4MTLA

Human methyltransferase-like protein 21c
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
208
structure length
208
Chain Sequence
KFVPTDYASYTQEHYRFAGKEIVIQESIESYGAVVWPGAMALCQYLEEHAEELNFQDAKILEIGAGPGLVSIVASILGAQVTATDLPDVLGNLQYNLLKNTLQCTAHLPEVKELVWGEDLDKNFPKSAFYYDYVLASDVVYHHYFLDKLLTTMVYLSQPGTVLLWANKFRFSTDYEFLDKFKQVFDTTLLAEYPESSVKLFKGILKWD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Protein-lysine methyltransferase METTL21C
publication title Human Methyltransferase-Like Protein 21C
rcsb
source organism Homo sapiens
total genus 63
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature ec 2.1.1.-:
pdb deposition date 2013-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10294 Methyltransf_16 Lysine methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4mtlA00
1EJ0A 3KQMA 9MHTA 1WY7A 3FRHA 3LDGA 1YZHA 5EMKA 4YUXA 3L8DA 1DCTA 3MERA 3EVGA 4C03A 1BKYA 3FPGA 5DTQA 2ZW9A 4CTJA 1FP2A 5DM0A 10MHA 3C6KA 2EJTA 2O06A 3CVOA 5EMJA 3M6UA 4QPNA 3C3PA 4E70A 4FT2A 5EIFA 1I1NA 2IGTA 3G5LA 3SVZA 4GUAA 3K0BA 4ER6A 1D2CA 1PJZA 2XVAA 3A4TA 4EQZA 2NP6A 3A27A 2B9EA 3BWCA 2ESRA 2NXCA 1KPGA 4F84A 2PXAA 2BR4A 4R8RA 3DMFA 2AOTA 5HIMA 2XYRA 2FCAA 2FPOA 1JSXA 5HEKA 4BLWA 5LQKA 3UJBA 4QQNA 3JWJA 2P7IA 1ORIA 2PX8A 5ICEA 2IDKA 2ERCA 3HEMA 2Y1XA 4L7VA 1XDZA 3LHDA 3NDJA 2FK8A 3UZUA 2UYCA 2IH4A 2PX2A 3PLAE 3ANXA 5EEHA 1SQFA 3TPZA 3UWPA 1X1BA 5ICGA 2OB2A 5C0OE 1R74A 3FRIA 1HMYA 1U2ZA 2QM3A 4Y30A 4PYJA 5GIOE 4RVHA 3DOUA 4OA8A 3NJRA 1AQIA 1YZ3A 1RI5A 1WXWA 2CWWA 4E32A 3SGLA 3LDFA 2C7PA 5CCXA 1QAMA 2FYTA 4CXMA 4PYNA 1JTEA 2I6GA 7MHTA 3AWIA 3EMDA 3TRKA 3KPYA 1PRYA 3KQYA 4IWNA 2B3TA 3NWBA 3HCBA 4QTUB 4A6DA 5M5BA 2ZBPA 4AZTA 5DRYA 4RTSA 1VQ1A 1NW6A 2PXXA 4PWYA 3REOA 2CKDA 3FTDA 3TM5A 3G89A 3EGIA 3FUVA 3TMAA 3G2QA 2UYOA 5EZSA 5HIJA 3I5UA 3LCCA 3OCJA 3GIWA 3ERCA 2ZWVA 3GGDA 4CWAA 4AX8A 2CL5A 2VDVE 4EVIA 3UJAA 3ELYA 4P7KA 2IH2A 3NVKI 2ZLBA 4GOND 5LQCA 4OBWA 4FP9A 5EZQA 3BUSA 3P2IA 3TFWA 3LKDA 2Z6UA 2ONYA 3MQ2A 2AZTA 2Q41A 2ZCJA 1SQGA 2NXEA 1YF3A 5KS2A 4KW7A 3V8VA 1O9GA 3EGVA 5FQOA 1WXXA 5DM2A 5DSTA 1L3IA 3OZTA 5LQAA 2B25A 2OXTA 1T43A 3HVKA 3O7WA 3M6XA 3OU2A 4C4AA 4E30A 1X1DA 2AN5A 2AR0A 3JWGA 3MGGA 4EKGA 3BGIA 3OFKA 4YUWA 2K4MA 4E2YA 3HTXA 1KHHA 3VSEA 3LX6A 3UJ9A 3JWIA 3P9CA 5LSAA 2IBTA 3B3JA 2P8JA 3U81A 4RTKA 1ZGJA 4HRAA 3LL7A 3EVCA 3R24A 2PJDA 4A6EA 2GAFA 1M6EX 2LD4A 4YV0A 5LR6A 4E2WA 4KVZA 1JG3A 1FP1D 5DX0A 4O29A 2F8LA 5KVAA 3THRA 3K6RA 2AOUB 2VZ9A 4AZVA 1N7IA 4RSRA 3HVJA 2Y1WA 3WSTA 3GO4A 2NYUA 2FK7A 3BWYA 3NWEA 5FHRA 5K0JA 4R6WA 5GINE 3FTFA 5DXAA 2EX4A 3FYCA 2JH9A 1NT2A 1KR5A 1RI4A 5T64A 3GRRA 3TOSA 3X0DA 2ADMA 3C0KA 3G8AA 4GOOD 3UJ7A 2XVMA 4DM3A 4F85A 3DH0A 3EVBA 3R9XB 3EPPA 1UIRA 3KPUA 3G8BA 3FYDA 1WG8A 2WK1A 2XYVA 1DUSA 3GXOA 1WS6A 2ZZNA 3NDIA 1KPIA 3EVFA 2IH5A 3DXXA 2HTEA 2JHPA 5GP1A 2B78A 2NNWB 4GF5A 4MWZA 1RI3A 1JR4A 2ZWAA 5LQNA 2JHCA 3CJRA 1JG1A 1RI2A 5D1NA 4E2ZA 3UBTA 2AOUA 3DLCA 2G1PA 4DKJA 2PX5A 4RWZA 4V0QA 2UZ4A 3LECA 3DUWA 3MTIA 5HIIA 5KQRA 4NECA 2HWKA 1VP9A 3BKXA 3GRVA 5H02A 4B17A 4FZVA 5JUWA 1M0EA 3Q87B 3MB5A 5DTRA 4X1OA 3FPJA 1NV9A 1SUSA 5E2BA 2FRXA 1Q0TA 5C9ZA 2GPYA 3KU1A 2V74B 4XUDA 2JG3A 4Y2HA 5F2OA 3M6WA 3HCCA 3SSNA 1P91A 4HG2A 3OU6A 1IM8A 5BXYA 1RJEA 2EG5A 2IIPA 1XCJA 3ER8A 3FTEA 1Z3CA 3PTAA 2OO3A 4HH4A 2AVNA 2PGXA 5F2NA 1R8XA 4P7FA 4RTOA 1O9HA 2Z6QA 2XBMA 1EJ6A 3BWMA 4HTFA 5EEGA 3H2BA 1G8AA 5FHQA 4ZTBA 5U4XA 3OZRA 3M4XA 1RJGA 4HSGA 5GOZA 3T7RA 5DM1A 3I9FA 2P1DA 4GOLD 3B3FA 4OBXA 5DT2A 3I64A 4U7TB 2ZIEA 4GEKA 4PGGA 4IV0A 1NE2A 2QRVB 2V7EA 3E7PA 1D2HA 3RODA 4BP1A 3IEIA 1IXKA 3G2OA 4RX1A 1H1DA 4KIFA 5EC8A 4EK9A 5KYGA 1AQJA 3UJ8A 4DF3A 2OPBA 3EVAA 2CMGA 2YVLA 2WA2A 4C05A 1JSZA 5KQSA 3KPVA 3LSTA 3FUWA 4DA4A 5E1MA 3DLIA 4E33A 5GWXA 3EVDA 3B7PA 4BLVA 2PV0A 3P8ZA 5G02A 1I9GA 4RTQA 1FBNA 1R8YA 2JHAA 4FR0A 5ERGB 1M6YA 2H11A 3KQWA 1FJXA 4KRGA 1L9KA 4RV9A 5T67A 2GS9A 5FWAA 2YUIA 3I58A 3EVEA 5E1BA 2DULA 3GWZA 1ORHA 2OKCA 3BXOA 3P71T 4DZRA 2H00A 2N47A 3CGGA 5DXJA 5K8VA 5E9WA 1SG9A 3DULA 3O4FA 1NBIA 1R00A 4DCGA 2E5WA 3PVCA 3NMUF 2NXNA 3SR4A 5K09A 4UOEA 1XXLA 2GH1A 3C3YA 3G5TA 5HILA 8MHTA 5EOVA 3UA4A 3A7EA 2C7RA 3LCVB 4M37A 2HV9A 3R3HA 1G55A 1BC5A 4K6MA 1EG2A 5FA5A 5FTWA 5HIKA 5CIYA 3HNRA 5DLYA 5E8RA 3NW9A 3TM4A 5DWQA 4YMGA 3KQVA 5BP7A 4HGZA 2BZGA 3RW9A 5D1HA 1L3BA 3HA3A 2ZBQA 3MHTA 5HFJA 3ORHA 3MAGA 3KPWA 3OZSA 2G72A 5FADA 3TR6A 2O07A 4RTRA 4RVFA 2VS1A 5CCBA 2VDWA 1X1CA 1SVUA 4Z2YA 4PONA 5JR3A 4C06A 3TKYA 4G56A 3KQQA 3T7SA 1KYWA 4WVLA 4ATNA 2AS0A 2JJQA 5IH3A 3AXSA 5K03A 2UYHA 1ZKDA 5K05A 3PX2A 3TLJA 1NW3A 2DPMA 2PT6A 3EGEA 4MHTA 2H1RA 3OFJA 5K01A 2YTZA 3O31A 3P97A 3OE5A 5EVJA 2HNKA 3GDHA 3HCEA 4CKCA 1NBHA 3P9IA 1TW2A 1NW8A 3B5IA 3M70A 1Q0SA 1JQEA 2G71A 4KDCA 3ELWA 2GB4A 3G88A 5K0NA 4BY9E 1R6AA 3AY0A 1D2GA 4PINA 4QPPA 3NVMB 2R6ZA 1I4WA 1VBFA 1UFKA 3QOWA 2PT9A 3GJYA 5CUQA 3LBYA 3PFHA 5CVUA 1NW5A 3FUUA 3LGAA 2PKWA 1KXZA 2G8NA 2OB1A 5LQUA 4IV8A 4PNEA 1XTPA 5GM2A 5MHTA 3RIEA 4ER7A 5CVVA 3UJDA 5GIPE 3KR1A 4XUEA 5FULA 2GA9A 1ZHFA 2QE6A 3FUXA 3MTEA 2HR1A 4PYIA 5DM4A 4YUYA 3THSA 1YB2A 1G60A 1RJFA 4PYLA 2PXCA 3CJQA 4MIKA 4LWOA 2B2CA 4QVGA 5E1OA 4ER0A 4R8SA 4X61A 2P41A 2G70A 2P3OA 5HOQA 3OE4A 2A14A 5P8WA 1ZQ9A 3FPFA 2YX1A 3VC1A 4CKBA 4GC9A 5DX1A 2PWPA 5F2KA 4C07A 1EQAA 4EMSA 4PYMA 1EAMA 3SXJA 3IYLW 5B1SA 2ZFUA 3IHTA 4U7PB 5EMLA 3HP7A 4FGZA 2Z6AA 2NXJA 3GNLA 4YUZA 5EG5A 2OY0A 4JXJA 4PGHA 1XCLA 5CVJA 1N7JA 2I7CA 3CC8A 2P7HA 4H0NA 3TQSA 4ER3A 4RTNA 1G38A 3PFGA 1AV6A 4V0RA 3G7UA 3CJTA 4RTJA 2BH2A 2OZVA 3LCUA 3B3GA 4PYOA 3R6TA 5BW4A 3KR0A 3UJCA 3HCFA 1L3CA 4RTMA 1JQ3A 1YUBA 3CBGA 3GU3A 5IKMA 3ELUA 1TW3A 5BW5A 3LPMA 3FZGA 1BOOA 3HCAA 1ZGAA 3FTCA 1INLA 3AJDA 2AOTB 3SX0A 1ZG3A 3UFBA 2BR3A 5ICCA 3DXYA 4EKIA 3OPNA 3G2MA 1G8SA 5FUBA 1TPYA 3UA3A 3HVHA 2O0LA 3P9KA 4E2XA 3MCZA 2PX4A 3A26A 2ONZA 4MQ4A 4PCAA 2QY6A 1Y8CA 3ME5A 4ISCA 4QTTB 2P40A 5FWDA 2XYQA 3P2EA 2AN3A 4KWCA 2ZTHA 3EEOA 3BT7A 3KPJA 3C6MA 3ID6C 2BR5A 4DMGA 4R05A 4QDJA 2ZSUA 3KHKA 3M33A 3B89A 3OU7A 2ZIFA 2YQZA 1F38A 5DX8A 3PS9A 1KP9A 1XVAA 4QVKA 3KKZA 3DTNA 1VIDA 4WXHA 3VYWA 1QYRA 2ZBRA 4PYKA 4YUVA 4P7JA 5E9JA 2YXEA 3VC2A 2O05A 3BZBA 2PY6A 3HA5A 3MCTA 3KR9A 4FSDA 3SSMA 1MHTA 1VL5A 2PBFA 3ELDA 1XDSA 3KQPA 3M6VA 5EKXA 1X1AA 2HMYB 3DMGA 3DXZA 2QRVA 3E05A 4LWPA 4P7GA 4F86A 1SKMA 3HM2A 1XJ5A 3SMQA 5LQRA 3EEYA 5EHIA 5CVEA 5E8JA 4CTKA 3FPEA 3EMBA 3KQSA 1YFJA 3Q7EA 4ER5A 3KQTA 4C04A 1BHJA 4OQEA 3BWBA 1VPTA 3DMHA 2JH8A 4IKPA 4C08A 1QZZA 1JQDA 1VP3A 3ER9A 2NP7A 5CVDA 2P3QA 2PWYA 5DSXA 3JWHA 4XCXA 3AXTA 1JTFA 3T7TA 2ZZMA 5CM2Z 1P1CA 2AOVA 3NTVA 4XUCA 5K0BA 2ZVJA 5FQNA 4BP3A 2IDJA 3PT9A 4POOA 2ORED 2R3SA 4HC4A 1UWVA 4BLUA 3DR5A 3PX3A 1L1EA 3CCFA 2AOWA 5EIWA 2PSSA 1RI1A 3BGDA 4HGYA 1V39A 3R0QA 4P58A 1QANA 3I53A 1P39A 2UYQA 4YV2A 2CMHA 3QV2A 4FT4A 1FPQA 2YR0A 5T6BA 4YV1A 2I62A 4KIGA 2IFTA 5E1DA 1OR8A 1HNNA 1VE3A 3E8SA 5E2AA 5FCDA 4YMHA 4RVGA 1WZNA 5EGSA 4X60A 4AUKA 4KDRA 4PCLA 1P1BA 5EKUA 4QDKA 4E31A 1YFLA 4LG1A 2O57A 3S68A 2YXLA 2ZULA 1SUIA 1EIZA 5FA8A 5ICFA 4OA5A 2PLWA 3SSOA 4PIMA 3V97A 3A7DA 4AZSA 1R18A 1JG4A 4R6XA 2EJUA 3HCDA 4X41A 2AVDA 4OX9Y 5K0FA 2BM9A 2BM8A 2ZIGA 1NKVA 5DPMA 3TKAA 5EMMA 4AZWA 5K0GA 2P35A 2AOXA 1NV8A 3F4KA 3G2PA 3SM3A 3GRZA 4RVDA 5HZMA 3FUTA 3D2LA 2FHPA 5LQJA 3A25A 1NW7A 1G6Q1 1VLMA 2OBFA 3IV6A 3KQOA 5DRTA 1B42A 4GQBA 3BGVA 3CKKA 5DTMA 4CKEA 1F3LA 3GRUA 2WA1A 1JG2A 5C1IA 2QYOA 4X63A 2PVCA 5GM1A 2C7OA 3EVZA 2IP2A 3GCZA 3T0IA 1IY9A 2AN4A 3P9NA 5K0EA 1MJFA 2GLUA 4FSXA 3QOXA 5CD1A 3HVIA 4OQDA 1KIAA 2IBSA 4M7RA 4GOMD 3HA7A 1O54A 4RTPA 2KW5A 5EHGA 4M36A 5K0LA 1AF7A 4RYLA 4DQ0A 3LBFA 4LECA 3BKWA 3LDUA 3P2KA 4HTFB 1N2XA 2P3LA 4GC5A 2EFJA 3GRYA 3PB3A 1RJDA 3DP7A 2YXDA 2VDUE 3KR2A 3UJ6A 4DCMA 4FS8A 4GBED 4QQKA 1KYZA 2OYRA 1DL5A 4PIPA 4M38A 5K0CA 1QAQA 2C7QA 5E9QA 1QAOA 3LKZA 1KPHA 5EPEA 1X19A 3FPHA 4RTLA 4MTLA 5EQJB 2VP3A 3E23A 2IPXA 2I9KA 4PYQA 1XDUA 2ZZKA
chains in the Genus database with same CATH superfamily
3HRKA 4NSNA 1GNVA 4P1ZA 4E94A 3TNFA 2O0KA 3LZDA 5CLJA 3I2JA 4AKSA 5DTQA 1HE5A 1NZDA 2A84A 4R1LA 5AK5A 4M9ZA 4IR7A 5CH8A 4X7PA 1NRIA 4R2IA 2FEKA 3TJZA 3GV0A 3PF9A 2PJRA 3HMQA 3A32A 3OOYA 3RU9A 1XQ1A 2Z3VA 3A27A 3DD5A 1PW7A 2R8OA 2NXCA 1KPGA 1R15A 2BFDA 2XT6A 1EUCB 4XGQA 3CSUA 3P9SA 4NOKA 5ALEA 4DL9A 3VDNB 1GNLA 1P2GA 3N2YA 1BAPA 2IZZA 1KWKA 1M67A 5HEKA 5C8YB 3RASA 4IINA 5CNJA 4M0LA 4E5PA 1I33A 3CFYA 4NMMA 4Z7OB 1CWUA 3MCWA 4JGBA 4HI0E 1QH1B 1UXJA 4QQ8A 1QCYA 4X7MA 1HL3A 1HDZA 1MX9A 2DBZA 3H5IA 3B51X 2GZ2A 5F12A 3UOWA 4D81A 1WPQA 1M2NA 1R74A 3ECAA 2CXRA 5HX7A 2WNHA 2XVYA 2FMXA 4MQ6A 5TRTA 1RHRA 1W5EA 5EE9A 4QGAA 3KT8A 2JFOA 1QR6A 2P3SA 5D8DA 3SXUA 3R7WB 1IWBB 4IDHA 2OYCA 3Q9UA 1SHTX 3FOZA 5JROA 1X77A 3ZHVA 4UAUA 1MBZA 2VSYA 5COBA 5DHFA 1AB5A 3KEQA 5LZ7A 4H4EA 4AKEA 1OH5A 5SY4A 2V7PA 3ISTA 4JSTA 1MC4A 5FPQA 4AIIA 2WMOB 1SKAA 2PLNA 1FLAA 4L6AA 1XF9A 5LJLA 2FPGB 6REQA 1B0PA 1GTL1 4WBSA 3V7WA 1REQB 2A7QA 3GOHA 3PUKA 2Z6UA 2XYGA 2WYOA 4YAFA 3PFNA 4H27A 1SXIA 2ID7A 1Q22A 3P5BA 4XQEA 4HNVA 1TLLA 5JEDA 3LXXA 5ALNA 1RE0A 2DH6A 2H1CA 1QHIA 3IP7A 3MVEA 4WK6A 2W5UA 2PUWA 2I34A 3OCXA 5DSTA 4AN0A 3PF8A 4B3XA 1U80A 1K68A 3GJQA 4RMNA 1NUHA 2AKAB 2WWYA 4IVPA 1NSYA 4XFDA 7ADHA 3P4YA 1NQWA 1A9XA 2GFQA 4WKBA 5KJEA 1BQ3A 5ESWA 3FNEA 1QJCA 4HRAA 1VGRA 2JFVA 2QRJA 4X3CA 3RVLA 4MRSA 2P6NA 2JCBA 3CR7A 1Q16A 4HPXB 4FCTA 5BSTA 3ZDAA 4QM6A 3WC4A 4JT2A 1M74A 1RM4A 2RHLA 5KMGA 4QOHA 4S1VA 2XXAA 4DA8A 1H2AS 5DGTA 3W9YA 3EY4A 1BVYF 2VZ9A 4AT1A 1N2ZA 3EVNA 2QSJA 4W1SA 4GHWA 1SUWA 4QLAA 1CY2A 4YXWD 2PVPA 2RH8A 4KXQA 3V6MA 3HJFA 3ZE6A 2DQKA 3NHMA 5IDQA 3EW7A 4PLYA 2GXQA 2RHDA 2NXWA 5FHRA 3HBMA 4R6WA 4EB8A 1PAUA 1RI4A 3QJ5A 2CHEA 1OLXB 1FRFS 3QFSA 4M60A 3UJ7A 3F49S 5TV2A 2ZSAA 2QNIA 1H8EA 1GPJA 2FPXA 2JI4A 2Q21A 4ZDKA 1WG8A 1MOZA 5KO2A 3M9XA 2XYVA 8ADHA 3MFQA 4H2DA 1NUUA 2JVKA 2ZJ4A 2Z2ZA 5JO9A 1RQGA 4GMKA 3QKSA 1ZL2A 4F56A 3IP5A 4JYZA 5GP1A 1Q0UA 4CKZA 4FOOA 3NM6B 2H1HA 1E58A 2IKQA 2VI5A 1RBZA 1YR1A 1Z13A 2F59A 1YVDA 3G5UA 1EE9A 5JVDB 4EY7A 1PNVA 2AOUA 3CCCA 5KYUB 3IA7A 4FGJA 1E3JA 1VCMA 1B23P 3W5JA 2A1UA 5L3QA 1QP0A 3AUYA 3BE5A 3DUWA 5CITA 3L4BC 2VT3A 4IS3A 1O97D 2G5TA 4LKRA 1X0XA 1ZX1A 4LDPA 3H83A 4EB0A 5MN5A 2QRHA 5AXBA 2O7SA 5HMLA 3ZE0B 1YJ8A 2VO1A 4F7WA 1R7RA 1I3MA 4US2R 1MABA 3L6UA 2XBUA 4TXLA 1A04A 5FWYB 4OHPA 3TRFA 1R6BX 1XJWA 4HAUA 4FFOA 4QOSA 3TZKA 3D1VA 4OHUA 4E13A 1HSZA 5EWJB 5DN9A 1EWRA 2K2QB 1F06A 721PA 1WKCA 4UMVA 3GRFA 5AM4A 2X6TA 2ZSFA 4AMGA 2CMFA 4JY7A 4MJ7A 3KZVA 1P6QA 3EUFA 2AEEA 4TZ0A 3IT0A 4HNHA 3T0GA 3H2BA 3T1VA 3DZGA 2JEOA 4WT7A 1NXOA 4G2TA 5LXTA 3OPMA 1NY6A 2A88A 4ZTBA 3N58A 4D4GA 3M4XA 4YMLA 2EYQA 4NAHA 4BFYA 4AYTA 1RKVA 2YOHA 1W2HA 1F6BA 3GLVA 4IEIA 2ZAMA 1CRPA 4WDQA 3H8WA 1P18A 5EP3A 4BQRA 4LHWA 4YCMA 4PGGA 2IUYA 3VZQA 3A05A 3PYMA 3MMPA 3LA8A 4RX1A 1T9KA 1EVIA 3NCHA 3J80A 1M34A 5F7OA 5CM9C 2C5LA 3D7SA 3P4UA 2GN1A 4OLJA 4ITUA 4R0NA 4Y6RA 4X90A 3UT0A 1E1RA 2PD3A 4QBTA 4KXNA 4KQXA 2R6FA 2HPVA 1ZA1A 3E22B 3QFRA 2O8BB 2FN8A 3EQ9A 2XUIA 1DBVO 5KYWA 3C3WA 1CUZA 4UHCA 2H11A 2DG2A 3THXA 1JE0A 4KPGA 2JLUA 3RARA 3LQFA 2CYAA 1RE1A 2J48A 1UJ4A 4HLCA 4X44A 5FWAA 3G0IA 5GPBA 1XJQA 3UXEA 1KEKA 4R1MA 5ELLA 2BVNA 1QPBA 3BD7A 2GPNA 2PX6A 2IOQA 4H9GA 4PFQA 5KCMA 1DELA 3RAJA 3QNUA 2C5HA 4MROA 3FMVA 1SUFA 1MRSA 1T2NA 5K09A 4UOEA 2QD3A 2RBGA 3DW1X 3H1EA 2VZEA 3PDIA 3ROKA 1DX9A 1DKLA 4XEUA 4KXMA 4YRAA 4G5OA 3V46A 4EDHA 8MHTA 2ZQZA 3ICPA 4J76A 5LLTA 1J2JA 1G5HA 2KE5A 4QBKA 3FDIA 4YJ3F 4Y9UA 1J8FA 3NHUA 4E7PA 2CC2A 2IOFK 4LTNA 621PA 5CIYA 4U8GA 1EU1A 1OQAA 1T2AA 2NO0A 5DLYA 1BFUA 1DOZA 3R20A 3KQVA 4HGZA 1H6CA 3QLJA 5E4TA 4FFRA 1F6DA 3M4JA 3PSHA 1XA0A 3A9SA 5DGDA 5KKAA 2WBLC 3C5WP 4PZCA 3TR6A 1FBTA 4WUTA 1P45A 5CFZA 3HKDB 1GU0A 5F76A 3LP5A 4GZ5A 3GYGA 3SWWA 1YOVA 3C85A 4Z9FA 3RRJA 4G56A 1FEZA 2N3ZA 3I2KA 1XTBA 1FX0A 3CSDA 3GDWA 3HU1A 2Q0QA 3QWHA 4E5UA 3NP7A 4R41A 5FV4A 3RS8A 5K03A 5B53A 4ZGWA 5H83A 3I2HA 4HWSA 3EOAI 4BMZA 4UPEA 2G1KA 3MWDB 4EG7A 1E2LA 2EL9A 2IHVA 4I5IA 1XZLA 2AQIA 3IUPA 4MV9A 4BKOA 4CRWB 2HNKA 2DHDA 3T4UA 3FUCA 3NVDA 1P75A 4QJIA 4JI2B 3BYZA 4MNTA 1NYLA 3QI2A 3RD5A 2RKWA 2YWGA 4JKIA 3ROTA 1RQ7A 2YY5A 3ROPA 6REQB 2FE1A 3VH2A 3SHVA 2Y4OA 2A9OA 1EFRD 4ESEA 3O26A 3VR2D 1MAHA 2FZ4A 3DOFA 4FMDB 4CHTA 4NABA 2C00A 4DR4B 1KI6B 1EMDA 4ZYXA 4H3HB 1U0NA 2YWRA 3LBYA 5KSPA 1BN6A 4MRMA 2AE1A 4HXYA 2P6OA 4DCTA 5MHTA 4GX2A 1JQLB 4XCQA 3KJFA 4LXHA 1PN3A 4AIRA 2H18A 2IL1A 5JLJA 1SKQA 3V8MA 3A9RA 1DG1G 2H63A 3M3HA 3UK1A 1XDDA 4GIBA 5KX5F 3S2UA 3LU1A 3QBVA 3R40A 1L4MA 3LXMA 1D6MA 3MB8A 2P41A 1ZVKA 2YZ7A 4QFCA 3A3YA 3EXHA 3NHWA 3OE4A 5ISMA 3A4MA 4ND6A 3L4JA 4EEKA 1AT1A 5K3FA 2ZRPA 1Z36A 3OFSA 5AVYA 3PUWA 3D7RA 2ZFUA 3I52A 4M9XA 1XTZA 1THZA 4RD0A 1CNFA 4CDMA 5KOJB 3N2ZB 2YH2A 4O2AB 4P3PA 5KTKA 3OQIA 2IXBA 4O5AA 1M8KA 5CVJA 2PS0A 5JDIC 3DFMA 2Q8PA 2QLBA 2YL2A 4UC0A 1I4LD 4RTJA 2QAGB 3G9XA 5CYPA 3B3GA 5YASA 2XITA 3SNKA 1UP7A 1L3CA 3AY7A 5L95A 1QF7A 4MZDA 3NUQA 1Z6TA 4BZQA 1KWGA 2V3CC 1FQJA 1OVMA 1VFNA 2BJVA 3B85A 3PA6A 4LYJA 3RSCA 4BVLA 1FZTA 1LY1A 3HCAA 2I3ZA 3W7VA 3RRMA 1M0EA 4ARCA 4RJKA 1XEFA 4D82A 4JYPA 1W36B 2VWQA 4LBVA 4DY6A 1PVOA 4TLDA 4E5VA 5IWAB 3PHJA 3GLHA 3T0FA 4HAWA 2H4YA 3VOBA 2XODA 2EG9A 1MC5A 1R88A 2HMVA 4J7XA 4NBKA 4E5MA 4ENTA 5B2EA 4OU5A 1SH7A 2CNWD 2ZITA 3P9KA 5JANA 2XB4A 3OKAA 3BA1A 1YJ5A 4QTTB 1K7CA 1CNMA 1T5DX 3LM8A 5HCIA 2JGFA 2P40A 2R84A 3E70C 3AL2A 5EKSA 5KJ1A 3N39C 3IQFA 4R4JA 1N36B 2J9XB 4K9RA 3KE8A 4QUBA 1RVV1 5AUQA 1C9EA 2ORIA 3WYCA 4XWOA 5M04A 1KY5A 4C0WA 4CUZA 3WMFA 5HXAA 1KAEA 5J2UF 1K1EA 4AJJA 3ZKAA 2C9YA 4RY9A 1W46A 3PNBA 1XRPA 1SVNA 2JI6A 1G4HA 3DHEA 1E7YA 2GNAA 3O8OB 3ASVA 3DFUA 3E84A 3QVWA 5JFTA 2YXEA 5D3MA 4DCPA 1JI0A 2BT4A 2GM5A 2PY6A 4GO1A 4ZCPA 3ZD7A 3C8MA 1CS0A 4W5JA 5F3RA 4RHYA 3S2GA 4O4HA 2JD0A 1W4BA 3ELDA 2AFHA 1V45E 1R1DA 1GAQA 1GYRA 1QUFA 1T1JA 1VJRA 1YDWA 2ZSBA 4K6HA 1ZGHA 1VE7A 4X84A 2RD2A 4J49A 4L7QA 4WNAA 5FNVA 4Z7QB 1GITA 2C7BA 4XVUA 4C4PA 3SQWA 5D84A 4NOMA 2NO7A 1JDPA 4REOA 1A77A 1S02A 1HK7A 4ER5A 2P1RA 3RC9A 4P0QB 4DXDA 2YVAA 1SRRA 2X0RA 3KDAA 3V7UA 1HE4A 3MJSA 4JKOA 5BNWA 1S8OA 4DWOA 4AB1A 1Z8NA 1VP3A 3EIHA 4JB2A 5H7XA 2PWYA 3OCUA 2HBZA 1WA5A 1V9CA 4TQGA 3ZWKA 1GTZA 2GN4A 2F8TA 3H3XA 4Y2JA 1FP4A 1I14A 2H5LA 2EP8A 2X14A 1IM5A 2NN3C 1W93A 2IYEA 1P62B 2QTWB 4GKBA 5DIZA 3N53A 3WK8A 4M8KA 1L1EA 2W2LD 3FROA 4QGBA 5HBRA 4WN3A 4KR7A 3BGDA 4YLEA 4KLRA 3D4BA 3ZIDA 4RELA 1F4LA 1J70A 4EB6A 4UE6A 3H75A 2LVBA 2G09A 4C3OB 3L0BA 4PLZA 2LWIA 5B55A 1KK2A 1TRHA 4N7MA 4ZGBA 2VIIA 3H5LA 5AM5A 5DWDA 2O3TA 4CIDA 4GYJA 4RJTA 2A0XA 1KZ6A 1PK8A 1M2KA 3L01A 3DZ8A 4V0MA 3TGPA 3W9SA 2XE7A 3EXEA 5AKYA 1QOZA 1CVIA 1F6WA 1UM8A 3I8XA 3RTBA 5DHSA 1NUQA 4TUYF 1E0KA 1P7CA 4OL0A 2G67A 4BKUA 1IRXA 4UU7A 1DE0A 3F7TA 2GXUA 2VH1A 1ZH8A 3W2IA 4M1WA 4OX9Y 2BM9A 2VP6A 2ZRBA 3AUKA 4R8LA 5LMUB 1W29A 3EULA 3QFHA 4JOCA 2F62A 1YR2A 1XL1A 1SVLA 2GSDA 4OKNA 3A2LA 3RV4A 2FH5B 3BCRA 1GPUA 1OF1A 4UUPA 1RM0A 1XCBA 5DJ5A 4XOUA 2DUMA 3UJ3X 3L9WA 2QAIA 5AM1A 1DCTA 5EYPB 2IE8A 3PVZA 5TF4A 3S2YA 2OQRA 3DE0X 2H57A 1PNRA 1YZQA 4G5RA 3DCIA 4UAGA 2Y0DA 1HG1A 1P7YA 3W7AA 3SI7A 3VR5A 2N42A 1T0BA 2AEMA 3JAKA 1CERA 3GW8A 4JL6A 3RVOA 1E2FA 1F0PA 4EY3A 4NCXA 4FFBA 5L4SA 1NYTA 2AMFA 3QOYA 4FIDA 5COQA 2XOEA 2B1GA 1NVEA 5EHGA 2E21A 1YBFA 1BA3A 2VXOA 3DFIA 3HEAA 1UDRA 2OXCA 2UZIR 5IU6A 1F0KA 1XKQA 4ZU3A 1X42A 2ON6A 1ML4A 1B73A 3F6PA 2WMDA 4CPDA 3IIIA 5B3JC 1EZZA 2P3LA 1U8TA 4DM7A 3M6MD 2BFFB 1PSWA 1FFCA 3O3NB 1NXXA 4HDKA 2QVZX 2ZI7A 3OY7A 2XCRB 3CM0A 1GGKA 1HDOA 2WWWA 2QX8A 2ZI5A 3PE4A 1DL5A 2OYRA 1KOLA 1A1VA 2GAOA 5BW6B 3OO0A 1X19A 4G5SA 4GS5A 1RYHA 1IQPA 2GKOA 4JLOA 4WE3A 3S3TA 2YICA 3ENVA 3DO5A 4X6UA 3X1KA 4M22A 1JB9A 1XBTA 3ZS8A 1YQQA 5JYEA 1EJ0A 1N7HA 3OPXA 4JHLA 3UMYA 1YNOA 2QDKA 3F98A 3X1JA 3V2UA 4LV6A 3KVRA 2QN7A 3C98A 3LUBA 2VF8A 2WHXA 3AF2A 4Y3UA 5DGXA 2ZW9A 4JLNA 1FUEA 3Q8LA 2H2DA 4PZAA 2O52A 3I8OA 4H35A 4IH1A 4NCIA 4XB2A 3SZ3A 3K9LA 1U5BB 5CXSA 1E9VA 4IVQA 1PL7A 5B5SA 5L8VA 3F3SA 3NHLA 2HCTA 3B6ZA 3L1IA 3KXPA 1TJNA 4MW4A 5KNDD 1F8UA 4P3KA 4MWDA 4M0EA 2Y77A 5SZKB 2ESRA 2ZJ0A 2H1LA 5THKA 1T6XA 3E8XA 4U00A 1XDBA 3F67A 2OFPA 2C83A 3O2SB 3WYNA 4UQPA 3HDQA 1Q11A 3NBQA 3HEMA 4I50F 4Z7NB 1G42A 1L4UA 2GN6A 3GEEA 5KVQA 4QUAA 1JBEA 1P2TA 5EEHA 3KYIB 3UAZA 4BO3A 4I2VA 2B83A 4KXYA 3IVRA 1LX6A 2XDQB 3OZXA 3WYDA 3MGCA 3E3OA 1XVIA 4UHFA 5ESRA 4ZALA 3W8NA 2GN2A 4YYEA 2FFJA 4BN0A 3LVBA 1ZRHA 4M8LA 1Z68A 3TFOA 4V39A 1ZK2A 3SLRA 4HNSA 3UQZA 3I0MA 1U2DA 4EKEA 3EEOA 1WHTA 2JRCA 1E2DA 5DWVA 4XIJA 3SKVA 1CD5A 1HT3A 1XKTA 1D7OA 2CUNA 2JGLA 2ZUCA 2M2IA 3DT6A 4U63A 3R7BA 3EPHA 1I6LA 1Z75A 4Z0NA 3ZS9A 3REOA 4Z6KA 2NZJA 4LV5B 1L1FA 1TA4A 3LCCA 4YO8A 5ESDA 2FZCA 1C0LA 2ZM5A 1AKNA 3ZI4A 1WCYA 4DSOA 4MI3A 5EZ5A 1YS4A 4GOJA 4AY3A 1V1JA 3RIXA 3PXGA 1ST2A 4CT0A 3JQCA 2IH2A 4E11A 2J3QA 4N5LA 4QATA 4BO4A 1NULA 1WJGA 2RJOA 3CH5A 1UZUA 1P5JA 1I3LA 2FU5C 1RFGE 3SIPA 3M5CA 4K1LA 1E3MA 3QA9A 1CLUA 3EGDB 3ZVNA 4DR7B 1NMXA 2C96A 3CZMA 4XPZA 1O9GA 4CIAA 3FNHA 3P94A 4R2JA 4C1NA 1P19A 4RGVA 1TEXA 2PGLA 2CL7X 2VPXA 3H3FA 3L2OB 1IJKA 3WGJA 4TVOA 3QELB 1E2EA 4LZLA 3SS9X 4MKHA 4K9OA 5LN1A 1Y5NA 2W58A 4L1KA 1S3SA 3JWIA 3OQ1A 4Q7JB 4TS9A 3IQDB 2QTHA 2YHSA 4BMNA 3FPKA 3O6VA 2BONA 4DARA 2SBTA 1U2SA 3NKLA 4YR7A 1G3QA 1JXOA 1VGVA 2NO1A 3DTVA 5HBGA 4K8OA 3HR8A 1N4DA 1JR6A 3THRA 1A76A 4MIYA 5JJLA 2E37A 2VTEA 1QF6A 5TSDA 3DVAA 4YCLA 3FOBA 3PR3A 5A4AA 4DJDC 4IH9A 3RS5A 2WIAA 5LJIA 3W79A 2C5FA 2A59A 3EIQA 2JH9A 3IH5A 5IMSA 5IHPA 4FE7A 1Y4SA 1C1YA 2PT5A 3EWIA 3GEIA 3AVYA 1JFVA 2GCGA 4AF8A 4UCXA 3MRXA 1YR6A 3AEUA 3KL2A 4KLZA 4UQLA 1M2EA 4IMJB 4BNHA 2ADOA 3OJ0A 1E60A 1DG9A 3FWHA 2IH5A 3HV0A 1E5LA 1RTTA 4O2RA 3M34A 5EQDA 4FGSA 4ANFA 3DA8A 4KMOA 1P9RA 3UGKA 1UPFA 1RLMA 4PFSA 3W5UA 4G5GA 5E6UB 1JG1A 1L8QA 5D1NA 5F35A 3UAOA 4F11A 3WGIA 4LXYA 4P5PA 3K9CA 2Z2JA 3NT4A 5JMWA 2UZ4A 4OQXA 1R3DA 4JITA 3H5VA 3RYHB 4HQFA 4C4SA 1H1TA 3BKXA 4MVJP 2CF5A 1PZEA 5AVKA 4EQ6A 5EHQA 1CQJB 3C8HA 1NV9A 1E9SA 1IBCA 4QXMA 5H81A 5ALMA 3ELBA 2CZCA 2V58A 4X94A 5CYFA 1GTMA 2XRYA 3UHFA 3ZVLA 4TSFA 1H2WA 4JI8B 4LCJA 4OQPA 2HMTA 4E1AA 2UZAA 4JEMA 1E6WA 3A2KA 1GPNA 1A4XA 4M1SA 2I1VB 1DC5A 1FXWA 4HB4A 4P3NA 2RB5A 1OLSA 3L0CA 1PV2A 1WTCA 4FNMA 3ZBUA 2JFBA 3ISJA 3EOZA 3ENNA 2DYKA 3LUAA 4AJ1A 4B2PA 1NN3A 4TL8A 4N9WA 3DF7A 1L7DA 1RCFA 2EKQA 3QSYA 2RFLA 3NB0A 1GTJ1 3ETNA 3GD5A 3DLBA 3C1TA 3EZNA 4ZFNA 4DCOA 3VR6H 3GC6A 4HSGA 1N5DA 5IXJA 4M0UA 2W0SA 5JNRA 1MO3A 4KKXB 2V54A 1IBSA 4PIVA 1BMDA 1Q3HA 2W6IA 1OAKA 3W1WA 1J5PA 3DW3X 3B52X 4J2TA 1ZS9A 1IXKA 2HA3A 3IEIA 1CZOA 3TNDA 1JL3A 3IIKA 1OIVA 1TK2A 5FBWB 3FFWA 1S2LA 1X7WA 5BWLA 1GFIA 3KPVA 1ZN7A 3FOFC 3BJZA 1BG6A 1RKBA 2AXNA 4K0RA 5HUHA 1D07A 4BLVA 1X1SA 3GUHA 4QOIA 4ERXA 4X9XA 2XECA 4JQSA 1UPXA 2VHCA 2XJ9A 3COSA 1PQWA 3OKPA 5P21A 4KRGA 4IYJA 3V33A 3H19A 2J4CA 3ASUA 4L3VA 3KSDO 1NLMA 5BVHA 1VYVA 3CX8A 8GPBA 1QRTA 4Z1OA 1N57A 4YMIA 2JGEA 2XTNA 3S1LA 2B1IA 3AR9A 3Q10A 2RI6A 3CEPB 3B48A 4FYYA 3O4FA 3PFCA 3R76A 2AYYA 5EJFA 1N2GA 5BV2P 2VYVD 2P9BA 4BJ5A 1XXLA 5DHUA 5A3QA 1OYWA 1TM2A 1X6VA 1TCBA 2VAVA 3TSZA 2JKVA 3C3YA 1YJXA 1KMQA 1WP4A 3GJ6A 1W0KA 3SBOA 3VV3A 4TX1A 4JNCA 3A7EA 5EOVA 1OXKB 1JHQA 4R7TA 1ESNA 4OK5A 4HZUB 4OFBA 3SHTA 3AEYA 3I3SR 5HTOA 1XI2A 3HNRA 4HZIA 4X91A 3INYA 2HZBA 2XNDD 3HFRA 2XCSB 3WL3A 2D1RA 1TRKA 3UAGA 2RAPA 1KO5A 2YN4A 5KC9A 4LF4B 4M99A 1R6DA 2FG5A 4OHOA 1QU3A 5JADA 1N5KA 1NM5A 1Y9AA 3VJLA 2IHJA 1U98A 2O2IA 3IDQA 3N0TA 1YTLA 1JALA 3TOZA 4MJXA 2O2CA 4E1BA 5L7YA 1WW2A 1GL7A 3A6EA 1NOIA 3GPDG 4WCDA 4U7DA 3GFGA 1KRXA 4IFIA 1R0WA 3NIWA 2DU8A 3P9ZA 1NVFA 1NW3A 3PFBA 4F96A 3HDYA 3KTFA 1UBRS 1TYBE 1LDBA 1NP3A 2GYVA 2V5AA 5ALRA 4Y7CA 1NAIA 1CPYA 2RI1A 5IABA 1Q14A 2D1SA 3ENWA 2BGJA 1QS0A 1CIJA 3HCEA 4S0ZA 3ESCA 4QG3A 3H97A 4DA7A 2HREA 4EG8A 2HW8A 1IL0A 3NEJA 1TQDA 3CUTA 4FQ5A 3CVYA 2IF0A 1WV1A 5ILQA 4XVQA 2IOFA 1L2TA 4UBNA 4ZT3A 3RBZA 4UTNA 1QYIA 1KAGA 1BH2A 2Q6TA 3EAQA 3EZ9A 4O25A 1FNCA 1DJNA 1TAQA 2HCJB 4OCZA 2YV4A 4G1CA 2PTHA 4RIGA 1KZYC 5G1OA 4JYCA 1CJUC 1ZMTA 4L8YA 3Q0IA 1SK9A 2O8FB 3E15A 4BJ1A 1Q0RA 3L5KA 2VNAA 5FXMA 3S55A 3V1NA 4OGGA 3WS7A 2GTIA 2VEOA 1AS3A 2OO7A 3OFND 4B9EA 2IYVA 2GA9A 2A8YA 1YQEA 4TKZA 4JLDA 4YJ2F 3TI7A 1VRCA 3PGA1 4HAOA 3VPCA 2GBLA 1CUDA 2XEDA 2EV9A 5DM4A 4MWBA 3V8RA 3AP1A 3ETDA 3CKLA 5FO0A 5BNZA 1SB9A 1XQWA 3TL6A 2Q62A 3Q1KA 5E1OA 3WIOA 1TZKA 1VLQA 2XR1A 1NGSA 1XELA 2CCJA 1DO8A 2OHOA 4F46A 1OIWA 4X65B 3N2NA 1TJ5A 5JI2E 3I5MA 3OX3A 3IE1A 3BTVA 4E6PA 4PX2A 5AVZA 1DC6A 4HWGA 4MUHA 1DIHA 1ZI9A 3ZV6A 1E0SA 3B1VA 4ZCIA 3GNLA 2PUAA 2VJMB 4JU8A 1SN7A 4H0NA 4BFLA 1KAOA 1TECE 1AV6A 1R10A 2OILA 3OEWA 4B6OA 3CJTA 1T15A 2FPMA 2C94A 1JHZA 4RU1A 5KHLB 3NFYA 1MDFA 4KH1A 1TK9A 4YMVA 2H07A 4BTVA 4I66A 5TGTA 5K0SA 1UBGA 4IDCA 1JEQB 2W37A 1DFGA 3CUVA 4EG4A 1SUAA 5JH7F 4N03A 3ZV4A 1O6BA 3UFBA 1IUKA 1NXPA 4B31A 1P3Y1 2OGUA 3DZDA 3G7NA 3NALA 4OIMA 4EKIA 4O1HA 3DUFA 3UMSA 2IUEA 1MJGA 4Q4DA 2EOAA 5FWDA 3LFUA 3JV7A 3MA0A 2CFCA 5C31A 1DXYA 3LPAA 3VNBA 5ALGA 3PGXA 5I4IA 2BR5A 1JEYB 2Z3WA 3O4IA 4QYIA 5B6PA 5JQWA 3ZWWA 3CTPA 4DMGA 4QM7A 3U60B 4MMZB 5FL3A 3ZY2A 1CDDA 4S1TA 3UCXA 2Q27A 1G7CA 2R65A 5F21A 3S2ZA 2PGIA 4F45A 1S2IA 3KZKA 6Q21A 2ZBRA 4K6KA 4H7PA 1E2GA 1YQGA 2HJGA 3WLJA 4BDTA 5C5DA 1HYHA 1F2UA 2ERYA 3L7MA 4XYMA 4BQPA 1MHTA 2I91A 3N6XA 2ZYTX 4Y2YA 5FLKA 4MWEA 4Z9XA 5CDFE 2XLCA 3JWPA 2QROA 5J4LA 3CLSD 4LV8B 4IJKA 2QZJA 1R5BA 3D7NA 4KYVA 4TT3A 4IDPA 3K0AA 4YAJA 5GVRA 4CTKA 1LI7A 3GLIA 2CXPA 3CE9A 2JGNA 3NP9A 1UP4A 1PS8A 1ULBA 3R1IA 4OQEA 3E9DA 4FMPA 3BSFA 2PBZA 3K1TA 1Y3IA 3OLQA 1N0UA 2Q5EA 4MUXA 1HOTA 3RFUA 1L1RA 1T5LA 2CMKA 4NG4A 3V4ZA 1HFWA 1J33A 4JLAA 5FYDA 4A3SA 1RWOA 1Y8QB 2HXYA 2ODWA 4BOYA 3IQHX 4CM4A 2Q3HA 5KNCH 1TYCA 3NIGB 1V7ZA 4RABA 2GT1A 4DLRA 5KYXB 3RC3A 1RYDA 5LB4A 4KBGA 5IZ4A 2G9UA 1YR3A 2Z43A 3LUKA 1RPNA 3ET5A 4KHZA 4R2WA 4UBIA 4C7XA 1ZICA 2X0KA 1AGPA 1MHPA 3Q5GA 2NUBA 2O2DA 2BEVA 5KZMB 2QN8A 1HNNA 4MLZA 3ZIUA 3X44A 2KYRA 3SR0A 1SIOA 4WLEA 3GWGA 1L5GB 4CLRB 4YMHA 5JNSA 1K92A 1XPUA 1WSBA 4TYPA 1Z7YA 3MCUA 3R6GA 4X95A 3TKLA 4EMBA 4WKOA 4A8JC 3F47A 1JLHA 3WWOA 4XWAA 4XYBA 1Z22A 5BR1A 3SYNA 1Y5MA 1C9MA 2ABWA 4DLVA 3CVJA 5TJHA 1ZESA 2ZIGA 3O84A 4TV9B 4C0JA 3D6VA 1NXVA 2R86A 4XSVA 1T3GA 4X97A 1P1IA 1GHTA 2R00C 2W6MA 4JUAA 5C1BA 4KR3A 3W5SA 6NULA 3BCUA 4BC1A 3BJRA 3ZHYA 3VU9B 5E6RA 4ZXFA 3KUCA 3DDUA 1WZCA 5PNTA 3VKVA 1NW7A 1R0ZA 3BG5A 1KRHA 1URPA 1YDMA 1LC0A 1YVRA 2IJGX 1HV8A 1O5IA 3PR1A 4EJFA 2GGSA 5DCWA 5HFNA 2OAP1 1PG5A 3B38A 4X63A 1AA6A 4ABTA 3HN6A 3CSSA 3MBOA 3UMJA 4QZVA 2WD8A 3IUSA 2L18A 3P9NA 4J0GA 3D4IA 1SIWA 3TLGA 1QQBA 5CD1A 3QOXA 4BWFB 1EM8A 2IVFA 3FPBA 3RGGA 4CLEA 1V37A 3OKFA 2CHGA 1CC1S 1PJBA 5ECGC 1DEXA 3T1QA 4I55A 4Z4GA 1IQ0A 1H0SA 4F72A 1CUGA 3GJXC 4MV5A 1YS9A 5I9SA 4LRYA 1CJTC 2I66A 3TK1A 4C1BA 1L6RA 5EPOA 3NV7A 4NTZA 1N2OA 2IXDA 3WNZA 1P1FA 5HMMA 1ODFA 4DBLC 1MKYA 1TT5B 1V6AA 5DW3A 1RJDA 4R01A 1PR6A 1R9GA 1XAGA 1KI1A 2FOLA 3H9QA 4V0LA 2F4VB 2QPAA 3KELA 3Q3CA 2B35A 4CCYA 2EX1A 5K0CA 3OTQA 2C7QA 1KEUA 3WG9A 5C5EA 1ZM4A 1ETUA 4NYMR 4Z0TA 1E8NA 2ACWA 4GMDA 2V8BA 5IG2A 2I9KA 2WQ6A 2FSIA 3G13A 4HADA 2AW3A 1S3GA 1XDUA 4BV8A 5INTA 5TPZA 3G2IA 3I05A 1COZA 2II6A 4CGYA 3GFQA 3CT6A 2R66A 2GVZC 2WYVA 2VHQA 5L3ZA 1V8DA 3DBLB 3LWDA 3PEWA 2LIPA 2UUAB 4TMVA 1R50A 1H85A 4MK4A 3SDZA 8ABPA 1KEWA 4ETNA 5AK4A 1GAXA 2ZYIA 1I1NA 3UJHA 5JNLA 4A2CA 4G0MA 1Y80A 3N1UA 1D2CA 3FOWA 3RVPA 4B3RB 2EFHB 2Z95A 4IF4A 3VMMA 4IEEA 2AC2A 3PDUA 3Q7SA 3A6JA 3ND7A 4H1VA 4RLQA 2WTNA 3D6NB 3W9BA 3B1YA 5IAEA 1GSHA 1OFGA 3T7KA 3ZQJA 4P53A 3ND5A 2CDRA 5EP1A 2FCAA 4HTAA 2IELA 4US1R 1QNLA 1NI5A 4QQNA 2J0SA 4AP5A 2JHGA 1B1AA 4F93B 3LHDA 5EESA 5IYZA 1PDOA 1BW9B 5BQ3A 4ZHSA 4AJNA 1YKGA 3QIAA 5BRJA 4CCAA 3D59A 3C3XA 3WV5A 2ZIXA 3CRVA 2GTHA 4KXVA 1CJSA 3HSKA 3MC1A 4NKRA 4O4JF 5EFZA 2CWWA 7REQB 3GEDA 4RVSA 5FPTA 3T5TA 3DE1X 5BOSB 1QAMA 2OCDA 1KY3A 1ZK3A 1LVHA 4CMJA 5CCXA 3ICCA 1WP9A 1YHZA 4CT4B 1BCRB 3PZRA 3VGJA 4CXMA 1UZMA 2DY1A 1TF5A 5ALJA 3TRKA 4AYWA 4EUEA 2W2MA 3OP1A 1PR4A 1FSSA 2DX7A 3QG5A 4L2IA 4RJJA 3DCJA 4C4OA 3PE6A 4DW8A 3SYLA 4KE9A 3UK2A 1NG9A 4CEHA 1Z0ZA 4B40A 4COKA 1T9CA 1GZSA 4K3VA 1GGJA 3ADCA 3EHDA 3FTDA 4RF4A 2ZJYA 1QIFA 3FUVA 4MVJI 2UYOA 3GUVA 3AFMA 5G4KA 2MYUA 2C2MA 2DLCX 1K6IA 2YVKA 2MDTA 1T9GR 3IPYA 1GPMA 2RHRA 1I10A 2VZ0A 4AMUA 2ZI6A 2ZLBA 5DHQA 2PR2A 4FP9A 1N2SA 5GMOA 4ZWNA 5ITZB 1LX7A 4E08A 1C1XB 1OLUA 4ND8A 5KVVA 1A7AA 2Z08A 1UUFA 4CCSA 4KX3A 1DAIA 4Z4QA 4HX2A 5ALZA 1Y82A 3R9IA 2JC3A 3K4PA 1X8KA 1C7JA 3STXA 4R1OA 3E8MA 1D3AA 1HDXA 1O94C 5F7ZA 3P19A 3Q7PA 3AF0A 1K5GA 1JHAA 1MB9A 1Y48E 3QYPA 3G8CA 1KR2A 2WVHA 3ZZ1A 1UFOA 1P72A 4D8XA 1I9CA 2MOKA 2JGKA 4DCCA 5CCEA 2R1TB 5DN6D 1PHPA 5TS3A 4L9AA 4LY3A 1T8PA 1HOXA 3ES9A 2ILTA 4HQOA 2P8JA 4OXKA 3VPAA 4BO6A 2E3JA 4FEEA 4OMUA 5BSGA 2W42A 2W2XA 3GMTA 1WKVA 2J5RA 2ZPAA 2LD4A 3LWZA 3VXKA 3PENA 1EVJA 3DQQA 3DYIA 3J7TA 5KVAA 3S1SA 1KVTA 2PEYA 1PBNA 3D8NA 2HCRA 4U2FA 4TRRA 4KRYA 2H9IA 3DO6A 5T4EA 4P38A 3IAS6 1KR5A 4NCHA 1U28A 1P44A 5CLQA 3C0KA 1ZIPA 4GMHA 3G8AA 3WY9A 4F85A 2R4UA 1Q1GA 1YDHA 4MVYA 2JBAA 4M3NA 2ZRNA 3SS7X 4IXDA 4EGJA 1M8PA 3GXOA 1LZKA 4HBGA 3ZGXA 3AKDA 5IAJA 4ZEMA 4KACA 3EVFA 1JFFB 2XB6A 1CRWG 2K7ZA 1AHIA 3EJ6A 4OB7A 3ZXIA 3SXPA 2J46A 2D7JA 3K05A 4K1XA 3HMKA 4LVCA 4MRVA 3CTMA 1KDZA 1VI6A 5AM2A 1UBFA 3ITDA 2G25A 2PRYA 1Y6JA 1DCKA 1IEXA 3QK7A 4I4IA 2M6KA 3LECA 4IIFA 4JAVC 4OX9B 5HIIA 1JDTA 3TB4A 2GKGA 2AK2A 2IGBA 1YULA 1DDGA 2HD4A 3PWTA 4IIHA 3SKYA 3VSDA 4BMDA 3E27A 1P0MA 5J1TB 5E2BA 3ASYA 3DE2X 1IN1A 1MVOA 4AY5A 2JRLA 2OV3A 3C16C 1X14A 4IIXA 2OSVA 4HG2A 3COPA 4D6PA 1EVLA 2ZI4A 3LF2A 1USWA 3OZCA 2FZLA 1M34E 5AW4A 4WEQA 2JIDA 1SXQA 1IHXA 4II7A 4HTFA 3SQMA 4OATA 4YJ3B 4BX0A 4BO5A 5AIAA 2CJWA 1YTUA 2BPOA 3D1LA 4WZBA 3CF4G 4YAKA 4YP5A 4J43A 5K2OA 1PS0A 1UQTA 1Y8AA 1YRBA 3OM8A 2ZIEA 3E82A 3QUQA 4QARA 5JIBA 5TIIA 1G63A 2IHUA 4GEKA 2Q4RA 2VNKA 1FJHA 2GPWA 4RA9B 3BULA 1O8BA 2ZE5A 4UEJA 1FNDA 1P1HA 4FYVA 2Q5OA 4PHCA 5HYVA 4OQYA 3B6MA 2NU7A 2IW1A 2JS7A 1ZY2A 2OM2A 2OZEA 2YVLA 5DM60 4BDSA 4CMAA 1KQFA 1VXOA 4QSMA 3D8RA 4DCSA 5DNDA 1SM4A 1UQRA 4L5JA 2FPWA 4C78A 5LMNB 1NXQA 2AMYA 1OT3A 2H59A 4AG3A 1WETA 3OWHA 1E0DA 3O9ZA 3PV0A 2IYWA 3MJRA 4HOYA 4YJGA 3U4DA 4FR0A 4RTQA 5I5EA 3EZXA 5A05A 1DBSA 4B6QA 1YE8A 4I1UA 2DULA 1C1HA 3P27A 2ZT8A 4FCCA 2FEOA 1RD4A 1MT0A 4JP8A 5LLSA 1EFPB 1MB0A 2ZVPX 1GXSA 3BF7A 4OUDB 5JC1A 4NMLA 4R2MA 1KYXA 4RVCA 5EXPA 3STUA 2JA1A 1G2QA 2E5WA 4F8YA 2PSJA 4ZMBA 2P9YA 3V42A 1M75A 1ZK4A 4ZO9A 3WB1A 1VA4A 3AHJA 4IRXA 4RE6A 2XWQA 1RKXA 4WEOA 2AFVA 5EN4A 3ZDQA 5IEJA 1Q0PA 2F1OA 2XUFA 1I1QB 1SQ5A 2OXFA 3BJEA 3KT0A 3OIWA 4U7GA 4LE1A 4F2PA 4DXAA 4YMWA 4M1OA 1DRVA 4B6JA 1XZPA 2IOHA 3OX2A 3BJIC 2CFSA 1FYVA 3I42A 3R0VA 4BMYA 4P4SB 1A50B 4O4HF 4H3KB 2IYNA 2BZGA 1HURA 1WCV1 1GIAA 1TKCA 4TTAA 3IJ5A 1NQ5A 4FE3A 5FNVF 1JMYA 3A1FA 3OBBA 3PCTA 4RQTA 1JDVA 3X1DA 5KX5B 3GJ4A 2VS1A 3K2BA 2CDCA 1X1CA 3PQDA 1V43A 2CN1A 2Q45A 4JMPA 4OP3A 4WASA 3WYAA 2AG5A 4HEQA 5CT9A 3T41A 1C30B 3T7SA 5I7UA 1E2IA 3NHAA 3IMFA 2NTJA 5TQVA 2QM8A 1GYQA 1QR2A 1XEXB 1DKMA 1FTNA 2F2TA 3BIXA 1NJ2A 1KP2A 2I29A 5HW0A 4BB5A 1KI8A 4CKEB 2A0WA 2QLTA 3AUUA 3EHEA 4RIFA 3I72A 3HCPA 3NAZA 1PU2A 4YP6A 3W04A 2CXSA 2RG7A 3AEZA 3G23A 4RS3A 3UEOA 4ADSG 4LDQA 3JVIA 2V1XA 2NVUB 4EJ6A 4F9GA 3SF8B 4FFLA 2WJPA 3BRWD 4IXMA 1ODLA 3DPUA 1O89A 1MGOA 1GCUA 3AV0B 2D00A 1E9AA 1XD2B 4WERA 2DBRA 3BPSA 3CE6A 4FWTA 1XRRA 3VM6A 4YDRA 3FUUA 2X1VA 4K9PA 3T38A 2OB1A 4B6RA 4BEJA 1NXTA 2QYHA 4HXFB 5G0WA 4MUKA 5GM2A 4B3GA 1XU9A 5F4ZA 4KI7A 3HBJA 1CP3A 2X41A 5CFPA 2C2XA 3BWXA 3WMXA 1JP7A 1ZHFA 3NG1A 4FS3A 2PRIA 4RZXA 5KNDH 1X3SA 3FCXA 3MQ4A 1X7HA 3B12A 1CULC 2B4TO 3HV2A 4P9NA 4ZVSA 5HKLA 5A02A 2Q3BA 1PR3A 3IVAA 1VLLA 1Q1AA 4MWGA 3HKBB 3N8DA 5IH3A 3VBCA 3ZHOA 2D1TA 3CO5A 5HOQA 4TV8A 2CVHA 3JQPA 3RWMB 4A03A 2O2GA 3AI7A 4U9IS 4ZVQA 3D02A 1PL0A 1N4AA 1VJGA 3PRYA 5JSZA 5L7WA 1BCSA 5ALLA 4ZU6X 1VXRA 4R54A 1C4WA 4WN9A 3UANA 1Y6FA 1FDVA 1J0CA 4GPBA 1FOEB 1GV1A 2B3DA 4FGZA 2NXJA 4A0SA 3GLHE 1T4MA 3NC0C 3QPBA 4ZQEA 2RKBA 1SGWA 3D3JA 3S8YA 4PE5B 3CRMA 2HDWA 2FSHA 1GR1A 3VPDA 4FFVA 3EA5A 3N7AA 4PX3A 4UCQA 4MVJD 4J16A 5G2OA 2Y99A 3KR0A 1TKBA 1A71A 2X5OA 4PANA 4FNGA 1VKHA 1WMBA 4K7JA 3ZDFA 4PW0A 4RF2A 4BNLA 1THMA 2WHYA 1ZUIA 3EX7C 2B21A 2I80A 3AJDA 4RKWA 4M0PA 5BQ5A 2QTAA 5LDGA 1HNWB 5CT5A 2DKFA 2ZRQA 3H9UA 3N70A 3ZCXA 2HWYA 1D2EA 2AZMA 5CGQB 3MINA 3UMVA 4EH1A 1V11A 4P4LA 1RXEA 3R6DA 5TVKA 5JU6A 1M5RA 2XYQA 1JAHA 3LDAA 3H1PA 2O48X 1ENZA 3NNDA 4W9NC 5NULA 2WM9B 4NV0A 4DABA 3FMPB 3JQFA 2AFHE 4KN8A 4BNTA 1UC9A 5I01A 4NZ9A 3UVEA 3W8RA 1T9DA 4IPTA 4QUJA 2WJ4A 3REQA 1ZWKA 4JBNA 4NE7A 4L76A 3PS9A 1PG2A 3HP4A 1OXVA 4L08A 4QGSA 2XD4A 5JAIA 5A9SB 2R96A 4EHJA 5DE3A 4QUKA 2W6JD 1OHHD 4MS3B 4MV0A 4P7JA 4DCJA 2IY7A 1JLKA 1ZAKA 2H1WA 3QVXA 1FLVA 3MCTA 4TYMA 4O3MA 1D6JA 1E1MA 1EK0A 2P0YA 3OMXA 1DQPA 1I1OA 3BQNB 4INAA 5ECYA 5CB8A 1VRWA 4TUYB 1AHPA 3OZWA 1NUPA 4D6YA 4ED9A 4IIBA 1M66A 3AEKA 2XKBA 4L0QA 4UHKA 3D5QA 4JEUA 4HQ0A 4PLCA 2PL5A 4R81A 4UJ3A 3TRDA 5JJKA 3EUAA 2GAAA 3Q7EA 1MVNA 1EGVB 2Q3LA 4X6YA 4AJEA 4U3JB 3AM5A 3ENZA 4IIGA 4N3GA 1O2DA 4XAQA 4E4TA 4Q01A 2Y1OA 3ER9A 3AVUA 4L3OA 3N2IA 5EJIA 1YIDA 2MSLA 4Z9AA 1JDBB 1VJ0A 3ADOA 4FGLA 1FNSA 2XZPA 3H9CA 3S1AB 3TL3A 2RAFA 3CNEA 3GZNA 4JBYA 5FV7A 5G3YA 3IJEB 4BVFA 4EFLA 3QHQA 1MIOB 4KQGA 4V0ME 3UB4A 3VQTA 5KTOA 2PUGA 3LLCA 2ZTSA 4AMYA 1Z5ZA 4QJ4A 2PCLA 4U6SA 3IUMA 3MJFA 1PFGA 3LT1A 1Y9DA 5H59A 1ADFA 1N0WA 1ODTC 2R6DA 2ECPA 1SA0A 2WILA 3F2IA 3H2ZA 4IIUA 5J5VA 3S0JA 2X5NA 3PQ4A 4P4TA 5C37A 3KKEA 4OYRA 1LPAB 3IB3A 2BYTA 3QBJA 4PCLA 2WM8A 3T9BA 3VFDA 1NUTA 1WNTA 4BVEA 3QUAA 2ZULA 1Z4MA 3ILVA 2O2XA 4FHCA 3SSOA 1CUIA 1FLNA 1NKSA 2W8ZA 4NFYA 2XXBA 1PNTA 3KXIA 2WHEA 4R6XA 1U99A 2JI8A 3QLEA 4CDRA 5I4BA 2FZ5A 3AJ9A 1KMCA 4EJSA 1TZMA 2WJZB 4HDMA 4MYDA 2IP1A 4CF7A 1PIWA 3VR4D 1J1UA 2GZ3A 4F3RA 4M4SA 3QVJA 4WLUA 4JK3A 1AU9A 2EX0A 2A33A 1NV8A 3IAM6 4ZPXA 5B36A 5HKBA 5CT4A 4OXNA 1Z2AA 3BICA 3GA0A 1VBMA 3ABIA 2MYTA 3MCVA 3R5KA 1TX4B 5DRTA 2GAJA 2ZJFA 3EPLA 1KYVA 3TO5A 1QUEA 2A6PA 3KKMA 3SD7A 3FVTA 2VNSA 3I9MA 4IGIA 4D9FA 5KWJA 5LYJA 2BFEA 2YMQA 2YYYA 3WTCA 2CEAA 3W1VA 1Z0JA 5F5NA 1QV9A 2VAWA 3GCZA 4R9NA 2C9BA 1IY9A 3EG9B 3NBAA 1PR5A 5FBRB 1GFZA 3DVRX 2EBHX 4LIPD 3QY0A 1TM5E 4MW1A 3M2PA 4CMEC 5L3VA 4ODIA 4EITA 3O8CA 3QPUA 3WWZA 1AB6A 2PS9A 4YC7A 2C61A 1U3CA 1GFSA 4GLBA 5DI3B 4BQFA 2R1ZA 1RLOA 2Y71A 1ZA2A 3F2VA 4OB8A 3Q3GE 5HGXA 1Q0ZA 5CX1B 3N87A 4NENA 1E8DA 4YPOA 1PZXA 2I2CA 3CIFA 3CEMA 4QYMA 2OBLA 1J0XO 1E9DA 1ESDA 1YDGA 1RM3A 1PUIA 4YT5A 4C6TB 3MCAA 4RLFA 1MT3A 1BN7A 2Y92A 3WLHA 2BY4A 2WJIA 3U9LA 4ZQCB 3HYLA 2QRQA 4IG4A 4MP6A 4TTRA 4CMIB 2DTXA 4FILA 3T5DA 3C6QA 3FBGA 2BFPA 3R23A 4PIPA 3TSOA 4KQ1A 3OQNA 1US8A 1E94E 5BR8B 4UBLA 4HL6A 3L9XA 2XMPA 2QZZA 2W2PA 3WWEA 3VU3A 3KQHA 1XCOA 5KWEA 2RAVA 2VJOA 4WLFA 3EAGA 4HH3C 3RR2A 3T9DA 3VPHA 1OT5A 1K8RA 2A92A 1NR5A 2GDZA 2QR2A 3BILA 1NBMA 3FYHA 4KQJA 1CZLA 2OESA 4IOJA 4C03A 4OLFA 1BMFA 1JT9A 1ODSA 1PHRA 2MWMA 3ZHUA 1M3SA 2BTEA 1KH3A 4OMCA 1MEJA 5DM0A 5F33A 3MLAA 3VH4A 3TZLA 1MRZA 1DCFA 2AE2A 4D8TA 1MAVA 4DSNA 2V59A 5ITVA 2Z1NA 3RFXA 3UN1A 3PGMA 4C4RA 4B4UA 3ND6A 4Q47A 4KXUA 4RZUA 1OH6A 2OGSA 2NADA 1L7EA 3OCCA 1UJ2A 1UKBA 2Y0CA 4XSGA 4YP7A 4X71A 1FXWF 5AVRA 1ZH6A 3DBIA 1ECFA 4R8RA 1WZ2A 3KX2A 3K0CA 3I23A 5LA6F 5LMZA 1V6CA 4EFNA 3VKHA 1FFXA 1YC5A 5CURA 1ZC4A 3DKVA 5JAOA 4Q03A 1XT6A 1DS6A 2G7ZA 4L73A 1EGHA 2Y1XA 5AM3A 3KT3A 4KFSA 2O7RA 4HFMA 4RA6B 5AOAA 1SKUA 1SQFA 1DP4A 3BJMA 3F6CA 4N76A 2OB2A 4IQFA 3IEKA 1KOGA 5JZBA 4MSUA 3DEZA 1CSEE 3F8TA 3NAQA 3WLSA 1WXWA 2V96A 4MQFA 1FRNA 2CLSA 2DFNA 1R3UA 1GPDG 2X9GA 3W3AA 4PXAA 4EX6A 1GRVA 1K06A 3HGMA 3MWEB 1O95A 1RC8A 1JTEA 4TSKA 5FPPA 4BFWA 5JSYA 1CRLA 2NPIA 2X5XA 2EKPA 5BO5A 3GNTA 1N34B 1XZKA 3NUGA 2IZ7A 3VUEA 3HCOA 2QBYA 1NNI1 1EUCA 1VA5A 2PZMA 3S99A 3K53A 2Z5LA 3UPTA 3LPNA 4G9EA 4G1BA 2CWDA 1E7MA 2HLHA 1GQSA 3GIWA 2ZYUX 5CB6A 3AOEC 3GFRA 4UCFA 3EPKA 4JHXA 3K16A 4G5QA 4GAEA 3YASA 4CKCB 3UJAA 1QP4A 2WZCA 4IMIB 4AJKA 1U2GC 3LKDA 3BGSA 2HXSA 3JQAA 5E6SB 5K3SA 4AWBA 3MQ2A 3P5SA 4GPZA 4UASA 4RDIA 1DC3A 3L06A 4MWSA 3O38A 4FX2A 3EISA 1G2PA 3FE2A 1L5HB 3I9KA 3SIRA 4NXNB 1L3IA 3HHPA 1MN6A 2XLBA 4XZ3A 1N33B 1U1CA 1TGVA 1IM2A 3ND9A 4IM7A 4JX9A 2RGWA 3GELA 1UBUS 3MBKA 1E3SA 3VTFA 5E0OA 4MR9A 5IJ0A 1WULS 4NAVA 3P9CA 3UATA 1GAEO 4AMZA 4D9KA 1GOTA 2QDXA 1GGEA 1YCDA 1YZGA 4DPMA 4EPWA 1L5QA 3V4OA 1Z6ZA 2PJDA 2JGJA 1XSEA 2ZUBA 4YI5A 2BGWA 4J1SA 1QK3A 3OCZA 2JLVA 1TXGA 2BHSA 4DVGA 1IDN1 3ZNOA 4KV7A 4DIBA 2CV1A 2RB4A 2FMIA 1SMKA 4BL5A 1RMTA 3EQ6A 3OX4A 4K9KA 4TMYA 3SC6A 4DIOA 1UBJS 4HUQA 1JZQA 4UXJA 2BD0A 3K9HA 2W2KA 3ONNA 4M7WA 1OB2A 3BBLA 3ZVKA 3ZGOA 2ETVA 4UEQA 2CXHA 1Y3AA 4KGZA 4CYMA 3OC6A 1VM6A 1UIRA 3VHQA 3EIEA 3KYCA 4C0SA 1D03A 2Q1WA 4WVFA 1E66A 3PUJA 3VVMA 2ZBFA 4NC9A 2NUAA 4MR8B 3TW8B 4M21A 5A03A 1WPRA 2JGDB 3GVCA 3RJ9A 1W7AA 2BTQA 3ZW9A 2FB9A 2X5JO 1NTRA 1IZ9A 1ORWA 2WFAA 3HUUA 4LCEA 5BQPA 5HUQA 1Y37A 2F43A 2VSFA 3ZU5A 1EHIA 1YQTA 2QRNA 4CHGA 3FLAA 5H3HA 3BMOA 2H7XA 2ZRHA 4F4IA 1JGTA 1FU4A 1V3VA 4AM8A 2V5VA 3EUWA 3K9NA 3QTLA 4IWYA 4DKJA 4RWZA 4L4UA 5JATA 3REFA 2O2JA 1TK3A 3BL5A 3Q6NA 4IJQA 3IAS1 5DV9A 1OFUA 1VP9A 5FTNA 5LP6F 1HPLA 1NF8A 3CN9A 1MORA 4B3IA 3IDAA 4HEHA 3PQFA 2DFDA 3FPJA 3I9NA 1SUSA 2EARA 3WA6A 1II9A 3AB3A 2WMNB 3VKWA 1HDYA 1QQ5A 1GGFA 4WUVA 2D8AA 4B8WA 2JLYA 2PD4A 3VU1A 5AUOB 1QB7A 3NTQA 4HDOB 5IWCA 1UAGA 1CX9B 4XQGA 4DDKA 4JLPA 1L4KA 5T7BA 3E3MA 1MO2A 2F8MA 4EGSA 1FRZA 4R5MA 5DASA 4LN1A 5B6JA 1JLRA 1UKEA 2EJWA 3FR8A 2AR7A 4NPHA 4Y2PA 4MMXB 1EUDB 3WO0A 2QWXA 3M5PA 3VZRA 3R75A 5LIRA 4MTCA 1F17A 4TWJA 1E3EA 1D6SA 1EXMA 1YMQA 2NZYA 5I9LA 4FYXA 2HHCA 4FEAA 3WMGA 3NEYA 2BKAA 4EDFA 1TZ2A 1U9IA 2C8VA 1WUYA 2P1DA 3BWVA 4Y2GA 3SHFA 4B6EA 4D3YA 5KYUA 5L45A 5BNIA 2FETA 1RLUA 2E4YA 4NFSA 1XNRB 1UH5A 2HQSA 3JQBC 3K9WA 4BP1A 1SXPA 2EAUA 4EK9A 1A3CA 2BJHA 4C20A 1KJYA 4NDNE 3BXGA 3MSCA 3TX2A 2I3DA 2HEIA 2XQVA 4BX8A 1R4MA 2BGKA 2ZB4A 5DLQC 1WDKA 3S2IA 1YZLA 1DKQA 4PC2A 3LFTA 4GYKA 4CR7A 3SHWA 5JS6A 4ILKA 3V7NA 3T7DA 1GZ6A 4DREA 2PH5A 4YS6A 5C1PA 3F6SA 1R8YA 3ABQB 4JC8A 1AE1A 2O59A 2BMAA 4M9RA 4BNKA 1C14A 5K6AA 5F9HA 3HSYA 2ZRFA 2R44A 1DZ3A 4FYIA 3FSJX 3B13B 5H9WA 1I4OA 5AJZA 3FPCA 4MVJM 3LTEA 2WNIA 1HYBA 3MWKA 3A0RB 4Q21A 2W6NA 3K9QO 4TOIA 2QL5A 5LWQA 1QGUB 1B6RA 2VSXA 4J0KA 1X8JA 3ZE8A 4WA8A 3FSGD 2XOKD 2FUG1 1Y1SA 4P2BA 2WSMA 5AI9A 1KAMA 4QREA 5TPWA 3TTSA 2AYXA 1G55A 1BC5A 1RYBA 2C98A 5FA5A 2BDTA 5FTWA 3MRVA 2GXSA 2OHJA 4ZVVA 2J0UB 4Y1EA 2DUUA 1NIPA 1Z28A 1QYWA 2QU7A 3ODPA 4A0GA 4CKXA 4D43A 2JF0A 2EP5A 1L3BA 4YJ2B 3U62A 2J0QA 3H7IA 2VQ3A 3FB4A 3FKSD 3IS3A 4MW6A 4Q66C 1QVRA 5CFMA 3ABRB 2PTGA 2R7KA 3ZZ0A 1D9XA 4HNUA 4V38A 1NNLA 2CUTA 4RZ3A 1PD0A 2CJFA 1OBCA 2R85A 2X2PA 4GVXA 1FS5A 1S8AA 2AS0A 3L4BA 2RHMA 3G1TA 3PBKA 3QXGA 3KJIA 3AFNA 4HVTA 4P54A 4UBJA 1JKIA 1RS0A 1C8BA 4YXWA 3E48A 4IOLA 5BN4A 4KFUA 3LA6A 1YA6A 4D79A 3TIIA 1D0VA 4D02A 1ZK1A 4E3WA 1FS6A 2NU9B 4I5GA 5AVTA 1EQUA 1NW8A 2PJZA 3G9UA 2ZKIA 3KZNA 1J0DA 1UEIA 4N40A 5JZSA 5LQSA 4CM9D 2H65A 3PZBA 3IMGA 2Y1GA 3JXEA 4CR8A 4D9HA 1YMUA 5I47A 3G2LA 1D2GA 1P80A 2YN0A 4YRPA 5IH7A 3KLMX 4OHMA 5AM0A 4QPPA 1I4WA 4IL5A 4DOMA 5E9AA 2PT9A 3P96A 4IGAA 3VHRA 5H16A 1N5JA 2A86A 3EWAA 1G0NA 4HXEB 1W1IA 1I80A 3EBPA 3GAMA 1XLVA 4KMSA 3HO6A 1LBTA 2OVBA 3K09C 2XB9A 3HBLA 5I7RA 3DDOA 1U8ZA 3I2IA 3R3YA 3RIEA 5GIPE 3OQ6A 2I65A 4MI9A 3LRXA 3P0RA 2ORWA 4TWZA 3EZ2A 2I99A 1BJRE 3TDNA 4E09A 5SICE 3THSA 1N3LA 3W2TA 5HQTA 4KWHA 4PTLA 2Y05A 1VZ3A 1YS1X 3T3HA 3C7DB 4ER0A 1QYDA 2X19A 4LW8A 3FZQA 1NIJA 2AC7A 2GBPA 5CBPB 3FHJA 5LLDA 2BKVA 2D2VA 2GVDC 2B4YA 3Q7RA 3WDSA 4RXMA 2PL1A 3T06B 4EMTA 5F2KA 3MHPA 4WK4B 4PYMA 3T54A 5FX2A 1CJBA 2HN9A 2GPAA 4G23A 1FP6A 2ZIAA 4I3FA 4XJSA 3STVA 3EQ2A 3N2EA 3FDZA 1E2KA 5FJJA 5IM5A 3S4YA 4PGHA 1CV2A 3WAJA 4YH1A 3A04A 5IBCA 1G38A 3S28A 2JCYA 1KMMA 2FE4A 3T15A 4ZQFA 5T5QA 2LRHA 5I3ZA 1Z0SA 3ANLA 3C6YA 1DI0A 1JQ3A 2IZ6A 1QIEA 2C3OA 5ER9A 2ZYSA 3EDQA 3OQHA 3U7IA 2V7VA 3LPMA 3SZGA 3W6NA 4O8ZA 3ZY4A 2BFDB 1C9YA 1II0A 2LPMA 1RQ2A 4I55F 4JD5A 4KXXA 2A94A 4Q4AB 4HDCA 4WJKB 3UV6A 3VA7A 4Q6BA 1Y9ZA 2X58A 2AD5A 1QGYA 3DOOA 1B26A 1EFHA 1FFAA 3F5FA 1N25A 4LY0A 3NH9A 3DE3X 4CG0A 4C30A 1TPYA 3TOCA 3I5AA 4MQ4A 1GD1O 3IDFA 4Y2RA 5KYKA 2WRZA 3PC3A 3KJQA 2R5FA 1J56A 2YV1A 3CR8A 3FD8A 3NM5A 5I9IA 2BLLA 3JASB 3OSZA 4I5EA 2P2YA 3PPIA 4LZJA 4P3OA 4ZAGA 1G7SA 1WL8A 4RPCA 4KOEC 1LVGA 4E5KA 5MFZA 3WMWA 4ZQHA 2WSIA 2ZSUA 3KHKA 4QDJA 2Q8NA 1RWQA 3ZN2A 1D09A 1IJEA 2XV1A 5A7HA 3SAJA 3T8YA 4AO7A 4JJGA 2ZUVA 1CY7A 1XQXA 3WQQA 3QLTA 4A92A 1CJVC 3KEMA 3BRQA 2KWIA 2P78A 1EFUA 2FRVA 4H77A 4M0DA 1LPBB 4P6VF 3SXUB 2P6PA 4HWOA 4JXZA 1I3OA 1W581 1DTEA 2EW8A 3HA5A 3LP6A 3UCFA 2HJ9A 4F5EA 1Y6GA 3EIUA 2QMEA 1M2WA 3SICE 5D86A 4LXXA 1THGA 3AERA 3OWXA 3KQPA 2EGUA 4FINA 3N7UA 3HWRA 5B4TA 3ULKA 1UC8A 2QRVA 2YN2A 5CDGA 4KREA 4HT3B 5CDTA 4YJKA 4FJ1A 5EHIA 5C46F 1A4RA 4B5LA 4TMZA 3RQIA 1Q2UA 1G3UA 2JFWA 3P32A 3OJXA 5K9ZA 1AG9A 1T9HA 1I5RA 1D04A 3BWBA 4MUIA 1E2NA 4JI1B 2JCSA 5LFAA 3G85A 5DM70 3KTAB 3M7IA 4GP6A 5DSXA 2PS1A 3KEOA 1CR2A 4XUCA 5K0BA 1BS1A 4UNQA 1P2UA 3CX4A 5FQNA 1T5SA 1XXHA 4C2AA 4D5GA 2G17A 3HA2A 3ZDDA 1H4VB 3TAXA 3DR5A 1XRNA 2DXIA 2ZIUB 3SX2A 1GZ3A 1Z25A 4FMCF 2P9ZA 1F1JA 1ZXXA 4QLOA 3L6EA 2D06A 3QITA 3RK1A 3W8FA 4YT4A 4K88A 5KMGB 1J8YF 1OTHA 1LCIA 1Z0KA 3AVOA 4FT4A 4YV1A 2LW7A 4RK4A 4ALKA 4EYGA 1Z38A 2IPNA 1ZZGA 2IFTA 1HDIA 1F8YA 5M2QA 3VR2A 2JFYA 3E4DA 1OR8A 4H7EA 4BO2A 2BI8A 3QVMA 5JDIA 1E7WA 3F96A 3NT2A 1OY1A 3BMXA 4ZO8A 3TLAA 1Z2CA 2GLXA 1XQ6A 4G81A 3KZ1E 4LYHA 1JFSA 4AY2A 1U7HA 3DDSA 3GH3A 3H4TA 3EZYA 3FYUB 4R3UC 2W6OA 2VP0A 4W1RA 4I36A 1PNOA 2DQZA 1U6JA 3U19A 2G6TA 4LZWA 3HCDA 2WWXA 2WJYA 1WUKS 3HO1A 5DPMA 1Q74A 3QKSB 4BE7B 5JD6A 121PA 3ONFA 4KLAA 4UZEA 2P35A 3TN7A 1ZM9A 3ZI7A 5AKZA 3VPGA 4UU1A 2WD7A 2C1EA 3QKRA 2OC9A 3O8LA 4I6EA 3LFHA 2JJ2A 1PG0A 3R3JA 4F1KA 1Q20A 4RQUA 3KQOA 2XRMA 3RVQA 1RWXA 2I1WA 4FDAA 2FR8C 5B64A 3HACA 5EJ8A 1ID8A 1GVNB 1OI2A 2OZPA 5I4CA 5K8CA 2A5FA 3V8NA 4GX1A 2D54A 5COAA 1RRPA 3SFZA 4NS4A 1OA0A 2BFBA 2IP2A 4UXIA 4CZ2A 3R3XA 5LZ2A 1DWOA 3KKNA 3MUNA 4G1MB 4D42A 5IXYA 3DXFA 1OH8A 4WOKA 2Z30A 1MABB 1E3IA 1M1YB 2GLUA 4H6PA 1K5PA 3JQ6A 5DGCA 3B82A 1HZZA 1D0IA 1KIAA 2PYDA 4K26A 5JHGB 3GY0A 4LRTB 3R8FA 2GO7A 5JAUA 2QG6A 3L3BA 4V0OA 5HF9A 2WI8A 1V3TA 1J0EA 2P0AA 3TE6A 2GFHA 3ZLVA 3BQMB 4DIFA 2G9NA 4EI9A 5BW8A 3EG5A 3RAFC 2CXQA 1USIA 3M4ZA 5FJIA 5LXTB 3DZFA 1CG6A 2OSBA 3IAXA 1YZTA 4PAGA 4UUAA 3L1VA 3PB3A 4ZDJA 4KKVA 5JSQA 3MS2A 2YXDA 4QL3A 2CNWA 4BMSA 2OBNA 4DLUA 2FOIA 3DSRA 4FR5A 1QAQA 3T5CA 4U8HA 2ATIA 4OU4A 1E5VA 3LKZA 3SJAA 4JP5A 1L5LA 4Q3EA 3C4JA 3E1SA 2R6AA 4PPFA 1M34B 2QSZA 1Z6PA 1EX6A 4YDHB 3T3EA 4CIYA 3D8SA 3ITKA 2M32A 3KKKA 2ZSHA 2CF6A 2PA0A 3JAMA 3RUEA 2Q9UA 4YROA 5DHTA 2PAFA 3L1JA 4NJMA 3JAWA 3SVTA 2C9CA 2VZ8A 2C20A 3F7OA 5KYWB 2J6IA 1DV1A 1RP7A 1SULA 1Z0IA 3IIEA 4YK7A 4X7RA 2Q4OA 3W7BA 5JNTA 1C8KA 4MYTA 1ISGA 4MQUA 3K0HA 2VDMB 4G01B 3D0KA 2CXUA 1YRWA 3R7AA 2WMYA 3AH8A 4PLGA 2XVAA 3O1JC 2NPFA 3RUPA 4NH0A 3QBDA 4DUGD 1MC1A 3PIRA 2V7QA 1BIFA 1YQ9A 2IEDA 3PDIB 5D5HA 3NAMA 3B9BA 2DPYA 3O4HA 1Q2XA 1TO1E 1ND5A 2BW0A 2GUGA 4PV7A 1HLGA 5KNBH 3EASA 4RD6A 1P7WA 3FVWA 3DMTC 3L84A 2FZKA 4AJ4A 1J23A 2VAXA 5IJAA 2PBRA 4OXIA 5GIOE 4A8PA 3L43A 2W2LA 3SGLA 5SYMA 1U5BA 2EC5A 4NZZA 4I81A 3VO9A 1MV8A 1YOVB 4KSYA 5IC5A 1YA8A 4RPHA 1Q19A 3FETA 4U2KA 1FX0B 2O0MA 4RAOA 2XAAA 3TLZA 4BO8A 5AFSA 3RSSA 4AZTA 3O92A 5DRYA 2Z4RA 1MR3F 5ETJA 4B4OA 2PPLA 1QSGA 3L8YA 3EGIA 1DXHA 4JJ4A 5HIJA 3K9GA 2ZWVA 1P5FA 3EB9A 4ND1A 1TYEB 4HWRA 4R8KA 4CNBA 3RVDA 3RS2A 2ZUFA 1XZCA 3M1LA 3O1LA 2P9JA 1KARA 4OBWA 2YZ2A 4O2BA 1G2OA 3PFWO 5IAOA 1EESA 1NR1A 3B3QA 1DEKA 2NMVA 2VHJA 4MX8A 4DA6A 2Q41A 3GGJA 3K0FB 5B3JA 2A3RA 1VHDA 1SQGA 2HOQA 2NXEA 3C74A 1VLHA 2VP9A 3A1SA 1WMEA 3FLMA 3ZDZB 2C78A 2OK8A 3OZTA 1MFZA 2GA8A 3RFVA 4E30A 5ES4B 3KYDA 1YIAA 1EWKA 1ZZEA 2WLTA 4TTQA 2JK1A 2IVZA 2C07A 1E3WA 3CH4B 1M8GA 1I3NA 2TS1A 4Z0HO 2IBTA 1OXBB 2H8GA 3K72B 1S7GA 4IFEA 3RHFA 4UUBA 4AU1A 4FHFA 1ISIA 2LXNA 1DU4A 3OF5A 5EZYA 1FSPA 1PZNA 3NPMA 4DSAA 1B3BA 3EXHB 3FWZA 3ODGA 3E1KA 1RYEA 1CUVA 1FLDA 5B1DA 3QSGA 5B6IA 2Y1WA 3OKCA 3E03A 2FK7A 2HSZA 4QO8A 4LSWA 2VJPA 3S40A 5AW1A 4ZEVA 2CMDA 1IPFA 4HMOA 1AVTA 2WY2D 5JXWA 1ZH0A 5TMDA 3OQIB 1UDBA 4MW7A 3ABZA 4GZ6A 1UADA 4BQOA 3QELA 1ISHA 1ZQ1A 4RHEA 3RJTA 2GK6A 4BNJA 4DR3B 2PGNA 1LD3A 1E1DA 5BMOA 3LY7A 4LI3X 1Y8ZA 2XGMA 4EBBA 1VTKA 4S3MA 5AVWA 4REQB 4PBTA 2H1VA 3NO4A 1ZI8A 3QHAA 4GF5A 1FXUA 3WKDA 2VJKA 5MFPA 3TOXA 1MZVA 3P2YA 4DJ5X 3NAGA 3GLHB 3I6BA 4JBHA 4KFRA 2J9FA 3C4QA 1NJSA 1FDSA 1XZIA 2Z98A 1KEZA 3H2KA 2DC1A 4QUDA 4N1AA 5C34B 5TQ0A 2VOJA 1PZHA 5ALYA 2SECE 1JJBA 1NG1A 5FR1A 1GA4A 3AR6A 3U3XA 4ZAVA 2QD4A 3W4KA 4BO0A 4YCNA 1OU4A 1JWAB 3KBBA 4CG3A 5LR6A 1N77A 1NDHA 1KU6A 1Q0TA 3C70A 1TVEA 4WZBE 1ZNZA 2X3FA 2RH5A 3CXRA 1UFRA 3RGWS 1NVVR 3RSLA 5KNDA 5HP4A 3F6YA 4TV8F 3PJRA 3QM1A 1RKQA 3T3MB 2RGUA 2HJHA 2W6CX 3U3DA 1BE8A 3K4HA 4B0PA 3CRQA 4TVKA 4RTOA 1RAAA