1LPMA

A structural basis for the chiral preferences of lipases
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
534
structure length
534
Chain Sequence
APTATLANGDTITGLNAIINEAFLGIPFAEPPVGNLRFKDPVPYSGSLDGQKFTSYGPSCMQQNPEGTYEENLPKAALDLVMQSKVFEAVSPSSEDCLTINVVRPPGTKAGANLPVMLWIFGGGFEVGGTSTFPPAQMITKSIAMGKPIIHVSVNYRVSSWGFLAGDEIKAEGSANAGLKDQRLGMQWVADNIAAFGGDPTKVTIFGESAGSMSVMCHILWNDGDNTYKGKPLFRAGIMQSGAMVPSDAVDGIYGNEIFDLLASNAGCGSASDKLACLRGVSSDTLEDATNNTPGFLAYSSLRLSYLPRPDGVNITDDMYALVREGKYANIPVIIGDQNDEGTFFGTSSLNVTTDAQAREYFKQSFVHASDAEIDTLMTAYPGDITQGSPFDTGILNALTPQFKRISAVLGDLGFTLARRYFLNHYTGGTKYSFLSKQLSGLPVLGTFHSNDIVFQDYLLGSGSLIYNNAFIAFATDLDPNTAGLLVKWPEYTSSSQSGNNLMMINALGLYTGKDNFRTAGYDALFSNPPSFFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords LIPASE
publication title A Structural Basis for the Chiral Preferences of Lipases
pubmed rcsb
source organism Candida rugosa
total genus 190
structure length 534
sequence length 534
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 1995-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00135 COesterase Carboxylesterase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1lpmA00
1CUEA 2ZYIA 2VJAA 1DT5A 5ALVA 3MVEA 4B7ZA 2X8BA 4RPCA 2O2IA 4H7IA 4FFVA 2JGIA 2UZ0A 2EDCA 3R0VA 5AM1A 4OSEA 1UK8A 5H3HA 3E0XA 1BCSA 3NGMA 2CB9A 1XZMA 3BJRA 1SCKA 3TGLA 5AKYA 1YSCA 4LYEA 2HRQA 1PJAA 5DNWA 5AKXA 1EB9A 4HTAA 3W9BA 4Y2TA 1P0MA 1WCYA 2DCMA 1FFCA 2OGTA 5AK4A 2G5TA 1BU8A 2Z8XA 1LPMA 4AXBA 2O7RA 3FWHA 4P9NA 1XRMA 3N0TA 1FFBA 3KDAA 5ALTA 2HU7A 4MYDA 2CMFA 3DOHA 1THGA 2OCKA 2CKMA 1UZAA 2DFPA 4QWMA 4C4XA 1H22A 1U2EA 1YA4A 1E89A 4B9AA 1WHTA 3F97A 1E3QA 3C70A 4NS4A 3WJ2A 5LKRA 3O9MA 4Y2SA 5JASA 1LBTA 1ZD5A 5CRIA 3HZOA 3V9AA 4WDQA 1J07A 3K6KA 3O4GA 1R1DA 3H0CA 3FNBA 2VEOA 5LZ2A 2QJRA 1F0PA 5DYWA 1XQXA 2JGKA 1W75A 2G63A 4B81A 1NU8A 5ALGA 4DGQA 4DNPA 2O2GA 3OPMA 2Z3WA 4UBNA 4BCCA 4UFOA 1F8UA 3O4HA 5ESRA 3V1KA 4UFPA 2H7YA 1L7QA 4AQDA 2AXEA 3QITA 3W2TA 3PICA 5LZ8A 4MQMA 2PU7A 4AN0A 2Y1KA 1QOZA 1TCBA 3W9UA 1XRQA 5EHQA 2BUBA 4XVCA 4Q05A 1G5FA 4BRSA 1T2NA 1IVYA 2XUJA 3I2IA 4QDXA 5HF6A 3G02A 4UHBA 4FBLA 4PSDA 3L1JA 5JAPA 4TGLA 5EHZA 1Y7HA 1XLWA 2AJLI 5AM4A 3OG9A 3AZOA 4BDSA 4J0KA 4BDTA 2GYVA 2VAVA 3FYUA 5K3CA 5ALQA 1A8UA 2DHDA 5E2IA 5AKGA 5JATA 5HQ3B 5AJHA 3LS2A 5K3EA 1ZJ4A 2BAGA 4UHFA 2BGNA 2VA9A 3UUEA 3O4JA 2WUGA 4QLOA 2QKYA 5BV7A 5ALSA 3S2ZA 4MEAA 4MYSA 4J0GA 1CEXA 5ALMA 4OU4A 1ZI9A 4LXHA 4Z49A 5DYYA 4J7AA 3RKSA 2QM0A 5CTAA 5IVIA 1EDBA 3R3VA 3D2AA 1B6GA 3O4IA 1AZWA 3R40A 4DM7A 5AOAA 2ES4A 5ALIA 5FLKA 5HFAA 2FJ0A 2ZVDA 3C43A 2OPHA 2YH2A 1H2WA 3QPAA 1U8EA 5DJ5A 1QIEA 5EIHA 5CT6A 4M0FA 2ZYHA 2XUKA 4QDTA 3WI7A 4IH1A 4Q1VA 4J03A 3BE8A 2V96A 1QFMA 4MWSA 4D9JA 1QLWA 4GXNA 3DEAA 2QR5A 2QVBA 2H1IA 3O95A 2XMGA 2WU4A 3QMVA 1QE3A 1JMKC 4EHBA 1JJFA 5LLSA 1SOMA 1EXWA 4F21A 2XUHA 5CH3A 2XMSA 5AM0A 5JADA 3R3UA 2B9VA 4FDMA 3STTA 4ARBA 4ITVA 4C88A 3PFBA 3S8YA 2PKYX 2DSNA 4J0HA 3FLAA 4NMWA 4J0CA 1CVLA 1UK7A 3H2HA 5FXMA 1E8NA 4UUQA 4G8CA 1QIFA 1TAHA 1ZI6A 2ZYSA 1Q84A 3KXPA 1E66A 3CN7A 5ALRA 3V1NA 3VKFA 1E8MA 5HKAA 2EDAA 2HIHA 3V1LA 3GUUA 4U2DA 1FFAA 1UK9A 4UHDA 2XMZA 3FYUC 2OGZA 4MJ3A 5SYMA 1XZLA 2RHWA 3WL5A 1NU6A 3A2NA 3WK9A 3LLCA 4I3FA 4P92A 1G42A 1XZDA 4N8DA 4K6KA 2B4KA 5DYTA 4PSCA 1CUYA 3OC0A 4Q3LA 4L72A 5HK8A 5AICA 4X6XA 5AKEA 5EIAA 1MAHA 3I2HA 5K3DA 1BN6A 3FAKA 2HHAA 3RARA 2K2QB 1QJ4A 3D2BA 2XUAA 1BCRA 5AI0A 4G8BA 1CIJA 5A6VA 1CUJA 2GZRA 1C4XA 4KAJA 5JD4A 5C8XA 2Y2VA 4WFIA 1FSSA 4QE3A 3NUZA 2WFLB 5HF5A 1ODTC 3HEAA 3B12A 3DL4A 4KACA 4RE6A 2C5FA 4U2EA 5CURA 1QIIA 3DCNA 2EEPA 4J0DA 1USWA 5AK3A 4DNFA 5K3FA 2WTMA 3C8HA 4C4YA 5JZ9A 3F96A 4A23A 3QH4A 1DU4A 2CEKA 3SC2A 1QTIA 4OD0A 4ETWA 2YASA 3VXKA 5JANA 5C81A 3DLTA 3O0DA 1JKMA 1XZIA 4FMPA 4J0IA 1UKCA 2HFKA 4Q3OA 7YASA 4KRYA 4CG1A 3WA6A 2FJPA 3KOOA 5T4BA 2D5LA 3ANSA 4K5QA 2QOEA 1XLUA 4FOLA 2WG1A 2GBFA 1A8SA 1YB6A 3IUMA 2C7BA 1Q0ZA 1QIJA 4CIBA 3WL7A 4H7KA 3I6ZA 2X76A 2PSHA 5DNVA 1DWOA 1L7RA 1UWCA 5ALNA 3EQ9A 1TRHA 5D3KA 1G66A 2WU3A 5J3JA 5FKJA 1H23A 5IKXA 1EK2A 1HL7A 4G8DA 3IA2A 3TRDA 3MGAA 2JGEA 1XZJA 1UOPA 2PL5A 2W6CX 1K6EA 3DS8A 5AHXA 1UKBA 5AH0A 1CUAA 4CCWA 5JAHA 2YXPX 1CLEA 2HU5A 4CCYA 4HRYA 1BN7A 3WLAA 2AJDA 4BAZA 1G4HA 4WY5A 4OYYA 4E15A 3FYTA 4Y9SA 3WKEA 4BB0A 5AI9A 3IUJA 1IUOA 3PDCA 3STUA 1KEZA 3DKRA 3F67A 2ZJFA 3IUNA 4KE7A 1W76A 3WKBA 3F9CA 2XQFA 2OQIA 1HLGA 2QTBA 1K5PA 1QZ3A 2VAXA 3VISA 1VJ5A 4UBLA 4HVTA 1W6RA 1X70A 1LPNA 1YAHA 4BP8A 3MUNA 4WJLA 2DR0A 4HRXA 1P0PA 3F8SA 1XRNA 3HLKA 5HF9A 3H19A 1RP1A 3R3XA 1QFSA 2DQYA 3OM8A 1EH5A 4X92A 4INZA 3HACA 4XIIA 5AKJA 3BF8A 5KREA 2QRUA 2C4HA 4ARAA 4BZWA 3KD2A 1N5RA 4DNQA 3M81A 1YASA 2WQZA 3VJKA 4N5HX 1XZEA 1ZIYA 4Y2XA 2JIDA 1EDDA 2HM7A 1VKHA 2WKWA 3IVMA 4P08A 3D3NA 2RGUA 4FWBA 3WJ1A 4MQLA 5E4JA 1TQHA 3FVTA 3AINA 1MX5A 4LXGA 5LZ9A 1GPNA 2HA0A 2HADA 2O7VA 2WLSA 3I2GA 4HS9A 3YASA 4N5IX 3VJLA 1IMJA 4C01A 2HA6A 4FHZA 2ACEA 1H2XA 3IDAA 4X6YA 5AKKA 2Q0XA 1UXOA 4OB7A 5JALA 5AKLA 2WIJA 1ZD2P 1HQDA 3C45A 5A2GA 2OGSA 1MNQA 1XZGA 2XI4A 1UFOA 2GZSA 2PUHA 5ALWA 2LIPA 3WYNA 1EVEA 5FUMA 3VDXA 1EI9A 2CBGA 4AMZA 4GHWA 1EVQA 3WL6A 4GI1A 1BEZA 2ZJ6A 3R3YA 2R8BA 2WSLA 2X5XA 2Z3ZA 2Y2UA 4IH4A 5D3ZA 5DTJA 4ZV9A 1AUOA 2WIDA 3WK8A 3JYHA 1JFRA 3U1TA 2Z5GA 4FLFA 2WTNA 5I7UA 1KU0A 4OYLA 3H18A 3PE6A 4X6UA 1Q0RA 3A70A 3BF7A 2IX9A 2J4FA 3TEJA 4BAUA 3WWOA 1ISPA 3G8YA 3K2IA 1D07A 4X90A 5AM5A 3FOBA 4BZZA 5AO9A 2ZYRA 3GELA 3ZI7A 1NX9A 3Q8WA 3A6ZA 4N8EA 4B0PA 2ACKA 5JIBA 1J1IA 4EY6A 3T4UA 1CUUA 2VSQA 1CRLA 4UBMA 2AJCA 2B20A 1X2EA 5JAOA 1A88A 4B80A 2JEYA 4H77A 1DWPA 1JJBA 1QIHA 3IURA 5FRDA 4C4ZA 3B3QA 3G0DA 3IUQA 2C0PA 1BROA 2G4LA 5CH8A 1MN6A 2V97A 2QUAA 4NZZA 1FJ2A 2XUOA 4LYDA 4IHAA 5HCUA 1ZD3A 3V1MA 5T4FA 1TK3A 1VOTA 1DQZA 2IITA 1VZ2A 3I1IA 4FNMA 5A62A 5LYYA 2XUGA 1JU4A 1TCAA 4LXIA 3QMMA 4L0CA 3HC7A 4G4JA 5BWCA 1J06A 2QT9A 2HFJA 4KYVA 4TVKA 3JWEA 1E8DA 3ILSA 2XUQA 1XRLA 1HPLA 5FDFA 4U2CA 4ZGBA 1YA8A 4JH0A 4A16A 2QZPA 4Y2VA 1CUCA 4UPDA 3GZJA 3HJUA 2CZQA 5HKBA 1AC5A 4ZRDA 3JW8A 4W1PA 3ESBA 4MEBA 4ROTA 1SFRA 1XRRA 4AX4A 1XFDA 1CUHA 2ECFA 5K5EA 4X97A 3STYA 1P0QA 3H2GA 4KE8A 5CH5A 3K9BA 4Y2QA 5LIPA 2QJWA 1YS1X 2XUDA 5AI6A 5FOQA 1AX9A 2WHPB 3C6BA 4LIPD 3WWDA 4QNNA 5LZ4A 1DWQA 1DX6A 3QBJA 1MX9A 4AN1A 3H1AA 2VJBA 1VZ3A 2Y6UA 3U0VA 3C6XA 1AMNA 3NWOA 1IZ8A 1CUVA 1CV2A 3O9VA 3RM3A 5C7YA 3M83A 5CT8A 1XZAA 2ZJ7A 4DSAA 5CXXA 1ZICA 3OTQA 3WZMA 1CUWA 2XUIA 4B82A 4H7EA 1ETHA 5LKAA 1EB8A 2H7CA 3WKAA 5JYCA 3NOXA 3E3AA 1K4YA 2I3ZA 2XLBA 4WCVA 3WK5A 1CUBA 4G1FA 4FNGA 5EHXA 5HQ3A 2WIFA 2WHQA 1EK1A 4EBBA 1K8QA 4BRZA 3N2ZB 1M33A 2PSJA 3D2CA 4E46A 5IVKA 1QIMA 1WM1A 2OCIA 4ZWNA 1CQZA 2HU8A 5AOCA 2PPLA 2OXEA 2PU5A 3C8DA 3R3WA 2HA2A 3I6MA 4BVJA 2NW6A 2PUJA 1H2YA 4Q3KA 1BEEA 3VJMA 4F0JA 4AO8A 5EIEA 3G9XA 5AIAA 4QZVA 3EQ8A 2JBWA 3L1HA 4A5SA 5I8PA 4G9EA 4OUKX 2WHRA 1LPAB 4M0EA 5IH7A 2PSFA 4HAIA 2WG0A 3D59A 1GPKA 2BFNA 1N5MA 3I2FA 4BTVA 4BTLA 1ACLA 1DX4A 1AQLA 2XMCA 3I6YA 4OB8A 1QIKA 1ZGCA 3ESCA 2VATA 3ICWA 1GQRA 1YR2A 4JEIA 3ZWQA 4QEKA 1CUFA 5CT9A 4OPMA 4BE9A 1CUDA 1JMYA 2Z8ZA 3AJAA 2JF0A 5AI4A 5FPQA 2XB6A 4FLEA 2GYWA 4KJXA 1TCCA 4EY4A 3AUKA 3QYJA 1XZHA 1BRTA 1VXRA 4E11A 5IVDA 2OCLA 4Y2UA 2G5PA 5F4ZA 2GYUA 1N1MA 1JU3A 2GBCA 3IB3A 2GBIA 4X93A 5ALJA 2XUFA 5CT5A 2XE4A 1W4LA 4B84A 1WB5A 4TPKA 5DWDA 4X3CA 3EBLA 4AO6A 2ORYA 2WFZA 3W05A 1IUNA 1RWQA 4UHHA 1AURA 1GPLA 5AI8A 3KWJA 4CG2A 4UBKA 3BIWA 1GT6A 2IIVA 1FFEA 1MX1A 3B5EA 3CCBA 1QIDA 5SYNA 5A7HA 4J3JA 4IO0A 1GQSA 3A2MA 5EI5A 3WQHA 1HKHA 4H7JA 2BJHA 2OCGA 4PV7A 4FTWA 3G9UA 1XZFA 3KWFA 4W1RA 5LZ5A 4FKBA 3BJMA 2V9ZA 2AJBA 1R9MA 2WJ3A 1A7UA 2OLEA 3BL8A 2WM2A 1LPSA 5HF8A 1XLVA 1LPOA 4BP9A 5CBKA 1HDEA 4C87A 2WJ6A 1IZ7A 1P0IA 4AO7A 2C0QA 1R9NA 3AZQA 3WWEA 1DT3A 3LP5A 4PW0A 3ESDA 4WY8A 3TJMA 4X7BA 1S8OA 2R11A 4B83A 1F6WA 3ZLVA 4X91A 5C8VA 2ZSHA 2VJDA 3H1BA 6YASA 2I03A 4BCDA 1KU6A 1OILA 2HA4A 3VVLA 2WFLA 4OU5A 4YASA 2XUPA 2ROQA 4IQ4A 2BCEA 1ZOIA 4KE9A 5A71A 5YASA 3QM1A 5ALHA 1CR6A 2HA7A 5DTIA 2QXTA 3X3HA 2WUEA 3IIIA 1I6WA 5D7BA 3FSGD 5AKIA 4Y2JA 5ALLA 3D0KA 4AMYA 1MJ5A 1GKLA 2J4CA 3R3ZA 1LLFA 1VA5A 1XROA 3FLBA 3BIXA 3DKKA 3P2MA 2QXUA 2HL6A 1BS9A 1WPRA 2Y6VA 4I4CA 4EB0A 4LHEA 1N8SA 3WWPA 1WB4A 4ZV7A 5HZGA 4ZREA 4UFNA 4YK7A 2FX5A 3M82A 4YPVA 3V48A 4GECA 3EF3A 3R41A 2I78A 3ZPXA 4XJVA 4BYMA 1JI3A 4HXGA 4DMHA 3WZLA 5A7FA 3ICVA 3FYUB 2P8SA 1GXSA 4JYMA 3DOIA 2PSDA 4PO3X 4QDZA 3H04A 5KWIA 4Y2RA 4DTCA 5CT4A 2DQZA 5HFNA 1SC9A 1LZLA 3C6ZA 3G9ZA 5ALPA 3WK6A 1R88A 3WWCA 4DYHA 1L7AA 3FVRA 2XT0A 4PNZA 3PUHA 3AILA 3FCYA 1VE7A 4X94A 3L1IA 5AK6A 2DHCA 4M0MA 1UOOA 4J0JA 3Q0TA 1SCQA 3DD5A 3CXUA 2WFMA 3IBTA 4S0XA 4KAFA 2BUCA 1Z68A 2HRRA 5C8ZA 1R4ZA 5E4TA 1MAAA 2YYSA 4QWWA 1YB7A 2VJCA 2D0DA 2XMQA 5ISMA 4BCBA 2BUAA 3FLEA 1CUIA 1K63A 1OCEA 1LGYA 2GBGA 4P93A 5ALYA 2WG2A 1QO9A 1XZKA 3GBSA 2FUKA 5KBYA 4XX1A 4DNOA 1EINA 1THTA 1F0NA 4DSZA 3QMWA 1XKLA 3OURA 1WHSA 2XMRA 4GLBA 3T52A 1EHYA 2H7XA 4PSUA 2VTVA 2RONA 1LPPA 4X95A 1LPBB 5IVHA 3GFFA 5ALXA 3BDIA 5ALUA 4MXDA 3AIOA 5JZSA 3QPDA 3C5VA 3G9TA 3WMRA 2PM8A 2PBLA 1J2EA 1CQWA 5EFZA 3LCRA 4W1QA 4N8SA 1PV1A 4Q34A 4FFWA 4CI9A 4AZ0A 4K6HA 1ORVA 3DJYA 4EY5A 2JGFA 1ODCA 3RLIA 2XQIA 4CIAA 5CW2A 2VQ6A 4DIUA 3I1YA 1PFQA 3HSSA 3WIOA 3WK4A 4RE5A 1GZ7A 4H35A 3HABA 2XQJA 1DQYA 1XZCA 4HXEB 3ESAA 3DYVA 3WYDA 2PSEA 2XQGA 3EQ7A 2C5GA 4RNCA 3H17A 2J3DA 1QO7A 4F60A 3LIIA 1YAJA 2OAGA 4G4IA 3VVMA 4PQEA 5FV4A 1GKKA 4DLNA 5AM3A 1U4NA 5I9IA 2RIPA 2ZSIA 5AKHA 2JEZA 3H2JA 4IH9A 3I28A 3C5WP 4UBJA 3HRHA 4BVLA 4GDMA 4BC1A 1MTZA 4H7FA 3SWWA 1UT6A 1T4MA 2JGLA 4EUSA 1R50A 4KEAA 4E14A 3FCXA 2W22A 4DMKA 3MUOA 5ALOA 4GBGA 5LP1A 4F5ZA 5T4HA 4O08A 4MWTA 1VE6A 1W1IA 5E4YA 1CPYA 4BC0A 4BE4A 4FBMA 2AJ8A 1CFJA 1LBSA 1UKAA 3KSRA 4GWLA 1CUXA 1QIGA 4Y2PA 2HA3A 5AI5A 4Y2YA 1A8QA 5K3FB 3ZLTA 1TIBA 3EIOA 3HXKA 1EA5A 3QVMA 2C58A 1VA4A 5AK5A 1X2BA 4BATA 3RK4A 1XQVA 2QUBA 4LKOA 4KRXA 2PX6A 1ZGBA 1ZIXA 2BGRA 1JT2A 4K6GA 3I2JA 1XKTA 1UK6A 4OCZA 1MT3A 1QONA 3LIPA 3ED1A 2RI6A 2QS9A 5A7GA 4FLMA 1VLQA 4JNCA 1MO2A 3BXPA 3GA7A 3AIMA 1VXOA 5BOVA 4EZIA 1CUGA 2VT7A 2OG1A 4H7DA 3W06A 4WFJA 3G0CA 3QPCA 4X85A 3SK0A 2XLCA 2WIGA 3UUFA 3PF9A 3STWA 4U2FA 1IUPA 3DDUA 4H0CA 1MNAA 2ONCA 5JZBA 2E3JA 5KWJA 4KAAA 4W1SA 1HBJA 5FPPA 3ZLUA 2QMQA 4X71A 2WIKA 1Y37A 3M3DA 1WOMA 1W52X 2HA5A 1EDEA 2XQKA 4G4GA 4BVKA 3AFIA 4CCYB 1UOQA 4Y7DA 1ODSA 1ACJA 3G0GA 4B85A 4BBZA 4RGYA 3WA7A 4G9GA 4U2GA 3WKDA 1ZJ5A 2WUDA 4PF1A 2H9YA 1AKNA 3BDVA 4EY8A 1E5TA 2HDWA 5JARA 1DTEA 4Q82A 1XQWA 4UBOA 5AOBA 5JD5A 3ZV7A 5AIBA 4I19A 4JYPA 4AB1A 1FFDA 3HI4A 4ZXFA 4QLAA 1C7JA 2XMBA 1XZBA 4DMFA 3W04A 1XRPA 1B41A 1MU0A 2VT6A 1AGYA 3CCCA 4WDRA 1LZKA 1Y7IA 4W9RA 3STVA 2WHPA 3D5EA 3GROA 4W63A 4JUIA 2RHTA 2JGMA 1BE0A 5FP0A 5DLPA 5ALZA 2XMDA 1XQYA 5JD6A 4B0OA 3C6YA 3D7RA 2V98A 3FBWA 3OOSA 1SCIA 3UMJA 1DINA 1O6FA 3QZUA 5ALDA 4DMCA 5HK9A 2XDWA 3AZPA 1WPXA 2WUFA 3G0IA 2WJ4A 3DYIA 5LZ7A 3PFCA 5CXUA 2CUTA 5ALFA 1MPXA 2I3DA 5JAUA 4UHCA 4KE6A 2B61A 4H18A 2PVSA 3PI6A 5EGNA 4XWGA 5CMLA 3C87A 4EY7A 4B9EA 1ZD4A 1C7IA 2VF2A 3WIBA 4BAGA 5EHNA 1JJIA 4X00A 1WB6A 3DNMA 3WL8A 5ALKA 3ANTA 4L3WA 3WK7A 3A2LA 1Q83A 4QDUA 4QA9A 4U2BA 4YX9A 4V2IA 3HYSA 2OAEA 3D4LA 3E1GA 1CUZA 3H2KA 3G0BA 3F98A 2BKLA 4GW3A 3BWXA 2J3QA 4ZI5A 4K2AA 3E4DA 3FSGA 1TKRA 4NVRA 4B6GA 5AP9A 1R3DA 2JGJA 2O2HA 5ALEA 1YS2X 3I2KA 1CUSA 4H7HA 1O6GA 2RAUA 1YCDA 4CFSA 3DQZA 3G7NA 2DHEA 5AM2A 1U65A 3PF8A 4AZ3A 4GEGA 5K3BA 3WKCA 5DNUA 5D6OA 1GGVA 4EA6A 1QTRA 4C6HA 3IULA 5K3AA 5BWBA 4HXFB 4KR0A 1LNSA 2WILA 4UHEA 3AIKA 1H2ZA 3DL7A 5T4EA 3STXA 3PUIA 4C89A 4L9AA 1EX9A 3SX4A 1OXMA 4QDOA 1QGED 4WFKA 2OQVA 1RYYA 1ZI8A 4HZGA 4G5XA 3H2IA 4UBIA 5AKZA 4CG3A 3CN9A 2CJPA 1ORWA 4OB6A
chains in the Genus database with same CATH superfamily
1CUEA 1MIHA 1ZIPA 2VJAA 3K1YA 2F1HA 2FUEA 1NNSA 2X86A 5DNEA 4IJUA 1S8AA 3NP7A 5DHPA 2R4QA 3IBYA 1E1CA 3LY9A 4P58A 3COJA 2RCNA 2P4EA 2VP9A 5CA1A 2UZ0A 1SIUA 1M2NA 3CT4A 1N3YA 2NTJA 2JA2A 4OSEA 4LJ5A 2EXXA 3DFFA 4PPQA 2ZM5A 3FDXA 3A26A 1I9GA 2AI3A 4MR9A 1QOPB 5ILGA 3K5IA 3MTAA 3DWEX 1EHIA 4N6GA 5H3HA 2XKAA 3SMVA 4G0QA 4B7AA 3NGMA 2W6JD 1CZLA 2DR3A 4Z9BA 1IJEA 1TVCA 4R2WA 5ILOA 2GD1O 1WUHS 3ZHYA 5LC1A 1P4GA 3QF7A 3BJRA 5F1KA 4RD1A 2VHCA 2QPTA 3K1JA 5CAEA 4LYEA 2APJA 1PJAA 4E6EA 1H94A 2QD1A 3QA9A 2ZJ1A 4L5CA 5DNWA 1VSTA 2BJVA 4WY2A 2OBYA 4HS4A 4WOKA 3V1UA 1QMGA 3MJFA 2GSWA 3KHSA 4MGKR 4Z51A 3VC2A 1BA3A 3PITA 4O0MA 1GPWB 1MC4A 2P4SA 4Y2GA 4IWYA 3VU0A 5M2QA 1WCYA 2DCMA 4D43A 2WP8J 2XAUA 1CTQA 1OYYA 3EULA 1O7JA 3UK2A 1FRNA 3KT6A 1E5XA 2F3RA 4O5OA 2Z8XA 1LPMA 5TARA 1X7DA 3DO6A 4IJ6A 1KY4A 4K7JA 4FFDA 1V8BA 3AP2A 1FFBA 1NKTA 2B35A 2ODPA 3EH2A 4TWJA 5ALTA 1HRKA 1KXJA 4MYDA 4Q7QA 4KJZA 1KI6A 5FQNA 1II0A 2CMFA 3G8DA 3DOHA 4XARA 1BVHA 3NATA 5LP6B 1FYFA 3ENWA 1OB2A 1D04A 3EHDA 1UZAA 1Z5UA 3ZHTA 4LCJA 4C4XA 1H22A 2R6ZA 2AUTA 1KAMA 1U2EA 3IMCA 4Z9AA 5HCIA 2XB4A 1QQ6A 1CJBA 4KZPA 4R5MA 4S2EA 5EOVA 3W1VA 4C3OB 2D6FA 1MA0A 1Q20A 3E2PA 1E3QA 1EPUA 1GRCA 1YOVA 3B3FA 4V0NA 1P17A 1ZGAA 4WX2B 3WJ2A 1FXWA 4RA6A 2ZE6A 3UMSA 2B3TA 3I5AA 3O21A 2PUCA 4BQRA 4O3FA 3NHSA 3VHQA 1T8WA 1TUGA 2QN9A 1NJGA 2XA2A 3DBHA 5CJJA 3RVPA 3UMCA 1EUYA 4EZEA 4YV2A 1ESDA 2QAGC 2EGGA 5TJ9A 1NOKA 3KZOA 2G0NA 5JRJA 2ZUEA 1VSQA 2P35A 2VNKA 5FOXA 3BD6A 4BC0A 2Z09A 5CRIA 3OEEA 4WK6A 4DB2A 3UGQA 5E6UA 1I36A 1K68A 4C6TA 4F5EA 3NR2A 1VPWA 2WIAA 3H0CA 3I53A 2XNKA 1T2FA 1W9HA 3V2GA 4N0EA 4MQ5A 3L8YA 3TOXA 1B1CA 1KEVA 3PNKA 3GD7A 1H0KA 1J22A 1R18A 3AJEA 3NH6A 3I8SA 1YL5A 3GMSA 1I5EA 4NU5A 3BOSA 2IIQA 4J4TA 4MHOA 3TPFA 1XQXA 3GLRA 3TRKA 1JIIA 3QVLA 1C7ZA 3WLNA 3MW8A 3ZDZB 3C1TA 4CV3A 4HUQA 1JA1A 1NT2A 1W75A 1NVEA 1VBFA 1W85A 1MAWA 1VHWA 1WSDA 2F90A 3QF4B 3K71B 4A0RA 4M6WB 2QW1A 4NJEB 1VFNA 3ZGZA 2IU4A 3DMTC 1UUFA 1ZRSA 2QN2A 4NYIR 3ONVA 4X41A 1I1NA 1FU8A 3U7EB 3TINA 2P9EA 2DYKA 2VSXA 1Z8FA 2B0JA 2WF6A 2EFHB 1EWKA 3E23A 4ZT7A 4ZEOA 1G8AA 2QMEA 1DC5A 1GTZA 3AGPA 4UD2A 3QVGB 1V3TA 2JLAA 4M2LA 1XRJA 4Y30A 2O3TA 5JEEA 2FDCA 1IN1A 2ZSFA 1Q0UA 5C8YA 3FMFA 3R7AA 1L3BA 1CETA 5ESRA 3HKBB 3P9NA 5FOVA 4AKHA 3OFSA 2X8LA 3GRCA 3H0EA 3JQ6A 5EMMA 4RKRA 3SPXA 3QITA 4IWXA 1FFXA 1ZA2A 3LF1A 4DLKA 5B58C 3Q98A 2RCYA 4BWFB 3PICA 1LTKA 4C4RA 1XTRA 1KI7A 5FL7A 2BI4A 1L8XA 3W3AA 3NW9A 4UAJA 4YJKA 6NULA 3WJAA 3BREA 4I66A 1XKQA 2OESA 4N76A 1FTYA 2IP1A 3VZPA 4CF7A 4HYYA 1T5DX 2G8NA 3WBFA 1FLAA 5KOJB 1P2BA 2QM3A 3NHJA 1P60A 5LDDC 2BKVA 4JOSA 3N2NA 4N7BA 3RYHB 4FHCA 3SDZA 4MCJA 1YQ9A 2IUTA 3GRKA 1T2NA 4EGQA 5I7HA 2XUJA 3QPBA 1YR9A 3I2IA 3IP5A 2AC2A 1EFPA 1EP9A 4M1WA 3D1LA 3VQTA 3DQQA 1JLHA 4JK3A 3FCUB 3RK0A 1B6TA 1M2VA 2G1UA 3FPJA 3M4NA 4CTMA 4PE5B 1HDGO 2JJYA 4UHBA 4KN6A 2P4UA 1WTCA 4LE2A 4AD8A 4ZPXA 5KJ6A 3DLBA 1DAEA 3J7TA 5FTMA 3AVTA 1UBCA 1RWKA 4J75A 4RCYA 4TGLA 2OCBA 2Y1LA 3T5GA 2QNIA 1KE1A 5EHZA 1Y7HA 2UVQA 1CJSA 3DEZA 3L7KA 4R2XA 1L5HA 3RV4A 3BT7A 2Z6AA 3U3XA 1T6YA 2X6TA 2R96A 1UWKA 3AZOA 3OG9A 2QX4A 1M7HA 2EERA 4GP6A 1MFZA 1WXEA 1WU8A 1U0JA 2DH6A 2H1SA 3GIDA 2VAVA 4KLRA 4P35A 1ZH8A 3NZEA 4AROA 3UMGA 5JCJD 1NE2A 1JEDA 1JDTA 3MTDA 5K3CA 1BXGB 1XDWA 5SZJA 1ZMBA 1HDRA 1SURA 3EPPA 1EP2B 2Q5HA 3ESRA 1KK1A 1HT2E 3I83A 5DGIA 2REBA 3V6LA 4FE3A 4WXEA 3OT5A 3WIEA 5IUKC 4F2DA 3K1AA 1Z6AA 2HKIA 1REQA 1FUIA 3OKCA 2OD7A 3RTBA 1Y9EA 1MC5A 1KIMA 5HILA 3PTLA 4Q7JB 4R2LA 3G2NA 3V8VA 4F2PA 1Q0TA 3DTYA 3O4JA 4MYCA 5FJJA 1S6YA 4YRTA 5BR7A 4RTNA 2YV1A 1WVGA 4EI8A 4MEAA 1L5VA 4MYSA 2DQSA 4J0GA 4XDGA 3C3EA 3RVSA 4C22A 1ZINA 1SELA 3AUFA 1PTJA 1CEXA 2X6QA 3UH0A 3W34A 4DA8A 1AU9A 1IOVA 4Z0HO 3P2OA 5CVUA 1T8SA 1YD7A 3KTDA 2HGSA 3SSNA 2ZUFA 4E5VA 3R20A 4IGEA 1N3IA 2PXCA 1Y8RA 3FF1A 2O0LA 1WS6A 1TKAA 5DYYA 4U1RA 2F3PA 3OJ0A 3H3XA 2O2DA 2ZB3A 1SUWA 2CXXA 4FXPA 1E62A 4YP7A 5TS3A 1QNFA 2C2KA 1F1BA 3OQIA 4IQFA 2LCIA 2QM0A 4LYFA 4PHGA 1UXJA 3ZJYA 2XB2A 1R64A 3AR8A 4D97A 2QTTA 3DE5X 2H18A 1SCBA 3N86A 3SLRA 5A1JA 1T91A 3H5NA 3IHLA 3SQLA 4DM7A 2A35A 2RH9B 3FI0A 1GEGA 1Z08A 4B7UA 4HYQA 3Q6MA 1SD1A 6CHYA 1J0BA 5E3HA 1FRQA 4N40A 2O3UA 5FLKA 4RGVA 3QKIA 3F46A 4CUKA 2OPHA 1V8OA 2GI4A 1PZHA 1JPNA 2YJNA 2ILTA 4L95C 5I7VA 4M8SA 1YQGA 1H2WA 3F5QA 2IHYA 4TV8F 3TGWA 3THWB 4I2NA 1MKYA 5AHKA 4JS0A 1U8EA 3AF4A 3UYKA 2Z1MA 3MBOA 3FUXA 5IT4A 1UQTA 4ILKA 1QIEA 3T15A 1YE8A 3R5KA 5D5HA 1XP5A 5F2OA 1CF9A 3MTJA 3J81A 5GIOE 1EJ2A 1VE1A 3ZHVA 2D5IA 5CT6A 2ZYHA 1GCUA 1Q1EA 2ZRGA 2XUKA 3KQPA 1Y9AA 1YS6A 3V97A 2A78A 5JBNA 4FYYA 2QRVA 2OUIA 2X2EA 4DC1A 4J03A 1EE1A 4DMGA 4PHFA 1VBKA 2GWRA 1XXHB 2NWQA 1TB4A 4L8VA 2P9JA 1DZIA 4XLLA 4YHBA 4F9EA 5AT1A 1HWYA 3DEAA 5LOVF 4TKUB 2V3CC 3UHAA 2QVBA 1Z4QA 3ZZTA 1I6MA 4AMGA 2XMGA 1D4ZA 3LWZA 2VHJA 4E5PA 4TLLB 5K99A 2ZJ8A 3V8BA 2ADFA 4QOHA 1E2NA 3LECA 5HIAA 2B4RO 3QMVA 4QU5A 4AYXA 1RAEA 3EWSA 3TZQA 4EFKA 1QE3A 2G3YA 4BEBA 5I7AA 5U1PA 4UNPA 2K2WA 3SC2B 1RYHA 1SKBA 1VM6A 2YFQA 3KS9A 3PGVA 3R6LA 4OP1A 1E2KA 2FCAA 4NU6A 3UGTA 4EH1A 5LLSA 4FW8A 2C2MA 3CLUD 2W93A 1EXWA 1R0WA 1T10A 2BBOA 3FTPA 4MYRA 5TE9A 5FYDA 1I0ZA 3HV2A 1WNTA 1MDFA 1U6IA 1Y1TA 2XMSA 2ODTX 3RS2A 1MAUA 1I8TA 3IAAA 5KTOA 3AV0B 1TADA 3E61A 1YRYE 3W6NA 3R3UA 4M7WA 2OZEA 4X64B 3VNAA 4OX9Y 3S1AB 4DR6B 4YAEA 5LLDA 1RLMA 4ARBA 1EFRA 5B7PA 1Y1QA 2C84A 2GJAA 4CHTA 4DZRA 3H65A 3JPWA 4PQFA 1DDIA 2QTZA 2ZBRA 3F6CA 3I0ZA 4MZDA 3VR3D 4HFJA 5BNWA 4AM8A 3S8YA 4YCMA 1XA4A 1S2DA 2A5DA 2B82A 4QUHA 3T06B 2ON6A 2JJ1A 3G5MA 3OCZA 3QX9A 3OVMA 1YCHA 2IP2A 1CVLA 1DQRA 1T4BA 1AK2A 3ULKA 4ZI3A 5MHTA 3SQMA 1UJ4A 1POXA 1SY7A 2QIOA 5FXMA 1BYUA 4UUQA 2CLLB 1LNQA 1Q17A 3QY0A 4R3UC 4Z2AA 4X1KA 3RIMA 5CLHA 2FX3A 4XX0A 3U3MA 5JY6A 3WBBA 3GJ6A 3M5PA 3NC0C 2OLJA 2GAAA 2Q2VA 5H70A 1HYQA 1PYDA 3RUFA 2ZYSA 1G0NA 2NX2A 3QE3A 1OAOA 4LRWA 1EMDA 1E66A 3HFSA 5ALRA 3V1NA 3ZWKA 1APBA 4ARIA 1YCGA 4KDFA 4RJIA 1FYEA 4JU9A 4FR2A 1N1DA 3UPDA 2HIHA 5KJ1A 5C52B 2Y27A 1E61A 1R12A 1QGDA 4O2AF 5HGJA 1OAAA 1D0VA 1XEFA 3I32A 2HHJA 2W6PA 4L07A 4UEQA 1G20B 1V11B 2Q46A 3HDGA 4B73A 2XMZA 2YZNA 3BX1A 4UM9D 1NBMD 4DA0A 5KX5A 1B2RA 3FYUC 1U11A 1VIMA 3NHFA 3PEUA 2BHNA 3RSGA 3KKQA 3N0RA 1BMFA 5SYMA 3UV7A 1G2PA 1LJUA 2RHWA 4NPHA 1U8TA 3LOUA 5IH3A 2WWTA 1SAYA 3Q40A 3SYKA 5FR2A 1N2OA 3WGYA 3I30X 3ZUPA 4H6WA 4RF3A 2B1GA 1RZRA 3NHPA 3JYQA 5K3SA 3GN2A 5EUCA 1G7CA 1P1CA 2VTBA 2FLVA 3HKDA 3P2EA 4MR8A 4OSOA 3OC0A 1NVGA 2V59A 2FETA 1TYDE 4S3MA 4GI2A 1Z7GA 4XQEA 5AICA 2M1XA 4AP5A 5JDCA 4MQ4A 1KPHA 5AKEA 4YJ2A 1MAHA 3P4YA 4REQA 5LQRA 2O20A 1BN6A 3A1FA 5EPUA 3E5RA 5H16A 5JMOA 2ZIWB 3GLGB 2P2DA 4PYKA 1IC6A 4S2UA 4HDCA 3ND5A 5HHTA 1F51E 5KSWB 4PEVA 3PXAA 1QH0A 5AI0A 3VKWA 3W4JA 1Q15A 3LQFA 4Z7OB 1BVYF 1O0SA 2CVFA 3JPYA 4QASA 1PJCA 3UFXB 4DEVA 1KQGA 2IH5A 4P80A 4QQRA 3DE0X 3STHA 4NJMB 4IEEA 4BQOA 4KQ2A 4LY3A 4HLCA 4B4VA 2JGRA 4DWOA 2SNIE 1V8PA 3FZGA 3WS7A 2A94A 3DAPA 2BY4A 4M1KA 2HD4A 1C3LA 2V7PA 1RI2A 2J0VA 3JWJA 4L73A 4LE0A 4PYLA 4URYR 1FSSA 1TU4A 4LRUA 3RV3A 3RSSA 1PVVA 4QE3A 2J9RA 2OZKA 4KMOA 3K9LA 4Q9KA 4ACBA 1AV7A 2W8BB 4MVJD 4HFNA 1ODTC 4GICA 4E1AA 4RQBA 4KACA 3PTAA 3W2HA 3T7TA 5BV1A 3A4LA 1PWYE 1L3CA 4RE6A 5D5QA 4D9CA 3TTYA 1BS1A 4NRDA 3BXFA 2LDXA 4KMMA 4L4RA 1JNYA 1BOOA 3AFHA 3FF4A 3OSZA 2N0SA 1KMIY 1W5AA 4RHYA 4HB3A 1XJWA 5D3MB 3TTSA 1RQ2A 5CK4A 4DJFC 5LP6F 5JARA 3PQDA 1ZXLA 4PS1A 1AIPA 1X15A 2WABA 1MAVA 3EXFA 1I01A 3QJYA 1RM4A 3D3EA 3MTEA 1KI8A 4IIEA 2UYQA 4MWZA 2XTNA 2PA3A 5BSMA 4GR9A 5JT1A 3C4QA 3HN6A 4C4YA 5IAOA 3H1PA 8ADHA 3DVRX 3QH4A 4DCJA 4F04A 3F1KA 3K9NA 5D00A 2CEKA 1M1YB 3NHWA 3ZU6A 3FG9A 1Q1AA 1Z2OX 4OD0A 5AJZA 3UAYA 3ZK7A 1E60A 3AKDA 5C81A 1BDBA 2CMKA 2QTFA 1IZ0A 3LWNA 1AVTA 1J8MF 1VCMA 5EQDA 3TL2A 3O0DA 1V8FA 4I36A 3L46A 4FMPA 1EXDA 4J0IA 1UKCA 1JILA 2HFKA 3U3RA 2ZT8A 1IIBA 1XMJA 4ZKEA 3AYXB 2IU6A 3JQ8B 2WK1A 2YNMC 3B2EA 1W30A 1Z38A 1T3TA 2VK8A 1V6SA 4ND3A 3OIWA 3EXIA 4YCJA 5T3UA 2VLBA 3GFVA 4F6RA 5BURA 2ZDHA 2FJPA 4PRLA 3K31A 4MVJG 4TS3A 1JIJA 3O75A 2X2PA 2G7MC 1N6IA 2XWBF 3PFWO 4IZHA 2CF5A 1YKSA 2CLSA 2VWGA 2WG1A 1OZHA 2EL9A 1A8SA 3PSAA 3WHKA 3GI1A 4R9SA 1E3MA 5FFNA 5I3ZA 4UHKA 3H5OA 4OVKA 3EVAA 3NHYA 4WLOA 9GPBA 2WJYA 2QYOA 2FOXA 2WD9A 1H4VB 3HCRA 4ACAA 4CKWB 3W5JA 1QIJA 1LLQA 1SG9A 1JR6A 2PK3A 3GLQA 4EHLA 4EG1A 5E8RA 5JXJA 2GK6A 4OXQA 3ZDFA 1Y42X 3O2NA 2GBPA 5BW5A 1KNXA 5DNVA 1L7RA 2HMWA 1UWCA 4QT0A 1KDOA 2CE7A 4D0NA 4ZTZB 5TF0A 4JCOA 2V0CA 3CRRA 1WMSA 4DV1B 2XY4A 1GVHA 3LKVA 1B23P 1G66A 4UEJA 1YR6A 2ZSBA 4ZC1A 4ZAYA 5BNIA 4MRNA 2PH3A 1H23A 1NW7A 3CNHA 1K8ZB 2H8GA 1D3AA 2EU8A 4K26A 3UTCA 1F6BA 1V6CA 1SIWA 2NZ8A 3O3MB 3V4ZA 3ODPA 3S2FA 5FBVB 1O96A 4TXNA 3IA2A 1R5JA 2VDKB 5BV0A 1N0VC 1KR2A 1X14A 5HYVA 4BXOA 4CM9D 1ENYA 2PL5A 2M9MA 4GWGA 4LRTB 2Z2YA 3L7OA 1J9EA 2RJOA 3AERB 4MKZA 2ZQ5A 3SZOA 4GPZA 3T8YA 4NEQA 5AH0A 3T95A 4NOLA 1CD5A 5F21A 1CQIB 2XZLA 3IEXA 2FZVA 2B4TO 3EZXA 1U28C 1JAHA 1H1DA 4HMOA 3EXHC 4HRYA 5F12A 4ZAXA 5JPIA 4RLSA 5G0VA 2PD6A 2DLCX 3RBAA 4BJ1A 3C7KA 1XTZA 4BAZA 1N7GA 3CWZA 3OP1A 3VSBA 1VPLA 2VWHA 4MYUA 2Y0EA 4ZYYA 5AHRA 2YIJA 3IODA 4DLVA 4OYYA 4DLLA 4E15A 5AW2A 3HGTA 1ISGA 3MQ4A 4M7PA 2XCUA 4U7HA 4Y9SA 3VR4A 3ZGYA 3TL3A 2O2CA 3RAGA 3VI4B 5ERGB 2WD7A 2Q5QA 4HSGA 3UAVA 3STUA 1W0KA 2AOXA 1DEKA 1Y5NA 3UJDA 1KEZA 3HNOA 3ZWAA 2ZJFA 4M3NA 3G8BA 1DUSA 3D1VA 3OLQA 3L82B 1D9ZA 4KE7A 1W76A 3RAPR 3PQEA 4JLBA 5BVHA 1JQLB 3SP1A 3HCFA 3WKBA 5DMXA 2XQFA 3IHTA 1JR4A 3FCCA 3OFVA 3HUEA 1NW4A 2C2HA 3CVYA 4MOWA 2VAXA 3K94A 1ZLYA 1PJBA 3VISA 4OYRA 4EKEA 4YCCA 3R2JA 4JJ8A 4OA8A 2EATA 1LPNA 2YX1A 1YAHA 2BMDA 4D0LB 4NBTA 4BP8A 3PUJA 4NF2A 4MUAA 4JEMA 4X0EA 3SHWA 1TMOA 4EMTA 4AJOA 4WJLA 1K9SA 1VCIA 3PJEA 3RBZA 3OJXA 1KA9H 4UQPA 5GZ6A 2VJYA 4HRXA 3KEFA 5B12A 2NSLA 1ULTA 1PNVA 4LV8B 5BP7A 2GQ0A 2NPOA 1B8PA 1TTPB 3PYMA 4PY2A 3ZKAA 4YRIA 5F2NA 4CEJA 3F49S 4FHFA 5LB2A 3VU9B 1XRNA 1R4NA 2A0FA 5FUXA 2ZWOA 1UH5A 4K3VA 1N34B 4A6PA 2Q0QA 3EVFA 2VSFA 4G0PA 3OZSA 1FQOA 3C7CB 4AMBA 4PLWA 4B48A 2CNLA 2DQYA 4RYDA 2ISCA 3IV7A 3QWIA 3SHTA 5CNMA 3X1JA 4EMBA 1KZGB 2JCXA 1JP7A 2HK6A 5BUZA 2I1VB 1QH8B 2JJQA 3EFOB 4XIIA 2HWKA 4N0MA 2O0KA 4OQQA 4ZJYA 1RPZA 3B8EA 1EWVA 3W5SA 2CZCA 5EA2A 5ITZB 3R09A 3VR5A 3ID6C 2F48A 2Q28A 4M9UA 5IEBA 3TR5A 3TTUA 4EW3A 3R5JA 1GR0A 1QLJA 3DFIA 4TV8A 4UAVA 3H05A 3VJKA 4FCCA 4QOJA 2XTZA 3QX8A 2B2CA 2G40A 1XZEA 1ZIYA 2P62A 4N5HX 5IXJA 5JH7F 4UATA 2NO1A 1EDDA 1X9IA 5B5SA 1DBIA 2NTVA 5KNLA 2REQA 2WKWA 3LP6A 3QV2A 5FWAA 2P6OA 2O54A 4MIKA 2VAWA 2SKCA 5CNIA 5JMWA 1V71A 4E31A 4RADA 1MX3A 2F3QA 1YZTA 1HGXA 1P39A 2IOYA 3H5VA 3V2UA 1GAQA 2YFYA 5KQSA 1XJ0A 1ZGHA 4A1FA 2PNFA 2Q6LA 3FTCA 4BQEA 1ZXBA 2PUGA 4QARA 3L7IA 4PAOA 2HV8A 5CB4B 1QRUA 1XNJA 2CXSA 4LJ9A 3T34A 3VZSA 3BKWA 3VOSA 3LCVB 1KYWA 2H59A 5THQA 5LOVA 1MC8A 1TQHA 4R68A 4R1MA 5F7ZA 4D5GA 2FW8A 4KRFA 4CMCA 4PC7A 5FWYA 1E32A 1ZXXA 2FXIA 5JTUA 4BO2A 1SWVA 4E51A 5K6AA 4LJRA 5B3JC 1KK2A 2XOXA 5LQUA 1B1AA 2BMEA 5ESXA 4EPTA 3SU8A 3FW1A 4ER5A 4O2RA 1AN0A 2XE8A 2O7VA 5DMHA 2E4YA 3UK1A 3YASA 4CHGA 4EG3A 3ZCQA 1TA9A 3E3LA 3AOEA 4C76A 1JDUA 1ZISA 4U00A 1Z5OA 2ZRQA 2VDWA 3RUEA 4PU0A 4W99A 3DPIA 4X8HA 4X6YA 1XNRB 1I7PA 1WO8A 3KEOA 2WIJA 3PR1A 1AQYA 1TECE 4RTOA 1ZD2P 1HQDA 3C45A 4EFLA 4B40A 4GI3A 3W77A 5LDGA 2HU2A 2PT5A 2REOA 2C7PA 3AL2A 3EZ2A 1H8ED 2NSHA 2HTEA 1NQVA 2NV6A 1W35A 1GA1A 3AGQA 3FKJA 4ZARA 1WCWA 1TRKA 2QVZX 4PAWA 3A37A 2BRUC 3GBPA 5DDIP 3UWKA 1U8YA 1XLTC 3X2EA 2P7HA 4J9UE 2PUHA 4EPWA 1UFQA 5ALWA 3BCUA 1RMYA 3DFZA 4OG2A 4QTUB 5I9NA 5FUMA 3AWIA 2XNHA 4PZCA 1E2UA 1XC7A 1DJMA 4K1LA 2QL5A 2CBGA 2FFJA 4EJMA 1Z62A 4AMZA 3EFHA 4YMGA 4JQYA 3BXGA 1LLUA 721PA 2Q1XA 3WL6A 3UHOA 1TAUA 5E7QA 3TSWA 3LY8A 3DVQX 3NB0A 4FZRA 4PR0A 1BX1A 1GNRA 2C3YA 2CHEA 1L2TA 1OFIA 1KXZA 2G08A 2R6DA 2I67A 2X5XA 2Z3ZA 3EUFA 4R1SA 5F33A 4B3FX 3VR1A 1OVMA 3U44B 1QP4A 1R74A 4DHWA 2C3MA 3R7BA 3AF1A 1X8JA 4H9GA 4C14A 2HMSA 1W2WB 3B6ZA 2FR8C 4TLAA 2V3VA 3OHPA 4ND6A 1Z4PX 3TR0A 4K03A 1RWMA 4FEGA 3EZ6A 2M6RA 2KM1A 4PLPA 2WIDA 4Q9IA 3TOSA 4BMSA 5BRJA 1P9OA 1NA5A 5L7YA 1J8FA 4O2AA 3M2PA 3JYHA 3OTGA 4S35A 1I3CA 3WDKA 1KBOA 2BFBA 4PX2A 3ZE8A 1K08A 3FWKA 5D2CA 1T29A 2O3RA 3RFFA 2RBKA 1VCNA 4MMZB 1NI4B 2EYQA 4O5AA 4OYLA 3P0JA 1MXHA 3F6EX 1NL3A 3RC9A 1FPQA 3H18A 2OV8A 1IDN1 3PE6A 5ADVA 4HNHA 4EPVA 2ZSEA 2Y77A 3UCEA 2J4FA 3ET5A 2ZYTX 2QVXX 1OZAA 3DPSA 3GU3A 1LX7A 3PPVA 4BAUA 1QR6A 1RJ9A 1ITZA 2HLNA 2AH5A 4ERXA 4M1MA 3B1VA 1KMMA 4R0MA 3K2IA 1QH1B 1PGPA 4MWCA 5AVWA 1PNOA 3B52X 4K9NA 3UMRA 4PLHA 4US1R 3C3MA 4BNTA 1U63A 2KBEA 4UQLA 4BZZA 3TRJA 2W6MA 3NOQA 3ZBPA 2GCEA 3ZI7A 2CJFA 3F6SA 1Z0AA 4GRIA 3ZWYA 4AIRA 3BKXA 5JXWA 3L0ZA 3VBEA 4N8EA 4EEXA 1WG8A 1GU0A 2DQKA 2HLPA 2F1RA 5DO9A 4WMLA 3SI7A 4YDSA 2RHGB 1SCJA 1CUUA 4WKGA 1DBWA 3TMAA 2CHFA 4Y1GA 1U8ZA 2Q4DA 3ILYA 3PUXA 3T5BA 4K05A 5IMSA 2VJPA 4GQBA 4RW0A 4ZMSA 4YH1A 5JAOA 2FSSA 5K2OA 1CY2A 1Y63A 1PT6A 2B8NA 2GS9A 3HKCB 2JEYA 1E7SA 5JLJA 4KXQA 4C4ZA 3SMQA 3UB3A 1J20A 1UBUS 5A2QA 2CUKA 1W0JA 1J1ZA 2H3EA 2J9XB 3LI2A 2HH9A 4I50B 2X6RA 4ITRC 5CFPA 3DNFA 16PKA 3O4RA 4EL5A 5EHIA 2CLDX 2AQHA 1MN6A 2C8LA 4YIKA 4DMUB 2GCOB 4JC8A 4R41A 3KYJB 1NHGA 2J5RA 5JRZA 2VK2A 3D8UA 4C0XA 3FNRA 4ZFNA 2OAP1 1XHEA 3DKIA 4NZZA 1FJ2A 4HLUA 4HX2A 1PYGA 2H92A 2ZE8A 1OI2A 2XUOA 2NP6A 2Z3VA 4ZT4A 4V0MA 1NP3A 4HQ0A 2Q2NA 3SHFA 4JP8A 1ZK2A 1BFUA 1SBHA 4DDMA 2H2GA 2G88A 3OEHD 4BEWA 5LP6A 4N0QA 4DIKA 1N2ZA 2KB0A 1DEXA 1OPXA 1H05A 1PRYA 4F85A 1VZ2A 3KDPA 2WE7A 4JC0A 4ZQBA 3G5UA 2V7UA 4EGJA 4U8GA 4CLOB 2UUBB 4DLRA 4PQYA 3GFGA 5JSZB 3PQ8A 4XAQA 3N2LA 4JY7A 3B2NA 4PRKA 1TGYA 2XF2A 3A6PC 3L4BA 1YHZA 4BRWA 1P3JA 1YNOA 1GNSA 4LXIA 4JL6A 3K35A 3H4VA 3QMMA 1DOZA 4L0CA 5C2JB 1AQJA 3FIJA 5DRYA 3KC2A 3CBQA 4N3GA 4G25A 3PNVA 4KTVE 3TM4A 2GAOA 2V9CA 3D54D 3OPXA 4BPRA 2ZRPA 3QA3E 1WABA 3THSA 3RD5A 1N6RA 3GLUA 4IDPA 2PMFA 3MWDB 2WA2A 3P9SA 4QPJC 1CW2B 3IUEA 1YS7A 2X0RA 1E7YA 3SBEA 1WTAA 1DCKA 1SVNA 1YA8A 1CG6A 4JH0A 4A16A 3KUDA 1E9SA 1L4BA 2QZPA 4LK3A 4PGAA 2Q3EA 1A50B 4O4IB 3LK7A 4C08A 5I4BA 5CGZA 3QBEA 3QF4A 1JHZA 2JIMA 1YZVA 4OQZA 3HJUA 4DILA 4LCEA 4YP9A 1R10A 2R25B 4M6WA 4BKOA 4HAZA 1HEYA 2HO5A 1N7HA 3K15A 4Z7NB 2GM9A 3L8EA 2PG3A 1SQGA 1C9YA 3B9BA 3IPLA 2DY0A 4HNSA 1TQ8A 3ZDDA 3CLSC 4W1PA 1BXRA 3I3SR 4MEBA 4ROTA 1O94D 2NXCA 2ZT7A 5AW8A 1EAYA 2AHRA 3FSEA 2O4CA 1SFRA 3R9IA 3UT5B 3DBLB 4C0AC 4Z99A 4C0KA 3DV9A 2IYAA 5H68A 2FW7A 3DZFA 3QVGA 1HFKA 1HYBA 1XFDA 3CS3A 3SKVA 3MILA 3UKJA 2HMVA 4U7WA 3CHYA 1P0QA 3H2GA 1U0RA 3HKBA 3D4BA 4OKNA 1RYNA 4Y2QA 1NVWQ 1DOAA 1ECPA 3FWZA 2Y1EA 4GYKA 1Q7GA 2O5EA 5AI6A 4M1QA 1B2LA 2IY8A 1M10A 1RPAA 1KZ1A 2IOFA 3HY3A 5BNTA 1QANA 1ACMA 1T3ZA 4BO8A 1WV1A 1Z9BA 3WB2A 3WQSB 2H31A 2R62A 3AFOA 1G2QA 3HVKA 1VI6A 4OQFA 1NNEA 1TE2A 5LZ4A 2R8YA 4XR4A 1DX6A 1AKEA 4MGHA 5KOJA 1T6ZA 3W6ZA 4JT8A 3WP1B 1R8YA 1MX9A 4ND4A 5CX4A 1Q7BA 4PFJA 2RH4A 3T1QA 2ZFUA 4LWPA 1AMNA 3IEMA 2ZYVX 3NWOA 4ZTBA 2PX8A 1PT9A 1TW3A 1YQEA 1T4CB 2Q4BA 3NI2A 2Q50A 3RM3A 3E03A 1IQ0A 1SUCA 3OO1A 4BNVA 3N8DA 4QHYA 4TN5A 3HJHA 3VU1A 2CNNA 2H2IA 4KDRA 1K6IA 3HBJA 5CXXA 2HF8A 3DOOA 3L77A 1YQQA 4BN5A 3RYCB 1G16A 1MQ9A 1HLPA 5DB4A 4O4JB 4A91A 3NBQA 3IKJA 5L4LA 3GEDA 2P4QA 1JXMA 3HDQA 2V7XA 3MWKA 4H7EA 3ZK9A 3GQBB 1UINA 1XP8A 2R2AA 3ICEA 1VYTA 4OAQA 3AVXA 2MWMA 5JYCA 3R8CA 5GM2A 1T8UA 2PANA 5IZCC 3DDHA 3IVAA 3S2IA 1K4YA 2BL4A 5B1HA 2Z43A 5C7IO 2XLBA 2XYQA 3VPBA 3QE9Y 4I81A 4EJSB 2IXTA 2IYQA 1Q91A 3EVBA 1BXGA 2JLXA 4WCVA 3AY3A 3NBFA 1Q1BA 4KKXB 3EY4A 1GO2A 1TJ5A 2Y1DA 3BZWA 2IBTA 2ZUSA 1NATA 1H5NA 5T67A 2WMYA 5K03A 3JWGA 4D25A 3ITEA 1NURA 3A9WA 1PK8A 3FNEA 1RXVA 2WHQA 3MUEA 4GPIB 4LW8A 3ST7A 1Q12A 4EBBA 1TQ2A 1L5QA 3HLTA 4PWZA 1ADCA 3JARA 4HLDA 3RFXA 4A5OA 1N36B 1XVIA 3FHLA 3H5WA 4B3GA 1Z73A 3OPYB 1SKUA 4D7AA 2CJWB 2D8AA 5IVKA 4DIOA 2NIPA 1WM1A 1NVDA 4PGHA 4PZYA 5AOCA 3NRBA 3GAMA 4MB0A 4JLVA 4IMJB 3C8DA 2JLUA 5T64A 4RHCA 5DP1A 2IF2A 2PH1A 3I6MA 3DLPX 4U2KA 4FB5A 1FF9A 1X39A 2PUJA 3P9RA 4NYJQ 1BEEA 1LFAA 3VJMA 1G4AE 1WXHA 4TT3D 4V38A 5AK0A 1EFAA 2OYRA 3RC7A 1KSFX 3TOCA 4RVCA 2W0SA 3SFTA 3IOYA 4X1IB 1TA4A 1CZUA 2PXAA 1OV4A 2ZUUA 3IB6A 4NENB 1FX0B 3M1LA 4DLXA 3A3PA 1PJ2A 3T1OA 4UVHA 4E4TA 4Y1FA 1DAOA 1EQ2A 3ASUA 4NK5A 4A5SA 1PTJC 3PX2A 4I9FA 2GR9A 1AF4A 3CBGA 2UV8A 5KWSA 2IELA 4N6NA 1VMAA 1OWMA 3E48A 1NXTA 1UT8A 4BGUA 5IH7A 4GMDA 4XUGB 4BKPA 2O07A 3VAYA 1JNXX 1LJ8A 1P9NA 2QENA 1JLKA 3WFJA 2VF7A 4W8HA 4AJ2A 2ZVPX 4GVLA 5JH7A 3BE4A 2A88A 3ZDQA 2YMPA 1DC7A 3CKYA 2Q6OA 1VLZA 4IDNA 4KGZA 1T3GA 2FEAA 2WDZA 1BD3A 4Y9RA 3THWA 3C14C 121PA 5HS6A 2IZ0A 4XZ3A 4DF3A 1GRVA 4DA6A 2XTJA 4PC3A 1ZHFA 3ZIAA 1ZGCA 3ESCA 3ZWDA 1XNHA 2GOYA 2ABWA 3A3KA 5JNLA 1WF6A 5IZ4A 2RGYA 4A4DA 4LQDA 2M2IA 3GGJA 4F56A 3HWX1 4C7OB 3ZWQA 3O0TA 1AA9A 4BJ3A 2IA5A 1KQOA 5DBFA 2LRHA 3RS4A 3WOHA 4B4WA 3BCRA 5A05A 5JYEA 5G3ZA 2YBEA 3M4JA 1IHXA 4OQMA 2A1TR 2OECA 3M3HA 1GAJA 5IBCA 2PL9A 5CB4F 1RRPA 5KTRA 1XXHA 1ZGZA 2PLWA 5EY5B 2NV2B 4B1FA 2F9MA 4FFMA 4UPEA 3EVTA 4BFZA 4KJXA 1CXZA 2R47A 3A3NA 7ABPA 4TKUA 1PLLA 1XX6A 1SVSA 1G6KA 1XZHA 2HF2A 1BRTA 1ES9A 2I2BA 3VVBA 4E11A 4YUYA 4M1OA 2OCLA 4O29A 4WRRA 4EEZA 1G98A 2E7ZA 5EE5B 4J91A 1LDNA 4Y2UA 5F4ZA 4F93B 1X1SA 3X0DA 1SA0A 3O1HB 4E5YA 4Y7CA 4V1CI 4JI0B 1FFSA 4AQYB 4KSBA 1C3OA 5C18A 4DXDA 2GBCA 3SSMA 2JVJA 3QTLA 4EP1A 2J85A 5KWVA 3F9IA 3TBKA 3LL7A 2C95A 2XT9A 2R6FA 1QF9A 2WM3A 1GCOA 2IV7A 3EODA 2XUFA 2P9ZA 3CM0A 2EFYA 4IXNA 4PCVA 3TNFA 3W2IA 3LT5A 2X9GA 3WC4A 1NVBA 3RHFA 4FM9A 3LT4A 5CT5A 2X0DA 1PR4A 4MUBA 1DAMA 2F17A 2XSZD 4B84A 5H02A 3D43A 2Q9UA 2XA9A 3MRSA 3GRVA 4LZPA 4TPKA 4JSYA 1BX3A 2IYPA 1L4KA 5DWDA 4NMLA 1GPUA 3S1AA 4C30A 2G6TA 3IJEB 4XWKA 5AVVA 4X3CA 1ODKA 4DUGA 3QG1A 1E1QA 4AO6A 1VKRA 1KARA 2PS3A 2WFZA 3GAFA 3RIHA 4E4RA 1KRWA 1PDOA 1I30A 3OCYA 3EPHA 4IOMA 1K3TA 3ZW8A 5LLTA 1RWQA 1G7TA 1AURA 2I4OA 5ED0A 3F78A 3KWJA 4S1OA 1LLCA 3FGZA 3R6TA 5HQJA 4Q66C 4CG0A 4UBKA 1KMQA 1W4BA 4ENVA 1GT6A 3L9WA 3JTMA 1TU3A 2IIVA 1NVTA 1EEHA 2G77B 1AQNA 3BXHA 5EQTA 1HLFA 5HIMA 5I6DA 3RSOA 2G1PA 1ZUWA 1VECA 1OLXB 2QM8A 2V6JA 3CCBA 2I3AA 3JAKB 4G07A 4RVSA 4DY4A 2FMTA 3G6WA 5A7HA 5CVTA 3ZJUA 3TGPA 3U48A 5C5EA 3KZ1E 3IPXA 1NUHA 3T5DA 3V00A 4J3NA 5KNBA 2GN0A 3CNEA 5EJ6A 1SZPA 3UMYA 1BC5A 1E4EB 3C4VA 2BJHA 5KYGA 1GZ3A 1V9SA 2R6CA 3QFSA 1D6SA 5DSXA 4HYEA 3PD1A 1G17A 2AK3A 4B2IA 1QAOA 2OCGA 1Z4OA 1R6AA 4FTWA 4GE0A 5H4HA 1G20A 4H3HB 3U1VA 3P97A 1W36B 2ECQA 4S1PA 2BM9A 2NUTB 1QYDA 4X44A 4WK4B 5IHXA 2XKJE 1P6XA 2ZW9A 3VOBA 1GUYA 3BIJA 5AJUA 2EFEB 5CNJA 5DWQA 4DARA 2FWBA 3DB2A 4KXYA 3W3ZB 2RKBA 4UQOA 2GEDA 3PKZA 2OLEA 3PNPA 2BJWA 3QE0A 3BL8A 1YWGO 2K7FA 4Y0VA 4ZI7B 2IL1A 3GVIA 1OC2A 1Z25A 5E3IA 4F6CA 1GUFA 5BMVB 2Z9CA 4XI9A 4J7UA 4JB2A 2WJ6A 1QFZA 1FSFA 3PEWA 4BZQA 4FWTA 1RM3A 3RRXA 2FW1A 3OX1A 1R0KA 2CFCA 4C2BA 4FFOA 3GPBA 3OEWA 2HXYA 4LRYA 5JRDS 2C0QA 1HEUA 2O6LA 1C1YA 1DT3A 1L1QA 1ZMOA 3INTA 3LP5A 3GLGA 1U7WA 4WY8A 3O8LA 3TJMA 4AKGA 4TMYA 1OGYA 2BM8A 4X6LA 2VH1A 4JLOA 3SBOA 3EW9A 4JKOA 3I9FA 3CG4A 4H3SA 5J9FA 1P44A 3MMXA 3UFXA 1JN0A 4XYLA 3UCXA 2XXJA 5KQRA 3ZD6A 3CUVA 4IJQA 1B93A 4MWDA 1PT5A 4FMDB 5HQTA 2WF7A 4NX2A 1VL1A 4BN4A 2JIZD 4CTJA 5BNZA 4EJ2A 2CL7X 5G1OA 4AJEA 2HEGA 1XCPA 3OQ1A 4ZV4A 1VSUA 2A4KA 4DXAA 3SVLA 2EHJA 4I50F 3CISA 1I14A 1KO1A 1M2WA 4IKOA 4XUCA 3C39A 4L4SA 4M38A 4QM7A 1DI0A 4JA2A 3VVLA 4CKBB 2Y68A 3IC5A 3I01A 4NONA 4ARZB 2FFBA 3EMDA 1J99A 4DXHA 1SVKA 1SVOA 1GL9B 1WDLA 4BMXA 3LTNC 2CW5A 5J4HA 3SC3A 5ALHA 4N0DA 2HA7A 5CB0A 2EHDA 1YB1A 1Y3IA 1ZJJA 4XCXA 1P0CA 1OUMA 1ZJYA 4ZRNA 3DO8A 1BE8A 3B1JA 2PMDA 1TMGE 3AESB 3P32A 5D7BA 1ZM7A 3FSGD 2GILA 1M2HA 1X6VA 4HEJA 2HTFA 2DEUA 5CDUA 3MJVA 4E0BA 1DRVA 4FVTA 4C0HA 1E58A 2D4HA 3BFJA 3KTOA 1A2OA 1TZJA 1C2YA 1J9ZA 5JAMA 2PUFA 1V5IA 5E9WA 2OK8A 1VA5A 5G1NA 1IHOA 3HKEB 4D4MA 2QUZA 4U9IS 1XNQB 1G5TA 1XN1A 5F3DA 4WEQA 3NONA 4BMCA 2FRVA 3DKKA 4AUNA 1M1YA 4JDUA 3K1ZA 1JSRA 2VZ9A 4NR0A 4QNRA 3WICA 1Z16A 3PGJA 2LCFA 3PXDA 2IYSA 1T36A 4YRKA 4RM2A 5M5BA 2HREA 3SNHA 5BSHA 2HJHA 5C35A 2W2NA 2P0EA 3GCWA 1YQUA 4XPZA 4LMBA 3G2LA 3OZTA 4JNKA 3UICA 2GSDA 1ZMRA 1V4VA 2CWWA 1DAIA 1QV7A 2QYHA 2Y6VA 1WDTA 4BE4A 1F4LA 3D0RA 3PXXA 4I4CA 1I4OA 4GNRA 1CS0B 4LHEA 4IDBA 1WB4A 4EKIA 4JVNA 2OCDA 4HUTA 2YKGA 3DKPA 2CVZA 2IPAB 3HS3A 3K6SB 2FX5A 2HSEA 3TUJC 2IVZA 2PRJA 4HGPA 4YMUA 4YPVA 4G1EB 3TTVA 1DBVO 1Z8DA 2DHQA 1KYTA 3GFBA 4NBUA 4O4IF 4XQCA 3LPAA 4AZ0B 4EVRA 2M6KA 4MWOA 2D1SA 1UXGA 4KBYA 5FV7A 1T26A 2QG6A 4LXTA 3TXYA 4KQJA 4RMHA 1DKQA 3TO5A 2GEFA 4CKWA 2BGLA 3NLLA 4OLFA 4JJEA 5CA0B 4C07A 5CU7A 1A5BB 1V7PC 2QD2A 5DHTA 5AJWA 3I9JA 4YMVA 1ULAA 3FOCA 4IVRA 3OPQA 5C1DA 3UAXA 2VDLB 2P8SA 3FH0A 4KFUA 1ZNZA 3DOIA 5AW7A 1IOZA 2R751 2D5BA 4RU1A 2ZJZA 1QO0A 1GUDA 4XB2A 2HV9A 1BMQA 3SM9A 2VCYA 1GHTA 5GV7A 2QV0A 2XWSA 3K7EA 4HZUB 4LEIA 5HFNA 3C8ZA 5ECYA 1SC9A 4Q00A 2A9KA 3TW8A 4B3XA 3H42B 2ISQA 4M21A 3U09A 1RPNA 3C6ZA 4P0QB 3B36A 2GRAA 1H0SA 2CMGA 1R88A 1X3LA 2FK7A 1IE3A 2EF1A 4OFZA 4QRIA 3WWCA 4TMFA 3UPUA 4BNFA 4FILA 4YUXA 2QN7A 5JWRA 3PUHA 2FFRA 3AERA 4M9ZA 4LRSB 1YB2A 4HEQA 2OAQ1 1QOQB 3FRHA 4AICA 3OY7A 1CQIA 3UM9A 2VOJA 4HFMA 4BBPA 3AM4A 3TH5A 3JWPA 2PY6A 2JFZA 3H5RA 5B57C 3NU1A 2ZSJA 1QX3A 1RXYA 3BCSA 3M34A 3VAAA 1VKNA 3RUAA 1VE7A 3IOEA 3OCWA 5C1BA 3S81A 1A9PA 3MJSA 3ZD8A 3UJAA 3QLEA 4O3MA 1T6NA 2F4NA 3TQFA 2H00A 3VHXB 1KHHA 3FFWA 1OH5A 2LKCA 1R27A 2PKCA 1LI4A 5JXHA 4D9GA 3BTUA 3LHKA 4NU0A 3ZU5A 1P33A 3OBBA 1LDYA 3Q0TA 3SKXA 3FYCA 4O4JF 3F71A 5HPYB 1F8GA 1WU7A 1U5CA 2COEA 1K98A 5T57A 4GBED 1TI7A 5A9SB 3I4FA 1R15A 4S0XA 4KAFA 2F1OA 3H97A 5EJMA 3JQGB 4RVFA 1KAQA 1ZR4A 1D4OA 4QUBA 3E18A 3L8GA 5GGYA 5E4TA 5FH9A 5SZKB 4RZIA 4TM7A 4WZAE 1SVLA 5EMHA 4NCXA 1ZUIA 3TDMA 3UF0A 3VSAA 1YB7A 3U81A 5DNCA 2DUJA 2HCTA 3O9ZA 2BUAA 1CUIA 1JJAA 1K63A 5J2TB 2DP4E 1OGIA 3QWHA 1D2CA 4LYGA 3SC4A 1LGYA 3F2IA 2C61A 1A8HA 4RSMA 3CU5A 1Q0LA 3JQFA 4B3HA 3GGPA 3I72A 3HFGA 3SR3A 3IPCA 2PH5A 1YUNA 4XX1A 5BSRA 3OTOB 3OE7A 3S44A 4ETNA 4JVOA 1EINA 1XDUA 2I2AA 1JG2A 4M55A 3ZY4A 1THTA 3M4YA 1WUYA 3EOAI 3TNDA 1QRSA 3VU9A 1KMNA 1ZSVA 1RE0A 4MI1A 1IDOA 8GPBA 1JT9A 1LB1B 1U7ZA 3T52A 4H31A 4G0NA 4DM3A 4IG9A 3ZVMA 1IBCA 4LF7B 3REQB 3C3DA 1V45E 4BECA 2RAFA 2EQAA 1DPGA 4X95A 3AI3A 4AF8A 1GLGA 3TXAA 5C34B 3EVGA 2FN3A 1J39A 1NONA 4R6XA 1GRQA 2GPYA 2ZJ5A 3W5VA 3WL4A 1QH8A 4HGNA 4IUYA 4YCSA 1AO0A 2POCA 1IEQA 1NFRA 5E95A 3QX3A 1VPVA 3OE4A 5ALUA 2NSJA 3DZBA 3RRYA 5JZSA 4MITA 3U9SA 3QPDA 3TLYA 5DLEA 4UM9B 2BVNA 2GTHA 2NUAB 5ITZA 4ZCMA 1GEEA 4PBTA 1N6LA 5L7TA 1IN4A 4K9QA 1E2QA 1JEAA 2XX3A 3OLCX 1CQWA 3V55A 2AVDA 4I1VA 3J81k 2WKSA 4WGGA 5EWJB 4W1QA 3FNFA 3BE5A 4RWZA 4N8SA 4WL0A 1S4MA 1WF3A 2A33A 2NQTA 5KYWB 4IQGA 4B76A 1Z34A 4DQXA 1K8XB 2JCVA 4A2CA 2FW9A 2ZUDA 3ENKA 1DUIA 4CI9A 1E0KA 1M5UA 4U9UA 4MNTA 2R8EA 2REXB 3ZZNA 2LE0A 1DJQA 5JFOA 1PJSA 4AJ4A 5A5DA 1DAHA 4EY5A 1IM8A 4DBLC 5CB4A 3GYBA 4QUDA 2DJ5A 1ODCA 3NVDA 1MG5A 2W37A 4DIUA 4CVNA 1H2HA 2OHGA 3F5MA 4GBMA 2YYYA 3WXMA 1BMTA 3D6HA 1JIKA 5GP1A 3WK4A 5C7LO 2BEWB 4RE5A 5JC8A 2PD3A 5G1PA 1GZ7A 1P9RA 1PG2A 1ZL0A 3HABA 3ZWBA 5BQ3A 1NW5A 3BZUA 2YWEA 4MQ6A 1XZCA 3KWLA 3KXDA 1IQRA 3NP9A 4WPGA 2R79A 2P2LA 3PQ4A 1Z63A 3ELBA 4L5YA 3AI1A 1PE0A 3FTDA 3HDJA 4KN9S 5KSYA 5CLIA 2PBZA 2PS1A 5DTQA 4LNHA 3TZBA 2PRSA 1IN5A 4BV9A 1ODJA 1G8FA 2E6UX 3GFQA 3FMVA 5SY9A 3H17A 3TOVA 2J3DA 2JGNA 1N6HA 1SXHA 3N6RA 1RBZA 3L5OA 5EXDA 2B92A 2I33A 2NYAA 2W71A 4OQLA 3W7BA 3MAAC 3LIIA 4JBLA 5SV2A 1YAJA 5C5IA 4R0NA 2VTEA 3LSTA 3BE6A 3UMBA 3N8NA 2EWWA 4WZ6A 4OAOA 4Y6PA 1ISMA 5A3SA 3QEMB 3AKCA 5K6AC 2XZTA 3F74A 3R75A 2J07A 1CE8A 4AF7A 5CFZA 2LV8A 4RHTA 3T1TA 4RVHA 2JAUA 1H69A 4MQFB 2WU0A 4MW7A 3LM8A 3EXAA 1FP7A 3MXTA 2QQGA 3CLKA 4DC0A 3LAWA 1Z35A 1S1MA 3AOEC 4U7FA 2OSVA 4OLJA 4K6CA 1Z4MA 3TIXB 1Y4ZA 3IVGA 1DO8A 5FEUA 1KJNA 3UOAB 2GAFA 5AKHA 3ZTTA 3CTPA 1FTGA 1JTVA 1MEEA 1UBJS 4DR5B 3RK1A 2JEZA 5A5EA 3W0LB 3GDHA 4AWAA 4IH9A 2N46A 2JHAA 1L9KA 4KSCA 3WDLA 2FWJA 4JUCA 3RUCA 1X38A 4BVLA 5A4JA 3PXCX 4XDHA 3UXYA 4M37A 4BC1A 4BGVA 1FVXA 4QU9A 3GY0A 5J1SB 5FO0A 2EAUA 2XBMA 3SWWA 4EW6A 4CM7A 3DXFA 3SR0A 2ZWPA 4Z54A 2AYYA 1O77A 1Y8QB 4FB4A 4Z3KA 4E14A 3U44A 3FCXA 2XNCA 3EGOA 1YS4A 3C6QA 4RH3A 5BORA 1DIHA 3IVXA 4HATA 4OBBA 4DEXA 1I2ZA 4AUEA 4CV0A 1TIPA 4LSMA 1A98A 3ZLJA 4KWHA 1PWHA 1YRQA 3EK2A 4O59O 3GLHE 3GVCA 2ADOA 4JYAB 3GXBA 3CVWA 2JG3A 3DOEA 3TJRA 1X1CA 4DMRA 4R8LA 3NHMA 1U4OA 4QUJA 2JAXA 1DHRA 2Q3JA 3IEUA 4AJLA 4FW9A 3FDZB 2J67A 4MW0A 1NI4A 2HWYA 3DQPA 1IZYA 3K9WA 4MVWA 3NASA 5BRAA 3FNHA 3QKWA 3UAOA 4EARA 2AHOA 3MGKA 3I6IA 1NKSA 3TSCA 3VDRA 4DLZA 2FUNB 2ZYDA 4Q7EA 5D86A 2AJ8A 1EEXB 2PPVA 2XUZA 1DQNA 2AC7A 2QN1A 2JB9A 3ZGVA 3OTWA 3TZKA 3OQHA 2WAXA 4PGGA 5IUNC 3PDJA 2QLFA 1OW3B 1XFAA 1T0BA 2O5CA 5L4SA 4Y2PA 4I1SA 1ESNA 2HA3A 4BO0A 4CL0A 4LE1A 2W9XA 4L4YA 2QZJA 3GJXC 3S55A 4F3TA 1YBAA 2ET6A 1I0LA 2FA9A 4XFJA 5AVXA 1XWWA 2HZ7A 4ZI7F 2OGUA 4DLUA 4BV3A 4RH0A 4KK4A 2XCRB 1EA5A 2HWXA 2DFTA 4F8JA 4HG2A 2ZPTX 2DU8A 3QSYA 1CY1A 4I1YA 3PX7A 1V48A 3CZMA 2QZSA 1LEHA 2FMKA 3C24A 1XE3A 3RK4A 2A8YA 4WTOA 4P7JA 3CEAA 4LKOA 3SEZA 1ZGBA 1ZIXA 2IPMA 3ZZ1A 1J0DA 1JT2A 2Y8EA 1NJFA 3GH3A 2VTDA 4FYVA 3HKCA 2JK1A 5G53C 4Z7QB 2UXDB 1UK6A 4LNUB 5JYBA 3K9CA 2DFVA 2W2LA 1R16A 1ZD1A 1HT1E 4DSTA 4FLMA 3PZBA 1WKBA 4I50A 1VLQA 1PZNA 2FSVA 4FMDF 3V80A 4CEHB 1F8XA 2ZJ2A 4G1BA 4MMYB 4DLPA 1LQUA 2C9BA 4MGZR 3BXPA 1BGXT 1JFVA 2X2FA 5DSTA 3ROFA 3QBTA 5A6SA 1RCUA 1PYOA 2GCOA 4LDQA 1SJ9A 1WD5A 3AIMA 1DFIA 1JUDA 1TO1E 3GUYA 1KYYA 1CUGA 3QHAA 4LOHA 1WL8A 4OMCA 5JAIA 3ADCA 3LFTA 2VT7A 2PL3A 1MABB 2NQ8A 1C4WA 2PKRA 2PJZA 2PCJA 2E4XA 2YWDA 3NORA 3P2IA 3W06A 1ZH4A 3SZ3A 3WP0A 1XMQB 4PC1A 1Z06A 2AG1A 4ZOAA 1I80A 3NAMA 1JV2B 5TQVA 1ZOPA 4QXAA 3ITKA 3SCZA 3PF9A 3STWA 4U2FA 5DN6A 1ILEA 1M8FA 1IUPA 1OBVA 1TA0A 1UADA 3MMNA 1IY8A 3DDUA 1TZ2A 4KIGA 1UBHS 4RDXA 2X4LA 2V4ZA 4AS3A 4NP6A 4KR2A 4PPNA 1BEUB 1VJCA 2VPZA 3IDOA 4H0CA 1F12A 2E3JA 4GOLD 4CMEC 2OVBA 5E1MA 5JSZA 2O8EB 1JG7A 1F0YA 4A8JB 3Q8KA 8MHTA 1GIAA 4MYTA 3WXBA 4QLBA 3WG9A 5L40A 5CLQA 1RYFA 3MM4A 3WGNA 2XRMA 4RCVA 2C94A 3JQBA 1Z33A 1YJAA 5LSAA 4JXKA 2WIKA 3T3HA 5L3QB 3AJDA 4G2NA 3HO6A 2X0IA 4RJLA 4JR0A 1XAJA 2CNOA 3C5HA 5KYXA 3S2EA 1KEEB 4JP2A 4RF2A 1ZRHA 3ZXXA 4N7JA 3D8BA 1E5QA 2G5GX 3NWBA 4ZAZA 3A7DA 4PPYA 4RVOA 4ZAFA 5FA6A 3WSVA 3DHYA 5HE8A 4Z3OA 2QXYA 3ETEA 4S1NA 2ODBA 1QZTA 1G8KA 3MWDA 5I7WA 5IDVA 1AGNA 2PGDA 1D4AA 4Z2YA 3W4KA 3N1UA 3WMWA 1VHJA 3W79A 2TMDA 2OOSA 1UOQA 1ODSA 2V45A 3IXMA 4F96A 4DKXA 1ACJA 3G0GA 1KFJB 3ET4A 2WVAA 1VE9A 2CC2A 4O4IA 4KN8A 4YCAA 3C3BA 4RVDA 4HQLA 3KR1A 1K7YA 3HR8A 2OGWA 1WMEA 3Q9LA 3LYHA 1SUDA 4R0VA 3AEKA 3MOSA 2W2OA 3BQNB 4KK3A 1H5UA 3AHFA 3L93A 4OM8A 1EUCB 5DSZA 1L4GA 1NRIA 2H5LA 2R8PA 4Q1BA 1NVUQ 1KDZA 1NXOA 1M9NA 2OG2A 1XQWA 4Q37A 4IR7A 5EIOA 5FB3A 4UBOA 5FL3A 3M1YA 3T9FA 2CK3D 4C3ZA 1IN8A 4KITB 5JS7A 3UT5A 3DBLA 5AIBA 1GG8A 2V6MA 5CA0F 4B45A 3D7MA 4BLWA 3EPJA 2ZSAA 3ZCXA 2Q4TA 1V16B 3RNLA 1RZUA 3MFYA 1ECBA 3CSSA 4ZXFA 2XODA 2ZI7A 4QLAA 4KQ1A 3AB3A 4HNQA 4FJ1A 4TYWA 3HB7A 4LDRA 3NM4A 4UUMA 1MD9A 1QQ7A 1QHSA 3KZKA 5BW6B 2VUHB 1B41A 1MU0A 2WPDD 4I5GA 1NZJA 1AGYA 4I4IA 2Z04A 5KTMA 1ZK4A 3HVIA 3QE4A 1Y7IA 3HB0A 4WDRA 1X7YB 3C98A 3S6JA 3STVA 1ECGA 4J16A 2H3HA 2JAOA 4ARUA 5IRCD 2QLBA 1N77A 2EKZA 5KHOC 2OM6A 2GT1A 3HJAA 3JRWA 5KYTA 2RHTA 3EAFA 4DQUA 4YFYA 1XU7A 1BE0A 3MCZA 4U5QA 5I8ZA 3RRJA 5AVKA 4GL2A 2P6PA 4LFBB 1NR7A 1A95A 4D45A 4CM1A 1KVSA 1P91A 3BC1A 3RBXA 5ICFA 1WZIA 3TZEA 1K3FA 3UMJA 1CCWA 4C0BA 4N65A 4JUDX 3QZUA 2YMQA 3DTTA 4XPIB 5ALDA 3REFA 3DCJA 4IIDA 1BQ3A 5HK9A 1QLHA 1T4CA 1V47A 1XBTA 3WLHA 2I6QA 4YR7A 2JLBA 2SKDA 4IDQA 2GPTA 3D8SA 1SR8A 3KEGA 1JHXA 2OMEA 3MGBA 1GCAA 3WYFA 2FKNA 2HSWA 3PFCA 4I4LA 5DNAA 2QLNA 2EQBA 4BMNA 3TG2A 1V26A 2CUTA 4O4JA 3BWYA 3BDAA 1IJKA 1EG2A 3JRXA 3EG9B 3BMQA 2I3DA 2UYCA 4UHCA 3GQBA 2PVSA 1MQSA 3AO0B 3MRXA 5EGNA 1F2DA 4JFAA 4H6PA 1NPDA 3H99A 4RHUA 4HPWA 4NYIQ 4XWGA 2A9RA 5HG0A 1I7NA 2PAAA 1NC1A 1DJPA 4EJSA 2W2PA 4B9EA 1ADGA 3WLIA 3ZHZA 5FBKA 5IJWA 3HK2A 3P4XA 4BNKA 4MV7A 3E9DA 4C78A 4G26A 2CLMB 5JCXA 5CK5A 1SBNE 1YVPA 1OAKA 1JJIA 4NMXB 1NSFA 5DXJA 4D6YA 1D1TA 2OB1A 3PK0A 1HKUA 2YL2A 4KB5A 1UJCA 1YI8A 3V4LA 3QJ5A 3AONB 4Z0PA 1QYRA 3L9XA 5MDHA 2V7QA 3GR6A 2ZP1A 4P7FA 1XDZA 5AHWA 5J2TF 1Q83A 1KVUA 3OPYA 4G0MA 4JBWA 4H3KB 4OBWA 2E6KA 4IGAA 4QA9A 3VKVA 2VDNB 2YWJA 2OV2A 2OAEA 1DLJA 2ZKLA 3CUEF 3OE5A 2PR2A 3E1GA 2G71A 3H2KA 2FSUA 4W5QA 1SPXA 1SEPA 2VT3A 3PP8A 4NWIA 3HJCA 1YMQA 5KB3A 2HIAA 4ZMRA 5IK2A 2BKLA 1RJDA 1XL1A 3G89A 3L7AA 5BQOA 5TT0A 3V6MA 2I2DA 3EJ6A 4AXXA 2B6NA 2GPSA 5KSZA 3PC4A 5GM1A 2G72A 3E4DA 4X1IA 2I4RA 2XTAA 3ZDEA 4Q4CA 1LCIA 2WEKA 5KOHB 1N8TA 3WGLA 1KVQA 1XG5A 1FX0A 4NNOA 1YJ5A 4IDHA 4NENA 3RJTA 4WXMA 4ZOCA 3WHPA 3QOFA 4B6GA 4M0DA 1W6UA 4OHWA 2HLDA 1J00A 1PHPA 1TUEA 2EKLA 1I13A 2P11A 4BQFA 1LDMA 2PBRA 5ARDA 3QUQA 2IWHA 2JGJA 4WE3A 1YS2X 2WZDA 3I2KA 4Q9HA 1CUSA 1XVVA 3LY5A 4H7HA 3TIFA 3T4EA 4MX8A 3W90A 4DWJA 3ZN2A 3D8TA 1BWSA 1QG6A 2HJRA 2AMFA 4IVQA 4CI0B 3P9CA 4XTCS 1YCDA 2DT8A 2C3PA 2JGAA 4PG5A 4PLCA 2O57A 4GM0A 2Z83A 3QXCA 3K70D 2DHEA 2GK3A 2WQ6A 5JMTA 1LNZA 3WLFA 4JEHA 2I7TA 5SYAA 4CETA 1W5BA 3WKCA 5JQGB 1AKQA 1I32A 4RK1A 3UYLA 5K0CA 3T3NA 2QGFA 2XGGA 1A27A 3G2PA 2Q5EA 1L5SA 2VDRB 2W2MA 5K3AA 4WEOA 4PZDA 4GX5A 4C7OA 5IKEA 1RI4A 1MH9A 2LXNA 4ED9A 2JRCA 2W6JA 3FFXA 2RC6A 3MC1A 3D64A 5CBPB 1E3TA 1TL7C 2D1YA 4XRGA 1QC5B 1TZMA 1GSAA 2WILA 3QSGA 1IM2A 1JR3D 4JV5B 1SU6A 1HDXA 3AIKA 3H6KA 1UF9A 4MV9A 5FPHA 3TNYA 3QI7A 4QQFA 1WY5A 4KH0A 2FPPB 4QECA 4L4UA 1U6KA 2JD0A 2AOUB 2PFSA 1ARZA 3EBPA 3A28A 1QGED 4RDHA 5KNDA 3I9OA 1JR3E 2DUMA 5KJEA 5KDDA 3CEJA 1ZI8A 1JDZA 1UAGA 1XCOA 4G5XA 2BFMA 3KALA 1NMXA 2R86A 5A04A 3GRRA 3PEYA 3GDOA 4H2DA 5H4GA 2F8LA 4GYWA 2NO5A 4EYQA 2OFXA 3MJEA 1N5IA 1S2IA 4N9QA 4IVPA 3WMGA 2GNPA 2WWWA 1Z47A 2FW0A 2O19A 4TRJA 1ORWA 4WNIA