2Y1LA

Caspase-8 in complex with darpin-8.4
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
150
structure length
150
Chain Sequence
LDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Caspase-8 in Complex with Darpin-8.4
rcsb
source organism Homo sapiens
molecule tags Hydrolase/inhibitor
molecule keywords CASPASE-8
total genus 56
structure length 150
sequence length 150
chains with identical sequence C
ec nomenclature ec 3.4.22.61: Caspase-8.
pdb deposition date 2010-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2y1lA00
4D3XA 2XYPA 4N7MA 4ZVOA 3GJSA 5IBRA 1RWWA 4QUHA 3V3KA 1I4OA 3BIJA 1NW9B 4PS1A 4AWAA 3GJQA 4JR1A 1RHJA 3R6LA 5LUAA 3R7BA 3R5JA 1RHRA 1RHKA 3SIPA 5IARA 2P2CA 2H5JA 2H4YA 1M72A 4PRZA 4PS0A 1PYOA 1QTNA 2HBRA 3D6MA 2CDRA 1F1JA 1QDUA 4QTXA 3NS7A 5IASA 4FXOA 4N5DA 5LUBA 5LU9A 1CVRA 4QU0A 3SIRA 3GJRA 1SC4A 1PAUA 3IBFA 3DEKA 2FUNB 2H51A 2K7ZA 2NN3C 4HQ0A 5IAKA 5JFTA 5LU8A 1KMCA 1RWOA 3K7EA 3PD1A 3R6GA 1I51A 2QLFA 4JR2A 4M9RA 5IAEA 3D6FA 3V4LA 2XYGA 4EHLA 3NKFA 4NBKA 4NOMA 4IEFB 5I9BA 4EHDA 1SC3A 3V4OA 1I4EB 5K20A 2FP3A 2C2ZA 3E4CA 3QNWA 1NMEA 4HVAA 5IC6A 1ICEA 4NOLA 5IC4A 3P4UA 2J31A 3RJMA 2H54A 4AW9A 4I1RA 4N7JA 3UO8B 4I1PA 3ITNA 1JXQA 2HBZA 4N6OA 4NBLA 5IBCA 3H1PA 4NOKA 4D3ZA 2C2MA 2H5IA 3DEHA 3IBCA 4ZVSA 2Y0BA 5H0IA 1GQFA 3S70A 3PCXA 1RE1A 4JQYA 4ZVTA 3R7NA 2J33A 1F9EA 1K86A 3V55A 4JR0A 1NMQA 3GJTA 4QUIA 5IABA 4FEAA 2CNOA 2H65A 2QL7A 3EDRA 4QUJA 3NR2A 1I3OA 3OD5A 4PRYA 4QUGA 4DCJA 4DCPA 1BMQA 2AR9A 4IYRA 4HQRA 4QUAA 5IANA 1RWMA 5IAJA 2CJXA 3DEIA 5IAGA 3R7SA 4AWBA 4QTYA 1NMSA 2HBYA 2C2KA 4ZVQA 2CNLA 4N6NA 3P45A 2J32A 2CNNA 4EHKA 1SHJA 2J30A 2H4WA 1QX3A 2CNKA 3EDQA 4EHNA 1RHUA 3KJQA 3H0EA 4QU9A 3V6LA 1CP3A 1SHLA 2C2OA 3DEJA 2H48A 2QLJA 3KJFA 4NOJA 3H13A 1RWKA 2DKOA 3PD0A 4EHHA 3UOAB 1IBCA 4QU5A 1RWXA 3H11B 4QUDA 4D3YA 2QL9A 2XZTA 4QU8A 4ZVPA 3D6HA 4ZVUA 4ZVRA 2CJYA 4JQZA 5I9TA 4JJEA 4FDLA 4QUBA 1K88A 1RHQA 1RWPA 2HBQA 4EJFA 4NBNA 1SC1A 2QLBA 2QL5A 4EHFA 5IBPA 3S8EA 4JJ7A 3KJNA 2C1EA 2XZDA 3V6MA 4JB8A 4N6GA 4JJ8A 3R5KA 4QULA 2Y1LA 4FGUA 1RHMA 1GFWA 2WDPA 1RWNA 3H11A 4QUEA 1RWVA 2FQQA 4EHAA 2XYHA 4DCOA 4LSZA
chains in the Genus database with same CATH superfamily
1KL7A 1W8DA 2Q3EA 2QUJA 3OBBA 1CU1A 3IOMA 1TK2A 3PFGA 4PZCA 5ALXA 1IN6A 4C43A 3W78A 4Z4HA 1CZUA 4FSHA 1CQZA 4IJMA 1XFDA 5E3HA 4C89A 4Q9LA 3O90A 5L3RA 3X0DA 1GTRA 2Q3DA 3UANA 3L0SA 1DARA 2CVOA 3QE2A 2Z6AA 4HPWA 2YJ4A 3FA2A 2ZULA 5F1YA 3LQRA 4E07A 5EERA 3GD7A 4HDCA 4IS3A 1IOZA 2Q0SA 2I9PA 5K3FA 5A5EA 5JPIA 3H3JA 2XXBA 1DMRA 1UC4B 3PX3A 3PQ4A 3T3OA 1F8GA 3DFUA 3BMXA 1FTGA 3TUIC 4RTSA 2C98A 3D3NA 4WXYB 2QAGA 2VHUA 4WIAA 4DR3B 2CL5A 5EHIA 3WOVA 2ZTSA 1AUXA 1EQ2A 1EX7A 4D9HA 3UJNA 1BGXT 1BD4A 1MVOA 1GUFA 2AJ8A 2FSIA 4O4IA 4UUNA 1GL9B 2OILA 3SNHA 4BASA 3BHNA 4R54A 5B36A 1O5TA 5KEIA 1DELA 1Q57A 3FTNA 4F0JA 3DE7X 1LJ8A 1XOIA 2OBMA 4CDNA 1QBKC 4IPTA 3MMSA 4D98A 2H85A 4BNYA 3W6OA 5BV8A 2GCNA 4EL0A 4XIJA 1R74A 3DWEX 4NBWA 1ESZA 4MHOA 2JD2A 3FTEA 2F64A 2DBYA 3VSCA 3IAAA 5HGJA 1E9FA 3G0DA 2VUHB 4K0KB 1K9VF 2PAAA 3T54A 5FWNA 3AQ4A 4G8JA 1D1QA 4EK9A 1PEKE 4V0SA 3ZWNA 3QU2A 5FD8A 2W2XA 2DBVO 1TQ8A 2EFJA 4MVJH 5ED0A 1OJLA 3R7NA 4B71A 4EABA 1S3GA 5JNRA 2YIMA 3Q8WA 3LI2A 4PSCA 5EKDA 1KEZA 2X6RA 3O8OA 3WGOA 5HXAA 1DFHA 1I3OA 1WVMA 5IFKA 1E69A 1NJ8A 2QN7A 2P0YA 2WA2A 1KO8A 2QRUA 3AFGA 3FPLA 3GL9A 3M4ZA 3RJ9A 3ZEIA 3U4QA 5H82A 4BB6A 3L07A 1JT9A 3BSFA 3NEAA 5JQWA 2ONKA 3FTCA 3P0FA 2DMRA 1EXDA 2JFWA 1KSFX 2PWBA 3NHFA 5B5SA 2ZRPA 4DUPA 3WGIA 1KYXA 1FK8A 1WU8A 5F76A 3D6TB 5BORA 2EFGA 3ERCA 1SO8A 5CX4A 3FFAA 3QVMA 4GM1A 1G42A 3H2HA 3WRYC 1Z2AA 2W4MA 2OFPA 3SHQA 3ZVRA 1IY9A 1JEDA 3C6MA 3E05A 3O92A 2OLEA 2PX3A 4XLTA 2FDXA 1GOTA 5HF9A 3IHTA 3C97A 2VL7A 2EJBA 1J8FA 3U26A 3WRVA 4YCSA 1BXGB 1IC6A 2Q6OA 1C7RA 3DOFA 1CETA 3M70A 4YJGB 5REQB 2JGJA 4YRRA 1XTRA 3R5FA 1HE2A 1SUEA 4Y1EA 2GFHA 1UEIA 4D81A 5LQNA 4PX3A 1O87A 3D0KA 1A96A 4GYJA 4R40A 1N5OX 4QBGB 1FUIA 1Q7RA 2I76A 2WDPA 4KE9A 3RABA 4EUEA 3I32A 3R5TA 3DBHB 4PC1A 3SC2B 2PXCA 3MZ0A 4LRQA 4WJKB 4XWTA 5FOVA 4KPFC 4TKVA 5TQ0A 2DEUA 3E5MA 4YRLA 3ET5A 3OT4A 2JI6A 3I30X 4KXWA 4FFSA 4QM7A 3LP5A 3AI2A 2I2CA 3R0JA 2X5OA 3A70A 2XJ4A 3F6YA 4L5IA 4YBRA 1D07A 4X0EA 2RBEA 2YZGA 3ET4A 1EEHA 1DO8A 3HJRA 2IPMA 4WCFC 4E6PA 3C5CA 4TGLA 2RH9B 4P54A 4DLLA 4V02A 3BJRA 1OT3A 4JENA 1DXOA 3DE6X 2IELA 2W93A 4IZHA 2W6JA 4LN1A 1RADA 2HCFA 3JATA 4WADA 1T3HA 2FZEA 3GROA 3DZCA 2MOKA 2IHYA 2FPLA 2ORIA 2X41A 2Q4OA 3GDGA 3KELA 2XI4A 3N8IA 1EGQA 3KFXA 5BNFA 3T7JA 5KOIA 2FEXA 4LWZA 3F71A 4D26A 4URZR 4DXDA 4AJPA 3AVQA 3JVDA 4OJTA 3CSSA 4MA0A 3ZGNA 4WE3A 5FB3A 1G64A 4B6EA 1KQNA 4LUCA 4QICA 4BQEA 3BL8A 5HRAA 2OWEA 3IQFA 4ZYZA 1JJ7A 3Q7IA 3QLUA 3NVDA 1BTOA 3CCCA 2WFZA 4CMIA 3U0BA 3IIIA 3C87A 3QPVA 4Z1MA 3EC1A 4NZYA 3OTIA 2EX0A 4NH0A 5ED4A 4M98A 3OICA 5KAPA 4RLHA 2H54A 5ERXA 1HDGO 1YE8A 1YS2X 1UZLA 3DWGA 4TKUB 1T0BA 5P8WA 4NMMA 5CDFE 5LZ7A 3BHMA 4ZVSA 1FXWF 1EM8A 3GFGA 4RK5A 1NFRA 5AOVA 4UFOA 5A7HA 3NP7A 3SICE 3M8KA 3OZGA 3KQMA 1DZ3A 1BDJA 2NTEA 2D74A 2Q5CA 3AR4A 3I6QA 4GKVA 1V7ZA 2DHCA 2UZ3A 3GJTA 3DMDA 1KYIA 5FWAA 5JJIA 5EPEA 1RI1A 3PQFA 1ZWKA 5F2EA 2ZYRA 4MYSA 1U2QA 4OYYA 4ZARA 3PR3A 4MUBA 1UF9A 3DEIA 5JNWA 4O4LF 3T5MA 4HNGA 2WDZA 1ZJJA 3WLKX 4DNOA 3BE6A 3RGWS 1Q20A 4JLBA 4QBKA 3N2LA 5AKXA 4N47A 3IAS1 1NSTA 4J1QA 1HEUA 3RSOA 1FSGA 1I4WA 4HDAA 4MR7A 5DM70 3QEAZ 1AGPA 5TT1A 4MH0R 1GZSA 2PX2A 1CVIA 1FQKA 4AM8A 5KOJA 3JZFA 2D3WA 1BEUB 4YNBA 3CTPA 3D3KA 1BS2A 4P80A 2PV7A 4AXXA 1Q84A 4XX0B 2AQKA 3UV7A 1PZEA 2FX2A 4JCOA 2H07A 3G9UA 2ZRFA 3BGVA 1AD2A 4MRMB 2JPDA 1KAEA 1R6XA 3IALA 3SHTA 2X6TA 4YXWA 3RW9A 3F5DA 4CIWA 2VA9A 1CRPA 3F8TA 3RD5A 1PGPA 1IY8A 1WZEA 2AOUB 3FH0A 4UU0A 4YJ3F 2DB3A 3L79A 1KKLA 4MVJE 1N57A 4RFSB 4RXMA 1JDUA 3F1LA 2ZE8A 2NUAA 3LLSA 2YUIA 4AS1A 2G4LA 3HCNA 5EP4A 3M33A 2H0QA 1SKYB 2ATXA 3IIMA 2QX7A 3FUXA 2VYFA 3W1EA 1W0JD 1AF7A 3BERA 3MBOA 4ZV4A 4OOFA 4H4DA 4XJXA 4IUCS 2FZLA 3OOYA 4JL5A 4YR9A 2L18A 2PX8A 3EAFA 3L05A 1OYYA 4H7HA 3KCNA 4DBVO 5FUWA 4DHEA 3S81A 1YXMA 3L7AA 4C03A 1RBYA 3G8AA 1UBKS 1T26A 4BQQA 3UPDA 2OHGA 1YCGA 3W5AA 2BFBA 4IH1A 2ZDGA 3FROA 1RW4A 5EQTA 1WW2A 1Y5NA 3M6XA 1L9XA 3R7BA 3T5TA 3WJ1A 5KWJA 4RLSA 3UJ6A 1M0WA 1NYRA 4J9UE 1Z36A 1JI3A 3D6VA 4GP7A 4CT0A 3C74A 4HX2A 1YBHA 1OI3A 3RH0A 3FMFA 4ND5A 4D6YA 4C29A 1NJ1A 2AUMA 4NECA 1K66A 2ECQA 1OWLA 2FWJA 1G291 1G4UR 2OT3B 4R9SA 3PQ6A 1H2ZA 4YPVA 1CB0A 3SYRA 1VFNA 2QD5A 1DEXA 2RAFA 3CKLA 2CV1A 2WWGA 5C0OE 5CFZA 1NBAA 4URHA 4DIOA 5C8ZA 3D3QA 5AM5A 4MR8B 1BU8A 2YJTD 4V1CI 1NVGA 4PO3X 2WFLB 1G0NA 1W19A 3DO8A 4BX2A 1GAQA 2EXXA 1NRJB 3AQIA 4TTIA 1IZZA 1H5NA 4ZOEA 5CLQA 1YUMA 5AKZA 3WI7A 1OLSA 2AF3C 3AEXA 4DAOA 1SZCA 3CLSD 3G2IA 3DH0A 1NBWB 3VGJA 1KDVA 5JI2E 3DDWA 1W36D 4Q9DA 4R3NA 1XDDA 2EFEB 4HH0A 2EBFX 1ENPA 3L7LA 1P5FA 5J40A 2J5BA 5E9WA 3HXKA 3EDOA 2IWHA 1JPNA 1VJRA 5C8YB 1JQ3A 4X62B 1EJ0A 1FYWA 3MAAC 3BXZA 3LUJA 4GC5A 2JIOA 2UKDA 4RKFA 3VH4A 5FOSA 4C7XA 4ABTA 4OXIA 1M2OB 1KZ6A 3TZBA 3ZDCA 1JLSA 2HD4A 3WXMA 5L3QB 4G0YA 2NPIA 3EGIA 5LSAA 4IHJB 1NLYA 3OPQA 1B74A 2AZTA 3O8DA 1QCYA 3I4CA 4HNAA 1UAGA 5TJHA 3QBEA 2QMHA 3R7AA 4ASUD 5CT6A 1HYGA 4MIOA 4MMXB 1F14A 1Q0ZA 4RZ2A 1VE7A 3FTDA 1UMDA 1KIFA 4UPEA 1EB8A 2A59A 3M7IA 3MGGA 2IKSA 1KQOA 3F9CA 3K96A 5FPTA 3IJPA 4I8DA 3E1GA 3H6GA 4XUCA 4E2XA 3PC8C 4YCMA 2JCXA 2DPLA 3HM9A 3U44B 5DCLA 4DR4B 4OB6A 1IB0A 4EGSA 4IDEA 4ENVA 2I66A 2YWFA 2XIJA 3CZCA 3OZVA 1IN5A 3R6DA 3RRXA 4OKIA 5FOQA 4QFBA 4IIEA 4ATNA 4GXNA 4XFJA 1K88A 2Q8PA 3W6ZA 1X70A 4PNPA 1VLVA 1RZRA 1B8UA 5ALRA 3UC5A 2J9ZB 2IYZA 5B57C 1P9LA 4UTZA 1PR0A 3ETJA 1OFUA 2TMDA 3ZE0B 1Z8FA 5ALZA 5H81A 1B4DA 1RQPA 3E9DA 1Q15A 1V3QE 4FP9A 4LSZA 5TARA 4BQFA 3BXXA 1QZZA 4ZV9A 1MBZA 2J1LA 3LCRA 5SV2A 3OIFA 2FI1A 3RU7A 3H1BA 2FWBA 5M5BA 7YASA 3WGMA 1FQJA 2JHFA 4ZJYA 2YW2A 5GTDA 1PJQA 4MP3A 1C4XA 2X7XA 3MJHA 4WZAA 4XVQA 8ATCA 1ZR4A 1LNQA 4PNHA 2IXGA 3NTRA 4XIIA 4R2LA 1TUIA 3ANLA 3H97A 3WWCA 3B6JA 4KTTE 1YULA 2OXEA 5LDHA 3BJZA 5KSPA 1QO0D 2WUVA 1X1RA 2F1KA 3GRZA 2AZDA 3VNAA 5AH0A 4HX9A 5B1YA 4A8JC 3DL4A 4XOUA 1A5BB 4NARA 1HX7A 1TKRA 4CHTA 2IDKA 2JBWA 2WHPA 3A7DA 3FI0A 4NTZA 1HNXB 3V8QA 4LDPA 4XKJA 3KR1A 5LYJB 1KBOA 2PBZA 2IDZA 3MCWA 3AB8A 5KQMA 4LWOA 1NXOA 3BXHA 3WHKA 5G0UA 2WWTA 2GERA 2CMGA 1NI3A 3II6X 1G20B 4LE0A 1DX6A 2PMWB 3JQ9C 3FTPA 2J41A 1JLMA 2NADA 4IFTA 3I4LA 4EO7A 2PH3A 2VHCA 1YK0A 3RODA 1L3IA 3VOAA 3Q8LA 1V47A 4M8SA 3JQDA 3FYUC 2BP7A 4NOMA 3IVMA 1SKQA 4E5NA 3QNUA 3DMRA 3GGGA 4R2KA 4WOPA 2CK3D 5GGXA 1KVRA 4B4WA 5K0CA 1QF6A 3ITDA 4MV5A 3NUQA 4J0DA 5EVCA 3ZCRA 5BPFA 4RTJA 5CT9A 1QZUA 1HNWB 4GOXA 3PPWA 3WICA 2XUQA 2YXNA 5H3HA 3FMGA 4WY5A 5E4FA 4QOHA 3O38A 5F21A 1W49A 3GPLA 1L3CA 3IJ5A 3UTCA 4CQMB 1ILEA 4Y7DA 1RR6A 5LD2C 1NUQA 2OV6A 3DOHA 5BR1A 1M75A 3GF4A 5AM4A 2NU9B 3FZGA 4DLPA 3IELA 4MV7A 4K3UA 4MPDA 4X6XA 1ATZA 3IILA 1NIPA 3EW9A 1HR0B 1O97D 2PM8A 5FPQA 4JI1B 2XGGA 4E4RA 4R01A 4D4LA 2C8KA 1X1BA 1L4GA 2HSEA 4QOEA 4KO1S 5KCMA 4EZIA 2XCSB 2G1JA 2VDUE 2WE7A 2YICA 3EXIB 4QO7A 4IF6A 2ZRLA 3Q41A 1LVUA 1P6UA 4KGDA 3FSGA 4CUJA 3RTAA 3TQRA 2J6CA 3ESQA 4KIJA 3I52A 5JMOA 1GM5A 3TOZA 3UT5B 3A6FA 2GH1A 2JGFA 3IOBA 3ICQB 2RI6A 1UADA 3KVNA 2OCDA 4ZI5A 1TX4B 3Q0EA 2GF0A 1E7QA 3BTOA 3L0BA 4H18A 4ZOAA 4H1VA 1QAOA 2JFPA 4OJMX 1IM8A 2FXVA 1RT9A 1IK6A 3F5MA 4FDLA 2ZKIA 1LFDB 3WTCA 3WKBA 4EYKA 2XTJA 1E0KA 3E81A 2VHQA 3M6UA 1ESDA 3ONEA 3CVWA 4WESA 3K6RA 1P0QA 1L7AA 5AW8A 1J8MF 3ZWVA 5F77A 2JEYA 5BNWA 4W1SA 4JJ8A 3TCKA 5IFLA 1ZCZA 4Q4JA 1P91A 4WXHA 2YVQA 1J70A 1GFWA 2OBXA 1B8NA 1KJJA 3NXKA 4J8PA 4EITA 4P5DA 1Z7BA 1NDUA 1O89A 2Z57A 4FCTA 1ORDA 1EDDA 4JBNA 1SBCA 1G7CA 4Y2HA 3N3BC 3L0PA 1KI6B 2TMYA 3PICA 4XWYA 2GI4A 1C7QA 1YB7A 2VZLA 1AQLA 1R4NA 1XF9A 2E7ZA 4G37A 1J2YA 4ZO9A 3WFZA 1M1NB 4J76A 1QIKA 2AFVA 1U7ZA 1F0PA 3WIOA 1SIUA 4C2BA 1BCSB 2QAIA 5TSDA 3DVAB 5BUQA 1XNRB 1VPWA 3K9WA 3VRHA 1U8XX 3FPAA 4YO8A 1FUYB 1ST3A 4B3XA 2NU8A 1M2WA 4QLAA 3IX7A 2I9KA 3PTLA 4JMPA 4KDEA 4V1CB 3EQZA 4ZQCB 4TMTA 1ACJA 3KSUA 2BM9A 5EEHA 3SSOA 3PNOA 1PSDA 3KYDA 1JEYB 1WSBA 3CKYA 2ZLBA 1LPAB 3LXXA 2DHEA 1YZNA 4HXEB 4UUBA 4C6HA 5JU6A 2Y4OA 2PRKA 2JC3A 5KNCH 1L1FA 1EP9A 2EW1A 4MO2A 4ZEVA 1PK8A 1COWA 3H5NA 4MDEA 3MLEA 4G65A 4MI1A 4AJNA 2XZLA 2OECA 5C7IO 3IOEA 5JCJA 5DIFA 4B2LA 3SDSA 5LJLA 1P6QA 4TZTA 5CM9C 2E87A 4AKSA 1NGSA 5ICSA 1VCNA 3M49A 3TO5A 2FN9A 3CYFA 3E3NA 3V4OA 1O9HA 3AF0A 3U9LA 4PYMA 2Q3BA 5LNK1 4R2XA 5JQGA 3HK2A 1N5MA 1LU9A 3FWZA 3NB0A 2HJSA 2Y0DA 2XADA 2XXAA 1FZTA 2G7MC 2RH8A 2F9FA 1W25A 3Q8KA 4CG3A 1WDMA 3EXHA 5AVYA 3DV2A 1NUSA 5C5DA 5DRTA 3R74A 2NZVG 3INTA 1PW7A 3ENNA 2R5NA 3EVFA 4N0EA 5DV9A 3VKUA 1KZ9A 3F7NA 3KWMA 2OGTA 4BVGA 3MTAA 4NYJQ 5UKDA 4AZ3B 5KNBD 1FP4A 2XUAA 4ZEXA 3UMBA 3Q9LA 4CODB 4ZDJA 1PHRA 1KKMA 2R86A 1R0YA 2PFSA 4UAVA 2I2DA 3B6MA 4D45A 2EU8A 1ZGHA 3A6HA 4J29A 3VHXA 1U8TA 1GU0A 4KFTA 2FZCA 1J8DA 1DAFA 3PB3A 4OQXA 5K8IA 3KT0A 3JYOA 4NENB 3WDMA 4DS3A 2EKDA 4ME6A 5BR7A 4PANA 1GCAA 1G18A 2PX6A 1CP3A 2C5EA 2NZJA 2GO7A 1MO6A 4C7OB 4OLAA 3C6XA 3V7NA 3KKEA 2NPOA 4HUTA 4BMCA 2DFNA 3HBNA 3RUEA 1IUOA 4B7AA 1OUMA 5CLJA 1CFJA 1CUGA 1OXXK 4UOZA 4PGFA 4ZVUA 1YIDA 4KFRA 1ZUHA 1Q12A 1TT5B 3VOBA 1YKGA 2P4SA 3PFFA 4PBTA 1LLDA 3SU8A 5F5NA 1GGKA 3D6AA 3EN0A 4PG4A 5KYGA 2EARA 2FMKA 1TNDA 2BKAA 3BGOS 4YC7A 2WTAA 4TLEA 5AVOA 3H9CA 5KNDA 3QPUA 4G56A 3SQMA 1MIOA 1ZMTA 4ERNA 1TPYA 3BEOA 1C9EA 1T6NA 1CC1S 1CY6A 2EFCB 2XNDA 3B3QA 4ZU6X 1FSPA 4DLWA 2PGOA 5FTNA 2PUCA 4KO3S 5AW7A 3K8QA 5FH9A 3ZWDA 4WW0A 4BKOA 3LWZA 2NUBA 4MQEA 1SU4A 1Y5RA 2V7WA 3CNEA 5ESWA 4E5SA 2Z3ZA 3V9AA 4EMTA 5JAZA 2GVZC 1NZFA 5I7AA 2NUPB 2ZBEA 3PGVA 4U2FA 1C9JA 5I9MA 1YTLA 3GUYA 3L1KA 4U7TB 5DX8A 3RVMA 4LZAA 1WPXA 1T5IA 3K92A 4XPZA 1XLVA 4GF5A 4ILKA 3KLNA 4UE3S 4BU1A 4D1YA 3FWYA 3DEYX 1QOQB 1T5HX 1DG3A 4C4PA 3GCXA 5A6VA 5T67A 2CDRA 1FYFA 1EWYA 1U28A 2WHXA 3FHJA 1RBZA 1K4YA 1S01A 3T3IA 3BK2A 3G2JA 5FBWB 3ITKA 3NZEA 1G9TA 4UFPA 1B6TA 3DD5A 4ENWA 1PAUA 3T3DA 4CHGA 1N33B 4MS3A 2B4KA 3UWKA 5J5VA 4OBXA 2ZRGA 1SGWA 4QEDA 2Q9AA 2XGMA 1YRBA 5SICE 1JFVA 4JEMA 3VO1A 4KVAA 4ZAFA 9GPBA 2J0QA 2EC5A 3AP2A 1F4VA 4PLHA 3ROGA 1WZCA 2GK6A 1QZXA 5GJCA 1L2TA 1P5HA 5LDDC 1C4KA 5EMJA 1GSAA 5LQMA 1O6CA 2J45A 2AN3A 3D02A 3ONWA 4B4UA 1WXFA 1MABA 2ORYA 3KD2A 5BR4A 3OP4A 1EG2A 4D79A 2WJJA 3OZUA 2VWHA 2WM9B 3HI4A 1JR6A 1U90A 3SZMA 3H2JA 3JCZA 5J2TB 2JANA 1A4UA 3MJEA 3AC0A 5HCUA 3UXHA 5ELXA 5DNUA 1BJRE 1UWVA 4EYGA 3HWX1 1JWBB 1N36B 1WE2A 1MO3A 1E4OA 2PGJA 3A4YA 1KZ7B 3DOUA 3JWPA 3PFCA 1XZPA 4Y3UA 3FKJA 2C4TA 4LZPA 4E5DA 1C3OB 3CVOA 1ZFNA 1N0IA 1S2MA 3AONB 4JR0A 1JHXA 1U1CA 2AQ8A 2YINC 4QPZA 3VX3A 4C4ZA 4DOMA 4LMRA 3LUBA 1YFJA 1SBNE 2ZJBA 2ZTUA 5KTMA 3UHPA 4Q7KA 3PUZA 3QE9Y 3FPCA 4LNHA 1G2QA 3X2SA 5FO0A 4CPDA 3L46A 4JP1A 1VRVA 4GE3A 4FQ8A 3WLMA 4GOOD 1XMQB 1MOZA 3CZ5A 1PFKA 4NYMQ 5JFGA 4MA5A 1E5QA 1MF7A 1JF8A 3WRYA 2CJWA 3BHIA 1JYSA 1XCOA 2QVYX 3MXOA 3A4IA 4Y6RA 1KOLA 3ZWYA 3CTMA 1JU9A 3KJZA 4FFOA 5TF0A 3VSAA 3ZY5A 2IS2A 5FTKA 4NZZA 2V4MA 4LY0A 5HJ7A 2XA1A 1DJQA 3I62A 1OPRA 2O0HA 3OZCA 1J0AA 4AJ9A 1EB9A 4MVJG 2R8PA 3ZE2B 2QP9X 4C07A 4DYHA 1QIGA 1J2TA 1RIFA 1GHTA 1KBQA 3HBMA 4I5DA 4DUGD 3E1KA 2JJ2D 4YCNA 3LLMA 3IQHX 4Q4HA 1LFAA 1OLXA 4BQRA 3E8XA 4RFLA 1JDPA 3G7NA 3H8WA 2CLMB 2RI0A 2VKTA 2RHMA 3C6QA 1OTXA 1VP3A 1V4VA 1AA9A 1BQEA 2FUKA 2KJQA 2NVOA 2OE2A 1OFTA 5H16A 3L6RA 5AK6A 4HZUB 3T0IA 2HRBA 5AHKA 1FX1A 4KMOA 1P81A 2OHFA 3HGMA 2BM8A 2FQ1A 3I0ZA 4GL4A 3VV2A 5C9ZA 3LBAA 4XFDA 5HKBA 4QJ3A 3PUWA 1RJWA 5G0TA 5GONF 2GRUA 4YAUA 3A9CA 1G7TA 3C16C 1U4OA 4YJ2F 1RLIA 3DULA 3Q0IA 3ESDA 4AD8A 4RTMA 4RMHA 2XDWA 3M1IA 2P6UA 1RMYA 4KYVA 2HA3A 1OV6A 2AJCA 3HWSA 4F04A 1QUFA 5EXSA 4AF7A 4CIXA 3CT4A 4FFDA 3P9QA 4RL6A 4BO7A 2GBLC 2GYWA 4FDTA 4ALJA 1ONOA 1Z0ZA 3FNEA 3A3NA 3FRJA 3ZIAD 1XTKA 2OCLA 1KDOA 4DCVA 2O5VA 5ARBA 4IWYA 1DEOA 4JLKA 1E2EA 1X1TA 1GJRA 2V3VA 3DJFA 5FBQB 5HDQA 4EJSB 5C2JB 2ZITA 2OVBA 2ZBFA 3G8CA 2GEJA 4RLFA 2YMPA 4WBNF 2BEVB 1SC4A 4L57A 3W3AH 1E2IA 3KRTA 3TNDA 4LBWA 5JJCA 4KQHA 4B3GA 4PG7A 1XJQA 3DKVA 4PXAA 5EA2A 2PX5A 3R6GA 4LRWA 3LSYA 2CLDX 3D6FA 3SJBA 4DSZA 2CXSA 2HMAA 3V7YA 2WICA 5DYTA 5LZ8A 1A98A 4GMKA 2ZXEA 3MJSA 4LZJA 1URPA 2VJQA 3QXGA 3FSGD 2QPLA 4F56A 2AYXA 2WTBA 4CM7A 2FJPA 4MGEA 3FMPB 4AW9A 3N0RA 3GNQA 1Z06A 2X22A 2FY8A 4P2GA 4TV9A 4PTZA 1NJGA 4W9NA 3W79A 3PYLA 3E5RA 3QUBA 2GYUA 4CYMA 3HGTA 3L6CA 4OLJA 2JFQA 1L5MA 3LC1O 1I6KA 3ZWQA 1BW9A 2VK1A 3T35A 2Q7XA 3FF4A 4MPRA 3ABRB 1Q3TA 3GLKA 5JNTA 4LZLA 4TMVA 3VYRB 1CUZA 1K86A 3IXMA 4NFSA 5DHPA 1QH8A 3HJFA 3CLUD 4ODIA 1V2GA 4MUXA 4WL0A 5DWDA 4CM5A 3NBAA 4I3GA 4DCPA 2PZMA 6YASA 3JPWA 1ES9A 1DG1G 1FXWA 1NOKA 3U39A 1N6RA 1U65A 3X2EA 4ZCIA 1AK2A 4GLOA 3LRTA 4YAFA 2XHEA 3S3TA 2ODTX 4RD0A 3L7YA 4P9NA 1KDYA 1UPAA 3F8SA 3HJCA 2FEAA 2ZP1A 3NHSA 4RDCA 1CY1A 2VRWA 3KXLA 3RROA 5A9RA 1WHSB 1MB4A 4OP2A 1GKKA 1IHDA 1AQIA 3E48A 2G0AA 4NG5A 4YAGA 1QP0A 2LCFA 3N2IA 2DQYA 3UBTA 3SKYA 1K3UB 4O6VA 3CXRA 4US1R 4CM4A 1UP4A 4JJZA 3LQ2A 2O4UX 1QVRA 2HAEA 4P8RA 4TX1A 3KJIA 2XVAA 3PLRA 2ZIXB 1JYFA 4WA8A 1E98A 2BHLA 4E1VA 1EHIA 5KDOA 1GG8A 1Y4AE 2D1YA 1ETUA 4Q7LA 2IU6A 3C3KA 2RGEA 4RZUA 1NRXA 4TSKA 4LF8B 3WZMA 3ZY2A 4C04A 3H2BA 1X2EA 2ZU0C 5LZ4A 2Q99A 3LT2A 5MFPA 2Y0CA 1K08A 4HTAA 5F1KA 1CX9B 4KGZA 5EGNA 5I5GA 3RV3A 1WVIA 2PZJA 3AUYA 1O95A 3COWA 1CUJA 2JGNA 3KL2A 3OMWA 3H86A 4A03A 4RTNA 2WMYA 3FCUB 1PU2A 4UEJA 1LPPA 5A04A 4RJ2A 1QAQA 2EP7A 1UJBA 4YMGA 1KEEB 2FFBA 3LT4A 4OJNA 4UEQA 1T2EA 5F2KA 1ACLA 3NONA 4CR8A 5CDHA 5A0VA 1MB3A 2BFCA 4PQFA 3DYVA 2O5RA 4INOA 4U6NA 1PBNA 1TQ4A 3SOPA 4H7EA 4BP1A 4PS0A 1B8PA 1DIHA 3PNQA 5AO9A 3WP0A 1KOFA 2R6GA 5EPUA 3VA7A 1DL5A 1DMSA 1J8VA 3TWOA 1JDSA 3AFNA 3NTXA 1OI4A 4UXJA 5D6NA 4F9EA 4UUPA 3UXYA 5AVTA 2OD2A 3QFTA 4L9RA 4M38A 4W63A 3ND8A 2P78A 4BMPB 2VTDA 3RBVA 4BC1A 3EH2A 2OQRA 4XI9A 3QVGA 2VLBA 2XYGA 1YZQA 2O2DA 3C3DA 2HSJA 5C3MA 3FNHA 1S2LA 2CUTA 3MWGA 1M8JA 1NFQA 4I50A 5D1NA 5CD1A 4JUIA 3W2IA 1Y7HA 1J0XO 3I1FA 1LSJA 4Y1RB 4M9XA 1ZOSA 1LJUA 1QDEA 1N5LA 2O3UA 3HP1A 2AN1A 1WXIA 2PGLA 2AI1A 3ISTA 2P9TA 4I1RA 4K6GA 5L6MB 2O59A 1Y3BE 1KYQA 2OG1A 4H6XA 4YRFA 5J43A 1NQ5A 2DFKB 2VDMB 3H3FA 5T4EA 3I9KA 2PT6A 3CURA 3JQPA 4Q3DA 5BSKA 4LVUA 2OORC 1RRKA 1P1HA 5DULA 4RK1A 5EE1A 2YY6A 3ECAA 3UYLA 3P2KA 1MAVA 4WFQA 4HGNA 2AX4A 1MKYA 3D7RA 4N5NA 4QUJA 5A5VA 1ZUWA 2CVQA 3IPAA 4KWEA 1BMQA 3FJOA 5CX1A 1TMGE 3ZWPA 4B40A 1E5XA 3SEQA 4GP6A 2PYIA 3K53A 4KK4A 1IHOA 1P2BA 2XWQA 2OENG 4G0XA 4ZAXA 3ZX5A 4XWOA 4Q4AA 3QOXA 1E2KA 3OU2A 5KQLA 1E1CB 1KK0A 1VLQA 2D54A 2P1DA 2BGNA 3RO7A 3VU9B 2OAEA 3RVBA 4XYLA 1DAEA 2FGJA 1QX3A 4J0GA 3FRHA 4E7PA 2A1TR 4ER3A 1M6VA 1TAGA 3HCCA 5IBQA 2B1RA 4GX0A 1RWKA 3D7NA 1JWAB 2XDYA 2EDAA 2R8OA 4JLDA 3RT1A 4FCWA 4XLZA 5BP7A 5KNBA 4Z0NA 1WSAA 5B3JC 3JR7A 1QMGA 1ZHFA 2AMYA 4L8YA 1PNRA 4L0DA 2MT9A 2EGGA 2QRJA 2C04A 1U81A 5HJ5A 4D9IA 3PEEA 1WMSA 4DMRA 3RADC 2XDAA 3RVDA 4BLPA 1SVOA 1X7XB 1EXMA 3OQJA 3MWEA 1HY3A 2ZQ5A 4OHXA 4DUGA 1F12A 2H06A 1WP4A 3K3PA 4INZA 5NLLA 1C3LA 3EVBA 3K0FB 1Z5VA 4DCUA 1QGAA 2LUOA 5JD6A 4WOJA 2IGTA 2CB9A 4IHQA 4F2HA 3ELDA 4YJ3A 4BECA 4IXTA 2C97A 4WKOA 1VXRA 4KPGA 4A4DA 2IH2A 1MD9A 1RVDA 4I4LA 1H1DA 2IU0A 3E35A 4AY5A 4JI8B 4CIAA 2OHIA 1NF9A 2PH1A 4R6WA 1QDLB 1QZ3A 2WKWA 1KO1A 3UUWA 1GGHA 1QVVA 3J81k 4MJXA 4DM4A 5KNBH 2WSSD 2Z6VA 2FH5B 2IE0A 4UCWA 2PGDA 3SJCA 4AWAA 4O4IB 4TLCA 4LJ4A 1SKYE 4RTQA 1WKCA 2DY1A 3CF4G 3L49A 4KHZA 3EX7C 3DZJA 1ZD3A 3RTCA 4A0GA 1D09A 1A5SB 2C59A 3WA7A 5DTQA 1RXUA 3HNPA 3O2QB 4CMGA 2J0UB 1S2IA 3ANNA 3IEPA 4DT1B 2O54A 3M2PA 2BVNA 2P7HA 4LTNA 1Q2XA 3H1GA 3KPYA 3WO1A 4ACAA 3HB4X 3FZEA 3BEDA 3MPUA 3I1IA 5HE8A 1C80A 1EX6A 1BOFA 3CSUA 4FJ1A 5G40A 4Z9YA 1FFBA 1I2DA 4RH1A 3VJKA 4F8YA 4DR2B 4XIYA 2QRNA 3KKLA 1NVMB 3PQDA 1MAUA 1RWOA 3SXJA 3NOXA 2OK8A 2C5GA 4BFYA 1KMHB 1ZMBA 2QN3A 3ODPA 3CUWA 4LNUA 3B2QA 4WN9A 1FBTA 3GIWA 3VR2D 2QW0X 2ORED 4CN9A 2Q4BA 1V39A 2NTJA 4GL2A 3CLRC 2C4MA 2QDXA 4BOYA 2AWNA 1BA3A 3F5QA 3QNWA 5ELLA 5JXHA 2O3RA 3PGA1 2WIBA 3ETLA 3KQUA 1P18A 1O58A 3IKTA 2GLTA 1NURA 2UV8A 5AD1A 1Z17A 5E6SA 3UMJA 1XVIA 4NAHA 4XWGA 3SIWA 5HX7A 1J25A 1BWRA 1ZVKA 1U0JA 3OLQA 5JJLA 1DUSA 1UDBA 2XA2A 3KPVA 3CISA 1A76A 3PK0A 4I4TA 3OFSA 4JQYA 5HFJA 3VR6A 3NMUF 2V74B 2G06A 3JQFA 2WLTA 4N03A 3CNHA 2FWAA 2RHOA 4UW9A 3GJ0A 2AZXA 1CW2B 3PL5A 3ZWMA 2WWYA 5DHSA 5B55A 2OHJA 2FW7A 2D6FA 3A6EA 3IPLA 3IESA 4DILA 5IJ9A 1QM5A 3EZYA 5IDWA 1JBQA 2ZOSA 1X3SA 2AVNA 4UPDA 5E4TA 1K3TA 1SQ0A 4X7MA 3MGKA 2AQIA 2EZ4A 4KQEA 5FT9A 3UBMA 2OUKA 4XCXA 3O94A 2NAFA 1O6GA 4NU5A 2XAAA 4YJ2B 3LXRA 1RU3A 4KC0A 1K6XA 4FDUA 4IDBA 4HWTA 4EO9A 3U7GA 1XZDA 4TVOA 4AUNA 3OH8A 4CKWA 3AUXA 3O9MA 4BX3A 5B2FA 1VJ5A 3TL2A 2X14A 5KU1A 1MFZA 3HJNA 4G5HA 5TQ0B 2WBLC 3T4UA 3UJ9A 2XZOA 3K0SA 5KINB 1YDEA 2DRIA 5I9TA 5B7PA 4HOYA 5BYJA 3S8MA 1H23A 3TZQA 3UMVA 4G5YA 1WD7A 3K70B 5KSZA 2V6FA 4NL4H 2QLBA 3D64A 4TSRA 3LF2A 2DZDA 3WK8A 3T12A 1RXCA 3KL4A 1AO0A 2V6BA 4RK7A 5D85A 4MKFA 2FMXA 2BBOA 5AW5A 1F6BA 4X61A 4Y2RA 4Q7EA 1C1XA 1G4HA 1T1EA 1CUBA 1Z15A 1J0DA 3X44A 5I4IA 1ULAA 1SIOA 4JXXA 2PEYA 1PSZA 3SEZA 1N8NA 4WNAA 1ZXBA 3U81A 4Y0AA 3WSTA 1CS0A 2BBTA 1E64A 4B83A 2VJNA 3SDZA 2QM7A 5BN4B 1P7CA 2VNAA 4L08A 3VJLA 4NV1A 3P2YA 5CBPB 3I61A 1AGRA 5CW2A 3I1YA 1U6IA 4MRRA 2R96A 2JCBA 2XKAA 1MEOA 4CMBA 5THKA 5E2IA 1XA3A 2C2XA 4RAQA 5CFRA 3GLFE 5E6RB 1F48A 1I4TD 1PFUA 2C3UA 3SBEA 2SCUA 1OF1A 2LNDA 3WBJA 3R7DA 4E5YA 5CLFA 4V0MA 3GGCA 5JSHA 3GFVA 3JQ7A 4QOSA 2WF9A 3FNRA 2JKVA 3KJHA 4UMFA 3V33A 4UZFA 2A8YA 4KLZA 3T06B 5IJ0A 4Q1EA 3NIDB 1GL7A 1XMXA 1RXYA 3H87A 3N75A 4BKQA 1NRIA 2Q45A 3HB0A 1H3FA 4EP1A 5CFOA 4Q1CA 4MV9A 3GI1A 4L9WA 4PC7A 1ZCBA 4OQZA 2C2YA 1H2WA 1DEAA 1BAPA 1SCIA 4BMOB 5LQDA 3HR8A 1IIBA 4M1WA 3W2GA 5JYCA 1RRPA 3NLLA 3D8SA 5TF4A 4D9KA 4ZZ3A 5F35A 1YB2A 4QLOA 4I36A 2O5CA 3O4HA 3SS7X 4ECEA 5M29A 4DLUA 5MN4A 4YUYA 1WZ2A 1ZM4A 3NT4A 2JAPA 3D2AA 1UBFA 1MC8A 3E84A 5DSZA 4DQDA 4EDHA 4EGAA 4MDHA 4C4XA 3VSDA 2A3NA 3WWZA 2ZB8A 3GVCA 3GCZA 1YB4A 3KXIA 4LOAA 3NDPA 5LMUB 2KBFA 1IQRA 4CEHA 4W1QA 1E6MA 3JWHA 4MYRA 4JYMA 4NX2A 5F7JA 5H5JA 3PQ2A 4I50F 4CM9A 1E92A 2C0PA 2ZYWX 4IRUB 1FS4A 4EG8A 3FR7A 2ZJ6A 2PJDA 3LMKA 1KWGA 7GPBA 4JC4A 4DVJA 3G9QA 2C5HA 1EA5A 3EA0A 1SFRA 1I5OA 1PLKA 4OA5A 1WB4A 2DR0A 4EB6B 4MO9A 1NFFA 3NIBA 3OIWA 4F2PA 1ATIA 1UKZA 3T5AA 3THYA 3ZHUA 2CNWA 2G3YA 1Z56C 1G6Q1 1D6NA 1QK5A 5G53C 4KNVA 3DB2A 1KERA 4V39A 2B99A 3LX4A 4KIGA 3B36A 3WLJA 2DY0A 1U0EA 5JC1A 1JG1A 2QG6A 2HF2A 3IO3A 1PZHA 1ADCA 3TLBA 1PL0A 4HGOA 1Y6QA 4LMPA 5FUQA 2AZ4A 2A5YB 2QVXX 3NWBA 1J8YF 3GEBA 1K97A 4IIJB 3W6NA 4B35A 2VTKA 4NOJA 3JAWA 5FX2A 1T2UA 4KO8A 5E1DA 1SBZA 3LBHA 3QNMA 4X20B 3TVYA 5IT5A 1EVLA 1NM5C 2HQSA 2J5KA 1WVGA 1US8B 1C1DB 4C3ZA 2GD2A 3R9IA 3K5IA 1V1RA 1X8XA 3JWEA 3RTGA 2QN9A 1N75A 2JAQA 3KEQA 3OQIA 3RCBA 2BSXA 4J2TA 3TYXA 4YAKA 3HDJA 4YIHA 1ORHA 1BMDA 1XD2A 4EHFA 3ZDDA 5HQ3B 5FWYA 4H6WA 5JBIA 2AHRA 4MQFA 4N6GA 2IP2A 3DE4X 4O4HB 3PI7A 2CHEA 2BKUA 4JP5A 4LDQA 2Q3MA 4CTOA 3DDCA 3OZWA 4GKBA 3H9GA 4GSYA 4Y6PA 1R8YA 5IW8A 4E2FA 4EG0A 2DBQA 4I9GA 1UT8A 2WTNA 1JW9B 1QFZA 2D0DA 3A4NA 1RAAA 3H65A 1NPYA 4QARA 5CTJA 5KJEA 5A5DA 3GLIE 2IW1A 1IM2A 2QTMA 4JDPA 4MPPA 4EFLA 3WGZA 1Z29A 2IUYA 5G41A 3TJMA 2RH4A 5IHXA 5F3WB 2IHTA 2NX2A 1NMYA 3GJQA 4ZV7A 1RHJA 1IJKA 2I03A 4I9FA 4WGFA 2E0IA 1I9GA 2Z0MA 2E48A 1UQRA 1Y1PA 1YQGA 3IAFA 2F62A 5DBIA 1YZYA 4F3CA 3MSCA 4KQKA 3W05A 1ZD4A 4AMZA 4MVWA 1GPDG 4BNHA 1SXJC 1YDGA 3NIWA 1IWBB 4JMLA 4OYRA 3ROKA 3TL3A 3UK6A 1QKJA 1TKBA 4RY8A 3SJAA 2FP4B 1I1HA 3FAKA 3IMFA 4PHCA 3VH3A 1Z08A 3MB5A 1J2JA 3QLJA 1MRNA 4HLCA 5JXJA 1CF4A 5KX5F 5BSFA 1G8KA 3IV6A 3THWB 3KXKA 2CUZA 5C8YA 3WGVA 2QUAA 3AJRA 4OQ4A 5HK9A 4M89A 1FE8A 1IEVA 1GZ6A 2EZ8A 1MAHA 3S40A 3B9PA 3D3EA 4NBKA 2HO5A 2MYUA 1NPTO 1TYCA 3NHLA 4YCAA 3A25A 1YR3A 5BRNA 4EY4A 4ZTBA 2GBPA 1AUOA 3K16A 3J7TA 4MW6A 4YIKA 5B58T 3KAKA 1IXKA 3WL8A 3CIOA 4NNJA 2OBBA 3GZTB 4ILEA 5CJ2A 2FX3A 3BMNB 3OJ0A 2CXHA 1Q83A 4KDRA 2DBZA 4X8LA 1YR8A 3C3PA 1XTBA 1GFZA 4YP1A 1ZNYA 3WIUA 4AXBA 5L45A 1LPOA 2JARA 3WMWA 3ILSA 2BFDA 1I7LA 1XCMA 1RXEA 4G1VA 4DPKA 2FLVA 3I5YA 2HV8A 4M9ZA 3QFFA 1TLLA 1AURA 4K7JA 4MUYA 1R3DA 3S29A 1IBLB 3ZCUA 5DCWA 1EP2B 3LKZA 3M4NA 4MQUA 3TOXA 1EJ6A 2WUWE 1Q0HA 2GLUA 2N46A 3NWPA 2H65A 5ALEA 2X0KA 3UCXA 5BN3B 5CB6A 5IMBA 3AUFA 3GDOA 3ASYA 1MVLA 2CCJA 4TYMA 1XIVA 4HXFB 4LYGA 5IAAA 4M8LA 3H4TA 5G1NA 4KBFA 4G9BA 2W6PA 1WUYA 5EE9A 4BATA 4TMFA 2PWZA 1BVHA 4H3HB 1ANKA 2ETVA 4L5BA 3C2QA 3U9TA 3F6RA 4Q34A 5FF9A 3W9SA 3ZU6A 1KO4A 4B2IA 3ZK7A 5FJJA 3G0HA 3UAWA 2R2AA 3A6ZA 2IBMA 3ZEAA 4EUNA 4JOSA 2DUNA 2BISA 4Q18A 4JN6B 4GU5A 4F92B 1A7AA 1X1CA 2IDJA 3CPSA 3Q7TA 4GKAA 4BNXA 3PNLA 1AH2A 3VKVA 2RK3A 2PY6A 3RG2A 2WY2D 1ORTA 2XMGA 2HDWA 2Z9DA 3GW8A 4PYQA 1A9QA 4X41A 2YUTA 4WZAB 4M22A 2FPRA 3RTEA 3TCXB 4BFWA 4BMYA 4A2WA 3G5UA 1JXMA 3ZH2A 2J7KA 4JY7A 2F55A 1TYZA 3NUZA 3SSNA 2NMVA 3BWYA 4IS2A 5JIBA 5JFOA 1RKQA 4F2WA 4FIDA 4X63A 4G81A 1Y5MA 4JGGA 4RWEA 3UVEA 4MWZA 2HHJA 1LC3A 3AVOA 1NN5A 3ETGA 1P3Y1 1KU6A 2WHYA 3QU4A 4UJ3A 4A15A 1WY5A 2G1KA 2ZI7A 1U3FA 4GWLA 4PXSA 3UJDA 4RGQA 4E5KA 5AK0A 5JJ5A 2HK7A 3PNBA 3HHPA 4DMLA 4GBJA 5EZYF 2C3MA 3NRJA 2R6DA 3FYUA 4Y9SA 5EJMA 4YWHA 1JU4A 1UODA 3B52X 4I1YA 1U6JA 3OX1A 4RQAA 4TN5A 3IP3A 1H94A 4L74A 1S1MA 3V4ZA 2BUAA 1NBEA 2IBTA 2ZUCA 1X8LA 3HC7A 1AOXA 3ZVNA 2VSQA 1VJ0A 3W5IA 2GCGA 3W1VA 3K9HA 1GAEO 1BG6A 3CNOA 1X7HA 3BFJA 4PZZA 5ERYA 1E9BA 5G0SA 3V2UA 3W9BA 4DSAA 3JWIA 2QN6A 1DEHA 5AW6A 3DKRA 3R9XA 4WD3A 2RHLA 3AY6A 3R2JA 1RDFA 3AEQA 3PD1A 4I5FA 2GM9A 4C01A 1SXJE 2HLDA 4KQJA 2BELA 5EJEA 2BJHA 3EOZA 1XAIA 3W04A 4HNRA 2QTGA 2VQFB 3HH8A 1NBHA 2Z1MA 3FTFA 3WKEA 1HUQA 2W37A 2EQBA 5LOVB 2AYYA 3T34A 5K20A 1ZJWA 3X1DA 3R5SA 3WBFA 3HKDB 2XB9A 3OX2A 4Q9NA 4Q3EA 2BAGA 1GPMA 2E4VA 2XODA 3TKLA 4IWNA 4CNQA 1I1QB 1W34A 2J31A 3BWEA 3GC6A 3IYLW 3SXUA 4PYJA 1U9JA 1CQJB 4NCAA 1P0FA 1T8RA 1TU3A 5IM4F 2IPAB 4TPKA 3W5HA 2YXEA 1C7ZA 4BFZA 5ITSA 2F9LA 1IBKB 1IPEA 2LVBA 1VBNA 4GOJA 4RCYA 3HDHA 5K0TA 4JCCA 3RDPA 1I4DD 4N49A 3TMAA 4LE2A 3BMCA 4GGMX 4OAQA 1H8EA 4O33A 5LZ5A 3DNFA 3K35A 2QR2A 3NYQA 5CIWA 2C5FA 4BVHA 3LNTA 4IQ8A 1GZ5A 2JFHA 3E0XA 1PBTA 2Z5VA 1DTWA 2HGZA 2YWDA 2BE9A 3LZ6A 1N2CB 1JQBA 2DPXA 2VYCA 3TXAA 1QGZA 5K09A 3QFRA 5K7SA 1QU3A 2HLDD 2JK1A 2KBEA 2XE6A 1SUIA 1Z6AA 5A1TA 5I6DA 4BLVA 1JG3A 3A4MA 4ER0A 1V6AA 2PXXA 4KFUA 4UREA 2QN8A 4C3VA 2GK4A 1C7JA 3W5BA 3OCUA 2DJIA 5FWDA 3IKJA 3HB9A 4RPLA 2XRMA 3VC2A 1GVHA 2JHPA 3FDIA 4XGRA 3VUFA 3A6GA 1WABA 5K3SA 3WL3A 3HXMA 3CGWA 1JJAA 1UJNA 3ZXIA 2AYZA 3KHUA 4ZIRB 1GA6A 1GAJA 5MN5A 5KYWB 2DFPA 3M3DA 2G8NA 3M9XA 1JHUA 2V7EA 4HS9A 1Z0DA 2PQ6A 5C51B 1Q7BA 3GLUA 3PXDA 1N1GA 2QMQA 2FN4A 3PHCA 4AN4A 5JC8A 2LKCA 5IX8A 5ESDA 4RF4A 1E63A 1ZK2A 2O20A 5ECGC 3RJTA 4P32A 4D0RA 4M1YA 3T1TA 5CHYA 3RTDA 2ZIWB 2ZQYA 3GCWA 4JI5B 3JYLA 3DR5A 3C98A 3EXAA 4EKNB 3PYMA 3BMQB 2C1XA 5DVZA 1XF1A 1UFRA 2BEUA 2CMFA 5AW1A 2GXQA 1L7RA 2QJWA 4ASUA 1JHYA 3A1DA 4MUKA 3WY9A 5D8DA 1C9DB 2SBTA 4YA6A 5EQDA 1F51E 3AIKA 5FOUA 3C3YA 3WMRA 1QE0A 4E5PA 3VO9A 1EWQA 3HRKA 2BL4A 1SG9A 1KVQA 2XMSA 2DCMA 3VO8A 2G5CA 4HLUA 2PSFA 5IARA 4G4JA 4NQZA 4YMUA 5CG2A 1LDGA 4CFSA 2XNCA 2RCYA 1Y4UA 2CDAA 3N7UA 4HRAA 1DO2A 4P98A 1L8OA 3B48A 1OWMA 5AVVA 1UBMS 3DOEA 3Q72A 4FJ0A 1VSVA 3DLHA 2YMQA 3NATA 2QTLA 4JBYA 1MO2A 1UIRA 2CD9A 3RVLA 4KH0A 3ZWKA 4JI0B 2I6FA 1Y8RB 1FL9A 4HADA 3ISVA 3R7WA 5KHOC 2CSXA 1PF7E 3M6AA 5U4QA 1TD9A 2B69A 2IXEA 3HL4A 2VI5A 2ILVA 4YRDA 2GEFA 5FFNA 5CA1F 1SPBS 1Z6QA 5ALPA 1H85A 3BREA 4PCAA 2VHJA 1RC8A 3ZD9A 1DO0A 4KL8S 3RRYA 3FCOA 4R05A 1DXYA 5ECYA 4BNZA 5FNZA 1TLFA 2GNOA 1NMEA 4KQGA 1YS7A 4ALLA 4IO0A 1CIVA 5IC4A 1QG4A 2FVYA 3TM5A 3OAAD 1QTIA 1F8FA 5BQ3A 4H4CA 1WSDA 3SKXA 2QRVB 4ON9A 2ZCJA 3IGFA 5F4BA 1Z0FA 1UT5A 2C9MA 4PVCA 1NXSA 2KE5A 2TMKA 1EFLA 3GUCA 2FFJA 3O2JA 4EX6A 1KSGA 2KMLA 2IJGX 2W2MA 3CPJB 4RVGA 4HX5A 2WHEA 2RARA 1FLVA 1JXOA 3GDFA 3VPGA 2O2EA 1YL7A 1ND6A 4N48A 1NMQA 3FUTA 4L4RA 1KFCB 3PKZA 4AP5A 4LZWA 4JUBA 3W90A 3ELUA 2F3UA 3N8HA 4HEJA 1V71A 3TD9A 4N4AA 4JT4A 4DWOA 1AQYA 1T6YA 2Q3JA 1DQZA 1QV7A 1RWMA 2YV5A 4FD3A 4ZT6A 4BIIA 2O8BB 5DW0A 2OAP1 4C87A 2HU5A 1UL1X 2ZM6B 3JRWA 5AHXA 1LVHA 2PWPA 3KK0A 3OTGA 4O4JA 1G16A 1OPXA 3PDCA 1CYDA 5KKAA 4CV3A 3QJYA 2CHQA 3G2QA 4J07A 4BLOA 2YQZA 2IEAA 3GMDA 4BO3A 4LFBB 4IDQA 4AI6A 2HWXA 3JARA 4EPTA 1W0JA 5DN6A 5IUJC 4GW3A 4K05A 2XCRB 4PE5B 1JHZA 5CIYA 2HU8A 3NC0C 1UBCA 1F2TB 1G6OA 3EJWA 2FZ5A 2ET6A 2QL6A 4EVSA 4TUYF 1QG0A 4ARZB 4XVCA 4W5NA 4BBZA 1PHPA 5U1PA 4A36A 1TO2E 1V16B 3H4IA 3LX5A 4RANA 2ZUVA 1FDWA 1P5RA 2PZFA 4FGWA 1S8NA 2Q50A 3RC8A 3V1UA 5KC9A 5I7RA 4L02A 2NXJA 1ABBA 3GZ4A 3UJCA 3LDFA 1IZ9A 3OF5A 2XKBA 5L9AA 3OP1A 2GEBA 3RVRA 3E4DA 1V1JA 4EHDA 2P4EA 2PU7A 1EU1A 3SFVA 2M32A 4B8WA 4CEJA 1ORRA 2BHNA 1XN4A 2J48A 3H84A 3HQ4O 3TX6A 5CM2Z 4Z3OA 5HIJA 3VR4A 2X5NA 1PN3A 3FBGA 4IHAA 3OHMA 3T3GA 5AUNB 5EUMA 1TL7C 2I6XA 2IF0A 3QKUA 1SB8A 1A82A 4PLCA 1O08A 3RT7A 3ZD7A 3IT2A 2YN0A 4PF1A 2I1QA 3X1ZA 3PFWO 3ZWWA 2QW1A 4IG9A 4TZ0A 3EG5A 3ZXXA 4CIYA 4YGYA 4YEDA 4WCFB 4GKJB 1F5SA 4URFA 1XB2A 3BL5A 3MTQA 5HBGA 1Q1EA 3EDYA 4RJLA 1BJTA 3JASB 1QDUA 2BMJA 4DJFC 2IIVA 2WT9A 4GH5A 3T38A 4ZN6A 3ZVKA 5LA6A 1T8YA 1DIOB 3B7PA 4L4XA 2FSVC 1KU0A 2WIAA 3GQBB 4I2VA 4JD5A 4JBWA 1OC2A 2YJ3A 3EISA 1XLUA 3ISJA 4PYLA 5ALGA 2E82A 3LY8A 3LQ4A 4L9AA 2B4TO 3PQ7A 1KEUA 1UOQA 3IQXA 2DR2A 1P39A 3RIYA 3L4KA 1Q91A 5E8JA 1TJ5A 4NJMB 1IY1A 2GAAA 3O4FA 2MTBA 1O6BA 1E32A 4LI0A 4HPXB 4DMMA 5HEKA 3LOPA 3N87A 4JOQA 3CZ4A 2GWRA 3L8DA 4FZJA 5FFFA 4YRSA 1VE1A 3BUSA 4W5RA 5JR3A 1FVXA 2V54A 2W6QA 4X8OA 2NPFA 2GZSA 1KDRA 1ZW1A 4G2NA 4L9SA 1RAHA 4U2EA 1W4RA 3UO8B 1B0AA 4YRQA 1EWVA 3UICA 4ANFA 2HFKA 1Z33A 4LGYA 2HRCA 3K2IA 3TRHA 4AP6A 2UUOA 1T1GA 1YMQA 3WZ2A 1GGMA 4YP7A 2OM6A 1BD3A 2JCSA 3BIWA 3CX4A 1J0EA 2DSTA 3HN6A 2IT1A 4WA7A 4KR2A 3WLIA 3OZTA 3SOZA 3IMEA 3GEMA 1E8DA 4X1KB 2A88A 5KYVA 1E4EA 5C5EA 3QKRA 2B0JA 4IGAA 1IFXA 1J56A 1E1KA 2X4IA 2HU7A 3K1YA 1CEQA 1KYZA 3QV1A 1YS9A 2WD7B 3WLSA 1ADGA 1Z2PX 2V65A 3K8OE 1VYUA 4KRGA 3THXA 3CU5A 1Y3DE 3GARA 1XTVA 4Y9DA 3THRA 5T7BA 3GLIB 3JALA 1YVRA 4QNRA 4D96A 5KSYA 2B21A 3GMSA 2IX3A 3O7WA 3OIVA 1P5JA 1G5RA 2DKFA 4F9FA 3AJ8A 2W6IA 3OZ7A 1N6LA 1JKFA 1NMZA 1GQYA 2HSZA 3KE8A 3LLCA 4FKBA 1W36C 3U7RA 3V9PA 4UPVA 2FWNA 5DNAA 3EASA 4WBXC 1BO6A 2COKA 4OGLA 5CBKA 1HOXA 2OCKA 2H4HA 1M5UA 4UHJA 4JQZA 2B25A 3PDIB 4QOGA 2FHPA 1O9BA 4E5VA 1V9LA 2WSYB 2ZQZA 3QEMA 4TV8A 1BRMA 5FA8A 4BNUA 1QCZA 2KLHA 2YHBA 4C0SA 3LC2O 5KREA 2ZAOA 1CNEA 3OQ6A 5IXYA 1K4MA 721PA 1UFQA 4HDOB 1PT7A 1Q1NA 1QONA 1L8QA 3O2NA 5KX5A 2A3RA 4TSFA 2Y1LA 2I3AA 1JR2A 3KTOA 3R3ZA 4CLOA 1TM5E 4DZZA 1DNPA 4LDJA 4TXHA 4ZYWA 2Z3VA 3C70A 3IVRA 4QNMA 4Z8XA 5CT8A 4Y0NA 1C3VA 3V8VA 2IXFA 4P7KA 1ZGAA 2IYAA 2RHDA 2FQYA 2ZPAA 3AM3A 4G3XA 4LK3A 5CDFA 1M2VA 2QM8A 1H0HA 2JHAA 5H7XA 3E3MA 4LDZA 4TXJA 3VXKA 4AROA 3Q2IA 2Q5QA 3FZQA 2R97A 3FPHA 4NFLA 5IZ4A 1W75A 3AXTA 4JR1A 2B9EA 4GPAA 3ZJ4A 2R00A 4MR7B 1RYZA 3DA8A 3RGGA 3TQIA 1V2HE 4CG0A 5BT8A 2X15A 3DHEA 2XLBA 3E8MA 3K9BA 4RXUA 4TVKA 3RU3A 4HQLA 1XT6A 4GOKA 2AN4A 2CXTA 4BXOB 3T7EA 1EDEA 4MCAA 3V8MA 4UNRA 4QJBA 4F93B 3DQQA 3S4YA 4AF8A 4G1FA 3PT9A 3GJRA 4BZXA 1Y6RA 4LJAA 5I9LA 1NE7A 4DV5B 4R9NA 1L5NA 3ZHXA 3KEGA 1DQRA 1QX4A 5CDSA 3W7BA 4NFHA 3AV3A 10MHA 4PQYA 1NR5A 3TRFA 3CN7A 4B6GA 1XPUA 3HCDA 4BO1A 3L6UA 3OQNA 1BX1A 1FS5A 3GLHA 4GBED 2WVAA 5JCPA 2DULA 1NSFA 3EXHC 5JCXA 2P3QA 3PZBA 3HKEB 4CIVA 2PKCA 4XARA 4CLRA 2PL1A 4EVRA 2JLAA 4CLHA 1U7TA 2BN4A 1FQWA 4BMSA 3DHNA 2WJGA 3AF4A 3F5FA 3MGBA 5AKKA 4K6KA 3PJDA 3WV5A 3BIXA 3EQ7A 3LYAA 3TW8A 3WIBA 3IO5A 1WDLA 1K0UA 1Y1TA 1JJIA 1JLHA 1SEPA 3FETA 1HSOA 2J4CA 3PR1A 4PONA 3MWDB 1V45E 1QRRA 1K89A 4OATA 4YQYA 3DDHA 2E5WA 2C5BA 4CLXA 4D9CA 2HSWA 1X3LA 4EHJA 1DAIA 5ALTA 4AZWA 4X71A 1QHXA 1OB2A 1CKEA 3JY6A 5KNDH 3O4IA 2H52A 1WBDA 3HNRA 4NFYA 2V4UA 4WXMA 3WC4A 1RI4A 5JWRA 4CM4B 1GD1O 1FVHA 2K5UA 2VPZA 4P08A 3DHYA 3KBBA 3E18A 1ZRSA 2PFKA 2O0LA 3GXBA 5IAGA 4QTYA 1NMSA 4XEHA 3NGMA 1M8KA 1DOAA 2GN4A 4E5MA 2A94A 5EJ4A 2ZIXA 1ISRA 4KWCA 4P53A 5FHRA 2GPJA 2J6BA 4JI3B 4CKZA 3TS1A 2B8NA 1P1KA 4WECA 1KTIA 4BS9A 2YQ5A 2DUWA 1KGDA 2XAUA 4OV6B 1TCVA 5BQOA 4B7CA 3GNTA 1G8YA 3UENA 5LJIA 3AM1A 3BKWA 3L7IA 2CUKA 3GDWA 3SE7A 4C78A 1E60A 3AG6A 2I91A 2XB2A 2BFOA 3BDIA 4LOLA 3C4VA 4EJMA 2XUHA 1FW6A 1ICIA 3N6XA 5ILQA 4NJEA 2QQ0A 3DO5A 3ZGXA 1RRFA 3MMZA 3R0ZA 3SBDA 2WU8A 3INNA 4ZK6A 2WVHA 4Z1OA 2FRDC 2P0AA 3C4QA 3DTVD 3RWMB 5F2NA 3PLAE 2VJLA 1UMBB 4TTPA 2YFHA 4MVYA 4QYSA 4E4YA 1IWOA 1OYVA 1QRUA 4MVJI 4JGBA 4OI2A 4K26A 4N7BA 4FZRA 4C0QC 1WA5A 5C4MA 4IJQA 1V3TA 3W06A 1YI1A 2I65A 2HWWA 2HREA 2RAPA 1LZLA 3DAGA 3NBQA 2SKDA 3ANSA 1WX1A 3NT5A 5G3YA 2CXPA 1J39A 1S4QA 1NV9A 2PRZA 2VJBA 3W4JA 4NCHA 1YVUA 3DFMA 5KQSA 1FLAA 2RHBA 3IXQA 4P92A 4BGEA 2ACEA 3EZFA 3RHSA 3WLHA 5BSMA 3MOIA 1G8GA 3EVGA 4GR9A 1N2GA 4BVBA 3G0CA 1OFUX 2MYNA 3Q10A 5BN5B 4EL5A 4WXRA 5K01A 4ZA2A 1OYOA 3FNFA 4MGIR 2F00A 2XBUA 5C8VA 3PXXA 1J6UA 2GKSA 2YHIA 4K9QA 5EXXA 5LUBA 4LYEA 3H9BA 3VQTA 3WNCA 1C30B 2G5PA 3HXLA 4QU0A 3VNRA 1OIVA 2ID7A 4NSNA 4F6LA 5A4KA 1PL6A 1S3SA 2TMGA 4AJKA 4PNEA 4POOA 5AQEA 1U9CA 1X19A 3DVQX 1O8CA 2XNSA 2P30A 5BOVA 5KVCA 3P9NA 1E1MA 4UUQA 3REGA 1U9IA 3JQAA 5JZ9A 4S3MA 4BGUA 4GNRA 4XVUA 1Y6ZA 1P2DA 1RC1A 2ATIA 4R1SA 1NW4A 2QNRA 4PLYA 3NYRA 2A0UA 3L93A 4KPUA 5EIBC 1ZONA 1C8KA 3VSEA 4A8TA 1CPYA 2QK4A 2X5KO 2RGGA 3B7WA 2XRFA 4YI5A 3W34A 4PWYA 2VDQB 3NFYA 4QTZA 1J06A 5A4DA 4H0CA 5IHPA 3DTYA 3O4VA 4MGKR 3IHWA 3EOBI 1PGOA 1VI5A 3I04M 4FOTA 3VC7A 3P5BA 1RZRD 1X8KA 1VG8A 1Q7TA 3DXXA 5I7VA 5JSFA 3OECA 1UH5A 5JYDA 2FGKA 1R66A 2VF4X 5DLEA 3B5JA 1P1RA 1KVTA 4PIPA 3V00A 4ENUA 4JLNA 1RKUA 1PX2A 1KSJA 3ANXA 1Y7IA 1J9ZA 1UEXC 4PPNA 4LE1A 4X1OA 2PS0A 7REQA 3L3BA 3GRVA 3OQHA 5CLHA 5EP1A 5GV8A 3WWOA 1JKMA 3WE7A 3QX3A 4NICA 3MRVA 3OEED 5BURA 2IXBA 4P3PA 4Q3NA 1WCYA 2X76A 3M6FA 4LXIA 4UU1A 1Y8ZA 2JGIA 3TIVA 1VGRA 3SGLA 3WR5A 5ITZA 2VJDA 1ZCAA 1ZL0A 5BMVB 3OJFA 1JFSA 3RVSA 5JECA 2GOYA 1K8YB 1IZ7A 1P61B 1UBNA 1P17A 2VEOA 4HDNB 2HMWA 4B32A 1D0VA 2ZJAA 3A06A 3BM5A 2IYXA 1W4ZA 2B2XA 4XFKA 3L0YA 1N34B 1XTPA 4CV1A 1V8BA 3MRXA 1FDVA 3F9RA 5FL7D 2YNMA 1K1EA 2ZWAA 2PXAA 4PAMA 1EE9A 1Y89A 1OZFA 3MHTA 4YFYA 5KYYB 1MH9A 1YV9A 2HTEA 4R0NA 5A9SB 5BWMA 1ABEA 1VKOA 3GLFB 2IU4A 5MDHA 2ZUEA 3FRIA 3BBPA 3PNKA 1SJ9A 1LF0A 5KU7A 4RPJA 3AHCA 1E5VA 2XX3A 5E3JA 4IKOA 4JL8A 5HOQA 1RWWA 3CRMA 3DMTC 4HH3C 4QJ4A 4YDHB 8ADHA 2UVPB 3HCFA 2BD0A 4MOWA 2Q9UA 1IU9A 5AYVA 1I4LD 4WACA 4IDGA 1RACA 1XQYA 5FNVA 3BA1A 4G41A 1PD1A 2XVMA 2FF7A 4H6VA 1C81A 3E82A 4NLLA 1NLFA 4ZRNA 4JEIA 5KJ6A 2E4UA 2H5JA 4LG1A 1E3QA 5TS2A 3RUFA 4K2HA 1VSTA 1PYOA 4Q03A 1YOVB 1M74A 1X1QA 2ARKA 2Q1WA 3KTDA 1LS1A 4UNPA 2W0SA 1DSSG 5I47A 2YZ7A 4LI3X 2C82A 1X7WB 2BBWA 1M9NA 3LECA 4GICA 4PYRA 3NNSA 4Q9HA 3RS9A 4X64B 2F1OA 2O8DA 1WCV1 4MV0A 4ESOA 1NVFA 3ZS9A 2NZ8A 4MUIA 1L4HA 5LU8A 4TROA 3ZHYA 1RP7A 2Y1OA 1RQGA 3ZI7A 3MWFA 2QV0A 2UYHA 4PZ9A 2HXSA 4IDCA 1N5DA 1Z5WA 4XASA 2NXNA 1U80A 4I4TB 4D8TA 1Y7LA 4F5DA 5CAEB 4DNQA 4RU1A 2BFEB 4DIFA 1SC3A 3IAUA 1GPH1 2IODA 4PZYA 4BNKA 4WVFA 4BP9A 3Q1KA 3FVWA 5K0EA 2H1FA 2WG2A 4CKEB 2N47A 2EF1A 2QIPA 3RYFB 2VHYA 5FADA 4Z0TA 2AI2A 1QF9A 4ZCSA 4ZHQB 2YZKA 1FW8A 5DBEX 3JD0A 6REQB 3C3XA 3HY4A 3N6VA 5M2QA 1WLSA 1B15A 3K1ZA 3O74A 1E79A 4FSXA 1OH6A 3GX1A 5E6UA 4L0MA 1VTKA 1JE1A 4KVFA 4BJ3A 5TR9A 3AUAA 3IBYA 3L41A 1E3SA 2GD1O 3O3MB 4H1HA 3QOFA 3HP7A 4BBAA 1QHEA 3VR0A 2VNJA 3FOBA 4YXWD 1GLGA 1LBHA 1USWA 3DMPA 4L5JA 1LY1A 4YJFB 3O8QB 3FSJX 1DBIA 2VP4A 2OYRA 2XGSA 1II9A 4MUEA 2C9DA 2G9UA 2FPGA 4DMUB 1GARA 4EBFA 4XDYA 1EWKA 4FE7A 4EELA 4EGFA 3K9CA 1PZFA 3ZLVA 3NWEA 1NM5A 3NALA 3HACA 1PDOA 2Z4RA 1PJSA 4Y9UA 4TMZA 5C46F 5I7UA 3BCRA 1PWXA 2CL0X 1ZGZA 3TPFA 3IAM1 5ICCA 1HLFA 2QGZA 4CQMD 4KAJA 3MFYA 1MN6A 2R751 4YWJA 3Q8XB 2VDNB 1FMFA 5KNCD 4GZ5A 4XDZA 1MJHA 3UJAA 1PP4A 1GKYA 1HT2E 2XBLA 2VSFA 1H0RA 2X8JA 1V7CA 2QE7D 4BTLA 5E1BA 1OHHD 1SOMA 1AZLA 3A3OA 1AF4A 3SX0A 3V5NA 5AUQA 1VJDA 1LI7A 3PRYA 5EZYB 3HN2A 5BN4A 2D59A 5BSHA 5ILOA 1VLMA 3GG2A 1PFQA 1E2QA 3GR6A 2WZBA 1RQNA 4FZVA 4UCQA 5IPFA 1KDTA 3CQ9A 3C48A 2P2SA 3QWIA 2GD0A 3O4JA 1Y33E 2A9VA 2Z83A 3E53A 3EZLA 1UK7A 3G5TA 3PRHA 1I8TA 4FSDA 5E6RA 3TZCA 5KMGB 5KYKA 2GJSA 1VHWA 1UKCA 2D0IA 3T3HA 4PYIA 2C4KA 3ZU2A 4NG4A 1DT5A 5IULC 1AN0A 4G01B 5AM1A 4C30A 3T1HB 4RMJA 4BVJA 4Q1DA 4UVIA 2Q07A 3RUIA 1QIHA 1W581 3AI1A 1LCIA 3H16A 3KAJA 4GM0A 2QOEA 1B2RA 4H0FA 5EMLA 3SYNA 5FTJA 2CL7X 3P0IA 5AKEA 4FBLA 3N2GB 3ZCPA 3KWJA 1LH0A 1Z74A 2E49A 2NVUB 3R3UA 2ZAYA 3RRBA 3W4KA 2OCAA 1BIFA 4FYJA 3A6DA 5EZQA 1ZGCA 3WGJA 4LC0A 3GRKA 5DCUA 4D4KA 3N9IA 1U63A 4CBVA 5IDQA 1OWOA 2QT1A 3F47A 3FE2A 3GV0A 5D00A 5BRJA 3HSKA 2I7VA 4OUKX 5K3FB 2C95A 2WMDA 3L8ZA 4EGJA 2QWXA 1TYDE 4N3BA 4JYPA 1YFZA 1EVJA 2WU4A 5LP6F 3WLPA 1E7SA 1JVSA 5BQFA 2YV1A 1QQ5A 3MAJA 4IDHA 5FKJA 2GAOA 4MDFA 3ESXA 2B94A 3TIGA 2BGGA 1XWIA 3AEKA 2W8ZA 3AI7A 4Z4QA 2YWCA 1WZNA 1W48A 1I0LA 1NZJA 3C1AA 6GPBA 2XQKA 4XE5A 3MWLA 4HL6A 4LBVA 5ULLA 4NH4A 4EJ0A 5IXSA 3THYB 2CWDA 3EIOA 1VRWA 3CFYA 3U13A 4A26A 2FDCA 3SXPA 4KUGA 5D86A 3M9WA 1AKMA 1NW6A 1AZSC 1YZ3A 2YY7A 4IJWA 2ZXUA 3F46A 1XJ5A 1P8JA 1FBNA 1CZNA 1KJWA 1NF2A 1U1DA 5HIKA 2XWBF 2HF7A 2B2NA 1YACA 1YS1X 4ZQIA 4YMLA 4ZVLA 2CYCA 1COZA 2XW6A 3TFWA 4GQAA 2I34A 1XMJA 4GUAA 3ZBTA 1Y8AA 3WMEA 4TMKA 3WDLA 5L7WA 3QF4A 5A02A 1I3LA 4K8OA 1T8PA 1ULSA 3LFTA 1IIRA 1TVMA 5F3DA 2IUTA 4D6PA 2XWPA 3NR2A 5JATA 4TL7A 5JI3E 3T94A 2FE4A 1XSEA 3USZA 6PFKA 2HN9A 4K6MA 1ENYA 3R5XA 2W2VA 4G5QA 4CJXA 1XCGB 4DCCA 3WBBA 1FSSA 5GOZA 2EWVA 2ZKLA 4JBXA 4HSEA 4RK0A 4AJHA 1P5ZB 1R1DA 1DV2A 3TLZA 3ORQA 1P72A 4KUHA 3VPBA 3KJQA 1A2OA 1DHTA 3QE0A 3S5UA 2PR2A 4PVDA 1WW8A 2FFHA 4F1KA 2D0PB 2OBYA 5I3ZA 4HQNA 4YJHA 4YP6A 2ZBPA 3JR3A 3DZIA 1SOVA 4KR0A 4LRYA 3EPJA 1RJEA 1SKUA 2P27A 1B23P 1VDMA 3VDNB 2NTYC 1SVMA 4UTNA 4EF5A 2W48A 2QEQA 2DTEA 3QLVC 1QH0A 4Y2GA 4AJ1A 1B6SA 4MTLA 3OZXA 2GSDA 4X92A 2GWHA 4JC8A 2W90A 1R0SA 4YJGA 2G0NA 4GBMA 1OFHA 4ZJPA 3A2KA 3A6PC 3BZUA 3U3OA 1F8XA 3PUJA 3OWHA 1P2UA 1TZJA 4BEBA 4F12A 1GPYA 2KWIA 3DP9A 1PEYA 1ZN7A 1SBIA 2FSGA 3EA5A 4NYMR 4OA8A 3RYTC 4OSOA 3DCIA 5BV1A 3W9YA 4F1WA 3P9IA 2QUZA 3QMVA 1YB6A 4WV3A 4BZQA 3MBKA 1QGDA 4J1SA 2B5OA 2P65A 1JFLA 3GHYA 3KDSE 3NQ41 3QLEA 2HA7A 4KXLA 4OM7A 5BYBA 5FHQA 4DCGA 2EV9A 3V1TC 3U7FB 4JYAB 1U99A 2O8EA 4HNUA 3I12A 5DP1A 5LXTB 3U5ZB 1UZNA 3RASA 4OIMA 4RVDA 3CSDA 2NO0A 2BHSA 2ONJA 3TGPA 3O73A 2V8OA 3LQQA 2DCUA 5SYAA 4DSUA 1T8TA 1XRLA 2RGNA 4XSVA 2OAQ1 5DK4A 2ZCUA 3EGEA 3EVZA 2C9CA 3TVTA 5JAHA 1T15A 5JSZB 3TR6A 3ICCA 1UDRA 2Q2NA 1LUAA 5EKSA 2QTCA 4CCAA 1WG8A 5J2UF 1AQ6A 5CEFA 1D5WA 1DIRA 1Z9BA 2WAAA 4X1YA 1OFGA 1CVRA 1M73E 2CF5A 5C7OO 3BE4A 3X1YA 5J63A 3RHZA 2J6IA 2A9JA 2H51A 1NC1A 2X9QA 4A2QA 4ARBA 4Y30A 1QG2A 2EP5A 3CV3A 1R0LA 2EBWA 1NSYA 3MS7A 1X0VA 1UC8A 2XUDA 3QMMA 3I73A 5AJTA 2VPWA 3F74A 5B53A 4AQYB 2XKKA 3C6YA 3LA6A 3C7AA 1QOPB 3DZKA 4NAUA 4H7FA 1A8SA 1VL2A 3V2HA 1E79D 3FN4A 5I8PA 1M5TA 2BMWA 1PLLA 2ILTA 1YD7A 1Z4OA 5JRDS 4DM7A 3EF0A 3DMTA 1TDJA 2JDID 5DM0A 3VU8A 5FORA 5JWOA 4O4JF 1FRZA 2YFQA 4YYEA 4MAFA 4B4OA 2MSKA 4Q4CA 3QUQA 4TKUA 1A4XA 2OG2A 1ZICA 3MC1A 2WQZA 4DNPA 2P6OA 2XUZA 3HCBA 3ZGOA 1UP7A 1ZOIA 1J9GA 1LSOA 2NYRA 4HYEA 1KJ9A 1NOIA 1QC5A 3MCAA 4DEXA 2QT0A 3S1LA 2VTBA 1P60A 4LF7B 4R2MA 5CVDA 1SZJG 2P6MA 3MBIA 3ENQA 3COSA 4QBIA 4RHFA 4NESA 3C43A 1K6IA 4G4SO 5ER9A 3MS4A 1TCAA 1EK6A 2CBZA 2JVJA 2D4HA 3B8EA 5DGDA 4CL0A 3PXBA 3REFA 4DLXA 4AFNA 3D5QA 1SK9A 3NXSA 1TUBA 2HTFA 2VF7A 5THQA 5I7FA 1L5QA 2E5FA 2PKWA 3K72B 1SXJB 5GVSA 1XRPA 3D7KA 1P3JA 1AV7A 1VZ2A 2GJ4A 2JCVA 2JD1A 3C7KA 4L4YA 1VKJA 3RS0A 2FZGA 4U2DA 1LDMA 2OQIA 3GUUA 3HXTA 4C88A 3GH1A 3NRBA 3PTAA 1PR5A 4M7WA 4D3SA 2FLKA 1UR5A 1AQNA 3L4BC 5JXGA 3JVIA 1SUWA 5FFMA 5D3QA 3RF6A 2FZVA 4UDOA 3GT4A 1JS1X 5ERGB 4ZDIA 3E9NA 4DA6A 5K4HA 2W98A 4XPIB 1OVMA 4XUGB 5AUOB 3PPVA 1DV1A 1XCPA 1N1MA 2PTGA 4IVQA 2VN8A 1ZVVA 3FDZB 1FX0B 1JAZA 2XV1A 3EGVA 3H4VA 3I6BA 3M2TA 3LU1A 4WY8A 4IIBA 5KPDA 3TTUA 3IEKA 3D8TA 1JZSA 2NV2B 4ZK2A 2CLFB 4QPJC 4RIEA 4I14A 1AHNA 2OCPA 1V1MA 2OORA 5DI3A 3L8MA 3O84A 4LJ5A 5K3AA 4D44A 5BSEA 5IJAA 3SE0A 1N5IA 2Z8YM 1J1UA 4EHAA 4X95A 2ZT8A 4GX5A 5B3JA 3Q6IA 4WEQA 1U11A 5EJIA 3EXEA 5CH3A 1ISFA 4IH9A 5JNVA 1E9VA 1OBOA 1SHTX 1UKVY 3MHPA 3L4JA 4BB5A 4UDNA 1F7VA 2P9EA 3K0HA 4YMTA 3H7AA 4UULA 1L9KA 3LPLA 4ZQFA 4WGGA 2R66A 3L84A 2JATA 1CRQA 1PE0A 3M6VA 1WHTA 4NABA 1KI3A 1NNI1 3PWTA 3VDRA 1I01A 5JAUA 3C85A 4BNIA 2HLHA 4HMOA 1QTNA 5IVPA 4XXHA 1U3UA 1C50A 4IFIA 3ZCVA 2R0QC 1MAAA 3P2OA 1TZMA 4RF3A 1TIKA 3PFKA 3CLHA 4Y0VA 4YREA 1SD2A 1ZHHA 1QK4A 3SM9A 4MIEA 3T8YA 2A84A 4YQEA 4FQ7A 4K9MA 2Q5IA 1WL8A 3GA7A 2R6HA 2Q8NA 3H1TA 4GQBA 4CCSA 4TLAA 1NC3A 4N8DA 3T3EA 1ZD9A 4AG5A 3ZLTA 2BW0A 5K6RA 1YWGO 2JFXA 2QM3A 4EHLA 5CH5A 2BTEA 4US0R 3SQOA 3BMCB 3IRUA 4BE9A 5JVDA 1R50A 1S6YA 2N42A 4RMIA 1QMPA 2G82A 2R44A 2J9YB 3A1UA 1Z3CA 2BKEA 4REQA 4IDPA 3NYWA 3CUEF 5AVJA 4MRMA 3KYBA 2HRRA 3PXEA 3VR3D 1IE3A 4PZDA 4D41A 3CE9A 4JVNA 2Y1EA 2P5YA 4E1BA 2A86A 4O02B 4RO0A 4UM9B 3HV2A 4LQ4A 1N0UA 5LBUA 2XT9A 4D3ZA 1YJ8A 1OX4B 1T8SA 3BE8A 3KTAB 4TQUS 5H0IA 1UMCA 3RYCB 1BS1A 1J7JA 4N5HX 4BN4A 4F7WA 2G88A 2PXHA 2IV3A 1ORVA 2FRDA 2FWRA 2REQA 1X15A 2O0JA 3H9UA 3F3YA 3I3OA 3ND5A 2XYQA 4RD4A 1X7YB 4YDSA 4BPRA 1N9KA 4CIDA 3EDRA 4XUEA 1KWKA 3HZOA 3FUCA 1U98A 2JS7A 4UC0A 4OHVA 2LD4A 4LXQA 2ADOA 2CYAA 5DNVA 3JSAA 1UBJS 1PEDA 5GJWC 4XR4A 1QJCA 3CX3A 2P5SA 2QZZA 1V95A 3K94A 5DYGA 2BUBA 1KY2A 2XMDA 2Q0QA 4K28A 4H7PA 4K9OA 2CNDA 2QY9A 4ZO7A 2YIDA 4FBMA 3OD1A 1GPBA 5FUVA 2FK7A 3MS2A 4ALKA 3VPXA 1T35A 2V5AA 5J23A 1SH7A 2E21A 2J07A 4XGIA 3TGWA 1WTAA 4D56A 3LPMA 2ZUBA 4V24A 4Z4EA 3OSZA 3UMMA 3ANMA 1NHWA 3PJEA 4J0CA 4EY7A 5I4KA 2J0EA 5JJBA 1T5OA 1Y4ZA 4N40A 5CFQA 3MTBA 3ZJTA 3BK7A 1GKLA 1I1OA 1KH3A 4YPOA 2O8NA 2RGBA 3LW8A 1CVLA 2WQ7A 1ZH2A 4GMDA 4ZOLB 4G0WA 2GHQA 3RC1A 4AICA 3K31A 3KJNA 1NQAO 1BXZA 4JB8A 1A88A 4LHXA 1Y7PA 4AX4A 3EBLA 1NI5A 3RS4A 5FR1A 3PVZA 1WXDA 2P8JA 2CEKA 2XYPA 4HHEA 5T8KA 2WSBA 4IGKA 2HA0A 3OY2A 4RSMA 4C0XA 4DSTA 2Q1TA 4DV1B 3I09A 3WNZA 3A31A 3OCYA 2CSUA 3HBJA 2P41A 1W44A 3Q9UA 1I6MA 4U6QA 2JIZA 5D5PA 3U3RA 4TLMB 4X3PA 5HM6A 2GFIA 1F2UA 1CR6A 1JB1A 4Q4AB 4PS1A 2Y76A 1E4YA 1G5HA 3CS3A 3BQMB 4XVRA 1T9GR 4YCCA 1LF5A 4WQMA 5LOVF 1TZBA 1DS6A 1LBEA 3AOEC 1ZYUA 2FN7A 3OPYI 4FVTA 4YS6A 1DRJA 4RQTA 3EZ7A 3KHSA 1JBKA 1U0FA 2DKNA 1DJPA 3D3WB 3EUWA 3VYWA 2G83A 1AXEA 3WNBA 3NUGA 4LXHA 1GTG1 4DY4A 4IHJA 2FQWA 4GNKA 1AQUA 2VK8A 1YR1A 4L50A 4HRXA 4R8LA 5LYJA 5HHTA 1Z5OA 5H1YA 1M1YE 3I5UA 3IT1A 3LUHA 1GPNA 2OBFA 4U0JA 4YGXB 4O2LA 3W6PA 4FMBB 1T0PA 4TTTS 3M5WA 1LPBB 1ADBA 3KQOA 4ZWNA 4DBZA 1DXHA 4BAGA 1ISSA 4A8HA 2HK8A 5TVGA 5IN4A 1XWWA 1I4EB 2PT7A 1U3TA 4YBZA 3H8JA 2PUAA 1VG0B 1OD6A 1NONA 1R00A 2C2BA 1Z4PX 3IUJA 2VHXA 4GMGA 1Z5GA 3MRTA 2QR3A 1HE5A 4UASA 1PJ2A 2A5GA 4F3NA 5CEEA 3HUEA 4EA7A 4NU0A 4D4JA 3OVMA 2MSEB 4JT8A 3S2ZA 3PXAA 2Q1UA 3QMPA 3T7CA 1EI9A 3L2OB 4W4TA 5FPSA 4CQLB 1Z28A 9ATCA 1B26A 2E4AA 2G80A 3B13B 3E22B 3EFOB 2H1CA 4DAEA 1P3DA