1LPMA

A structural basis for the chiral preferences of lipases
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
534
structure length
534
Chain Sequence
APTATLANGDTITGLNAIINEAFLGIPFAEPPVGNLRFKDPVPYSGSLDGQKFTSYGPSCMQQNPEGTYEENLPKAALDLVMQSKVFEAVSPSSEDCLTINVVRPPGTKAGANLPVMLWIFGGGFEVGGTSTFPPAQMITKSIAMGKPIIHVSVNYRVSSWGFLAGDEIKAEGSANAGLKDQRLGMQWVADNIAAFGGDPTKVTIFGESAGSMSVMCHILWNDGDNTYKGKPLFRAGIMQSGAMVPSDAVDGIYGNEIFDLLASNAGCGSASDKLACLRGVSSDTLEDATNNTPGFLAYSSLRLSYLPRPDGVNITDDMYALVREGKYANIPVIIGDQNDEGTFFGTSSLNVTTDAQAREYFKQSFVHASDAEIDTLMTAYPGDITQGSPFDTGILNALTPQFKRISAVLGDLGFTLARRYFLNHYTGGTKYSFLSKQLSGLPVLGTFHSNDIVFQDYLLGSGSLIYNNAFIAFATDLDPNTAGLLVKWPEYTSSSQSGNNLMMINALGLYTGKDNFRTAGYDALFSNPPSFFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LIPASE
publication title A Structural Basis for the Chiral Preferences of Lipases
pubmed rcsb
source organism Candida rugosa
molecule tags Hydrolase
total genus 190
structure length 534
sequence length 534
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 1995-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00135 COesterase Carboxylesterase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1lpmA00
4X92A 5A2GA 1N1MA 2H9YA 4X95A 3H2IA 1J06A 2DSNA 1N5MA 3Q8WA 5HZGA 2Y6VA 1H2ZA 5JZBA 4YX9A 2ZSIA 3PUHA 4FFWA 5DJ5A 1QLWA 1MPXA 3FLAA 4Y2YA 2WJ6A 1UK9A 3FVRA 1E3QA 2XUAA 3FSGD 3WL6A 3F97A 5ALEA 4EBBA 4CCYA 5DLPA 4DMHA 1TCAA 4FBMA 5D7BA 1ZOIA 1P0QA 4QE3A 2WM2A 1CUDA 5FLKA 1BN6A 1XZEA 5IKXA 3H1AA 5C81A 1GT6A 2XMSA 2O7VA 1YASA 2PUHA 2K2QB 3DD5A 4H18A 2WUFA 4BCCA 2HA7A 3CXUA 3IVMA 3O4HA 5AM1A 2C5FA 1W76A 3DKRA 2WFLB 3A70A 3D5EA 1XZDA 4KACA 1JKMA 1BROA 1XZLA 1YB6A 2RONA 3D0KA 3TEJA 4JYMA 3KD2A 3QMWA 1AGYA 1LPMA 5ALJA 4E14A 3I2GA 3WK8A 4RPCA 4LIPD 1CUZA 3C8HA 1XQYA 4KRXA 3WKAA 3S2ZA 5AM2A 5EHXA 2BAGA 4B9EA 2XUFA 3V1NA 1NU8A 2O7RA 1VE7A 5AKEA 2QTBA 1ZJ5A 3R3YA 3FBWA 4KAAA 5LP1A 2X76A 4PSUA 4OPMA 3G0DA 3Q0TA 4WJLA 6YASA 1DQYA 1W6RA 1O6FA 3DKKA 2J4CA 4QWMA 2OLEA 1ETHA 2HU8A 4EZIA 3WWCA 3UUEA 1T4MA 4F0JA 3FYUA 1YCDA 4BAGA 2CUTA 2H1IA 1JJFA 2HA2A 4Y2VA 3C6ZA 2YXPX 3DLTA 1EK1A 3IBTA 1GKKA 2HRRA 2HU5A 1UKCA 3U0VA 3BDIA 4ARBA 4IH9A 5K3FB 3CCBA 4QNNA 5CW2A 3F67A 3PUIA 1XZFA 3W9UA 1EB9A 3IDAA 4I19A 3CN7A 2QXTA 3ED1A 4BAZA 5LZ9A 2DR0A 5ALWA 2HFJA 5AIAA 2C58A 5CT6A 4C87A 2XDWA 4M0FA 4K2AA 2JGMA 3X3HA 3G0CA 3LIIA 4BC0A 4UBNA 4H7DA 3FNBA 3I6MA 4L3WA 5LZ8A 1EDEA 2OAEA 2V9ZA 5KWIA 1G5FA 2R11A 4U2GA 3C70A 2Q0XA 1YAJA 3WZLA 2JGIA 4MJ3A 3RLIA 3OG9A 2XMBA 1YAHA 1EVEA 1XKTA 3MUNA 4MWTA 3IUNA 1HL7A 4J0IA 3WYNA 3FWHA 5JZSA 1EHYA 2C4HA 1VLQA 3NUZA 5E4TA 3D4LA 2XQGA 4J0KA 3TJMA 2ACEA 4ETWA 2ZYSA 4KYVA 4JYPA 1MT3A 5CT9A 4ITVA 3STYA 2XMZA 4BRZA 5JAOA 3WK9A 1G66A 1TK3A 3AINA 3ANSA 3ESDA 1OCEA 1QIHA 2HRQA 4PW0A 2CB9A 2HIHA 5AOAA 5J3JA 4AZ3A 1EK2A 1MN6A 2RAUA 4PQEA 1UFOA 2AJCA 5AKKA 5FPPA 2PX6A 2QR5A 1O6GA 4BTLA 3G8YA 3CCCA 2B61A 1JFRA 2LIPA 1XROA 2DHEA 4X71A 3KSRA 3MGAA 2J3DA 3DS8A 1VJ5A 4XX1A 2QRUA 1DINA 2ZYRA 2OCLA 5C7YA 2VAVA 4AO6A 5EHQA 2BKLA 5AP9A 4B83A 5JZ9A 2QUBA 3WWDA 1TKRA 4FNMA 3P2MA 1AUOA 5ALRA 2PSHA 5BWCA 4Y9SA 1FFBA 5ALTA 4M0MA 3DOIA 3JW8A 3R3VA 3QVMA 5DNWA 4OSEA 1C7IA 2WKWA 3WK5A 3F96A 1IVYA 3W04A 5DNVA 5FPQA 3WMRA 5LZ7A 3RARA 4J0DA 3I1YA 2PU5A 4BAUA 1CQZA 3LLCA 1Q0RA 3O4GA 1EI9A 5AI9A 3DNMA 1UWCA 2BUAA 2XMQA 4GHWA 1AMNA 3GUUA 1DT3A 4AN0A 4U2FA 4ZXFA 4HAIA 4KAFA 4DLNA 5JADA 5FRDA 3A6ZA 2BCEA 5EHZA 1WB5A 5AO9A 3BIWA 3N2ZB 1TCBA 3C45A 4B81A 4G8DA 3E1GA 1XZGA 1YSCA 3AJAA 2PUJA 2XQJA 2VATA 5AK4A 1ZI6A 3DEAA 4IHAA 1WCYA 1SCQA 2XUQA 3ZPXA 1QJ4A 1XRMA 5FKJA 3QMVA 3WWPA 2WFLA 1CUHA 3C5VA 4KJXA 4UFNA 1TIBA 4BATA 5ALDA 4J03A 5JD6A 2GZRA 1MNQA 5IVDA 4W1PA 3DYIA 1UOOA 3ILSA 5JIBA 5IH7A 1HBJA 5H3HA 4DMKA 1WPXA 5LZ4A 3O0DA 1LGYA 1E8DA 1BCRA 1UK8A 2ZJFA 3K9BA 3CN9A 5A7HA 5HQ3B 4C4XA 2VJBA 3C6BA 1LPOA 3DCNA 1YB7A 2PSFA 3T52A 1TCCA 1DX4A 1CPYA 5LKRA 1ODCA 4XVCA 3C6YA 4XWGA 2G4LA 4NMWA 3IUMA 2B9VA 2OG1A 5AI8A 1H2XA 4UBLA 4NZZA 5CH5A 1RYYA 2I03A 2XUOA 2J3QA 2XT0A 4W63A 4LKOA 4N8SA 1GGVA 1K4YA 5ALGA 1UOQA 3NWOA 5HKBA 3B12A 2AJLI 4IO0A 4E15A 1QO9A 2HA6A 1K8QA 4J0HA 3GELA 3QMMA 1SOMA 1AZWA 3QITA 4Y2JA 3IA2A 2PSDA 1XRQA 5K3FA 1F6WA 2Y6UA 2FJ0A 3V1MA 3WQHA 1XLWA 2XMGA 1LPNA 4B7ZA 1F0PA 1S8OA 3D2BA 4ZI5A 3KOOA 5HF8A 1A8QA 1R9MA 2XUPA 3IURA 5AM0A 3DJYA 1BEZA 1K63A 3I2IA 3O4IA 5LLSA 3W2TA 3HI4A 2PBLA 3ZLVA 4KE9A 2W6CX 1A8UA 2O2HA 4OU4A 3WYDA 4X94A 5BWBA 2ZVDA 4CG2A 3OURA 3DQZA 1J1IA 4OD0A 3MVEA 4GDMA 5JAUA 1MTZA 1CUFA 1XRRA 2XQKA 2WUDA 5EFZA 2BGNA 4FLMA 4BP9A 4QDXA 2DQZA 1MX5A 3ZV7A 3WIOA 2I3DA 5A62A 2HL6A 4RE6A 5K3AA 2GBIA 1Z68A 2PSEA 4OUKX 4H35A 1ZGCA 1GQRA 4UBOA 5IVKA 3I1IA 4AMZA 2WHPB 1TAHA 1VE6A 1R88A 4X97A 5JARA 2C0PA 5AI6A 2G5TA 1HPLA 1LPAB 5AI0A 1F0NA 1G4HA 2XUJA 2XMRA 1UXOA 4ROTA 3WWOA 1U65A 5JYCA 2QKYA 1OILA 1EINA 1MO2A 4FWBA 4AN1A 3WKDA 4H7KA 5ALOA 5ALYA 2WU3A 2GBCA 1IZ7A 3RK4A 4ZREA 1U8EA 3E4DA 4FLEA 1GQSA 4U2CA 4Y2RA 1JI3A 1DU4A 1R4ZA 1MNAA 4OU5A 5AKLA 5AI4A 1BN7A 3QPCA 1L7AA 3LS2A 2ORYA 2CBGA 1QE3A 1FFDA 1B6GA 1W52X 3I2KA 5AKIA 1VA5A 2JIDA 3RM3A 2VSQA 1CUEA 3WK4A 2G5PA 1MU0A 2PL5A 5ALPA 3H1BA 4OYLA 4MYDA 5AKZA 5HFAA 4XJVA 4AZ0A 1CUWA 4J0CA 5K3CA 3BE8A 4V2IA 4BVKA 4H7JA 1MJ5A 1U4NA 1Y7HA 2PPLA 4K5QA 3AZPA 3FCXA 1T2NA 1JMYA 3STWA 4Y2QA 4UPDA 1XQXA 3WL8A 3WK6A 1HLGA 2AXEA 4P9NA 3TGLA 4KRYA 5HF5A 1EB8A 3ZLTA 1UK6A 2GYWA 4MXDA 4B85A 5AKHA 4L9AA 1UKAA 5CMLA 5ALVA 2XUIA 3H17A 4LYEA 3WKCA 5C8XA 3I2JA 5K3DA 4UFPA 3WJ2A 5ALMA 4X3CA 5JASA 1VOTA 4H7HA 3D2AA 5BOVA 3BJRA 3STXA 3FCYA 2VJCA 4BE9A 1MAAA 2XI4A 2XUGA 2Y1KA 2E3JA 4F60A 5ALQA 4OYYA 1WM1A 2XUKA 3WL7A 2XMDA 1X70A 4DMFA 1MX1A 2JGJA 3DDUA 5KREA 5JAHA 2QUAA 1AKNA 4GWLA 2OGTA 1AQLA 1CUUA 3VJLA 4Q34A 1USWA 4S0XA 5ALZA 1XZIA 1VZ2A 3OTQA 1ORVA 1XQWA 1IUPA 2OGZA 4KEAA 4PO3X 1J2EA 2ZSHA 2VT7A 1L7RA 3MUOA 4HZGA 3HYSA 3G9ZA 1GPLA 4BCDA 2XUDA 2JEZA 5HQ3A 4YK7A 1YR2A 1KEZA 3R3UA 4KE6A 1G42A 1XLVA 2CZQA 4DSAA 3HABA 4U2DA 1HQDA 3H2JA 4QDZA 2Y2VA 2BFNA 3PF8A 4E46A 1THGA 1EA5A 4QDUA 4X85A 1XFDA 1GXSA 5AOCA 3ICWA 1BS9A 4UBKA 5K5EA 4EY4A 1LLFA 3DL7A 4BP8A 4N5IX 4X6XA 4JEIA 1ACLA 3HXKA 3IUJA 3S8YA 4CIBA 1XRNA 3G0GA 5YASA 4Q82A 4UFOA 4Y2XA 2AJBA 1WOMA 4W1RA 4G4GA 4UHHA 3VJKA 4L0CA 1QZ3A 2PSJA 4ARAA 4W9RA 1R3DA 5AJHA 5I8PA 3GROA 1FFCA 4P93A 2FUKA 3FVTA 1LPSA 2WIKA 4EY8A 4MYSA 2VT6A 1EDBA 4FMPA 3YASA 3L1JA 1QIDA 5JD5A 4G1FA 1Q84A 2VJDA 4PSDA 1WB6A 3VKFA 4KR0A 1VXRA 1EX9A 2CMFA 3O9VA 1ZD2P 2EDAA 3G7NA 2WU4A 1Q0ZA 4BCBA 3SX4A 2C0QA 3OC0A 1NU6A 3QPDA 2O2IA 2OXEA 2QXUA 2WTMA 5AM5A 2WHPA 5KWJA 2IX9A 2ZJ7A 4G9GA 1VZ3A 5LZ5A 1P0PA 1QIJA 4LXGA 2DFPA 3AIMA 2CEKA 4K6HA 4MWSA 4B9AA 2O2GA 1WPRA 4N5HX 5C8ZA 3EBLA 1QONA 2DCMA 4C4ZA 4Q3LA 1XKLA 1DTEA 3R0VA 3C43A 4WFJA 5IVIA 3HSSA 3PICA 5A6VA 1QOZA 2WIJA 2WILA 4OB8A 4Y2TA 3DOHA 2YASA 4CI9A 4KE8A 4DIUA 4QLAA 5E4JA 1JJIA 3IULA 1CUXA 1Y37A 5AHXA 1QO7A 3FLEA 1M33A 2CJPA 5DYTA 4GEGA 4J0JA 3H19A 5DTJA 4LHEA 2QS9A 2ZYIA 3FLBA 5EHNA 5JAPA 4IQ4A 1C7JA 2VA9A 3HJUA 3UUFA 1EDDA 5JALA 3PF9A 1YS2X 2JGEA 5CXUA 4AX4A 3WL5A 4FNGA 3AUKA 5I9IA 4H77A 5DTIA 3VISA 5K3EA 4HRXA 4E11A 1XQVA 1BRTA 2DQYA 4BYMA 1K5PA 4TVKA 3U1TA 2NW6A 4BC1A 1X2EA 3I6YA 2ZYHA 3BJMA 4CG1A 4J3JA 4DNPA 2QJRA 3WIBA 3VJMA 5DYYA 3VXKA 2RHWA 2V98A 2XMCA 1TQHA 2BGRA 2C7BA 2FX5A 3ESAA 3DYVA 5D6OA 2RHTA 3T4UA 5LIPA 4BDSA 4AXBA 2WIDA 1DWQA 2IITA 2HM7A 5SYMA 2J4FA 1QIIA 1FSSA 3FYTA 3VDXA 1GZ7A 4YASA 2ONCA 5EGNA 2PM8A 4B6GA 3EQ8A 4DM7A 5FXMA 2HADA 3N0TA 5D3KA 3BIXA 4BRSA 1A7UA 3ICVA 4OB6A 2HFKA 2YYSA 2HDWA 3B5EA 1K6EA 4C01A 1ZD4A 3AZQA 2ECFA 2QOEA 4UHDA 5T4EA 4EY6A 1GKLA 1R50A 1BE0A 1UZAA 3QPAA 1E5TA 2RI6A 4JNCA 4XIIA 3LIPA 3B3QA 4Y2UA 1ODSA 1U2EA 5AH0A 1C4XA 1RP1A 5HK8A 2PVSA 1ZI8A 1CUJA 4FTWA 3OOSA 5ESRA 4DNFA 5E2IA 5ISMA 4QWWA 1PFQA 4UBIA 2WG0A 4EB0A 5C8VA 3EF3A 1J07A 3WKEA 1SCIA 2HU7A 4GBGA 2QMQA 1OXMA 5HK9A 4ZV9A 4B0PA 1CRLA 2WHQA 5D3ZA 4X91A 4H0CA 4BDTA 1H22A 1IMJA 4DSZA 2ACKA 1RWQA 2I78A 1I6WA 4HTAA 1CUCA 4UHCA 4W1SA 5ALLA 3IIIA 4RGYA 3I28A 5DYWA 2WG2A 4BVLA 1QFSA 4O08A 4W1QA 3WWEA 1DQZA 1UKBA 4WY8A 3AZOA 3QBJA 4GI1A 5FV4A 2WTNA 4A16A 1P0MA 3L1HA 2RIPA 3M3DA 4WY5A 3GZJA 4LXIA 5JATA 4GECA 4WFIA 1XLUA 1YS1X 1EXWA 4UHEA 4UBJA 4YPVA 4DGQA 1A8SA 4Q1VA 4ZV7A 4FHZA 3K2IA 5AK6A 2QT9A 2OQVA 1ZI9A 4U2EA 1EVQA 2VJAA 4NS4A 2GYUA 2Z3WA 3SK0A 4X7BA 1DWPA 1IZ8A 2QJWA 5K3BA 2BUBA 2GYVA 3GA7A 5AK3A 1LZKA 4OB7A 1QTIA 3UMJA 1ZIXA 4X90A 1QIMA 2WFMA 5DNUA 2AJ8A 3C6XA 4K6GA 1FFEA 2XUHA 3M83A 2D5LA 2WHRA 1QIEA 3EIOA 1E66A 3QM1A 3BF7A 4DMCA 1L7QA 5HF6A 4OCZA 2WIGA 5AKJA 1ZD5A 4FLFA 3R41A 4P92A 3WKBA 2XB6A 1AURA 1F8UA 2D0DA 5A7GA 4JH0A 4B82A 4FKBA 5ALXA 4B84A 2OCKA 3C87A 3H2HA 3D59A 5SYNA 1CIJA 4WDRA 5JD4A 2GBGA 3F8SA 3M82A 2QZPA 3G0IA 5CXXA 4F5ZA 2Z8XA 1KU6A 5F4ZA 2P8SA 4INZA 1XZAA 1ZD3A 4B0OA 2UZ0A 3D2CA 3AFIA 1XZCA 4FDMA 4G9EA 4J7AA 2JGLA 1QIFA 2DHCA 1AC5A 4C89A 2DHDA 2H7CA 1JMKC 4P08A 1CUSA 1LNSA 5T4HA 3TRDA 2IIVA 3HACA 4RNCA 3FOBA 4AO8A 4BE4A 4H7FA 3V9AA 2G63A 4H7IA 1Y7IA 1ZJ4A 1CLEA 1ACJA 3A2NA 2ES4A 3ZWQA 5ALIA 3WK7A 5CH3A 1UT6A 1DWOA 5ALSA 2HA4A 4NVRA 4QLOA 3EQ7A 5ALUA 3VVMA 4Q3OA 4PV7A 2XQFA 2ROQA 3KDAA 1YA8A 2XLCA 4C4YA 1LPPA 5AIBA 1CQWA 5LKAA 4HS9A 3ZLUA 4AMYA 3G9UA 4GLBA 3HZOA 3E0XA 4Y2PA 2HA0A 5I7UA 2ZJ6A 4QDOA 2B20A 3HEAA 1H2YA 3NOXA 4KAJA 1HKHA 4KE7A 5JANA 5AI5A 4Q05A 3PFCA 5AKGA 3FSGA 4Q3KA 3KWJA 1JU4A 4LYDA 1VKHA 4G8BA 1YA4A 1X2BA 1GPKA 1MX9A 3GBSA 1W75A 3R40A 2YH2A 1XZMA 5EIHA 2WG1A 4IH1A 3KXPA 4ZWNA 3L1IA 3D3NA 4QA9A 5CBKA 5A71A 1H2WA 4QDTA 3E3AA 3A2LA 3WA7A 1CVLA 3BF8A 4CIAA 4EA6A 1W1IA 5A7FA 1CUGA 3PE6A 5CTAA 2C5GA 2OCIA 1XRLA 3SWWA 3WJ1A 5EI5A 1QIKA 1D07A 3W05A 1CUIA 3HLKA 4BTVA 3ESCA 4G8CA 1E8MA 3STTA 5LYYA 5AK5A 1LBSA 4X93A 5HCUA 4UHFA 1XZJA 2WQZA 3EQ9A 2R8BA 1XZBA 4QEKA 2OCGA 4MEBA 2V96A 3OM8A 3R3ZA 5EIEA 4U2BA 1LPBB 4FOLA 4EUSA 2OQIA 4TPKA 2WJ3A 5ALFA 3BWXA 3WA6A 2WFZA 3NGMA 4M0EA 1SC9A 1KU0A 3IB3A 1NX9A 4CCWA 5IVHA 3QH4A 4C88A 3SC2A 5AICA 3WI7A 1PJAA 2CKMA 1ZGBA 4I4CA 1JU3A 2BUCA 5FOQA 1QIGA 3G9TA 3QZUA 3H18A 3HC7A 1ODTC 3G9XA 3PI6A 1ZIYA 4ZRDA 2Z5GA 4X6UA 2V97A 5AOBA 4IH4A 3C5WP 3F9CA 3I2FA 4Z49A 4CCYB 4JUIA 3QYJA 4WDQA 4BBZA 4EY5A 1BCSA 1SCKA 5ALHA 1FFAA 2AJDA 2BJHA 2GBFA 3VVLA 2JGKA 1CV2A 4HXFB 2EEPA 1UOPA 3DL4A 3W06A 4DNOA 3M81A 4FFVA 4RE5A 1R9NA 3C8DA 5ALNA 1E89A 2X8BA 4PF1A 4GW3A 5CT4A 5CH8A 2QVBA 1CUYA 1SFRA 2WUGA 2JBWA 2WLSA 2Z8ZA 1EH5A 1DX6A 1IUOA 3JYHA 4Y2SA 5FUMA 1JJBA 1VXOA 7YASA 1IUNA 1A88A 3STVA 2JEYA 3GFFA 1QFMA 3H2GA 3RKSA 4H7EA 5CURA 4MQMA 2H7YA 2EDCA 3LCRA 4AO7A 3I2HA 5CRIA 4WCVA 4UUQA 4MEAA 1ORWA 5LZ2A 3AIKA 4MQLA 4AB1A 3ZI7A 1XRPA 1DT5A 3G0BA 4L72A 1WHTA 3STUA 2FJPA 5HF9A 1P0IA 1ZICA 5T4BA 3IUQA 4F21A 5AM3A 3H0CA 4HRYA 3AIOA 1Q83A 4D9JA 4PSCA 1MAHA 4DTCA 4J0GA 3O9MA 2XE4A 4G4IA 4A5SA 5AKYA 2Z3ZA 4Y7DA 2JF0A 1UK7A 5FP0A 3FYUB 4HVTA 3BL8A 1N8SA 4PNZA 4B80A 4UBMA 4FBLA 2I3ZA 1CEXA 3JWEA 5E4YA 3D7RA 3OPMA 2JGFA 2QM0A 2VQ6A 1LZLA 1H23A 1BU8A 4LXHA 4N8EA 3WLAA 3BXPA 1QGED 4EY7A 1N5RA 1CUBA 3V1LA 3R3XA 3O95A 2PKYX 4DNQA 3ANTA 5EIAA 1CR6A 4N8DA 1CFJA 2PU7A 5DWDA 2VF2A 2WSLA 3HRHA 5T4FA 4G4JA 2Y2UA 1AX9A 4X00A 5HFNA 3PFBA 3O4JA 2WIFA 3G02A 3ESBA 2OPHA 4G5XA 3FAKA 2XQIA 2GZSA 4HXGA 3PDCA 3V48A 4UHBA 1WHSA 1E8NA 5CT8A 2B4KA 4BZWA 2WUEA 1XZKA 4BZZA 3V1KA 2HA3A 2XLBA 2VTVA 1R1DA 1ISPA 5AM4A 3A2MA 3BDVA 1W4LA 2H7XA 4EHBA 1BEEA 1GPNA 2HHAA 2X5XA 3W9BA 5BV7A 2W22A 3AILA 4A23A 1QTRA 4BVJA 4ZGBA 3R3WA 1CUVA 4TGLA 1XZHA 2RGUA 3KWFA 3WZMA 5FDFA 2VAXA 5ALKA 1LBTA 3F98A 4BB0A 3I6ZA 2OAGA 1JT2A 4HXEB 1VA4A 4DYHA 1THTA 3K6KA 4I3FA 4CFSA 1PV1A 3LP5A 5AKXA 4X6YA 4WFKA 2HA5A 3H2KA 4AQDA 4CG3A 4C6HA 5HKAA 2VEOA 4K6KA 1B41A 1WB4A 3H04A 2WJ4A 3FYUC 1HDEA 4GXNA 1CUAA 5KBYA 1FJ2A 1TRHA 4QZVA 5CT5A 2OGSA
chains in the Genus database with same CATH superfamily
4GPTA 3F46A 1Y8RA 5LA6A 2IY7A 4X95A 1V7QA 3QVKA 4PWYA 4CYMA 3IKMB 4UJ5A 1CQIA 1A1VA 4CEJB 1ZL0A 5IP5A 3KEMA 3ZQJA 5K3OA 4MK4A 4FM9A 3OQNA 2DQ4A 1COWA 3KHKA 3WBKA 1XDGA 1YL5A 2X5KO 2GSDA 4CUJA 3GYBA 5HZGA 4R1SA 3GAAA 2QSUA 1XCOA 1HORA 4H1HA 1S01A 3ZHUA 2ZU6A 2ZSIA 4X20A 1FDVA 5GJVC 2HSJA 3WLNA 1TTHA 2PV0A 4II3A 2PE5A 3KU4A 4I5GA 1XCMA 1JLKA 3WRXA 1AKWA 3FLAA 4I66A 2VH2A 3WWZA 2H54A 1SVIA 1N9KA 3LDGA 3NATA 1UK9A 1JHOA 1FXUA 3FVRA 2OWDA 3I9LA 2UZAA 4C0JA 2D62A 4MV6A 4FFLA 5K0LA 2XUAA 5F9FA 1X9HA 4HEA1 2WWTA 1E3LA 4U7FA 1T8SA 4DCPA 4K0KB 4IQ8A 3EXIA 4IIFA 5EMLA 2XNDA 5DLPA 3UY4A 4ER6A 1AO0A 1RT9A 1CX9B 3PT9A 4ZO4A 1BD4A 4M83A 3NRJA 4FBMA 4L0QA 4JXJA 4PNPA 1P0QA 2H1WA 4N54A 4TTSA 4BN0A 2WM2A 4JC4A 5FJIA 1BN6A 2HOQA 2IZZA 3A32A 4ENVA 4MUBA 3H5TA 2CWDA 2QV7A 3ORFA 1TJ3A 3VI3B 5KO2A 4L2IB 1VIMA 2PFSA 5C81A 4MUAA 1XTPA 2CV2A 1KBZA 1YDGA 4BVFA 3OFKA 1TMOA 3T3NA 3I53A 4BX0A 2E85A 5F3WB 4HGPA 2A5YB 4OJKA 3V1UA 3JVDA 1YASA 1G20E 2IYZA 3FKJA 3KKOA 5C52B 2M6RA 1Z18A 2BM1A 2K2QB 4H18A 3C3JA 3QKSA 1JKJB 2MSKA 1MA0A 4BQOA 4B47A 4UTRA 2HA7A 1FFYA 3TLZA 1F9EA 5AM1A 4QTXA 5FPTA 3JQ7A 2NQ2C 2PMDA 2L19A 1RI1A 4KACA 2ZJOA 4MQFB 3GJ5A 4JJFA 1J97A 1WQ1R 2YWFA 5JSKA 4FE3A 2N42A 3JASB 1XVVA 2KQUA 3OC0A 2YWJA 5MGNA 3F3YA 4ZCPA 3EZNA 1MQSA 1JDNA 2HMYB 2I8LA 3DBRB 4MO9A 1L7MA 1OU0A 5FH9A 1YZHA 3O21A 5JWOA 1A9ZA 2E55A 4BQSA 1WEKA 4EVRA 3I2GA 3WYBA 1K5HA 2G9RA 4DY4A 1FS5A 4JLVA 5KOHB 1MRNA 4QDKA 1NSTA 4RW0A 1J8MF 4PZPA 4MA4A 4CIXA 4XI9A 2ZK7A 4CT0A 4KDEA 1JA0A 4A2CA 2NP6A 1TM3E 1Q0PA 3PPYA 3TOSA 5THQA 5EHXA 3FW1A 1Q50A 1YZTA 3GRCA 3C3YA 3TZKA 4GMGA 4KRFA 2G1PA 1TJNA 4HI0E 4K9OA 4YHHB 3HWWA 1F5NA 1AG9A 1N9GB 1ZBDA 2WSMA 2HZBA 1I1HA 1LU9A 1OREA 2XD9A 2O7RA 3VBCA 3F6YA 5FD8A 3O8RA 2Y0PA 4UNIA 3EXAA 3HJAA 3U4IA 4XR4A 4US0R 1WDLA 3SC3A 2OE2A 1EFTA 1NBMD 1UKEA 2X0RA 4JC8A 3AJ8A 3EUWA 4G0VA 5I9TA 3L0OA 2ZRMA 3JQFC 4DYVA 4IUDS 1SU4A 2P9YA 4WAUA 4OLHA 3SG0A 5CDYA 4PBRA 4YALA 3RYCA 4N76A 3AI1A 3LKBA 3UJCA 4XTCS 5EZYA 1CR0A 1DQYA 5IKOA 6YASA 4IIGA 1NYQA 2KW5A 3A11A 1I7LA 1AHHA 1MW9X 1LXCA 3T41A 1GKUB 4RVHA 4CDRA 5EP1A 2VQFB 4ZVKA 1Y5MA 2Y0DA 2EEZA 1IEWA 2IYYA 2DU8A 2OMKA 5CCEA 3F49S 2OLEA 2A9KA 2VAWA 3VZBA 2HU8A 1ESZA 2K5UA 4F12A 1Z82A 1ODKA 4EZIA 4UCWA 4RDCA 4X9XA 9MHTA 1JRLA 1E9FA 1EVYA 3OCJA 1JV2B 2P6MA 3I92A 1WAMA 3EN0A 4U0KA 5ILGA 4BMDA 3V7FA 4F0JA 4L74A 1A9RA 4KQ1A 4OM8A 4FHFA 4K9NA 3EMBA 4RO0A 2BKAA 3K9GA 2XH8A 4FQ7A 4ARSA 1UDAA 4BAGA 2CXHA 2VR1A 1UADA 3LY7A 1SXIA 4EOGA 1G63A 3OHSX 2FPSA 1BDJA 4MDHA 1S4MA 1LQTA 1L5VA 2GLTA 2J8ZA 2AQHA 2YXPX 3DLTA 2IVFA 2XHEA 2JFPA 3R6TA 4GEKA 3JARB 3OU6A 4LX8A 3UFBA 1N25A 2ZR7A 1UKCA 3AFNA 2XXBA 4IEIA 1MGPA 5GINE 3L4JA 3AESB 3OETA 1BYUA 1PUJA 2XNHA 1PTKA 4IH9A 3FJ1A 3LYAA 3TW8B 1A98A 3W2EA 3NVAA 4NESA 1G16A 3ZIUA 3MMZA 5D2CA 1NJ6A 3PGA1 1CNMA 1C9NA 3RBVA 3BXGA 3F67A 3IPRA 5WRFA 2G76A 3PUIA 1FBTA 3VV3A 3W5CA 5KDDA 4C7OB 1FP1D 3QVTA 4EJFA 1ZH2A 2ZIZA 3KV1A 4LGYA 2Z9BA 2JJQA 2Z1DA 2G77B 1P45A 4RDXA 3I4LA 2FW7A 3ED1A 4XZ3A 2J9FA 5BO5A 4GOXA 5ALWA 2HFJA 4B48A 2C58A 4UCQA 3L8MA 3CZAA 4WOKA 2XDWA 5C8YF 2XD4A 4NENA 3VZSA 4CKWA 2JGMA 3D5TA 1PO7A 4HNAB 4YR9A 1V8OA 1RAHA 4ZOAA 2ZJ3A 2AI3A 2AG1A 2YBEA 1RBMA 3OD5A 4UEQA 1C41A 1CRZA 1SCUA 1MENA 2AN1A 3NUGA 5D1NA 2EZUA 2QXYA 2VXYA 4I1OA 2COEA 3IYLW 3JQGA 4A7PA 1P8AA 5LBIA 1P6UA 1BJTA 3D8HA 5DV9A 2IHTA 4L3WA 5CTJA 5F4BA 3DWGA 2DXIA 2JBAA 3KQOA 2EVWX 3ZLBA 4AMBA 4PC1A 5BXQC 1EX7A 1ZNQO 1G5FA 4OQEA 3S2IA 3C70A 2JH3A 1U3GA 1BYIA 3Q10A 2AN3A 1FXWF 1AKYA 4FYIA 4UPVA 3WZLA 1G20B 2FSFA 3D4PA 3CM0A 3L9WA 3QP9A 2X1MA 3PTAA 4RQAA 3N53A 3RLIA 2PRYA 4ZDKA 1N33B 1XYYA 4GQAA 3DMTC 3Q6MA 4NYJR 4KQWA 5ICSA 4MWTA 2V6IA 4EGJA 1VMAA 1HA3A 1NATA 4NFHA 4WGFA 2E4YA 3A9TA 3BMOB 5BV0A 2XCLA 4HX9A 4OJQA 3FSJX 1T4CA 1NUQA 3L0CA 5JZSA 4P81A 2OK8A 1AHNA 4UC0A 4MVJD 1HEYA 2JI9A 2KM1A 3GY0A 4B45A 4FINA 4D80A 3BWYA 1A9PA 1M0TA 3C3EA 2ZYAA 3D7NA 4J0KA 4RKEA 4RF4A 3BE4A 4RH3A 5L3ZA 3N7AA 4WINA 3TJMA 3IS3A 5K20A 3R7WA 1YDHA 2NZ2A 2KHZA 2ZTLA 3CHYA 2ACEA 2ZJYA 3COPA 3QBTA 4PGHA 3ZI0A 4R68A 4PXSA 2OYCA 4NE9A 4KYVA 3P97A 3EGIA 3OX2A 1MW8X 2O7QA 5D5QA 2IYVA 3U4QB 3E3MA 3OQMA 1W2WB 1LTKA 1GCGA 1NTRA 1FX0B 1R8QA 3Q3HA 1JJ7A 1I4EB 4OA8A 1RJ9A 5F2EA 4ZU6X 2M6SA 3AINA 1OXUA 2WI8A 3VH2A 3RPEA 2RDMA 2Z2XA 1OCEA 3E5RA 5J4YA 1DIOB 2EGHA 3EVEA 1ADFA 2R8XA 1N6HA 1NR5A 1YKSA 2CUNA 3LT1A 4I9HA 4KOEC 3D7SA 2OYRA 1VJCA 3QU4A 2AJTA 3WL3A 2DERA 2CB9A 1VC2A 1F1BA 2IHBA 2R1TA 2ZUWA 3N2EA 2ZPUA 1Y3FE 4LDQA 2C2GA 5JXHA 2YOFA 4GICA 3N8HA 4JBXA 5D86A 4ZA2A 4AZ3A 3S1LA 4EHNA 3JQFA 4H1WA 5EFOA 1R4AA 4RTSA 3RKUA 1EK2A 2P68A 1ITZA 5CA1F 4GE3A 3ZDDA 1UFOA 2CFTA 1C7EA 1XEFA 5FPPA 2QR5A 5CHYA 2WF9A 3GBVA 4EO4A 1F8XA 1GG8A 1M6VB 4TZ6A 2HTEA 3RK1A 1H2BA 3D4IA 4I81A 3UATA 1KZ6A 1TM2A 2DHEA 2ENUA 3BULA 1TVKB 3LYHA 4LGVA 4YMSA 5DP2A 1C0PA 5DTRA 5KYVA 3SXUA 3VPSA 3HE3A 3AB8A 4Y2HA 4RYLA 3RDPA 1KH2A 3I4FA 5LQUA 2HXSA 4HWRA 5LB2A 5T64A 3LX6A 5JCOC 1ZNYA 1GYPA 2GWHA 5B58T 4ZMRA 4FMBB 3F74A 1ISJA 5JNRA 1V43A 3FROA 5DBOA 5BRNA 4J7CA 2RH9B 5C7YA 1W35A 1H4TA 1LDYA 5EHQA 3CKKA 3FHTA 2BKLA 4IXMA 1QNLA 5AP9A 1MC5A 2HD4A 3ABIA 3PQ3A 4H31A 5CJJA 2JI8A 3QG5A 3DV0A 4JLPA 1AO3A 2D2IA 4N65A 4WACA 3RRJA 2QN1A 3EZYA 3WC4A 3TUJC 2I6SA 4LY0A 2QUBA 4ZI3A 1U94A 1CY0A 4JL5A 2ISQA 1FP6A 4BX3A 2PO5A 2Q8PA 2PVPA 4C29A 3R7NA 2D8AA 2YX1A 3DXXA 3KIPA 2CLCX 2D3TA 2E6KA 5ETJA 4HGNA 4XCVA 5IT5A 3OCCA 4LOLA 1Y33E 2Q4DA 1BXRB 1CE8B 5KQPA 3SXJA 4GXRA 3GDOA 2COKA 1PJRA 2ZBGA 2B8JA 4S1NA 1GA4A 4FKMA 4M0MA 1OYWA 2WAXA 1IXRC 3DOIA 3T4EA 4BB6A 4CM3A 1DV1A 1KZ4A 3JW8A 5LDDC 3U60B 3R3VA 3HB7A 5CFZA 4JP1A 2V5UA 4I08A 4QJ3A 1ZSVA 3QF4A 2CVZA 4CKCA 2CMKA 3GVXA 5JZMA 2VF8A 1CRWG 4B3RB 1CF4A 3SF8B 1E7SA 5DNWA 2AXPA 2Q5OA 2ZKIA 3VO1A 1IIRA 1LW7A 3A2KA 4LAFA 2JJ8A 1ZD8A 3JQRA 2B1QA 3V8VA 3F96A 1IVYA 2P9FA 1RR6A 4NYIR 3DLHA 2VNJA 4Z4IA 1P7WA 4RTOA 3R5FA 1A9QA 1NLUA 1KI6A 3IDSA 3R8CA 2WDPA 4AX8A 4X1IA 2R6FA 2O0MA 3I1YA 4YRDA 2PKCA 3TZBA 1LA2A 4JA0A 3MJFA 1CQZA 2BLLA 1H8EA 3G2OA 4HDNB 4XSGA 4QSHA 6ABPA 1TT5A 1ISIA 3CUTA 2E1PA 4C0WA 3ZVNA 2A0YA 2RGXA 2XVYA 5JLAA 2XMQA 3DBLB 2X13A 3H0EA 5E9QA 3G5UA 3SS9X 4U2FA 5KTSA 1PFYA 4KIUA 1OF1A 1QK3A 5A5EA 4JA2A 1RS0A 1O54A 4KAFA 3K31A 4NLLA 4WJKB 2EW8A 2IUFA 5ULLA 5E1BA 2C31A 5J4LA 3KCNA 4EEZA 3GLGB 4QVIA 1FMTA 2BCEA 3PQ5A 5IJ9A 3C2QA 1QE5A 4FI3C 5A3VA 3T3EA 3WBBA 3BMXA 4RKFA 4RXUA 4YXWA 2AXNA 3RS5A 1CJTC 1MOQA 1SXJE 3IP5A 3JAWB 2QRHA 4I5DA 3WMEA 5AO9A 1AVTA 4RXTA 4YHBA 5FBZA 4BNZA 4EPRA 2VPPA 1B0PA 1SELA 3AFHA 1LNZA 3VA7A 4KLNA 3DQQA 5LBUA 4BO6A 4G8DA 1MHPA 1O5IA 3DMTA 3N7UA 3ZDEA 1THZA 2ZATA 4RDHA 4XH9B 4HGOA 2FSUA 3L79A 3ZWOA 4CF6A 3K92A 4JQSA 2HMAA 3LXXA 1P18A 2B6HA 1I0ZA 2BI7A 4QGHA 4P38A 5DDIP 7GPBA 4GO1A 4ZEVA 4DCMA 1PWEA 3H8WA 1FQKA 3HO8A 1WCYA 1PKEA 1UANA 1GHTA 4L5BA 1J90A 1TVCA 4C3ZA 3QEBZ 1XRMA 2TMGA 3VKUA 2RHDA 5LYJB 3HR4A 2X9QA 3PKZA 4XD7D 2NSDA 5EPOA 3V5NA 3IILA 1O9HA 1GNTA 2IF0A 3OM9A 1NYTA 2PRJA 4IL5A 2QZ9A 1EX6A 2WFLA 1QUEA 2G9VA 2MSNA 3NWPA 5EE1A 3UAWA 5HJ5A 3PC3A 5KJFA 4U7GA 1HE2A 4YS6A 4AJPA 3FM9A 4FDUA 4MKIA 1EFUA 2IDJA 1CETA 3F5SA 4LHYA 2FPOA 2VCEA 4HEQA 1LLUA 4O4HB 4DXHA 1SVOA 2D4HA 3RS4A 3JYOA 2R8RA 5ALDA 2FPXA 1QVAA 3GARA 5GGYA 3A04A 3VOTA 4H1UA 4DXAA 1MNQA 2QTTA 4IRMA 5B7QA 2QL6A 3OTHA 2GZAA 5JTTA 1QAMA 2EBWA 1PZXA 3PPIA 5DOZA 3HL0A 3ZXXA 2GPAA 4XWWA 4I8XA 4Q7QA 1UOOA 3ILSA 2OT3B 3MXOA 4PLPA 1KO7A 4OEHA 1WV1A 2BFOA 4OHXA 3DLIA 3GP8A 2WJHA 1AKMA 2HY7A 2H17A 3DZDA 2J4DA 1RYNA 3AX6A 4L6AA 3RSGA 2NXWA 4EUKA 4OQZA 3SXPA 3GEGA 1DRJA 4JK3A 3PHLA 2BTQB 2CLFB 3C6QA 3KQLA 3P0RA 4MV0A 1V35A 4QVKA 1E8DA 3D7MA 3F6PA 1XL1A 5LQNA 3GA0A 1JKXA 4PC6A 4QSMA 3TIIA 2QRVB 1T6YA 4S3MA 5I3CA 2JLRA 3JD4A 4ODIA 4Y0AA 5JCOA 4GMKA 4OXXA 4ZC8A 3VX4A 9ATCA 2IOHA 3UV7A 1E2BA 4ZKEA 5A7HA 1J2UA 1ODJA 2C2MA 3GH1A 4UVHA 4ND8B 3BRSA 3IT0A 2OUKA 1WP4A 2PKQO 2G28A 3QGMA 3DCNA 4MA0A 4PIVA 5HTKA 1UP4A 3KZOA 3UXYA 3VHRA 4Q19A 1XVLA 4E4RA 3FPSA 1E1LA 3SS8A 2Q6OA 4AD8A 1OZGA 1T9AA 4INJA 5FWAA 1DX4A 4E2WA 1ESCA 3QPVA 1CPYA 3MA0A 5EEHA 2QT0A 5LKRA 4MRMB 5JS7A 3B2EA 1WZUA 4OTZA 3QXCA 4EUNA 1QKIA 3RBAA 3GEEA 5AHRA 2YL2A 2RHJA 4AS2A 2I2AA 1EFRA 1KH1A 3IQXA 1COWD 1I3OA 1J70A 2EQAA 2YS7A 4UBLA 1G3QA 4NZZA 4JOBA 1RYYA 2GF2A 1DAGA 2JFNA 4N7RA 3UV3A 1JFLA 4N8SA 4YRQA 3L7BA 4FJ2A 2P0EA 2UAGA 3DE5X 2IEBA 2DULA 2Q6VA 3BDAA 3F5DA 4UATA 5JWHA 3WMGA 2APJA 1FU7A 4I3HA 2Q4BA 5HKBA 2OUIA 3L77A 3FOZA 4E15A 2QTRA 3FNFA 1WCV1 4ITUA 1D6SA 4YCCA 1Z5VA 1E5VA 5THXA 1QP8A 2EW1A 3G1UA 3GRVA 2DOKA 1AZWA 3HJRA 4GMHA 1M34E 4JVSB 5KX5B 3EPLA 1D2HA 2Z83A 3DBOB 2JFOA 4QPDA 4DSUA 1KDTA 1C0KA 5AXDA 1J8VA 2XNDD 3K4QA 3PIRA 4LMBA 5IG2A 3KAQA 4LS3A 4E5KA 5DSXA 3CONA 2BM8A 1ZMOA 1Z29A 1XRQA 3SZOA 1F6WA 3LFUA 1T9DA 1XR3A 2OD7A 3ILHA 2BWJA 3ANXA 3QHPA 1EWQA 5FOUA 3W2FA 3WQHA 2DPYA 3IKLA 1Y1LA 1TC2A 2N47A 1GU1A 5L7YA 4PAQA 4B7ZA 4DV1B 1DV2A 3GDFA 2CXXA 3D2BA 1T2AA 1NW5A 4ZI5A 2SCUB 4LF7B 2ZWMA 2Q3DA 2PGXA 2QTNA 1WOYA 4TVOA 4WZAE 3U7EB 1R9MA 4ZC1A 2HF9A 2FWMX 3ZWVA 3O91A 5CITA 1O03A 5JS2A 4F56A 3S2FA 4M1QA 4EA8A 2G1UA 5K99A 4BIMA 4FR0A 2I8AA 1T1JA 2WFAA 3GNSA 4KIWA 1CC1S 1FYWA 3DWEX 1OLSB 1TUBB 3SR4A 3TSOA 1LNQA 4CM4B 3QELB 4L4UA 4YRTA 3U7GA 4JI4B 7AT1A 1SB8A 1CJSA 2WWXA 1GIAA 4XM2A 3QSYA 5A0VA 4R1OA 1WO8A 1ULUA 2ZSBA 1Y8QA 2BDUA 5LLSA 1K5DA 1D3AA 2BD0A 4LRSB 1W48A 1XG5A 5FT9A 3GCXA 1Z8DA 7MDHA 4FK8A 1IPEA 2FUNB 1A8UA 2KWIA 1PJ8A 1Z6ZA 4KXXA 5F64A 4B6OA 2YYYA 3RODA 3F6RA 5AD1A 4OU4A 4FDLA 5EWMA 3SVTA 3KB2A 4Z9AA 2TS1A 3NBZC 2XVMA 2XRFA 2Y1CA 2ZVDA 4ITRC 1C0LA 3RVBA 1RIIA 1T2DA 2R1UA 1BA3A 4IUCS 3U37A 4I7EA 5D84A 1RSZA 2QA5A 3K15A 2O1WA 1L7NA 3AP3A 5JAUA 3LD9A 4ABTA 2WF6A 3I5AA 1HY3A 2LKCA 3FFBA 4LWQA 3WFZA 3CBQA 3KC2A 5TQ2A 3KJIA 4YIHA 3OE7A 1W4ZA 5DCYA 3PDWA 5FNVA 1SWWA 2JGNA 5K4HA 1FPQA 1UPBA 1STOA 4DLRA 1C9JA 3VQTA 5EFZA 4Z3OA 3EWSA 3DOUA 3RC3A 4BP9A 3QYAA 4LBVA 2DQZA 1V8DA 1Z73A 3UFXA 3ZV7A 3RIHA 1T6ZA 2I3DA 5TGZA 4MP3A 3CZPA 1CEQA 4RE6A 3WIOA 5A3QA 2O05A 2IDMA 3HYRA 3I9OA 5EMKA 1ADJA 1F2DA 2AL7A 2GBIA 1UEXC 3U4HA 2NO0A 1J0EA 4C5BA 1Z68A 1H1DA 2QLLA 4IQGA 3HCBA 4LWPA 1UMDA 1I4TD 1OXKB 3ROFA 4BV3A 3CB2A 4UBOA 3CEMA 5EKDA 5IVKA 2ZWIA 2MR5A 3B1WA 1II0A 1ATIA 3BH0A 3KLNA 2WHPB 4BFWA 2MMCA 1Q1AA 2QT1A 5G4KA 2PZLA 3BFVA 1WMEA 2Z58A 5B3KA 1B42A 3QY0A 1RM0A 2EV9A 4KQMA 4J2TA 1OTHA 5EXTA 3RRZA 4YRMA 4LBYA 2ZI7A 5EUCA 5DI3B 4JP3A 4LVNA 5AI6A 2G5TA 1R12A 4BPRA 1VDZA 1OFIA 1KRHA 4BRUA 3HKCA 4EGAA 1EIZA 3HRIA 1D7OA 3MC1A 3TQFA 3MWLA 2ZRDA 2XUJA 2XMRA 1UXOA 4UZEA 1UF9A 1A5TA 3M9WA 3OIUA 5EJIA 4KPFC 3U3OA 1U65A 3SIRA 4EW6A 2QKYA 1OILA 2YY7A 5KKCA 1WS6A 2AOXA 2ZBQA 4FWBA 2CLSA 1E0DA 4K6MA 5A6SA 1KNXA 3OZ7A 2WTEA 4AN1A 1HSOA 1W44A 2H3HA 2OWEA 3HV2A 4HDOB 4DWJA 5TQVA 1DLJA 2AFIA 4WXRA 3K2QA 5IAAA 1AZLA 2GN1A 3KOYA 4LFCB 2HBQA 3IRUA 2ZBPA 4H7KA 3ZXIA 4DG8A 5ALOA 5ALYA 3ZDBA 2UXDB 2WU3A 3TRKA 4JWKA 2GBCA 4OAPA 2CSUA 2C1ZA 4HWPA 3RROA 4EIWA 3BFXA 1ZM4A 2PWBA 4JKYA 4EAAA 1M5TA 2OZVA 1SG9A 1H1TA 1H1LB 1GQOA 2OXFA 4IV0A 5DMHA 1QHXA 1E5LA 2EGUA 3MK31 4YRBA 3LXRA 2WU0A 1XQ1A 4FLEA 3X43A 2Y8EA 2QN3A 3W2IA 4RFSB 5J1TB 1TT7A 3CVOA 2Q9UA 4FE4A 3JZIA 2D7JA 4GC5A 1APBA 1IG3A 4RA6B 3H5AA 4FYWA 3COYA 4I9FA 3L7AA 4G65A 5JMPA 3QKRA 4PHGA 5H81A 3T5PA 1FRVA 3MJDA 2ECPA 5CLIA 8MHTA 1OXTA 1XJCA 3L01A 2X2FA 2RGRA 1TUIA 2R62A 3LS2A 2M6KA 3ZUPA 1Z06A 2L2QA 4GNRA 4IW3B 4E88A 1FFDA 1QRAA 1NXPA 1YRBA 1T35A 3HJTA 3IAS6 3MYYA 4KRGA 5K9ZA 4HYQA 3HFRA 2I1QA 1Z4NA 5C9ZA 2GN6A 4H4DA 2NTEA 1DEOA 4MRSA 1JLRA 4XJTA 3WK4A 3NKFA 2G5PA 2P77A 4RK4A 3TRFA 3JRWA 4NXNB 3UMRA 2XEDA 1M2VA 2QD2A 4MPDA 4Q4DA 2FUCA 2PL5A 3GLKA 4LK2A 1VGRA 1ZZGA 1ZK1A 4E31A 4TRRA 3AW9A 1E1QA 1RYFA 5JNVA 1OZ0A 3IPLA 4AZ0A 1KY2A 1UBRS 2A3NA 2HV8A 4BJ5A 3UHFA 1CUWA 1GCIA 1SUWA 2OHIA 3EWAA 4J0CA 4URXR 4Y6SA 1TA9A 3CNEA 4UCFA 1EM8B 2M1XA 4J0FA 3BE8A 1U7DA 3P9SA 2LR0A 4BVKA 1YQQA 1Y7HA 4KVFA 1NYRA 2IHZA 4YRIA 1VHWA 1H05A 1KJ9A 5JBNA 1VSBA 4URHA 1B8VA 4K5QA 4Z4GA 1OHHA 1L5FA 3WSTA 1B1AA 2GR9A 3AYXB 4YRCA 1KQFA 3SMVA 1XIVA 3PEEA 4CQLA 4N3BA 4OOFA 1E4VA 2QSZA 3STWA 1B73A 1F8GA 2Q46A 4CTNA 4IOJA 4XPIB 1UBJS 4F8YA 2Z95A 4CF7A 1JQJC 2PGOA 1SUDA 2IHKA 3B3FA 3BBLA 1XV5A 3FCCA 3KDSE 4CVNA 2AXEA 1D4ZA 4CLOA 3IT3A 3QI2A 4NU6A 5CA0F 3AI7A 1FYDA 5HDQA 3OCVA 1WMBA 5HF5A 3RBXA 3SEFA 1E3SA 1JS1X 4MRAA 5C7LO 4Q9JA 1P9OA 3OLZA 3OZBA 2M1ZA 3A6GA 4I1YA 3R7DA 4XRRA 2UZIR 3P9KA 5SICE 1NBEA 1WZEA 3H17A 3MSCA 4MIYA 5ICFA 4BFZA 3FPFA 1E61A 3LXMA 3H5OA 3LX4A 3NJ8A 4FFPA 4IF4A 2MYPA 2ZBFA 4LI0A 3G8CA 1L7BA 3WKCA 4KL8S 1PJ4A 2G0AA 5K3DA 4HDKA 2VJNA 4RIGA 1KO4A 1QCCA 1VOTA 2IE8A 3VDNB 4B32A 3U1BA 3BJRA 1T9HA 5EG5A 1ZLYA 3EZGA 3RSZA 1QHHA 4X8LA 4BE9A 1JI0A 1FK8A 2HBRA 4DBLE 2XUGA 4N0PA 3HZRA 4BNTA 2E3JA 1UJ2A 1SK9A 2NVWA 3HU5A 3TGPA 2ID4A 2GRUA 5FI5A 1R74A 4DRYA 4EENA 1B4DA 3Q98A 3NNSA 2C4NA 3GVCA 4MJLA 2F9MA 4YJ3F 3EPKA 4B3CA 1PEAA 4RTRA 2OZLA 3F5MA 4OYYA 2Q7DA 2XUKA 1THMA 3VYUB 2XEXA 2VBGA 1V9CA 1YR8A 2DWCA 4Z9FA 4XYGA 3AF3A 4B76A 4G6ZA 2G0NA 3LPDA 5FR2A 3OY7A 1LSJA 1X70A 3QEAZ 2QMUA 2V8BA 2GEBA 2JGJA 3JSAA 2WTUA 1SY7A 3PS9A 1B93A 3DDUA 2KYRA 1U3VA 2IPLA 3T1YB 1AKNA 4EGFA 3LT4A 4GWLA 4YREA 1UOEA 3RWMB 3VJLA 1V6SA 3JZDA 4BFLA 3H5RA 1SHJA 3MFQA 2I8CA 2VQDA 1KY4A 2BMDA 2GTPA 2VTKA 2LNDA 1XZIA 3OC6A 4FGSA 1P73A 4DEXA 1BHSA 2YFKA 1VZ2A 2QN8A 2X0DA 4JV5B 3CUUA 1XX6A 4DT1A 1EGAA 4V0RA 3WLQA 1NT2A 1Q1BA 1G8GA 1JAZA 4TQGA 2NZYA 3KD3A 4E5UA 1GV1A 1GCOA 1XMIA 4FDAA 4JC0A 4GX1A 1SULA 2CJXA 2G3YA 4LXQA 4MV9A 4PGAA 1E2QA 5BN5B 4RSGA 1AUPA 4UAVA 4D4HA 5BUCA 1NVEA 1OYYA 3HYSA 5DN6A 1PVVA 2BI8A 4U9UA 4HEHA 5FL3A 2O5EA 4JLSA 2X6QA 3A37A 1FF9A 2O7NA 3IAHA 5F33A 3EFOA 1F4LA 2DFLA 1RBYA 2D7DA 2A2ZA 2JEZA 2X9NA 1RZRD 1YR2A 4Q3EA 2GTIA 1VE9A 4WXMA 1NP6A 1S3IA 1TCVA 2B69A 3DQPA 1CKEA 4TWJA 1R5OA 1VRWA 1QZUA 4KQKA 3TW4A 1SQ0A 2WC1A 5IEJA 3B8HA 2CLKB 4CL3A 4GWGA 4U2DA 4B3JA 2XDQA 1AD2A 1PQ4A 2R6DA 3QOFA 4MOWA 4C07A 1HDCA 2FVYA 3UWMA 3H2JA 1E64A 4QDZA 3WNDA 4F4CA 1A2QA 2J08A 4IUYA 1XTQA 1NV9A 3NIGB 4OP1A 4EJMA 3BHJA 1RWKA 5AJXA 2C3YA 3DPUA 4PS1A 2XT6A 1U3UA 4XM1A 4P4TA 3I34X 4JJEA 2PKQP 4XGRA 2FW6A 1SQ6A 4DA0A 4Q9NA 4QDUA 4MB0A 3WO1A 1F2VA 3KHTA 2E48A 1YNOA 2ASEA 1BS9A 3ICWA 1J7JA 1H8ED 2A5JA 3GEMA 3L6DA 3DL7A 3GMSA 2O8DA 4NBLA 2X0IA 2OC4A 2IODA 4N5IX 4ER3A 1HTTA 4FFMA 3AQ4A 4FNOA 4X6XA 4CMJA 1IY2A 3O82A 3H9UA 2WF8A 4HNGA 3ULKA 4EECA 1ACLA 3NDIA 1XKQA 1WUHS 5AJUA 1EP1B 3WY9A 1QHGA 3S8YA 1L5QA 1YTLA 4UUAA 4CIBA 1KI2A 2F59A 3KQHA 3NQ41 4YXWD 1O2DA 3AUYA 3B8EA 4EW3A 5I45A 1Z4MA 4BV9A 5BPFA 2JFUA 4GXQA 2QGFA 3EDCA 4PLYA 4TZTA 5IVPA 3FTFA 1N6IA 1AK1A 3R6DA 3S68A 1KO1A 221PA 2OBYA 4BO1A 2OLKA 2ZYVX 3UT0A 1COZA 2XYGA 4WKCA 1KK2A 3R20A 3HYNA 4GGPA 2AJBA 1PDOA 4LDNA 3UK7A 4W1RA 5BOSA 4PO8A 1X1QA 4HTFA 1PR3A 4G4GA 4Z7QB 4R1MA 1TJ5A 2PAFA 4ZAZA 2J67A 4FSDA 2QN9A 1XXHA 3PPWA 5FEUA 2PZJA 2IBSA 2AG5A 1G3MA 1KDYA 4C7KA 1QZ3A 5LLDA 1KFEB 1UP6A 4ARAA 2PD3A 4HH4A 3RK0A 4CXMA 1PJSA 4M0DA 5C51B 5J5VA 4YAJA 5G0VA 3ZQ6A 4PZUA 1AN0A 3BGSA 1YB1A 2HMUA 3MGKA 5I8PA 4H3KB 1VJ1A 3HO6A 1PSDA 4G8JA 4JBYA 5T6BA 5JVDF 5E2AA 1LW6E 4RPLA 2L0XA 2VSYA 2VP3A 1YI1A 4HAWA 5EJFA 4AJ9A 4HVLA 5EJ8A 4D79A 3KSDO 3KB8A 2HB6A 4ZAVA 3VDRA 3W8RA 3D54D 3RD5A 4ZQIA 1E2PA 3C0KA 4TRNA 3CIFA 1UP7A 2WIKA 4EY8A 2FKNA 2OECA 1QUFA 5FLYA 4QASA 5KYWB 4BWGA 1MC4A 1WZIA 4US2R 1C3OB 3L6CA 2J5XA 3L7MA 5JCZA 5KYUA 1ZW1A 4DV7B 1L7EA 3KFVA 3MWDA 1PI3A 1L5WA 4HDMB 3L1JA 2AUMA 3MNFA 4BZXA 3V8RA 1Q84A 4PSDA 2Z3VA 4JI3B 4EY3A 1G5TA 4YLYA 3A1TA 5AVWA 2PFKA 4PCUA 4BLWA 5E6RA 4AF7A 4DXDA 3GV0A 1QQ5A 1IB0A 2F1IA 4CMAA 4QEZA 2WU4A 5G1OA 4OXNA 4O4JF 1OFUA 2IX3A 3IVGA 4Q9IA 1EZZA 3DT9A 4JKOA 1U3TA 3F90A 1F0KA 621PA 1YRAA 2Y1WA 1XN4A 1MB0A 1TLLA 1XDUA 1X42A 2GBLC 2Y77A 3BTSA 3H05A 3IMFA 3IVAA 3ZE6A 4C7BA 5EQTA 1Q3TA 2HHJA 4L9WA 4IEEA 4N49A 2RHBA 4IY1A 4R6WA 2QTWB 2GGSA 3TLKA 1GU0A 4D4KA 4YRSA 5FUVA 4Q1EA 2HLNA 2FSHA 3EOAI 2WTMA 3G13A 3O1LA 3G2KA 4NOKA 5C8YA 2IOFA 1Z8HA 3JRNA 1O94C 2IZ1A 4MULA 5G3ZA 3JS5A 5GGXA 1K66A 5LZ5A 3GT3A 4MLCA 2BZ1A 3D7KA 2XKKA 2GD2A 5LIRA 2DYKA 4LXGA 3TSWA 3U9LA 3MJSA 2O2YA 1Z83A 3IMKA 5BQXA 2FFHA 2O2GA 4A6DA 2AGVA 3BTVA 4UE6A 1A8HA 1HLDA 1AXEA 1EFRD 4F4IA 4N0DA 1TGVA 2CUKA 3VSEA 1QVVA 1ZUWA 5FAKA 4D3YA 4F4HA 4WXHA 1TZKA 4C4ZA 3WLPA 4QYTA 5BSUA 4PPQA 4DREA 1DTEA 2HXYA 1RI2A 1W8DA 2IKSA 2IOFK 3S28A 4CLDA 1IBSA 4E3WA 3QLJA 3TPCA 4LF5B 2EKLA 2FSVC 1FXWA 3NETA 4JXZA 4HPJB 2RBEA 1R4NB 1IULA 1QOZA 2CE7A 4CTKA 2P78A 3FIUA 1J6UA 1LDMA 3BK2A 2I7TA 2VJOA 3LW8A 3Q3JB 3PQ7A 4G24A 3DVRX 4YAKA 2WTXA 1PR2A 3DOHA 4AKIA 4N5LA 4F5EA 3RUEA 3KZCA 3WOVA 1SCDA 3TKYA 1PW5A 4GPBA 3IUBA 4X54A 3L41A 4CGYA 1O87A 3S2GA 4QUKA 3KUCA 1OAAA 1N2JA 3QSGA 2H11A 4Q00A 1Z88A 1JJIA 3ZK7A 1AS0A 2GT1A 1Y37A 5A9SB 1NRJB 1WDMA 3JSXA 3EXFA 1E4OA 3ZCXA 1M33A 1GUBA 1R37A 2GXUA 2R7KA 2WZQA 3I2YX 3O3NB 4PYNA 3PNBA 2HCFA 2FE1A 2R7LA 4JU8A 1B0UA 1P2VA 2XBLA 2ZITA 4D3XA 1T2CA 4LKRA 5DTJA 3SEQA 3VC3A 3FUVA 1WMAA 3FLBA 2FSGA 5ARDA 4EI7A 1E60A 4JAVC 2CK3D 1C7JA 2OGUA 4KN9S 1PJZA 2VA9A 2HREA 5CCXA 1N7IA 2OHJA 3HJUA 1D7AA 3UWKA 4WUVA 4CV0A 5AJTA 1VHTA 2PH1A 1E2GA 1B2LA 2RKOA 4L95C 1M6HA 1P39A 2GB4A 1KBOA 2VL7A 3LF2A 1Y7LA 2I7XA 3ENKA 5CXUA 5K0TA 2PH7A 3SNHA 1GTG1 3AUKA 2NVUB 4H3HB 2X3UA 4ZVNA 3TNFA 4ZHQB 5B12A 4K9LA 4PZEA 2DUWA 4GL2A 4BKOA 2RG1A 4RQBA 4BYMA 2O8EB 5CA1A 3MTDA 1Y3DE 1QKKA 2AEFA 3U1TA 4ZGGA 4TKVB 1BVHA 3I6YA 3RHFA 3V4PB 4B4UA 4D5GA 1U3CA 2XKJE 3FPKA 2GI4A 3PXEA 3PZRA 4Q7KA 5A9RA 3ZGXA 4YQZA 1C9YA 1OJ7A 4FFBB 4IXWA 2GK6A 2AZ4A 4GLLA 4OXRA 5F2NA 3OUTA 4ZIRA 3II6X 2I99A 2VUUA 3QEJA 5DYYA 3VXKA 3DCJA 3HVRA 4L8YA 4DC0A 4AJJA 4EPXA 1Z4QA 2IL1A 3HMKA 3WRWA 4U3JA 1UBMS 1IAQA 3GZNA 3OE7D 2J6IA 1H65A 3JALB 4LOKA 3WO0A 2WKSA 3E9QA 4PRLA 3WNVA 5LU8A 1Q3KA 2OBBA 3ELUA 4I46A 3OZGA 2RHTA 1UBHS 3E0QA 1N2CA 2IUEA 4JR2A 3G0OA 4PHHA 4Y6OA 5H5JA 4HVCA 1RWPA 1JFFA 1TZ2A 2WM3A 4M1OA 3T0GA 3MD0A 4HRAA 3RVRA 4CR8A 4LRWA 2YN4A 1Q44A 1RFLA 3GZ4A 2WZDA 4MV3A 2IEYA 4TWAA 1ADYA 2XADA 3C3PA 1KR2A 5GV7A 2J4FA 3FOEC 2X4GA 3NT5A 1QIIA 1BC5A 3I8OA 1JGTA 3BSSA 4AWBA 4KBGA 3N59A 1X9GA 3SDZA 1M8KA 3GLQA 3ETHA 1PF7E 2QX4A 3K53A 5EGNA 3OQ6A 4PPYA 2YQZA 2C00A 3ZXSA 5FXMA 5AW0A 4FN5A 4IRUB 4F8JA 4LJ6A 3KM0A 1XCPA 3ZBTA 3IB6A 2VEDA 3DDSA 4F4DA 3N0TA 3GPCA 3F1KA 4PYMA 4II2A 5CUQA 1Q57A 3ADDA 4QT4A 1VL6A 2BBOA 3BIXA 1DQNA 3TSAA 2D0IA 4RJTA 1KNQA 2F8SA 4D4MA 1ZITA 1QVZA 5J2TF 1WXHA 3QW4B 2Z4TA 4ZVUA 4EITA 4IIXA 4O2AB 4LF6B 2GBLA 1ST2A 1OLXA 1RYDA 2W6JA 2ZIWB 4FJ1A 3S7ZA 2AR0A 1ZD4A 3BYZA 1QYWA 1QG0A 2JAWA 3GA5A 5D5PA 3LOUA 5BWMA 1W49A 2VTBA 3MFYA 3N07A 4GUDA 3ZQUA 1YZYA 1P2SA 1ST3A 2HXGA 5IJAA 4NDNE 3IBSA 1W0KA 2UYQA 2GCOA 3L6EA 2HMWA 3VR0A 4NJMA 5AVRA 3MTQA 2I6TA 1KAGA 2XJ4A 1O94A 3DZIA 4Z54A 5KMGB 5M34A 4GH5A 4WNCA 3OQVA 3QPAA 4HEJA 4BQPA 1QVRA 4OGWA 5AVTA 3RNOA 4GMXA 2RI6A 3CH7A 3B3QA 3CO5A 2GFHA 5GWXA 4MVJI 1ZA1A 2E4XA 1K86A 3EFBA 4OBBA 1Y48E 1MCZA 2I7VA 3SLRA 4E7OA 2GFQA 3EGDA 2MYNA 1OGYA 5BMVA 4TS4A 5HRUA 1CUJA 3OOSA 4O3FA 2IQ5A 5HPYB 3THYB 2ZRAA 2JAUA 3IHKA 4F3NA 2NU9B 2FSVA 2H59A 1NW3A 5KOIA 2AX4A 1U0EA 4QGGA 4HDCA 2HUNA 3DGEC 3HSKA 3L84A 4FMDF 4H15A 1XHLA 4B4KA 3SVZA 4B5KA 4W9MC 5JROA 2GVDC 2BYTA 1OI3A 4WNAA 5EC8A 2JH8A 1J07A 1LI4A 3EF3A 4LDPA 3ZTWA 5BNIA 2HIGA 5LQDA 3IEUA 1HYEA 1TJ4A 1U3WA 2R6HA 1XWIA 1LF5A 3NJ4A 3EGXB 2F8TA 4V3BA 1CDDA 1JF8A 1YFKA 2Z9CA 2QMQA 3KOXA 4GBGA 3EIUA 1HGXA 5CHEA 2OAQ1 3FPGA 3IR6A 1FW6A 3IKTA 4G3XA 3TRJA 1E79A 3ZHTA 5P8WA 3GVPA 4MS1A 4BNKA 5JSZB 4QM7A 4X91A 4H0CA 1KRXA 3LVFO 4BDTA 1J56A 2JI4A 1OV6A 2V0CA 4HV4A 5B36A 4FNAA 2VO1A 5B3AA 4PVDA 1P4HA 1E1QD 3QU2A 3CLUC 1V11B 2F2TA 4HMOA 4B71A 3D8UA 3GCWA 3ONFA 1OUMA 4NNJA 3EZXA 3RUIA 3X1DA 4CMHA 2ZRFA 3TM4A 1JNXX 3E8SA 1ZR4A 1OZHA 1PZGA 4RGYA 4H6XA 3I28A 4JQCA 2WG2A 3F3MA 5CGQB 4O08A 1OFUX 2XTMA 4XSVA 2ONJA 3SJUA 4W1QA 1KSFX 4NU0A 3LE8A 4TS1A 3BA6A 3ETGA 1TM5E 1DQZA 3WWEA 1UKBA 3CX7A 4WY8A 4DCGA 1OLUB 1OHHD 1R0LA 1CYEA 3QBJA 3GLFE 5FV4A 3VR4H 2WTNA 4W5JA 3JXEA 1PFUA 1P0MA 4RK6A 2KX7A 3L1HA 5D8DA 5E6UB 1SGWA 3GJ0A 3A3NA 1HDIA 1RJWA 2GHTA 3ZI4A 1JXQA 4KR9A 5J1SB 2COUA 2QL5A 4DA8A 3K71B 2P9ZA 4LXIA 3GVHA 3KKZA 1VG1A 4F60A 2A8YA 2FOXA 4K03A 3T3HA 1YS1X 4TXJA 3TN7A 3UHPA 5KHOC 3RUCA 1I5RA 4M1WA 4CM8A 1FFWA 2C77A 2P40A 3BD6A 4DQXA 4N12A 3DZGA 5JO9A 2B5WA 3NBYC 1DRVA 2FP4B 4YGYA 4ZV7A 1JH9A 4FHZA 2WJZB 1EFVB 1ZVQA 5KINB 3AEUA 3NYRA 5AK6A 5DSZA 1M2GA 3Q3VA 5KQLA 1X9IA 3JQAA 4U2EA 3Q5GA 1EVQA 2Z6VA 5DEIA 1UDWA 4WLOA 3EVCA 4XQEA 3EUEA 2NO9A 3KB6A 4QUAA 4P83A 3F4BA 1BJRE 2GYUA 4RC9A 1TADA 1I1OA 3ZC3A 4N0QA 4CEHB 1GSHA 4U6NA 2IIQA 3INNA 4ACBA 1QC5B 1T26A 4HB3A 1IZ8A 2ORIA 4A8JB 3TVTA 4UEKA 1Z7YA 3TTXA 1TEVA 5ECYA 2DPLA 3D3WA 3OSUA 3PJEA 5AK3A 3AY7A 3HS3A 4JQYA 2H1HA 5EYPB 3EEOA 3KB1A 3C5EA 4EQ6B 3F5QA 3UMJA 3RTBA 1ZIXA 3HPRA 4Y7CA 3K73O 5EUBA 2ZP1A 3A25A 2YDXA 2AI2A 5H7XA 4CPDA 1E9DA 2OXIA 3KQSA 3VR3D 3I30X 5TQ0B 3LL4A 5HUHA 4Z9BA 2WFMA 5DNUA 2XW6A 4KU4A 5AVOA 2QLTA 1K6JA 3OIDA 4FCWA 3SSAA 4AFNA 3FRJA 4BNXA 3A3YA 3JQQA 3LQFA 4CF3A 5HHTA 3LLSA 4M1EA 2FF5A 3BMCB 2AK2A 4NCKA 1V3UA 2JHGA 4OX9B 3M83A 2D5LA 2WHRA 4DKJA 1JA1A 3ZNQA 2V7BA 1NLMA 3ILXA 4XWKA 2IS2A 3B6JA 1G5QA 3SHQA 5HF6A 2TMKA 1E2UA 1SXHA 3ESQA 4BVHA 2AUTA 1UDCA 4AF6A 2Q0SA 2A7QA 3QWIA 3R41A 4FLFA 4I99A 1UJBA 3FDXA 3WKBA 3IP9A 4O25A 1BIFA 3SZLA 1AURA 2G9QA 4L8WB 4XWAA 4MWOA 3AVXA 2LV8A 4B7UA 3IBCA 2UUAB 4UXIA 4B82A 4X3PA 2B7BA 4LHSA 2G70A 1CR2A 1RHJA 4PLCA 1N92A 3G5TA 3WG9A 1I2ZA 4FKBA 2ZSUA 2ZB3A 1W9HA 2EJWA 2A0KA 2YWGA 3IODA 4RJKA 1ABBA 4EFDA 1BHJA 3U48A 3QVGA 1A5BB 1YDEA 2ZJ4A 3D6TB 4XD2A 4BLTA 1WCXA 2JAHA 2PIAA 3B52X 3S27A 4K3VA 1E3EA 1G3IA 4PO1A 2BFAA 5F7JA 4WDRA 1T36A 4PGGA 1CLUA 1SG0A 2GBGA 2IXEA 2QZPA 3M82A 3G0IA 5I48A 4OQYA 5CYPA 1KVSA 2ID7A 1BHO1 2W2TA 3LFHA 1IDOA 4PG5A 5F4ZA 3HWX1 3I6IA 4G37A 1NLFA 3HH8A 5C53B 1RI5A 3GFSA 2ZDHA 3PGKA 2YIMA 5DIZA 2P8SA 4DDKA 3OVMA 2AMJA 1HV8A 5EQJB 1XEXB 1BXKA 1XAIA 1ZN9A 2HQRA 2ZB4A 5DT9A 3HA2A 1SVSA 2R7MA 2VI5A 1G9XA 5LC1A 3ZVRA 4YQEA 1ZD3A 4B0OA 4DLXA 1FVHA 4YRPA 2YYZA 5FIUA 4NAUA 2C2XA 3A9UA 4AP6A 1QFZA 3Q7QA 3VKHA 4G9EA 4Q7LA 3VNAA 1PDWA 3NTVA 1ML3A 5D5HA 3OTGA 1AS3A 4J7AA 3SBXA 5TGDA 2B1IA 1CS0A 1RC0A 4DLBA 1U2RA 4LGCA 4P54A 4UTPA 5FWNA 2PLWA 5DGHA 4BBPA 3N3AC 1NOIA 3T5AA 1A2OA 1MB2A 2J32A 1A77A 1GRVA 1P2DA 3ZJUA 4AL4A 3BD9A 1T8YA 2G5GX 3FPLA 1V3TA 1GRRA 3DDHA 3I9JA 2EAUA 3MPUA 4NBTA 3W5VA 1DIGA 4G89A 2P67A 3WNCA 2ILVA 3X1MA 3U26A 1Z15A 2IYOA 4P08A 2HK9A 3O8NA 1LNSA 2ZI3A 1OBHA 3OLCX 3WGUA 2ZYWX 3KYCA 4BNVA 1CEYA 2P6NA 3DUWA 2Q99A 1X19A 2YN2A 3H1TA 4AO8A 2RK3A 4NNOA 4RCZA 1CJCA 5KNBH 2JHCA 4HLUC 3PVCA 3H5IA 3PNVA 4N0MA 3N2GB 4G5OA 4GVXA 3PBKA 4Q4JA 4O8ZA 1RZVA 2P79A 2VK8A 5EQFA 3TWOA 2OD2A 5TARA 3GG2A 1FIUA 1AV6A 5EJAA 4RLHA 3K1AB 4ZARA 5CD9A 1Y7IA 1ZJ4A 3LAWA 3B48A 4XVUA 5ITZA 1BFDA 2ES4A 3NOQA 1IHPA 1PBTA 3IOCA 5FQOA 3SY8A 3T8YA 3CEAA 3ZWQA 4F5YA 2ZR0A 3K8ZA 5CH3A 2V0GA 1UT6A 4EHDA 1WW3A 3ISJA 4NVRA 3H4MA 3KQKA 4L8LA 1JLLB 3DKIA 3IQFA 4QLOA 4ER0A 3DLBA 3FNHA 4ZXPA 1Z5PA 5BNTA 3VYVA 2PBFA 1GNVA 1UMCA 4B1FA 3VVMA 4BKPA 1YZNA 4Q3OA 3JQ9C 2QW8A 3KDAA 2H2DA 3OZUA 2A9RA 4IDAA 1P2FA 5LKAA 3CJRA 3K8OE 3G9UA 2DFDA 4UM7A 5DBFA 2JLQA 3HZOA 1WHSB 4OF4A 4ARZA 4EELA 1JWBB 2A30A 1FRNA 3HUEA 3LQRA 1KORA 3LZCA 3OQOA 1CJVC 4P2GA 5DYNA 5CCBA 3A3OA 2HA0A 2JDID 4QRIA 1NW8A 1RPAA 2ZOSA 1A3CA 1G8KA 3I37X 3DO5A 3HEAA 4ARVA 4BEWA 2DP4E 3PGLA 2DH6A 3SX2A 3NOXA 1TYDE 4ESHA 2ZROA 4KE7A 2Z08A 5AI5A 3FTCA 1UXIA 4C43A 4DM4A 2VNKA 2C9CA 2FN9A 2C5EA 1XF1A 4XRGA 2OFOA 4IZOA 4JVOA 1D9XA 1JU4A 4J1QA 1CD5A 1RNLA 1YL7A 3C7AA 4LYDA 4QBHA 5EP2A 5ECGC 3IUSA 5EMHA 4YWHA 2VZEA 3LT5A 4AUNA 5KOJB 4JVMA 2C98A 2QMHA 4IMJB 1K8ZB 1LUAA 3JAKB 2QV0A 3CPJB 3GBSA 4K46A 1XD2B 4A0SA 5JNUA 3S1SA 3QEMB 2PQMA 2B9EA 3DMRA 1IN5A 3PJRA 1PS9A 3V8QA 3B5IA 3RF7A 1W75A 3R40A 4DR7B 2FEPA 3C7TA 2YH2A 3I0MA 4MICA 4RENA 1M1YE 5AHWA 4GOJA 2Q5LA 2WG1A 1ISHA 3QV2A 1KZ1A 3Q85A 3A4VA 4KR7A 5GIPE 1J0XO 1UODA 5KWEA 3R9XA 2ATVA 2VQ3A 1U2TA 2A4MA 4NIMA 4TQAA 1GFSA 1QGUB 1R27A 2NUTB 1F2UA 3HVUA 3RYHB 5DEOA 4ZV4A 5I7HA 2CFOA 4PYJA 3L1IA 2W2LA 4HB0A 4UNQA 2C5SA 4JUCA 5PGMA 2C9DA 4QA9A 5FOWA 5A71A 2YN0A 2ZXFA 4Q03A 2IWHA 4EUHA 1WZ2A 4P7JA 2YWXA 3GP5A 4OQMA 4XWTA 2V45A 3TCNA 3LBIA 4AXXA 2H5JA 1CVLA 4TMTA 5ITVA 2G09A 5K6RA 3E48A 2AA3A 1X80B 4KSYA 5L3VA 4JOQA 3THWA 2EJVA 2AIRA 3U62A 4GPD1 1BQEA 2NM0A 2FZ5A 3CZ5A 5CTAA 2J9GA 2C5GA 5HOEA 4HSGA 5G0WA 3CWZA 3ADBA 3HTXA 4RV4A 1Q6YA 4TN5A 3VZQA 1NF8A 3DDCA 5IABA 4HH1A 4NPHA 5BWNA 3DTYA 3LRPA 1SKYE 3KS9A 1D07A 1UJCA 1E1DA 1O7JA 4QPZA 3W05A 1CUIA 1H4VB 1POXA 1X6VA 2PQ6A 3EGOA 4ZCLA 3GDGA 3O1IC 4P4LA 2D5CA 4G5FA 3ESCA 2UYCA 3L06A 1NG9A 1ECCA 3FY4A 4WFQA 2XCSB 4JP8A 3TAUA 3PDIB 2GJ9A 3DZBA 4YT8A 2R47A 1LBSA 2VHQA 3EBOA 4LW8A 3KYBA 1P4AA 4X93A 5HCUA 3K9FC 1HT0A 2XXJA 4ZQGA 1IJFA 1G3UA 1AKEA 3L8YA 2FQXA 1TRKA 2XMPA 1A4IA 1QG2A 1JEEA 4B7AA 4Q12A 2ZGVA 5CA0A 4GP6A 2O4CA 1KOFA 2EKZA 4LZLA 5CDGA 4QLBA 4EM6A 5CLFA 1PD1A 2IYRA 4QHYA 3HWSA 2PYDA 3IQWA 1G1MA 3N2KB 3KNZA 4P4SA 3MGCA 3K70C 1GZ5A 3H86A 3MMSA 3RIMA 3R4CA 1LPBB 3CH5A 1ZKMA 2J0UA 4FOLA 2HRCA 2W7TA 3T9AA 5U4QA 3KLPX 3GQBB 4DUPA 1Y4UA 2DR3A 1MEOA 2FX2A 1XPUA 4R98A 1OIVA 5AUNB 4A6PA 1RPTA 3SKXA 1WUYA 5FULA 5KQRA 3F8WA 1EK6A 1OJLA 3BWMA 2V4UA 3A36A 3GN1A 3M70A 4MSUA 4C76A 4FB5A 4OQNA 2CDAA 2RFLA 3I04A 4MW9A 2RARA 5A1TA 2LP4Y 4LQ4A 1GL6A 1SC9A 4ZD6A 3UK2A 6REQA 3BZBA 2O0LA 3QENA 3SYLA 3UA4A 4ZYWA 1KU0A 5C1IA 3IB3A 3T6KA 1Y8RB 5LA6B 1TC1A 4QEDA 3M7IA 4FGZA 4UE2A 1CQIB 3RC9A 3JWHA 5HZMA 1A9YA 1ML4A 2DBRA 2GAAA 3EEYA 4JLAA 4KXWA 1UDXA 3SC2A 4WHMA 4YDQA 3ROXA 4YJ3A 2GLXA 3KWMA 1HE1C 2PCJA 3OO0A 1UXJA 4DUGA 1EP3B 5FOQA 1YXMA 5IF9A 3GC6A 4FX5A 3AEXA 1YC5A 2VDKB 4JT9A 3T1QA 1XZPA 3E7XA 3VNUA 1TW3A 1KYQA 1NE7A 3QZUA 1A9SA 1A9TA 3W7AA 3U4GA 1YRYE 4FVTA 3NBFA 4JQOA 5DMXA 1I7QB 3PI6A 3LBFA 1ZW6A 1P6QA 2DC1A 3FHLA 1ZIYA 4H3VA 4EI9A 3IOYA 2QD4A 4ZRDA 2ZWAA 1Z6GA 1SH7A 2EFEB 3EJ6A 1XD8A 3JQ9A 4RMJA 4C05A 4GI7A 4G56A 3R7SA 1FPMA 2B7CA 2E4VA 3C5WP 3EXIB 3D8BA 3F9CA 4RY2A 5B7NA 1H0SA 3OA2A 1P19A 2QTMA 1CHNA 2XNSA 5TR9A 1H69A 3RC8A 2CHFA 4BBZA 1BCSA 1SCKA 4UAGA 5BYBA 3USCS 3Q3CA 4WNYA 5J5CA 3SZMA 3MT0A 3AF1A 4HFRA 1U0JA 4MZDA 1FFAA 3ITEA 4MUEA 2BJHA 1RAAA 1XNGA 3CW9A 5ARCA 3A6LA 1QVWA 1WTCA 3QLVC 2EKPA 3ZHYA 4L4XA 3EK2A 5CJPA 4OLFA 5SYAA 3SFVA 2F90A 4PBTA 1CV2A 3VPHA 1UBLS 3I0ZA 1P8JA 4HG2A 1UDRA 1W6UA 4HS4A 5DPMA 5I4IA 1RZUA 1SZDA 3CNNA 5B7PA 1ZAKA 5TEVA 3WLHA 2X42A 3GRPA 3C8DA 3K9NA 1OA0A 1U0OC 1X7GA 3QKSB 5ALNA 1Q1GA 2X8BA 4LC1A 3ZZ1A 3ZCUA 1K0FA 2YHIB 2B37A 3MBIA 4JFAA 3C97A 5DO9A 4FMCB 1V96A 4W5HA 1EUYA 3JQ7B 1DHTA 1OZAA 3T7SA 2CXSA 2W6JD 4C0LA 3ZD9A 3LBNA 4CV1A 3REFA 4F9FA 5DXFA 4LHZA 5CXSA 3VU8A 5FI1B 4DB2A 3V6MA 4TWZA 5IKPA 1AB6A 2GH1A 2LWIA 3NORA 4EPVA 4YPFA 3RC1A 1ISFA 1UZMA 1J0CA 3HDVA 1W0KD 2ZI6A 2F48A 1W88B 3JQEA 2WUGA 5I51A 1UT5A 2CVQA 2A1UB 2PXAA 1O94D 2JBWA 4PONA 1EH5A 4KWIA 4W5OA 1T1IA 2MWMA 3WXBA 1UC9A 2QYTA 2BEKA 1S1MA 4Y2SA 1YDFA 5C1PA 2VT3A 5BNZA 2AMYA 2V7QA 2W98A 3OBIA 5IK2A 4C4TA 1O6ZA 1C1XB 3FR8A 3JD1A 1ETUA 1K3TA 3GFFA 1HE5A 2JIRA 4S0ZA 5DNCA 1N6LA 2BEWB 1QFMA 5FBRB 3H2GA 3W1EA 4F6CA 3GLHE 3QU9A 4YONB 2AN5A 4BO7A 3WIVA 4MQMA 2H7YA 2R4UA 1URPA 2EDCA 1E3WA 3LCRA 3OZWA 1L8QA 4IFEA 4KBYA 3ZCSA 3ZHRA 4IPTA 2KBEA 1PL7A 3K7EA 1HFWA 5CRIA 1JHDA 2ZPAA 3B13B 4ECAA 3VYTB 4MEAA 3HM2A 1AZTA 4ZRMA 4C78A 3HKBA 2O07A 2HBYA 2RHMA 4J6EA 4XEHA 5F35A 2H4YA 3EZLA 3ZEIA 1YCHA 3EGEA 2JFBA 5LVAA 4CHTA 2JLXA 3RYCB 3F2IA 1ISGA 1V41E 3EIHA 1X3LA 1IN8A 2BH9A 1DT5A 2ORED 2OXCA 3FRIA 1W94A 2XSZA 3GJTA 3NOVA 2AI1A 1Z0SA 5EZYB 4Z8XA 3EDOA 3SMQA 2Y4OA 2RK4A 4DF3A 1E7MA 3H2BA 3IUQA 2C20A 3RU9A 3R7AA 4D9NA 2Q1YA 2H57A 5THKA 2IUTA 4R69A 4HRYA 4WT7A 3TJZA 4BECA 1G2IA 1IHOA 3AIOA 1WETA 4DRZA 1I0IA 1Q83A 3COSA 4IHJB 3SQXA 1P1HA 2CHGA 2JFWA 2YJGA 1MAHA 4KWCA 3CF0A 4HLDA 3TE7A 5L53A 3O9MA 2G9ZA 4RANA 3TTUA 2C4TA 3LVRE 5HBRA 3RRBA 5JVDA 4INOA 4Y7DA 2GEJA 2JF0A 4OQDA 4RXMA 4D3ZA 5JAIA 1UK7A 3EE6A 3WB9A 1Z8FA 4J0EA 3KUUA 1KXJA 3T7CA 3ZHBA 3BL8A 4HB2A 1N8SA 4PNZA 5H80A 5HEKA 4YJDA 3IMEA 3ZJVA 4QUHA 2AB0A 1XT6A 3TLEA 5A4JA 4E33A 3JASA 1SUAA 2H1VA 1KYTA 3GPIA 2I3ZA 1TIPA 2ATXA 2WJGA 2L82A 3CEPB 2PBRA 3M6MD 4FC7A 4N1AA 1R6AA 1CEXA 3JWEA 4C4RA 1L5ZA 1RACA 2A78A 4R2XA 1ZL2A 3HXTA 2Q4RA 3WHKA 5KNLA 2AVNA 4P3OA 1KOGA 3CNQS 2C2ZA 3RR2A 3NGLA 3ODPA 1WUKS 2OKCA 3HA3A 4TV8F 2C1XA 3SCZA 3P5SA 2OHHA 3AJEA 1A82A 4GRDA 4TTIA 3RASA 2IEDA 2P3LA 3KVRA 5EIBC 1YIDA 4O4JA 2Q5QA 2DT5A 3VV2A 2P75A 3PX7A 3NVKI 4LXHA 1L4YA 3OCZA 2RAFA 4KTTE 3UB2A 2YWRA 5C1DA 4NOJA 4KR6A 3UB4A 1U9CA 1N9GA 2VTEA 4JI8B 1JILA 2BKUA 2A9PA 2NYAA 3B78A 3BXPA 2RHHA 2W8ZA 2J9FB 3QVLA 2QNRA 1A0OA 4LRUA 5LSAA 1CVRA 3RFUA 4JI1B 4EY7A 5K0EA 2CCGA 2R5WA 3GUZA 2JJYA 4D9MA 3UMMA 4NENB 1TX4B 1KJWA 1RRKA 3TQOA 3NCTA 2WAMA 2Y9PB 1XNQB 1VLVA 3MN1A 3GYGA 3ANTA 1SCUB 4ONEA 1JEDA 2IXAA 4B79A 3GO4A 3QIVA 1HZZC 1NZJA 4U1RA 4BNDA 2NPIA 2OR3A 3HUUA 3RKRA 1MBZA 3AG5A 3L04A 3PQ6A 4URWR 4OQLA 3HRHA 2EBFX 3W3AD 4YUVA 4HL6A 5P21A 4IX1A 4EHJA 4F2PA 2JBAB 1U80A 3IKJA 3ZY5A 3P26A 1R16A 3QLVA 3R5TA 5DLQC 2IDKA 3SYRA 3SZGA 1ZCJA 3OICA 3OFJA 3O4JA 1AMOA 4KMOA 1EE1A 3G02A 4L07A 4OGFA 3ESBA 2OPHA 2XXAA 3RHSA 3F3KA 4YCAA 4PLWA 2X2EA 5HMMA 1VPTA 2ZT5A 3PXXA 4RA9A 1M1UA 3TDMA 1HYBA 3DA8A 2JGDA 3V48A 1C8BA 1VBMA 2OOSA 3GFRA 3I9FA 2O2DA 3NASA 3MB8A 2UYHA 4PIMA 2XB2A 4CMEC 3ZNPA 1N2EA 2B8TA 2V7WA 3PR1A 3KT0A 1USIA 4BGIA 4M7RA 1IQUA 3T4XA 3WS7A 3HN7A 3ER6A 2WUVA 1AKTA 5JW6A 4YAEA 3CJTA 3QFRA 4CMCA 1T4CB 1XZKA 3ETNA 1NOKA 5BR1A 1JPUA 4KPEC 2WJPA 1CZOA 2H1CA 1U8CB 3DV2A 4WECA 5K45A 2QRZA 3VHQA 2FPPA 3HY4A 3ND8A 4P4UA 5EKUA 4BO8A 3LA8A 3R7WB 5AM4A 2OV4A 4JBLA 1VL1A 4GPIB 4LDZA 5DIFA 2D2EA 1IPFA 2H7XA 3DNFA 2JVJA 4EHBA 5B58C 1GPNA 5LB4A 1Q0UA 4XYBA 2V7UA 1Z2OX 1EK5A