2Y1LA

Caspase-8 in complex with darpin-8.4
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
150
structure length
150
Chain Sequence
LDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CASPASE-8
publication title Caspase-8 in Complex with Darpin-8.4
rcsb
source organism Homo sapiens
molecule tags Hydrolase/inhibitor
total genus 56
structure length 150
sequence length 150
chains with identical sequence C
ec nomenclature ec 3.4.22.61: Caspase-8.
pdb deposition date 2010-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2y1lA00
3PD1A 4AWBA 2J33A 5IC6A 1F9EA 3V6MA 4NBLA 2Y1LA 4QUGA 3NS7A 2XZTA 1QDUA 4LSZA 1RWVA 5IBCA 2QLFA 3R5KA 4IEFB 4QUDA 1I3OA 1RHMA 2XYHA 3NR2A 2QL7A 3BIJA 4QU8A 2H48A 4ZVSA 2J32A 5LUAA 4ZVPA 1RHUA 5IBPA 3QNWA 3D6HA 4NOMA 4EJFA 1RWPA 4NBKA 4EHDA 3GJQA 4QUAA 1F1JA 1JXQA 2FUNB 3R6LA 4D3YA 2P2CA 4FEAA 2QL5A 1RWOA 1GFWA 3H0EA 5H0IA 3V4OA 1SC3A 2K7ZA 4QU0A 2H54A 4DCPA 2H4YA 1IBCA 1RHQA 3EDQA 2CJYA 3SIRA 3UOAB 4D3ZA 3NKFA 4FDLA 1SC4A 2XYPA 1NMQA 3DEHA 4QULA 3DEKA 3R7NA 4QU9A 4N6OA 1RWWA 4JJ8A 1RHRA 4EHHA 3ITNA 3H1PA 2WDPA 2XYGA 4NOLA 3OD5A 4ZVUA 4ZVOA 2CNOA 2H5JA 1SC1A 2H65A 1RWNA 5K20A 1GQFA 2CJXA 1CP3A 3PCXA 4NOKA 3IBCA 2FQQA 3DEIA 2C2MA 3H11A 4N6GA 3R7BA 4PS1A 1PYOA 2QL9A 4EHNA 3H11B 1I51A 4M9RA 4QUIA 2HBRA 3GJRA 1NMEA 4DCOA 2NN3C 3PD0A 4QUBA 4I1RA 3GJTA 1PAUA 1QX3A 3D6MA 4N6NA 2DKOA 2QLBA 2Y0BA 1CVRA 2C1EA 1RHKA 3H13A 1KMCA 5IC4A 4ZVTA 3V4LA 1SHLA 3DEJA 1I4OA 4HVAA 2HBQA 3S8EA 4JQZA 3E4CA 1SHJA 5LU9A 2HBYA 4EHAA 1K88A 5IABA 4QUEA 2H4WA 5IARA 4EHFA 4IYRA 4QUHA 2XZDA 3V3KA 5IANA 1RHJA 2J31A 5LU8A 1RWXA 1M72A 1ICEA 2J30A 4N7JA 2CNKA 3K7EA 4NOJA 1QTNA 3SIPA 2H51A 3KJQA 3P45A 4HQ0A 5IAGA 3P4UA 4JR2A 3IBFA 2CDRA 4HQRA 1I4EB 2CNLA 4QTXA 2HBZA 4JB8A 4AWAA 4FXOA 4D3XA 1NW9B 2FP3A 4PRYA 4ZVRA 4JQYA 4ZVQA 4EHLA 3D6FA 1NMSA 5LUBA 4QUJA 3R7SA 5IBRA 3V6LA 4EHKA 2H5IA 4QTYA 4N7MA 2CNNA 3R5JA 3EDRA 4QU5A 2C2KA 5IAKA 4AW9A 4JR0A 4FGUA 5I9BA 4PS0A 5IASA 3KJNA 3S70A 3UO8B 5IAEA 3GJSA 4NBNA 4JJ7A 1RWMA 1K86A 1RE1A 5JFTA 5I9TA 4I1PA 4JJEA 4PRZA 4DCJA 3V55A 2QLJA 3KJFA 5IAJA 3RJMA 3R6GA 1BMQA 2C2ZA 2AR9A 4N5DA 2C2OA 4JR1A 1RWKA
chains in the Genus database with same CATH superfamily
4IIJB 2JJMA 3KVOA 4DY6A 4IDPA 3M3DA 1F48A 2AMLA 1QB7A 1L1EA 1TQ2A 4OG2A 1N8SA 1Z83A 1Y4UA 4QVIA 3HEBA 5E6SB 1HR0B 2RGNA 2FFAA 2WWTA 1RLMA 1CQPA 2P5YA 3BB4A 3G6KA 1JPNA 3C6QA 2L19A 5ALFA 4AKTA 1I9CA 4MARA 4QYIA 3ZHRA 5ALZA 1CXZA 3CNQS 1KZGB 1VPTA 1JLMA 1Y82A 3WXBA 3O73A 3FHOA 1N33B 4CIBA 4JI4B 2QB5A 1E7QA 2I9PA 3BXPA 4NDZA 1GAWA 1Q0LA 4N48A 1TPYA 5DISB 3HXMA 1T5TA 1ZN8A 5ALNA 5EJ6A 2Q9BA 4H0FA 4UPVA 5DX1A 4B73A 5KQPA 1AM4D 1W48A 2PRSA 3FYTA 1QYXA 4M86A 1L3BA 1EBFA 2NZWA 3FUUA 4LC9A 2BGLA 4QM6A 3DDHA 2J0UB 5HDQA 3V7FA 3OCYA 3GZNA 3X44A 4KQWA 3ETNA 2Q28A 2ZW9A 3EVEA 3ENKA 3JXEA 1OY1A 2RHRA 3T1QA 5BWOA 2AVDA 3VKVA 2RBGA 1TTHA 3KXKA 4LY9A 1L5NA 4XDZA 3R74A 4CRWB 5AW6A 4A36A 1M2HA 5HUQA 2HMVA 2A57A 4LXQA 4UVGA 1ZGJA 3E48A 3DT9A 1ZLXA 4U02A 5EXPA 4DUZB 1NRIA 2JCYA 2FSUA 1LS6A 2IDJA 1ZUNB 3GEDA 4ZPXA 1KY4A 1HE1C 4X1YB 3WDKA 5C8XA 2ESRA 3JCZA 1HTTA 1II0A 3EH2A 2E82A 3MT8A 4MRVA 3L7IA 1T8SA 2J3DA 1U3WA 2VAMA 3HVJA 3WWPA 4GBMA 2CF5A 2QJOA 4UVDA 4MWSA 4PM4A 3UY4A 4ES6A 1R6AA 1XMOB 3LDFA 1LZLA 2G9ZA 4BNNA 4Z4CA 5ICMA 2GUWA 4F4CA 3LBFA 1XTRA 1U9IA 1YVDA 2R44A 2KW5A 4GNKA 4D4LA 4DJTA 5LWHA 1F38A 5AW3A 2GPSA 3E5MA 2ECOA 3NKVA 3QKWA 1FTGA 2CXSA 5EIAA 3A2NA 1CJUC 3DHWC 3UB3A 2BGNA 3FF1A 4WXRA 4COOA 1KI8A 1PZEA 2R2GA 5HRCA 4MCAA 3P2OA 4RF4A 3PJRA 1GG5A 5KJFA 2ZB4A 3LY5A 2XNDD 1O8BA 1ONBA 1X8LA 2V45A 3O82A 2A9QA 4LNHA 3WL8A 1D8AA 3DONA 1A76A 3MJVA 4K03A 3O9MA 3ROXA 3WWYA 1XPRA 4KJXA 2QMZA 3KKNA 3PNPA 3T7JA 2RAPA 2J3IA 2J45A 5DHAA 4ASUD 2JI8A 4DA8A 2QM7A 5MGBA 1W1IA 3AW9A 1F6WA 2HK6A 4KLCA 3HS3A 2VP5A 1KYWA 2K2WA 1A5AB 1LLUA 3S5UA 1PG5A 3KLPX 4Q3KA 4ZKEA 1FS6A 1I4DD 2WHPA 4B8YA 5MF6A 3FSRA 2FZWA 3COSA 3GJSA 4YRRA 3KPVA 4ZO9A 2O7SA 1A9TA 5IHXA 4YLGA 1LJLA 3QLEA 1L5LA 5SZHB 2YHIA 4CQLB 2GXAA 3LBAA 1QHYA 3MS7A 4FP9A 4YECA 4V39A 1IN1A 1FDIA 2WU1A 1JEDA 3ED5A 4URVR 1YFJA 1G0OA 3FPSA 5T5QA 2NVUA 4O2BF 2WRZA 4WQMA 1LVGA 1H2WA 3NDJA 5C5IA 3D6UA 3HKDA 4XCQA 3KE8A 2WU3A 1C0PA 3MINB 4DUGA 2VPXA 1HE3A 1WDLA 3WQRA 4MB6A 2GXQA 2P0YA 3UATA 3V1UA 4HT3B 1B8UA 1R6XA 3LCMA 1OA0A 1QHEA 3SDZA 4MP8A 3EXHA 3IQIX 2XCQA 1BW9A 1ISJA 3AZQA 3H1FA 3HV2A 4GMFA 4UMVA 3ZGYA 2BEJA 3TGWA 2OWEA 2HO4A 2QZJA 3LBIA 2J46A 2X0KA 1N1EA 2AG6A 3FJYA 1RJFA 3ETCA 3IUPA 2R8XA 1FQJA 3AC0A 3PT5A 3PT9A 4LX0A 4EF4A 1Y63A 4F84A 1JNXX 1EX9A 1GSOA 3ENNA 4EA6A 4ITRC 1GQRA 3CRNA 3MFYA 3IE1A 4M9ZA 4GC9A 2AOVA 3BOSA 3KU4A 2OBLA 3QPWA 4L8FA 4BS9A 4CMEA 1G7CA 2XE6A 2CXNA 3I8SA 3NEYA 4AECA 3PLNA 2X0RA 2E37A 3HZHA 2DSNA 4CF3A 1QZZA 4O6VA 2GZRA 1KO8A 1UWKA 1XHFA 1JYEA 2J48A 4R8MA 2YL2A 3ANSA 4BY9E 4F11A 5JYCA 4Y8VA 5GZ3A 5JXJA 3F3SA 4BMSA 4N76A 4OK5A 2Q3DA 4Z4HA 2C7BA 4DSAA 1O3YA 5MFZA 1RACA 4CYMA 1TZBA 4BFTA 4P35A 4X24A 1NC3A 1E2QA 3L43A 1G5HA 1CZOA 3H5AA 5TQJA 3H2ZA 4C03A 4ON9A 4EY3A 1PYDA 2JA2A 3DW1X 4BQQA 4BUCA 1RXUA 4C0WA 2OY0A 3LUHA 1W1WA 4INAA 4AU1A 2Z8YM 4RMNA 4GBED 1TCCA 3SR0A 4YJFA 2R8ZA 3CZRA 3HP4A 3MWLA 3Q12A 1W6RA 2IEGA 5C35A 2CJPA 2ZCJA 2GD1O 4WN9B 1XRPA 1A9RA 4DCSA 3PQ2A 4HGQA 5EE5B 1NA5A 5EHXA 4P7GA 2WJ3A 4C3ZA 3ENZA 4B80A 5B4TA 3GLHB 1PWHA 3LF1A 3BUSA 5IABA 5IWCA 1HDOA 3PDCA 3VR4H 4N3BA 4DMCA 4ZT7A 2O8DA 3EEIA 3N75A 3B6EA 2ATEA 7YASA 5JRJA 1UMDA 2PMFA 3I04A 4TTQA 5A71A 1EK6A 4EGJA 1Y8ZA 1DO2A 1XJQA 1IMJA 3OCXA 3AU9A 3P20A 4OVKA 1XELA 2CLEB 4UVEA 5A0FA 2G9NA 2VBFA 1Z34A 1BFKA 2UUBB 1YV9A 1FW8A 4G56A 4TMTA 3IE2A 3GBPA 3U4AA 1GDHA 4RZ2A 5TSDA 6CHYA 4ZJUA 2Q4OA 1WB4A 4FOSA 3ZZTA 1K97A 1W36B 3C5VA 4I5IA 5JAZA 3K5WA 1PZMA 3NRCA 2G70A 3ZE2B 2A33A 1PDOA 5G3ZA 1OH5A 2FXVA 4O02B 3U40A 5AW7A 1TTPB 1MC8A 2VPTA 2YHUA 3AWIA 1NBMD 5ECGC 4F1WA 4FE4A 4JT4A 2XF2A 1S3SA 4G1MB 4RZSA 4Y1EA 3A11A 2NO7A 2JNWA 5K7SA 2R7MA 3TJZA 4KR9A 1CR0A 3IGFA 4O2BB 5H16A 1O94A 4AP6A 4DSNA 4O4JB 1EZ1A 5JG7A 2Q3BA 3O0DA 1W6UA 3L1VA 3HN7A 1YTUA 4EYSA 2FDXA 4JI8B 4XOUA 2OBXA 4X7PA 5GJBA 5I9MA 3E3AA 1RLJA 3FG9A 3L0SA 4LXYA 4QDTA 4JI6B 1RRVA 1UMCB 2MYPA 4CNQA 5FBKA 4HDRA 2OC9A 4G0ZA 3AM3A 4ZTZB 3O94A 4R2XA 2BMFA 1UQUA 1XMSA 4TTJA 3PR1A 2XCOA 2WKSA 4M38A 3RANA 1MTZA 3TZLA 4EFDA 5KQGA 2VJBA 2FK8A 1T3SA 1GGVA 2QRZA 3Q3HA 2QT1A 2QEQA 1D6SA 4HXFB 3ETEA 4O2AF 3TCKA 1A4RA 4WA7A 1GAXA 4G9GA 2VC2B 5CITA 1PVVA 3U9SA 4M7WA 1Z6YA 3L0PA 4LDZA 5E1MA 5KOJB 2V5VA 3S6JA 1G3QA 3R7DA 1JHRA 5L6LB 3GMDA 3GPIA 5BW8A 3EAGA 2IS6A 2VT7A 5HZHA 1WXHA 2HQ1A 4TM7A 2WJWA 5TMDA 3CKMA 4ZZIA 3OP4A 5FI3A 4A4DA 1A98A 1CDDA 1RSZA 2WE8A 3CLHA 4KVGA 4HLQB 1YTLA 3URKA 3ECCA 1UH5A 3IEMA 3MRXA 4YR9A 3T7SA 1IN5A 1NVDA 2CJWA 3FX2A 1K7EB 2X4IA 3RDPA 3RHZA 3SWWA 4G5FA 2CCGA 1DBWA 4BO8A 2O8VA 5T41A 1SO8A 1P2DA 1W73A 2UVQA 2ZSHA 4IZIA 4AQ7A 1ZD5A 5U9CA 2JJ8A 1QGAA 1SB9A 1A8UA 3UICA 3M49A 3BWVA 5LBTA 7ADHA 5J4YA 5F3WB 1DNPA 1PG0A 4I50F 1ZVKA 2X8AA 4FD3A 2CHEA 4GS5A 4MYDA 3VZQA 2GASA 4OBBA 3EIOA 4Q6BA 3GU3A 2GCEA 2EKZA 1F06A 1KA9H 3KQVA 4DBLC 1V41E 4IJWA 1K7FB 2C92A 4KR0A 2UYHA 2OMKA 4DW8A 2PAFA 2RONA 3GVIA 3IJ5A 1DQZA 4YLYA 1JLRA 5IAAA 1BE1A 5FPYA 1JZSA 3JQFA 2LCQA 1MTOA 2Q3MA 5IKPA 4GI7A 1U3VA 1WEKA 5TXGA 2G25A 2PVPA 1O97D 3Q5EA 4NFHA 3ZGOA 3TCNA 3KWMA 4BPBA 2XJ4A 1NV9A 2GA9A 1D2GA 1BHSA 2MSLA 2R68A 1QGUB 3T35A 2V8BA 2AOUB 3A1EA 1T2AA 3OTIA 4GXQA 4YYZA 4YQFA 2ZSUA 4B3MB 3DJFA 5C5DA 1NM5A 2W2QA 2GLTA 3L6DA 4Q7EA 5K3SA 1M2FA 1ENYA 1Q5PA 4U2DA 4M87A 1T1JA 4FEYA 1KKUA 3SJCA 2VJLA 4JBWA 4JLPA 1V1JA 1KNQA 2PR7A 2HU2A 2QF7A 3A06A 5AI8A 2Z56A 1Q0ZA 1Z47A 1DDGA 3W6PA 2YOHA 1LUAA 5IT4A 1YBHA 4HDKB 4IEEA 4G8DA 4ISBA 1Z5WA 1BXRB 3FGOA 1X7YB 1QHNA 5J40A 4N3NA 4RMIA 2AEEA 2B2NA 2H4HA 1CQIA 4PLPA 4I4NA 4Z9YA 4NMMA 3KYBA 4KE8A 4XIYA 4XUDA 1H22A 2YNMC 1F6BA 5BV2P 3PFGA 3EOZA 3R2JA 3JQAD 1N2JA 1QHHB 3W2EA 4JYMA 1MF7A 2X4DA 1FF9A 1MNQA 2MINB 4HAUA 3E8SA 4U2BA 3DP7A 3C3AA 4OGWA 2OLJA 2OHXA 3DOCA 3AKDA 1EG2A 4HPJB 5JAQA 3GEHA 1BWSA 1JDZA 1R0CA 1Q0UA 2ZSIA 1WDTA 3H4VA 3OF3A 4QJBA 4IJMA 4PAGA 1KH3A 1XTZA 1G1AA 2JHCA 2NQ8A 1U8ZA 3NBMA 2IV2X 4Z0NA 3D1JA 3P9PA 3PE4A 1NF8A 4I9GA 4JJZA 1M0SA 3ILXA 2G71A 2VDUE 3W2IA 4Y6LA 5T64A 4YRFA 3K9GA 1RBYA 4O2BA 4P3NA 2QZ9A 3T7KA 2UVPA 2ZM6B 3TQCA 2HX1A 5DASA 1XRQA 1EZZA 4ZAZA 1BG6A 1V5WA 3KL4A 4JQOA 4QDXA 2D7CA 4JJ8A 5HM8A 2WR8A 3B8HA 3Q2IA 3OQ1A 3USZA 3ISVA 4RYLA 3K0SA 2FG6C 2VA9A 4NOLA 1Q15A 1MHPA 2G83A 1ZD2P 2NUPA 3Q85A 5ED0A 4BN4A 2W6JD 5LKAA 1JMYA 2H06A 4RYDA 4JUIA 4KREA 1IQRA 1I1OA 1FSZA 5HTOA 3OZXA 1FDTA 1JG6A 1F14A 5DMHA 2ZJYA 1NJ1A 3K0BA 1CSEE 3RW9A 4D6YA 1QPGA 3IJEB 3RK4A 4LDAA 5CM9C 2ONJA 5L3SA 4Q7QA 1POXA 1RCTE 2XZOA 3A6DA 2QSJA 4WKBA 3SKYA 1XNRB 1S4MA 4JLNA 4QOEA 1XFDA 5L7YA 2C1EA 4XRGA 1SUAA 6LDHA 1KYQA 1EUCA 3DZDA 5LQSA 3W8EA 1IIRA 4AZVA 5HQTA 5LNK6 3OEEA 2A9JA 1SHLA 1EVYA 1XVIA 2G3YA 2LKCA 3DVAB 3OH8A 2JJYA 4I50B 2G08A 3O95A 3KFXA 2HBQA 1U7WA 2FY8A 4K9MA 5AVWA 1LDBA 1XZFA 1WEHA 2GZ3A 2WWWA 3F74A 1E5TA 3OOYA 4HPWA 4CIDA 1CUJA 1PQ4A 2JFUA 5DTJA 4PTLA 1Y9JA 4M83A 5E95A 4AT1A 4AUEA 2YWGA 4URHA 4QTZA 4LIPD 4TQAA 1FLAA 5AOAA 1PYGA 3BE4A 3FJOA 4DAOA 2Q0XA 4I5GA 4KI7A 3SHWA 5TPWA 4U2GA 3T12A 1G59A 2HRCA 1F12A 3C8HA 1XVLA 1PUIA 4H6XA 2PUVA 4J8PA 4NENA 1DRWA 3OCWA 1T8UA 5CA0B 2TSYB 4DA4A 4MW7A 1CJKC 1Z4OA 4G07A 4X94A 1LSOA 2HV9A 1P60A 3HHEA 4ZVQA 1ZUWA 1MXHA 2Z09A 4X84A 3CXRA 3T0IA 1S4QA 1ENOA 3PXAA 1V25A 2JGDB 3WLLA 1E5VA 3E7XA 4KXQA 1EM8A 4UEKA 2QVXX 1FE8A 4Q1EA 2WM2A 4I1SA 1ILEA 4B7XA 1UKCA 1XB2A 2O23A 3BK1A 3DMTC 3LDUA 2EU8A 2ZROA 4M98A 5EUMA 1S89A 2XUGA 4JZYA 1WLSA 1YK0A 2FZ5A 4K5QA 3ZN2A 2A1TR 4EA7A 2GN1A 2FEPA 1VMKA 2QW8A 2WYUA 3M6MD 1PT8A 4RHXA 5AKYA 3VZDA 1YRHA 1Z8HA 2UZ0A 3W2HA 5A5FA 1I7SB 1IZYA 1LGYA 1G3RA 2J09A 4MIKA 1C3JA 1Y4SA 3F4BA 2CHUA 5DXJA 2HFJA 3FNBA 3A3KA 1K9SA 3MVEA 4RDCA 1PFKA 5DBGA 5TARA 3SI7A 5BMVB 1UXJA 3HXOA 1VG1A 2Q5HA 1M5UA 2JHPA 2ZAMA 3LVBA 3M6AA 3ZH9B 2RAFA 5EHGA 5LZ5A 2CT8A 1C3XA 1ECCA 2H48A 4HEA1 4P5EA 3KCQA 1DLIA 4Z0TA 3ZOKA 1SXQA 3DMNA 1NL3A 2IPLA 5F12A 2P1ZA 4QUAA 4Z49A 2HCBA 2ZB2A 5CLFA 2NO4A 2I0FA 1LXCA 1OVMA 1VCMA 2FUKA 2NU9B 5KBYA 1ADGA 1EA7A 1X7YA 3I6YA 4D41A 3U16A 3SF8B 3VZCA 4XAQA 4F93B 7ABPA 1COWD 1K5GA 1CKEA 1W0JA 2G0NA 4U7GA 3TS1A 4RJKA 3ZG6A 1L7XA 4EW6A 3GLGE 5GP1A 5F7OA 1TJ4A 2SCUA 2YWFA 4MQ4A 4WLFA 3UFBA 4RTJA 1LCIA 2Q3EA 1N8NA 1ESDA 3V3TA 5FEMA 3C1OA 5BR7A 4QXPA 1M6WA 1XZDA 4YWHA 3QXXA 3N5KA 3IAS6 3GI1A 1OWOA 3RRMA 4XFKA 4LOLA 3W8DA 4MA0A 1RI2A 4UDXX 3OG9A 1E7RA 4NMWA 3BCSA 3VBCA 5C37A 1JEAA 2O5VA 2PKRA 2RGWA 5A05A 2HXSA 1NBIA 2VHTA 4XM0A 1RTKA 2DFVA 5DGDA 5A1TA 3PFWO 3U5TA 2ENWA 4JJ6A 3NQ41 2NZYA 5JSZA 3W04A 1TI7A 2OL4A 2WP8J 4GP7A 4AWXA 1YFLA 1Y3IA 4RUKA 3OZUA 3Q40A 2EHDA 4O2AA 3RVMA 4HLDA 4M1EA 1QHXA 1DUSA 1XEWX 3BKWA 4MVJH 1E8MA 3VNVA 2D5AA 1JHXA 1B76A 4LE2A 4ZVTA 3OU2A 5KJEA 4DG8A 4LXUA 3FCEA 5B3KA 2GEVA 3EXIA 4PFSA 4IBOA 1QBGA 1HKHA 4KZPA 5AMXA 4E15A 1G5TA 1IBRA 2P2NA 2XODA 1BVUA 1NPTO 4V0OA 3PEYA 2MYUA 3TOCA 1YI0A 3LGAA 4CF5A 2VJDA 2HA5A 5A4DA 4WADA 4JROA 3H5RA 5JH7B 4I3GA 1GRQA 2CHFA 1KE2A 3Q9NA 2VXCA 1T5HX 3QOFA 1Z17A 2VT2A 5MN4A 1EFLA 1TZKA 3JX9A 1JDNA 1UBJS 1Z28A 5AI5A 3D4PA 3WQQA 4AIIA 3GBSA 3ZD8A 3FZEA 4UNIA 1E20A 2NVOA 3TLKA 4LJAA 2D1SA 3VHLB 3I5AA 2GMWA 1IOWA 1QC5A 1PSZA 1U9JA 2PRYA 1E6CA 3GNSA 4FXOA 2JARA 4JL8A 4M46A 2BJHA 3GELA 1XYYA 4I50A 5F5LA 2ZYWX 4EUNA 3T3HA 2GN6A 4IDCA 3WGZA 3CJTA 4BLSA 3ZXSA 4D2IA 4TLEA 5FFMA 4IJ5A 3PP8A 4CG0A 5HM6A 2PGOA 2Z0MA 3ACDA 3ROZA 1NJ5A 2HL6A 3HJTA 3UXMA 3DMFA 3KBBA 1VSVA 5A3VA 3CG0A 3W5VA 4EQ6A 2WUWE 3PWTA 4ZK2A 1ETUA 3OFKA 2FZVA 3KUUA 2HB6A 2QRPA 1XMJA 5GZ6A 1KQPA 2X7HA 3FWZA 4NAUA 5TEWA 2AEJA 4BMZA 4HVCA 5AH0A 3U37A 4K9OA 3ESRA 1BFDA 4OXRA 2I1VB 4R2MA 4BL5A 1CUBA 2CLDX 2VJMA 2XB4A 2Y0DA 4BBZA 2AN4A 2AJDA 4N39A 4W99A 3DNFA 3A1WA 3W5DA 2Y9PB 3AF6A 2JS7A 4JBNA 1KYVA 1B3RA 3WLIA 5I7VA 5HKLA 2NYVA 4FD2A 3NS7A 2IV3A 1CC1S 2UKDA 1DX6A 2JIPA 5DV9A 2W42A 2QRVB 3I76A 4OH7A 4L0CA 3NR2A 4YMVA 1B3BA 1FUEA 2Q99A 3PRJA 3VKUA 4C6HA 1TJ3A 1X7ZA 1Y1QA 4J3NA 4PO1A 4IMPA 3QNUA 4EJ2A 2IU4A 3FW1A 3STYA 2MOKA 3A4NA 1TJPB 3HYNA 2FRXA 1XF9A 4P38A 4JOSA 1PJ3A 1I0LA 1ZRNA 5HHTA 2YYAA 2JFXA 5D87A 4KNWA 3B8EA 2Z4TA 3UMMA 4UM5A 2NU8B 3UH1A 1FTQA 4H7KA 1EJBA 3NH9A 4L5JA 4OHPA 4J29A 4L27A 3ESQA 2BFNA 3M83A 5LQCA 5KOHB 2BP7B 5EOVA 2XVZA 2VHEA 3DAGA 4XJTA 5I7OA 3SQDA 1ZONA 2I65A 3ONVA 4J2OA 1T26A 1JS1X 2WFLA 3CXUA 3ROPA 4NCBA 2Q1SA 4IM7A 1GPKA 3H1TA 1ZNQO 2GILA 5IDWA 1ZN7A 2IFTA 3ZDRA 4D96A 1ZAKA 3V8PA 1KK2A 5KAMA 5KNLA 3OTOB 2QI9F 2ZI9A 3HJFA 3CZCA 4YAOA 1OB2A 1EDOA 4JVMA 1KO1A 1MABA 4M54A 4Q9IA 1UJ6A 3E1GA 1ID8A 2CUNA 2QENA 4MWTA 4X1KB 4BEVA 3ESXA 1TEXA 4BQPA 1PJTA 2JIOA 5SZKB 4B2PA 2Z4RA 1RXWA 2PSSA 3ZNNA 2I66A 3ORHA 3UMGA 2HHHB 1N3IA 4NU8X 1QGOA 3ICVA 2Y1DA 3C3CA 1PR2A 2XKJE 4UKDA 4WERA 4CLHA 3W7AA 5B3JC 2QORA 4G4GA 4ZQBA 3WGLA 3HCPA 1ZM2A 4XVRA 2H85A 2GZ2A 3C3DA 4DANA 2O52A 2BR3A 2NXEA 3BRWA 3F73A 4JLVA 1KJIA 1Y7HA 5FFNA 3ZE8A 3ME5A 4G6ZA 1A9ZA 1F5NA 2QTGA 3W8FA 1WVIA 3N5CA 4RV5A 4I8XA 3RODA 1EGHA 4JV5B 1NPDA 2ZWAA 4KIUA 3ITEA 1VA4A 2JGNA 5A62A 2R6GA 4BFVA 2QMUA 2CZGA 1MV8A 2DH5A 3G59A 3VVCA 3WLMA 3ZVNA 2GN2A 4NU5A 1KDOA 5EKUA 4E2ZA 4LDQA 1UZLA 2IKSA 3N8HA 5IZCC 1OLXA 4LVCA 2FZGA 4Q1AA 1SH7A 3MBIA 4UHFA 5THXA 4BJ5A 3V4RA 1L5RA 3IDQA 3QKUA 1EDZA 4DUGD 2QJFA 3PHLA 3MNFA 4LRWA 4ROTA 1DOZA 1PCXA 1QJ4A 2OO3A 4BNDA 4HX2A 1H1LB 1RAIA 4JP8A 1CYDA 5JAOA 5AJZA 1RP1A 1DAKA 1TKRA 4IHJF 3ZYCA 3DMDA 5I9TA 5BRJA 1FYVA 1BYUA 2PX2A 3GDOA 2AK3A 2VTBB 3ZU4A 4R8KA 4ER7A 1SG9A 3EC1A 4CQMB 4WK2B 1B23P 3TXXA 2XWQA 1MZPA 1BMQA 1F8GA 1LB1B 5GMOA 2O2XA 2N9UA 3F3YA 1THZA 1D4OA 1G20A 1UP7A 1J99A 4BVHA 1AKRA 1W4RA 4DV3B 2WD7B 2GKOA 1TQDA 4NYIQ 4EKGA 2BI4A 4FJ0A 4I4TB 1Z35A 2ATCA 2ZYDA 3N8NA 3DE4X 4M9XA 2PRKA 4R2HA 1Z07A 4KDEA 9LDTA 2BMWA 2QUIA 4IDQA 5JU6A 2BGRA 1MRSA 1QFYA 5CNMA 1KEZA 3W5BA 3WBFA 5JIBA 1IEWA 3BBPA 2P9CA 2VLBA 3A1SA 3UB2A 2VF8A 2ZOSA 4WJLA 5TS2A 2B0JA 2A0KA 2IPNA 1GGNA 4M22A 1Z4KA 4LYAA 2Q5FA 3ZLBA 3B51X 4FEAA 4NZNA 4XIJA 5C3UA 3CCBA 4RIFA 4R84A 5LM3A 2DOKA 1EHCA 1NP6A 1P7ZA 3DW3X 4WKOA 2H54A 1XHEA 3H2BA 1ZOOA 4OHOA 4R54A 3SZLA 4CT4B 1H0KA 3AY7A 1ZSNA 5JBQA 5JR3A 4DARA 2B4RO 1HRDA 5CXUA 3HN2A 1VYVA 1OXSC 4GYWA 1L7MA 3I9V6 1TLFA 4ZO6A 1KY2A 1L7DA 2QTVB 3LRPA 3MGBA 3ZJTA 1Z5PA 3K5IA 1A04A 1C8LA 1ECLA 1ZPDA 3T3GA 5LJIA 1NXPA 3LP5A 3WVNA 4D4MA 3OAAD 5B1EA 2HGSA 3UV7A 1UPXA 3HLYA 3GRUA 4ZYUA 5C8DA 4TRJA 3GPBA 1ECFA 1Y1RA 4WXMA 1VE5A 3R0VA 4R1LA 3ZY2A 3HI6A 2FPUA 1LX7A 2E55A 2VXOA 3E70C 5FPHA 4DMLA 1G21E 4J3JA 2F8MA 4P4LA 4DB4A 3S7ZA 2P9HA 3SEQA 2DT5A 4J7UA 1IZ9A 1ORDA 3PQ6A 4N0DA 3RUCA 2PUFA 2ID4A 1XQ6A 3O2JA 3F8SA 1WIWA 3OIUA 2ZJ4A 5F2OA 3KSAC 3FUCA 2BP7A 2HREA 3OZVA 4WHMA 3HM9A 3MAJA 4H6PA 2D54A 5FO1A 3A58B 2HZBA 3RUFA 1KP2A 1E5QA 4IPTA 4JLKA 1QSGA 3WB0A 1DFIA 1KMMA 5LB4A 1U28C 2V5UA 1EK5A 3WMWA 2OORC 3U39A 3TKAA 4H1WA 1CVIA 1DRJA 1FUKA 2O2CA 3DDCA 3QPAA 2OZEA 4IYRA 1UIMA 1VE3A 3WGQA 2GX6A 5IFKA 3FTEA 1Z56C 3KOMA 1Z33A 4K40A 4AKGA 3D6AA 3AG6A 1WW2A 1OAOC 2P4HX 1XXHB 1WXDA 2YC4C 4C3VA 1Q22A 4HQRA 2Q50A 5JZBA 2HMTA 2COEA 2H7CA 3LHKA 4FYWA 4RGBA 3SYKA 4PZEA 3D0RA 2ZI3A 4L16A 3CF0A 2EJCA 1R4MB 5MFPA 2PIDA 2CEKA 4KR7A 1P2UA 3EDRA 5H9VA 4AY3A 4D9BA 1O94D 1OR8A 3AHCA 3ZNPA 4EF5A 2C29D 5BR8B 5LVAA 4IVRA 6Q21A 4LPKA 3R9IA 4Z3KA 4G85A 2E4AA 3VJKA 4UFPA 1AC5A 4HCJA 3ZIUA 1JEQA 1M2OB 1QHGA 1YKGA 2FN9A 3HB9A 3BEOA 3LVQE 3WK9A 1J90A 1GPUA 3KR9A 3L6OO 1RLTA 1UT8A 4GBJA 2ZIXA 5IVHA 4JJGA 1MJGA 3BB3A 3MG9A 3DDUA 4KWIA 2OILA 2PQ6A 4LRQA 3G9QA 4ZHQB 4B81A 1NXOA 4P4UA 4RPLA 1U99A 2V0CA 3PD1A 3IH5A 4KDRA 2FZLA 4Q3EA 1DWPA 4R05A 5F3DA 3QNMA 4LHWA 1NJ6A 5E3JA 3SOZA 3N0XA 1KOLA 2IYYA 4BZWA 4F7DA 3M81A 1QYVA 3RHFA 4J43A 4OF4A 3HDTA 1FNMA 1UDRA 2DHCA 3HZZA 3JWGA 3NIFB 4OHMA 4IQ0A 4V3CA 3W4IA 5GADl 3CNBA 5A9TA 3PQ8A 2ODPA 3Q0IA 2A92A 5YASA 4J0DA 4FW8A 4UMDA 1RAAA 3K5HA 1N8KA 1FS4A 1SXGA 3QP9A 5F33A 1NDUA 2QVLA 3A9SA 4DSZA 3C5WP 4U39A 2I33A 1W5FA 3OLXA 4BVBA 3R6LA 4G2NA 3I83A 4KUEA 1FX0A 4CKXA 2EV9A 4B5KA 3O0TA 4L9SA 1U4SA 2DWCA 4J0CA 4IGIA 4KOEC 1YKFA 1ZBQA 1L7BA 3INYA 1RHQA 1U5AA 4W9RA 4KQKA 4MULA 4G8BA 4BX8A 3M4NA 2GERA 1QIIA 3ZCSA 4ZOAA 4DXDA 3DBLA 1JIKA 4OMDA 4MDHA 5KYWA 1KS9A 3C98A 2D7JA 2R8PA 5JZMA 3ILSA 5JASA 2PS0A 2OXFA 3AINA 4TSFA 3TBKA 2P41A 2HNAA 2BEWB 2Y4OA 1HNWB 2FPMA 5B7GA 2PA0A 1RWNA 3DBHB 4EF6A 4LRSB 4QTUB 2F1HA 2A9RA 2EKQA 2C0CA 2VPIA 4O3FA 2P9JA 3DCJA 3PE3A 1QOPB 2WF6A 2RHHA 1NTRA 1CE8A 1Q0PA 4HWRA 3RRNA 3E9MA 3ZZMA 1XR3A 2HDHA 4EG6A 2OK8A 3H5IA 1RBQA 3WWOA 5KIAA 4DTIA 3MHTA 1GKLA 4G0PA 4G4SP 3IP8A 4RELA 1Y4DE 3ZE6A 2R79A 1KGSA 1KP3A 2FZ4A 1YRLA 3QKRA 1RCFA 3N1UA 3SMQA 1AKMA 1IPFA 1GA6A 2OYSA 5GOTA 3RKUA 3FWKA 4POOA 4PRKA 5CT9A 3NV9A 2Q3LA 3PPYA 3RSHA 1CUVA 1V96A 2WFMA 4FWIB 1OJLA 4OFBA 4F5YA 3HCWA 1NMXA 4PQYA 3VTZA 1R0LA 4BX3A 1P44A 1TVKB 5L4LA 2C2HA 2NV0A 3E7PA 4G1FA 5LQRA 2G09A 2J30A 1BOFA 1U80A 4K9SA 4R8RA 1P2GA 3S81A 1MB0A 1I1QB 3QPBA 3SYRA 1NT4A 5IC5A 1Q44A 1CERA 5FO0A 3OZAA 2OOSA 3TOZA 1KFJB 4OKSA 4OXXA 4FYXA 2M1ZA 2UZ1A 3IA2A 3STWA 4GQAA 5K09A 3A1TA 3UKOA 5E6RB 2PUTA 4RABA 1P1RA 1PNTA 4OYYA 1Y3DE 3GEBA 4KRYA 1SCKA 1B26A 4C7OB 1ZD4A 4PR0A 2FETA 3OQ6A 1SZPA 4CMKA 3L8YA 5IX8A 3C6ZA 1AK9A 1FP4A 3HA5A 4GQIA 4LHYA 4ENPA 2F59A 3TMKA 1FYWA 5AW1A 1N0VC 1UCFA 5BUZA 5JARA 2QLJA 3KJFA 4MSUA 4YO8A 3WA7A 1GYQA 2EL9A 3OFVA 1QLHA 1MORA 1R3DA 1Z7WA 2PZGA 3LX5A 4JLJA 5E7MA 4B3CA 2BW0A 1OXBB 3ZWNA 4L3OA 3RFVA 3ZBPA 1P0FA 2FW8A 3QVMA 2DHQA 1O9BA 1WRBA 3FTFA 4PRLA 4JDUA 3HEMA 1OBVA 2DFDA 4PXSA 2V0GA 4QYMA 4DMUB 7MDHA 3D3JA 1C41A 5B1DA 1LDYA 2X2PA 2IVFA 4DSOA 2Y93A 3RVOA 5B7PA 4X66B 3C16C 4DNPA 1GUYA 3ZTWA 3CLRD 1PQWA 4ZVPA 1HL7A 5DWVA 2HHLA 1KPHA 4NZ9A 1E9RA 1M2OA 3DDZX 3IR5A 1DMRA 2MYTA 2RAUA 4E2YA 1JHQA 5E38A 1H2XA 4IHJA 2WKRA 3RRYA 1BHO1 1JA9A 3USES 5DCUA 5ALVA 1YJBA 2RKOA 5AI0A 4YHHB 3AF1A 1P1BA 3UTCA 4UD2A 4MCIA 1CZKA 5G4LA 3U7JA 2ODTX 2CNBA 4QULA 1Z39A 3RNLA 1Q0TA 1U0BB 3I9MA 4NCHA 4W9NC 3NGMA 3ZWBA 1T43A 1UJCA 4IDGA 4LVUA 2V65A 1AXRA 1UM8A 3H7IA 3QYPA 4S12A 1X92A 4HQFA 3WYEA 4C20A 2YMMA 4DV1B 3KHSA 2Z2KA 4PZZA 5EN4A 2RGYA 2X14A 2QXTA 1UMBB 3OEED 1C7QA 2C9BA 2I7CA 1CFZA 2HF8A 3KYCB 4WCFC 5IJXA 1HSOA 3SVLA 1C4OA 3K09C 2R66A 3IDZA 4A6PA 2IVZA 4Q3CA 4PSVA 4QOGA 2QKYA 4RZIA 4JD5A 2R6CA 4RHCA 2NN3C 1L8OA 2Q07A 3P0JA 3EFOB 4IDAA 4BBJA 1LRKA 4N03A 2YQ5A 3GJ4A 4GXTA 3TOXA 1Z6QA 2G72A 1J49A 4A9AA 1YDMA 3S29A 3L8MA 3HPQA 3RUAA 1V6SA 2BISA 1CCWA 1YJ8A 2BKLA 1A4IA 2DUNA 4PG5A 4ZT2A 2G06A 2VR1A 1ITZA 3I92A 2QPAA 2H31A 4OJTA 2VDWA 4U5QA 1LRJA 3D5QA 2QMOA 3DE7X 1CDZA 3CLSC 4IQ8A 2IYTA 2H1OA 1FTSA 1H0SA 3ICOA 3D31A 1G8PA 1DL5A 1XWWA 2PZLA 4WEQA 5AVXA 4PXYA 4J1TC 1RJGA 4CG3A 3CSDA 1U7OA 1Y8RB 3BMOB 3DZBA 1GT6A 4WNYA 3U4QB 2QRQA 3IFSA 1IAVA 2ODAA 3FDXA 3IUSA 3QBVA 4E5KA 1NP3A 3ZX4A 1IXSB 3I39X 2XV1A 2LP4Y 2MDTA 1T9BA 3TDNA 4OQEA 2Z43A 1REQB 3P19A 3OUZA 3PTZA 3LWBA 3H2GA 4TLDA 1EH5A 3IUQA 4YGXB 4ER0A 1KFCB 4PONA 3RTBA 4CHTA 4DLPA 1L4LA 1RBZA 1Z73A 3H9JA 4N7MA 4M21A 1NHWA 4OQMA 3UT5B 1HDXA 4L22A 3B6MA 5EIEA 4ZT5A 2CUKA 4A8PA 5KX5F 3IQDB 3HYCA 3X3HA 2QS9A 5A9RA 1ADYA 2CDBA 2W2LD 4PQRA 7REQA 3FYUB 2ZRBA 1AF7A 4OFWA 4LRXA 5L3QA 1WB6A 1GEGA 4QPJC 2HU8A 1V8DA 2GJ8A 1DFGA 3B2EA 2OHOA 3IP1A 1EFVA 3OFSA 1XC7A 2FX3A 1DI0A 3E9YA 1DXQA 1OX4A 5E9WA 3UOAB 4EYKA 3U7FB 3EEQA 4AULA 2YIMA 1URPA 4C1BA 2YXPX 3HEAA 3U60B 2FG7C 1YKSA 3DPUA 3FXAA 3R6TA 4IWYA 3JASB 4L5AA 4I8DA 4QBGB 4QG7A 4BFUA 5CFQA 1OXUA 4NZYA 4O4HB 3UWMA 2ATIA 1W0JD 1CU1A 2OK7A 4LJ5A 2LPMA 4XRRA 5E6RA 5A5EA 3KZCA 5D1HA 4BWFB 1CS4C 1O9GA 1GLGA 3INRA 3TLGA 2QNRA 5FHRA 4O4LB 3KAPA 5T7BA 3NOVA 1J21A 1N7IA 2DRIA 2XXJA 4Y2QA 2GHTA 3THSA 1BDMA 1A7JA 1ORIA 1FTYA 2JL1A 3GP5A 4GGMX 4UJ3A 4F1KA 3Q9LA 3ZJ4A 4EPTA 4KVAA 1KKLA 5FWYB 4H3VA 3O93A 1UANA 1Q7TA 1E62A 2OD2A 4YIHA 1TUEA 3ZWKA 1VZ2A 2DPHA 2ZB8A 1B8NA 4BIMA 4HUTA 3WAGA 1GAJA 2RIPA 3ZGVA 2JLAA 3AFHA 1EUQA 1M1YA 3CO5A 4A26A 3UC9A 2ID7A 4X71A 2BKEA 3G2OA 3OKFA 3UUGA 1E60A 3FHLA 8GPBA 2G7ZA 3NIDB 4CCYB 1D04A 1SUPA 1UBNA 1HDIA 1NN1A 2VF2A 3IAEA 4MS3B 3ROMA 2JZNA 3AEUA 5B3LA 2ZWIA 1HTBA 1LBHA 1PJ2A 3DEIA 1EPUA 1Y5IA 2IL1A 2W8BA 4PLGA 2F43B 3OCJA 5BY2A 1PJZA 1BKDR 3BMNB 1KYZA 2MJLA 3CRVA 4YS6A 3U44B 5ERGB 2UZ3A 4FGWA 1Z6AA 4Q0MA 1H42A 1LVUA 2BFFA 3KKOA 2G0AA 4UOQA 5JC8A 1Y89A 1DAPA 4L51A 1VRVA 1HZZC 3ZWOA 1E1YA 1CVRA 2B25A 4JUBA 3RD5A 3CPSA 4R40A 3EXEA 3PCTA 3NASA 1K6EA 1L7VC 1T5IA 5HYVA 3ECSA 2XOKA 5HZKA 2QJWA 1PV2A 5K2OA 1RI3A 3QPVA 1G5QA 4N40A 5DI3B 3M34A 4Q4HA 4ND1A 3QMVA 2H2WA 4C2UA 1GL6A 4D0SA 4OQPA 1IY0A 2R7KA 3HGQA 2CE2X 1L1FA 3SZUA 2QYTA 4GLFA 4DV4B 3ZKWB 3BCRA 3LA6A 4RZ3A 2DBZA 1J5XA 4DV7B 4UDOA 3C7KA 2YDXA 1CTQA 2PZKA 1PVOA 1MFZA 4LWOA 1XEFA 1GTZA 1ICEA 5DGTA 4YMGA 3P2EA 2ZBRA 4M8SA 1BQEA 2O1XA 3EGDB 3O4HA 4Q9DA 5T67A 3A37A 4JC8A 2EW8A 2C7QA 4KNYA 5EE3A 2JI4A 1BVHA 2C2BA 3RRFA 4X95A 3IURA 4HEHA 2VF4X 1IVSA 2WB4A 3IALA 3G2MA 3R0QA 1YA6A 5CHEA 3RI3A 3OI7A 2PX0A 3VU9B 4CMIA 4ECEA 2EP5A 5THKA 4ABTA 3W6OA 4WXHA 1Z5ZA 1QR2A 1TAGA 5ALRA 3WLTA 4CXMA 4NHOA 4PBSA 2OCKA 1CW2B 2JLBA 3Q3VA 3MCVA 4LZWA 4MUFA 3A4MA 4PS0A 5JPCA 4WX2B 3WTBA 2IITA 1ODSA 4R0NA 1VKRA 4E12A 3LPCA 5ICCA 3HLTA 1JH9A 4Q9KA 4FE3A 2G36A 4R2KA 1CRQA 1J42A 1I7LA 3AP1A 4F2GA 3AR8A 1MVOA 2Q62A 2P6RA 3CURA 3WGKA 1KDZA 2Z6AA 2Q1WA 3V1TC 4N54A 4C14A 1G19A 3QIVA 1GGMA 1CY6A 2XMGA 1MW8X 3MGAA 4QAQA 1UOEA 1U3TA 1UAAA 3ICQB 2ZUWA 1IHOA 5DNDA 3SC2B 1ZAYA 3OWOA 4BGUA 3CW8X 2V3WA 4KQIA 2AW3A 3D4LA 3EQ9A 4GX0A 3L84A 2F1KA 4MQFB 3FF4A 3T7AA 1V7ZA 1N25A 4YP9A 3NORA 4K88A 4PYMA 5FOVA 3DBIA 3N6RA 4J75A 4DCUA 3ZVMA 3DMHA 3AYXB 5MDHA 3B6KA 3VR3D 5LBIA 3BGSA 4GOKA 4HOYA 4LF9B 3EIQA 1KK3A 4FWTA 2P69A 3GMTA 1ZH0A 2QTBA 2I4TA 5I7SA 4YH1A 1O54A 4BFCA 1KDVA 4R9VA 2XGGA 3TD6A 4X91A 3TOVA 1H94A 2HWKA 2N75A 4F4IA 5K3BA 4DMMA 3LXUX 1VE7A 4P4SA 5CFOA 4KITB 1C1XB 5DT9A 3PXXA 1C3VA 3V4OA 3HG7A 3PC8C 4MIEA 4QU0A 1RI4A 5K3FA 1UPUA 2WI8A 3GA5A 3IQEA 4AL4A 4G0VA 2WMYA 3K31A 4MUEA 1FNNA 3VM6A 2N46A 2XD9A 3DFIA 3ZBQA 3OWXA 1P1FA 2RI6A 3DKRA 1AHHA 3Q11A 4RFVA 4LF5B 4BNHA 5K8TA 4UCFA 4M7OA 4NABA 1LWNA 3AEXA 3K0CC 3MFQA 1PU2A 3QVXA 5GJVC 4E70A 4WCDA 5U4QA 3OPYA 2DQKA 3QVKA 4MPJA 1U2GA 2HJ9A 1DAFA 1DS6A 4I46A 4MPPA 1JWBB 1LPSA 4K28A 1WDMA 3H5LA 1DIBA 3X2SA 4A0HA 4GO1A 4XPIB 1GZHB 3PNKA 4LZJA 4NY1A 1AX9A 1Q6ZA 3CVXA 4U6QA 1IBLB 3BRWD 4YRCA 4OX9B 2I7VA 1KPIA 4QGHA 4CKEB 3WIEA 2AZTA 3LNTA 1AXGA 3UKJA 1Q83A 1XZEA 1LF0A 5IC4A 2Q6VA 3F2IA 1W8IA 1H69A 2OSVA 4HS4A 4OAQA 1AT1A 2A5GA 4QXOA 1C7EA 1KYTA 1GNVA 1NRJB 1NXVA 3ZWPA 2CBXA 2GGSA 4QJ5A 3N3BC 4DKXA 3EGVA 2R97A 2XA9A 2F43A 3NHYA 1KY5A 3AY6A 2ORWA 3QPUA 4WVFA 4W8HA 4BECA 2YWXA 3RJ5A 4AZWA 3RVKA 3U44A 4BX9A 2Y76A 2Z5LA 3LUPA 4MW9A 5IAGA 3TF5A 2YWEA 1R10A 4JR2A 1U31A 2O07A 1T3HA 2GI4A 1YRYE 1VL1A 3AH8A 4KGXA 3C7DB 4IOKA 1B6TA 1SD2A 3DO5A 3RS9A 3BD6A 4QTYA 3R5SA 4F8EA 2IEYA 4JC0A 3H5WA 4CQNA 3UJCA 4O0LA 4BKMA 4Q4JB 4V0KA 2Q5CA 1YQEA 1Q21A 2C98A 1C29B 3C45A 3RIHA 4CF4A 1QV7A 4PG8A 1FQWA 1L8AA 2BZSA 2WZQA 3QUCA 3R44A 1GQ2A 1K7XB 2ZIEA 1ZR2A 3PTAA 1DC4A 1ZIYA 4I19A 3WISA 3ZY5A 4DSUA 4I9FA 4O1MA 1OYOA 1E3QA 1AQ6A 1CJCA 1JR3A 3K0HA 1FP1D 1X1QA 4JLUA 4DYHA 4K9RA 4ZCRA 2R62A 1DBRA 2V4UA 3IPLA 1PVDA 4U7JA 4DLBA 1GPJA 4DCMA 4HDOB 1OXTA 1CIJA 2HPVA 1W47A 5F52A 2FDRA 3CCFA 2HHAA 5HK9A 5DM2A 1DEHA 1M3SA 2PZBA 4AWBA 1GG8A 1OFUA 3T4EA 4KBYA 1R88A 3CF4G 3VU9A 2QUZA 1E61A 3DNPA 3UXHA 1SVUA 3DKIA 3GLGB 1PWYE 2C9YA 4QAJA 3KB1A 4KXLA 4OHKA 1GT91 2AX3A 5JCJD 3I45A 1T0UA 2ZQYA 5KX5A 2JDIA 4ZEXA 3RYTC 1R6TA 2IS2A 4QZVA 1N5RA 4PHFA 5L7WA 3L92A 4TTAA 3WBBA 5CB4B 3CT6A 1M5RA 4RD3A 2XAAA 3FTDA 3T1OA 3OECA 3QA3E 3C97A 4NZPA 5AKJA 5I7HA 3EDYA 3SAJA 2E5FA 4CMCA 4E5DA 2FSGA 1Q74A 2X22A 1SOMA 3F96A 2NIPA 1TVCA 4JFAA 4R7ZA 3AR7A 4MGYR 4LF6B 4EVQA 1C4XA 4Q34A 3AF4A 3N2LA 1TL7C 1AGXA 1P8JA 1N3YA 5IN5A 1N34B 4EW3A 3NJ4A 2FW9A 4P7BA 2C59A 1L4BA 3FJ1A 2VP9A 3L7DA 3GZJA 4LECA 1KNXA 1HT1E 4OQYA 3V8NA 3CLUD 4F4JA 2GM9A 1NONA 4NU0A 5ALQA 4MO2A 3EPRA 3KAKA 3E2PA 3QHAA 5LP1A 3C74A 4YJHB 5ALGA 1YFZA 2I2WA 3MCWA 3QKSB 3E05A 1E2IA 5KCZA 2PSJA 4LFBB 3AOEA 4WBNF 5IPFA 1J4AA 5JSHA 1NVMB 1MRZA 1KY3A 1P80A 1TD1A 2Q5QA 3IAHA 1XL1A 2XTNA 5DLQC 2ET6A 1HOXA 3C3YA 4BC1A 5KQLA 2A58A 2W6OA 3K8YA 3CX6A 1HT0A 1Z8FA 2GAJA 3GLKA 1UPAA 1M0WA 1RHKA 2CZQA 4KPFC 3SZGA 1EKXA 3OBBA 3WK6A 4YT8A 1KZ4A 2ZQ5A 2A9PA 3BQMB 1Q0HA 2B98A 4F6CA 2VRWA 2FWRA 2NZ2A 4XEHA 1N4DA 1GCOA 3ENWA 1Y7TA 3VPDA 3WV5A 4Q4AA 1C1HA 2V96A 4FMBB 5HS6A 3FNFA 4BQIA 3RFCA 2COUA 4GRDA 4Z7NB 3VJRA 5HKOA 3SXJA 2QL6A 4BE7B 2IQ5A 2H3EA 1O2DA 3GFFA 4EHFA 3R41A 3H6KA 2WSSA 2ZTLA 2LZ0A 2EZTA 1W52X 4CIXA 2GPTA 3F6EX 3O2SB 3PI6A 2PBRA 2HSWA 4GGOA 2JAPA 3KSRA 1XZKA 4B3IA 1UT5A 4WDQA 2XF8A 1K5DA 3NBKA 4CODB 1MO6A 1WCXA 1BXGB 3DV0A 2XSZD 4GEKA 4N0PA 1DQPA 1J2UA 2PO5A 3LF2A 1N5DA 3EVDA 4Y2TA 5JS2A 1JJ7A 3AL2A 4Q37A 5GIOE 4O1IA 3PJGA 4RJLA 2V7UA 4IIGA 2XMRA 3CUUA 2YBEA 1EINA 3JQEA 1CUEA 3K9NA 3FR7A 4ZOEA 2J3KA 3TOSA 5IEJA 4U7HA 3D1LA 2CMFA 3FUTA 3T3IA 5IAEA 3RU2A 4MINA 5KKAA 2QN2A 4MYTA 2DUJA 3BICA 4RNDB 1YFKA 1DQSA 3HACA 3MWEB 4N8SA 1KR2A 2BRUA 3QEJA 3U3XA 1FU7A 3THRA 5BNFA 4ESHA 1ULSA 3GGPA 4RM3A 5P21A 3V2UA 3ZWXA 4G5GA 5KVQA 2RHWA 1CS0A 2XUJA 1OLSB 2Q4TA 3JQCA 4AF8A 5C1PA 2GJKA 2HWUA 5C2JB 1C2YA 1PGNA 1L5GB 5AVVA 5CEEA 2C8KA 4QGFA 4JU9A 2ZZKA 4KAAA 1A27A 5CBPB 4FFDA 2OTCA 1PNVA 5K0FA 1ORHA 2H4ZA 1HI9A 1MB3A 5I7WA 1UBHS 3LPNA 2IH4A 1ZXXA 1A82A 2NAFA 5C8VA 1ONNA 1ZMXA 4ZVSA 3H4TA 1NI4B 4PLYA 2DPGA 2VHQA 3E84A 5FB3A 5H3LA 3LPLA 1L5HA 2F6RA 3SKXA 2DKNA 1Y33E 4TSFD 1MT0A 4A6EA 3LLCA 1N5OX 3EG5A 2PFKA 3LLVA 2Q3FA 1FUYB 2GF0A 3AWDA 4RPIA 1E63A 1OX6A 1FZTA 4MYCA 4MS1B 3DBRA 3FH0A 5B6JA 2JGFA 1JFVA 3BB1A 3PNYA 4N3GA 4DA0A 4DC9A 1BWPA 4ER3A 5C32A 5H8WA 2A86A 1L4MA 3FVTA 1QFXA 1ZVJA 3ZU5A 4MVJF 2HY7A 4HDNA 2H1RA 5FLXA 1UKEA 2IOQA 2VZEA 5FWDA 2MMCA 2GN4A 4N47A 5AM4A 3HU3A 4IIDA 2XZPA 1DWOA 2REXB 3L4KA 1SC1A 3G0HA 4EG4A 5AK3A 2ZAOA 2QTFA 4HUQB 1DV2A 3SK0A 3WSVA 3SN6A 2WWHA 5IMSA 4XQ0A 3GGOA 3P9IA 3WGUA 4TT8A 1O58A 1R4NB 1W4ZA 1XU4A 4IDFA 4CM7A 2PJZA 5GTDA 4FQ5A 4PO8A 3NHPA 4ZAFA 4WBNB 5KSOA 3N2GB 4ZT3A 2JHAA 3C5CA 3QYAA 5E6UA 5E4YA 4R69A 4N8DA 2H1FA 1B1CA 1XX6A 2Z2IA 3JAMA 4ZQFA 1EFPA 2NYUA 2HWXA 3OE4A 2WBLC 3CISA 1YC5A 5KPDA 1I1NA 3CH7A 1LD3A 2AYXA 2ICAA 3BT7A 4MWEA 2VDMB 4Z4EA 2JLVA 5AJYA 5ALSA 3E22B 1LDMA 2XMZA 3AUUA 5EEGA 3PB3A 1JAHA 3IPXA 1D7OA 4DSTA 1W5BA 5BSVA 5K8VA 4YMWA 1QWSA 1ZCAA 4F9TA 4PYLA 1RIIA 1VPVA 2C61A 1TM1E 1VCHA 1C9MA 1F2UB 2WAOA 4Z0PA 1P2SA 3G02A 5ABPA 1UZUA 3JAKA 4V0RA 3I9JA 4RK7A 3M6WA 3BSWA 1DDOA 1RMYA 1N2IA 1V43A 4E51A 4UNNA 5JWOA 1DKLA 1SUCA 1N0UA 1QIGA 1W2WB 2OD7A 2PS9A 3BH0A 5JFOA 3RS4A 1P1IA 4YBRA 3NB0A 4CWAA 1P3JA 1UWLA 2BPOA 3K2BA 4CTOA 2G1PA 3L7NA 1E7SA 3AONB 3KNZA 5DGHA 3CW9A 3TTWA 2KHZA 1NRXA 2EKPA 3M4ZA 4PNZA 4JI7B 3WJ2A 1A72A 1IZ8A 4AVYA 3VKWA 3FFWA 2OM2A 1GGEA 3JTMA 1FFXB 1CV2A 3LHFA 4JGIA 4RMGA 5LZ8A 4B2IA 4BPRA 4DADA 4EUFA 3BMQA 3O1JC 4M0PA 4NR0A 3VNSA 4NFLA 2QN6A 2A5YB 3RYHB 3ZYZA 1G5FA 2PLFA 3QFRA 1A9PA 3QXGA 5IMBA 2QAGC 3N3AC 5FKJA 4EQZA 2BFDA 4AY6A 4DLAA 1RWKA 4NBTA 3VOTA 5EFZA 3GGGA 3IB3A 1X6VA 2IXEA 3CIFA 1OZAA 2Z04A 3CUKA 4X60A 3W2FA 2EX0A 2ZTMA 4C0XA 4URZR 1AZLA 3H3FA 5ITWA 3T3MB 3W6UA 1R6DA 3ZD9A 1UOQA 1XLUA 2B34A 1SVSA 4QPCA 5ECYA 1WJGA 3REQA 4HGPA 1VE1A 4KIFA 5K0EA 1ONPA 4CIVA 3JYOA 4BO2A 3EC7A 2R7NA 2BELA 4HN9A 2I6FA 4CVNA 3CU5A 2ZITA 2AQ8A 2WIGA 2ZRGA 3PV0A 1RWPA 3B48A 2ZIVB 3P0EA 4FINA 2NTVA 1QF9A 3R6DA 1DBVO 3GOQA 5CRIA 3BSYA 4BE4A 5F5XA 2FHSA 2PLWA 3KTFA 4HQ6A 2QW0X 4B74A 1PJLA 4ZVVA 1L3CA 4EJSA 2JVIA 4JVSB 3VYRB 4PN3A 4B3FX 1G21B 2D1QA 1BA3A 4H0NA 4P7KA 2EWWA 4G5SA 3R3WA 4DVJA 3S55A 3KSUA 1V3TA 3KLNA 3NZEA 1NF2A 4PHTA 4ZVMA 1NI4A 3IMEA 3MBKA 3MMPA 4MQUA 4DCGA 4P58A 2WJHA 3A1VA 4MPRA 2Z1NA 5L45A 1DCTA 2VAPA 3L4SO 1BOOA 2VO1A 4ECAA 1ONOA 3R7BA 1ESCA 1A7AA 2HUPA 1U6KA 1A9XB 1IN6A 1WA5A 4KMRA 2AYYA 5EJIA 3G0CA 3DG9A 3GHYA 4KH1A 4ZAXA 4R2LA 4B46A 5IDQA 5FI1B 1DGQA 1GPDG 2PH3A 1IHUA 1SXJC 3IAFA 3FB4A 1ENPA 4OGGA 4FCVA 1G5PA 2ZYAA 3K2IA 2ONYA 4Q39A 1I36A 2P2GA 1OYVA 2PYDA 1HFEL 3E9QA 3H7AA 2OHGA 4LNUB 4TWAA 1TRHA 5F5NA 5SV2A 3D59A 1E1NA 4GZ6A 3L2OB 4NNOA 4YDSA 5LNK1 1G98A 3RU7A 1U8YA 5LKRA 4BNUA 2GM4A 2IXFA 4QXQA 4C7JA 4C7KA 3OJ0A 4I9UA 1JEOA 1B8OA 4G2TA 3AEKB 3TFQA 4KQHA 4DIFA 4P7FA 1TM4E 1X8KA 2YV5A 3BKXA 4Q4CA 5IJ0B 1L6IA 2XMQA 1MO5A 2RG1A 4P9NA 3LUJA 6REQB 2XUOA 3STTA 1MVNA 1TZ2A 1WCWA 4E6PA 1PWXA 2ZSEA 2IW1A 2IS4A 1VL2A 4FB5A 1I3MA 2BUCA 1Y5RA 3W9SA 2FQ1A 2BM9A 3LZDA 3TRJA 2H1IA 4BV3A 5HF5A 1SXIA 1OILA 4MKRA 4KI0A 5EYPB 1XKTA 1US8A 1XA4A 2IHTA 3LC7O 4Q7JB 3GV0A 1MHTA 1DTSA 5FPKA 2ZIUB 3CZAA 3K15A 3PQ5A 3TRHA 5AXDA 3ZLUA 1H5QA 1F3LA 4LGMA 2CWWA 2AFIA 2QMHA 3EXAA 2B21A 3F7MA 4I7EA 4JLBA 4RY9A 3DYVA 1PR0A 1G6OA 3F46A 2HH9A 2OZLB 3MOGA 4IX9A 5JSYA 1JFFA 1N92A 3TZCA 3WNZA 3VC3A 2L17A 2FPLA 1XRSB 1SCJA 3KC2A 1L4KA 1UK7A 2WIJA 1P9RA 4M8NE 4MUNA 4XQEA 1KEVA 1NJ2A 4UXJA 1HE5A 3U7QA 1RU3A 1SVIA 2XMDA 4P53A 2HWYA 1PHRA 1SBZA 4W5JA 1EFDN 2LXNA 5F78A 3QUAA 3O8DA 1EU1A 4JEUA 4HUJA 4FMDF 3HB5X 4AKSA 4FSHA 1T36B 1QHIA 3H3JA 3KFVA 4LKOA 5TQ0B 2OGUA 3PPVA 1BVYF 3O4IA 5EHQA 4ZMBA 3BJIC 1Y0BA 4MEAA 2HT6A 1IUPA 4J4HA 4CETA 4NDNE 2NXCA 1FMJA 5ES4B 5KEIA 1E4YA 4NP6A 1IATA 2OGZA 3AHDA 1JSZA 1PK8A 5HOQA 3OEHA 3JALA 3B6JA 1E1CA 1MA0A 1F9AA 3DWIA 4HDSA 4GWLA 3G0IA 2ISQA 4OX9Y 1R9GA 4GOJA 1MNAA 2ERYA 1RT9A 2G1KA 2VSXA 2IKQA 3L0BA 1GU0A 1I80A 1Z4QA 2H4XA 2YRXA 4YROA 3UOGA 1K08A 1MAUA 3ZK8A 4Q4LA 3ZK9A 1B7GO 1XCJA 3B7GA 4KXMA 2NPIA 2VZLA 3I3OA 1EBUA 4JB2A 1XK7A 1KU6A 1IM2A 3DL2A 2B5VA 4D5GA 4TVSA 2O1EA 4M1WA 1PT6A 5AOBA 3RSLA 1KSHA 1XDGA 2GCIA 4FGZA 4MVYA 4FN5A 4XD2A 4G1EB 3AQ4A 4L15A 1NVVQ 5ALTA 2XOKD 4MUHA 4X20B 3TLAA 5BT8A 1JG7A 3IAS1 1JQKA 2TMYA 2V7XA 3FTNA 2XRFA 2WVHA 3QOXA 1J33A 1P0IA 1E2HA 1TOAA 4ER6A 3DQPA 4CLEA 4EAQA 3JU3A 5K6AA 2O5RA 1THTA 1ENZA 1OC2A 2PKWA 1CQZA 4HYEA 1NW4A 3PHCA 4PVDA 1SUFA 4AMZA 3P2IA 2XBLA 3LPAA 1KDTA 2ZANA 4G3XA 5CX1A 1Y9DA 1CR1A 3A4IA 2CJFA 4F5ZA 3JRXA 3LPDA 3KYDA 4AG3A 4ZGWA 2LCIA 3KZMA 4DV0B 4M0DA 2GFHA 1STOA 1OBFO 5LZ2A 2MCFA 2O8BB 4MVJA 1QONA 4JBIA 4I1VA 1OQAA 1TJ5A 2F3RA 1VI6A 4JC5A 1KAMA 2O3RA 3OPYI 4WECA 2M6LA 4PPQA 3I23A 2EFGA 4XYGA 3N2KA 3QRWA 521PA 1DARA 1SBQA 2B4AA 4K87A 5AYVA 1AUQA 5KNDH 1JSCA 1OV6A 2GWRA 1UEJA 3L3BA 4QEZA 3IPCA 3H2HA 3OZIA 1QS0B 3CZPA 3VPXA 4UU1A 2JAOA 3SYLA 4M8IA 4FBMA 1VSUA 1OYYA 1X7WB 3SKVA 1J0EA 3MIZA 5AVJA 1GSIA 3ZJYA 3FPEA 2C2WA 1RQ2A 5LDGA 3HFSA 5AJTA 5CW2A 3D3WB 2AN3A 4OHWA 1XD9A 4XEUA 1K4MA 4OQXA 3VH4A 3GBVA 4H3HB 1JQ3A 3QZUA 5EE0A 2OOKA 3CWCA 1RC0A 2JI7A 3MAAC 4JR0A 1TO6A 2EQAA 5IW8A 4BN0A 1U6JA 2YRFA 5D51S 1GGFA 1K27A 4GUAA 4A0QA 4EITA 4W9MC 1P62B 4ZODA 4RTMA 1EDBA 3P2MA 4C0SA 5LP6F 3IS3A 1FFBA 2OV6A 3SZ3A 1AUPA 1FL9A 1G4AE 1H2ZA 4J16C 4OLFA 2CE7A 1ADJA 5G0TA 5GY7A 3ZDXB 2B5OA 3MOIA 4AJ9A 1DQYA 5DSZA 4KR3A 2G1UA 2D8MA 3KKLA 2C2OA 5B5SA 4U6SA 4OHRA 1EZ4A 3QXCA 2PKYX 2DCMA 2MTBA 1CX9B 4U7PB 3U48A 2PH1A 1D03A 2VHXA 3HY3A 4HDMA 4LZNA 4MUBA 4NV0A 5I7AA 3U26A 3HK2A 1YU6A 1XCMA 3BAFA 3L7CA 4L85A 4MV7A 5FNVB 3NDPA 1A97A 2YJZA 3ZK7A 3T3DA 2IYUA 3SEZA 2J3EA 1IHXA 1C9EA 1WCYA 1XNHA 1WMEA 2NVWA 3D3NA 1T3ZA 4KAXA 2C5FA 1V11B 1W5AA 1RHMA 4K7JA 2I4LA 3AG5A 1A7KA 3CF6R 4QU8A 4X85A 4U7DA 5CAEB 2W8ZA 3CVYA 4MMZB 5EMHA 1FRVA 2DE0X 4EPVA 5C8YA 5JADA 2O59A 1ZJJA 3RYIB 1JDTA 3VJLA 4B3SB 1MIOA 1IY9A 4C6SA 3CUYA 5JEEA 4LSMA 5DGCA 1X77A 3MN1A 4XGKA 1G6Q1 2WWIA 3RRZA 2DUMA 3FMOB 1VP9A 2HQRA 4QE3A 1RWOA 3FMVA 2FQXA 1Y3CE 1VHJA 2GZSA 3CR7A 3PNVA 5H0IA 1DTEA 1KEEA 1EGAA 2HK9A 1DUIA 2Y71A 4IJ6A 1ECBA 3SQNA 5JCOC 1A8PA 2NSYA 3TSOA 2X8JA 3V1LA 1EBBA 2DWQA 1HLDA 2ZJAA 1TT7A 4B6FA 3THWA 3VO2A 2BBOA 1YR2A 4ZYWA 1JQBA 4AIRA 1U2SA 1NAIA 5CT4A 1MGPA 2FA9A 1LPAB 4P8RA 4DY4A 4QGSA 5CFMA 4GKJB 4PZPA 2GFIA 2H5JA 4ZEMA 3IB6A 4I55F 1VMEA 5A4FS 4E11A 2RJ3A 1VMDA 3LS2A 3OKCA 4UOEA 2FPGB 5IRCD 3R0ZA 4N9WA 2C77A 3ET4A 2PO7A 3NPMA 4GOMD 3DMGA 4YY3B 1E0AA 4AYTA 2QN1A 1YCDA 1RAHA 2ZSBA 3E9EA 4AAYA 4I4LA 4RJTA 5HJ2A 5K05A 1WMAA 4ZV7A 3PEUA 4DMGA 1P81A 2OGSA 5DJ5A 1O9HA 4R0MA 1FRFS 5BVGA 3BGOS 1A1VA 1LQ2A 4RETA 2PX8A 4DF3A 3KXDA 4F3NA 2ARKA 5T4FA 4EPXA 3G2KA 3DMPA 3BXEA 3WYBA 3HVRA 1M2VB 4I5FA 4RZHA 1HF3A 4PR3A 4N5MA 2QW1A 3HWWA 4TYQA 3RUHA 4AY2A 1B6GA 1G291 3AB7A 1GKYA 4WUVA 2XT9A 2VXYA 2VJAA 2DBYA 3HCCA 5KKNB 1SU7A 3CLTD 4GP9A 1B6RA 3IOCA 3C4JA 4GKAA 4LY0A 1FY2A 1DBSA 1G42A 3N58A 1AS2A 1NX6A 4A8JC 1DZIA 5J4VA 4GLLA 1RYMA 2IXGA 2V7WA 3O92A 3QJGA 3UAWA 3DGFC 4ITUA 2WG1A 1AG9A 1GPH1 1XNJA 4QXRA 2MR5A 1JR3D 2AA3A 4YNBA 3T99A 3J80A 4CEHA 3UJDA 5IHPA 4JX9A 1AUXA 1WSBA 2O54A 1SVOA 4YXFA 1O6ZA 3G0GA 4LBVA 4FHZA 2B3DA 1V7PC 5J58A 1F4PA 4FYKA 1X1TA 2AFVA 4C4RA 2EKBA 4O29A 2JFVA 4YP1A 3PITA 4DLUA 1AQJA 4PZ9A 4BN5A 1ILWA 1R4AA 2OFXA 4DWJA 2CL7X 2YJ4A 3STUA 5E1DA 3V8EA 1GLVA 2JDID 4WKCA 2YMQA 2IOHA 3EMVA 1SKAA 3SZMA 1GRCA 3W7VA 1UMKA 2EX1A 1T0IA 3SQOA 1E77A 3JQQA 3PWSA 4Y0NA 1QRTA 3AJEA 2C3MA 3ZE9A 3ZZUA 2PLRA 2OMEA 2RGUA 3BMXA 5JRDS 4WACA 5HIJA 1Q0RA 1RJ9B 1WZIA 1M83A 4YPFA 4AROA 4EYQA 1TMOA 1LLCA 4DM4A 3S4YA 1PZNA 2YCBA 1OROA 2PYIA 2ZBQA 1Q1GA 3TQSA 3U4CA 5IT5A 4QDUA 2YYYA 3MGGA 3AFIA 4DE5A 1H1TA 3WL5A 1ATIA 4FIZA 3HCDA 4DR7B 4GKKB 2IU0A 1IZ0A 5GM1A 5UKDA 3VV3A 2AFHE 2XLBA 4PPFA 2JD0A 3FKJA 3K8OE 4U7WA 3IXLA 3DA8A 3TW8A 3B3GA 2FYTA 1KO5A 1S8AA 3PNSA 4FEEA 4UAGA 3C3WA 4WOKA 2RH5A 4D98A 2J6BA 4Z7QB 1YQWA 2XDAA 1AA9A 3I9V1 1M7HA 3KB8A 3DE0X 3Q98A 1YCGA 4YCBA 5KJCA 4EMSA 1XTBA 3UF0A 2AFIE 4C3UA 2Q8QA 3Q6IA 4X61A 4AJEA 5BWLA 2A1UA 3JQBC 3NHAA 4FDUA 3RC9A 2AMYA 2WJPA 3EVTA 2AKEA 1DLJA 3GDFA 2BEVB 4QA9A 4QQNA 2IYVA 2YZ2A 1EYZA 4YJ3F 4UM8B 3TL6A 5DDIP 3WA6A 1I51A 1HNXB 2NX2A 3GCWA 1GUBA 3U19A 4C2TA 4PAOA 5EMJA 1JBEA 1Z5GA 2X6RA 3EZYA 3OTWA 3QJYA 4BLWA 4DA7A 4KFTA 3GJTA 3ID6C 3VR5D 2E2WA 2W6PA 3VYVA 5KQRA 1J8MF 3EIHA 5J1TB 1E9CA 5FUMA 4REQA 5AVYA 4BXOA 5CR9A 2WSIA 3NP9A 5KYNA 3OZWA 2BC9A 5EJ7A 4PYNA 3R20A 4ZEVA 4IGEA 2WK1A 5DP1A 2NLOA 5I8PA 2EBFX 1S1MA 5HBRA 1YR7A 2P8JA 1Q7RA 3C39A 1NN0A 1K8RA 2VFAA 3AUFA 3GR6A 4W5WA 4ZK6A 1QIKA 4KACA 4ZXFA 1QVVA 1TK9A 2X1LA 2Z8XA 4F6RB 2ILVA 5HCNA 1QRRA 3GNTA 4OL9A 4DLRA 4YFVA 5GPBA 3ACCA 3WZMA 2Z08A 1MIHA 1X86B 3FOWA 1YR9A 3LC0A 4G9EA 4U9IS 6NULA 4GYKA 4G23A 2AN1A 2H11A 4WXEA 3TNLA 1VJ1A 3P4UA 5EMNA 1L7EA 4M0FA 1OIVA 4IRMA 3R8FA 3BGDA 4PE5B 1HDEA 1SVKA 1T34A 3CIOA 1F7UA 2B9VA 2QZSA 2O8EA 4P1ZA 2LVBA 3PGMA 3AHEA 1LI5A 1S9HA 3IR7A 4AW9A 1AMUA 1IB0A 4KN8A 3RS2A 5BQ3A 5BSUA 4FOPA 2YV1A 1XQYA 2ZSDA 2FE1A 4AZ3B 3KJNA 4CKWB 1OXVA 1YONA 5A3RA 1KEKA 3HDQA 2HSGA 2VYFA 3EG9A 4B09A 7MHTA 1VJTA 4OJYA 5HCUA 2IOYA 3NNNA 4IJUA 1BH6A 2VK4A 4BP8A 1K06A 4KVFA 3ZQ6A 4AJJA 4OH1A 2AE1A 4ZOLF 1PT5A 1VHQA 2Y67A 4B85A 3DUFB 4P2GA 2CEAA 2GNPA 1UP6A 2AMVA 4H1UA 4JOCA 1BE8A 1JSXA 1KJJA 5CA1F 1AHPA 5FQOA 3OZCA 2Y3IA 2IJGX 4DYDA 4NCXA 5DPMA 5BWBA 3J7AC 5JATA 1RVDA 2B6NA 2FWPA 2ORED 2ZR7A 2ODEA 4MVJE 5FJJA 3LHDA 3WYCA 1KWKA 1TAUA 3G68A 5IYZB 1T2CA 2VZ0A 4RTSA 3L8HA 1GARA 2E4UA 2F3SA 4LJ6A 2IYEA 3QFCA 4AJNA 3HL4A 4MS4B 5LP6A 1O08A 1JVBA 1XJWA 4JVNA 4JUAA 2BMJA 3VV2A 3WLQA 2ZT8A 5LDDC 4PCAA 2FR8C 5I7UA 3JARB 4X97A 2QRHA 2B7CA 2I3AA 2ZVPX 4DDUA 4R9RA 1RYFA 4HNAA 5GONF 1Q20A 1QKKA 4JKIA 3DVSX 1FP2A 4HTAA 3SPXA 1N3LA 4K2HA 3TI9A 4ZMRA 1ZC4A 1HYEA 3TPZA 3IUNA 4WE3A 5EWJB 2WWYA 3E3LA 1RYDA 2CXOA 2AMFA 3VJMA 3ZHOA 1K6JA 2PE5A 1GM5A 1YU9A 5JYEA 1EE9A 2LR0A 2R84A 4RH3A 1SA0A 1Z82A 3JQRA 3KIPA 3MYYA 1L7AA 1M2JA 4LVNA 2XEXA 3UAVA 5LJLA 1RPZA 1OU4A 2Q27A 2PUGA 2ZQZA 4KQ9A 1Z36A 1XLWA 2W2XA 1SVNA 4L1KA 4TZ6A 1GQFA 4H0CA 1W25A 2HDOA 3AF0A 3G9XA 4OB6A 4LEIA 2FF7A 3GW8A 1NATA 1QAQA 3B3AA 3G8AA 1T9GR 3L6BA 1KVRA 4IH4A 3ETLA 4UQOA 3A28A 4PYRA 3E9ZA 4QUIA 2G6TA 1A4UA 1C1DA 1EE2A 1I6WA 1XVVA 2DR0A 2EARA 3GJRA 3R4CA 1UJ5A 3FCCA 4RD1A 4GHWA 4JB0A 1DP4A 5DKFA 16PKA 3KE9A 4DJAA 5CB0A 1X3SA 3H9GA 2R60A 4B82A 3ORFA 3OJWA 4GSKA 4HRXA 5HPYB 4MLPA 1X9GA 2G07A 1W7AA 1I2MA 1S01A 1L7QA 1V7CA 1IQPA 1TT5A 2H2HA 2Y0BA 2ZJBA 2CFCA 3I1YA 4Y9DA 5DXAA 1VIAA 3VSDA 4LISA 3OETA 4H6VA 1NY5A 1TU3A 4J3FA 2PN1A 4LYHA 3KSDO 4MP3A 2OP1A 2DG2A 3ND6A 4MMYB 5PNTA 1JDSA 2RKBA 5A9SB 1JHOA 1N75A 5DULA 4HYTA 3B6IA 5DN6D 2ONCA 2R1ZA 2BEVA 2VTVA 1DWUA 4I55A 4JLAA 1RW4A 2CY0A 3M6LA 4BNYA 2MWMA 5K0CA 2WMOB 4HH3C 4INJA 2GPYA 3EZGA 2VH2A 3O03A 2DCUA 3LUAA 3SDBA 4BB6A 4BO4A 3JVVA 4LFCB 4L57A 2BTQA 4ME6A 1I8TA 3N53A 2XDQA 3FOFC 2D5LA 5G2OA 2QLNA 1PFUA 1CJMA 4M0CA 4NC9A 3Q3EA 2B61A 4E5PA 3PC3A 2XQKA 3G5TA 4ZCPA 3T38A 4NJMB 2GARA 4PC2A 5FUWA 4QXAA 5E0KB 3FHTA 3X1JA 1R0YA 1JIQA 2RGGA 4KQEA 1ZFNA 3NETA 3ZWWA 3G0BA 1GSHA 2ACEA 3QXSA 3C3BA 2GCOB 2FCRA 4LJYA 2YOGA 5C4MA 4WY5A 1JTEA 4L8GA 4JBYA 1E3LA 1TM5E 1E2MA 5DVZA 3GRYA 5AVZA 1A5TA 1CEXA 3H17A 3HFJA 1SBYA 4QLOA 4TRRA 1IM8A 3PZBA 3D9QX 3RFUA 1U0HC 2DXIA 1Z63A 4LFAB 2OQVA 1W76A 3GDHA 1SXJE 3PHJA 5DHRA 4BNXA 3EGXB 1W87A 4GX1A 4OLJA 3NTUA 4NNPA 1XLTC 3OM9A 1ZHFA 2PKCA 2FAXA 2OBYA 3PTLA 1E99A 1D9ZA 1T1GA 4M0UA 5EE1A 4UM9B 5KTMA 1JDUA 1SBHA 3MTEA 1EK0A 3T9DA 4YV2A 3SQWA 4AJKA 2Q2NA 2RHDA 5JYDA 1BAPA 1ODJA 5CDFA 1Q3TA 1QOQB 2FLWA 3OMLA 5DOZA 1TFRA 3A7EA 1GVNB 5JV5A 3VO8A 2NW6A 1C2TA 1XEWY 2JC3A 4IMIB 3CTMA 4FIDA 4DA6A 1QZXA 1C8BA 5L40A 1VC2A 2C8JA 3FHJA 4KE6A 4Q9NA 4D9GA 2BEUB 1WP9A 1KMHA 4JBLA 4J2TA 1W75A 4CEIB 1E9AA 4M36A 3OIWA 4QHYA 4X9XA 5EL0A 2GQ0A 4B44A 3B89A 3OUTA 3HB7A 3EY9A 3P32A 4EG8A 3B1XA 4G89A 4A91A 2OHIA 3X1DA 1HE4A 1Y7LA 2Z57A 4LYDA 3B6ZA 3SQMA 1WR8A 2IYXA 3V7NA 1YS1X 4G5RA 4YBZA 3O84A 3TX2A 1BCRB 1D2CA 2R4QA 2NT4A 2QGFA 2RB5A 3JVEA 3QOYA 3QU4A 4XTRA 5KNCH 4YLEA 4LSWA 2F4VB 3EDMA 1G9TA 3IULA 4N6NA 4QGBA 5B2ZA 5NLLA 4EEZA 1TYBE 5LPNA 2D59A 3EFEA 1RJEA 1D1TA 2H8GA 3AVOA 2J85A 3L6UA 4G36A 3VO1A 4D43A 4EECA 5KTRA 1R8YA 1GKUB 4TPKA 4P98A 3TZQA 5G1NA 2PUWA 1FQOA 2XXAA 4RDIA 1B4DA 2YZKA 1XNQB 2ZU6A 3P9KA 3CEPB 4IW3B 3LPMA 5EWMA 4WJKB 2HWWA 1OBHA 1WVGA 3B1YA 4B47A 2PEZA 3VYTB 3BSSA 2SHKA 3MTDA 2Q0SA 4BMXA 3OIGA 3QLUC 1CD5A 1H6CA 1DV1A 3K32A 5BPHA 5JJ5A 3LDHA 1SR8A 2CDRA 2ILTA 3EVGA 2AOTB 3N0RA 1FDSA 1ZOLA 1QE5A 2HGZA 1NVTA 2YH2A 3L0IB 3ETDA 5M04A 2OCLA 2QTMA 1NJGA 3CC8A 2VH1A 4GLJA 5DWQA 1A2KC 1YB1A 2CMDA 1Q95A 5J2TF 3CA8A 4PZYA 2ZRJA 3DOIA 1NQUA 3H0CA 3KALA 1M1NB 3HCBA 5A9SA 2JKYA 2OBBA 1A8HA 1SVLA 3HQ4O 5I9BA 2F9FA 1QMGA 2Z8ZA 3A9RA 4QC2A 4RVHA 1CUIA 4NZMA 4BKUA 4BQSA 3KM0A 4NARA 3V4PB 5P8WA 4TMVA 5A6SA 2Z95A 1WV1A 3D7NA 3OTHA 4QX6A 3SD7A 4Z86A 2QJTA 2G17A 3TQTA 2BFPA 1JEYA 1YR8A 1R8QA 3AVQA 5FAXA 3WRXA 1XF1A 2CVPA 5AVKA 2I6TA 4YHBA 3FZNA 1X1SA 3DHYA 4O4IF 4OY3A 3ZU6A 1KKMA 1PUXA 3AEZA 4UE3S 1ZLYA 4ZQGA 3OEHD 1O96B 2KLBA 1S7GA 2D4HA 1VPDA 3VTFA 2QSUA 2F1JA 4NE9A 3TAXA 4B3GA 4FT4A 1YRWA 3LM8A 2WAYA 3HDYA 3OSUA 4GKVA 2WG2A 5E3IA 3ZTYA 4B0PA 2QDXA 4A0FA 1MRNA 2FN3A 2ZKLA 3L8ZA 1ST2A 5IUNC 3B2NA 3G2PA 3RVBA 4QFCA 2VNJA 3WLEA 1X80B 2C9MA 4MAAA 4JN6B 5IBPA 4R51A 3NPAA 3P71T 1P0PA 5FD8A 1MGOA 1QO0A 4QGAA 4B6QA 4BQOA 4KGDA 4DMRA 2HXGA 2JK0A 1TUBB 1SY7A 2OP0A 1RYHA 1NY6A 4E7PA 3OUUA 4KPUA 2LKDA 1BQ4A 4QYSA 3EGOA 4ZOLA 4ZT4A 1KVSA 4S1TA 5EP4A 2HHCA 4I99A 4RORA 2VSFA 4TYMA 3NATA 1OW3B 3DEKA 3EGXA 2IEBA 1WQ1R 5CA1A 2FEKA 1P7WA 1OB5A 1M9NA 2RK3A 1UDBA 2YY6A 1M2KA 2WM8A 1OAOA 3K5PA 1J2JA 1S2GA 4NBRA 4RJIA 3W2GA 3GWGA 3PD7A 5JVDB 2QBYA 1WKCA 3DOJA 4G0XA 4B45A 3ASVA 1ZSYA 3CUWA 3IMCA 4XIGS 4MWGA 2P1RA 3I2YX 3K4HA 2C96A 4BGDA 1GZ7A 5HKKA 4PGGA 1GTL1 3B2QA 3GP3A 4MVJD 4EABA 5DNYB 1BS1A 4U2EA 3CRMA 4NS1A 3G17A 2YXDA 5AW4A 3WMXA 4GT1A 3ELUA 4A0GA 1QRUA 3DJYA 1EVIA 4WKNA 2Y0PA 2BHRA 3VNUA 3DT8A 3L5OA 1Y37A 2VQDA 1KAGA 4IH1A 1YSCA 3F5DA 1JG3A 3KUKA 4XSVA 5AKEA 5GONA 1MEEA 3DE2X 3WGGA 3ZI0A 4DC1A 5E4TA 1KFBB 1OT5A 3VR1A 5FIUA 3D8SA 4U0KA 4CMJA 4NRDA 5G02A 3X1WA 1U6IA 3A4VA 3MUFA 2NXWA 4NJEB 4BJ3A 1XMPA 5KTOA 2QRGA 4ZQHA 3OOWA 3Q41A 1XHLA 3M8KA 4P32A 3RJTA 3I9NA 2ZAIA 1PZHA 3KZNA 4BX0A 3PQDA 2H00A 3U9TA 2NZ8A 4P80A 4ESEA 1DC3A 3V8VA 4OUDB 2PWBA 3ZDYB 3FFAA 5DNWA 5AJXA 1UM9B 3KX2A 2E4ZA 4I9HA 1PFGA 1T10A 3AMVA 1GFIA 1WD7A 3HBJA 2Z2XA 1UFKA 3TN7A 1N4AA 1QTIA 2CUZA 4QLAA 4KEAA 4OD0A 2OXTA 4WCFB 5CCEA 2OFPA 4UARA 4LV6A 1KAEA 1KH2A 1X1RA 2FP3A 3B5JA 3GJXC 1TM3E 1D4FA 1B74A 3NBUA 4GMKA 3L7OA 4ARUA 3KKPA 3ZWCA 4XWKA 1XMIA 2A0YA 1MAHA 2BDUA 3MUNA 4ZIRB 1XQ9A 1VYHA 1N2SA 4WFIA 2GKGA 3ANMA 1G6KA 3DLTA 3TW4A 1WETA 1U2DC 1CZUA 2R85A 1P9WA 1LF5A 3OWHA 4OQNA 3ZJUA 3A25A 4IIXA 3R6WA 5E9QA 5BWMA 1W8DA 4OQZA 1Q50A 2RAVA 2R8BA 4O4IB 5K0LA 1E1QA 2SKDA 1R6UA 1OPXA 3B7PA 5CNKA 5FLYA 4D0LB 4G1VA 4S1OA 5FWNA 1O95A 2UYGA 1SQ5A 5AIAA 3W7BA 1PTJA 4EATA 4EX7A 2C84A 1HETA 1HLGA 5FUVA 2X1MA 2GF2A 3QLVC 2ORVA 2WZBA 4IXNA 4EGAA 2VAXA 1N1MA 3DAHA 2DFNA 1XZQA 2FWBA 3LTNC 2BH2A 1G4HA 2CYBA 2PVCA 1PX0A 1QCYA 1A9OA 3COZA 2ZT6A 3F98A 4NOMA 5ELLA 3TZHA 2DU8A 3VC7A 4JJAA 4Q3BA 4TQGA 3JZMA 4CV2A 3KQSA 3NIWA 4P3YA 2R1TA 2FRVA 3N76A 2H08A 1FDOA 4YX9A 5F51A 1ECPA 2JEOA 4EO7A 3ZXXA 1RRFA 2ZAGA 1PG2A 3IOBA 1O96A 5B1SA 2C2YA 2R86A 3JD3A 5CXSA 4D74A 5CG1A 1G2PA 2COKA