1LPMA

A structural basis for the chiral preferences of lipases
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
534
structure length
534
Chain Sequence
b'APTATLANGDTITGLNAIINEAFLGIPFAEPPVGNLRFKDPVPYSGSLDGQKFTSYGPSCMQQNPEGTYEENLPKAALDLVMQSKVFEAVSPSSEDCLTINVVRPPGTKAGANLPVMLWIFGGGFEVGGTSTFPPAQMITKSIAMGKPIIHVSVNYRVSSWGFLAGDEIKAEGSANAGLKDQRLGMQWVADNIAAFGGDPTKVTIFGESAGSMSVMCHILWNDGDNTYKGKPLFRAGIMQSGAMVPSDAVDGIYGNEIFDLLASNAGCGSASDKLACLRGVSSDTLEDATNNTPGFLAYSSLRLSYLPRPDGVNITDDMYALVREGKYANIPVIIGDQNDEGTFFGTSSLNVTTDAQAREYFKQSFVHASDAEIDTLMTAYPGDITQGSPFDTGILNALTPQFKRISAVLGDLGFTLARRYFLNHYTGGTKYSFLSKQLSGLPVLGTFHSNDIVFQDYLLGSGSLIYNNAFIAFATDLDPNTAGLLVKWPEYTSSSQSGNNLMMINALGLYTGKDNFRTAGYDALFSNPPSFFV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LIPASE
publication title A Structural Basis for the Chiral Preferences of Lipases
pubmed rcsb
source organism Candida rugosa
molecule tags Hydrolase
total genus 190
structure length 534
sequence length 534
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 1995-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00135 COesterase Carboxylesterase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1lpmA00
5C8VA 2XMRA 2R8BA 4G9EA 2HIHA 4HZGA 2VATA 4Q82A 4FLEA 1ACLA 4MEBA 3STVA 2Y6VA 5JAPA 3AJAA 3LLCA 1Q84A 4L72A 4Y2VA 1N5MA 1THTA 4ARBA 1LPMA 2X76A 2O2IA 2Y2VA 2OQIA 4BTVA 1IZ8A 5FUMA 3WJ2A 2XQKA 4X91A 4CG3A 3FAKA 5ALHA 5D6OA 3A2LA 4JUIA 3EF3A 4P92A 4F0JA 1CUBA 4DSZA 2WUEA 1FFBA 4E14A 4G1FA 1H2YA 4TVKA 5K3EA 4CI9A 3V1LA 5E4YA 1EI9A 3VXKA 1Y7HA 1TK3A 5AM1A 2QTBA 5C81A 2AJLI 3W05A 2WFLB 5LKRA 1HBJA 2Z8XA 4HRXA 4Q05A 2C4HA 2W6CX 1BRTA 1DTEA 3G9UA 4H0CA 4FWBA 5HCUA 2WUFA 3DL7A 4J3JA 2FX5A 1ZIYA 1XZAA 4C4YA 3U0VA 2CEKA 3I6YA 3I2HA 3B3QA 5DYTA 5A7HA 3F8SA 5HQ3B 4KE7A 2ZYHA 2JEYA 4S0XA 5AI9A 3BIWA 3H0CA 2WIDA 3KXPA 1XRPA 3DOIA 2J3QA 1HLGA 5EIAA 1JJIA 3D2CA 5DLPA 4B80A 2V97A 1ZGCA 3IULA 1YA8A 1GT6A 4ZXFA 3AIKA 5DTIA 1VA5A 2BAGA 4BAGA 3C6ZA 4ZREA 3WL6A 2C0PA 4OD0A 1DWPA 3H04A 1THGA 2XLBA 1ISPA 4C89A 4CCWA 4MWSA 4XWGA 1UK9A 4Q34A 2C58A 1GKKA 3HZOA 3G7NA 3AZOA 2ZJ7A 5ALKA 2OQVA 4FNMA 1AUOA 3C87A 1LPSA 4OSEA 5KBYA 3O4JA 1EA5A 5JADA 3WKCA 1MNQA 4HXGA 2CB9A 3HEAA 5AKKA 1SCIA 1KU0A 3AIOA 5FXMA 2I78A 1LLFA 2V9ZA 4BZWA 4X6UA 3BDVA 4NVRA 4H35A 3DKKA 2QOEA 3IA2A 2DHEA 2ONCA 4GI1A 3OOSA 4BYMA 2HL6A 5CT9A 3FYUB 2HRRA 3OTQA 3WYDA 1CUEA 5KREA 4LYDA 3EIOA 1LPOA 2WG1A 2XMBA 3TEJA 4H7IA 5AKEA 2PU7A 3KWJA 1VJ5A 3F96A 4B0OA 1TAHA 4J0IA 2XMGA 2OG1A 3PUHA 3FOBA 1CUWA 4AZ3A 3E3AA 5JYCA 4BVKA 5AOBA 2GBFA 1CRLA 5H3HA 1WHTA 2IIVA 4KE6A 4E15A 4C87A 5SYMA 5A2GA 3H18A 3WK8A 4A5SA 2LIPA 1M33A 2WUGA 2HU5A 3QBJA 1VOTA 4WFKA 2WILA 4UUQA 3V1NA 4KJXA 3PI6A 2XMZA 4Y2RA 2XUQA 4BTLA 1LNSA 5ALDA 4BCDA 1YS2X 2WM2A 5BWBA 2H7YA 2HA7A 5DJ5A 2BJHA 2VEOA 1WB5A 2WKWA 5AK6A 2P8SA 1FFDA 2QVBA 4W63A 3H2GA 4Y2TA 1F8UA 3G8YA 3WJ1A 3RKSA 5ALUA 5LZ2A 1K4YA 5AOAA 3HRHA 5EGNA 3GZJA 4BC1A 4C4ZA 5AKZA 2B61A 3X3HA 5JAOA 1BEZA 1NU6A 4ZRDA 4XVCA 5ALRA 4OCZA 5JASA 1VKHA 3I6MA 4DMCA 3DKRA 5HK8A 4GXNA 1DWQA 4RGYA 4QDOA 3W04A 5JD4A 2WU3A 2JBWA 1CEXA 3ZWQA 3ESCA 2Y6UA 4QDZA 1QIGA 1XQXA 1EX9A 1LGYA 2QMQA 3WWEA 1CR6A 5AM0A 1XKTA 4QDUA 1E8MA 2Y1KA 4EHBA 5JAHA 3WMRA 5EIHA 3QVMA 3C8DA 4OB6A 1VZ2A 1XRRA 3N0TA 1G5FA 2XLCA 5C8ZA 3F9CA 4UBOA 4FMPA 1UOPA 1F6WA 3R3UA 3WWPA 1XLUA 3IUQA 4LXGA 1CUHA 4DM7A 3F98A 3FLBA 5A6VA 4TGLA 3GBSA 2WSLA 3V48A 1DT5A 4JH0A 3E0XA 5K3FB 1CQWA 1YAJA 4HAIA 3N2ZB 1S8OA 5D7BA 5YASA 3R3WA 5LZ5A 3STWA 5DYYA 1MU0A 5K5EA 3C6XA 1CUXA 1EH5A 1ZI6A 1DQYA 1G66A 1YSCA 4JNCA 5LLSA 2JGFA 5EHZA 4BP8A 3SWWA 1U2EA 1C7IA 3KDAA 1XZEA 3NWOA 3D7RA 4FHZA 1N1MA 1KEZA 4Q3LA 2IX9A 1UKCA 2WIJA 5ALSA 5EHNA 4KRXA 3M83A 3G0DA 1IUNA 3PICA 5IVKA 1A7UA 1WPRA 3IIIA 1CUCA 3V1KA 3V9AA 1F0NA 1T2NA 2Z8ZA 1UZAA 2ACKA 5ALZA 4GWLA 3AUKA 3DYIA 4FLMA 2XMQA 3AFIA 2ZYSA 1EVQA 3QPCA 1EDBA 2WHQA 1XROA 5EI5A 4J7AA 1XLWA 5AKYA 1KU6A 4B7ZA 3I2JA 5ALJA 2VJAA 1WM1A 3K6KA 3SC2A 1QJ4A 5HF9A 4X90A 3WWDA 3PDCA 4B82A 3DLTA 4W1SA 4N5IX 3A70A 3O4HA 4PQEA 1ETHA 5AK4A 2WJ3A 1K8QA 5DYWA 4BE9A 2WG2A 2WTMA 1QFSA 4UBJA 4X7BA 3NOXA 1LPNA 4WJLA 5JZBA 3GELA 1IMJA 5ALIA 4C6HA 4J0HA 4XJVA 1XKLA 1AC5A 1JFRA 4BAUA 2G5PA 1RYYA 1ORWA 4O08A 3H1BA 1R4ZA 3HC7A 3I1IA 3ICWA 4C01A 2YASA 3C45A 1UT6A 3G9XA 5HKBA 3DNMA 1R50A 4WDQA 2H1IA 1IZ7A 3D4LA 4IH9A 3D3NA 2YH2A 1MJ5A 2GYWA 1FSSA 4HVTA 4J0GA 3TJMA 4ROTA 1TCBA 2WUDA 1E66A 5FPQA 3MUNA 5K3AA 1X2EA 4W1PA 4GLBA 4MYDA 3QZUA 4AXBA 4PV7A 3A2MA 4FTWA 5HQ3A 4UHCA 3HACA 4M0FA 3PFBA 1CUSA 4B6GA 5T4HA 3C8HA 5AP9A 4OYLA 4QA9A 1YB7A 4PSUA 3VJMA 4YK7A 3VJKA 5ALLA 3JWEA 4V2IA 1HDEA 1XZLA 3G0BA 3DOHA 5ALEA 4BRSA 2ROQA 3C6BA 4I3FA 4F21A 1HPLA 1W6RA 5KWJA 1VLQA 1E5TA 3ICVA 1E89A 2RIPA 4FDMA 4AN0A 4H7FA 1ODCA 1AX9A 1J2EA 1JJBA 3O4IA 3FSGD 1K5PA 5AKLA 2VA9A 4J0DA 1VXRA 2YXPX 4OPMA 3PE6A 1ZICA 4QZVA 4H7KA 2QZPA 1PJAA 4H7EA 2FJ0A 2PM8A 2HA0A 1YB6A 4H18A 4FFVA 5CRIA 3G0CA 1B6GA 4P93A 2HU8A 3PF8A 5IVIA 3WYNA 4Q1VA 4MYSA 1CUYA 2BUCA 4KYVA 1MAAA 1UK8A 2OCLA 5LIPA 5SYNA 1MNAA 2I3ZA 3EQ7A 1HKHA 5D3KA 1QIJA 5AO9A 3O0DA 3FYUA 4EB0A 2XT0A 4G4JA 5CBKA 4CFSA 3E4DA 3WA7A 2Z3WA 3W2TA 1Q0RA 1BN6A 1ACJA 4H7DA 4BC0A 2B4KA 3I6ZA 3B5EA 4DGQA 1LBSA 3DD5A 1UOOA 4FOLA 2JGIA 3IVMA 2QJRA 1JMYA 2VTVA 2O2GA 3F67A 1UK6A 1XRQA 3UUFA 2HA2A 2OCKA 1AZWA 3WKEA 4PO3X 4Y2YA 2VJCA 1ZGBA 1R9NA 1AKNA 2G4LA 1TQHA 1MN6A 1QIDA 4Y2UA 4AO8A 3H2HA 2QJWA 1TKRA 4Y2JA 2OXEA 1U4NA 4U2FA 4QDXA 4BDTA 4FLFA 1YASA 2XUGA 2XI4A 1QONA 5K3DA 4A16A 5AM5A 3WWCA 3LS2A 4IH1A 1LZKA 4J0KA 1UFOA 4UHDA 3FVTA 3PF9A 5FPPA 4AB1A 4G8DA 1FFCA 2BFNA 2XMCA 4J0CA 1A8SA 4INZA 1DINA 1I6WA 1XRLA 2J3DA 2WFZA 4ZV9A 1ZIXA 3W06A 2DQYA 1CLEA 3C5WP 1JT2A 4LXIA 4X92A 5AIBA 2YYSA 5BV7A 1CUZA 4UBLA 1OILA 1YCDA 3EBLA 2VT7A 1QIFA 5FP0A 1UWCA 2PBLA 3WL7A 1QLWA 2G63A 1MX1A 1P0MA 5JD5A 4D9JA 4JEIA 2J4FA 3S2ZA 3CN7A 1NU8A 1CUDA 1LPAB 3CN9A 4AMYA 2RHTA 3H2IA 1QO7A 4G5XA 1WPXA 5K3BA 3SK0A 1Q0ZA 5LKAA 3I2IA 2ZJFA 1B41A 4FKBA 3BE8A 1P0IA 5AOCA 3ZPXA 1D07A 4WCVA 1TCCA 3T4UA 1EK2A 2GYUA 3AZPA 1DX6A 2BGRA 2EEPA 4WFIA 2ZYRA 2QXTA 1UK7A 5K3FA 1R88A 3OM8A 1EDEA 3ZV7A 1USWA 4G4GA 4N8SA 5A71A 4EBBA 3G0GA 2G5TA 5AI0A 4AMZA 3KSRA 1SC9A 5I9IA 4F5ZA 4DNOA 1UKBA 3I2FA 3RM3A 1A8UA 1CUAA 3TGLA 1CPYA 2H9YA 3GUUA 3QYJA 2CUTA 3HI4A 5CTAA 1Y37A 2OCGA 3R40A 2CBGA 5IKXA 4GW3A 5JZSA 2DCMA 2PVSA 5AM3A 3ESBA 4KR0A 3FCXA 2JGMA 4I19A 3WZMA 1XQWA 3JYHA 4QNNA 2XMSA 3JW8A 1IUPA 1IVYA 2JGKA 2QM0A 3PFCA 2H7CA 4ZV7A 4WY8A 3RARA 4QE3A 1FFAA 4MXDA 1UKAA 5AJHA 1O6FA 2WTNA 1QTRA 4ZWNA 4KAJA 1BROA 2Y2UA 4PF1A 5LYYA 1DX4A 4GECA 1AGYA 1JMKC 3T52A 5AHXA 4UFNA 1N8SA 2BGNA 3QPDA 4H7HA 4C4XA 5JARA 3V1MA 4LYEA 4Y2XA 1YR2A 2RHWA 3QMVA 1JJFA 2AJBA 4CIAA 3G9TA 3MVEA 4OB8A 3NUZA 4IH4A 3BDIA 1CVLA 2HDWA 4OYYA 5EHQA 2XUIA 2GBGA 5CH3A 4GDMA 1LZLA 1QOZA 1SFRA 2HA6A 4X3CA 3WKBA 1Z68A 4B83A 2VAXA 4C88A 1VZ3A 2PKYX 2XQIA 4G8CA 4HS9A 2CZQA 2XQGA 5JALA 5E4TA 3FLEA 2BUAA 3ZLVA 4EY8A 2VJBA 5J3JA 3STXA 3R41A 1H2ZA 5DNWA 1O6GA 5AK5A 2OLEA 4N5HX 4BVJA 2ZJ6A 2RGUA 4ZI5A 2XQFA 1QZ3A 4NS4A 3ZLTA 3LP5A 4U2CA 2ZSHA 4FNGA 1P0PA 3P2MA 4G9GA 2PSEA 4UBMA 5DWDA 1X70A 2IITA 2WIFA 5AM4A 1ZI9A 5CH5A 3SX4A 5AKXA 4PSDA 4AX4A 5JAUA 3DCNA 5CT8A 4AO7A 1GQRA 5AKIA 3QMMA 4LIPD 2ECFA 4CG1A 1CIJA 1CV2A 4DTCA 2GYVA 2RONA 1H23A 3STUA 1LBTA 1XFDA 2PL5A 2GZRA 1DT3A 1L7RA 4L3WA 5CT4A 3H1AA 4ETWA 3M81A 4DNPA 2HRQA 1EXWA 3IURA 5BWCA 1TIBA 2QT9A 1U8EA 2ES4A 1FFEA 3G0IA 1J07A 5LZ8A 4AZ0A 1AMNA 3HSSA 2OGTA 4Y9SA 3EQ9A 1SCQA 4FBLA 2O2HA 3C43A 1JU4A 5T4EA 1VE7A 5HFAA 4KE8A 4G4IA 1GQSA 3HLKA 4MWTA 2HA3A 1WHSA 5ESRA 3WQHA 5FRDA 1DU4A 3WIOA 6YASA 3OG9A 4X85A 3BIXA 1VE6A 3WLAA 2O7RA 2WFMA 3FCYA 2AJDA 3A2NA 1XZCA 4DSAA 5HK9A 4GHWA 3LIIA 3WWOA 3IUMA 3G02A 2OAEA 5ISMA 4BVLA 1A88A 3E1GA 4BZZA 1ZD4A 2WIKA 5JATA 4NZZA 1ODTC 5A7GA 4N8DA 2HU7A 4KAFA 1E3QA 2B20A 4J03A 2E3JA 3RK4A 2BKLA 2JIDA 4LXHA 3BF8A 3STYA 2PSFA 4L9AA 4DMKA 1MTZA 1T4MA 1WCYA 4Z49A 2WIGA 3F97A 1NX9A 4Y7DA 4QDTA 3O4GA 4W1RA 1WB6A 2AJCA 2K2QB 2PSJA 3ESDA 2Q0XA 4UBKA 3WK4A 5A7FA 1JKMA 5CXXA 3WK5A 1XRMA 2ZVDA 3FSGA 1TRHA 3I28A 3WIBA 3GROA 5ALWA 4F60A 1X2BA 3IUJA 3GA7A 3ED1A 3DQZA 1YAHA 2EDAA 2Z3ZA 5I7UA 1ZOIA 3DL4A 4UHBA 4U2EA 2QUAA 4BCCA 2XMDA 2I03A 3FYTA 3M3DA 1GXSA 4U2GA 2PSDA 4A23A 4MEAA 2PUJA 5IVDA 1ZD5A 5CMLA 2VJDA 4JYMA 2JF0A 3D2AA 2GBCA 2D0DA 1EHYA 4H7JA 3H2KA 5I8PA 1XZBA 1E8NA 3PUIA 4ZGBA 1BEEA 3VKFA 4CG2A 3D2BA 5AKJA 5ALFA 5LZ9A 2XUJA 2CMFA 1QGED 1EINA 1XZGA 3KOOA 3STTA 2HFKA 1BCSA 3H19A 4YASA 2NW6A 4EY6A 1C7JA 2FJPA 4QWWA 2WLSA 4W9RA 1R9MA 2QXUA 1ODSA 4QLAA 1VA4A 3MUOA 3VDXA 1XZHA 2VT6A 3Q8WA 4EY7A 1AURA 3A6ZA 4HRYA 3DDUA 3TRDA 4BDSA 4BCBA 3FLAA 1QE3A 3WKAA 2VAVA 3I1YA 3VVMA 3H2JA 5IVHA 3WK7A 1QIEA 3WKDA 1AQLA 1XQYA 2CJPA 5HF6A 3RLIA 2ZSIA 3WK9A 2OGSA 4B9EA 3ILSA 4IO0A 4M0EA 4KAAA 3QM1A 4FBMA 3W9UA 5FOQA 4TPKA 2RI6A 2XUHA 3VVLA 1XZJA 5HF8A 3ANSA 3AINA 3NGMA 3C5VA 4UBNA 3ANTA 5HF5A 5ALOA 2JGJA 2VF2A 4RPCA 1JI3A 4BAZA 1HQDA 2FUKA 3IB3A 1H2WA 1MT3A 4B84A 1SOMA 2PPLA 3K2IA 1TCAA 1MX5A 4GBGA 3Q0TA 1XZDA 2OPHA 1YS1X 3HABA 4UHHA 4YX9A 2XDWA 5JANA 4UFOA 4WFJA 4EY4A 2WJ4A 4ARAA 5E4JA 2WJ6A 4HTAA 2HHAA 2C5FA 1SCKA 3D0KA 3FBWA 2V96A 4BP9A 5CH8A 5FKJA 2PSHA 3WK6A 2HM7A 1W52X 4KEAA 1DWOA 4XIIA 5AIAA 4L0CA 1EB9A 2HFJA 1CUJA 3R0VA 3LIPA 5ALXA 1GPLA 2V98A 5AM2A 5ALGA 2RAUA 1H2XA 2AXEA 1LPPA 2DR0A 2HA5A 2H7XA 2DFPA 3I2KA 3MGAA 5AKHA 5LZ4A 2CKMA 5DNUA 4RNCA 4Y2QA 3QPAA 2JGEA 4Q3OA 1MO2A 1FJ2A 5T4BA 1H22A 1BCRA 1OXMA 3OURA 2PUHA 1A8QA 1L7AA 1XQVA 5DNVA 4I4CA 2W22A 4B9AA 1BE0A 4WDRA 5ALMA 5FLKA 3AILA 4K6KA 1GGVA 4N8EA 4YPVA 1QIKA 3G9ZA 5IH7A 4UHFA 5JD6A 2C7BA 5ALNA 1CUIA 4J0JA 4K2AA 4X6YA 4MJ3A 2C0QA 4K6HA 4DNQA 2JEZA 2B9VA 4UBIA 4PNZA 4Y2PA 4H77A 2DHDA 3M82A 2UZ0A 3FNBA 2WHPA 1G42A 4Y2SA 3KWFA 3L1JA 4GEGA 4DNFA 4UPDA 1PV1A 3O95A 1UOQA 3AZQA 1EVEA 4EY5A 5EHXA 4KRYA 7YASA 1ZJ4A 5LZ7A 5EIEA 4QEKA 2ORYA 4X97A 4EA6A 2PU5A 1K6EA 5ALVA 3B12A 2Z5GA 3WA6A 3HXKA 1QTIA 4U2DA 3C6YA 5E2IA 5AI6A 3IBTA 5D3ZA 3FVRA 1UXOA 5A62A 4OU4A 1ZD2P 3CCBA 3ZLUA 4MQLA 2EDCA 4NMWA 3OC0A 3VJLA 3BXPA 1JU3A 2GBIA 3HYSA 4DYHA 2DHCA 4RE5A 1XRNA 5C7YA 1W4LA 1QFMA 2R11A 2QKYA 3HJUA 4E46A 2D5LA 1EK1A 1R1DA 3BJRA 4FFWA 2PX6A 2XQJA 2HADA 1QO9A 3O9MA 5AICA 2JGLA 1CUFA 2DQZA 1IUOA 5LP1A 4OU5A 3ZI7A 5HFNA 1EDDA 1CUGA 1XZKA 1GZ7A 1RP1A 3K9BA 2X5XA 4WY5A 3WI7A 3LCRA 4HXEB 1BS9A 5FDFA 4CCYA 1GKLA 3ESAA 5AKGA 4OB7A 2VQ6A 1MAHA 4EUSA 5KWIA 1K63A 4OUKX 5CURA 1J1IA 3FYUC 4W1QA 2XUKA 1P0QA 4DLNA 1MX9A 5AI4A 4XX1A 4BATA 2WG0A 4X95A 4QLOA 1C4XA 3OPMA 2C5GA 2BUBA 3U1TA 3YASA 4PW0A 1F0PA 3D5EA 4DMFA 2WHPB 2DSNA 3L1IA 3UMJA 4X71A 2QS9A 2X8BA 1ZI8A 4K6GA 3CCCA 4KACA 2OCIA 3DJYA 3S8YA 4AN1A 4G8BA 1HL7A 1W76A 4HXFB 5CXUA 5AK3A 1OCEA 1YA4A 2I3DA 1PFQA 2J4CA 5BOVA 1BN7A 3BF7A 5JIBA 1CUUA 1CFJA 2XUOA 4CIBA 1G4HA 1MPXA 4X00A 3WZLA 5CT5A 1VXOA 2XUAA 3D59A 1GPNA 2OAGA 3R3ZA 2QRUA 5DTJA 5CT6A 1N5RA 4Q3KA 3IDAA 1QIIA 3DEAA 4JYPA 1LPBB 5T4FA 5JZ9A 4P9NA 2WHRA 1ZJ5A 2VSQA 2OGZA 3BJMA 1W75A 3I2GA 4K5QA 4B0PA 4EZIA 4IHAA 3O9VA 4MQMA 2ACEA 4BRZA 2XUPA 1QIMA 4CCYB 3R3XA 3VISA 4UHEA 1XZFA 4RE6A 5ALYA 5ALQA 1U65A 2XB6A 3FWHA 2GZSA 1RWQA 1BU8A 4BE4A 1CQZA 1WB4A 1E8DA 3BWXA 5AI5A 4ITVA 1Y7IA 4LHEA 3UUEA 4P08A 4X93A 4BB0A 2QR5A 5EFZA 4IQ4A 4M0MA 5AI8A 4DMHA 4DIUA 1ORVA 2XUFA 3IUNA 1R3DA 3L1HA 4E11A 2BCEA 4X6XA 1W1IA 1J06A 1CUVA 5C8XA 3R3YA 4AQDA 3BL8A 2XUDA 3CXUA 4LKOA 5ALTA 2XE4A 2WFLA 5FV4A 1Q83A 2WU4A 1EB8A 3QITA 1XLVA 5ALPA 4B85A 4KE9A 1XZIA 2AJ8A 1QIHA 2HA4A 4AO6A 3DS8A 1XZMA 3KD2A 3WL8A 5AH0A 5HZGA 4X94A 3GFFA 3EQ8A 2ZYIA 3R3VA 5F4ZA 2QUBA 3AIMA 3W9BA 3WL5A 4PSCA 4B81A 1L7QA 3H17A 4QWMA 3QMWA 1DQZA 4BBZA 3DYVA 3C70A 2O7VA 4UFPA 3QH4A 4U2BA 5HKAA 5CW2A 1ZD3A 1GPKA 2WQZA 5K3CA 1WOMA
chains in the Genus database with same CATH superfamily
3HU2A 3NTRA 2XMRA 3NM6B 4D79A 2HUPA 5C8VA 3GR6A 3QWFA 4ESEA 1T24A 2LP4Y 4AICA 4TYNA 4O3FA 2PO5A 5CPBA 2HIHA 3K2BA 621PA 3USES 4Q82A 5KSWB 4WGFA 4JP2A 4C6RA 5HKLA 4B48A 3KE8A 5HILA 4J07A 2FKAA 3KYCB 4LWZA 4Q01A 3COVA 5JAPA 1A7KA 1VJGA 1W88B 3FZEA 4L72A 1Q84A 4UEKA 2ZB7A 2ZT5A 4OQNA 3EIUA 1LQ2A 5B36A 1II8A 2A94A 3UIEA 4IJQA 5EIOA 4HVAA 4ARBA 1FZQA 2EV9A 3ONDA 4MCIA 4AKIA 2Y2VA 1PLLA 2YYYA 3LKBA 3ZQ6A 4IQ0A 1NLMA 1UEJA 5LQMA 2AK3A 5ADUS 3IRVA 1IZ8A 1I30A 3B1JA 3SDBA 4V0LA 5FUMA 3LX5A 2ZUEA 3S40A 2XQKA 1A2KC 3ROKA 3VGJA 1NT2A 3TPZA 2NPOA 5DXFA 2VXYA 1KAGA 1W5SA 4K9NA 4CG3A 4L4SA 3IGFA 4F3YA 3HA5A 4KMMA 1W30A 4FXOA 4DT1A 3EF3A 5DTEA 2GF2A 1L4GA 3ODGA 4NV0A 4EUEA 1KPHA 4GL4A 2VFAA 4L3VA 1SU6A 3WLEA 4C0QC 1IAQA 4G0PA 4I0WB 2PL9A 3DM9B 1FFBA 3D02A 2D00A 3O5AA 4ABYA 5FOVA 3VYSB 1KWKA 4E14A 3KAPA 3V6LA 4KWTA 5DYIA 5K3EA 4O4JA 3V1LA 3QHQA 3LMKA 1NMQA 1TFUA 3AR2A 1TJYA 2X3FA 3J7TA 2ZXFA 3PI7A 3P1JA 1XTZA 5J9FA 4BKOA 3U81A 4B6EA 3CB4A 4DSNA 3IKVA 1I36A 2Z2KA 2JLWA 2CJXA 4KQ2A 2ZETA 5HE9A 2FCAA 2M6RA 5ECWA 2AJLI 4BQNA 7MDHA 4W5NA 1YUBA 3R8CA 2QNRA 3EGWA 5IK2D 3CH7A 1Q1EA 2P6UA 1ZRNA 2QX6A 3DZIA 3MEQA 5EMMA 1RI5A 4HRXA 1ZK1A 2G4VA 4O4LB 3CQ9A 2KMLA 3UGKA 1J99A 3ASUA 2ZRKA 2W6CX 1JQDA 4IX9A 3HN7A 5DV9A 3PEYA 2DPXA 3HZRA 4M0PA 3B3FA 4HF7A 4NDNE 2WUFA 2QQ5A 1F2DA 2FX5A 1LH0A 1KTVA 1YE8A 3NAZA 1NVGA 2BM9A 3HUEA 1QHHB 3X1YA 2QQGA 2ODQA 1E1LA 1UMDB 3OF3A 1Y1KE 4TKUA 1IQPA 4XDYA 3LQYA 4BGUA 4WCFC 1P4SA 2PIDA 3VHXA 2CB0A 4WZAB 3F5MA 3F3SA 5A7HA 2J3KA 3BRWD 4PPFA 2GJAA 4Q12A 5B2EA 3FGPA 5BPHA 4TZKA 4DPKA 1N0VC 2OECA 4DDHA 4DCMA 1UAGA 4J7UA 1XN1A 3QJ5A 1DJNA 2I9KA 4DMUB 2OZVA 1RZRD 4EVQA 3T5PA 2XAAA 1MJHA 2FU5C 1XHLA 4R3UC 1J2TA 2FUG1 4JWTA 3VZDA 1MABA 5LYJF 1WB9A 1ZWLA 2ZRGA 5AW1A 4P4NA 4W5TA 1DGQA 1U31A 4WWHA 5LSAA 5G1NA 3WRWA 1NP7A 1Y5MA 3BFKA 3LC0A 5E1OA 2GKGA 5EIAA 4EG0A 3T9CA 3D2CA 4QGFA 4XTCS 1TUEA 1PJRA 2ZI6A 1P6XA 2ZTLA 4RA9B 7ABPA 4BO7A 2AYZA 1SOWA 3HY6A 5KQLA 3WGIA 3PNVA 2ZRLA 3TE6A 3PDWA 1HR0B 1RR6A 4U00A 3FFTA 2K87A 2O52A 2RHLA 3NHZA 3OTHA 3H9UA 5AW2A 4ZT6A 3T5CA 1BHO1 1QFZA 3QVOA 1DAOA 1XDBA 1VA5A 5DNEA 4E33A 1PNRA 4UTVA 3NXSA 4KI0A 4N7MA 4TQ9A 5IBQA 4BAGA 1Y3IA 2CFTA 4YV0A 4Z9XA 3WL6A 4YV1A 1MEOA 2G77B 2XD9A 5E2BA 1CYDA 3AI7A 3K15A 2QEQA 5DWVA 3BZBA 5LQSA 1KDZA 2ZCVA 2ATEA 1H9CA 3HBJA 1FTQA 3GH1A 1AKUA 1UC9A 2B8EA 1QTNA 2F3QA 4KN8A 1YL5A 1QNFA 2G3YA 4MIOA 1THGA 2QT0A 2XLBA 3VR3D 1N2OA 4UPEA 1X42A 2WF8A 4HNTA 2GZAA 3IIEA 3HCOA 3O8DA 1R6VA 2BWJA 3IPAA 1PQPA 4HGZA 4Q34A 5H81A 5G0UA 1KNXA 2IC5A 3G7NA 4WADA 5EGSA 4AUEA 2VHJA 1PQYA 2HREA 3OZEA 5ESDA 4G1CA 5ICFA 1PHPA 4B4UA 5IJWA 1P3JA 1WO8A 1G20E 5IJZA 1A0OA 2R1TA 4BX3A 2YFHA 1F38A 1VCMA 4FNMA 4K9OA 4QRHA 2H4ZA 4AWBA 3WRVA 3UCFA 1UCFA 4CMCA 1HEUA 1Q95A 2CNBA 1R0KA 2DFLA 4KBFA 3WYFA 1DJMA 4OXKA 5A02A 4PXAA 3KAKA 1QCZA 3WKCA 3B70A 3T1YB 4Q4HB 4M54A 1JS1X 1E61A 4JHXA 1XLTA 3AERA 5JNRA 4HDKA 2A5YB 3CEMA 4BNYA 2O54A 1PW7A 1MB2A 3LDHA 1VLLA 2CB9A 4PCAA 1D0SA 2G1JA 4FHCA 4TRJA 3FD8A 3DWFA 2PS1A 2W2VA 1PK9A 1RM5A 4CKWB 4QBIA 1QF6A 2H0RA 4P4SB 1B16A 3CT4A 3T9BA 4U3JA 2Z56A 1RCTE 2G0AA 1EUDB 1E7RA 2HO4A 3ZXIA 1JJVA 1Y1PA 3QOFA 1NBAA 3FJ1A 3TBFA 4NVRA 4I81A 4LRTB 4YRIA 2XCUA 3CUKA 3IA2A 4RKFA 1PZMA 1G21B 1KORA 3BH6A 3FSEA 3HU3A 3RVNA 1ZK2A 1V7QA 4GOND 2QRMA 2CYBA 4BB6A 4D82A 1YDWA 1VIYA 2HL6A 3G8AA 5IKOA 3W5JA 3OTQA 4GC9A 4IZOA 5D84A 3VBCA 5BSFA 5KX5A 2WVGA 4A2CA 3E35A 3ITEA 4FJ1A 4DR1B 3EIOA 4TOIA 5CFZA 4NCIA 5J4KA 1JIXA 1AS2A 2QVZX 5AW5A 4BNVA 3MAJA 1QRUA 2I7CA 1YWGO 2BEUB 2YNMC 3N8GA 3OZXA 5JRZA 5KYXA 4M1ZA 1YCHA 3IMFA 1NVMB 1AQ6A 3BIJA 4CIXA 3K96A 1FRQA 2OD9A 5KU7A 3DLAA 3IKTA 4FGUA 3NIWA 1Z88A 3R6LA 1ZAKA 5FFFA 4OOFA 3RR2A 4TKVA 3AKCA 4IUYA 3USZA 2R2AA 5J58A 4FFMA 3U56A 3T3HA 2BR4A 2GK3A 1SVUA 2P9FA 3CV3A 2F67A 3GA5A 1EM6A 4EG1A 3NHBA 1QQ7A 3BZUA 4ZOLA 3OE5A 2WQ7A 3CFYA 2X0RA 2I0FA 3EC7A 4LI0A 5JNWA 3Q85A 2B34A 4CM7A 3U61B 3IOCA 2JGDB 3I09A 5CFRA 5LJIA 2FEMA 4LDJA 4Q4CA 1BGVA 1N92A 2FAXA 2IIVA 4JVMA 1FNDA 3EVTA 4QNRA 3WDMA 1U2ZA 4KE6A 4E15A 4XE5A 4HDRA 3TLJA 3GVIA 4O8CA 5LL6P 1N8TA 4ICIA 2JJYA 4MMZB 3CEPB 2HJVA 1XELA 4MQFA 3O91A 3VO9A 3ZKWB 5A3JA 1HH4A 3L93A 4UAUA 4YJFA 4BIIA 4QQFA 3CRVA 1TLFA 2O23A 5DBHX 3KT0A 4PZPA 4S1VA 4EG8A 5CP8A 4WXMA 2IE0A 5EE5B 2BGUA 2FWJA 4C7OB 4TMYA 2O2SA 4D97A 3KKNA 1IPHA 2PH3A 1GD1O 2CLHB 2CZCA 4WFKA 2H0QA 5EEGA 4MW2A 3PNYA 1YB2A 2PLRA 5EMJA 3DFIA 5BSEA 3S1SA 4BLOA 5B1IA 2BSQA 3N2KA 1WSWA 2CYCA 2JNWA 3ML1A 1NR5A 2IVFA 4GX0A 3PI6A 3NUGA 2XMZA 16PKA 1UPUA 4NMMA 4BTLA 2IH2A 1KQ3A 1O8CA 3I6BA 3D7NA 3VDNB 3AKEA 2IHKA 3T3DA 3TE7A 4O59O 2J5XA 1XAIA 1UXIA 1E79D 1H85A 2H7YA 5I7WA 4LSGA 3N0WA 4WN9A 2CCGA 1B3BA 4N1AA 5DJ5A 2QRJA 3JQBC 1X8LA 4EJMA 4PG5A 5AVQA 1IONA 2E4YA 4KYTA 4RIHA 4L4UA 4NCAA 3E61A 3WYGA 3TTWA 8AT1A 1Z6XA 2BFBA 2G28A 2ZBDA 5CHEA 2GNOA 4ALMA 1FFDA 1GCGA 3KZXA 4DVJA 3RSFA 5CG2A 4OLBA 3K6RA 1PS8A 2EC5A 4W63A 4MYRA 3U7GA 3H2GA 3ZXXA 3GI1A 4Y2TA 4RS4A 1F8UA 4MPRA 3AF3A 1H42A 5ALUA 4FONA 5AOAA 1H0HA 2HTEA 3GVPA 3P9KA 4AKTA 5KQRA 2VRCD 4D0LB 3OFSA 2D5CA 2UZ1B 1TI7A 2B5WA 3UC9A 3AGQA 3GZJA 1Y4ZA 4KVGA 3CW8X 5IYZA 2B61A 3ECSA 5JAOA 1BEZA 1HI9A 2WVAA 4L2IB 1IZZA 3GGSA 4WZBB 2XDQA 3TZQA 3FHOA 1I2ZA 1IY0A 2E89A 1B2RA 3LL7A 3ASYA 3AM3A 4DMCA 1PJ8A 3U80A 1X86B 3CA8A 5C1OA 5LP6A 1E0AA 4P22A 3NHFA 3INGA 1H5UA 1S2GA 4M7PA 1NQ5A 1AK2A 3MK31 5B1DA 2O0JA 1E6CA 1H1TA 1TO6A 1VKRA 2BE7A 3IDFA 3QVKA 4M98A 1EGVB 1EHIA 3LAWA 3TLGB 4RA6A 2JBWA 5EJIA 3NBZC 3TOCA 1R5OA 4DHWA 2QRHA 4EAAA 5JTTA 1DRWA 2IXBA 2Y6UA 4QDZA 4XOUA 4EW1A 3VUEA 3AVQA 3RFTA 5L3RA 1OB2A 5H59A 1A1VA 1SQFA 1EX9A 4HH0A 4DA0A 3H5RA 2ABWA 1XKTA 3UAXA 3A4IA 4QDUA 4FOSA 1UBNA 4QGHA 4DABA 3U0BA 1BFKA 4F4FA 1E8MA 2P9TA 2R60A 1RJGA 3KWLA 4DLVA 4EHBA 5EIHA 3QVMA 4PGMA 2P9EA 4M9ZA 2ESRA 5IEJA 1SURA 2VHZA 4YXFA 1FJXA 4OB6A 3N0TA 1V96A 1MPTA 5A4KA 3EGDA 2FPIB 1NQAO 4FMPA 2FKNA 2I29A 4OQQA 5BN1A 1F4PA 1F6WA 5TNXA 4GPEA 4RL6A 3EHEA 3DZCA 5BN5A 2ZIVB 2P30A 4L16A 2VNJA 4LXGA 2ZKIA 4UM5A 1G5RA 5CJ2A 2WZDA 1RWXA 5GMOA 2O8EB 1CUHA 1RM3A 2CNLA 3F98A 3I12A 3QLVA 4PIVA 1M6VB 3Q0EA 4RM3A 1PLJA 3PC8A 4LC0A 4RFSB 3FLBA 4K87A 3ZD8A 1PGNA 1TK2A 5A6VA 2EXXA 4TGLA 4OGFA 5GVSA 4FT2A 2ZS9A 2J3IA 1RE0A 1FY2A 1UQTA 1NQTA 3W5CA 3V48A 1GYPA 4LRWA 3BMOB 4KODA 1E7YA 4D46A 4KV7A 4YWJA 2AL7A 2CW5A 2P0EA 2EKDA 1SK8A 1J2UA 1YAJA 5BWMA 3L18A 4PX3A 2R8PA 3BIOA 3G6KA 4PBTA 4C05A 3H7IA 3GYBA 4N3NA 1MJFA 3WIUA 1E63A 1UZMA 2GTHA 4OHPA 4Z3KA 2F8SA 5KQPA 3TRJA 3D8SA 5KTSA 2CXXA 2BM0A 4BKPA 3AUXA 4XXHA 5JISA 2IV2X 1SWWA 1XV5A 3C6XA 1MEJA 3GQBB 2G9NA 1EZ4A 4Q15A 2WBLC 4P34A 2VCHA 1ISSA 1K75A 2PL3A 4A3SA 1GSOA 1DQYA 1YSCA 2ZGVA 5CB4F 1GVNB 4JCOA 4QDKA 5GWXA 3LPAA 4CQMA 3G85A 5GGXA 2JGFA 4IYJA 1TIKA 3H3JA 4FT4A 2Z58A 4NEQA 5JNTA 2PX4A 5LUAA 4KHPB 2I4TA 1TCVA 3JQ9C 1KRWA 2PX3A 3PIIA 1YONA 2VPXA 4LV6A 4CEIB 2A3RA 4QYSA 2N47A 4PAQA 3I9JA 4WSOA 3D3KA 2YJGA 3KDAA 1TEHA 2C04A 2Q8PA 5FPKA 3D7RA 3HBFA 1V43A 1AXRA 4M8KA 3TPCA 3V4PB 3OFNA 3KCNA 5THKA 2WICA 5E2AA 1J8YF 4KRXA 3TRFA 4MUBA 3G0DA 3B1WA 3DW1X 3EZGA 4BJ6A 1ZEJA 1SXHA 4LOLA 1V3UA 2P2LA 4YCAA 3THOA 3ZW7A 4X20B 5ER9A 4ZFNA 1NPTO 4QUBA 4BECA 4PYRA 1A4IA 2PLAA 5D7BA 5F2OA 1X7YA 3GVHA 2XTZA 3SYNA 2FMFA 2PR7A 4B4OA 3SVLA 4MA5A 3HO1A 4TN5A 1HQKA 1TGYA 1HT0A 3SSAA 1DSSG 1T2NA 4ZKEA 2F1KA 2WZQA 1YR1A 3H2BA 2PTGA 4JFRA 3RYFA 1IXKA 2QSYA 3F7NA 4FDVA 5JNUA 3E9ZA 3V8NA 1V9CA 2SBTA 3AUKA 3HI6A 3QNUA 3DYIA 4LE0A 4EEXA 5TS3A 2DFKB 3HLYA 3LXMA 3C3XA 3C4VA 2FPOA 4R8SA 2BFWA 3AFIA 3PWKA 3DJFA 3A1FA 4POOA 1Y8AA 1E5XA 3B38A 1DBQA 1BDIA 4JXZA 5HIIA 4ZOAA 1XROA 3LVRE 4NU6A 4A1OA 2O8FA 4BGEA 1BYIA 1UAYA 4URUR 4UQLA 1KARA 3L5OA 4CZ2A 1XLWA 1RBZA 1L5LA 4QU0A 3KQUA 5AKYA 1LK5A 5BMVB 4ZCMA 1C5KA 2QP9X 5ALJA 2HHCA 1HEYA 2I87A 3DWIA 3HCDA 3TL3A 3SC2A 2REBA 3AVPA 2XKAA 4PGHA 5JTUA 2P65A 2PA0A 1A95A 1ISIA 3TI9A 1X8JA 1CY7A 3QENA 3DLTA 2VYQA 1UBCA 4IRMA 4JLKA 4YJGA 4MIYA 5DISB 4AIIA 3I01M 1Y4AE 5E8JA 3O4HA 1N3YA 1I0ZA 1NUUA 4LWPA 5ESXA 3C24A 4I08A 1K27A 1C3VA 3MW8A 1KXZA 4PVDA 2PZFA 1E1NA 3IELA 3QVVA 2GVZC 5CA1F 4EECA 5KMGB 5DYWA 1LCIA 2XA2A 3OE7A 4RELA 1AV7A 3HB1A 3TDNA 3DEKA 4FOPA 3CX7A 3HYTA 3IBSA 5KYVA 3PUWA 2PS0A 4X7BA 5K01A 3S5UA 2WDPA 5BR7A 3GQVA 2EYQA 1ZX1A 5FADA 2O8BB 1BE1A 3GJRA 5F77A 3HXTA 4WHMA 1ZQ9A 3A7EA 3I04A 1XKLA 2X0KA 4D81A 2FP4A 3CJTA 3E7XA 2ZI9A 1HTWA 4HV4A 3IAS6 2I3BA 2RHMA 4EELA 3PP8A 3THXB 4OI0A 2M6KA 4M22A 2OCDA 1B0AA 1C41A 1JR2A 2FDXA 3FMVA 4L3OA 4QT0A 2AG1A 1TUGA 3TSOA 5D1HA 3QFFA 4JJ4A 4CJXA 5AVTA 4WPGA 3I1IA 4IR7A 4LF8B 4WD3A 4IOJA 4G0VA 2WUVA 1UT6A 3QHPA 1PDWA 5CB4B 2WJPA 3DNMA 4HYTA 5HKBA 4IICA 1R50A 4PQRA 1U8AA 2WWVD 5IXYA 1SXJE 4MVJM 1K0FA 3K2QA 3A3NA 4R8VA 4WCFB 4BGIA 3EYWA 4MX8A 4R84A 3RWMB 1IZ7A 4C4SA 4JIMA 4XB2A 1KBZA 3K7EA 3SR0A 2WKPA 5C5EA 1MRZA 5DSTA 3WXBA 4BP1A 5MHTA 2WKQA 4ROTA 1S7GA 1E66A 4C2AA 2P90A 3WIDA 4M8NE 5FPQA 3MUNA 1L5VA 1OGYA 1JAHA 2IGTA 4GLBA 5EJ5A 4KH0A 2W00A 2RG7A 2BI7A 3F78A 3ITDA 2OV3A 3QZUA 3TO5A 4YXWA 1T3TA 1NVEA 4NK5A 3HDYA 4Q1BA 1YZUA 4R51A 1PSDA 1IMOA 2IPNA 2Q8NA 4DG9A 1HDOA 5DOZA 4CTOA 1OYVA 1KQPA 2YNMD 2RB4A 3HACA 3L8DA 4F96A 5ICCA 4RH1A 2JLVA 4RD2A 3HDTA 2W43A 2Q4DA 3BH0A 4I55B 2GILA 2UV8A 2I2XB 3VVCA 2UVQA 1VFPA 3DEYX 3L7AA 2XCSB 3EC2A 1T0IA 2EGHA 4E21A 1MXHA 3GJ4A 2Q6KA 4NICA 1XJQA 1G60A 4PSUA 3LY7A 3UJDA 1ESNA 2DUJA 3VJMA 5BMVF 2YL2A 5DRTA 1EUCB 3RASA 3JWEA 1UBHS 3HR4A 4FFLA 4AECA 3ZGLA 4FGKA 1XTSA 2KW5A 3ER8A 2WJJA 1XNJA 1XZLA 2JFNA 3OM1A 3DOHA 3MT0A 1C1YA 2D7JA 3DO6A 2MINA 1RI4A 3NDRA 1P4GA 2OCAA 1NLUA 1JXAA 4DDWA 1K66A 5DI3A 4D4HA 4K6FA 2O50A 3LPDA 3QRWA 3HV2A 3KYDA 1OVGA 3AJ9A 3S8EA 1G5PA 2PK3A 3PHGA 3PNSA 3ICVA 3KEMA 1E89A 3VYRB 2RIPA 4FDAA 4BMXA 4FDMA 2E5LB 1XCJA 2HLDA 2JS7A 3MLEA 1JSCA 3NG1A 3Q0IA 3OTIA 2W0SA 4X64B 5BOSB 1M6HA 2ZT8A 4EZBA 3A3OA 5KHAA 1BMFD 3SIRA 3BOSA 1AX9A 4JDPA 1P1FA 1LTHR 1E2PA 3U13A 5I9MA 3LFTA 4HVLA 3DAPA 3OE1A 3S7TA 4K9KA 4OQ4A 4XOIA 1GU1A 2C77A 3K0AB 4OATA 3ZWVA 4MI3A 2G9ZA 4J0DA 3T4EA 2F8LA 2Q1WA 1C8BA 2NXWA 3LXXA 3UBMA 5GONA 1EAMA 3D43A 2WA1A 3WSTA 3VOSA 2YVUA 1A8HA 4YAKA 3U37A 1SA0A 1EUYA 3EIHA 2VNSA 4OQMA 1R74A 1VG8A 2ZIXA 4IV8A 1W8DA 4K9QA 5KAPA 3SEZA 1GCAA 4WZBA 1QC5B 3T94A 1E6MA 5TGZA 3FCUB 5CFOA 2XKKA 5KJFA 2ZBEA 2HA0A 4H18A 4UXIA 5DEIA 4FFVA 5FUXA 2I7TA 2WMDA 3OM9A 4O2AF 3PJEA 1B6GA 5GAJA 3CVUA 4B32A 3MS4A 3JWPA 3NX4A 3O3OB 3IE2A 3CNHA 4PLYA 3DMFA 3U9TA 1LJLA 4BLWA 3B51X 4RDIA 4Z4FA 1WD7A 2BCJQ 1I32A 4C5BA 1M7GA 2NP6A 1MIHA 5IKEA 3OFKA 3W9YA 4K26A 3FM9A 2YWRA 2LCFA 4WAUA 5T7BA 5NULA 1UK8A 2NUTA 2QRGA 3EAGA 4YRAA 3SZGA 3GC6A 3D6HA 3VR5A 4YRTA 4NE9A 1P6QA 3T34A 5THQA 1PJ2A 3UJPA 3ZEAA 5FHQA 2RDMA 2GN9A 1USKA 3K4PA 3W1EA 3ZCPA 4QBKA 2V6FA 1U2QA 2GD1O 1JTEA 1DAGA 3WYBA 3E5NA 3ZE7A 4P5PA 1OY1A 1QIJA 2Z98A 1ISHA 1TZ2A 3TTVA 5IBRA 1SVLA 3KPJA 4EYSA 4DIOA 2WV7A 4KVAA 4IBOA 4A6PA 3DOOA 3EN0A 2F90A 1NVKA 2XUZA 2UDPA 2XT0A 3R7SA 2Z6QA 2XVMA 1TTHA 3FRIA 3M49A 2QZSA 5T57A 4AUMA 2UVPA 4Q4AA 3RBZA 3RYHA 4C2UA 3JVDA 2YYZA 3E4DA 4C5CA 1P2DA 3GEHA 4QUKA 1XEAA 2GN8A 1EGAA 1Q0RA 2BBOA 1DTSA 2CUKA 2Q5EA 4IMIB 5JCZA 1ODLA 2I62A 3PQFA 1N5LA 5H70A 2N46A 3K1AA 1ACJA 2PGOA 1EBUA 3EUFA 3HKCB 521PA 3ZY3A 5H8WA 2R79A 3AVWA 1Q21A 5EWLA 5CDHA 4DGQA 3I6ZA 4HGYA 1CULC 3GZ4A 3JXEA 4W5RA 3ADBA 1JEEA 2NG1A 1UOOA 3N2EA 4G85A 1OWPA 1Y81A 1M2EA 3IALA 1JPUA 4QFMA 2L69A 4AU1A 2Q9UA 1E92A 2VYFA 3SEFA 3F6PA 4DIBA 2JGIA 1T3ZA 3JD3A 3QBTA 1N5OX 3MHPA 3HWWA 5A0VA 2QG4A 5FA5A 2H1RA 2ID9A 4ND8B 4DREA 1BMTA 2NU6B 4RTSA 1L6IA 4ENTA 1Q7RA 3R0ZA 5BR1A 1N9GB 1UK6A 3PQEA 4RA9A 4AP9A 1ZRSA 3KJZA 3UUFA 2DB3A 1E7QA 5CAEB 4MMXB 3L7OA 1YXMA 2C7VA 3DV0A 4J43A 1XKXA 3NDBB 1T5BA 2YWCA 4QOSA 4W5QA 1M66A 4Y2YA 2C2BA 3EZ7A 4IIUA 3V7YA 1P7YA 4TXMA 1TM3E 2FN9A 4D9CA 4UDOA 1AKNA 4MDYA 2G4LA 1ACMA 4KN5A 3J81A 4TT3A 1BXGB 5KYUB 3F73A 3TAXA 1AD2A 5HR5A 1MN6A 2HRBA 5KNDD 2ZM6B 1G1AA 3JYLA 5E38A 4Y2UA 1QKJA 3FPLA 4FEAA 4COKA 5IH3A 4MW6A 4QREA 5DNDA 2GBLA 3K8OE 2WD9A 3H2HA 3MJTA 4Y2JA 3PE4A 4TUYF 4BVAA 5JT1A 2V45A 3PQ8A 1HO3A 4LISA 3C74A 1KK2A 1ENOA 3CEJA 2PRZA 3SNKA 1T3LA 4U2FA 2CJWA 1I5OA 4X1KA 1YBMA 1RVV1 2HRCA 3SSOA 2W8BB 2I71A 1US8B 4GMKA 4QNMA 1RCUA 3PXCX 5DX1A 2OGUA 4TRMA 2IS6A 4UQPA 1YASA 2ZUSA 3JVVA 2IEGA 2J6CA 1W36C 1KHTA 1OA0A 4BOYA 3QVGA 5LD2C 1HDRA 4KLCA 1JAIA 1CQIA 2E4AA 1XEFA 3WWCA 2K6GA 2OWEA 4DV3B 3LKDA 3F6EX 1LZKA 1LI4A 1WDTA 5LOVF 4QYIB 2P1ZA 3KRTA 3IEKA 5DHUA 4K6OA 4BASA 1PKEA 3I34X 1RP7A 2WIBA 4IIGA 4O25A 4J0KA 5AJTA 1UFOA 5FWYB 2VHWA 2EFCB 2ZJ8A 2UYCA 2DRIA 2B2XA 3MINB 1KVQA 4GI5A 4NE7A 5EXXA 4DUGD 1WQ3A 5C8YF 1RFLA 3PF9A 5C5DA 2RAFA 2GNAA 4BQPA 3MLAA 4CBVA 1L3CA 1WNFA 5JBQA 3UAVA 4L8FA 1Y1SA 2CFCA 2H4YA 3KELA 4J0CA 1PEAA 4H6PA 4PWYA 3DMDA 3V2HA 4Z3OA 3BQ9A 4A0FA 1KK1A 4JY7A 3CZ5A 4UUAA 5JOQA 2HUNA 6GPBA 5E9WA 2NQTA 3UK0A 2A9KA 1DINA 2J3DA 4ND7A 2AFIA 3K73O 4EJ6A 3AVVA 1AKQA 1TADA 2HK8A 5H83A 2ODNA 4KSBA 4HUTA 1CEQA 3LHIA 2FGJA 2YN4A 4PZUA 3IT1A 4XVHA 4HWOA 5T6BA 2W2KA 1PJ3A 2IHTA 1BVHA 4ZCSA 1DQRA 2AB0A 2C3YA 3RAEC 2J9ZB 2HF8A 1TECE 2N42A 4X92A 3GZTB 1WY5A 1XYVA 5IN5A 3U3XA 1O95C 4NH4A 3UGQA 5BV7A 5JBNA 2KJQA 3RKUA 1OIVA 1OILA 4ZTZB 3U62A 5CLIA 1N6KA 3GV0A 3ZKAA 3B6ZA 3R1IA 4ER6A 3R9IA 4DCTA 3JQAB 3HGTA 3QMPA 4K9MA 2FW0A 4YAWA 4AY3A 4GBJA 1ENPA 3IPYA 5EJ2A 2VT7A 1R0XA 4WK0B 3B5JA 2IV7A 1UWCA 3U4QB 4D9KA 2IXGA 3PC4A 4E70A 1V4BA 4EJSC 1MX1A 3C3EA 3B2NA 2EBHX 1V35A 1IRIA 3HWSA 4R83A 3RC1A 1HYEA 3WAKA 5JD5A 2H2DA 1XWIA 2J4FA 4HHEA 1Z8NA 2ET6A 3S2ZA 4JYZA 3NANA 1F1JA 3D6NB 3PS9A 4RV5A 3Q7RA 2I4OA 1LPAB 2WPNA 4LMAA 2PMDA 4N47A 5F51A 1GCOA 2NAPA 1SXJC 1YMVA 2AOUB 3CN9A 3E0QA 3OX3A 4R1TA 1QXSA 5A4DA 3L5KA 3BXXA 4RHCA 5LM3A 4U7DA 2QJOA 1N6OA 2BZSA 4DLTA 2OBYA 3HTXA 2QW1A 2AK2A 2HCBA 1H0RA 1WPXA 5F3RA 4F5EA 3S1LA 5K3BA 3PXEA 1H69A 4YAOA 3NB0A 3A4TA 4AT1A 4II3A 1EAYA 1A96A 3MMZA 1P19A 1KVSA 2INGX 4KK4A 2B92A 4H60A 3U60B 1Q0ZA 2ZJFA 4BLRA 3ZE9A 1T0UA 3KT3A 1P0IA 5A04A 1LRKA 4TTIA 3OT1A 3LU1A 2UVDA 2V9CA 3HHPA 5F5NA 2E4VA 4P3OA 4GP6A 1EK2A 4MZXA 2R62A 5FBHA 1EXMA 1XEWY 2EU8A 1DX6A 2BGRA 2OZLA 1K6MA 4WFIA 4AJOA 5L4NA 4WOJA 5CVEA 1CRQA 3O8CA 1Z5PA 3GD7A 3PGMA 1MP0A 2M6LA 3Q2OA 1UK7A 4LVUA 5K3FA 3DVLA 2NVWA 5GPBA 4NABA 2IDJA 2FEKA 1K8YB 3DEJA 3L7NA 4N8SA 3AXSA 2HWYA 2P9QA 1TF5A 4I99A 2PBRA 4GYYA 4EFKA 2I54A 4HEJA 1RYMA 4CDMA 1H2BA 1UBSB 1NQVA 3NI2A 2C4MA 3L7JA 2X9LA 4GKBA 3REQA 3MHTA 1SH7A 1L5NA 1DQPA 4F5ZA 1Z4IA 2GFQA 1MIOA 3RBAA 4CLDA 4DIDA 4DNOA 2Y4NA 3TCXB 1YB5A 3JWJA 4P8RA 4UZFA 1Q0PA 4RK6A 3TQQA 5A9SB 5KJ6A 1A8UA 1LUAA 1CUAA 3TGLA 3VPHA 5T6MA 2CN1A 3ADCA 2H9YA 3QYJA 1ZNYA 3FROA 5CA0F 3VKVA 5UKDA 1YOVA 5F4BA 2E18A 3DFMA 3E15A 3SMVA 4D3SA 2OCGA 1ESDA 1G20B 4Q9NA 3DP7A 4ZPJA 1UJMA 5AUQA 4BRWA 1KY5A 1RC8A 1YJAA 2XTNA 2ZJ4A 4KUGA 5FTJA 3ESBA 2EHDA 1RPAA 3A3PA 3BJIC 3R7WB 1H0KA 1G7SA 1QLJA 1ZEMA 4I19A 3ZK7A 5ED0A 2UYQA 2AC4A 1GAWA 2CVOA 1QCDA 3FDZB 4YP1A 3ZVRA 3BD7A 5EMKA 1TT5A 3UICA 3DOFA 3E22A 4JASB 2QM0A 3HVIA 3PFCA 1DB3A 1FNMA 3ND6A 3PR2B 4HADA 5C1DA 3RARA 2ZSEA 3LO5A 4R3NA 5BVHB 2AZXA 3VKUA 3NONA 4P0QB 1L5ZA 5LA6A 2R6ZA 1HF3A 1PD0A 5LNK1 3BRSA 3LZCA 3AC0A 4ALKA 2V0GA 4GNKA 4TQGA 2G76A 1P4HA 2ASEA 4DLLA 4UE3S 4R1QA 4JB0A 3VC2A 4DRYA 4WN3A 4GNRA 1DHTA 1HSOA 1DX4A 1ONOA 2GPTA 4G25A 2F55A 3IEXA 4FR5A 5CFPA 5ADHA 3T52A 3PL5A 3DHEA 1QDLB 1JBQA 3EZFA 3AL0C 1CJCA 4LFCB 2BGNA 3G7SA 2H11A 4MYHA 3AQ4A 2W70A 1MCZA 1ONPA 2NADA 1XDGA 2VYVD 1K89A 5FUVA 4YLYA 2RHWA 1W49A 2DEUA 4M0LA 1DKLA 1QP8A 1QPBA 3B1XA 3QMVA 3WIEA 4IM7A 4KVZA 4G89A 1NMSA 3PJGA 4RF3A 2WT8A 4CIAA 2O2JA 3G9TA 4ZHQF 1D2GA 1BHJA 2FSUA 2J4DA 1GTZA 3AXTA 4LCEA 3IMEA 4IH4A 3BDIA 1CVLA 2BGKA 1EVZA 3IQGX 4KSYA 5ANRB 4BC1A 1NR1A 1ZESA 4JBYA 4CUKA 1I4TD 2ZYVX 5FT9A 3KZOA 4Y9UA 4DDUA 2XSZD 3GCWA 4J1SA 5DHFA 3TTUA 2OORC 5NLLA 3HCRA 2MR5A 3QK7A 1SUPA 1E9RA 1IM2A 1IEQA 4XQ9A 5DCWA 4GDMA 1NE2A 2G80A 3W5HA 4NH0A 3I6IA 1Z68A 4JAVC 1JDZA 3ZNQA 3C7AA 4EPVA 4B83A 1KEEA 1SHKA 3BFPA 4BO4A 2X8AA 2XAUA 2E21A 5D5HA 1KYXA 2VAXA 3CE6A 1JR3E 2GFHA 2ZPTX 1VZ3A 5ITZB 3HWRA 1USUA 4IDHA 3UWOA 4L85A 2P2SA 3MWYW 3C8MA 3RROA 6Q21A 2O5EA 3DYBA 1UBGA 2CMHA 1XSEA 1ZM3A 2H4XA 3RU9A 2A4MA 4AG5A 1YDFA 1U0TA 1YVEI 3DDSA 3RI3A 3UPUA 1V71A 2DZDA 3DKVA 2EEZA 4PAOA 4EY8A 3ETGA 2FSFA 1OI2A 2CDAA 4JMLA 2I6XA 4JL5A 2R97A 4MA0A 3SLKA 4D4KA 4F3CA 1C4OA 3OCYA 4ZVNA 4MPDA 3STXA 1N1DA 2ODTX 3TZHA 2PTHA 4P7GA 4TQUS 2JJMA 5CIWA 2HB6A 3E7PA 1OZAA 4IIDA 4LDZA 1R8XA 4XW2A 4E31A 1Y8ZA 3K94A 5FV7A 1T43A 1NI4A 1ZOLA 1RBMA 1XP8A 3JAKB 3JY6A 1O6GA 4G0QA 3EEIA 3VU8A 3CKKA 1B7GO 2FPRA 2Q8QA 4WNAB 3UUWA 1ZJWA 4LJ4A 2ZRJA 2ZJ6A 2PMKA 1IG3A 2J85A 2Q3MA 4TMWA 4LQCA 1ADBA 1Z0AA 3D6VA 1Q22A 2XQFA 2RG1A 5D3MB 3LLVA 1M0TA 2WNIA 4UU8A 3MD0A 3TW8A 2IZ7A 3TQCA 5CA0B 1YBVA 4RACA 3LP5A 1U3UA 3IT3A 3QE9Y 5JY1A 1Q57A 3SYLA 1X1BA 3VMMA 4EJFA 4HDSB 1W0JD 5DIFA 4CIYA 1GL7A 4GKJB 5A6SA 2J5QA 1HSZA 4BV3A 2BGJA 4CFYA 1TLLA 4U0JA 2R5WA 3GF4A 1VCNA 4NBVA 3WHLA 2YC2C 1X70A 1XMJA 4OSOA 3P4XA 1JYEA 2IITA 3NDJA 4L9WA 4ZEMA 3KXIA 4OTZA 5AM4A 3S81A 2GWHA 2RJNA 2DWPA 3KQQA 3R4VA 3JD0A 5DM0A 4NYIR 1ML3A 4B71A 3WX0A 1USGA 3CPHA 4BQFA 1QV7A 2P9JA 1EVLA 2XA1A 4PWZA 3FMFA 3LHFA 3DOUA 1Y3DE 3EMBA 4GI2A 4GPZA 4P4GA 3KQNA 1G9XA 1IPEA 1AZTA 3DDWA 1NAIA 1IXYA 1WPQA 2PX5A 2XR1A 3MBOA 3TQTA 3GA0A 1ZKDA 2D7CA 3LDGA 3SQWA 3DKPA 2PUBA 3HY3A 1C0IA 5C4GB 5BQOA 3OZGA 3RS8A 3L4KA 2UZ4A 2GT1A 2RJ3A 2JBAB 1WUKS 4ZYUA 2ID4A 4H1VA 2P8JA 4XUCA 4DTCA 2V6MA 4PLGA 4KNYA 5EP1A 2IZ1A 1A2OA 4QTTB 1QAMA 4KQIA 2VNAA 5EZYF 5DBFA 3TINA 3STUA 1R4NA 4AK9A 2J0QA 1DP4A 2TMDA 1FP6A 1KFKB 2XOXA 3AVXA 3F5QA 3E2PA 3AG6A 2C20A 1M8KA 4IOLA 3LBNA 1B93A 2V7PA 4RK5A 5HIJA 2GPBA 2Y77A 4ARZB 5JDCA 3ZGZA 4Q3AA 5FBVB 1TTPB 2FDCA 1J9EA 221PA 1AKTA 3U4CA 4ZYVA 1XPOA 2KWIA 3D7LA 3FKSD 4B33A 1NYRA 2QRZA 1ARZA 1TIBA 2QT9A 1Y6QA 2VK8A 4LN1A 1EFVA 4YCDA 5IHPA 1Q3KA 2ES4A 2R48A 5FWDA 3Q3IA 2FUNB 5DNVA 4DJFC 2ZUFA 2ANBA 2ZSUA 1Z45A 3RVMA 1FQOA 1Q74A 2R00A 1MUUA 4TSFD 4Z6KA 4G9BA 1JG4A 1T3HA 4K9DA 4A6XA 1K8XB 5GINE 2IDZA 4Y9SA 4GI3A 3QW2A 5FO1A 3MGBA 3Q98A 2Y4OA 2OFPA 4GR4A 4RENA 3U7QB 1SCQA 2Z5FA 4WKGA 1V16A 4YNBA 1LNQA 1NURA 3O8OA 4QO8A 3OPNA 1JU4A 3JS5A 5I5EA 5IZCA 1RWBA 2D8MA 2GPYA 2O6HA 4JLBA 5HOEA 4KE8A 3B5IA 4IVRA 1W93A 2RFLA 4G4IA 4MKFA 5HIAA 4ZMRA 2GM4A 2CHEA 2C4VA 5LBTA 4JLWA 2ANCA 4GXTA 3PFIA 1O2DA 3DHVA 4LGYA 3TVDA 5FRDA 2CLFB 2LE0A 4IFIA 2CXSA 2GERA 6YASA 4OUDB 1XDSA 4JJGA 1SCUA 1P0CA 3H0EA 3SFZA 1M6WA 2J46A 2CEAA 2Q3HA 4ZZIA 1VHQA 4TQAA 1FDUA 4RU1A 2COEA 4GPAA 1C1XA 2O7RA 1FNNA 1YHNA 3V7UA 2AJDA 3BJEA 1XZCA 1N2EA 1RBYA 4MV6A 4JBNA 1PK8A 3CPEA 3SS8A 5ES4B 3BCSA 3OZWA 2DECA 3F9RA 2BRUC 1DXOA 1KZ9A 3DGEC 4KIGA 4A82A 1U99A 3IUMA 2CV0A 3FR7A 2JFOA 3BWVA 4TT8A 4DQ0A 2O3QA 3HBLA 3O75A 3X1ZA 2PRKA 2Z08A 2C1XA 3AUFA 4K3UA 5A7GA 1LSJA 2IYXA 4NCXA 4N8DA 4X1YA 1PFVA 1QGAA 3QJYA 1RWVA 4TL7A 3H8JA 3ZDYB 1Z5OA 3LZ6A 1GV0A 1SBCA 1E3QA 4H1UA 1JZSA 3NBQA 1U6IA 1SKAA 1YACA 1IEVA 2Y1EA 4J03A 3L7IA 3UM9A 5JQGB 3ZVKA 1NUTA 2HJHA 1CY2A 4R9RA 2QP3A 2E3JA 1CJSA 3EPJA 3RK4A 3W5AA 1JVNA 3L8EA 4FFBA 1CZHA 2JIDA 2O0KA 3GNLA 3STYA 4UREA 3MG9A 3WBJA 1Y4UA 1RAHA 3U44B 4MLCA 1OXBB 3O73A 1E62A 2IU6A 3P2IA 4Z49A 4OIFA 4RIEA 3A7DA 4BX2A 2WIGA 1FSGA 2I6QA 1YDMA 3F97A 3FFXA 2BM8A 3JQFC 3KL4A 3QBEA 4LJ6A 1DO0A 3RG2A 1W9HA 4HLNA 3WTBA 1XEXA 1YS9A 4HEA1 3KM0A 5DM1A 1SXJD 2JHPA 4REQA 2BTEA 1W4AA 1WB6A 1LVUA 1XIVA 3K8YA 1JHZA 4KG7A 2NYAA 2ZPAA 5EE3A 3UXHA 2FWRA 3VPAA 4RHYA 1KZGB 3FB4A 3T54A 1DBPA 1PX2A 1ZIDA 2YRWA 2ECQA 4NYMR 4XI9A 4MVJP 5EUQB 1UBOS 1XRMA 4HN4B 5JS2A 4ZQBA 2VZ0A 3BULA 4W6ZA 821PA 2ZVQX 5HZKA 2AEJA 2RI0A 1RAGA 3GT4A 4LQDA 4QRIA 3I28A 2DUWA 3TQSA 3VDRA 5IUNC 5ENVA 4MV5A 5KTRA 1TYCA 4L73A 4YRZA 4TM8A 1E0DA 1EFUA 1RYFA 3EVBA 5DGCA 5DGIA 5LD2B 2LNDA 3D54D 4RTNA 2UXCB 1HZZC 3CH5A 2ZP1A 1RJ9B 3AHHA 2PANA 5HKKA 4PXYA 4L5IA 5FI5A 1OWMA 3DBHB 1CF4A 1HOTA 1NPDA 1UOEA 4HOYA 1UBTS 4AG3A 3PKIA 5BNFA 1IXSB 1XNGA 4RCZA 4F4IA 2QF7A 2AI2A 4R40A 3OZRA 3T0FA 5K99A 4BCCA 5CB8A 5CLFA 3OCZA 4JSTA 3I30X 5KYTA 1HK7A 4YTEA 4N3AA 3QA3E 4C7XA 2I03A 3W5BA 4EG4A 5BYKA 4P7BA 1OVMA 2YXNA 4A23A 4CEJA 4D42A 2PUJA 5IDVA 4G23A 1SKQA 3ME5A 1BH2A 1QWOA 1ZD5A 1CNFA 2R8YA 4FEYA 5I3ZA 1FS5A 3KWMA 3RTCA 3WNZA 4JYMA 1I2BA 3KAJA 1N9KA 2Q6TA 1NV8A 4ZMSA 2GBCA 3ROZA 3DMPA 1WEKA 2YZNA 4IV5A 3RC8A 2FW9A 1F8XA 3JV7A 4LDPA 1ZR2A 5E6UB 5I8PA 1DMSA 3M4XA 3PTZA 2A5DA 4AJHA 1MZPA 1EWYA 3QWIA 4GAEA 3L8YA 1UF9A 2QLMA 4OJYA 3RYTC 2XYHA 4D3DA 2ZRCA 1PR5A 4R2KA 4R1OA 2NZVG 4WINA 5ALFA 4C7JA 2QVCA 2WI8A 3LWDA 4Y0VA 1AXEA 2PV7A 2ZCUA 1K2VN 1L7EA 4EHFA 1G98A 2DBQA 5AHWA 2XYRA 3L7LA 4HYEA 2JAUA 3W8RA 2ZLBA 2FRDA 3WLJA 4CMGA 3FMOB 4RFLA 2P9ZA 2NWQA 3NM4A 5J2TB 1W48A 4WXEA 4PSKA 1RABA 1T26A 4XCQA 4YRFA 1UC8A 4AJNA 1GGMA 1JIUA 4EJSB 3ZYCA 3F74A 1FVOA 3MRSA 2OEPA 3GDGA 4B5KA 1NNSA 4AP5A 1XNRB 5JS1A 1P29A 1YDGA 1NTOA 1Y34E 4GVPA 4QLAA 1UJ6A 3BWEA 3TUIC 3HCFA 3LRTA 1XZHA 1AURA 1PU2A 4HX9A 4RPJA 4YROA 2OP0A 3L9WA 4XWWA 1PL7A 4I1RA 4LDQA 4O4IB 1SXJB 2W6ID 3BWCA 4H15A 2WE7A 2WLTA 4IS3A 4CM4A 3E7DA 1SEPA 1ZK0A 1AHNA 4S1WA 5CNJA 3VVMA 2LGJA 5KNBA 4B3MB 4BMPB 3VR1A 5IVHA 3WK7A 5DK4A 5EWMA 2IJGX 5TQ0A 3E9NA 3ZUPA 3IT2A 3P7MA 4WW0A 2OBFA 2OBXA 1K5GA 2A0KA 5HF6A 2R4UA 1GYRA 3RLIA 4BRUA 3A6KA 1G3RA 4X41A 1G291 2OXCA 1H9BA 2HKIA 2VH5R 4Z1MD 4TZ6A 3D4NA 1U7PA 3X1XA 4B9EA 4DB4A 3ILSA 1XPJA 4EO4A 1VSUA 1Q7GA 2FQ1A 2Q2NA 3FY4A 4QPJC 4Z9BA 5CTJA 4F1JA 1J25A 5A5EA 3TQIA 2NAFA 5H0IA 1B8NA 1Q11A 5K8VA 1APBA 2CT8A 2VRWA 3ZD6A 2J30A 4P4LA 1M67A 1VTKA 5DWQA 4ZDJA 1Y7PA 3M5DA 4QOHA 1Y3CE 1XWFA 1CDDA 3G88A 3R7NA 3VU3A 1Z5WA 3P0IA 3D1JA 3EWAA 1GAEO 4CRWB 4FN5A 3S7ZA 2YVKA 3GLSA 4M89A 4CIWA 5HF8A 3BPSA 4G37A 4HB4A 1UT8A 3FZNA 2YW2A 4LQ4A 3MOSA 5SV2A 3ANSA 1W47A 2CE7A 4QUGA 4UNPA 4ZHSA 3O1HB 3NGMA 3PFFA 4FDLA 1AMUA 4JP1A 1QDEA 2IK8A 2Y99A 2I33A 5JXIA 3EXIA 4AKEA 3OOJA 5ALOA 2JGJA 4CNBA 5KTMA 1UFKA 1RM0A 2WPDA 3ORRA 2XCOA 3DT9A 1HQDA 3IVAA 2OV2A 3W0LB 3D7MA 1U94A 3KL2A 1B73A 4HDMA 4UASA 1OI4A 1W5EA 4X54A 1SC3A 3F0TA 5D5QA 1W4BA 3E70C 1W2WB 1NRIA 1GEEA 2LVBA 2PHZA 5K8IA 1BHQ1 3SX2A 5EXSA 3S3TA 1R8JA 1XD2B 1T8YA 1A9XA 1UMKA 3ZC3A 1V1RB 4GBGA 3COZA 5K8TA 4X5OA 1UM9A 121PA 3HRKA 3QXCA 2X8JA 4DA8A 2VJMB 2OD2A 2ZIFA 3QTTA 2X1LA 4IIJF 4DQXA 4X62B 2VUIB 3ICCA 3O1LA 4OMFG 1V1MB 4UAGA 2H7VA 1JHQA 2ZUVA 4OA8A 1WBJB 1UZNA 4Q6BA 3WJ7A 2QTFA 1PVOA 2QTNA 4TMKA 2Z83A 5JPIA 1DARA 1VRCA 2X4GA 4WFJA 4CKZA 4GDFA 1FSFA 1MRSA 1RKXA 1GXSB 4GBED 2WJ4A 1QHSA 1JE0A 1A2QA 1ZM7A 3WRYA 2QTVA 2RGGA 3PRJA 1RPZA 2VNKA 3EASA 3VI4B 1QTQA 2WEKA 4X9XA 3IV6A 3RJ9A 4MWEA 4Q4JB 4OHVA 2R6GA 2VHTA 3NPMA 1EQ2A 1JQKA 3U9SA 2NV2B 3OWOA 3R9XB 3VZPA 4PC1A 5CH8A 5TMPA 1LLQA 2VF4X 2QRVA 4OI2A 4W7IA 4HMPA 1YIAA 1Q1BA 3N76A 4MCAA 4Q3CA 3PD1A 3KZKA 1VKJA 13PKA 2HM7A 2GPWA 3G8CA 4LJ5A 1T8WA 2VJQA 5DNAA 5B1SA 4BVHA 3ZDRA 1IY9A 1JTFA 4IV0A 1C7ZA 3DBRA 5F64A 1CRZA 1GA1A 1JXOA 2FV8A 1G59A 3U19A 3D0QA 4N5NA 1RPJA 3I9NA 2CHGA 3R0VA 1MENA 2XZDA 3LIPA 1MVLA 1JA0A 3HU5A 4FS3A 1YV9A 5K0FA 3TIFA 1TJ5A 3K35A 4Z2YA 4DJEC 3IUYA 1KPGA 2G6TA 1D8AA 3GRUA 1N77A 1Q1ZA 2RKOA 2VP2A 3NYIA 4S0ZA 2X1MA 3MJFA 2JJ1A 4QBTA 4DCVA 3R2JA 5AM2A 4TRNA 3IBYA 3TAUA 1O94A 3LT2A 4DXAA 1XJ0A 5FNZA 1H2XA 3PQ5A 2Y9MB 2BMDA 4D4IA 1MC5A 2ATVA 2HA5A 3ICEA 3A1WA 4D5EA 3KZVA 3LKZA 4DF3A 1QYXA 3EUEA 4HDNA 3CURA 4DGSA 3P20A 4E5UA 4LBVA 4OXXA 3QOYA 3R0JA 5G4KB 1QH8A 3NCHA 3I2KA 4C4AA 1E2BA 1ESEA 4UMVA 3ZI0A 4LC1A 1QMPA 2IZOA 4MQ4A 5BYJA 1SBQA 5LZ4A 3EDYA 1PN3A 2QLFA 3P0RA 1AO0A 2CBZA 1G4UR 5G53C 1M8FA 4BWYA 1I7DA 1ZM2A 4RMNA 1L5WA 3NYQA 1JG7A 4GKAA 2WYUA 1VL8A 5CFQA 1FJ2A 3W5UA 3K71B 2O06A 2O7SA 4HT3B 1U8XX 3IQHX 1VQ1A 1JA9A 2Q0QA 2EJUA 2QQ0A 3FCCA 3MWLA 5EP3A 1ID8A 2PUHA 2JH9A 2VBIA 4MAAA 4PTYA 4YJ3A 5JSQA 1YFLA 2VT2A 2BC9A 5M34A 3L6BA 4EATA 3CYFA 3I8SA 4TTQA 3WO0A 4I4CA 5J23A 4ETMA 1CSEE 3DDNA 2PKRA 2VZ8A 2DCUA 4TL9A 3ST7A 3PC7A 4WLVA 1Z2NX 5ALMA 4QSHA 4XJTA 4JT2A 1ZA2A 1S4MA 4K6KA 3ZV3A 3ZU3A 3H3FA 4B3RB 1CE8A 4V1CB 3G9ZA 1J70A 5KCZA 1WL8A 4OQXA 4WEOA 3ETEA 3PLNA 1FVXA 8LDHA 4RIFA 2YFYA 3AR5A 1NXXA 3IUBA 3WLPA 1J09A 4P3XA 2XBMA 3EG9A 2ATCA 1AY0A 4J0JA 2B8TA 5AJXA 4KKVA 2YMMA 3ZU4A 1KYWA 1R0SA 2HCFA 3DPUA 3IT0A 4JT9A 4TRRA 3U3DA 3VTZA 3R8XA 4EGJA 3VNUA 4E4YA 4KR7A 2QN6A 4JA0A 2HBRA 1GPJA 1X7XA 1YQTA 1R3UA 1YCFA 1N7GA 4TV8F 4ZEOA 1RMYA 2IDMA 4FE4A 4Q7KA 5A1JA 5BV8A 3OSZA 2P4QA 4PNZA 1IN7A 4EQ6B 2FPXA 4HGPA 1H4SA 1MG0A 1XDDA 3VGPA 4DRZA 1QS0A 3DZBA 1K6JA 3IUEA 4GGOA 4E1BA 1C0KA 2UZ0A 1W85B 2DJIA 3QKSB 4PCVA 1G42A 2ZTHA 1RS0A 3KDSE 1U1IA 3L4EA 4MRPA 5E6RA 4XJSA 1QVWA 1R9GA 3MPUA 5TPWB 5KOHA 5DASA 1FRZA 2JIQA 4F6RB 3QSYA 3ZW9A 4BB9A 4DNFA 3O95A 1UOQA 4IDCA 2PFKA 3WNBA 3AZQA 1MXFA 3WNVA 4TX1A 5CCEA 3EDOA 4UM7A 4C29A 2VOEA 1TPYA 1NWHA 2SECE 1H6CA 1ZJYA 4MARA 3TTTA 1BMQA 3A9TA 4KQFA 4JXXA 3SI7A 2JHGA 1VC2A 4LOJA 5EIEA 1ZNWA 5AJZA 2WMNB 2IEAA 3JYOA 3MTAA 2W6JA 3SR3A 3A05A 1C1DB 2X4IA 4G01B 3ZCXA 2GCIA 4DRXB 4Q5IA 4EA6A 4UTNA 2NN3C 5ALVA 2HQBA 3D4OA 3B12A 3T1NA 2CL0X 1I3LA 4RWZA 1R9JA 3X1KA 5LQJA 4O0LA 3PHJA 4PM4A 2PFGA 3X2FA 1QTIA 2QPLA 4XIJA 1KTIA 4U2DA 1I1OA 1GZHB 1ADCA 2OENG 3NYRA 5KHLB 3TLEA 1QP7A 5E2IA 3N86A 4HQFA 5EKSA 3WV4A 2XZLA 1A3CA 1UXOA 3SZUA 1YTLA 2QX4A 2AT1A 2WYIA 4ZYLA 5C1BA 5CDYA 4I9UA 1X1AA 3KVYA 1OR8A 1RYNA 3IEMA 3NKVA 3GVCA 5SY9A 4Y30A 3COJA 1YL6A 4ZO9A 3O31A 3I0NA 2B35A 2AOVA 2JFUA 3I01A 2BBWA 2BN4A 1DBWA 2BFCB 1PI3A 3EFEA 1AUVA 4TMVA 1NYTA 2GBIA 3KKPA 1DO2A 4KGDA 3ZNOA 4X7MA 5JC1A 1QGUB 3GFQA 2QPTA 3SR4A 2VSOA 2DHCA 3U4GA 3W6UA 4JZYA 4URVR 2HI0A 1XRNA 2PS9A 3I0MA 3EUWA 1XGKA 3CTMA 1W4LA 1GRVA 1O6ZA 2QL5A 4EO9A 3WHPA 1SCDA 1J23A 4J6EA 1KAMA 1XJWA 6CHYA 5F5XA 4C22A 2WTXA 2Q3DA 1E3WA 1KOLA 2LRHA 2VHQA 3LWNA 1H1LB 3TM4A 3Q9UA 3HCPA 3RFCA 4A8HA 1PL0A 3EGCA 3FSRA 5HWSA 2XWBF 3QJGA 3NT2A 1JSXA 5JCJA 2EJBA 1TM2A 5AICA 1MO4A 3OJOA 2DQZA 2GDJA 1IM5A 2PA3A 3ZHRA 2H5LA 4UXJA 3ET4A 4OU5A 4B47A 3O94A 4JLDA 1EDDA 1F60A 4LX8A 4RPIA 5K0ZA 2HHJA 4ECEA 2HMWA 3B85A 1CQPA 2R8RA 3EOAI 3OPXA 1NUAA 4ZO7A 3AEQA 4FC6A 3FXAA 2ZZMA 2XIQA 5HS6A 3K9BA 4QVIA 3D5TA 4WY5A 4OLAA 4IHQA 2F59A 4B3TB 2G7MC 4MVJA 3GFSA 3MLBA 1G6KA 2Y9PB 1OA1A 4R2IA 4CCYA 1G5IA 3OFJA 2VLIA 2WAXA 2F3RA 3FPCA 2ISQA 2OK7A 3S44A 3K9WA 2CFIA 4TLEA 2J3JA 3K4HA 2BEVB 1MAHA 2ZXUA 5CB0A 4HFRA 1Y4DE 1N5DA 1WXWA 5AXAA 4TV8B 4B40A 1MQSA 5HRUA 5IAGA 3WLRA 1FMTA 3ROQA 3ZZ0A 4L4XA 3VR4A 3RHZA 1JR3D 1MOPA 3O1JC 4LRXA 4W1QA 2D74A 1F4LA 2H1CA 5EXPA 1M76A 4DLNA 1QRTA 4QUJA 2FFAA 3K1JA 4Z0TA 3C2QA 4RVHA 4RLHA 2IZZA 3DKIA 4MGYR 3SSMA 5K8UA 3JD2A 3RIMA 4TS9A 3VHQA 4BATA 3EMVA 4RSRA 3PSHA 4QLOA 2LTAA 4RQBA 1P75A 4KREA 1DAHA 2O8CA 1GTJ1 1SVOA 3PC6A 4DS3A 1TQ2A 2XYPA 1DBVO 1KL7A 3IIMA 1M2OB 3IXLA 3U1TA 3GRFA 3DT6A 4AMVA 1DAKA 3GLGE 2YINC 2B4QA 4ROSA 5IZ4A 2C03A 3ZBUA 4DMFA 2DG2A 4HX2A 1JPJA 1UBLS 1V5EA 2R7MA 4OGKA 1XQ6A 3BREA 1ZW6A 1ZI8A 4F45A 4YV7A 3RG8A 4CN8A 1C8VB 1WHTB 2ECKA 3ZCSA 3VH4A 3FYDA 2GAIA 3GMSA 2LKCA 1E2LA 1M2KA 1TF2A 5TIIA 4LECA 3KU4A 3H8VA 5CU7A 1A97A 3UW1A 4ENUA 1NY6A 3AR8A 2EX1A 3HCWA 1M1XB 1A9RA 3LPMA 3RYIA 4ANFA 4IOKA 3EPRA 2OKCA 3K30A 1QFXA 3LBIA 2OZEA 2I2DA 3LXRA 3S8YA 4CMEC 2G08A 1PW5A 4MR8A 5H02A 3SF8B 2WWRA 3TI7A 3HJBA 1A9YA 1J4AA 1VJTA 1M3SA 5AK3A 1YA4A 1JILA 2H08A 2R751 1IK6A 1JQJC 4K8OA 1VBKA 2N9UA 1GZ6A 1T0PA 3KO8A 3ZIAA 5J43A 3JQ6A 1Y3BE 1E7SA 3CH6A 3B60A 3OZ7A 1ML4A 5BOVA 4ZCRA 4W82A 3VC3A 3ANYB 2RKBA 1AIPA 1FBNA 1FDRA 1TZJA 3CVOA 4E32A 3L7YA 5JIBA 2L0XA 2DYKA 2FA9A 2ZBVA 2BEWB 4E3WA 1SUAA 3P0JA 1TEXA 1E2KA 2G67A 1MC8A 1G4HA 3A9UA 3DDZX 4LMBA 5EC8A 3THYB 1W581 1CJTC 1MH1A 3R5TA 5IU6A 3FFWA 2FLKA 2ID8A 3D59A 1L4BA 1AGNA 1OX6A 3FTNA 3HA7A 1MB3A 5C34B 2BBTA 1ZG3A 1OWLA 4RHTA 5HJ7A 2P68A 5F12A 1W7AA 3MZ0A 4Q3KA 1DRUA 4JGBA 4BU1A 1RKBA 3AL2A 3V1UA 2AMYA 2ALJA 1LPBB 2IYPA 1YFJA 1MORA 1SIBE 1T8SA 2HJGA 4MPJA 4BQSA 1Z29A 3B52X 4C78A 3T4PA 3VZBA 2H52A 4LFBB 2FXIA 2NPIA 1KC3A 3UHPA 1DAFA 5JZ9A 1GEGA 5JJKA 3WMXA 1JIKA 3PCTA 4I6JA 1C7FA 1ZJ5A 3OAAA 3A4NA 3DCYA 4KQHA 1GA4A 3I5XA 1SZDA 2VDRB 2W6QA 2VSQA 4OJTA 4RQTA 1RC1A 2ODBA 4B74A 5HBGA 4BQOA 3BVPA 3BJMA 3QVWA 1BDBA 2VH2A 4K3VA 3FDIA 4B8ZA 1NJFA 3ZDXB 3IV7A 4GMXA 5CYFA 1W75A 3L0SA 1A9OA 1R0CA 2Q5JA 3NBKA 4M9RA 3QF4B 1GPWB 4R2HA 1H3NA 3FZGA 4CF3A 4IDOA 4BXOB 3QX3A 1SG0A 4OJNA 4RABA 3LCUA 3ZJTA 2WT4A 3FN4A 3AL3A 3ZDFA 2QLNA 3BEDA 4KQKA 1SN7A 3RTBA 1P8AA 5AVKA 1V8OA 4GPBA 5JECA 2PZJA 1T34A 1HURA 1QIMA 2P27A 5KTTA 4C06A 1W59A 1IHXA 2NQ2C 2ZBRA 3C1AA 4PR0A 1V8BA 2OXIA 1KZ4A 1Y5RA 2IIPA 2DX7A 4FCVA 3T41A 4QTZA 2GSWA 4M83A 1U65A 2XB6A 2ZKLA 3FWHA 3I39X 3V7FA 1NVFA 4FD2A 1BJRE 1CQZA 3WB9A 3EXFA 2UUPA 3EF0A 4YRDA 2G04A 3LC1O 4P38A 2ZBPA 3FBTA 1BXRA 3DZDA 1C2TA 3BCHA 2QMYA 1J33A 4PY2A 5HX7A 4HLCA 4RZSA 1I6LA 2G17A 4Y6PA 1G9TA 4KDCA 1GUBA 4EA9A 3ZH9B 1BHSA 1P2FA 2IQ5A 2QMHA 3IVRA 4R1NA 5K3SA 3ZJVA 1ULUA 4D6XA 3NH9A 3TD9A 4B3SB 4F06A 5F3WB 4J2OA 2NUAB 3RUAA 3SAJA 3BM5A 3HYNA 5JSKA 4DMHA 4DQLA 4X3PA 1UBFA 4C1BA 5IAKA 1EK6A 1WWKA 1BH6A 1C7QA 4NV1A 1NVDA 4HN9A 2H17A 3IS3A 2IUYA 3MOGA 2XXAA 2PH5A 3PUJA 3L02A 3KK0A 2B2CA 2FEOA 2B8WA 3JZIA 2BH2A 4YT4A 3ZS8A 1HQCA 1W1IA 4GLLA 2Z4SA 4PN3A 5JMWA 1SIUA 5C8XA 1MKYA 1XWWA 4N54A 4QGAA 4Q7QA 4YCMA 4FOOA 1SRQA 4L6AA 2GASA 3GIWA 4LKOA 3H6GA 1R4MB 1IN5A 4KLNA 1YVDA 1WXHA 1L4MA 4KITB 2XWSA 3B20A 5KYNA 4ZVUA 1S5PA 4MW1A 4V3CA 4OLFA 1GG5A 1TO1E 1T5DX 3IAS1 1JLKA 2GOYA 5FTNA 3V80A 5G0VA 4TXJA 1OAKA 2JAOA 3NHUA 4A03A 1TU4A 1UXJA 2WOJA 2D0OB 2GAAA 2XODA 4OKSA 4F86A 3KC2A 4B85A 4MDEA 1EBBA 5CVVA 5TF4A 1P6UA 1E98A 2VK4A 2XGGA 3GMIA 4UCFA 1X13A 2LV8A 2RGNC 1JHAA 3MN1A 4I6EA 3L0OA 3E2IA 4FYWA 3NAGA 1ZS9A 4KN6A 4IUCS 3PXAA 3CPJB 4UARA 5C3UA 3NTUA 4GMGA 1TZKA 3P45A 4ZU3A 1D2RA 3GPIA 3L8GA 2FSGA 3WL8A 5KS2A 2MHCA 4GD3Q 3HY4A 3UFXB 4Z4CA 1OD6A 3MA0A 1E1RD 4DR2B 3BHJA 3R3VA 3TZEA 5F4ZA 2QUBA 4MROA 1HETA 3LO8A