWVA 5JDIA 1K3TA 2BISA 4O4JA 5F1YA 4X6UA 2R1VB 4UUMA 2JFPA 3IRUA 4C0QC 1K68A 3FMGA 4O2AA 4M1YA 2X6RA 2B6NA 2GCGA 4DJ5X 2WV7A 1V9LA 5HF8A 3DAHA 2V65A 2E4ZA 3FF1A 4GBMA 1G8MA 4V0SA 3TZHA 4ANFA 3EGXA 2JG3A 1VECA 4RYLA 3C85A 1NZFA 1QO9A 1UXJA 1Z6QA 1GHTA 1L5OA 2J8ZA 2V7QA 1ZXLA 3NI2A 3QHPA 1EKXA 4TTJA 4HMOA 3R7LA 1UBOS 2N3ZA 1BD4A 5FV7A 2Q99A 1RWQA 1L5VA 3CCBA 4R2MA 4IDHA 3BRSA 4WCFC 2AE2A 4IXTA 1PK8A 4UPVA 1WCIB 3K0AB 5IDYA 4C7MA 2HUPA 3QLUC 4EW2A 3T3PB 3DPIA 2AA3A 4L8GA 4P5PA 5KVAA 1WS6A 2MINA 1PYOA 1XWIA 4TSFA 1OLXB 4Y1RA 2JBAA 4YP5A 1QIKA 4K0RA 5C35A 5JOQA 2POCA 2FKNA 5JIBA 3LUGA 1I4TD 3PI6A 3WBJA 1Z6YA 1JYEA 1Z25A 3KIPA 5KDDA 3P4YA 4X1KA 4W5NA 4WBNB 4KAAA 5CM9C 1E3WB 3JQ9A 6AT1A 3B1YA 2V4ZA 4DLRA 4U9HS 1Y7TA 3IAUA 1GZSA 1FTSA 1C7IA 1DKOA 1PQWA 2Q9CA 3CRMA 3DZCA 3GEMA 5IT5A 3FOEC 2O57A 1YT5A 1OI3A 4S24A 1DKNA 2QQ0A 1PJZA 4L07A 3C7KA 3DEZA 2W70A 4CV0A 1M1UA 1VP3A 2IXBA 1S3GA 3LV8A 5FPYA 5BP7A 4NYMR 1VBNA 4B6QA 5K3OA 1XTPA 1GV0A 1KTVA 4GOOD 1MH9A 4A16A 1A5ZA 1XDWA 3IP5A 1Y7PA 3KYCB 1C8VB 2YJNA 3JU3A 1DRVA 1DXYA 2W2TA 3ZCPA 5JC1A 1MB2A 3JCZA 1I3CA 3AJAA 4NCNA 3NDPA 4RGVA 5CHYA 2W2OA 2QTMA 3JAWB 4JEUA 4NAUA 3RHTA 1E2MA 4P7GA 2P9ZA 1IK4A 4U7JA 1GKYA 4Z7JA 5HQ3B 2AGVA 4EJSB 1HSZA 3E6AA 5DXFA 4FGLA 3N87A 3ESBA 1B15A 2V9ZA 3HR4A 2FPSA 2YZMA 4RO0A 1PGPA 1JHZA 2IPOA 1XXHE 1E3WA 4I9NA 2FWBA 1MEJA 2ZJ7A 3N0XA 2EP7A 3UANA 3ZKWB 1C4WA 2ZWAA 4G5QA 4Q1DA 3ZWVA 1U98A 4BMNA 4DQDA 5A3QA 1PWEA 1LDMA 4LZOA 1TGYA 5EP3A 2CSUA 2GBFA 2I80A 7ADHA 4LV8B 4OGFA 4AF8A 3NWEA 1ESCA 3AYXB 3CR3C 2JHFA 2Q0HA 3TD2A 2ODPA 3W34A 4CF5A 3BH7A 1K5PA 4WZAE 2OBNA 4EKNB 5DM0A 1EB9A 3JQCA 3LC1O 2PA0A 3R7DA 2BHNA 5ABPA 2ZSUA 2NQ2C 1AMUA 1HX7A 1GUYA 3ADPA 1V9SA 3EFOB 3VJKA 5EHXA 1P74A 2G5CA 3PP8A 4WLUA 2SECE 1HM5A 2XIJA 3DV9A 3NYQA 4OGLA 4DM7A 5HUQA 2CXRA 3UBTA 3VYUB 4DQXA 2W8BB 4BMPB 2IEBA 2OZVA 2FHSA 3IAS1 4JH0A 4WEQA 3KQNA 1MAWA 1E2GA 4Y6PA 5CLHA 2HLHA 2QENA 5IKPA 2QUKA 3E18A 5TSDA 3OT4A 1PJ8A 5A3JA 1XCGB 5IT9A 3IL2A 2GF9A 5JCPA 2QTBA 1E3EA 5ECWA 3C5WP 1QO0A 2ZBRA 3GEEA 4C21A 2X0RA 4DABA 2D6FA 1OHHA 2ASEA 2GWHA 2W5UA 3ANTA 4I3FA 2O8EA 1HF3A 5T57A 1W5EA 1T9CA 2EFJA 3HUUA 2RKWA 4W8OA 1B7GO 1JQJC 3G2PA 1Z6XA 5LKAA 5EIEA 1GNPA 4TWIA 1LPMA 2RHWA 5BOSB 1Z2CA 4TMKA 4CKXA 4YRIA 1HQKA 1FFBA 2R4QA 1BMDA 2GZSA 1FK8A 3BL6A 2WJGA 4JQSA 4L6IA 1USUA 4NECA 4C30A 1YA4A 2CXSA 5ALNA 3TBHA 5EMLA 3VR0A 1VHQA 5BY2A 1QP7A 1QHGA 1YCHA 1QSGA 1UBHS 4OD0A 1Z4QA 1I6WA 5F12A 4GOKA 5L7WA 3PNVA 4P7KA 4BN0A 2G06A 5G0SA 3OZTA 4RWEA 3G8DA 3IQWA 2XOXA 4RSMA 5EHIA 3VNQA 4CR7A 5BVHA 4NRDA 4W9RA 1E9SA 1RMYA 4MEJA 2I55A 3E3NA 3HVRA 4ETNA 2WPDD 5JXIA 1E92A 2GDJA 1G4AE 2RGDA 3K0EA 4HN2A 5C46F 4IOLA 2QUAA 4YWHA 2HT6A 2X40A 3AYZB 3EXFA 3H3JA 2J4FA 2PS1A 3HO8A 2G28A 2XGGA 2ZWPA 3QI2A 4IWXA 4IHJB 1U0LA 4LE2A 5FTKA 3QP9A 4CQMB 2ZYTX 1A4RA 4CKWB 4LGCA 1NATA 1M7BA 3BWBA 2VN8A 2L82A 4NDAA 2C2GA 2XJ4A 4ZKEA 4KDCA 1SIOA 3AT1A 2NO7A 3LQKA 1NWCA 4XJXA 2FEPA 4KACA 3DAFA 4JA0A 4WH0A 3TLGB 2UYHA 3C5EA 4DEXA 2PVCA 5LL6P 3DXXA 2CSXA 3EZ7A 5HWSA 1VKJA 4BVLA 3V7NA 4F9FA 5K09A 5LOVB 3L0OA 1BYIA 1PS9A 4NFHA 2J9ZB 1P18A 2RK3A 5EE5B 4R05A 1KETA 5A9SB 1K66A 4Q9IA 1EUCA 2BJVA 1G3RA 3EOZA 2D74A 2G5TA 4EH1A 5EYPA 1Z15A 1JL3A 2NGRA 1M2OA 5CBPB 1B74A 3FI0A 3BMQB 1RQXA 3HBAA 3PC3A 4BCBA 1X3LA 3N2KB 2WFLA 3CLRC 2IHUA 2XT9A 4DCJA 3GPLA 2G5PA 3MYYA 1W30A 2J9RA 2XGOA 4WE3A 4XQ9A 4BP9A 1DQZA 3L8MA 4XKJA 1FUIA 5KYYB 4L0QA 4QFMA 1WIWA 1JKJA 2MYPA 2VEDA 2BGNA 1R9GA 2ZR8A 3DKIA 1A1VA 3KV1A 3B36A 4UVHA 4N41A 3UXYA 3K96A 1C0LA 1WB6A 2B98A 4WFQA 2Q9UA 4Q9AA 2CD7A 5IAGA 4BNWA 1XCPA 3NDJA 4AT1A 3GLTA 2YZGA 2OESA 3OBIA 5CG1A 1KPGA 3HKBA 1SPBS 4A8PA 5B58T 3NH6A 4QJBA 3GLIE 3TQSA 1P7VA 2ZIVB 3O3CA 5LMNB 4Y1FA 3EYWA 3O83A 2PWAA 4MV4A 4Z3DA 4BCCA 1LLDA 3BXPA 1EAYA 2DOKA 2QRLA 3FJYA 2NXNA 2R87A 5FYDA 5LLSA 4QGBA 1D09A 2XBUA 3MA0A 1G0OA 4C01A 2FWRA 4OP1A 5LYJF 3A2MA 2B0CA 2YHBA 4JX9A 1K7CA 1YCFA 3NIWA 5ALLA 4OREX 1P0PA 1H23A 4AJ2A 3IUJA 3CIOA 4WW0A 4Z1OA 3TAXA 3K20A 1LFDB 4R1NA 4ZICA 1TVKA 4DLSA 5DYNA 4X66B 3IDOA 4JBIA 4DY4A 4DWJA 3VKUA 2DCMA 2O8FB 4H1UA 3PNBA 3RSHA 5GGXA 3EZ6A 4WV3A 2XNDA 3N5KA 1GGFA 1SZJG 4CHGA 2C7PA 1NR5A 3HH8A 4G8CA 3KQLA 1RRVA 3JVIA 4FMBB 1M2HA 2C2YA 3OD1A 1JG6A 2PRSA 3OO1A 1J5PA 2ZYAA 1Z45A 1TL7C 2PKRA 3EY4A 1XU4A 2J9FA 2OECA 3ABZA 4JU8A 4HNRA 3GLSA 4OI1A 1J90A 2R7MA 3QUCA 3KVVA 1LW7A 1WF6A 2JIMA 3IQHX 3GGPA 2IEZA 3PWKA 2IHJA 5DWQA 5KDOA 4KR2A 4IZOA 4TV9B 5F7ZA 4RK0A 2GXAA 1HE1C 1F8XA 1WZNA 1JJVA 2AC4A 2CY0A 3CKMA 3D54D 3PUHA 4TMFA 4D1YA 5DMXA 1JXQA 1FIUA 4RMHA 3PI7A 4K9SA 2C2KA 5CG2A 1LI7A 2IHTA 2EIHA 4Q4AB 2QYSA 2JAHA 3N76A 2VYND 1RHQA 2FG7C 4PQGA 4U39A 3UMJA 1XYVA 2IP1A 4CG2A 4IGKA 4MIKA 4MV9A 3DEKA 3CXUA 2JNWA 3M4JA 5SZIA 3DAOA 4CDNA 4D7AA 1DTWB 3LT0A 4UZSA 5KMGB 1XHLA 3L41A 4IH9A 4GW3A 5JS7A 3VNBA 2HHHB 3IE1A 4IX9A 4CM3A 5FQNA 1FLDA 2IHBA 2O1XA 3EMVA 1JDNA 3R0IA 3H1BA 2HF8A 3QX7A 2A57A 2J6HA 3LU1A 4YRGA 4DUYB 2E4WA 1OSNA 5KKCA 3VDMA 2MSEB 3E1SA 5T6MA 2R00A 2P8JA 2UUCB 2XITA 4YCNA 1QB7A 2AEEA 4O0MA 4Y2PA 5H9WA 4QUGA 4XA8A 2FPIB 1KJYA 4BUJA 3WX0A 1NW8A 2VDWA 4P31A 3KZOA 5D85A 5DI3B 5IYZB 1Q84A 1VRWA 4HADA 2NUAA 1ADYA 2OT3B 4DE5A 2JLRA 1E61A 2R25B 5EIHA 3A1WA 1G291 3WLMA 5HZHA 1IM2A 3KXIA 5DLDA 2AR7A 1JZTA 2WT4A 4F4FA 3ABOB 3OZCA 3TGWA 3I5UA 5ICMA 4P36A 1UBFA 2NUAB 2YN4A 7ABPA 5ALFA 3L40A 1ZD4A 3PVCA 1IMOA 5D5HA 1ZVVA 3PC8A 5HTOA 3MJDA 3THYA 1HE4A 1KQGA 2W6JD 1STOA 1O94A 1XNJA 4BGEA 2AXNA 1M7GA 1OLUB 4BO8A 5BMVF 2AN9A 1HLDA 3U1VA 3BWDD 2F8TA 1YHYA 5AESA 1VHWA 1OREA 1CHNA 2P35A 2W2MA 5J1SB 1S02A 3CLTC 2VDUE 2VP3A 3QJGA 1B3BA 3PJEA 2AFIE 2BONA 4PFSA 1HBJA 1CZNA 4ZQBA 5GPBA 4D96A 5FV4A 4DY6A 2PJDA 2XUIA 4L3WA 3AV3A 5BNFA 3O1JC 5IG2A 4ND3A 1C9JA 1QPGA 2FRVA 4C0HA 3V42A 5DCLA 1DIGA 2FHPA 2PDAA 3OUTA 1K5HA 4RPGA 1BDJA 4QBIA 2WYVA 4ID9A 3DZIA 1XALA 2Q3CA 1IH8A 3QUTA 1XTQA 2Q2NA 4WA8A 5FUVA 1INLA 3GA7A 3NCHA 4JJIA 4RMJA 1PL0A 2Z6VA 4C4SA 1P8JA 2QA5A 4ZYLA 1C3OA 1J39A 3I9FA 2DR2A 5C51B 1V5EA 1QHHB 2BFFA 1T24A 3B3FA 4MPRA 4DMGA 1RI5A 3NHFA 3VDNB 1R0XA 3ZU5A 3TIXB 1EVLA 4C7KA 5A03A 4EUKA 4GLJA 4LYFA 2X0KA 2GZAA 2J9YB 1I2BA 2CNLA 3R20A 1VJCA 5AJYA 1IXZA 1G8SA 3GNTA 1XTBA 4PC6A 4FK8A 4AMZA 4CXMA 3H84A 3BJIC 3H0EA 3E9QA 3NBFA 3DZGA 4FYIA 4L50A 1TDJA 4MR9A 4DL9A 3U6KA 4Y3UA 3TRDA 4PLWA 3U4IA 4GOLD 4N5NA 3KJXA 1L5GB 3RIYA 3WK8A 2E5WA 1PU2A 4BNTA 1NQOA 4UMEA 1JW9B 5I7FA 1RYBA 2PANA 3HU3A 4N5MA 5KYWA 4NQZA 2WINI 2BFDA 3AEXA 5FWDA 3RHSA 4ASUD 4TVSA 1D4AA 4G0MA 3O2QB 1PI3A 3SQOA 5FIUA 1JMVA 3T5DA 1HV8A 2VT2A 4HAVA 4FILA 4ZOCA 2W6IA 4A0RA 4UQPA 2HX1A 1PEDA 1SIBE 2PG3A 2OCXA 3K4QA 5DNWA 3TM4A 3F74A 2X9LA 3ROTA 3VYWA 3ZZUA 3HY4A 3EMDA 4NU8X 1PUXA 1QKJA 4KLZA 1DAIA 3HCNA 4LDQA 3R7SA 4TV8A 2VHVA 2AKYA 3ASVA 3B6JA 2O52A 3N2IA 3TSAA 2OP1A 1YMUA 2CFIA 3A9CA 4OGGA 2OBLA 3PFIA 1ODLA 4JI0B 5E1DA 4MEBA 1HI9A 1QRDA 1VM6A 3EVGA 5CTAA 3A28A 4UOZA 3A37A 5A62A 1L5LA 1E5XA 4EI8A 3E81A 4HDSB 1F48A 1VBMA 4PPYA 4B83A 1QIMA 4P81A 5TJ9A 3ZXIA 2WE8A 3GN1A 4ISCA 4H60A 4W5RA 3M9XA 4IX1A 2JJ2A 2CVZA 3LUCA 4JQCA 3B3AA 4OIMA 4Z8XA 1ZA1A 1SK9A 3UV6A 1RAAA 2PBRA 2E4VA 3BA6A 3N2KA 1A9ZA 3ANXA 1F0NA 2TYSB 3JYLA 4BLSA 4GI5A 1A9QA 1M2OB 1SM4A 1AZSC 3BZUA 3VX3A 4B8ZA 4O4IB 5AUOB 4KIWA 7AT1A 1POXA 4IYJA 1EH5A 1NKVA 5FDFA 4R2WA 3BMXA 1P0IA 4RTLA 2AK2A 4DLUA 3L18A 3QE4A 2ZUFA 3HLKA 4RVGA 1Z8DA 5LOVA 3W5DA 2WE7A 2I67A 2VP2A 3COJA 2P9HA 4BV8A 2WAAA 9GPBA 1NRXA 2YXDA 4ETWA 3C3JA 1Q1ZA 5TPZD 2F9LA 1PJ4A 5U4XA 1A4IA 1IVYA 4GX1A 3AF2A 4WZZA 2EWVA 2OM2A 1AO3A 3QGMA 5FJJA 3RT1A 3VMMA 4F06A 3MT7A 3OBBA 5ADUS 2I76A 1ZO8A 2ZVPX 1X0XA 4L02A 4EHLA 3LAWA 2ZRFA 3LHKA 4CM6A 4B3TB 3B3QA 3L8DA 2IY7A 2GZMA 3KZXA 1CQIA 4KOAA 1ULHA 2C9YA 2A5GA 4K9DA 4YXFA 3Q98A 5KYYA 3EXFB 1SHJA 3BJMA 2GCIA 3LIPA 3CKKA 3QLVA 3BGWA 4HSGA 5JWHA 1JLHA 4B80A 1NNSA 3DNMA 3ZQ4A 5BYKA 1XQWA 3WAGA 1JDJA 1ACJA 4K9LA 1RRPA 4W5WA 3W2HA 5A4DA 2GEFA 1XQ6A 1Q1QA 3FCEA 1ZR4A 2OO3A 4XDYA 3FETA 1MLDA 1W59A 4QASA 4B3CA 5K0LA 1RZVA 2NXCA 1EBUA 4J1TA 3AGQA 5IVDA 5A5FA 3AETA 4TS9A 1VSVA 1S89A 1QV7A 1J8FA 1P2BA 1LV8A 3QF4A 3EPPA 4QELA 4EVRA 1FY2A 1XQXA 2WNIA 2P4UA 3R9XB 2XB6A 2BTOA 3KOXA 2AKAB 4RD4A 2B2NA 4XW2A 4XOUA 1LI4A 4D9CA 1W6UA 4X3PA 1Z9BA 1V5GA 4W63A 1QIIA 1YZHA 4QUKA 1BMFD 2QD4A 3CLHA 3D4LA 3R24A 3BHMA 4R5HA 4RLHA 5FPKA 3D6AA 3SMQA 1W4BA 1GIAA 1JU9A 1EFUA 1YZKA 3I6MA 4BQPA 2GETA 3V1YA 3EGIA 3REFA 4JNCA 4PIMA 3OU6A 5D8DA 1BE1A 1O97D 1S2IA 1V6AA 2GO7A 1GTL1 1ZI9A 2HSEA 4ZU3A 5H82A 5I6DA 3A3KA 4K87A 3M4NA 5TS2A 1H6AA 1ECPA 2HB6A 4PN3A 2IK8A 4ZEVA 5AIBA 1EWYA 1SFRA 2CXUA 1AY0A 1VL1A 3LA6A 4AY3A 5BNWA 1QFYA 2R1ZA 1ZH2A 3V3KA 5KQSA 1X92A 3R5HA 3QYAA 5AXAA 4DCVA 4ZQFA 4DSAA 1YULA 1DAFA 2OCAA 3FGPA 4BE7B 3PFFA 4L8VA 1FSFA 4JGGA 4D81A 1I33A 5DSZA 5L3RA 1U8CB 5C5EA 3M1YA 3WK5A 4N7JA 3TQTA 4RJJA 3E82A 3PITA 4R01A 1E9DA 1YK1A 3DBHA 2XKKA 1NBAA 3WQSB 4JI6B 2HTFA 2O05A 3ZNPA 2J7PA 1E1MA 1M6EX 1YS2X 3ZLBA 5J2TB 2WU4A 2REOA 2V7XA 4TLCA 2ZVDA 3QH4A 4WLOA 3BK1A 1P91A 1QIJA 2A9QA 2X9GA 2NUPA 2XCIA 3LCUA 4YGXB 2D2IA 2WWWA 2J5BA 1W5SA 1XNQB 1N7IA 2YQ5A 3GPIA 1DNPA 1X14A 2AWNA 3QVOA 2CKMA 1VJTA 1SURA 1XL0A 1ZK3A 4BO5A 4EJSA 3NMUF 2OHFA 4JC5A 1TKBA 2ZI9A 5AO9A 3RROA 3PHLA 1TTPB 3V5NA 1P2SA 2E48A 3U16A 2MWMA 4TZ6A 4BZXA 1GZVA 1ZMBA 5FULA 3HBLA 1SG9A 3SE0A 5B4UA 3QPCA 4ALLA 3AVWA 2BHSA 3C4QA 3TR5A 2D62A 2PTGA 3EQ9A 4L8WB 3FCYA 4NF2A 5BT9A 3ZCUA 2ERCA 2DUJA 2GJKA 4DKJA 2XDAA 1BJRE 2P0EA 3K1YA 4WCFB 4ZO9A 4JKYA 3R6TA 2RH5A 2Q6LA 4D92A 4I4NA 3QXGA 1JBKA 1JVSA 3O47A 2G1AA 2OV6A 2XR1A 3O8BA 1AKVA 4M7WA 2VH5R 3CH5A 2H2DA 3GJRA 4F0JA 3AL0C 1XZJA 2XH8A 2OCLA 3TLXA 1CULC 1IOVA 1KJJA 4XQGA 2XCRB 2YS7A 1LQ2A 3DD5A 1Y8CA 3L84A 4R41A 4IEEA 1Q0SA 2OQ2A 4KO4S 4NH4A 1HR0B 3P9QA 4Y1RB 2IOHA 3DOIA 3FVQA 2DTEA 1N0HA 3X1KA 1QIGA 3ZLUA 2WWGA 3AO0B 4B1FA 1NU6A 3AJEA 3DMRA 1NRIA 1MA0A 3DXZA 1EFDN 3E8XA 1JQAA 3OCJA 4D3FA 5MGNA 1M7HA 1PR9A 2P9EA 4I6JA 5D7BA 4ZHQF 5BR4A 1FC0A 1RC8A 1JBEA 1DRKA 3VR4A 4M4SA 3WYCA 4HPXB 5CD1A 4C3VA 1YBAA 5NLLA 2QVBA 5AJUA 1KEKA 1SHZA 1RWWA 1I1NA 2IYAA 2YWXA 3H8WA 2NO9A 2D7CA 3I9NA 3IT2A 2RAVA 2COEA 3OKFA 4INJA 4JT4A 3SX4A 3IOEA 2WKQA 3A7EA 1DQNA 4A9AA 3R3XA 2ZROA 4ENUA 1MX1A 4EY7A 1ZN9A 1I1HA 2FZKA 3A26A 3OWOA 3PPWA 4KXNA 4MLPA 4S12A 1ZGHA 2H31A 3UMBA 4E22A 2H06A 4IY1A 2I3GA 1N5LA 3M6WA 2NSLA 1CK4A 3O7WA 4RKYA 4XGNA 3MQ2A 1VMIA 2AG5A 4FC6A 3NTQA 3D1LA 1L8LA 3HE3A 4XFDA 4ZT7A 4DLZA 3C45A 5FLXA 2WYHA 5IHXA 3NPAA 4NJEB 1QKIA 4NYJR 5DBHX 3WC4A 5FFFA 2BBTA 4JENA 4IG9A 3V7WA 3EIFA 4MUYA 4F4IA 1G38A 4CL0A 1EA7A 5DM1A 1N2CA 3V33A 1ES9A 4EYKA 5BXYA 1Q83A 1T2UA 4I4TA 3ND6A 3P4UA 2ZFUA 1SZCA 4S3MA 5E1OA 3T1HB 1FYVA 4JJ8A 2FWPA 1G3IA 4Z0HO 2VRCA 5REQB 3UK2A 5JNRA 4YHHB 1Y48E 3BXGA 5IJ9A 3HCBA 1F38A 3TZBA 4BAZA 3JQAD 3L92A 4XD2A 4TZTA 4R84A 4V38A 3TPCA 4IXDA 3GLFA 1ZAKA 2PSEA 2RGWA 3BHJA 4AX8A 4XWOA 1P9OA 3C2QA 1PE0A 5LNK1 4QATA 1BX3A 4MYDA 1QH0A 4Y9UA 1KAEA 3T1TA 1TEVA 1LRLA 3G6KA 4W5OA 2BRUC 4IXWA 3L4KA 4R54A 4LW8A 3HI6A 1E1RA 1NUHA 1L7BA 2C2MA 1L5SA 1X94A 2H5EA 2HM7A 4XSHA 4MH0R 2XB2A 2BLLA 3T7CA 3IURA 5AOCA 2QD1A 4JUFA 4TL6A 2M98A 4XQCA 1JJFA 3NT5A 4EHHA 2AV6A 1EG2A 1LPNA 2ROQA 3OEHA 5ESRA 3C87A 4B7ZA 5B2EA 2HIAA 4CVNA 2GD0A 3SPXA 1O87A 2DVMA 1C41A 4M0MA 4P2GA 1FTGA 3SYRA 4YRAA 2CLDX 2PTHA 1XZHA 4FQ7A 4O4HF 3ZDRA 1NTOA 4CIBA 1CYDA 2AUNA 2ZS9A 3OCVA 4L4ZA 3GYGA 1ETUA 3DL2A 1J6UA 2HPHA 2QTZA 4OA5A 1CQPA 1TUBA 1NUTA 4D56A 1LNZA 1P3Y1 1Z6TA 1AX9A 1XKTA 2BJHA 3ENWA 3H19A 3LQYA 1OWOA 3K5WA 2WWRA 4HP8A 1VIYA 2WSSA 4PAOA 5EZYA 3MJFA 4QECA 3ZHVA 3CTPA 1FBNA 2E1RA 4HDAA 2DQSA 1T0BA 3IVCA 2OLJA 4OO3A 1M8KA 2P1RA 3IDZA 2NXEA 3KUUA 4S2UA 3L4EA 1ZGBA 1LBSA 1UC4B 2IXAA 3RV3A 1ZVJA 1N57A 4A0HA 1F7UA 3QHAA 2PR7A 5EXPA 4YT8A 2HDNB 5B6PA 2IYTA 2QAIA 4I55A 3W77A 1X42A 2PT5A 3L0PA 1JILA 1LBHA 1NBIA 2G71A 4EKEA 4C7OA 3BMOA 3IDSA 2GN6A 5DLYA 2YXLA 5LQRA 2XWQA 1J8DA 2PN1A 3QYFA 1KSJA 3GP3A 3LF2A 4MQ6A 3I3SR 3CH6A 2VK1A 4S0ZA 1XYYA 5JWOA 4RF5A 4ARZB 2ZB8A 3HM9A 2QEQA 2I2AA 5CFQA 3GGDA 4JR0A 2O20A 1UKCA 3VHLB 1NJ2A 4QUHA 2WKSA 2R5NA 2GA9A 2HCRA 3LUHA 1OLSB 4BXOA 1Q57A 1YKFA 2Q3FA 4KO1S 4YRFA 1E9BA 5EXXA 3UW1A 2MYUA 1QCDA 3FZNA 4UHKA 2WUEA 1HYBA 1DJMA 3FZGA 4DLPA 2XTZA 3JZMA 4B4KA 4UAGA 3CZQA 1NXQA 1FSZA 1Q0QA 1YB2A 3N74A 4HPJB 1R9JA 4J0HA 1M0WA 4ZFNA 4V1CB 1VLLA 2EKQA 3AY0A 3HM2A 1KJQA 5JJBA 2WJ4A 4FBGA 2IUUA 1VYVA 2JK1A 5LU8A 4W5TA 1JFTA 4IV5A 3JWIA 2PSJA 3CRRA 3PL1A 1A2BA 2JF0A 2QTAA 5I47A 1PT7A 2A78A 1QZXA 2X15A 3GV0A 4OUDB 4B84A 4TLDA 3UIEA 2AJBA 1GUBA 2DC1A 4K6GA 4PPNA 4FZ3A 4EHJA 1A95A 2W11A 5HZMA 2O6HA 4OHBA 3UG7A 1M5UA 1RYFA 3K6JA 3KEGA 1HSOA 1NY6A 4GZLA 4B6JA 3H6GA 1Y89A 3CEHA 3F3SA 1LNSA 1B0PA 1K7SN 5BRNA 3TSYA 1YE3A 3PDCA 4I1YA 5FTWA 1ID8A 4ZO7A 4P08A 2XHEA 4P35A 2P2CA 4R71A 1A9XB 1T2NA 2PQ0A 1MDBA 1E4EA 4N48A 4MUAA 1IWOA 1PQ4A 3GCGA 2C2BA 3D7RA 3D81A 5TXGA 4ZREA 1Y9DA 2EFYA 2ZU6A 1UK7A 5JMWA 4D0NA 4UXIA 1H0KA 4GBJA 4BX9A 2Q5CA 3LUFA 3QQ5A 1KE1A 2Y92A 1NVVR 5F78A 1DXOA 1SCUB 5E0OA 3REQB 1QF9A 2PVPA 1L4BA 4COOA 4ZCSA 4ESEA 2G4CA 3MIIA 2AI3A 2FZWA 4JWTA 4PQFA 3ZS9A 3ND5A 2B8NA 1R64A 2Q4RA 3WJ2A 5BN1A 1IQPA 1NHWA 4FC7A 2QTGA 1HDOA 4RY2A 4N6OA 2D0OB 5IS2A 2Q3DA 1N75A 2P5UA 4DIFA 1MP0A 3Q41A 4KNWA 4QDTA 2ALJA 2H1RA 3WL5A 3K9CA 3FOBA 3A4VA 2AMVA 3CPEA 3DHNA 3BQMB 5B7NA 4TTTS 1P4HA 2AZDA 1R6UA 5I9BA 1WUIS 4ZVVA 2BLNA 4PICA 3EG5A 3LO5A 3PNPA 2EERA 4RPCA 4B3SB 4F8JA 1ZCJA 3A9TA 4WCDA 4PIPA 1WRBA 2BCEA 1RBYA 4Z3KA 3NVMB 4LRWA 2ZIGA 5DBOA 5ECYA 2TMGA 2C97A 1USIA 1AKQA 4RWZA 3VSDA 3VNRA 3IQXA 1RRCA 2JGLA 4JROA 2Z8YA 4WFIA 4PWYA 1IONA 4LJ4A 4PZUA 4AMBA 4PYOA 3HY6A 1HNXB 1KAMA 3BSYA 4YJHB 1JTEA 3ROPA 1KO5A 3BDIA 1Z8HA 4YCAA 4LSMA 3VH1A 5TGTA 3L8CA 3PIIA 1NY5A 1Z6ZA 5AW4A 1VG0B 1QR6A 2ZRHA 4V0QA 5AICA 3HMQA 1YI0A 4Q1BA 3KPYA 4KLNA 1X7WB 1V1MA 2FSFA 2Q8PA 4GOJA 1E58A 3E9RA 2PKCA 3H8JA 2QYTA 2O6LA 3KM0A 4LOJA 3W3ZB 2AS0A 1PJBA 4R81A 3EG9A 4GZ6A 5IEBA 4KQFA 3DE1X 2LNDA 5KS2A 3DDNA 2I6TA 4I4LA 3MLAA 2OGWA 3TKYA 2C8JA 5G4LA 1Y4DE 1RBQA 3FLEA 3PCRB 1E79D 1X38A 4TRNA 4E30A 1A72A 1EWKA 1PF7E 4W6ZA 3VHXB 4KYTA 5K0NA 1KQFA 1NQTA 4DV2B 2G5GX 3A10A 3P2IA 3TUZC 3B2NA 4M0FA 3EZLA 2GTPA 1VDMA 2QRVB 3ZGYA 4BNNA 5A05A 1JSLA 2PKXA 1JSXA 2A3RA 4B82A 2VJQA 1GPJA 1XZIA 1YR7A 2ZZNA 1UINA 2OCDA 4RSGA 2SKDA 5DXJA 4WXMA 3SQNA 2YWHA 4LRYA 3P2OA 4JJKA 3NUQA 4LOAA 5FUWA 3X1XA 3SYTA 1HZZC 1FUKA 3P0RA 3CN7A 1NPYA 2IRWA 2GKOA 1QNLA 3BRWA 4GC9A 4QSHA 4Z1MD 1NW5A 3PUYA 4RLSA 3T8YA 1LKZA 2VPXA 1N2JA 3KQHA 1OXBB 2R9VA 3II6X 1NURA 5KOYA 3LSYA 3OQBA 4PZ9A 5AKEA 4D02A 1WMDA 2EKDA 2Z2YA 4OXYA 1QZZA 2NYAA 4RANA 5EJGA 2O1EA 1F7VA 1T2AA 2P11A 2X8AA 2WT9A 1UBSB 3G2QA 3KU4A 4EDHA 3MTIA 4MW9A 2VF5X 3JQBC 4WZBE 2VHXA 5E1BA 2HHCA 3DT9A 4H7JA 5H5JA 4IS2A 4MB0A 3OQPA 1CQXA 4G5OA 1D07A 4EJSC 3THOA 4ZI7F 3C1OA 1RJEA 3IQEA 5HKLA 4EPRA 1DUSA 1I94B 1JECA 4QFDA 3WKEA 1KAHA 1ZJ6A 1UM9B 1FFEA 3CLUC 1QGZA 2CNOA 2GASA 4LBYA 1JE0A 2MSDB 2Q4EA 2LRHA 3P27A 4L15A 3VNAA 1Y9JA 2YVLA 4JODA 4DLNA 4DGSA 4OQNA 1VJGA 4DUPA 3HNRA 5AHRA 1RHJA 4FKBA 3OCCA 2IODA 3OX4A 4P86A 3IR7A 3E1KA 3S8EA 3SXUA 3B6KA 5KTPA 3AW8A 2Z5GA 4FMDF 3V4LA 4MUJA 3LDHA 5EJ4A 4EP1A 3SF0A 1QXSA 1CDZA 4MOWA 3HC7A 5D84A 3ZDAA 4OQXA 5K4GA 3S7TA 3ZZMA 4C78A 1GA4A 1CUBA 3RTBA 4AWXA 1CR4A 5CCBA 2Q5OA 2UZIR 1VL0A 4M1SA 4ZC1A 3Q7PA 3ZH9B 5L7TA 2RJOA 3I8XA 1JEOA 2LGJA 1V8PA 2Z2XA 2B8EA 5E95A 1Q1BA 2W37A 1V4VA 2FMHA 3O73A 1EZ4A 4NL4H 3WLJA 4ZZ3A 4YT5A 1C1XB 4JASB 1ULSA 2IBMA 5JSHA 1BU8A 1V3TA 2QN3A 5AVVA 2CJYA 2IPMA 6ADHA 2V7GA 1BCSB 4BQNA 1A2OA 1KF0A 2O3JA 1T36A 2FUNB 2QDKA 2Y6VA 4FJ0A 2QU7A 4GMHA 4ZARA 4P5DA 5HM6A 5LOVF 1KZGB 3F1KA 1NBWB 3P0HA 4AWAA 4I9HA 4UBLA 2PSFA 4JOBA 1E4OA 2IVFA 4RDIA 4W1PA 3EA0A 3QOXA 4Q9HA 3ETDA 1WKBA 5IM4F 1DIAA 1EP9A 5AKIA 4Q4HB 1T10A 4JXXA 3PC2A 2WHXA 5AVZA 3R5JA 3E84A 5CD9A 2VT7A 1YZ3A 1I36A 1ZPDA 3G7NA 3KK0A 1DU4A 4OB6A 4R2JA 5CX1B 1KYTA 3HSSA 4RD6A 4G24A 2PH1A 4XIGS 3WNVA 1N9ZA 3EXHC 4X54A 3UEOA 5CB8A 1DLIA 1QH1A 2CBZA 3P2MA 2QZPA 3FNHA 4PLFA 5CAEB 3MRVA 3OF5A 4YR9A 4GAEA 2OB1A 1WB5A 1X7YB 5IXYA 4AM8A 1KVQA 3KJGA 2K4MA 4NZ9A 3X43A 2RBEA 3HUFA 4JU9A 1QCYA 3PLRA 4EMBA 3E7WA 3U3KA 1Z22A 2OKCA 3KB2A 4IZ6A 1I6MA 1RAIA 3RRNA 3ONDA 1NLFA 2HLDD 3L02A 4TQ9A 2JGEA 1Y4ZA 2KX7A 3M4ZA 3OFSA 3QG1A 4FZJA 4YT2A 2QW0X 1H22A 1SBTA 4HZUA 3WFIA 3H7IA 2BM0A 3ZU3A 9ABPA 4C3OB 2E55A 4TS4A 5J63A 2E5FA 2IH5A 1E3DA 1Z0ZA 1EFPA 1Z4JA 3UK1A 1PFGA 1DX4A 3M9LA 4E5NA 4HR7A 1PUIA 2WZQA 1RQ2A 3SQDA 3VSEA 5B55A 1FF9A 4L76A 3OC6A 1R16A 4EHNA 3I76A 5HEKA 4R2IA 2YRFA 5AKKA 1B4DA 1Z5PA 3ZE0B 4A15A 1ZOLA 4TKLA 1PLLA 1E64A 2DQZA 1N1DA 3DM9B 3PDIA 2Z5VA 3SFVA 3R7WB 2QIPA 1Y4UA 4B87A 1YZYA 3M3PA 1MQAA 1F2TA 3BE5A 2FF5A 2QN6A 4GLFA 4W7HA 5ENZA 1LQTA 5ALKA 1ZKDA 3W2TA 1UDXA 3I3OA 3OSZA 3V1NA 5BW6B 5B57C 3VGJA 4C7XA 3LYAA 5DTRA 2A5FA 1M6VA 5DT9A 3VR4H 4E3WA 5JHGB 2EHJA 4EY5A 4RULA 4H1HA 1RBMA 3R0ZA 4LFCB 2FGJA 4H35A 4O2BA 5L4LA 2RGNA 4S04A 2VWQA 4NOJA 4DR2B 3IODA 4IJWA 2OYRA 1IBSA 5DGDA 4ZYVA 3AKZA 3GO4A 4E21A 3EQ2A 3GRUA 1O2DA 1IQRA 1YVRA 4FHEA 4KVAA 4YTEA 4NWIA 5AVJA 4BVJA 3B7PA 5ALGA 2ID8A 1GDHA 1NF9A 4YV7A 2TMKA 1RYHA 2YJ4A 3P0EA 5IUNC 2ZJYA 4UFNA 5EP4A 1NUSA 3U81A 1VSTA 1ZUWA 1JEQA 2OFXA 3BF8A 1U7ZA 5BUZA 4H6XA 1BXGB 3WZMA 1HXHA 4IJ6A 3SYLA 3HUDA 3UKJA 4K88A 4WKGA 2XNJA 1JQBA 2O1SA 3IT0A 4D4MA 4EY4A 4G85A 1BHQ1 4F84A 4B31A 1L4UA 3JARB 1OT5A 2BSAA 4PRKA 2HA0A 1GTSA 3A25A 3OESA 1ICEA 3H99A 1CUVA 5AIAA 1RZUA 2R60A 4CJXA 2XRYA 4PZZA 5K6TA 2KSQA 4HWPA 1WV0A 1G2PA 1OHHD 2ODQA 1HDZA 1WMFA 3IMGA 3IJEB 3JQRA 3LZ6A 3I05A 1DKUA 5C2JB 4MJ7A 2OBFA 3QX3A 4B74A 3VPBA 1KAOA 4ML3A 3VI3B 3ZUPA 4B3JA 2R6CA 1JLKA 4FBLA 2BM8A 3DTTA 3OFKA 1IVNA 2FDCA 2ZAYA 2NZ8A 3GQBB 3H3XA 1ESZA 2OHGA 5TMPA 1IVSA 4PN7A 4EO4A 2F1IA 2GUWA 3E7PA 5ALQA 1HY3A 2WSBA 3GUZA 3Q12A 4XJVA 1CD5A 1SOVA 2RG7A 1FFCA 2FSSA 2ZSBA 4LJAA 3QF7A 5FKJA 1WU8A 2YDXA 3QLEA 4M60A 1USVA 4WAUA 1HDYA 4E4TA 3E2MA 3A2NA 1GPWB 5F9FA 1XQVA 2O0JA 2ZSHA 1LF5A 5D6OA 1A77A 1BFKA 2GZHA 1XAHA 3K1TA 4GEKA 2Q4TA 4V0LA 4AULA 2OQIA 4BNYA 1KVSA 4GGOA 2O8DA 4PHCA 3BQNB 1OIWA 3ME5A 3IS3A 2CWDA 1XAJA 4KXYA 3PHGA 2XXJA 4RLQA 1IIRA 3DFZA 5IP5A 4BNHA 2JLZA 1R5BA 1XEAA 4MVXA 1ZMOA 4RHXA 2C3PA 4US1R 3RU7A 4E51A 5KQLA 5IK2D 2AD5A 5KNDA 2JRCA 3DYVA 4U00A 2QOEA 2O3TA 5M2QA 2IL1A 1MJ5A 1V45E 5EE3A 1Y3AA 3OY7A 4L7VA 5J5CA 1G59A 2HRQA 5I7UA 4RXMA 3RVDA 1WZEA 3LFUA 5J4HA 4YPVA 3A6PC 1WB9A 5DO9A 1U6IA 4UU0A 4H77A 2B20A 1TNDA 3GVPA 4ESOA 2VUSA 4PO9A 1E6LA 2XAAA 1I5RA 2XQIA 1G21E 1MR3F 1UQTA 3VPGA 3IP9A 2E3JA 2YL2A 1QOQB 1RR6A 1RYDA 1SGWA 1TADA 3BGSA 4QNRA 3I2JA 2FPUA 1RHMA 1VE1A 4OHFA 1EBFA 5C8YF 3MWKA 3FOWA 4YVFA 3F8WA 1LVHA 2P9TA 3PXXA 4OIFA 3FR8A 5ILGA 1FRQA 1Z35A 3RJMA 4BHTA 3FOFC 1WEHA 2D2EA 1DG3A 1XMQB 2C3OA 1QANA 2WIFA 4BQFA 2BHRA 2OORC 5PNTA 4I3HA 5BR8B 5L6LB 1LU9A 4R1SA 1Q92A 3ILVA 1FSGA 2J5XA 2PMWB 2QN9A 3K6KA 4UHBA 2P6MA 7MHTA 1PZEA 3TNJA 1OU4A 1HYEA 1Y1KE 1UMBA 4WY8A 1SC9A 1X1SA 2G9UA 4P3XA 4J3NA 3W5IA 3EIOA 3ZGNA 5DYYA 1O97C 4PS1A 4YMSA 4D4JA 2HD4A 4GHWA 4Z7QB 4X1IB 1NE2A 1UK9A 1B16A 4LWPA 1W96A 2HY7A 2V5UA 2WD7B 3I0ZA 2YZ2A 3GRAA 4JP2A 4WASA 3OQNA 1U0OC 2Q45A 5HNKA 4IAOA 3EXG1 2DR0A 4N8EA 3HEMA 4B47A 1PVOA 3D43A 3KJNA 5EZQA 5AI8A 1KDVA 2UXBB 5KJCA 4IIBA 1UOOA 2VPZA 3AFGA 3GJYA 3KLMX 2NSYA 3CR7A 4YK7A 1A9OA 1MTOA 1WMEA 2K7ZA 3DMTC 3OURA 4YYZA 4C0KA 1NHGA 1GCOA 5EJ2A 4A82A 1UPUA 5B1IA 3NFYA 1ZHOA 1V7PC 3WB2A 3ANNA 5HDQA 3PVSA 1NMYA 3U9LA 3AM1A 4PFJA 1Q7BA 4IJ5A 3R3SA 4DM4A 4E15A 1L8OA 2P6UA 4ND1A 1PL8A 3ROQA 4EF4A 2PCLA 2FMFA 1Q19A 3GNLA 1UMBB 2ACVA 2GBLC 3L8YA 3RO7A 2D0IA 1Y5NA 4LJ6A 1EK6A 3OZAA 1O77A 2EL7A 4XR9A 1SUBA 5E9QA 5C1BA 3V4RA 4BZQA 4Q9JA 1IY2A 1ND6A 2PKQO 4EG7A 4F3RA 5DN9A 4L8YA 2J32A 3NWJA 3FMFA 2VAPA 1ZUHA 1NE7A 1L8XA 4FYKA 3SI7A 4BBZA 5TARA 1V5IA 1XWWA 4RA9A 4YXWA 3MCUA 4P4NA 4RSHA 1ODKA 3DLTA 4HRXA 2NU6B 4AJKA 1DDOA 2DULA 3IE2A 2DBVO 3GNQA 4DILA 3BPSA 3UCFA 4K81B 2B3TA 1CY6A 4K9PA 4JC0A 3TIVA 4O4LA 3DNPA 4CKEA 1TYAE 1AKEA 1BE8A 3B5EA 5HCIA 4AW9A 1Q16A 5I45A 1AB6A 4R16A 4F7WA 2BR5A 1Q2XA 1X7ZA 2DYKA 2KQUA 4C6RA 2Q4OA 1W0JD 4TS1A 2RC5A 5AM0A 3RIGA 3TVTA 1U1EA 4EF5A 4ENSA 4JB0A 2Q5EA 1MHTA 3SDBA 4Q3CA 5KWVA 2HGSA 4RX1A 3OIYA 2VQSA 3SC3A 2PSHA 2A86A 2ESRA 1SBYA 5I9IA 3ZD6A 3QXCA 4ND5A 3DCJA 5EP1A 3GVHA 5AK3A 5FI0B 2QGFA 4L0CA 5C37A 4K1LA 3N2LA 1B6GA 2V7BA 1G1MA 2QR5A 1XCBA 3NONA 5IM4A 3E9CA 2C2HA 4M7PA 4JHLA 5IUKC 3VH4A 1VXRA 3ETEA 4LMRA 1QGUA 1TM2A 1YUBA 3JQ9C 1SUPA 4NOKA 5DKFA 5IXSA 4HTAA 2PLWA 4I5IA 1HNNA 1WUYA 2JCSA 5EJ5A 1JLLB 5KSYA 3B2EA 2W42A 1MRNA 2F55A 3I5MA 2NT3A 3ZE2B 4E7OA 4RHCA 4D97A 2QG4A 1TVMA 4GC5A 1AUQA 4HXGA 1BVHA 4LZAA 1EFKA 5IK2A 3LG2A 3HABA 1EP2B 2RKBA 4HH0A 4JVSB 1P5ZB 3DOFA 2DU8A 5H81A 1Z7EA 3PIRA 4CDMA 4HNSA 1MAAA 4BLTA 5IDXA 4PO3X 2RHRA 4QEKA 4BMXA 4CMGA 1W5AA 4LJ7A 3AHIA 4POAA 5I7VA 4HNVA 3PQEA 4P4SA 4DSZA 1QP4A 3ZV5A 4IOJA 2FK7A 2B30A 4QD3A 1OPXA 2TRSB 3IO5A 4YAEA 4ZCRA 5CW2A 4UDOA 5MDHA 5D51S 2GVNA 3IIEA 1KH1A 2H63A 1B6SA 3LP8A 4YMLA 1D7OA 3ZJVA 3ZWMA 1C2YA 1R3DA 1UF9A 3GJ6A 2W90A 3LP5A 3QU2A 3RASA 3U1BA 3WL7A 3J7TA 5BN3A 3E9YA 3IO3A 5BSTA 2V96A 3SP1A 1HNWB 3H7AA 4H7HA 1MHPA 5BSRA 1BXGA 1QFSA 4Z0TA 4JIGA 4HX5A 4U0JA 4BDSA 4WDRA 2AD1A 3CJQA 2IYPA 2CGEA 3EVCA 2FW0A 1F6DA 5LWHA 1KZ7B 1I4OA 1UOQA 2BZ1A 4P9NA 2JFNA 4XVCA 1IAQA 5C81A 4F5DA 2D2FA 3S1AA 4C43A 2HAEA 2XQGA 3F78A 4KR0A 1B6RA 2EF0A 3BIOA 3K73O 2ZZMA 4UCXA 3GG2A 2JA2A 2Q1TA 4KFTA 3BQ9A 1CXZA 3FRJA 3ZXYA 1A98A 2UYYA 4XR4A 3NBZC 4Y2RA 4IVNA 2Q50A 2FZ4A 1VKHA 5FWYB 4W6QA 2Q3LA 1DQPA 4WZBB 2DPHA 1OXUA 3LX4A 2PH3A 1XFAA 5C3UA 1SXJC 4PINA 4CDRA 2K5UA 4RK4A 3KTDA 3Q87B 4JIMA 3M6UA 4UVIA 1NYQA 2H1CA 2QVLA 3N6RA 4LYDA 5K3AA 1QLWA 3ZWKA 2HLNA 2WWVD 2BKLA 5KPJA 3X1ZA 3DVQX 3P97A 3VSAA 3G0BA 1UBMS 2E82A 4N0MA 1TLLA 2BKEA 1GL9B 4B76A 4XTRA 4HTFB 2VZLA 4IICA 4BPRA 2VQEB 1U1DA 4L9WA 4QRIA 4D43A 5T6BA 1EDZA 2GLXA 1EFPB 1R6BX 1ZUNA 2G6TA 2NWQA 2VHQA 3C3YA 3GCZA 4M0DA 4M9SA 4BNMA 4QHYA 1CF9A 5IBRA 2ZIXA 5A7GA 1GL3A 4A0FA 3EE6A 5LMCA 4RZHA 3WGMA 4L4RA 1V9CA 3ZVLA 4A2CA 1V41E 4INPA 2GCOB 3B5IA 3C3WA 3C14C 1HQCA 4HWGA 3T95A 5IYZF 4C2UA 5JCXA 2O2EA 5DNYB 4P34A 1Z4MA 1JHPA 4ZCMA 1MCZA 3IHKA 1KYIA 1X8JA 5FYQA 1E2UA 4F45A 1NBMA 1FDSA 2P3OA 1AHNA 4RDHA 2BFEA 3KUXA 3B8HA 3RBZA 4QQRA 1KSHA 4OF4A 4MW1A 1ICIA 4DG5A 3OJEA 2CYCA 1Y7IA 2AMJA 3AG6A 5CMLA 1QH1B 3D8HA 4AWBA 3GZJA 2WTNA 3T3HA 2VJCA 2I2XB 1ZM7A 3O26A 1D0VA 3JS5A 4DTCA 1PR6A 2VT6A 4DN6A 4DNQA 4KWEA 5EJ7A 3SIXA 1ILEA 3TB6A 1XRRA 5FHRA 3VTKA 2OFPA 3LWZA 1OWLA 1MIOB 1ZSNA 4FW8A 5G3YA 4EJ0A 2W6ZA 4PLYA 2EC5A 1AHPA 2OCPA 1FVXA 2H2WA 4TMXA 4YBZA 2ANCA 2WU8A 1ONSA 4EGJA 2CXTA 5KWEA 2ZM5A 3QEKA 1R0BA 1G5HA 2VYFA 5J43A 1J06A 1M5RA 3AOGA 2NQ8A 4U3JB 2FOIA 3CWQA 4BN5A 3EH1A 3BJEA 3OMXA 2CZQA 2ZSKA 3IP1A 2B4QA 2EU8A 3LNCA 1XNRB 1YE8A 1C1XA 1R3UA 2GN1A 2WG1A 1PL7A 2WV9A 3C5VA 1T9KA 1O3YA 4HLCA 2DR3A 2KB0A 2OB2A 3DLPX 3OC0A 2C7OA 1V11A 4JGBA 3MOGA 4KPUA 4Q6WA 4ZU6X 1G20A 1LK0A 1VPEA 2FDRA 3EWAA 2G4VA 3QIVA 4B6OA 1LQUA 1N5MA 3PICA 2AN5A 3MMXA 4I1IA 1B2RA 2BSXA 1FUEA 3ITDA 3V1LA 3VR6H 2AN4A 3FYDA 4MGEA 5CYFA 4N3NA 3M34A 2OXIA 2IHKA 1NULA 1PUJA 4P38A 1SHLA 2AH5A 2BIFA 2C3YA 1E2IA 3ZU4A 5C7OO 5CLIA 2V7EA 3IA2A 1RMQA 1G6Q1 4UC0A 1TU0A 4Z1MA 3RYHA 1RHRA 3Q7QA 1NVAA 2B2XA 1JVNA 2R44A 3IQGX 1GD1O 1ETHA 2EJTA 2IYFA 3NETA 2OENG 3OOWA 4NE9A 1O03A 1W85A 4QODA 4BJ1A 4F60A 1SO8A 5G4KB 5JBQA 2LCFA 4JHXA 2I29A 1FDVA 5CVEA 2EQ5A 121PA 3B38A 3BS4A 3HCOA 4D6XA 1YDHA 2BH2A 1G6HA 2IZ5A 4NIMA 2JCGA 2PD3A 3EUAA 4N40A 4ZPJA 1J5EB 4M8NE 1XCMA 1W93A 3B48A 4N8DA 3G2OA 3WKCA 4ID3A 1OA0A 2J6CA 2VYNA 4FFBB 4P83A 2Y1EA 5G4KA 1C3XA 2QKYA 2YWGA 4EPWA 1G6OA 3U7HB 3S2SA 3CEAA 1CZOA 3SQXA 2CEKA 1EM8A 2RGAA 1I3KA 2EQBA 3D3WA 4J75A 4RETA 3RS7A 4HVCA 4K3VA 4AMGA 4KWIA 4R0NA 2WK1A 3LUJA 3DDCA 2Z9BA 1HYHA 2DUWA 2QX7A 2RI6A 2JGFA 3DLIA 4ZVOA 3T7RA 4I19A 4MVWA 4K0KB 4U7PB 2IS4A 3TECE 1T35A 1P0FA 4PANA 2Y99A 3PJFA 3RSCA 3ERCA 4H18A 1M1NA 1RD4A 3RDPA 4NXNB 4Q4JA 3OE7A 1U3GA 1NU8A 4LCJA 3U7QA 4UHFA 5SYMA 2IXGA 3C39A 3H75A 4OBWA 5JWRA 3LUAA 3GJTA 3L6RA 4MKIA 4AYTA 3VDXA 4E07A 3IIKA 1FNCA 4PQRA 1T0JB 3GLFE 3AIMA 4H6PA 2X13A 5E9AA 4LJ5A 3ZWDA 2QS9A 2A9VA 4UM9D 2ZT5A 1XVAA 1FXUA 1Q7RA 4L27A 2WF8A 5ECDA 5BQ3A 3TL3A 2OZLB 1GEGA 4X7MA 4BP1A 1AN9A 2BF4A 4MNTA 1O58A 1QTQA 1RSZA 1OX4A 4Y2TA 3RBVA 5LQMA 4KWCA 3K3PA 1I4DD 2NPIA 3Q3GE 1N9GA 4M49A 5DNDA 5JTTA 3HHPA 4OUKX 5BORA 4MQ4A 2ZRAA 4W5JA 3Q8LA 4EVIA 3AOEA 4RCZA 2ID9A 2NU8B 3O8RA 4FEAA 1T2CA 3H2ZA 1KR5A 1P1RA 4WVFA 2CF5A 2VZ0A 3VTFA 2AJ8A 3MLEA 1J9ZA 2Q7XA 3FIJA 5C32A 1I3NA 3F9RA 2YFYA 5BMVA 1UT8A 4HRVA 5A04A 1YDMA 1Z12A 3AUUA 4MRMA 3CUTA 4OHZA 4CM1A 3LLCA 3U7RA 2Q4DA 4PC3A 3CJRA 3GMSA 3SDZA 2SKEA 4WN9B 3UAWA 1H05A 3HCFA 3M6VA 3SNHA 2AN1A 3L43A 1TMOA 2PO5A 3PXAA 3L7KA 3F90A 4YJHA 3PTAA 4G0XA 5F9MA 4RS4A 2DUMA 3GD5A 4OHVA 4FDMA 4N4AA 1JR4A 2BPOA 3PDHA 4WKCA 1KC1A 4HT3B 4CGYA 1GTJ1 2CXOA 1V3UA 3I04A 3NV9A 2G17A 4KH1A 5THQA 1E6WA 2QMZA 2R6R1 1G6KA 4G6ZA 5C53B 4EO9A 1PR2A 1Z0FA 4FB4A 1E9EA 2WU3A 3DFUA 5LNK6 2ZIXB 4BVGA 1G3MA 1YI1A 1Q77A 2JFWA 5ARCA 1ML4A 4DNOA 3PRYA 5D1HA 2V8OA 2C7BA 1DQSA 1GRVA 4NCXA 4Q24A 1AE1A 1S0UA 5G2OA 2D1FA 4F6RA 2X6TA 4DMFA 5EJAA 1EFVA 4X3CA 4C87A 2QVGA 4R1PA 3EVNA 4ZMSA 3H05A 4I1SA 1LS6A 4CWAA 1E6CA 2PH7A 1RIFA 3AZQA 2ZKLA 4MINA 1V47A 3VR1A 2MMCA 4LYJA 2POQX 2V7VA 1UBUS 2RAFA 4PGGA 4RTQA 4BBPA 1C1DA 2XUHA 4ICIA 3HKEB 1IB6A 2F3RA 4R2LA 2ZWOA 3KSBC 5BVGB 3WTBA 4C5AA 1T26A 1ULBA 1XRJA 3OE1A 2O8VA 3N6XA 1XCOA 1R8QA 4FMCB 3UAXA 3VPXA 5JDCA 2R751 1QGDA 3MTBA 4UJ3A 3G85A 5DW3A 2AG1A 1X80B 1BTOA 2G9QA 3F6EX 2ZDHA 2DFNA 3NBQA 2VQDA 5H1YA 1KI9A 5IASA 3TQQA 3UY4A 4QPZA 2OCKA 3I6IA 3R5KA 4S1NA 3E2PA 1K0UA 4GGPA 5K8UA 1WF3A 3O8OB 4KPFC 5CX4A 4AS3A 2XTNA 2EJCA 3MMPA 2HCBA 3IUYA 4ED9A 5BQXA 1OH5A 3ZDDA 4YP9A 4KR3A 1ZD2P 2XE7A 3GT7A 4DMMA 3C98A 5CA1F 4W5QA 1BOFA 2J08A 2EXXA 4UFPA 3MT0A 2JLXA 2CL0X 1ZBDA 3FDJA 2VVTA 3JYQA 4L0DA 4XM0A 1A04A 3PFNA 4PM4A 1XLUA 3W8DA 5CBKA 2RD2A 3SF8B 2CJFA 3LFHA 1CS0A 1V3QE 4DSOA 2VJLA 1DZ3A 3R3YA 3ZGXA 1WU7A 2I8CA 3U40A 3S2YA 2EKPA 1Y5RA 3H2BA 4WLVA 5D2CA 5CK5A 4A1FA 1TLFA 4RKFA 1OI2A 1XMPA 4MCJA 2QNRA 1JPNA 1TU4A 3F7MA 3BD6A 3HP1A 2YJ3A 4OHYA 2AXQA 3I1JA 5EUBA 4V1CA 2P4SA 3OICA 4L5IA 2AOTA 1YAHA 2C9DA 4X8LA 4ZKDA 2QQ5A 3KLPX 4X8HA 3SFTA 3U3ZA 2YFKA 2O2GA 3OH8A 3RTAA 1B8NA 2DFPA 1FYEA 1UFVA 4ARVA 3QA9A 4ZAFA 2FW8A 3EF3A 3VMFA 4RPHA 3L0BA 4KB5A 3O84A 1E6MA 3T06B 4E31A 1UXGA 1J8QA 4FPXA 2EX4A 4RMGA 4NONA 1UOPA 1YQWA 3BXOA 5DGXA 3RFUA 3MUOA 5F4ZA 2AVNA 2H4HA 5FUBA 1RRFA 2CLOB 3LUDA 1DKRA 1JDSA 4PIVA 3DWGA 3AG5A 2FB9A 4AJHA 4YWJA 2VZ8A 1A9SA 1DFHA 2Z95A 2YOFA 4LVNA 5JS2A 3UQZA 1BRTA 5L3QB 2WB2A 1XVUA 4BO1A 1Q0UA 1EZ1A 5ALSA 4M9RA 1CLEA 1ZN2A 3CC8A 4FYHA 5KSZA 3INYA 3DYIA 2W2LA 1E0SA 1JFFA 1U2DA 3Q6MA 1SC6A 1M76A 1O4VA 3OP1A 1KMQA 2GN2A 1LJ8A 2W43A 3CZPA 4HY3A 1J42A 3QKRA 3T5BA 1QTIA 2JHPA 2VA9A 3WYAA 4J0CA 3M2TA 3ZYZA 2JJYA 3C8ZA 5JS6A 5K8IA 1VSUA 2F8MA 3HKEA 1XPUA 1LVGA 2W2KB 2QK4A 4BMYA 4MV6A 5SY9A 3E4CA 3HFJA 1IULA 4J29A 2XYGA 3AIOA 2VJBA 1H2FA 3GK3A 3LYLA 4URFA 3D7SA 5E2IA 4X64B 4BVBA 3THXA 1JA0A 1MOSA 3K2QA 4DLYA 4F9GA 4O4LB 2SNIE 3DS8A 1II9A 3H0KA 4MDYA 3KQKA 2GNPA 2BFNA 2VYVA 5T41A 1YZVA 4XWWA 4PC7A 4N7RA 3AI2A 4XE5A 4FOPA 3NAMA 2QD3A 3W04A 4LJLA 4GPBA 1NOKA 4IR7A 2IKQA 4PPGA 1V8FA 1P2VA 4QBKA 1ISSA 1MC4A 2DLNA 4HUQB 5G1OA 2AQHA 1YONA 1W9MA 4KRFA 3LQQA 2D0DA 1JFLA 2NVWA 1WXWA 2IS6A 1LZKA 2XRZA 3E23A 2PSSA 3T3IA 4QL3A 2JHAA 2BGIA 2X3UA 3PJRA 5K5EA 2CLKB 3MCWA 3RV4A 3SVLA 1WUTA 5A5DA 3ADDA 2W8ZA 4IP0A 4W1QA 5KB3A 4CT5A 1PNTA 2B8TA 3EPHA 4WN9A 1RWBA 3EWIA 1SHTX 1FRFS 4F21A 4YO7A 2IYRA 2H17A 3AUYA 1F9EA 1KZ6A 2OZPA 4TWRA 3WSTA 4KI0A 4F92B 3WOVA 4I55F 3NV7A 1L9KA 1B93A 1N2OA 3OSUA 4X93A 4WK2B 4M22A 2J46A 4X61A 3OIWA 1PBTA 1LC3A 3FHOA 2VBFA 3LKBA 4LTMA 4D79A 1GNTA 3L7LA 4CUZA 2WWHA 4DLXA 5GM1A 5K8TA 1V7CA 3CVXA 5K4AA 1G8GA 3UCEA 1MGPA 4GRDA 1S8FA 4V03A 4E5MA 2CFOA 3SFZA 1YMVA 2XYHA 4Y9SA 4YA6A 421PA 4F46A 4GECA 4DCTA 2MSLA 2JH8A 4J2TA 1WDKA 4PSKA 4YI3A 4AJPA 2HSGA 3IBGA 1F5SA 2XWPA 3E48A 3UJ8A 5IRCD 2A9RA 1KDOA 5MFPA 1S7CA 2VBCA 4Q7EA 3FKSD 1P7YA 3OZSA 2RHHA 3ZQJA 5IVHA 2WEKA 2IP2A 3CZRA 2GAOA 2PZAA 2ZE5A 4PVDA 5B4TA 3ZJUA 3NBXX 3MGAA 2CDCA 2ADOA 3TW6A 2D8MA 5KX5B 1ZD5A 4C3UA 1TKCA 1ECCA 2IU0A 1WUHS 2HO5A 4BO2A 1U65A 2XKJE 1KZ4A 4B9AA 5AWFC 1FMCA 4QPPA 1H8HD 2J9GA 1FUUA 1T6XA 4RL6A 2VNIA 1U6JA 1EEXB 3L4SO 3PFCA 5KAPA 3L7AA 3H65A 1FNNA 1E5LA 3JATA 3FLMA 2HH9A 1GG9A 2R1TA 2IHVA 3T5PA 1DWPA 1T4CA 4MQBA 3T0FA 1YVDA 3E8SA 2IV7A 3HP4A 5DW0A 3JD2A 4DR6B 1P39A 2BFMA 4BGIA 3SZMA 1V95A 5FXMA 3WYEA 4FFWA 5CPBA 2M2IA 1GZDA 1TZJA 2VZ9A 3GROA 4CR6A 4M55A 2AEMA 5MFZA 4YPFA 1XZ8A 3SR3A 3VZRA 3OLWA 4HWOA 4HYTA 3V8QA 4EHAA 1UZAA 3GXOA 2IDJA 3WWYA 3UA4A 1YZLA 2FY8A 4IVPA 1P1CA 3LT5A 2QZZA 4DV1B 2ONZA 2ZSJA 3TZEA 1P2TA 2RC6A 5H02A 3RYHB 2D13A 4JJ4A 4MWZA 5JSZA 4RTPA 5ALMA 1MD9A 1VLZA 4NZNA 5JNWA 2A6PA 4AQ7A 4TQUS 3HCPA 3JQPA 4ZVKA 2L17A 2HADA 3G89A 3G9UA 5DHQA 4ZAGA 3HFGA 4GXTA 2DCUA 3BBLA 4FU0A 3T0GA 1EX6A 2DF8A 3IULA 3PTLA 3PC8C 4WJKB 3LXRA 4MA4A 5HVNA 4XD7D 1NBME 2JBHA 4X97A 1YUNA 1ZNWA 1F2VA 4MVJF 4XFJA 1SELA 1DMRA 2PBLA 4IXNA 1EA5A 3BMNB 4LC1A 4BVAA 3ROKA 4KNYA 3I5YA 4AYXA 1PWYE 2QW1A 4OY3A 3VAYA 2CW5A 3W4IA 5J23A 1AGYA 1AT1A 1O1YA 2GX6A 2OXFA 3QFFA 4TYQA 3ZDFA 1ZXXA 1WTAA 4FHFA 3KZMA 3WIOA 4E6PA 5CNMA 1G16A 1LFAA 1JG4A 3TSZA 4C9BA 2YR0A 3BH0A 5IVPA 1SCNE 4EELA 3CWZA 3EIUA 1YWGO 4O59O 3W3AA 5EQTA 3U0VA 4CETA 1UFOA 1JMYA 2HCTA 3RU9A 3W4KA 2NZWA 4XB1A 4EHDA 2I6SA 4NAHA 4BJ5A 1T5HX 4B32A 1JP7A 3WRYA 3ZWOA 1XMOB 1YQUA 2HC9A 2AG0A 3KSZO 2QPLA 1SXJA 3T9AA 1OYOA 5DOVA 4G3XA 5AI5A 3H5TA 2R84A 4M38A 4OQQA 2W71A 4QGGA 4OG2A 5LP6F 5NULA 1FNBA 3Q7TA 5IEJA 4M1OA 3KYJB 4B48A 1SCBA 4MJXA 1G3UA 3U1TA 1RPZA 4DCPA 1II8B 5JRDS 2QMUA 4GKJB 1M6WA 4PG7A 4YYEA 3OM9A 3ZWXA 5LMZA 3RUEA 1JEDA 2BC9A 3H42B 2ORED 3KAPA 4LZZA 3LT1A 3L6EA 3W1VA 4YRNA 3IUNA 3L0CA 4ZQIA 4DDTA 1M6VB 4A0GA 3SJCA 2Y66A 1RQGA 2DTXA 4HB2A 4NARA 2VKTA 4HQLA 3QF4B 1XAIA 1Z88A 2GCOA 5JDIC 4C76A 5HE9A 1V25A 4LGMA 1IN1A 3SS9X 1E99A 4ZJPA 2VNJA 5C80A 1UH5A 4QTYA 3GJSA 2WMDA 2RONA 3Q9NA 4ZTBA 4ZJUA 5JMOA 3U6BA 3DTVA 2HMUA 1LLCA 2JZNA 4JI1B 1AKYA 1N5RA 1UPAA 3CURA 5F2OA 3B13B 1XU7A 2XYQA 5CGZA 1TZMA 2X8JB 4YHBA 1KZHA 4DLLA 2DECA 3K9BA 3O4IA 4M7OA 2ZS7A 2FI1A 3RC3A 1MN6A 3G2LA 2I7TA 4MVJA 4DR4B 3COWA 3DTVB 4TOIA 4MUHA 5D5QA 2J7KA 2WJHA 1HKHA 1KEWA 1Z17A 3QITA 4OKNA 3URKA 4AVYA 1G4HA 1GNLA 1KJWA 1M2JA 3IXMA 3PTZA 4OP2A 5E8JA 5I7OA 3NGLA 4CLDA 4B3FX 5JISA 1LI5A 2EX1A 3VU3A 3MGBA 1HETA 2G08A 3DOEA 3KQTA 2AFIB 3P9RA 1SVWA 5CLGA 1E1LA 2FSIA 5ITSA 5JFGA 1YIAA 2XXAB 2Q2QA 1KO1A 4GOMD 4R9SA 3SMVA 1QIHA 1DEAA 1E1QA 1GUFA 2ZYGA 2I3BA 1U0FA 2IJGX 3FFXA 3NALA 4D0SA 1VKNA 4FLFA 3VH3A 1M2GA 1IXRC 2PGDA 2XCLA 2YFQA 3CCCA 3TBFA 4L28A 4DBVO 3NHLA 4ACAA 1G8PA 1ABEA 2HGZA 1I14A 2GI4A 2JPDA 4QOHA 5K03A 2W93A 1ORTA 4Q9KA 5EGSA 3H2GA 2EARA 5B1SA 3Q5EA 4NV0A 4EARA 4Q4HA 2D5IA 3OUUA 1D4OA 2BGJA 3Q7SA 4WK6A 4D5GA 5J4VA 3J7AC 1GQQA 2VNHA 5HFAA 1FFGA 1NNLA 3IVAA 4U6NA 3VOTA 1T36B 3KEQA 3FX2A 3NDBB 4B44A 3TGLA 3ZWCA 4NDNE 4GVLA 4GE3A 1BOOA 2QIOA 4UNPA 1KSGA 2QL6A 1APBA 3H1PA 1JN0A 2WTEA 3HCDA 3RS3A 4HDSA 2QRUA 4KQ1A 4ND7A 1SKBA 4EIWA 5K20A 1WABA 2C7RA 4YPOA 3N86A 3T35A 1IUNA 3WIVA 4B3XA 5DSTA 3PUKA 3S99A 5KCZA 1TTTA 1ZIOA 4OLJA 1BX1A 1YR3A 3BMNA 4RTKA 3T12A 2HCFA 5A4KA 3BGIA 1JLSA 1EK0A 2QMQA 3FVVA 4TV8B 1XUOA 5DNAA 5FWNA 1VJRA 4FM9A 1WUJS 4DR7B 1CQZA 3WGGA 3P9XA 5EIWA 3DR5A 4RDCA 2I1LA 4IHJF 4CN8A 1KVTA 4DNXA 1OX5A 5ES3A 3SBDA 4YO8A 5JAQA 1FMLA 3L7BA 1VB5A 4KQHA 2QZSA 2ZT8A 3E35A 3NHBA 3USES 4JKIA 1RLUA 2C4VA 4QUDA 3VU1A 5JNSA 3MSCA 3D7NA 3OCUA 3AB3A 1QGUB 3PQFA 2ZYSA 4OJMX 4REOA 2XCQA 4HL6A 1GV1A 1OZAA 2H5JA 3UGTA 3SIPA 1FLAA 2FPWA 1XWFA 2V7TA 4IUYA 1KEZA 3BWXA 4F8YA 1WLSA 3QZUA 4PSVA 4QM7A 1UM9A 3RC9A 3EGWA 2DRIA 2G4LA 2AOWA 3AIIA 3NHKA 1O0BA 2HQBA 1DG9A 4TMTA 4C04A 1HMYA 2AFHB 5H59A 4C4OA 4MICA 4CE6A 5CURA 3V32A 1KMHB 1C9NA 1R0KA 3W6OA 2XUGA 1TCAA 5A0FA 3RK1A 1J8MF 1KI1A 1YJCA 3ZYCA 2JFUA 2VI5A 4LYYA 2DPGA 1SNYA 2VAMA 5AVTA 2HJWA 4N9WA 4P4UA 4H59A 2RK4A 4MULA 3AU9A 5LC1A 1Z16A 3TFWA 2W6ID 4HKTA 2VHYA 3B85A 3T94A 1BCRA 2DP4E 4NJOA 3H9CA 4Q3BA 4YV0A 5LZ7A 3SICE 2FDXA 4G5HA 1CR6A 3H2IA 1KP2A 3RVBA 3DWFA 3ITNA 4HEJA 3W9BA 3VJRA 4IJKA 1N25A 3AUTA 5FOVA 1T1JA 3TUIC 1H3EA 2HBRA 2NU6A 2H1VA 3HG7A 2UUPA 4OK5A 2BELA 1FYDA 1TC1A 3PGXA 3QY0A 5JXHA 3NANA 2CD9A 1FS5A 3L01A 4U63A 2E5LB 5AW7A 2CNNA 3LTEA 1X87A 2GS9A 3L49A 3OJXA 3EGCA 1SU6A 2YWEA 4O8CA 2QRVA 5DWVA 3K7EA 1I51A 3T7DA 3TTSA 2PIAA 4DV4B 3DT8A 1AGNA 1RQNA 4K6HA 4JOCA 4YRDA 5L6MB 1QBKC 4LF4B 4LZWA 3KJFA 3IIJA 1MO6A 1O95A 2PX0A 1K63A 4RZXA 4PCLA 2ATCA 1P1FA 3R4CA 1YHNA 1II0A 3C3CA 2C3MA 1R6VA 2QHXA 2ZWMA 4E4YA 5DH9A 1IHPA 1YHZA 3GDWA 4MP8A 2L18A 3I0MA 4XEUA 4HV4A 4NV1A 2NZVG 1KS2A 4FSXA 4LC0A 2V98A 3H1AA 3SQMA 1YF3A 4K2AA 4FCWA 5TT0A 4P92A 4FE3A 4KMRA 3OEEA 5CA0A 3MF4A 1RQ7A 2LV8A 3H86A 1S4MA 1X7WA 4G5YA 3VPSA 3G2HA 3G59A 1YA8A 2VYVD 4PGAA 5DM4A 1N4AA 4WKBA 3TMYA 5H8WA 2ZJFA 4WY5A 1YDFA 1YQXA 2HWYA 2ZCUA 5IHPA 5DX0A 3T1OA 4FT4A 1EDBA 1FTYA 2FX2A 4LHXA 3CB2A 4GGMX 4HUTA 1D7AA 1E0JA 5K6AA 2I62A 3K70D 1TF2A 3PNQA 5K6RA 5H3LA 4FW9A 2HQSA 3E1GA 3KPUA 4G1VA 4ISBA 1X9GA 1EM6A 5GAJA 1QHIA 2JJ8A 4PC2A 3PR1A 1DCKA 3TD6A 3ZWYA 4A8HA 1YZGA 4DM3A 4DLKA 4W8HA 2ACWA 3E5MA 5IBQA 2NZYA 3L8GA 3I45A 1K4MA 1TIPA 4KIUA 5DYIA 5JCJA 5KSOA 1SCQA 2ZEJA 1SUFA 2MIIA 2R7KA 3MWLA 4RZIA 2H8KA 3NAGA 2ON6A 4UTOA 5FO0A 4FXOA 3W90A 2XSZD 1J2JA 1N6LA 4C06A 3WSVA 2CCJA 2QLMA 2C4TA 4MUFA 2RHLA 4G0PA 1EFLA 1VIMA 1IOWA 3KDPA 2XDWA 2PZLA 1KBZA 2XY4A 4G86A 3GCWA 2FPOA 2XQFA 5L4SA 4BAUA 3RIXA 5AKHA 1BNCA 5JJLA 5BSUA 4UHJA 5BO5A 3FPFA 1NBMD 4CM4B 4NU5A 2PMCA 4GMXA 5JNLA 3K30A 4E5DA 3OA0A 3H9QA 4RTSA 2VWGA 4FR5A 5KWSA 2YY7A 1QRUA 4BU1A 4B71A 4RGQA 3R7AA 5ALHA 3U17A 1SXHA 2VSOA 3UGQA 2XMPA 4HRAA 3B53X 3MBOA 3PNMA 3QKRB 3ZWBA 1DJOA 2AFHE 2HA7A 1HDIA 2VHUA 2WWXA 3EVDA 3KR9A 4OHPA 2BL4A 2VG8A 4FFMA 1F8FA 3REQA 4GS5A 2QZJA 1RI1A 2HK9A 3V8PA 4R9UC 1ORWA 2RH9B 1BXKA 1YKSA 3FOAA 2JRLA 1FB5A 4GF5A 4UNRA 5JS8A 2DJ5A 4FR2A 3ZBPA 4WXEA 3NUGA 3K9QO 2HPAA 3FUVA 4OH1A 5F2EA 3V6MA 4YRKA 2C04A 3FF4A 4PSUA 2CV2A 2O8FA 4YQYA 3VX4A 3R74A 4E5SA 4EA8A 5TIIA 1C50A 4HWSA 3LY7A 1M3SA 4R9NA 3F2VA 4FINA 4Q7QA 5F5LA 1WE2A 2PKQP 5G0TA 5HQJA 1U2RA 4NCKA 2C4WA 3S28A 1XEXA 2RI0A 4HI0E 3D7LA 2HMWA 1TQ4A 1JR6A 1YJQA 4KGZA 5AW1A 3WWZA 1QG0A 4AN1A 5C8XA 1DX9A 2A9OA 2Z5FA 4OUDA 4CI9A 1PSZA 3LI2A 1WMSA 4KR6A 4NP6A 2AJCA 3LBHA 2GERA 1BKYA 3A4TA 4B7UA 3TE7A 3CU5A 3R23A 1YOVB 3PBKA 4J4TA 3ZY5A 1E3QA 4QUBA 5I9SA 5GZ3A 1OZGA 3DDSA 4YMVA 5DOZA 2EFGA 1GZUA 1G5QA 2FSHA 3O3OB 4QTUB 2VSNA 3UFXB 1WMBA 2BV3A 2HLPA 4DZTA 4BNGA 1GG8A 3AVQA 1J1UA 3WRXA 3K71B 2ZPTX 3TGPA 3E3MA 1H1LA 4O29A 4TVBA 5HP4A 2WIDA 1ZM2A 4AJOA 3JTEA 4LXQA 3WOHA 2VHEA 3BSSA 3C16C 1SRRA 3JARA 3SJZA 1X9IA 5JR3A 3HJFA 1K27A 3HU5A 3IUMA 1C7FA 2XIQA 5C4MA 3IVXA 2Y93A 4GRAA 5JV5A 1GZ4A 1OE0A 1TYEB 4ARZA 1J22A 1PNOA 2MSCB 3P0JA 4GI7A 4R7TA 4YAGA 3ESCA 1Z29A 1KGDA 4OSEA 1L5HA 3RS5A 3CGGA 3U4QB 4EF6A 3BCHA 5TRTA 3ORRA 1UMDB 3L1HA 4BC0A 2BI7A 4D3YA 2Y0DA 4FSHA 1FNSA 2Q0XA 4KBYA 4EUEA 1QNFA 1FJGB 2Q5IA 5IAEA 1B8PA 4NKRA 5EIXA 1PJTA 3DDWA 4RTMA 3A2KA 2VCYA 3P9KA 1JG3A 1RI4A 2SHKA 1DE0A 2QYHA 3D02A 4RVCA 2QG6A 1IRXA 4AO8A 4L5BA 3D8SA 4QXQA 2VPIA 4MYTA 1W46A 2WSLA 3UWMA 1UBNA 4YRBA 3H9EO 3V4VB 2I0FA 4FJ2A 2OR3A 2B1JA 3EA4A 1R1DA 4WUTA 2AF3C 4W82A 4GDFA 3T3EA 5IXJA 3V4SA 4U4AA 1O6CA 1F2TB 2O3UA 3U3MA 4JP5A 5KNCH 5ISMA 3RNLA 4D3ZA 1XNGA 3BB4A 3PDIB 1NT4A 5ESXA 5AJHA 1N2BA 3ZWAA 3R0VA 1UT5A 3COVA 5FH9A 4FYXA 2A30A 5TF4A 3A32A 4PR3A 3ENZA 4Z86A 1PN3A 3PE3A 1K0FA 4B4OA 5BWOA 1U9ZA 2ZUVA 1EVJA 1D2EA 5HFNA 2CLSA 1HMPA 2PX6A 4K86A 4KVGA 4R4JA 4CCSA 1KO7A 4O33A 4RHEA 5IJAA 3W06A 3AJ8A 1Q6YA 3G0DA 4FFLA 3TX2A 4XLTA 1RWOA 2GXSA 4TL8A 2JAXA 3KKPA 3O9ZA 4HDOB 4A10A 3GEHA 3KZKA 4DHWA 1WCWA 1QLHA 4LXIA 4GO1A 4Q05A 1AV6A 1AJEA 2J3JA 3ZKAA 4AO7A 3ADBA 2C88A 4PLVA 2RGGA 4AKGA 3G9ZA 2CDAA 5FHQA 2GFHA 5JJ5A 4R8MA 1YZFA 5K8JB 3EN0A 2NG1A 1BZYA 2NO1A 2Q7DA 3QPWA 3RADC 1NT2A 4RH3A 2Q29A 3P9PA 3ZLJA 1I2ZA 1RKUA 3GUYA 4I5DA 3FHJA 2R6HA 3A1CA 3LMKA 3UUGA 1VKZA 3AZPA 1TRHA 2IFTA 2PBFA 3QVJA 2BYTA 1UP7A 4BPBA 1ISMA 3KT3A 2BMJA 4N39A 2I22A 1W48A 3A1FA 1IY8A 2PL5A 4GPTA 3GAMA 4TTQA 2BKAA 1FU4A 5EE9A 2JIBA 5DNCA 4ZT2A 3FUXA 4D0LB 3SOPA 2A33A 1XPOA 2ZRLA 1G55A 4JS0A 4Q4LA 2MYNA 1XVIA 1N9GB 2GPYA 1SVLA 4ILKA 1U9CA 4G5GA 3LPLA 5JAPA 1HEUA 1OX4B 4JLKA 1QFJA 2C5AA 2GCPA 5TF0A 5HZGA 1AH2A 1EGMB 3VR5D 2Q2OA 2W6JA 3UC5A 5HKKA 1TKAA 4YQFA 3OKPA 3U09A 2RGNC 4KDEA 4UUNA 3QUQA 5D3KA 5CXQA 3EFOA 5KX5F 4GH5A 4XQ0A 4L5YA 1LVUA 2YN0A 4LZNA 4NABA 3LE8A 4OM8A 2QE6A 3SNKA 3BC1A 1COWD 3DVSX 3N3AC 5EJ6A 3FZQA 4LS3A 5DHTA 5A6SB 1G7SA 5C7IO 3OG9A 4JLWA 3OPVA 1P4RA 3EBOA 3Q0IA 1IG0A 4Y2XA 1E77A 1J0BA 1DFIA 1SQ5A 3ODPA 4KBGA 3O94A 3RD5A 2G0AA 3D8NA 3KOWA 3IDAA 1CJBA 2PZGA 3KVNA 3O31A 3JQ8A 1IPEA 4LRTB 4Y6GB 4LCBA 3D9QX 4F86A 1CUUA 1P6QA 3P9NA 1AB5A 5LZ4A 5HBGA 5HCNA 1VMEA 1IZ8A 4F96A 2OSVA 2CVFA 4GX0A 3LCRA 3IAM6 1H9BA 2FK8A 2VK2A 3HKDA 5ARBA 1U04A 1X70A 3Q1KA 3GLHB 3AHFA 1G18A 2FJUA 4OB8A 3EQZA 1KBQA 2OFOA 4FFBA 1JAHA 1N0IA 3ROXA 3IPRA 4BB5A 5T3UA 3UAVA 4WCFA 3OJWA 3HDHA 4PQEA 4EFLA 4YUYA 4C89A 2B36A 2QRGA 1XHFA 5HKAA 4A6DA 1S9DA 5GOZA 2AYXA 5DHFA 5B3JC 1ST2A 1KHHA 1TF5A 4CMKA 2BBWA 2GJ9A 2P69A 1K1EA 4R69A 5B1EA 4EPTA 2HJRA 3TTWA 3RT9A 3P2JA 4OFBA 3L9WA 3CY6A 3R3UA 4M6WB 4HDCA 3NOQA 4K9NA 4UPDA 3U39A 4TL7A 1XJ5A 4FHDA 4A2PA 4ADSG 4KXLA 1YZQA 2GK4A 4W1SA 1SB9A 3P19A 4PQYA 2GESA 3OQOA 1XYGA 1FBTA 1U6KA 1Z8NA 2OV3A 2ZDQA 4JA2A 1IWBB 1K4YA 1GQSA 3NBKA 5D86A 3VVCA 1T5IA 1TM5E 2XMDA 3DR3A 4AFNA 2GFQA 4EUHA 3JWHA 4HNTA 4ECAA 4UU7A 2MSNA 1VCOA 4NBLA 1HFKA 1WXDA 2V6FA 1EUZA 2XTAA 2Z2JA 3PC6A 4LZJA 3DO8A 3LPDA 3OIDA 1W4AA 4MYHA 4EDFA 1WY5A 1I0LA 1GGJA 1MNAA 3ST7A 3UXHA 1XF9A 2JBAB 4TMYA 2I9PA 2MINB 4KGVA 4XIIA 5IZ4A 1K9SA 5KYKA 3DMNA 4ZI2A 1UMCB 2WKWA 3I2IA 3LRXA 3QWFA 3A3YA 4M1KA 5H7XA 3LOUA 4LJKA 1G19A 3M6LA 4LFAB 3A06A 4E7PA 3KLNA 3TH5A 1NF8A 2QVXX 3GC6A 3VHXA 4CIWA 4K9MA 1YRWA 4DXHA 2HV8A 4C4ZA 4U3JA 1JAIA 3HRIA 1D1PA 5CLJA 2JATA 2FWNA 4EPXA 3RRZA 3UXEA 4ZYUA 4ZD6A 4CR8A 5HGJA 1MZPA 1FDRA 2P8SA 4OP3A 4ALKA 4B8WA 1SUDA 3SDSA 5FL7A 1BDIA 4QVIA 1CUZA 1Q1AA 5ALJA 3ZY2A 3IB6A 5FI5A 4DJEC 2O5EA 4BX2A 4G97A 4LNUB 5AW8A 4S1OA 5BPHA 2VRWA 2XUKA 3GJ3A 3N5CA 3TDKA 1ZHHA 3QPVA 1H5UA 1FMFA 1BQ4A 2MSKA 2NO0A 2X19A 1X7GA 2CUZA 5YASA 3K9FC 4C6SA 4B3IA 1DT3A 5C5CA 4IDEA 3VV2A 4ZAWA 4PGHA 4IMJB 1Y8AA 2I4LA 1NJFA 3IUPA 4UATA 2ONJA 4DG9A 1S3IA 3TRIA 1W35A 4X20B 4ZWNA 1F0KA 2FJPA 3OZUA 5TS3A 4MWBA