2Y1LA

Caspase-8 in complex with darpin-8.4
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
150
structure length
150
Chain Sequence
LDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/inhibitor
molecule keywords CASPASE-8
publication title Caspase-8 in Complex with Darpin-8.4
rcsb
source organism Homo sapiens
total genus 56
structure length 150
sequence length 150
chains with identical sequence C
ec nomenclature ec 3.4.22.61: Caspase-8.
pdb deposition date 2010-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2y1lA00
1RWNA 1RWKA 1RWWA 4AWBA 4AWAA 2J30A 4QUBA 4ZVRA 4EHHA 2H5IA 2QLBA 2QL7A 4EJFA 1RHJA 5IAGA 3V6MA 4ZVPA 4QTYA 4PRZA 1IBCA 3D6HA 4IYRA 3D6FA 4FGUA 4EHNA 3IBFA 4QUGA 4EHKA 1RHQA 4JQYA 1F1JA 1NW9B 1QDUA 4NOMA 3UOAB 5IAEA 5IAJA 4NOJA 3EDQA 3GJRA 1RWVA 5JFTA 4JB8A 1NMQA 5IASA 3V3KA 5IBCA 2C2OA 5IAKA 5K20A 1I51A 2XYGA 1SHLA 2H51A 4D3XA 4N5DA 4QUEA 4N6GA 2CJXA 3UO8B 4PRYA 4I1RA 5IBPA 4I1PA 2NN3C 3GJSA 1CVRA 4QU0A 2H48A 1BMQA 5LU9A 1QTNA 2HBQA 4QTXA 2CJYA 3H1PA 2XZTA 3E4CA 1SC4A 3V4OA 2XYHA 2H5JA 1RHMA 3DEHA 4JR2A 2HBZA 2J32A 4QUIA 4ZVTA 3R7BA 4EHFA 1CP3A 4N7MA 2XYPA 3KJNA 1I3OA 2QL5A 2J31A 2Y0BA 2Y1LA 4NOKA 5IARA 5H0IA 1JXQA 3S70A 3NKFA 3GJTA 3R7SA 1I4EB 3KJQA 5IC4A 4JJ7A 3GJQA 2CNKA 2QLFA 4ZVOA 4N6OA 4AW9A 1PAUA 3DEKA 3DEIA 4HQRA 4FDLA 2DKOA 3R5JA 1SC1A 5IC6A 3NR2A 2C1EA 4QU5A 4EHDA 3H11B 1RWOA 4IEFB 4HVAA 1SC3A 3K7EA 3H11A 4JJ8A 3NS7A 3KJFA 3RJMA 3QNWA 1QX3A 2HBRA 3OD5A 4D3ZA 1ICEA 1K88A 2K7ZA 4FEAA 4EHAA 4EHLA 3EDRA 4NBLA 2P2CA 4NOLA 3H13A 2AR9A 2XZDA 4FXOA 1KMCA 4N6NA 3V4LA 3S8EA 4QU9A 4QULA 1RWPA 3BIJA 3SIRA 4N7JA 1I4OA 2H4WA 2QLJA 2H4YA 1RHRA 2CNNA 1SHJA 3R5KA 4JQZA 1RHUA 3IBCA 4NBNA 4QUJA 3PCXA 3SIPA 3V55A 4D3YA 2FQQA 4ZVUA 5LUAA 1RHKA 4QUDA 4HQ0A 3PD1A 2CNLA 2FUNB 3R6LA 3R7NA 3H0EA 5IABA 1PYOA 4JJEA 1GFWA 4QU8A 2H65A 3V6LA 2H54A 3DEJA 4DCJA 2QL9A 1GQFA 2WDPA 4DCPA 4DCOA 5I9BA 2J33A 2FP3A 1F9EA 1NMSA 1RE1A 2C2MA 5IANA 3PD0A 4QUAA 4JR0A 5LUBA 3D6MA 3R6GA 4PS1A 4QUHA 2CNOA 1RWXA 2C2ZA 1NMEA 3P4UA 4JR1A 4NBKA 5LU8A 2HBYA 4LSZA 4ZVQA 4M9RA 3ITNA 4ZVSA 3P45A 1RWMA 2C2KA 4PS0A 1K86A 1M72A 5IBRA 2CDRA 5I9TA
chains in the Genus database with same CATH superfamily
3FDXA 1VFPA 2GCGA 4QTTB 5GOZA 3GT4A 1QMPA 1WQ4A 2JJQA 3IMKA 1J8YF 4NBVA 3TIXB 3MWLA 3I2YX 4DLYA 2YY5A 5DBIA 4EH1A 4BO1A 1H5UA 3P0FA 3WK7A 4AYWA 1E2KA 1MH9A 2I7VA 1VDMA 4G4JA 1XC7A 4JL5A 4QUGA 1CQJA 4BVHA 3PRHA 2X5NA 4DYVA 4EO4A 3GDOA 2CF5A 4R8LA 2GRUA 4CEIB 4BXOB 1NUQA 1OLUA 2JLAA 1KQPA 3OLZA 1JL3A 4OXXA 5F9HA 1FXSA 4FVTA 4FYWA 4IOJA 5EG5A 2FFJA 2OMKA 3D0OA 3K30A 3OURA 3PR2B 1RAHA 2GCNA 2WJHA 4UHFA 1PT5A 5K8JB 1L8AA 2XT9A 4I99A 2VPIA 4JT8A 4OYHA 1ZC3A 2QP4A 1TC1A 2ZJFA 2WWYA 1EVZA 4F92B 2X0IA 3GI1A 2NN3C 1K6XA 2IGTA 3FDFA 4R83A 2J9RA 1ADYA 2BMEA 4KMSA 1FU4A 2C7RA 2LGJA 1QFJA 3O9MA 5H3CA 5B2ZA 3ZBTA 2NUPA 3V48A 2O8NA 5IPFA 2DLDA 1YJ5A 3ROQA 5KJCA 3N59A 1TYEB 4YCBA 4CG1A 3RYCA 5BN5B 4PWZA 2I6FA 5C3UA 4HVLA 3I34X 2E1PA 1UKZA 4PLCA 1P4HA 4JBNA 1CUVA 3DNMA 3VR6H 4JUIA 2GNOA 4RZXA 3UMCA 1PFQA 2YYAA 3QVUA 2REXB 3BK1A 3GO4A 2AD5A 4FKZA 1NN1A 4L76A 5TMDA 3WNDA 4U02A 2AS0A 4QJBA 4TKLA 2SKDA 1XNQB 1KIAA 4UOZA 3FJYA 3S2YA 2EQAA 1FYEA 1E3LA 2XAUA 2HHHB 3T1HB 3LGAA 3VR6D 5FBKA 5EMJA 4E13A 2XWPA 2BMFA 1Y5RA 1OXMA 4UJ3A 2K4MA 5HFNA 2NU6B 3H4IA 3AGQA 3BHIA 5FI1B 3CX6A 4EO9A 3RB8A 1IZ0A 1JSZA 2Q1TA 1IHUA 2AOTA 3CWCA 4U5XA 5DULA 4BNTA 3OE5A 2Q4OA 3MCUA 2WQZA 3WSVA 1WCV1 1LSSA 3AEXA 1F4VA 2C9ZA 3FMOB 2AGVA 4LNHA 2CLMB 3R3XA 2P9TA 1ICEA 5BW8A 1THMA 2XJ9A 4LYEA 5HJ2A 4LZPA 3AERB 2IHVA 2V7VA 1VPLA 5BXYA 3HKCB 3E5MA 2QIPA 1CJBA 5DOVA 2X0NA 3BRCA 1RI4A 3SMQA 1AKMA 4JSRA 4MMXB 4CLRA 4DN6A 5A4FS 1USIA 3VA7A 4A0HA 2C3MA 1GM5A 1RYMA 1QG0A 4QUJA 5FBHA 1ZRSA 2FZ5A 2GSWA 3AL0C 3MWDA 4MA5A 2WZCA 3C7AA 3CF4A 3PR3A 1VE6A 2HKIA 4UHEA 5E4JA 4AJOA 2EEPA 4F4DA 4QXPA 2JF0A 5BQFA 3DWEX 1EYZA 1KXZA 3HA5A 5FA6A 5FIUA 1RTKA 2WSYB 3D6NB 3C2QA 3W9UA 4IQ0A 1A4XA 16PKA 3LLUA 2PHZA 5LXTF 1JQAA 2LV8A 3PG5A 2G4CA 3KIPA 2WVJA 2QTFA 1ADJA 5EHXA 2I5PO 4M54A 5IAGA 5I48A 1HEYA 2PUBA 1O89A 2V3WA 4MS3A 2CN1A 3VUEA 1VGRA 4AUNA 4P3PA 2CZQA 1Y3AA 3NEJA 3HSYA 3R0XA 2FUEA 4RGYA 5MFPA 1EDEA 1U80A 4IZ6A 4CF6A 1UOEA 1GA4A 3ZVRA 1ZOSA 5EY5B 1NN3A 2PX4A 3I42A 2ZYVX 3DZDA 4M98A 3ZU3A 5D7BA 1U81A 3SC2A 3X0DA 3IP7A 1B8VA 3KXKA 2WICA 3O9ZA 1TOAA 4JB8A 3DLBA 2XTNA 2BI8A 4JVLA 4MYUA 2HWYA 2NVWA 3C0KA 3PFGA 1SO8A 4G5SA 2C2WA 3RVDA 3U7JA 1MHTA 5T6MA 1CVLA 4W5RA 3P5SA 2Q3LA 4OREX 3KT6A 1IG0A 3FYUA 4K9NA 1D8AA 3MQ4A 1GPJA 4E7OA 1W93A 4G85A 2OY0A 3BMCA 2H29A 4KN5A 3HUEA 1CD5A 1CUZA 5FBZA 3TMAA 1WF6A 3VU3A 3B9PA 5K0GA 3V8BA 1C8VB 3E7DA 1GTRA 2VPZA 5JANA 2F55A 4QPPA 1V5FA 2MU1A 5BW4A 1CEQA 2VDOB 5BVGA 1E4VA 5BN3A 2O0MA 3TZEA 1TTTA 2X4DA 2IP1A 4RHYA 3IVAA 4DM7A 1JTEA 2H1WA 4XIGS 4MVJD 1UZLA 1AV6A 1T43A 3AFMA 3RGGA 1Y37A 4TYWA 2EP8A 3UJPA 4KCGA 2P6PA 1L7PA 5HFAA 2JH3A 3WGZA 2PAAA 4B85A 2XOKA 3TQTA 3CPEA 3B12A 4RVFA 4AUKA 3U3OA 4C4AA 3OTIA 4HB4A 3T9EA 5LQNA 3T3OA 2WTUA 2R6FA 3DE3X 2YFHA 1E0SA 1FUKA 3FRHA 3STXA 3NP7A 9LDBA 3ZJVA 3QWHA 3X3HA 5DLEA 2G6BA 4URVR 1MX1A 4RZUA 1DOAA 2YDYA 2Q7OE 2LWIA 4Z86A 3SJCA 4JVMA 4I5IA 5IH7A 3HJGA 4R4JA 1QQ5A 2AX3A 1NX6A 1PT7A 4BLQA 4QG7A 4PLHA 3V8MA 2ASVA 2AFIA 4ADSG 2QTWB 5AHKA 1UEIA 4WXYB 3VHRA 1C0KA 2C20A 1IOZA 2Z4TA 1WXDA 2IZ7A 1WZNA 1F14A 2R751 3UC9A 1UXHA 1WQ1R 4NCJA 1DBIA 4G3XA 4KUGA 3LBAA 1J2EA 1E2IA 1D0IA 3INGA 4MB0A 1VI2A 4TRNA 3LCJA 5CUQA 3V6LA 3FOAA 4TYPA 4CG2A 1O94D 1NIPA 1Y8RA 3AHCA 1PZHA 2IJGX 4UUBA 2VK1A 4XJTA 2XY4A 2ZCVA 3I9OA 4ALLA 2REBA 3HWX1 3P4UA 3K2BA 3QFHA 1GXSA 1FX0A 1FU7A 2CMDA 3DT6A 5DFAA 2ZS7A 4MI3A 5B1EA 4W5TA 2OFOA 4LCJA 1E5TA 4BQQA 4D9MA 1LH0A 1KI4A 1IC6A 3G2JA 5F1PA 2CJWB 3PJFA 1KJ8A 3UAWA 3QE3A 1UT6A 1EFHA 3C7CB 2M1ZA 3E9CA 2P0YA 2WA2A 4IKOA 4L78A 4U6QA 5ALYA 2BFEB 4QG3A 1WM1A 3NASA 1M34B 1ZU5A 2DFDA 3LHFA 4QECA 2CL7X 2HI0A 4BLOA 1IBCA 4OX9Y 2ZRKA 4BLSA 3VJKA 3K9QO 2P65A 4LJ4A 4XVRA 3WLRA 4BB6A 4JB3A 3URKA 2BDTA 2R1UA 1N3BA 4KOAA 2O2HA 1EK6A 3F96A 4GBMA 3PTZA 4C5BA 1KRHA 2FFHA 3V80A 1PHPA 4DLNA 2O2JA 1QIFA 2FZKA 1GNLA 1UZAA 4ISCA 4ZC8A 3ZDFA 2IYSA 5KCZA 2CHVA 1M2JA 1DBSA 2AX4A 4K86A 3GLVA 1NUAA 1JG4A 2KPOA 3LY7A 4HV4A 5TQJA 3I1JA 2GSDA 2AB0A 3FOBA 2COEA 3M5PA 2CDBA 1W0JD 1ZSYA 2CJXA 4IL5A 1V5WA 3C41J 3T61A 2GT1A 2ZWIA 1P0QA 1NQUA 3OSUA 2VWPA 4PX3A 5E9QA 5FJIA 1C0IA 1C29B 1P6QA 2QTGA 4IMRA 1QP8A 1Z4QA 4NS1A 3RRBA 2WYOA 4ZYWA 2IWHA 5C31A 1SUEA 4DR1B 1AS3A 4URHA 4ARVA 1N0IA 4OP1A 2AFRA 5PGMA 2N47A 1PW7A 2ZOSA 3JYQA 3RSZA 1A4UA 1A9TA 1VIDA 3Q9UA 5EGNA 3AR6A 3RABA 3QVSA 1RXWA 4KLRA 4MUFA 3EEIA 4I19A 5DGDA 2EZ8A 4FFBA 4W1RA 3K9LA 5KWVA 2DPXA 3M9LA 2WJIA 2OPBA 3QLEA 4GMXA 1E7SA 1QOQB 3I2JA 4Y2QA 3HPQA 4UMDA 3GG9A 4YXWA 4EM6A 4PYRA 1CP2A 3IV9A 2LBPA 1XVTA 2NSDA 2W83A 1OI7A 1G7RA 1U1GA 1O95D 3RS5A 3ZVNA 1GAXA 1J5XA 3OZXA 5LFAA 3HZRA 1KARA 4H3HB 1U4SA 5GJVC 3TAUA 4C6HA 1DMSA 4INZA 3SYMA 2HK6A 4CFYA 4AJKA 3DYIA 1YK0A 4U6SA 2GVDC 3NC4A 5CK4A 1K98A 5DTEA 5J59A 3THXB 1X9GA 1E89A 3D3QA 3F78A 3FBTA 1GPYA 3L7MA 2QTTA 4GMGA 4IINA 4RMNA 3AF4A 1WV1A 2QD5A 3DQPA 4BKUA 1A50B 1TAQA 2ZE8A 4MDYA 2Q28A 3WJ7A 4D0GA 4XWYA 3T0IA 3ZQ4A 3R3UA 1JU4A 1BYUA 1KO8A 1VB5A 5BR1A 1D2MA 3AI1A 2IYPA 3M6MD 4ZCSA 3ACDA 5EKUA 5CYGA 1U0GA 3EDRA 1Q83A 4FI3C 4XI9A 4AF8A 1T0HB 2YIVX 3O8NA 3CISA 2AV6A 3NPAA 1TIKA 1YFJA 4F93B 2XUIA 3TTWA 4L73A 1WZ2A 4FHCA 2PA3A 4JSTA 2O3QA 2H5LA 4IXTA 2XRMA 3QFFA 3ROXA 2EYUA 1BHSA 2RCNA 4B6QA 1SCIA 2A5FA 2EFHB 1LI5A 3A6LA 1LNQA 3OBIA 3OCJA 5DYYA 4Z9XA 2GK6A 4E22A 4WOCA 2HRRA 2FEMA 2ZB2A 4XCQA 1N6IA 1XNHA 2VJQA 2HLDA 4BIMA 3L79A 1BD4A 1WPGA 4JYCA 3P9KA 3D6MA 4UU7A 4PX2A 3L7JA 4E6PA 3QSYA 2FPMA 5I9SA 2HCTA 2VXYA 5IJ9B 3K96A 4YVFA 3D54D 3KKEA 1UODA 4UPDA 3URMA 1GGJA 4JDUA 5IC5A 4DA6A 3O3MB 4IRXA 1KDTA 2CMGA 5KNCA 3ZWDA 2RB4A 4OH7A 3HR4A 5MGBA 3GFPA 2OHGA 4G0MA 5LKAA 1Y3HA 3V7UA 1OAOA 2JKVA 3KHKA 3SI7A 3F5QA 4K88A 4DCTA 3IEPA 5KVVA 2QKYA 2E82A 2PUVA 3AEQB 4MVJI 2Q2OA 4AJ2A 1M1YE 1QHXA 2WD9A 5LDGA 1ONPA 2B1QA 1EB8A 2QI9C 2JA1A 4OPMA 3D02A 3DM9B 4JWKA 3V7WA 3C45A 4G4SP 2B0JA 1GZSA 3D4IA 4KK4A 4AL4A 2XHEA 2G0AA 3NNDA 3Q3EA 5F3DA 1PV1A 1MEOA 3TL2A 1OU4A 3UAXA 3JAMA 4BQPA 4JI5B 5K20A 1OR8A 4C5CA 3ER8A 1T1IA 1J56A 4IKEA 2D7DA 2VQ3A 4Y2TA 1SBTA 1NFFA 1HTTA 1HDEA 2WJWA 3CZ5A 3L6DA 1UQTA 4L6IA 3L6OO 1G21E 1AHPA 1U1EA 1G20A 1DKUA 1W6RA 3H42B 3HZZA 4RA6A 4ZAWA 4BB9A 1J2UA 5F1YA 2RSLA 2IY9A 2WF8A 3MVEA 3NAZA 2EARA 2P9YA 2BFBB 3AR9A 2X14A 1Z2DA 2IK8A 1AKTA 2ZXEA 1K8RA 3PZRA 2NUTA 2QRZA 1GIAA 2IIVA 5AHOA 3IO3A 1VMDA 3TNLA 2JD2A 4GQAA 4HFMA 3RU9A 2H9IA 3SS8A 4EHJA 5A4IS 5LPNA 2EKBA 4QZVA 4XOUA 1EX1A 3UJBA 4JKOA 2AK3A 2C9CA 3Q3JB 2I0FA 3HSKA 5DEOA 2BHNA 5FTLA 2I4MA 3OE1A 2BMWA 4WLUA 5I5EA 2ZKIA 2ZYIA 4XKJA 3B9RA 4ZU3A 3N8DA 3EUWA 3DF9A 3CRNA 1DCFA 3GPBA 5DASA 4D0NA 5FNVB 2NG1A 1DV2A 3JD3A 1NTRA 4WNYA 4ESOA 2WMOB 3EFHA 4JJ8A 3SSOA 4H08A 1THTA 4GW3A 5JCOC 2NPIA 1SPBS 1DXHA 2VUTA 2OM6A 3RVOA 1HFKA 2OCIA 3CGGA 4M99A 3TUIC 1NBMD 1TEXA 2JIOA 3CW8X 2VH5R 1W36D 3FPGA 2BP7A 2VTBA 3C70A 2HO4A 1ABFA 2D2IA 3DXFA 2H2IA 3SVLA 1Q74A 2M98A 2VTKA 3BWBA 4IIXA 13PKA 4HR7A 4N7JA 4ND8B 1N5IA 4Z7JA 3IBCA 1TPYA 4D6PA 3V55A 2BFCA 3KD3A 3O74A 1YHZA 4QWMA 1Q0UA 3VPDA 4BGDA 3CUUA 4QXOA 4H7EA 2IP4A 2YDXA 4MRMB 4PY2A 4EJ6A 3KPJA 1L8QA 3TQIA 2KB0A 4TTJA 5HR5A 1WMDA 1YU9A 4RKQA 4U7PB 3WB9A 3PC2A 1J20A 1UEXC 5TMEA 1V2GA 1ZK0A 1XRRA 2HSEA 2RGYA 1P3Y1 1JFLA 2FR0A 4C1BA 3FRJA 5HDBB 1QS0B 1XLTC 2WG1A 3JWPA 3VGPA 3TR5A 4BQNA 4YYZA 3ZDZB 2OMEA 3KZMA 2O23A 3WKAA 2J3HA 1CEYA 1NW7A 2HHCA 3SNHA 5TLSA 2ZQ5A 5CDTA 1WSBA 4Y6SA 4TLBA 4D57A 1II9A 3LQ2A 3K4PA 4DMMA 2EGGA 2N46A 3F8TA 2PZEA 4R2XA 3DFZA 4NONA 4Q7EA 4IDNA 1ZZEA 1N2XA 1AF4A 3SR4A 1AK9A 2JD0A 3DFKA 5I9NA 5MGNA 3MMXA 4N82A 3LBFA 1RIFA 1M33A 4LF9B 4QEZA 2NX2A 4C6TA 5G1NA 3AX6A 3UWPA 2HSDA 1ND5A 1PWEA 1E1CB 2NU7B 3IKJA 3NBKA 3CMCO 1NF2A 2FFRA 1TUIA 1JHOA 2V98A 4OHRA 4C7MA 1AMNA 1QHGA 3ZHSA 2DFVA 1KGDA 4PZZA 4CKBA 2IKQA 4XWOA 1A2QA 3L8GA 2CLSA 5DNEA 2XGSA 4ZYXA 4TMXA 2AOVA 3T9DA 1A7AA 4FCVA 1UZNA 5JBNA 3DV0B 5J58A 1CJCA 4LK3A 1U04A 4LZJA 4WH0A 3VU9A 4EDHA 4BFXA 1L4FA 3W2EA 3MBOA 3ZC3A 1T36A 2ZB8A 4ZO6A 4DLBA 2D62A 2Z2JA 2FHSA 2P5TB 3TXAA 2P6RA 2CV2A 1C3XA 2ORED 4BLUA 5G0TA 1CJVC 2E49A 4I5GA 4I55A 3EZ9A 5TQVA 1EA7A 5GWXA 4BX0A 2WF7A 1NBWB 3OX3A 3UJHA 1QNLA 3AETA 1U2GC 3D3NA 4DCSA 3AR8A 3ZQJA 1DQZA 1JQKA 2Z98A 3V3TA 4Z1OA 5JCXA 4FQ8A 3STYA 2A5JA 1O8CA 3C5VA 1N75A 1ZAYA 2FEPA 3PEFA 1ZUIA 4OHZA 2CYAA 4EB6A 3LA6A 2C2HA 3DE7X 4X8OA 2Y6UA 1YDMA 2RC5A 3JSAA 3G6WA 3KQPA 4R2HA 1FCJA 3RKUA 4BWFB 2DBVO 2HU5A 3L0IB 3GXOA 3QU5A 4HDRB 3MLBA 1SKAA 3DSRA 1M76A 1FDSA 2HB6A 2IBMA 2WT4A 3GJ0A 5A4MS 2G1PA 1AKVA 4L5IA 4DRXA 4ZO7A 3DFUA 2HK8A 1PVDA 3BA1A 1XU4A 3HB9A 5LZ8A 3FPAA 3GARA 3OESA 1I5RA 1R0XA 2JLCA 4QLOA 2X40A 5AKXA 3QHAA 5AUOB 1RZRD 5FT9A 1EH5A 3Q41A 1J70A 2MMCA 5EJMA 3ZXIA 1F8XA 2F1IA 1T8WA 3LAWA 3ZV4A 3OFVA 4ID3A 4RD3A 2F9LA 1THZA 4HDNB 1XZMA 1GGNA 1SBYA 1ZUNB 2H4WA 3C5HA 4JHLA 5H80A 1Z6PA 4B3SB 1RHUA 3COZA 4Z8XA 1Z4OA 2WE8A 3AVTA 4Y1GA 5T8KC 5JUWA 5FA5A 3QVWA 4N0QA 1G8MA 2QM8A 3JQDA 1L1QA 1U2ZA 3R7FA 4CM7A 4ALJA 1NMSA 3TLKA 2ZVQX 4BTLA 3KKZA 2VYVA 2VPYA 3NV7A 3TWOA 4BJHB 4MCHA 4BS9A 2IYOA 3ZVMA 3GGPA 2GYWA 5KIAA 1I1NA 2FXIA 2P30A 1KBQA 3KQSA 1DWOA 4I4TB 5BVHB 2DEUA 1O96A 1DG1G 1U7ZA 3FVTA 5C8YB 3UUWA 1KH1A 1WW8A 3OTGA 1BCRB 1XD8A 4NEGA 2R6JA 4O29A 1L7QA 2BTEA 2CNWA 2GPJA 3H2HA 1HL7A 1E1RD 4GBGA 3EMVA 3I6BA 3A37A 2I4RA 4O1MA 4EI8A 2ZIVB 4ZICA 3UB2A 2RGWA 3HFJA 2JLXA 2UZ4A 2HYIC 4P5DA 1SMKA 1Z9BA 3ZH2A 4Z2AA 2YV4A 4JNCA 1JE1A 3QVMA 5DV9A 5AW0A 4BFYA 3H9CA 4J1NA 1ZYUA 1GG9A 2LP4Y 2QTVA 3KK0A 4FGSA 3ZNOA 3CRRA 1GZ6A 1SU6A 5AIAA 1BKYA 2EHJA 4TS1A 4V0LA 3QMPA 1CRLA 2AN5A 3T3IA 1I4TD 1V7PC 3N2EA 5K3OA 1G8AA 3RHTA 2BISA 2O57A 3ANYB 2NLOA 3Q15C 5C32A 3Q88A 3LFUA 4UMVA 1ZGCA 3DMYA 3GA0A 1HQDA 4FD2A 1LPOA 2GM3A 2NO6A 2Q4DA 4P33A 5JAQA 2YC2C 4B17A 3R3YA 1B42A 3R7SA 4XWGA 121PA 1W5TA 3JQ9C 3K72B 3ZQ6A 4HEHA 1U8AA 4YV7A 2C00A 5JRJA 3A6DA 3FI0A 1RXCA 5L51A 4LF6B 3T7TA 1J2JA 5I7AA 3U39A 3NHWA 1C1YA 2I78A 1QU3A 3BFPA 3L77A 4UBOA 4C7XA 3DLHA 1YCHA 1RRFA 1K0UA 3ABZA 4BHTA 4C5AA 1DC5A 5DNWA 1YULA 3AUUA 4B87A 4P7KA 2C61A 2B92A 3LQQA 4BO8A 3TCKA 5AM3A 3TG8A 2X3YA 1CERA 1ECLA 1W87A 2XITA 5M2QA 4OG2A 2C4UA 3D2BA 2GTIA 3QLUC 3R41A 4GYKA 4IVPA 4XB6B 3UANA 1L4NA 4O2RA 5A7GA 2NPFA 2NO4A 2AC2A 4LRYA 1P2TA 1RFLA 4CM1A 1DBQA 3B5JA 3NYIA 4K8RB 3K9HA 4X7MA 4C4RA 1H5NA 1X39A 2DR3A 5I7HA 3K4QA 3U61B 4JT2A 1ND6A 2L82A 4TKVB 3MB5A 1MJ5A 2AEJA 2PJDA 5BWCA 1NC1A 1EP3B 3HEMA 2CCGA 2FSGA 3BGIA 3MTBA 1NQXA 1YZLA 1EFPB 1JEOA 2EAUA 2VTEA 3W5UA 3UICA 2C1XA 2PMWB 3HI6A 4LVNA 4CEJB 4HDKA 1TVEA 3BRSA 1Z4MA 2EQBA 3V9PA 1C81A 1CUCA 5SYMA 4DXHA 4LBZA 1HQYE 3AB8A 4TUYF 1NQWA 2C0QA 2IU0A 2NO0A 4A27A 1E9SA 1KP2A 4ZARA 4CUJA 2QLJA 3PFNA 2W4IA 1BDIA 5EQFA 3TXXA 3FTFA 1P2SA 2XUAA 2VAVA 2GPAA 4P4LA 2Q1UA 4L4YA 1EFVB 2ZRQA 1FLNA 1RYHA 2OKGA 4A0SA 5JNWA 4MULA 2ERXA 2R7LA 1V9SA 3ENKA 4BE7B 2E5LB 2C4KA 4RETA 5IK2D 2IUTA 1XVIA 3PHHA 4F9TA 2JNWA 2IBTA 1H9CA 3I6YA 5IM4F 1JB9A 3QEKA 1OX4B 2VI5A 2BTQA 1X77A 3NVAA 3COJA 1NXSA 3WNBA 2UZIR 1G6OA 2FPGB 3C3BA 5DVZA 1ZJZA 1DGQA 1PJ3A 4IDAA 4G9BA 3VISA 1CJUC 2CVPA 3BWMA 4FI3F 1AS2A 2NYAA 4PW0A 5FUXA 5B1YA 1UFKA 3VVBA 1YCDA 4KFSA 1KZ1A 1SUBA 2J8ZA 2GHQA 2J67A 1JEQA 4H0NA 3L04A 2DFNA 3OX1A 4GVPA 4TVBA 1UDRA 2EBHX 3E9YA 4M9SA 4JVOA 4O02B 3ASZA 3E81A 4RTKA 2HADA 1KAMA 1U2QA 3SZMA 4B1FA 3HO8A 2D1FA 1I2AA 4PHHA 3WFJA 1AX9A 4ILEA 2BZSA 3C85A 1VCOA 1KEVA 2GYUA 1E6LA 3ABOB 4WDRA 5L4SA 4BO0A 1SVIA 2XAAA 1Q0HA 3NHMA 4LQ4A 1Y9JA 1OC4A 4UNSA 5AK5A 3LC7O 3W3AH 5C7YA 1OA0A 3NHUA 1HG1A 3UATA 4DT1B 1UBUS 3KQQA 3RYTC 1B1AA 3HB7A 1DKLA 3BXFA 5F5LA 5J47A 4I5EA 3HCWA 4EPYA 3B2NA 3KUUA 2OGZA 5SY6A 3PENA 3SQDA 3W3AD 3R6DA 5CVCA 4ZOAA 1MBZA 2WIJA 3HCFA 3OE7D 4Z0PA 3ZIAD 2FYTA 3PJDA 5JPDA 4G0YA 3GEIA 2VZ9A 5J2UF 3QI2A 1LLCA 1ORHA 3FM9A 1C3VA 1EKXA 5DM60 1GRQA 5EQTA 1J97A 3WGKA 3LK6A 5AUPB 2QI9F 2Q6VA 2CHFA 1V9CA 4WZAA 1XR3A 1ZD9A 4Y9DA 1YZKA 3HKDB 1EVIA 1J8VA 3CONA 3EHDA 2IBSA 3IT2A 2HAEA 3G8DA 1U65A 4IICA 1HM5A 1E9FA 3ROMA 1QZ3A 2P6UA 2H2GA 2QTNA 2OXFA 3OE4A 5AXAA 1P7ZA 1G8PA 3B38A 4CVNA 2QVGA 1JVNA 4AP6A 1TPZA 3I5AA 1V35A 5F77A 4MQ4A 1O6GA 3I1YA 3SS7X 2WJGA 1QKKA 4R1TA 3HJNA 2JFGA 4J7CA 3VU8A 2BYTA 3BPSA 4R84A 2DUMA 3EX7C 1QQBA 4W99A 5BOSB 3QQ5A 5TPZA 4N3NA 3W0LB 5EXTA 4EENA 2Y0PA 2ZDHA 4GUAA 5IX8A 2P8SA 5BSRA 2O8CA 2WUFA 1LDNA 1X7YB 2HGZA 2GCOA 3OJWA 3B3QA 2CVZA 4RABA 2J3QA 4PVCA 2AFHA 1L7OA 1FNDA 2YMQA 3F2IA 3REOA 3HUTA 2EWMA 1ODIA 1R18A 1JF8A 3ND7A 2QXTA 4ND5A 1FVOA 1YU6A 2M6KA 4Y98A 5K0NA 2QN9A 3QIAA 4IDGA 3ROZA 5JECA 1DWUA 1GQFA 1E79D 4LY3A 4DCOA 1QHEA 1KEEA 2QUJA 2C5LA 2GESA 2XVMA 3H19A 3OKCA 1JECA 5ALRA 3V34A 1C4XA 4F3CA 2PO5A 5LYJA 5KQPA 3EG9A 1IRXA 2YASA 5D00A 4XWTA 2BGTA 4LXUA 1CDZA 2QY6A 5E6UB 1KORA 2Q2NA 3OMLA 5B57C 5EJ4A 3BX1A 3VDNB 4D4GA 4XUCA 1P45A 1X92A 2OD2A 3LQ1A 1O08A 2ARKA 3N6RA 4TV9F 2C9DA 5AESA 2E7ZA 1CYEA 1RWNA 3GGSA 1WP4A 4WUTA 1C1DB 3DOHA 3ETDA 1RC0A 1VPEA 2HY7A 3FPKA 3K5IA 5IZCC 1IN1A 3CCFA 3NHSA 1P2BA 2VPTA 1KTIA 4C7OB 4JLJA 3CTMA 3RT7A 4AMZA 3D6HA 4IYRA 1O97D 4ERXA 1CJKC 3TNDA 3LZDA 2IH5A 1Z7BA 2QGNA 3IP5A 1T9GS 2MT9A 4PZ9A 2EHDA 1BN6A 3MMPA 1HETA 4XVQA 2QLMA 3ANXA 4EI2A 1BD3A 4PG8A 3ECSA 1IVSA 3LUBA 1L5RA 2X0FA 1ZWLA 4RVHA 2ZBFA 4EB3A 621PA 3AB3A 2WYUA 3U19A 3AVOA 1B0PA 3BE8A 3H1AA 1ZSNA 3MZ0A 5CNIA 2MYNA 2QT0A 4BNIA 2DECA 2LKDA 1JHMA 1M2VA 3FHLA 3HV2A 2WAYA 4N03A 2D5IA 5HJ5A 5FPTA 2EXXA 1GT6A 2AYZA 5BNTA 4NE2A 4YCJA 5I4KA 3SNKA 3EARA 1MQAA 1PWYE 3I2GA 3R5TA 2YZ2A 3EZYA 3JSXA 3CXUA 2P5SA 5C2JB 5IJ0A 1S2NA 3HXKA 4QL3A 5LZ9A 4O2BB 1JEYB 3WSWA 2DHCA 4WEOA 4CMIA 4DSTA 2J6BA 4FW8A 1XCOA 3OVMA 3HFSA 5TGZA 1K68A 3ZE6A 1I2CA 3KHSA 4B7XA 2PZBA 4EA9A 4U2EA 1LBIA 5BNIA 1B3RA 1H2HA 5HK9A 2IHTA 3RT1A 5EMMA 4G25A 3HGQA 4A0GA 1U90A 3EVAA 1U6IA 1BXZA 2B35A 4ER7A 4ZAVA 2V55B 1RXYA 4YRJA 1CWUA 1XQWA 4K05A 1ZVKA 4CWAA 1DRWA 3FTPA 4QOSA 3HJHA 4YALA 4FHGA 4LKOA 1AA9A 4CKCB 3O26A 2Z1NA 3KJHA 3I37X 3WZMA 4C78A 1UKEA 2GGSA 2Q3MA 1E0KA 3CX4A 3JVUA 3OEHD 1NJSA 3T54A 3VH3A 2BFFA 5JWOA 4D45A 4ZRMA 5ENZA 4N8EA 4PICA 5JCJD 3OC0A 1JXMA 1WHTB 3GGDA 3HDGA 3PQEA 2WB4A 3EIHA 4FMCF 4FYMA 2IYEA 1NRIA 2NZUG 1Q7TA 1JR3E 4DKXA 4YLEA 3C8DA 5CH8A 1BFUA 5DGTA 1EUDB 4DOMA 3L9WA 2C0CA 1A95A 4IV0A 1SQ6A 1UANA 1MRNA 5FQOA 1RPJA 4ZI2A 2L18A 5J2UA 1KEUA 2WP8J 3H13A 2YQ4A 3KWMA 1GOTA 3C7DB 3CH5A 1EUCB 4KQHA 1W96A 3EXFA 2FFAA 1OV6A 2GPSA 1N32B 4TYYA 1UPTA 2O3JA 5WRFA 2O8DB 1XALA 4MAAA 2FQQA 4ROTA 1ENOA 4J49A 1LSJA 3BZBA 1YZYA 2ONZA 2XDYA 3FCEA 3VNQA 5AXBA 1TA4A 3O3OB 1GWNA 4MQMA 1LI4A 1H94A 1J07A 1EWKA 3P4XA 4CQMA 5EE0A 1HDRA 3UJ7A 2CXXA 3DMTC 5EC8A 3G2NA 3R9IA 4GKJB 5H02A 5BUQA 4NJMB 1VRWA 1VIYA 2WNHA 4FFRA 2O2SA 1R4NA 3GN1A 4DR2B 4R68A 4O6VA 4YCMA 3F47A 2CGEA 3OOWA 4R01A 3PUYA 1R5NA 4E32A 3ESQA 2PGDA 2J0QA 4ARUA 4D1YA 4KXWA 4FWTA 2WZDA 4EUKA 4QYIB 3OM1A 3AR4A 4HXGA 3TSYA 4Q4CA 1A9XA 3FTCA 2SKCA 4ZOBA 2X8BA 1F2UB 1B23P 1R27A 4L4ZA 5CD1A 2X86A 5CTAA 5LZ4A 3FWNA 2HDOA 4PX5A 3RS2A 4YT8A 2IQIA 1P9RA 1YL5A 5DBEX 4RUKA 4EHKA 1E2BA 2NYRA 2A1IA 4OD0A 1MB0A 5EJFA 4NH4A 3FZYA 1YS9A 4WUVA 4E70A 1P2FA 1QDUA 5B55A 4E6EA 4FS8A 3UK1A 3VRHA 1V16A 1GQSA 2TMKA 4FBMA 4NH0A 2Q07A 5AJHA 2Q5HA 4TLMB 3RYFA 4CT5A 1LBHA 4EYGA 3TGPA 1JEJA 1CUFA 2QZZA 4CM9D 2ZUFA 1SHLA 1SVLA 1R12A 3HPRA 1PQPA 3FMIA 1QF9A 1W1IA 3OZ7A 4BCBA 2YMLA 2AG5A 3MWFA 5BURA 3EC1A 2CSXA 4D4LA 4AS3A 1B0UA 2Q99A 5LU9A 2QN6A 5B53A 3EZXA 3B1WA 2P9FA 5DTMA 4MRNA 2ANBA 1OASA 3PK0A 2PGNA 1LLDA 4Q9IA 1IUOA 2J9FA 3EIFA 2XVZA 4HWPA 4KWEA 2Z5VA 2P9GA 4M0PA 2IUYA 3NVDA 2AG6A 4DLSA 1Z56C 2XYPA 4OQDA 5TS2A 2N1BA 5IDVA 2F7SA 3DMDA 1F0PA 1TJ4A 1KMNA 1XXLA 2OSVA 1RCFA 1LV8A 1QO7A 2GWRA 1H6DA 4K0RA 3B6ZA 4XARA 4UW9A 4DXDA 4FBLA 2DMRA 4BNLA 2CNKA 2KM1A 4MROA 3MJ4A 3M4NA 1NI5A 4PSCA 1V26A 1SR8A 3D3WA 4UASA 5DZSA 3U62A 1L7EA 5KU7A 3W2GA 5H8WA 3V7NA 4FGJA 4M8SA 1T5LA 1HEUA 5CNKA 3UHJA 1PL8A 2OKCA 3MJCA 4C0LA 3DEZA 1TF2A 5BRJA 1DQNA 1YI1A 5JPCA 3BK7A 3PRYA 4HS4A 4BNJA 2PU7A 4HZUA 1KO5A 2GPYA 4C4XA 5KJFA 1P2UA 2F67A 2YVKA 3JQ8A 1SFRA 5DNCA 1UDAA 5KI6A 2CK3D 4UEQA 4GP6A 2VSOA 3GDHA 1FRQA 4EY6A 5IBQA 2WJ3A 3DOFA 3QUTA 2XZDA 1VL2A 1YL6A 3IIKA 3T4PA 4J0KA 3AT1A 1NQOA 1GZ7A 3R23A 3K35A 1EZ4A 2OHJA 2R8XA 1PNOA 5FB3A 5ILOA 5EUMA 4LWQA 5GV8A 3KQWA 3GA7A 5IKPA 1F8UA 4L4RA 2ZRBA 1NRWA 1XF1A 2V7QA 3IPLA 1UKAA 4OA5A 2D1YA 1YZNA 4DWWA 3FF4A 1XB2A 2BEVA 3E58A 1E1QD 1Q7CA 1Q5PA 4OL0A 4HUQB 1Y6RA 1VJCA 4Q4AA 3T95A 4YUAA 3BWCA 1CNMA 1UKBA 2W00A 3GY0A 2P9CA 3MJRA 3G5LA 3T7RA 3VR4D 5K6RA 1WXWA 1JJAA 1L5LA 1D2EA 2D5BA 4BYMA 3LSYA 5GZ3A 4ZOLB 4M38A 3DOEA 1Y63A 5ICMA 2B37A 4GRIA 2IZOA 4JI0B 1QIHA 3LG2A 3ZLJA 1T2DA 4UBLA 3T9FA 4U7TB 3BF8A 1E9CA 2PG3A 3LT4A 3PGVA 3UT5A 1KHTA 3IOBA 3O1JC 2PZJA 2XWJI 2ZRGA 4QREA 3AM5A 3TVDA 4D82A 2P35A 4QEKA 2PUGA 3TXYA 1EBFA 1K27A 1RSZA 3HVKA 4GAEA 4L27A 5DCWA 1U5BA 3QENA 8ABPA 5CA1F 1RHQA 1MO5A 1MJGM 1NA5A 1ZN9A 2FP4A 1CJSA 4WGGA 3IP1A 3WRXC 4C3VA 3OJFA 1O6BA 3RYIB 4E7PA 1C8LA 1YB1A 3M2PA 1M8JA 2PWBA 3K73O 3UBTA 3B1XA 4LOKA 1M5RA 2OV4A 5LP1A 3Q1KA 1KFKB 2QJWA 3LRPA 4UATA 2AHOA 1ZPDA 3PIIA 5CPBA 2XZPA 4JB0A 1U1DA 3ZU5A 3X1DA 4H6XA 3TPFA 1GADO 3DZJA 1M2NA 3LNTA 1H0HA 3ND6A 3IURA 5CM2Z 1GV0A 3CV3A 2DQKA 3NWBA 4KQKA 4DQDA 1KKUA 3TB4A 1KI7A 1TW3A 2HRDA 3IPXA 2O8BA 2C8JA 2HMWA 4RKWA 1PW5A 2VKTA 3DVAB 3S6JA 1RI2A 4GM4A 3ZW9A 1UXGA 4EK9A 1T10A 4N39A 4IILA 4OLJA 1X1AA 3REGA 3MTQA 4P34A 2V5UA 4MYSA 3FLBA 5LWQA 3O21A 4CMEC 3M33A 1TXGA 3SDSA 3FKQA 3K15A 3BAZA 4GPEA 4LGMA 4RAOA 1GCUA 1VRCA 1PK7A 5CHYA 4M4SA 5I4IA 1ZINA 2RK4A 3K32A 3WB2A 1Q2XA 4BCCA 1RJGA 1R74A 2A0KA 1H2AS 1IN7A 1KK0A 2OV1A 3EN0A 1PL6A 3LWNA 3DCYA 1FQJA 1JAHA 1X1DA 3OECA 4GEGA 2PBRA 5I51A 4O3MA 2O2EA 2XGJA 2G63A 4BAZA 3L7YA 5J2TA 1Y6GA 4M0LA 3PCTA 4EY7A 1B6TA 1M2EA 5U1PA 1E0AA 4MR9A 1YAJA 2R6AA 3FDJA 1IRIA 4D9CA 3RUCA 4HDQB 7MDHA 2FCAA 5JSYA 1E9AA 1E3SA 1E2JA 1JR2A 2PUJA 3I9NA 3N9IA 3OMWA 5DI9A 4CMKA 4DJDC 1YZVA 2E85A 2WSIA 2O7VA 3QY9A 5DEIA 1G1MA 4RDXA 3K31A 2ZANA 1X87A 3L43A 4IIEA 4CT0A 1WU7A 2B78A 1HDXA 1TEHA 1G3RA 2P2CA 3JQ7A 4MVJF 3ELBA 4IW3B 3IIMA 2YN4A 4NNPA 2IH4A 3BUSA 2ID4A 2ROQA 5KNBA 1GU0A 3OZBA 5K8CA 3TGLA 2ERCA 2C4TA 5IDXA 1QZUA 2AG0A 3CEPB 1BZYA 4RKFA 2JLBA 1OF1A 1KSHA 1ISRA 3LPDA 1SG9A 2Q49A 2QNRA 4RWZA 4TYMA 3TLGA 5BV0A 4WLOA 3IAM6 4EIWA 1DIHA 2H54A 3DEJA 3ZWVA 3PL5A 4UHHA 1XK7A 3FA2A 3HP7A 5EEHA 1TMOA 1YR8A 4EGAA 2NP7A 5KYWA 1MZPA 1AQYA 3I9LA 4BZQA 4KXNA 1O54A 1EFCA 5ESXA 5LBTA 4QIHA 1YJAA 3PFWO 4GX0A 4US0R 2EKQA 3PQ4A 2W22A 4MGYR 4OJMX 2XXBA 4D46A 4YQFA 4YV0A 2A5YB 5IBRA 3LO8A 4YP9A 1VPTA 3K1YA 1DG9A 2IYRA 3FFTA 1NPYA 3S1AB 2O2GA 1JG1A 3ITDA 1QMGA 1URPA 2X6QA 2J3DA 4JCOA 4EPRA 5HF5A 4H6WA 4LXTA 1WA5A 2R1TB 3GVPA 2ZRDA 4JDPA 4AS2A 1UQUA 1BAPA 2FMXA 4GZ3A 5CXUA 5FLKA 4L22A 5JMWA 1C7ZA 3AFHA 2FMHA 3RARA 3WSTA 1VYUA 2OXIA 2HHLA 1A5SB 1V1MB 4P4SA 4OI1A 2BTOA 4TUYA 4RKEA 5LJIA 2B7LA 1SK9A 3KU1A 1OBOA 2GJAA 2UYYA 4FDAA 4TQAA 4JYBA 5EWLA 3W5JA 3WQRA 4J1QA 2WWHA 4EF5A 1QQAA 2D2XA 521PA 1VRVA 1XCBA 1RWBA 3MGKA 2JFPA 1SD2A 3GCGA 1CR1A 4QXAA 4JLKA 4L57A 3V8RA 2IEYA 3DZIA 4HN4B 3ASYA 1KU0A 4RIEA 1CK4A 1X70A 2GO1A 3RC9A 3IVGA 2G28A 1HEIA 1XV5A 3K2EA 3M9XA 2CBGA 5BYAA 4HNGA 2XVXA 3R1IA 4U7GA 4PO1A 3SKYA 5GINE 1JFTA 4NMXB 5CDHA 1MV8A 1ABBA 4GLFA 1E3WB 1GNVA 3EUAA 4HSEA 1PR2A 4YK7A 1DWPA 4FBGA 3HG7A 3TW8B 1YUMA 4HEJA 4L8YA 4GPD1 2BGIA 2XXJA 1VDZA 2WK1A 1V2HE 4XPIA 2Y68A 4DIDA 2PJUA 3M83A 3QTLA 4GOJA 5JLAA 1QTRA 1G7TA 1UXOA 1Y3IA 2WLTA 3UAZA 4QYWA 1K4YA 5JD3A 5B7GA 1R6BX 4OEHA 3LUAA 2F9MA 1ZRNA 2PS0A 1IYZA 3B2QA 4DAEA 4DMKA 1CTQA 4KQ9A 2QB5A 1ZH4A 5CLQA 3FX2A 3S0JA 3LF1A 2WWGA 2BFOA 4GWLA 1RCTE 4HX9A 3OCUA 5MDHA 1OYOA 4YC7A 3NTOA 6Q21A 5LA6B 3WX0A 1FMTA 1L4GA 2FW1A 3CIOA 3HLYA 5D87A 3UHOA 5CA0B 4PYJA 4OUDB 3ET5A 1GRCA 3Q7IA 4TXLA 3U60B 5FPSA 5J5AA 3A36A 3GROA 3K6SB 4Y2RA 3TINA 2X58A 1TRKA 3Q5EA 4E1VA 6AT1A 4RD1A 2B8NA 3DBOB 1RC1A 2ONCA 4UU0A 5I9MA 7MHTA 1XQYA 2FZEA 2ZAIA 1X6VA 3VSDA 1Z4JA 3BK2A 1Q7GA 1Z73A 2DTDA 3HYCA 1H05A 2WM3A 2DKFA 4PHCA 2WU8A 5BYBA 1JG3A 4DF3A 1V3UA 1NRXA 1DKRA 3AB7A 2ABWA 4OK5A 2CLFB 1F8YA 3BCSA 4Q3NA 4W1PA 2OCBA 1H3NA 4ZA2A 3BWXA 1M1NA 1B41A 1QSGA 3QPAA 1C8BA 1AKEA 1J42A 1Q0PA 2J5XA 4NWIA 4REMA 1PJTA 4Q5IA 3UW3A 1QH1B 3ZCPA 2QEQA 2V8OA 4JEIA 2IZ5A 2X5XA 3GD5A 3O8BA 4J1TC 1YJBA 4BZXA 2PEZA 5BSFA 2XNDA 4UUNA 5I9TA 3RREA 3IBYA 1OYYA 2O19A 1KY4A 5DTRA 4YRRA 3O95A 4FOSA 4M9UA 1CZHA 2JAWA 1Y7IA 2XJ4A 2RHBA 2YHIA 5LLSA 1NQVA 2R8PA 1XTZA 2AQKA 4BE9A 3K5HA 5C46F 5L3SB 1U1FA 4XX0B 4AWXA 3BGOS 2X76A 3DE1X 3FNQA 3JVDA 5D8DA 1FU8A 2F43B 4EY3A 1IHXA 1MVLA 1G5TA 4EGCB 1D4ZA 1G59A 1A9OA 3GJRA 3BXXA 1K8QA 2XMSA 4GX1A 3V3KA 3K6JA 1GKIA 4TGLA 2B5OA 5JYBA 3BSWA 3G0IA 3MFYA 2JHPA 5BXQC 2LD4A 2RH4A 1KS2A 4KW7A 1XTVA 2W2LA 3NW9A 3QYAA 3SE0A 1FYFA 1Y48E 4GGOA 1ABEA 1BMQA 1UR5A 2SICE 1QTNA 2MSKA 3N8NA 2HBQA 3T34A 3GLIE 2OQ2A 4YRKA 1C50A 1ZGGA 4J0GA 1KHHA 4GX5A 2NOAA 2A92A 2G17A 3H65A 2QZPA 5BSUA 1EP2B 1UJCA 3E9DA 4BQFA 1YVEI 2OYSA 3NDJA 2Q4RA 4XGNA 5JCOA 3USCS 3ABQB 2I1WA 2JFXA 4EZEA 4TV9A 4MJXA 3O5AA 5CM9C 4JA2A 1R8JA 2P0EA 4B82A 1TMKA 2JJMA 2ZULA 1WKVA 4WA8A 5LBIA 3ZS9A 3TQFA 5FOTA 3BQMB 1CE8B 1DDOA 1DO0A 3B89A 1D1PA 3DE0X 4LJ5A 5JDCC 3KPUA 2FSSA 1QRAA 5L3QA 1T1RA 4HX5A 4NX2A 5FWDA 4J3JA 1I3CA 5KYUA 2BKVA 1SC1A 2X42A 2B69A 4KO2S 2D8MA 4TL8A 2VR1A 2G6TA 2XUZA 4G8CA 4Q3BA 4ZVLA 3L7LA 4E4RA 2FFBA 4UE2A 3ZCUA 5JH7B 1V3TA 2GPBA 4X94A 2HMVA 4AQ7A 3K0AA 2B4QA 1Q1AA 1YVRA 3HEBA 4TZ0A 3X2FA 3UGJA 1I0ZA 3DAYA 2NT3A 2JS7A 1Y8QA 3PA6A 4A10A 1EGVB 1GZDA 1Z2EA 3HA7A 4KH1A 2RGUA 4NENB 5U4XA 3TH5A 3UJDA 3FPFA 3ZQKA 4QO7A 5DX0A 1RE0A 1R0KA 5BQOA 4DR4B 2JIMA 3VBCA 3WXMA 5EOVA 4P0PB 5BP7A 1JBQA 1QFSA 3FTQA 4G5YA 4PNPA 2E4YA 4LV5B 3KTFA 1KOJA 3G7SA 3BS4A 1GFZA 2F4NA 2FJ0A 3TIVA 4LOLA 4W4TA 3VFDA 4O08A 1WRBA 4LHSA 5BWOA 1GN9A 2PGIA 3LXXA 2AG8A 4IQFA 2VF5X 3CEJA 3LC1O 4LDPA 5H9WA 4DA7A 1QPZA 3OF2A 5EJ8A 2FZLA 2YHAA 4EX6A 1M6NA 3TQRA 1NY5A 1Y4SA 3LTEA 4KJZA 1P2VA 1KXJA 2GLXA 1JJ7A 3C4JA 3IQWA 4G65A 2CLIB 4I6EA 2BGNA 2KSQA 1OI3A 3VNSA 2HF8A 3NBMA 1T34A 3HGMA 5JBQA 4AKSA 3RRZA 3O4JA 1O8BA 2I6SA 2PRIA 1I3LA 3LRXA 4P9NA 1D6SA 4YV1A 1XCGB 1ZBDA 5EE1A 5EIBD 3VPFA 3GEMA 1TQ4A 1TAHA 2C96A 3IDAA 1ZK1A 3B20A 4G09A 1AC5A 4DMLA 4S1NA 3LDHA 2JFUA 2V74B 3PTAA 2Q7XA 1IJFA 3FNHA 3WDKA 4CU5A 5LD2B 2AE2A 2P2SA 2PDAA 3BGWA 3GIWA 3KYIB 4JC8A 5EXXA 2XQKA 5CH5A 5IAEA 5K51A 1O2DA 3GVCA 3AYXB 4NOJA 1SN7A 3L5KA 3RUHA 3SICE 3TEJA 5TV2A 1JIQA 3UFBA 4MNTA 3NHPA 1U2GA 2GF0A 5FBQB 3S44A 4O0LA 1FW6A 3DOUA 4CLOA 5AVTA 3PE3A 3ECCA 4Z4EA 4BFWA 1FPQA 1D1SA 3B6JA 3HLTA 5HG0A 3QIVA 4M1KA 1MPXA 3UO8B 3D81A 3AG5A 1GCOA 3HXPA 2GTHA 3U5TA 1GCGA 1RI1A 3RFFA 1CZOA 2J1LA 3LYLA 1XZPA 3FPJA 3IJ5A 3HB1A 4TT3A 3VI3B 4PO9A 5KO2A 3FY4A 3VC7A 4HG2A 3GNLA 5EA2A 4JLDA 1SC6A 4YP1A 1ZZGA 2B1GA 2GBLC 2IEZA 4KDFA 2J5KA 4Y2YA 1DJLA 5A03A 4AJ4A 2GKOA 1XWIA 2F17A 3AOEC 4ZPJA 1M2GA 4CN8A 1KIFA 3LA8A 5CB4A 2P78A 1O3YA 1DINA 5CDFA 2UUCB 2VT2A 4YHBA 1XYGA 5JFGA 2IHZA 4COOA 1EVJA 2Z6QA 2W6QA 2QMHA 2O6HA 3GPIA 4FMDB 3GJTA 1COWD 2FOIA 1G9TA 2OCXA 4P98A 1XRSB 4PIPA 2K6GA 3ANTA 2JJ2D 3QBTA 4IEEA 1DL5A 2RAUA 2YWHA 2VZ8A 4PC7A 2PBFA 5T8KA 2B5VA 1Q19A 5FUWA 1NJGA 3IRUA 1ZGBA 1BEUB 4OGKA 2GARA 2P40A 1FQWA 3IAM1 3OI7A 3H8WA 4Y9UA 2BLNA 3UB4A 1OKKA 4BLWA 3SJ7A 1ZVMA 1Y3CE 1IXYA 3ZZMA 4NJEA 8ATCA 1D2GA 2Y1OA 4JITA 1S1MA 3BRWD 2JATA 1RXEA 2VL7A 1W5BA 4C3UA 4PYIA 3UMRA 1HLGA 3WLMA 1OD6A 1VB3A 3QUSA 2DP4E 1Z35A 4JP8A 2QSYA 2VUSA 3HLKA 5KX5A 1T5BA 1LX7A 2GF9A 3OM9A 4QJIA 4TSFA 3RFUA 4XZ3A 2H57A 5HP4A 4B3MB 1SULA 1G5IA 1OQAA 1EZZA 1KYQA 3OZSA 4NZMA 5E6SA 4IY1A 1S3IA 1A7JA 2GX6A 1P0IA 4JQZA 1YMVA 1PD1A 2VHZA 1EGQA 4DUGD 2H9AA 4UNRA 1MC8A 3QI7A 1ZW6A 4FHEA 5KSOA 1RQ7A 3W8NA 5JAHA 1J2TA 5IYZF 2ZUEA 1V6AA 4QVIA 4DM4A 3T5AA 3OCWA 2FNAA 4PS1A 2EJWA 2WTEA 4RVSA 5EYPA 1QCDA 1ZCZA 3IKVA 2ZWOA 4AROA 3PCRB 2XBMA 2JIZD 3NETA 3IEUA 5DBFA 1TLTA 4EGFA 3GC6A 3N05A 3IJPA 1IK4A 5F4ZA 2HK7A 3IODA 4C9BA 2YQ5A 1GILA 2H7CA 3OCYA 4QOGA 5CXXA 2Z9BA 4KSCA 3X1KA 4D9BA 4CXMA 3AWIA 3QXHA 4AWAA 1NW8A 1E5QA 3JXEA 4IGKA 3FOCA 2WD8A 4AO6A 3WLTA 1C7FA 3JQ9A 2FFQA 4HJXA 2QLLA 1PUXA 3NLLA 3KV3O 1UZUA 1NVGA 2A67A 4QPZA 4BV9A 2YN0A 4JQYA 1XO1A 3FKJA 5T3YA 5CHEA 4BWGA 2IPOA 2ZAGA 1RQ2A 1Y34E 3QBDA 4I8XA 1BSVA 4F3TA 1N77A 1SXJB 3R5SA 2E6UX 3EA0A 2O8EB 2EFCB 5BSTA 3EFBA 3NRCA 1BGVA 3VOTA 4BXOA 2EW1A 3FUWA 3NUZA 4XR9A 3EVFA 5L4NA 1OZHA 2CMKA 4F45A 4JENA 4F3YA 1T15A 2PX8A 1II0A 1XWWA 1JSXA 1KAOA 4WN3A 3KVYA 2WTXA 1EUYA 4G6ZA 2JJ1D 2ZRJA 1WUHS 1I01A 1G8KA 1EAYA 1RJDA 4R1OA 1XD2B 1E4EB 4FUQA 3VHXB 2SCUB 3MCTA 3ZGLA 2L19A 5BSGA 1X2BA 3AKCA 1RLMA 4H0CA 1S3FA 1W4AA 3PICA 2ZSHA 5BN5A 3TUZC 1FNNA 2XMQA 1USWA 3DP9A 1U9ZA 5JATA 2JGJA 4XR4A 4URFA 5AM0A 1YC5A 2WWFA 4MYTA 1SCQA 4QNMA 5EKXA 3SYTA 5JNTA 1Y5LA 4WL0A 4RBNA 1E7RA 3D0KA 2ATEA 2IPAB 4C87A 3U56A 3NT5A 3A4VA 5KEIA 1JU3A 2AMYA 2WNIA 3M4JA 5IS2A 3V2GA 5HW0A 1F2TB 4UXIA 3SFTA 1Q3KA 5NLLA 5FUQA 1THGA 1JEEA 1R4AA 4PTYA 1LVGA 5EN4A 2NV2B 2HO5A 5C8YF 2F1HA 2NU6A 2QTRA 3GCXA 5K09A 3H11B 2DVMA 3SJZA 2MSLA 4KO4S 1WE2A 2Q5QA 3T1OA 4G0WA 3K9BA 4HDMB 1XRQA 3A26A 1E64A 4R9SA 4YAOA 5AHRA 2WSLA 5T5QA 1YR9A 2VP2A 4OM8A 1MC1A 5KBYA 5IXYA 5DGCA 1G2OA 3QVXA 2IS4A 1MAAA 3RSSA 5ER9A 5EJ7A 1ISSA 1D3AA 4K2HA 4PLGA 5HBRA 3SQOA 4R5MA 1ZJ4A 3ENZA 3M6UA 3MGAA 1PVOA 1GRRA 1M6WA 3AERA 5BNFA 5K3BA 3X1ZA 1GKKA 2AJBA 3A1SA 4MINA 3HKCA 3UYKA 4LI3X 3CLTC 3L84A 3RSFA 3GLHB 2BKEA 2RK6A 4MUNA 1DJPA 1P4JA 2BSXA 1LKZA 2PUWA 2BPOA 3KJGA 4QUDA 5AVRA 2HYDA 2VNSA 1SU4A 3PUWA 3QJ5A 1GNSA 4WHMA 2IT1A 2YZ7A 3PKIA 3NHJA 4U00A 5GM2A 1QONA 4FMPA 1PQYA 1GLNA 1A8HA 1ZJJA 4HYTA 4A8HA 2OZLB 4QM7A 4HDAA 3N6VA 5CFLA 2CT8A 1Z4KA 1XN1A 4RFVA 5K6AC 3ZXYA 3X2EA 1L4EA 2DPMA 2H85A 2O8CB 1YTUA 4U9UA 3GRYA 1DUSA 1Z74A 2HWUA 3CXRA 3EK2A 4QDOA 1KEKA 5KTOA 3PHIA 2D2VA 3J81A 3CC8A 5AUQA 4UVHA 3EQ7A 1KI6B 5EE3A 3EJ6A 3K0BA 3W5IA 4D0LB 4AKGA 4IXMA 1CQIB 1HT1E 2BT4A 3IPYA 1YQUA 1ZMOA 2ASEA 3AKEA 3U16A 4IIJF 1C3JA 1GV1A 1KH3A 1LBTA 2R00C 2XKBA 3BERA 3COSA 2QRLA 3AO0B 3Q6NA 4FGKA 4P4GA 5THKA 3TZ6A 4R2MA 2P2GA 4WESB 4DGQA 1GR0A 2JEYA 4TROA 1QTQA 4IX1A 5E4TA 1KY3A 3NVMB 2W6OA 2JKZA 1JS1X 3RIXA 4ESVA 1NFRA 1WB5A 1Z2OX 2JZNA 1NVBA 2QZJA 3LY8A 1J9EA 2HCJB 4RMJA 2QN3A 1KYIA 2VUHB 2WBLC 3R2JA 4X6LA 3WK5A 3KYJB 5IBCA 3AEKB 2HXGA 4XVUA 5HSGA 3DHVA 2B2XA 2HCBA 4RZ2A 4KITB 1SHZA 3G9TA 5KSYA 1S2GA 4AJLA 1XBTA 1YS7A 5FTKA 4UTRA 5JD5A 2BFMA 2H7YA 2IHYA 1M0EA 2C31A 2QTAA 2JFVA 3DGEC 5L3RA 1OH5A 1Z8HA 3E15A 1MW9X 4AVYA 5IHXA 4DNQA 1CZKA 2X5KO 1TZMA 1VHDA 1RBMA 1VL0A 3RBZA 3OJOA 3NAQA 4MKXA 1KNQA 3FPSA 1CW2B 5ERXA 3UWKA 5BWNA 3AVYA 3RE1A 2ZE7A 5JYCA 2J0EA 4J16C 1M8PA 1CP3A 2DE0X 2GTPA 5GZ1A 1Z0KA 2BE9A 1B1CA 2BHSA 2VP4A 3RFTA 3VYUB 5ED4A 2JANA 5AICA 3HACA 1GU7A 4J0JA 4YRIA 2DF8A 1L7AA 4C2AA 1IHOA 3PL1A 3PSAA 4MPDA 4Z0TA 4YAIA 3NTXA 2GKSA 1Y4UA 1K97A 5AVVA 1ODTC 3RROA 1FPMA 1TTQB 1S6YA 4AMVA 2P67A 4ACBA 1UIRA 2CFCA 3M81A 2Z6AA 1L1EA 3NEAA 2OESA 4XA8A 2ZGVA 1J22A 4ARBA 1QR2A 4JLOA 5K0SA 5A3VA 3LIPA 4E2FA 4R0MA 3ETCA 4H1UA 2QPOA 2ZATA 4QOEA 1T4GA 2P5UA 5AI0A 2FJUA 3T5TA 1Y6FA 2HK9A 3ZWNA 1N5JA 3CUTA 3GGGA 1L7BA 2ES4A 1W581 3FTNA 3PKZA 1JR4A 4TMVA 1LEHA 4GPTA 3UOGA 3UT0A 4A2CA 1ZGAA 3D8NA 1ISJA 3L8FA 5KQLA 4HD8A 2FRXA 1OAAA 5KWEA 1TW2A 1ZRHA 2FLKA 3TDKA 2FG5A 4WE3A 3X1XA 5IZCA 3O31A 2YCBA 2ZJ7A 1ONBA 1IM5A 2ZJ6A 4L1KA 1W85B 3NFYA 2AW5A 1IZYA 4PYQA 1GAWA 4L4XA 3PNOA 1Z45A 3H9EO 5LCXA 2XMZA 3L6UA 2GF2A 3OU6A 4B4VA 1USKA 1GFWA 5F5XA 3P5BA 1KVRA 2OORC 5B2EA 2RGCA 4YDHB 1UP7A 1CF9A 2I9PA 3C4VA 2J5QA 4LHVA 3WGOA 1F6BA 1KSFX 4MW0A 2C29D 4B6GA 1XKQA 1OBFO 1PT8A 4OK6A 3OQ6A 2R5FA 2XGOA 4OGFA 3D1VA 5FWNA 1ZNYA 3FJ1A 3QQPA 4G97A 3HYLA 3NXSA 3T3HA 3IQXA 3TNJA 4B40A 3NDBB 1II8B 2PKEA 1LK0A 1CRPA 1HE2A 1T5HX 3QHPA 3KOYA 4FOLA 2X9NA 4H7JA 4MVJE 4LVUA 2Q3EA 4FUTA 4QDKA 1LC3A 3GLUA 5A04A 2CJWA 4ATNA 5CEJA 3M8KA 5AVZA 2NYUA 1JQBA 3DTNA 5AW2A 3KCQA 4IDDA 1KDYA 1BEEA 2BFEA 2PV7A 4JX8A 1FNCA 4JXKA 4KXQA 1M34A 4FSHA 2FPIB 4NQZA 5ALWA 2PNJA 4AK9A 1FW8A 3QWFA 2OXCA 4O0MA 5F23A 2XCSB 1U9JA 1Q50A 4ACAA 2WRZA 2CXUA 4PU0A 3MUEA 1XDGA 5D3MB 4B0OA 3VPSA 2VJAA 4O4LB 3V4ZA 4H3KB 1TU3A 4JXXA 1OY1A 1Y80A 3QV1A 4G5RA 5E8RA 4WEQA 4LY9A 2E6KA 2ZTLA 1QAMA 1SVOA 1A4IA 3WYBA 3WAGA 1VCIA 1U3CA 5LMNB 1NMYA 2WJ4A 3I9V1 4B3FX 3HCPA 1LUAA 4FWIB 1B6SA 1O1YA 4RD6A 5D5HA 3TTUA 4KYUA 2HSZA 1KQGA 2D1QA 4FNMA 1P44A 3U4AA 4FFPA 1GPDG 2WEKA 3NBQA 3FZGA 5DLYA 3UH1A 3EQ6A 1XEXB 2ZBVA 4I4CA 4L9WA 7GPBA 3Q8LA 3GLTA 1FP7A 1VBFA 1TYAE 1SY7A 3UJ6A 3PNKA 5CURA 3Q6IA 1Z29A 3K1TA 5ER6A 5LZ2A 1N0HA 3JQAB 5ERYA 3SM3A 1BE8A 1XFDA 1AGYA 3E6AA 2B9EA 4YRLA 3F7MA 4CTOA 3HTXA 3OPYB 3G2MA 2GK4A 2P4UA 2V3VA 1SRRA 1G98A 3LUPA 2NZJA 2XOKD 3EW7A 1Z28A 3M5WA 3OWHA 4O2AB 5EIWA 2VK4A 4D0RA 1BKDR 3DYVA 4EAAA 3TJMA 2P27A 4AZTA 5C1DA 5LSAA 1TM5E 3OZFA 3E1GA 5GM1A 1UKVY 4I9FA 4QOIA 3EB9A 5JPIA 4CM8B 3WFIA 4A4DA 5DU2A 2IA5A 3U4QB 3PE6A 1E94E 3DMTA 1P31A 4LOJA 4HLDA 4OSPA 4C0BA 3THXA 4HXYA 4RHTA 1HZJA 4GQIA 3DO6A 4ZRDA 3RV4A 1KMHB 2Z83A 3M34A 4BO2A 3AYZB 1R4MB 2WUVA 1MH1A 2VAXA 1M83A 5DHSA 1A8UA 1BVYF 1S7GA 2XT0A 4EHAA 1R0LA 2RHDA 2Y0CA 4UTVA 4N6NA 4BPRA 2PZ8A 1A0OA 2VJCA 2WIFA 2JH9A 5HCNA 5T6BA 4WIAA 4L8GA 4HGZA 4E5PA 3V7YA 2H4YA 3SZRA 1CLUA 1T0BA 4HQKA 3MPUA 5F35A 4KZKA 3CRZA 3H5LA 3R7NA 1YB5A 3FUCA 2CFOA 5BUZA 2C07A 5SYAA 4YJ3F 4YMVA 3HY3A 5JAIA 4HVTA 2IF2A 3SMVA 4P3NA 2V4MA 1VE1A 2Q3FA 2WWXA 1QV7A 3QVGB 3FOFC 3KZVA 2PYDA 4J0EA 5JEEA 1RBZA 2HBYA 2YJTD 3CWQA 3NDIA 3FCAA 2VBGA 2DHQA 3VYTB 3G3EA 2FWJA 4IXNA 5AKHA 2WWTA 5CJ2A 3WLQA 3BJZA 3OH8A 1XZGA 5IJ9A 4DMCA 3AL2A 3COPA 4A6XA 2RGGA 1JE0A 2B6NA 4NECA 3MC1A 2I9KA 1H6AA 1J25A 4XDHA 4GS5A 5F9FA 4Q7KA 4ZQGA 5KVQA 1T6NA 221PA 4I8IA 1TCAA 2DFLA 2YR0A 4NFLA 4PR0A 2IYYA 1E3MA 3EF1A 3EG5A 4AURA 4QPNA 4X66B 1V8OA 3I6QA 2ID8A 1L4HA 1HLPA 4K03A 3QKRB 5HF8A 3FCXA 5C35A 1CU1A 2JHAA 4XDGA 1OMOA 3UK7A 3AOGA 2ZIWB 4G89A 3FWKA 2BGWA 3AEQA 4FC6A 3KDPA 5HKBA 3E35A 3H86A 1TYZA 3CEAA 1OIXA 3K09C 5EEGA 3I61A 2IV3A 5E1MA 1DAFA 1Q84A 1WSAA 4V3BA 2BMAA 4X7BA 4YA6A 4NQRA 2PD3A 5E1OA 2M6LA 5BRAA 3HU2A 1V95A 2O3TA 3OP1A 4LF5B 3IUYA 4IGEA 4LE2A 4JB2A 2QTCA 5P8WA 3MT8A 2ZVPX 1U8XX 3BGSA 4RYDA 1F20A 2HREA 4OU5A 1CR0A 5ECYA 1DKPA 4MI9A 3PUVA 3HABA 2EWWA 4RPLA 4BX8A 3TJRA 3SCZA 5JSKA 3HUUA 4JROA 4WBSA 3UTCA 3LV8A 4WVFA 4AY2A 4P7GA 3STVA 3CHYA 1HT3A 1YS2X 1H2WA 2H11A 4L0MA 3OZCA 1B2RA 1RVDA 3LDGA 2BFBA 1SBHA 3JD4A 2ZU0C 1G5QA 1ESCA 1M74A 1RM5A 5H9VA 3VTAA 3ZG6A 3OQNA 3AONB 2V0CA 2Q4TA 3AP2A 3DJFA 4AKHA 4YXWD 1Z36A 4UPEA 2YWJA 5L6MB 2G5TA 5AOCA 4GI7A 1XZBA 4X64B 2QN8A 1DIRA 2D5LA 2HZ7A 4M7OA 2ZRFA 4UVEA 4DLRA 5FWXB 1NTOA 2DUUA 4WY2A 3SYNA 1P8AA 2UUPA 1J2RA 3QYFA 4TLCA 1O6CA 2W0SA 4R54A 1OFUA 4KBYA 1LK7A 2V9CA 2W2VA 3U3JA 5CVTA 3P2MA 3U6KA 2Z08A 3I73A 1RYNA 1HE1C 2A86A 2CVOA 4GM1A 2W8BB 3VYSB 2NXWA 1QE5A 4EPXA 1WTCA 3IV6A 2EZUA 4H1WA 5FNVA 5AOVA 1BCSB 3DH0A 4LJYA 5CVDA 1X3SA 1KZ6A 4MV5A 3IUEA 4NNJA 1KRXA 4J29A 1LU9A 4MW7A 1RQPA 4CF3A 1E0DA 5KWIA 1IXKA 1G7SA 1QR6A 3G0GA 4MK4A 1RKUA 1QHHB 1RPTA 3IEMA 2FW0A 2V6IA 2XEDA 3ANLA 3JQBC 1N3LA 4UEWA 4HB2A 1TK2A 1X86B 2LCIA 4ND8A 4TWAA 4X1IB 1HFWA 3PD1A 4H6VA 4G0QA 4QVKA 3BN3A 4KMRA 3QELB 4RHUA 3A6KA 1P3DA 1WXHA 1NI4B 3DDSA 4JEHA 3KKLA 4YAEA 4OQEA 2HLDD 3WRXA 1PP4A 1RE1A 2DT8A 3A28A 4MRMA 1PJSA 3AFOA 3C3JA 4RX1A 4UVGA 4ZCPA 5KNCH 3TFOA 2CEAA 3A4IA 5CYOA 4YP7A 2O1EA 3DKIA 4DR3B 1WD7A 2NIPA 3A9RA 3U9TA 2VS1A 3WTBA 3NBAA 1Z83A 3OIDA 1L5QA 3HU1A 3JQFC 3G2QA 3KR2A 2BZGA 1ZK4A 3RKRA 3T7KA 1QS0A 2ZG6A 4X62B 5KNCD 1WNTA 5FFFA 3UYLA 2Y1CA 1JAIA 5JNVA 3E1SA 2HX1A 3IC5A 5H81A 2W2KB 4PINA 1K66A 2Q6OA 1TK9A 4K5QA 2C0PA 1H69A 4H4EA 3GG2A 4DG9A 3K9FC 4LZAA 3I8XA 1YASA 3LFHA 1QE0A 5AI9A 1UPUA 5BUCA 1ZM9A 2LR0A 1H23A 1EVYA 2P2ZA 3ED5A 3GLHE 4KLZA 3WK9A 4CR8A 2BRUC 4Z8YA 4CL8A 1BU8A 1O6ZA 4GPIB 1W36C 4BKPA 3REQB 1CG6A 3OP4A 2VBFA 1N9KA 2PX2A 4RGBA 4Z9FA 1E1CA 2NU7A 3FZEA 1U0RA 5A05A 4K9DA 2BM0A 1XU7A 4AKIA 3H8JA 1NJFA 2ETVA 2XB9A 1XROA 2OBBA 2V7WA 4RVGA 3U13A 1NBME 2BGMA 2FF7A 2YXPX 4OHOA 3TQSA 3ZZUA 2PZLA 4B81A 3KZCA 4IJ5A 4U63A 5BV2P 1PLKA 2QMOA 1RZVA 2OWDA 3GVHA 5DH9A 2FPWA 2FE4A 3G02A 1PU2A 3P19A 4RLSA 4AMBA 3DV0A 3F6CA 1Z2PX 2H1HA 2QTMA 4EATA 1X1RA 2DBQA 4P84A 4RZIA 4YXFA 2HBZA 5JISA 1F51E 4NMWA 3NB0A 3PC8C 4YRFA 5FOWA 1FFWA 2DWUA 3K70D 1LZKA 1ODCA 2ZEJA 2ZYRA 3NTVA 2OGSA 1H4SA 2QAGC 4TKZA 2Y1LA 3CH7A 3NG1A 2WZBA 5LD2C 5H0IA 4DPMA 4XM0A 1JXQA 3GA5A 3VR2D 4QFDA 2DFPA 4B6PA 3FOEC 2RBEA 1HT2E 2VFAA 5KOJA 4TTAA 1U3WA 3R3SA 4ZTUB 3OEEA 4ES6A 4QXRA 1GD1O 1NVWQ 2C3PA 4II2A 4QX6A 4Y3UA 1MFZA 1GYQA 2VXCA 4S35A 3W34A 4CM4B 1B0AA 1HE8B 3L6RA 4G1EB 4YIHA 2NAFA 5GPBA 4EG7A 4U2DA 1DPFA 2HOQA 3KS9A 2AVNA 4GZ6A 3EWIA 5AM4A 5ELLA 4IZOA 4HDRA 4DTIA 3OX2A 3TF5A 1JWLA 4RK0A 1SC3A 2JAQA 3I9KA 4ZI5A 4NFYA 3WWZA 3B78A 1C9EA 3TW4A 1GNPA 3GUHA 2VSYA 2CLCX 4U3JB 1UCFA 1ZU4A 1U0SY 3RJMA 1ZNZA 2I76A 3P7MA 4OV6B 4XQ9A 1D04A 3ONEA 3CINA 5DF1A 4LNUB 1T9GR 5IT5A 4Q15A 4R8MA 1VSQA 1KK3A 2MOKA 3HYRA 4V38A 3AW8A 3UB3A 1TAGA 3FBGA 5CP8A 2UU9B 2VLIA 3F6PA 1C4KA 3BB3A 4OXIA 1WCYA 4CZ2A 4HDNA 5G1OA 1XOIA 1CZRA 3K9CA 1ZUNA 2HTFA 4W8OA 1LTKA 3H2SA 3L0OA 2CJPA 3HJRA 3TR6A 4O59O 1NXPA 1RLTA 3DWIA 1CHNA 5JJCA 1VPVA 3QEMB 2OE2A 5CVVA 2XE6A 10MHA 5CFOA 5JBIA 2WLSA 2WZQA 1RR6A 2P75A 4AZVA 1SUAA 2Z58A 2JJ8A 3A6HA 4G63A 4KP7A 3HK2A 3P96A 1IN4A 1JXAA 3VXKA 3A2LA 3I9FA 2G9VA 3V4SA 1TT7A 4I4TA 5BVHA 3PR1A 5C8YA 1VE7A 1ZK2A 4R1QA 3TQHA 4LI0A 1BCRA 1E2PA 3LH5A 4FD3A 5FYDA 2IV2X 1O95C 1OT5A 3FWHA 3R5XA 4NU0A 1MC4A 3EPPA 1FS4A 2OQRA 2PGXA 2P4QA 1RJ9B 1XVAA 3Q8XB 2JDIA 4FGUA 5CR9A 4NTZA 3LD9A 3W8DA 5J3JA 5ALVA 5AQEA 4ZT2A 5ECDA 5KDDA 5CIQA 5FD8A 2R4QA 2P11A 3NATA 2NW6A 3VO9A 1MFPA 1YRLA 1ZIDA 1UWLA 3W7BA 3EDQA 5EJ5A 5B1DA 1PF7E 4PGFA 3RH0A 3N7AA 5HKAA 2YJ6A 1DU4A 2RHMA 3G9XA 2BUCA 2JCYA 3J7TA 4QHSA 1C3LA 1JDTA 3ETJA 4FR5A 3VR5H 4TMWA 3WL7A 2WABA 2UUAB 1P1KA 4N6GA 3O3CA 4FOTA 4PRYA 4UUPA 1DO8A 4WAUA 4MV9A 5IBPA 3WWYA 4B4DA 5BSVA 2NSHA 1YQEA 1NI3A 2HHAA 3Q98A 3IEIA 3HP1A 5TGDA 4AN0A 4LJ8A 3IAHA 3WIEA 1V39A 2EV9A 2WINI 2G1JA 3VR5D 2IKSA 1S2LA 2RHJA 2XB6A 2PKYX 1V1RB 2B25A 3ORHA 1E3EA 1IEWA 1IHPA 1U4NA 1FQKA 3AZPA 4JUFA 4II3A 4TL9A 3WXBA 3OLWA 2XUJA 4BVJA 2NO9A 4CCWA 1UADA 1FXWA 2XH8A 4YT5A 5I8WA 4CV3A 4Q3KA 1HOTA 1D2HA 3BFXA 1YRHA 2OXEA 1TQDA 3OHPA 1G3IA 1RDFA 1OW3B 4MLCA 2XB8A 5ICGA 1TVCA 3A58B 3FFBA 3AUXA 3GLIB 3LGXA 1SXJC 1C3EA 3TD6A 1GQQA 3IUBA 2R2GA 4JJ7A 4EMTA 4BNFA 3L18A 1XDZA 3LUGA 4LY0A 1TKAA 1DAEA 3DEKA 2PSEA 2Q0SA 4YCAA 4L3WA 3QEOA 3BH0A 4FCTA 5FUVA 1QJ4A 4ZEWA 3VNBA 1I30A 4UAGA 2QD4A 3LT0A 3WYAA 1S8NA 2GB4A 3MIIA 1ARZA 1DRKA 3IBGA 1GPBA 2QBYB 1QH9A 4TKVA 3RRFA 2FEKA 2YJ3A 3RU7A 4F1KA 3QX7A 4RK5A 5HEKA 4FHZA 1BNCA 1Z5GA 1EFPA 1VP3A 3IIJA 5HMMA 3VU1A 2OV3A 2I80A 3AZOA 1K1EA 3ORSA 2JCBA 4CEJA 3IP6A 3OMXA 3BH6A 4B3IA 4WBNB 3HNOA 4QULA 1TKRA 5BW5A 4P53A 3RS0A 2YVQA 5I9IA 4YUVA 3WLEA 9GPBA 1GL6A 1NBAA 3RUFA 4BO7A 1PTJC 4EL5A 3F4KA 4F12A 5F2EA 2VPQA 1UMCB 3E53A 3QKIA 4JKIA 1AV7A 1G5HA 2Q27A 4U2FA 4A0QA 4LC1A 4DQKA 5F33A 1EJ2A 3W6NA 1RQLA 1TAUA 3PJRA 2QMQA 4FKBA 1TYDE 4QSMA 1HI9A 1MLDA 2IXFA 2PM8A 4HYEA 4GKVA 1PL7A 4II7A 3KOUA 4QNRA 1L5OA 5EPOA 1L5KA 1EFVA 1RNLA 2RJNA 4WY5A 3SQNA 3BULA 3PLAE 1UK7A 3DVRX 4Y9SA 1L4UA 2G9UA 1ZGHA 2HU2A 2VYVD 1RABA 4MQLA 4EJ0A 2VVTA 4CQLB 5ALSA 3U3RA 2PFSA 1TUEA 1NNI1 2J3EA 3NGMA 3U0VA 4CV2A 1DFGA 1OX4A 3SBDA 4QICA 4DWJA 1OFVA 1OOEA 2VF7A 2FPGA 1XFAA 1TZKA 2CNWD 3WWEA 2XGMA 4NSNA 1E2FA 4U6NA 3GLGB 3L8EA 1Y5MA 3AM4A 4QWWA 4OLAA 5KTNA 4X8HA 3WV4A 1DTWB 1RBYA 2WB2A 4COKA 3GV0A 4BBJA 5L40A 3EUFA 2IZZA 2OL4A 1Y5NA 2W6CX 4JU9A 3VVLA 5B3KA 1WXEA 4E5VA 1J09A 2BZ1A 3WMWA 3W5AA 4LK2A 5HK8A 4PBTA 2IDKA 4TS9A 2RHGB 3KPWA 3CLSC 4MA0A 4TL7A 2AUNA 3TLZA 3R9WA 3L7CA 4G1MB 5TRTA 2K2WA 5JDCA 5CU7A 3ZLBA 2PUDA 2YV3A 2I6TA 3ANSA 1OJ7A 2VXBA 4I1UA 2Q9BA 2FPSA 3WRYC 2V03A 3MPOA 1UINA 5GJCA 4DT1A 1E2EA 4P3YA 3RK0A 2GILA 5BMOA 1PZNA 1Z4IA 2G5GX 2IU4A 2OHXA 2QTZA 4FX5A 3FUUA 5E95A 5JVDB 1C80A 5HTKA 3SQMA 3GBSA 4N47A 1XZNA 4ENTA 3A9UA 1PEAA 1WW3A 5IN5A 3T7AA 1JIJA 4NZOA 3K8QA 4KQJA 3DO5A 1AXRA 4L75A 3IELA 1JG7A 1L4BA 1VFNA 2QP9X 2ET6A 3ILYA 4ZXPA 3W9YA 1FRFS 3ZUPA 2O5CA 4EY8A 4KIJA 5G0UA 2ZUUA 2J08A 3AU8A 3BZUA 3EEBA 3HA2A 4A5SA 3HCOA 4URUR 4JLPA 4WSOA 5D86A 4ZI7B 4G5FA 3SHVA 3AHEA 1YA8A 3W4JA 2OCYC 4EJMA 3T4UA 1FRVA 2EZ4A 2PTHA 3C39A 3HKDA 1KJ9A 2ODAA 1I4EB 4YIKA 1O9HA 5H7XA 1J0CA 4QO8A 2BBOA 5A3QA 3AY0A 1YXMA 1NW5A 2XWBF 4CLHA 1PX0A 3IDQA 1ISGA 3OHSX 4DUPA 3MXOA 1RADA 7ABPA 1Q91A 3JYPA 1QPGA 2P9BA 3I58A 2BD0A 4WASA 2WMNB 1RP7A 3O94A 2N9UA 1L1RA 1MABB 5LYYA 1H1TA 4H7PA 1PFGA 5T3UA 4Z1MD 721PA 2OM2A 2VK8A 4BP9A 1NDHA 4JWTA 1KGSA 3V46A 4B4OA 3U17A 2FQYA 4UOEA 1LDYA 5BOSA 3H2GA 3O7WA 1MVOA 2ZR9A 4B2LA 4NBLA 2E4VA 3GJ3A 2Z3WA 5LZ5A 1X7YA 3OJLA 2CFSA 4QPJC 4Y2HA 2QIOA 3VSBA 4CM3A 1Z0JA 4WFKA 3ER6A 1G0OA 4PZCA 2A14A 4O1IA 4IHQA 1EU1A 1TEVA 1RYZA 3RVPA 1WLYA 2ZZKA 4QXQA 6ABPA 4EYOA 4XWWA 2WM9B 3G0DA 1KYTA 5FO1A 2R7MA 3PPWA 3RRNA 3SSMA 3TI9A 1T8UA 4DUYB 3AY3A 2Q8NA 3CG4A 3DNPA 3F98A 3B60A 4FEGA 4HH3C 4YCCA 4X65B 2PLWA 2QQFA 3A1WA 1T1GA 2ZSIA 1MQ8B 1N9ZA 3D5EA 5LUBA 2DPHA 2VJBA 3IP8A 3OAAA 5COQA 3H83A 4ZV4A 4PRKA 1KWKA 3TTYA 5E6UA 2JVKA 4UJ5A 5HX7A 1YE5A 3X43A 3DHEA 4LYFA 5HQTA 1I8TA 1UBFA 1WCIB 1ENYA 3PHCA 1KPHA 1HUQA 4EJFA 3QBJA 1SCNE 2GBLA 1K9SA 3QVLA 4QPDA 2JIQA 4LWOA 1W94A 1C1DA 3G5AA 2R11A 3L7IA 4M7WA 2BGLA 2HLPA 3NZEA 4GI5A 3AOEA 3E2MA 1LTQA 2EERA 5JZMA 3WJAA 3BXPA 4C7OA 1CUXA 4D44A 2X8JB 3N53A 4N0PA 4ER5A 1L6IA 3COVA 1Q3HA 1HV8A 1WY5A 2XHZA 3UH0A 5B5SA 3OJXA 2GEVA 2HM7A 2VLBA 3RYCB 1CUSA 3FPEA 4MLDA 4F4JA 5JU6A 2IIBA 3MTJA 5CCXA 2YXNA 4RA9B 1NVVR 4HH0A 2E4WA 2V7TA 5JH7F 4R9UC 1ZD4A 1MNQA 4YGXB 2GD2A 5AKZA 3SSAA 4FCCA 1MXFA 3H6GA 2PNFA 2NT4A 3P97A 4A0RA 1JMYA 1T3LA 4MW5A 1MB3A 3GZ4A 3BD6A 2I3BA 3R24A 5AVYA 4O4IB 1UAGA 2EFJA 3EXG2 3GDFA 2LCFA 4ZQHA 5FTWA 4WCFB 2F3SA 5E0OA 3UXMA 1Y1QA 2JI6A 4LQCA 1YQQA 4EWLA 1E5LA 5JHGB 3PFHA 4C06A 2ICAA 3TDMA 2R87A 2J85A 3HKBB 3KEQA 3O2JA 4BO5A 1WG8A 2J0UB 2H3HA 2O5EA 4JYAB 2OZVA 5LN1A 4QYTA 1I4DD 2GRJA 1KAGA 4O2BA 1PKXA 1JEYA 2C7OA 2YIJA 2UXDB 2AKEA 4H7FA 4UDYX 3R6TA 3OZIA 1ELOA 3BT7A 1IBKB 4U1RA 2XUQA 4IOKA 5AI4A 3TOCA 1GUAA 2R8YA 3NBUA 4R8VA 1A04A 1YDFA 2OHVA 4YDSA 5CYFA 3MJFA 5AR1A 5C3MA 2R97A 2C4WA 1R5OA 2PVPA 2FUCA 3RVMA 1ZH2A 1Q44A 1QDLB 4D41A 2HU7A 2VRCD 3C8HA 3H5TA 3IR7A 4YLGA 2RJOA 4H7HA 4DCMA 5DCUA 4A36A 4O4HF 4O4JB 4CKCA 3V1KA 3F3SA 4PQYA 3HVHA 3QG1A 2FOXA 4MUIA 1T3ZA 2WKQA 1T0IA 2JI9A 3WOHA 5IVKA 1VJ1A 2VF4X 1P5RA 1P73A 1WHTA 2H00A 3ISVA 4K40A 3ZIUA 2WNSA 4GBJA 1QBKC 5C1PA 1CUUA 4N41A 2BSQA 4NCXA 2PL3A 4ZT3A 4DM3A 1CBUA 4G9GA 2C7BA 4ZCLA 1GEGA 3FKSD 4DC9A 3PFKA 1PSDA 4QXMA 5F21A 1EUDA 1C1XB 3ZHTA 1ES9A 3AGPA 3OQBA 5BWMA 2WQ6A 4JKYA 1I6KA 1AN0A 1QV9A 3ZDCA 1TX4B 2D0PB 1EUCA 1RHRA 2VEOA 5EHZA 4MW9A 3WL3A