1LPMA

A structural basis for the chiral preferences of lipases
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
534
structure length
534
Chain Sequence
APTATLANGDTITGLNAIINEAFLGIPFAEPPVGNLRFKDPVPYSGSLDGQKFTSYGPSCMQQNPEGTYEENLPKAALDLVMQSKVFEAVSPSSEDCLTINVVRPPGTKAGANLPVMLWIFGGGFEVGGTSTFPPAQMITKSIAMGKPIIHVSVNYRVSSWGFLAGDEIKAEGSANAGLKDQRLGMQWVADNIAAFGGDPTKVTIFGESAGSMSVMCHILWNDGDNTYKGKPLFRAGIMQSGAMVPSDAVDGIYGNEIFDLLASNAGCGSASDKLACLRGVSSDTLEDATNNTPGFLAYSSLRLSYLPRPDGVNITDDMYALVREGKYANIPVIIGDQNDEGTFFGTSSLNVTTDAQAREYFKQSFVHASDAEIDTLMTAYPGDITQGSPFDTGILNALTPQFKRISAVLGDLGFTLARRYFLNHYTGGTKYSFLSKQLSGLPVLGTFHSNDIVFQDYLLGSGSLIYNNAFIAFATDLDPNTAGLLVKWPEYTSSSQSGNNLMMINALGLYTGKDNFRTAGYDALFSNPPSFFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A Structural Basis for the Chiral Preferences of Lipases
pubmed rcsb
source organism Candida rugosa
molecule tags Hydrolase
molecule keywords LIPASE
total genus 190
structure length 534
sequence length 534
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 1995-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00135 COesterase Carboxylesterase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1lpmA00
4ETWA 3FSGA 2RHTA 2OCLA 4QEKA 2XUHA 3E1GA 3HC7A 2WIGA 4YPVA 2OXEA 3C5VA 4WCVA 1QIDA 2XUFA 3VXKA 5KBYA 4CCYA 4E46A 3BE8A 3HYSA 4FTWA 3KWJA 3WA7A 2JGKA 1FFDA 1LBTA 3R3ZA 1RWQA 4J0JA 3G0GA 3G9UA 4B9EA 1DQZA 1G4HA 1EB9A 3I2FA 5CMLA 1R3DA 1RYYA 1QIIA 3SWWA 4GWLA 3OG9A 4AXBA 2OG1A 4F60A 3FBWA 3W05A 3FLBA 4DMHA 3G0CA 5A7FA 4L72A 5ALYA 2BJHA 1XZDA 1FFCA 2WTNA 1GZ7A 4M0MA 2XE4A 1VOTA 5H3HA 5A7HA 4GW3A 3WWPA 1CUUA 4H35A 5IKXA 2WIKA 3UMJA 3GZJA 2H7YA 4UBMA 4IQ4A 1QONA 2ACEA 1T4MA 2C7BA 4RGYA 4KAAA 5ALMA 2PVSA 2WHPB 2WSLA 4MWTA 3F96A 2PU7A 5LIPA 3WIBA 3L1HA 7YASA 1R9MA 4M0EA 5CH5A 1UWCA 3PFBA 4OD0A 4KEAA 4QDTA 2XUAA 1CQZA 1KEZA 3HLKA 4GEGA 5DNVA 4IH1A 4BP9A 1ZI8A 1E89A 3PE6A 3STVA 3D2BA 2X76A 1X2EA 1YAJA 1TK3A 2RI6A 4DMKA 4L0CA 1J06A 2WU4A 3K9BA 3MUNA 3Q8WA 2EDAA 3EBLA 1XRNA 3PFCA 4HXFB 5ALKA 1CUVA 4PNZA 3ANSA 1IUOA 2HA5A 2JBWA 3U1TA 1EINA 4XVCA 4FLFA 5AP9A 3NUZA 3R3YA 1SC9A 1C7JA 4EY4A 1ZI6A 5JAOA 2CBGA 4W63A 1CUHA 1UT6A 4B9AA 4JH0A 2WU3A 5HF5A 4BE4A 2AJ8A 1VA5A 1CUDA 3C6YA 4Y2UA 1JKMA 1K8QA 1ZD4A 1QIFA 1UK9A 4K5QA 2WTMA 4CG2A 3BJRA 4JNCA 3AINA 3W9BA 1MN6A 3H2HA 6YASA 4AN0A 1VLQA 4QZVA 1XRLA 4CG3A 2B20A 3K2IA 1HLGA 4FMPA 1ODSA 5ALXA 1EVEA 4P08A 3HRHA 3ZV7A 3OURA 4B83A 3AILA 4I4CA 1CUIA 2DSNA 3NGMA 2CB9A 2JGMA 2JIDA 4PQEA 1H2ZA 3R3XA 2OGTA 1ACJA 1VKHA 4Y7DA 1WB6A 2JEZA 3HEAA 2RONA 1ZD2P 3O4HA 5LLSA 4WJLA 2XDWA 3FOBA 3D59A 3UUEA 4HTAA 3KSRA 4QE3A 1U2EA 4U2EA 1DT5A 3BWXA 4LKOA 4H7FA 5CT5A 4KE8A 5HF6A 2WQZA 1G5FA 5EGNA 2JGFA 1Q0RA 4P92A 4XWGA 4UHDA 4Q05A 4X90A 4Y2VA 3WK5A 5AKHA 5ALNA 5DNWA 3ZLTA 5AHXA 5A71A 2Z3WA 3G0BA 3FVTA 1MAHA 1UOQA 1W52X 5D7BA 1DWOA 4WY8A 2OGSA 4W1QA 4J0KA 3F8SA 4X7BA 1EDDA 3RKSA 2PM8A 2WFLB 4ARAA 4NS4A 3VJMA 3FYUA 2XMQA 1BU8A 3ANTA 5AI0A 1G42A 4J0DA 3DYVA 4KE7A 5AK3A 5FOQA 3BL8A 2GYWA 1EK2A 2YXPX 4QDOA 4DSAA 3G02A 2HU8A 2VT7A 1W4LA 3C6ZA 3WLAA 3HSSA 4UHEA 2WJ3A 4C88A 4G8DA 2QM0A 4L9AA 1QJ4A 1QZ3A 2C58A 3FWHA 1YA8A 1Y37A 2VTVA 1K6EA 1VE7A 1MX1A 3L1JA 5A62A 2XUGA 4KR0A 2BFNA 3ICVA 4Q3KA 3M3DA 4YK7A 2RAUA 3DD5A 3E4DA 4OB7A 4BRZA 1ORWA 4PSUA 5CT8A 3WYNA 5AI8A 1DWPA 3D5EA 2K2QB 4BYMA 2ZYRA 3A6ZA 2OGZA 2WHRA 3BF8A 4N8SA 2DR0A 1UOOA 1BEEA 3IUNA 2XMGA 5C8XA 4Y2YA 5EIAA 4AO6A 4C4XA 4Y2JA 3STXA 3G8YA 2XUIA 2WLSA 3O4GA 2J4CA 4HS9A 5JIBA 5FP0A 4Z49A 4I19A 1A8SA 5BWCA 3SX4A 2Y2UA 4G9GA 3ZWQA 2UZ0A 4PV7A 1VZ2A 4AO8A 2BUCA 4OCZA 3R3VA 3S8YA 3BIXA 2QTBA 1S8OA 5AKLA 4B85A 1W75A 3G9TA 4ZV7A 3MUOA 3NOXA 1CUCA 3STWA 4DYHA 1QIJA 5D6OA 1IZ8A 3HI4A 2ACKA 1ZD5A 3JW8A 4BVLA 2CJPA 1SFRA 3BF7A 1JMKC 5AK5A 3I2HA 3D3NA 4BVJA 1LNSA 5FXMA 3DQZA 4E11A 1QOZA 1P0MA 1GPKA 3RARA 5A7GA 1RP1A 1L7AA 2I78A 4BRSA 5ALSA 2O2IA 4H7EA 5CURA 4FKBA 5JASA 4DSZA 3I1IA 1D07A 5DWDA 1SOMA 3WKCA 2ZSIA 3AIKA 4Y2QA 4BZWA 3GFFA 3VDXA 2AJDA 5ISMA 1ZIYA 2ZSHA 3V1LA 4NZZA 3I2GA 1BROA 1R88A 4UBJA 1XRRA 1VA4A 3CN7A 4BE9A 1GT6A 4MEBA 4G4GA 2E3JA 1R1DA 4BAZA 4UHBA 5ALIA 1YB7A 4EY5A 2VQ6A 4UHCA 3C70A 1ISPA 4BC1A 1JJFA 4CG1A 1AUOA 2XQFA 3H17A 2ZYSA 4MWSA 1XRPA 5CH3A 4Y2TA 2AJLI 3M83A 1JMYA 2WIDA 1JI3A 2Z8XA 4PSCA 1WB4A 3FLEA 2XUKA 4MYDA 2DHDA 3PDCA 2YH2A 4P93A 1DWQA 2ONCA 4FBLA 1BN6A 5ALVA 2BCEA 5T4FA 1SCKA 5D3ZA 1N8SA 2JEYA 4LHEA 4QDXA 5T4BA 4U2GA 4A23A 2PKYX 2XMCA 4MYSA 4X92A 1H22A 3D2CA 4UHFA 1IMJA 1U8EA 2VJCA 5CTAA 1THTA 4X93A 3DYIA 1YASA 4GXNA 4OU5A 5AKKA 4UBKA 1EHYA 2FX5A 1GQRA 1LPOA 4A5SA 4EBBA 2PUHA 1YR2A 2HA3A 4O08A 1QIKA 4KAFA 3MVEA 5AM5A 3QH4A 4QDZA 1DQYA 5J3JA 3WK6A 2H7CA 1PV1A 2LIPA 5BOVA 2J3QA 3E0XA 5SYMA 1K63A 4JYPA 5JADA 5AIBA 3O95A 2C5GA 2Q0XA 4RPCA 4GBGA 1UOPA 3DJYA 1WM1A 1GGVA 4EY7A 5IVIA 1BCSA 2ZVDA 5HFNA 1KU6A 2Y2VA 4EZIA 2BUAA 1EX9A 4Q34A 4W9RA 4DIUA 5EHXA 2HL6A 3O4IA 3WL8A 2ZYHA 2GYVA 2DHCA 4G8CA 3V1MA 1IUNA 2XT0A 3RM3A 4AMYA 3C6BA 1QGED 4Y2RA 2PSHA 1MX5A 1UK8A 1CR6A 2D0DA 3B12A 5ESRA 3I2JA 3WZLA 1FJ2A 3IA2A 5AOAA 4U2FA 2HA2A 4HXEB 4DGQA 5DJ5A 2OQVA 3PF9A 4GECA 1HPLA 1E8MA 2IX9A 2XLBA 1XQYA 3LLCA 5AI4A 1XZMA 4MJ3A 4CIBA 2C0PA 1L7QA 4E15A 5HK8A 3RK4A 3LIIA 4C87A 3QPCA 1LLFA 4DM7A 5CH8A 3E3AA 1THGA 4E14A 3H1BA 2IITA 4EA6A 4H7KA 3B5EA 3TRDA 1E5TA 1E66A 2G5PA 4X95A 3I28A 3TEJA 3VVMA 3PUIA 5AKGA 4BAGA 2G63A 3STTA 2O2HA 2HADA 1CRLA 2HA6A 3PUHA 1M33A 5ALHA 4BB0A 4FOLA 3F9CA 2Z3ZA 3W2TA 5AM2A 4X6YA 4P9NA 2C0QA 3LIPA 4K6HA 3SK0A 5A2GA 3HZOA 4KE6A 4U2BA 3CN9A 4C6HA 2WG0A 4B7ZA 1P0PA 4OSEA 5YASA 1U65A 3KD2A 1XLUA 2QVBA 1XKTA 2HA4A 3KWFA 4XJVA 3N2ZB 5LZ4A 3KOOA 3D7RA 1H23A 1JT2A 1CLEA 2BAGA 4FWBA 4N5IX 3ZPXA 3FYTA 2QXUA 5FRDA 5HFAA 1GXSA 3FVRA 2GBIA 4C89A 1PJAA 5E4YA 1R9NA 1R4ZA 4U2CA 5ALLA 3EQ9A 3VJKA 4J7AA 1CUXA 1EDEA 2XQGA 3I1YA 1XZJA 3WK4A 1A7UA 1XQWA 3G0IA 4X91A 3OPMA 2I3ZA 4V2IA 2OCGA 1CUSA 1ACLA 4KE9A 3ZLUA 2WJ6A 3FLAA 3DLTA 3I6MA 1F0PA 3H04A 3BJMA 4UFOA 1SCIA 2I03A 3ILSA 4TGLA 4G1FA 3T4UA 1NX9A 1KU0A 2V98A 3M81A 2YYSA 2HHAA 3AZQA 4F5ZA 2H7XA 1F0NA 3AUKA 1ZJ4A 2XMDA 4DMCA 1YCDA 2XQKA 1PFQA 3F98A 2WIFA 3OTQA 2V96A 5AM3A 2GBGA 2VJAA 1SCQA 4BCBA 1W6RA 4EHBA 1ZGBA 3DS8A 1XQXA 4JEIA 4CI9A 1DX6A 4J0IA 5FDFA 2QUBA 2XMBA 3AZOA 3ICWA 5K3BA 4B82A 3H2KA 3ESDA 5K3DA 4BBZA 2WUGA 3WKBA 1Z68A 3HJUA 4HRXA 4F21A 2DCMA 4X71A 4OUKX 1CVLA 1XFDA 1W1IA 4FLMA 4DNOA 3GELA 3WWEA 3AJAA 5IVKA 3C8DA 3SC2A 5DYYA 2WIJA 1OCEA 2QR5A 3WL6A 1QTRA 1WOMA 4ZGBA 2JGIA 4AZ3A 1O6FA 4S0XA 1LGYA 1DU4A 1ZIXA 2HA0A 4UBOA 3OOSA 4B80A 4Q3OA 5JATA 3I6YA 2Z8ZA 4DLNA 5ALDA 4RE5A 3WWDA 5I8PA 3DCNA 4CFSA 2WUEA 2GYUA 1MT3A 2PPLA 4W1SA 1MAAA 2PSFA 1MU0A 5JAHA 1YS1X 5AM4A 1IZ7A 3WK7A 4G4IA 5BV7A 2VA9A 1ORVA 3PI6A 1O6GA 1Q83A 2VJBA 4ZWNA 3WI7A 2R8BA 3FSGD 1UZAA 1EB8A 2ZJ7A 5ALFA 1XZCA 5AH0A 4N5HX 5IVDA 1BN7A 4BC0A 3QZUA 4HXGA 3BDIA 4EUSA 1GQSA 4B84A 3VVLA 3A2MA 2ZJ6A 4LXHA 4BTLA 1J07A 5EI5A 2QXTA 2CMFA 5EHNA 2W6CX 1H2YA 3G0DA 1G66A 4M0FA 5ALJA 4PSDA 2JF0A 1C4XA 5AOCA 4AN1A 3EQ8A 2PL5A 1QIEA 4BDTA 4XX1A 1X70A 4LYDA 2X8BA 1WPRA 2AJBA 2XUQA 3AIOA 4ROTA 5AJHA 3ED1A 5DTIA 4G9EA 2PSDA 4ZV9A 4W1RA 3KXPA 4X94A 4UFPA 2CKMA 1JU3A 5EHZA 1CEXA 4F0JA 2HFKA 2W22A 2DQZA 1XZAA 3WL5A 3DOHA 3C87A 4FNMA 4Y2PA 5I7UA 3OC0A 4AMZA 1JU4A 1EK1A 4UBIA 4Q3LA 4B0OA 1FFEA 1AURA 4QLAA 5AKZA 1NU8A 1F8UA 1GPLA 3WJ2A 5E4JA 4WDQA 5AM1A 4BAUA 1DTEA 3QMMA 4NVRA 1FFAA 1XZHA 1LPNA 1XZBA 5JD5A 2ROQA 1BS9A 2PSJA 3ZI7A 5FPPA 5K3FB 1FFBA 3H19A 2GBFA 3G9XA 3VISA 4KAJA 1BE0A 1Y7IA 2XUDA 1IVYA 2EDCA 5C8ZA 5AK4A 1UKBA 4GI1A 5CXUA 1TRHA 3C6XA 4GHWA 4L3WA 1CUBA 2PBLA 5DYWA 2EEPA 2WUDA 1YS2X 5KREA 4G5XA 3D4LA 5HF9A 4DNQA 1CPYA 4K2AA 3H2JA 5AK6A 4IH9A 1AQLA 2JGEA 2PSEA 1P0QA 3W06A 1AGYA 5HQ3B 1YAHA 5CT6A 1YSCA 3H2IA 2XMRA 3QBJA 3AFIA 3PF8A 1U4NA 1MPXA 2WFMA 3C5WP 5ALZA 1JFRA 4BVKA 3JYHA 1JJIA 5FPQA 3WMRA 2HRRA 4MQMA 2ES4A 1MJ5A 4FNGA 4OU4A 5I9IA 5AOBA 1XLWA 4C4YA 5AKJA 1EH5A 4MXDA 1AX9A 1TQHA 3WZMA 4AB1A 1Y7HA 1AC5A 5DYTA 4H0CA 4X6XA 3LCRA 3IDAA 3H0CA 2WKWA 1QIMA 2QUAA 2C4HA 1E3QA 3V1NA 4OPMA 1XZLA 3DKKA 1XZKA 1TIBA 5FKJA 4B81A 5EIHA 4B0PA 2QZPA 2Z5GA 5AKEA 4QDUA 1OILA 1J2EA 3FNBA 5JD6A 2X5XA 4X85A 2HDWA 3H2GA 1TCCA 2GZSA 1Q0ZA 1VZ3A 3KDAA 3WWCA 5LZ5A 1UXOA 3QMVA 4AQDA 2J4FA 2VF2A 3IVMA 1XZGA 4LXIA 1LPPA 2I3DA 1XLVA 2OPHA 1R50A 5T4EA 4DNFA 3FYUC 2QMQA 4BCDA 4EY6A 2IIVA 4K6KA 2BGRA 1UKAA 1H2XA 2BGNA 4C4ZA 2DHEA 1MTZA 1CUGA 2CZQA 3CXUA 1K5PA 4PF1A 4IHAA 3C45A 3G7NA 3NWOA 5K5EA 3IB3A 3P2MA 3RLIA 4B6GA 5DTJA 5ALUA 4ZI5A 5T4HA 3C43A 5HCUA 3STUA 4KRXA 1YB6A 4I3FA 1WHSA 3IUJA 2XUJA 3H18A 2OLEA 5ALRA 1JJBA 5LKAA 3DL4A 5DLPA 4WY5A 4YASA 3IUMA 3STYA 3DNMA 1LZKA 3V1KA 2RGUA 5IVHA 3CCCA 5FV4A 1CV2A 1LBSA 3QVMA 2OAGA 4BATA 3G9ZA 5JALA 3A2NA 4TVKA 2HM7A 4OYYA 2BUBA 3MGAA 4U2DA 4J0GA 1IUPA 2V97A 4UFNA 5ALTA 2Y6UA 3WQHA 4X00A 4HRYA 5CT9A 1VXRA 1J1IA 2XB6A 2VEOA 3WA6A 4GLBA 4FHZA 5LZ9A 1VXOA 2XUPA 2QS9A 2VJDA 3L1IA 4WFJA 4KACA 5BWBA 1EDBA 2FUKA 5AKXA 1CIJA 4MEAA 1XRMA 2CUTA 3C8HA 3O0DA 1I6WA 4PW0A 1UK6A 5JANA 1A8QA 4DMFA 4UHHA 2H9YA 5AO9A 3VJLA 2XMSA 1HBJA 2H1IA 3B3QA 5KWJA 1BRTA 4ITVA 2HU5A 2XMZA 5CRIA 2WILA 1LZLA 1B41A 4G8BA 1DX4A 2VT6A 4AX4A 2PUJA 4Y2SA 4Q1VA 4ARBA 4J0HA 4QWMA 4WFKA 2ZYIA 4QLOA 1QTIA 3Q0TA 2G4LA 3R3WA 1VJ5A 3WL7A 5JYCA 2XI4A 1MO2A 1HDEA 2HU7A 3QYJA 1XZEA 3TJMA 2CEKA 1C7IA 3V48A 3O4JA 2RHWA 2OCKA 5D3KA 3R0VA 4C01A 2DFPA 3JWEA 2VAXA 4X6UA 1WPXA 5E2IA 3T52A 5CXXA 4QWWA 1ZI9A 1CUAA 3I2KA 1AZWA 1CUZA 5LP1A 3EIOA 4RE6A 5HQ3A 1WCYA 3QPAA 4HAIA 3PICA 5IH7A 4H7DA 3IURA 4KYVA 3R41A 3FCXA 1HL7A 1K4YA 1ETHA 4BZZA 3GA7A 4ZREA 4UPDA 4YX9A 1GKLA 4HVTA 1ODTC 2R11A 1ODCA 1N5RA 3QMWA 1EI9A 1QFSA 2B9VA 1QO9A 3R40A 4FLEA 5F4ZA 5HK9A 1MX9A 4LYEA 4Y2XA 4CCYB 4NMWA 1QIHA 3H1AA 1UK7A 2XQIA 3BDVA 4H7IA 2OCIA 2VSQA 5EIEA 5CT4A 5AKYA 5DNUA 4IH4A 1A8UA 3WKDA 2WUFA 3N0TA 1WB5A 3I2IA 3I6ZA 2HRQA 3WIOA 2VAVA 5AKIA 4FDMA 2ZJFA 3DEAA 4LIPD 5JZ9A 4H77A 1QFMA 2D5LA 1CUWA 3OM8A 5AIAA 3ESCA 5AI9A 2AJCA 4EB0A 5LZ7A 3IULA 5CBKA 2DQYA 1X2BA 1QE3A 4IO0A 3QITA 4BCCA 2PU5A 5LKRA 3DKRA 2Y1KA 3ESAA 4UBLA 1GKKA 1H2WA 2WG1A 5C81A 1GPNA 3D0KA 3EF3A 4FFWA 2GBCA 1BCRA 5HKBA 5KWIA 5K3FA 5ALQA 2OQIA 2O2GA 4CIAA 4Y9SA 3QM1A 1DT3A 1P0IA 2XUOA 5ALOA 3YASA 1CQWA 1USWA 4QA9A 4DNPA 1NU6A 4N8DA 5JAUA 5E4TA 4OYLA 1CUJA 4ZXFA 1WHTA 2WG2A 2QRUA 5K3EA 2HIHA 1EXWA 1TKRA 5LZ8A 1E8DA 3DDUA 5ALEA 1XROA 2QKYA 1MNAA 1LPBB 3R3UA 4INZA 4JUIA 1ZOIA 5JARA 2YASA 4CCWA 4A16A 1ZICA 5HZGA 2WHPA 1BEZA 5AICA 5JZBA 1ZD3A 2QJRA 3IBTA 3GUUA 2Y6VA 4HZGA 4AZ0A 5ALWA 3BIWA 4WDRA 4JYMA 3IUQA 3UUFA 3AZPA 5LZ2A 1MNQA 1XZFA 4RNCA 4BDSA 3EQ7A 4DTCA 2QOEA 2QT9A 5JD4A 4W1PA 3HXKA 1TAHA 3S2ZA 3W04A 1HQDA 3GBSA 3WKAA 3X3HA 3HABA 2C5FA 4AO7A 1Q84A 1N1MA 3WKEA 1T2NA 3WK8A 2HA7A 4PO3X 4QNNA 5AM0A 3WJ1A 3WWOA 4D9JA 3O9MA 5JZSA 1CUEA 4H18A 3A70A 1YA4A 1FSSA 1LPAB 4H7HA 1EVQA 3CCBA 1CUYA 3M82A 4UBNA 5EHQA 5C8VA 1AMNA 5A6VA 4TPKA 1EA5A 1QO7A 1E8NA 1CUFA 5C7YA 3LP5A 1XQVA 3TGLA 1UKCA 2G5TA 2WFLA 2OAEA 2O7VA 1AKNA 5K3AA 4FFVA 3DOIA 3FCYA 3WK9A 2VATA 4H7JA 1XZIA 4G4JA 1XRQA 3F67A 3IIIA 4EY8A 2WJ4A 3BXPA 4XIIA 1A88A 4FBMA 3DL7A 2GZRA 2B4KA 3V9AA 1L7RA 4LXGA 4MQLA 2QJWA 5AI6A 2AXEA 2PX6A 4ZRDA 2V9ZA 2ECFA 2JGJA 3VKFA 4OB6A 4K6GA 1CFJA 2P8SA 5K3CA 1B6GA 4OB8A 4KRYA 4WFIA 1TCAA 4BP8A 5LYYA 3FAKA 1N5MA 2FJ0A 1HKHA 3U0VA 2XQJA 3D2AA 5ALGA 2ORYA 2WFZA 5FLKA 3FYUB 2J3DA 3W9UA 4GDMA 1F6WA 1QLWA 2JGLA 5ALPA 4X3CA 2WHQA 1W76A 2BKLA 1VE6A 5CW2A 1OXMA 2WM2A 3QPDA 4N8EA 5SYNA 2NW6A 5AI5A 1XKLA 1UFOA 5HKAA 4J3JA 3HACA 3O9VA 2O7RA 3AIMA 3ZLVA 1TCBA 2RIPA 3F97A 2XLCA 2B61A 4J0CA 2FJPA 3GROA 4X97A 3K6KA 3A2LA 5JAPA 3LS2A 1QIGA 4UUQA 1ZJ5A 4J03A 5HF8A 1DINA 1ZGCA 5FUMA 5EFZA 4KJXA 4Q82A 3WYDA 4BTVA 1LPMA 1LPSA 2HFJA 3ESBA
chains in the Genus database with same CATH superfamily
3UCXA 1VL1A 2EG5A 1JLLB 1KIAA 3N6RA 4D8UA 1AQJA 3JPYA 3TIXB 1QQ7A 5KWEA 1F8XA 3I8XA 3UMSA 1FDUA 1DMSA 4DBZA 4OSPA 4E07A 1NOIA 2V7EA 4Y6RA 5ILGA 4TXNA 1Y9DA 2XUHA 2GHQA 4FXPA 4N0PA 4RGBA 3HU5A 1XOIA 2OD2A 2VNHA 1FP4A 1F48A 2I6TA 2YCBA 3KVYA 5CXSA 3U49A 3H99A 1ZC4A 4QTXA 2PUBA 4WY2A 1HFKA 4YPVA 1XMIA 3ZOZA 5BSEA 2X3YA 3GLRA 4Q1FA 2QG4A 3JY6A 1F7UA 4KODA 1EFDN 2J9RA 3NNSA 5CFPA 2MYPA 4XR4A 4J0FA 3VXKA 3NWPA 3LX6A 4CCYA 3LX5A 3HYSA 2KYRA 2XSZA 4FTWA 1NVXQ 1VJ1A 1Q1GA 1V7ZA 2VZLA 4FX5A 3CWCA 4WKGA 4ZIRB 3BSYA 1EAMA 1TF7A 4YTEA 3HVRA 1W36B 4EHJA 1WW2A 4CL2A 4YMUA 2BI8A 3S7ZA 1KJIA 1JDTA 2IUSA 1FZQA 1COZA 4RTPA 2WFAA 4CF6A 3SQLA 1PDWA 3TSCA 3U7JA 4AJ2A 2CJWB 1Q0PA 2DPXA 4WLUA 3CVVA 1VSBA 5LQAA 1YQTA 4YRTA 4Q7LA 3G0GA 2IELA 3UKJA 1ZSVA 4AKIA 1L7BA 2OGUA 2XWBF 1SBIA 1JIIA 4X9XA 1QV7A 2WZCA 4OGGA 2ZI6A 2LTAA 5ICGA 5BSUA 1YFKA 2V6MA 1DQZA 2H2IA 3ONVA 3T15A 5CA1F 4NYIR 1N7GA 3ICCA 3L8HA 1HLFA 3P9YA 4AICA 4AI6A 2HWWA 3JQ8A 2AE1A 3IQWA 4AXBA 4BP3A 4OQMA 3WRYA 2V3VA 5L7YA 3RSHA 3F73A 1EEHA 1PZNA 2GLXA 2AX3A 4H1HA 1XDGA 4O3FA 3PC8A 5A4KA 2HRDA 3U9SA 1N6KA 3AOGA 1XZDA 2ZTUA 1KMIY 4XB6B 1NQTA 3HKDB 5ECWA 1TNDA 5EJ9A 1WXXA 2B1JA 2FU5C 3OEED 4PAWA 1SZCA 4ZT5A 4LSGA 4X61A 4YUYA 3VKHA 1H0KA 2I66A 2JFYA 1H2BA 3BH6A 1CXZA 1VOTA 1C8VB 4OAOA 5A7HA 4WCDA 4UTRA 2YVUA 3KWMA 3LPDA 2CFCA 3MK31 4BNYA 4BN5A 4D8TA 1T5DX 2P8JA 2BM8A 2VLBA 3NG1A 2DFTA 2VNAA 3DW3X 4PHCA 1KZGB 4L8YA 4WINA 3GZJA 3B9BA 2OHIA 3MJVA 4PHGA 4UBMA 4RHUA 4TMYA 3RS9A 4D44A 3MFYA 1H1DA 1NFFA 4GYKA 1T4MA 2B2NA 4IIXA 2C7BA 2BFEA 4YO7A 2Y3IA 3PD0A 4RKQA 4R7TA 4RGYA 3WQQA 4KAAA 2O2YA 1YZTA 1VFNA 3H1TA 4TWZA 4JP5A 2CYCA 2IEAA 2X8JA 2PVSA 2WHPB 1MAVA 1JKXA 5F12A 3BICA 2FW8A 4AF7A 4NMLA 2L19A 3TUIC 4ML3A 4MAFA 3LDHA 3QNUA 4MI1A 4ZDKA 1PGOA 1LLQA 3LOPA 1GR1A 3FGZA 4ZI7A 2ZJ2A 4AZTA 2ZQ5A 2Z56A 5SV2A 3D8HA 1PAUA 3G7UA 4M0EA 2N1MA 3GVHA 4Y18A 3U3OA 3VJRA 2FW6A 4OD0A 3THYA 2HPAA 3PC7A 3EZ7A 2A5GA 3VZRA 4I6GA 4R7ZA 4I14A 5EPOA 3MB8A 4UCFA 4JGBA 2A78A 4ALMA 1KO5A 5DNVA 1QC5B 4CHTA 1JEJA 2QBYA 2IP1A 4S2UA 2GZ3A 4V0MA 2AQ8A 5F1PA 5B1HA 1KO7A 4RVOA 1R4NB 1EFPA 1ML3A 2GH1A 2NAFA 2X76A 2ZVPX 4RA9A 4FQ7A 1TK3A 4DMKA 1AOXA 1V1JA 3P2EA 5DBOA 1J06A 2Q41A 4GZLA 4ZQBA 1LK5A 3COVA 1L1QA 3V2HA 5IM4A 1K7XB 1Q0QA 2OBMA 1PW7A 2OOSA 3M1LA 2O1EA 2FR8C 2VFAA 3C3CA 3VSCA 2X41A 1Q6ZA 3RGGA 3GHHA 3QLUA 4K8RB 1E59A 2DR3A 3DDZX 3EBLA 3EQZA 4QRDA 5KAPA 4A0GA 5JNUA 3AOEC 4F4JA 3NHLA 1W34A 1VCMA 4L0QA 5I9SA 2NSHA 1FP6A 1WA5A 2P3OA 3DHNA 2PBRA 3HUUA 1GADO 3C14C 4MV4A 4YDQA 1DS6A 1YQEA 3LK7A 4CIDA 2G80A 3HY6A 3HM2A 3ZVNA 3A31A 4ZDWA 5CVEA 3CLRD 8AT1A 4UUPA 1SC9A 1JTFA 5HVNA 3FM9A 1HOTA 2ZWIA 1ZI6A 3L84A 2EYQA 4TRRA 3UQYS 3EGXB 3DL2A 2GPBA 2HF8A 1R5OA 1CULC 3IIEA 2XCSB 4KAXA 5TMPA 3DNFA 4X65B 2XOEA 1UANA 4OO3A 2IS2A 3HVUA 4JHLA 2GWHA 4ND5A 3SVLA 1P29A 4BO3A 3DD1A 3GC6A 4Q4AA 1U1IA 2PT5A 2YXLA 2HMVA 5EIFA 1BRMA 2A0XA 2EAUA 1DXQA 4LKRA 4RULA 2YJNA 4JASB 5TMBA 1UAYA 1UC8A 4EG5A 5IAKA 1QYCA 3QLTA 2DSTA 1E32A 3DJFA 4DDMA 4R8MA 3T41A 3C6YA 4B2YA 2OZPA 2XVAA 2Z6VA 1ZD4A 4G0ZA 1T2EA 1QIFA 4HXYA 2A4MA 2H48A 3R5FA 3VH1A 4CG2A 3DMTC 3L1KA 4HCJA 1ESNA 1VJRA 4JNCA 3EZNA 4QXQA 3BA1A 3ETHA 4A36A 2EX1A 4RV9A 4NU5A 1PVVA 1QHEA 3HNRA 3L43A 4PZEA 4IX9A 4E7PA 1FB5A 4QZVA 5JWHA 2JI4A 4IDOA 5KSYA 1HRKA 2DEUA 2B20A 3K2IA 1VBMA 4H60A 2RHJA 1L5HA 2R8YA 3AP2A 3M1IA 1RJ9B 1SR8A 5IEJA 1BWRA 4MQEA 4EI7A 3RRFA 2B69A 1XP5A 4P08A 2B4QA 4FINA 4U63A 4X1OA 3OURA 4HDRA 2IXGA 3LKBA 4NICA 3AYXB 5FUVA 4ETMA 1TUBB 3AILA 3WO1A 1BKDR 1OAOA 4QQKA 1CUIA 2M32A 2Z8YM 4RHTA 3SLGA 1U1FA 3TDKA 3VFDA 3RC7A 2JGMA 1JVBA 1OTYA 2DUJA 1Y1PA 1KMNA 2R00A 3DDWA 4OOEA 1OGYA 2LCQA 1RCUA 4OI2A 1U7TA 3C4QA 4R3WA 4RMGA 3WAGA 3K9CA 3C1OA 4ESEA 1VKHA 4KXMA 1I0ZA 5LL6P 3I5AA 3L7DA 2IYWA 1CHNA 3SYTA 4NABA 2RONA 4W5HA 3U4DA 2PVCA 1M0WA 2D0PB 3KJIA 5EOVA 1I0LA 1F3LA 1ECLA 1T9BA 5LLTA 3NQ41 4GPAA 1MIOA 3FI0A 1LSOA 3HA7A 4X45A 2IYTA 4H6PA 4NULA 2BMEA 4BKOA 1E4OA 1H8EA 1T43A 2DQKA 2A67A 3F5QA 4TL8A 3CTPA 4ZAXA 1T9ZA 2NTVA 2PX8A 3K4PA 1U2EA 3KKPA 3PSAA 4QE3A 3VZBA 3W2GA 4DABA 3J7TA 2GI4A 2ZVJA 2JI6A 3FCEA 3BWXA 1Z47A 2C42A 3EOBI 4DRZA 2QLLA 2ZCVA 1JHVA 1V7PC 1C9NA 4H7FA 2GN0A 4JDPA 4KIJA 2DPMA 1G5FA 3B6MA 4JI2B 4RSRA 3DDNA 1GPWB 1W9MA 2JGFA 4DZZA 1SULA 2R6JA 4HR7A 3OU7A 4P92A 3V46A 4YT2A 2BKAA 3NJRA 3A6HA 1JA1A 1X1AA 4WESB 5DYNA 4KO4S 3SE7A 4TV8F 3WK5A 4YXWA 4EYGA 5AKHA 5ALNA 2P9EA 4O8CA 3S2EA 3UC9A 3UQZA 2XCRB 1J90A 5AHXA 5A71A 2Z3WA 1P4SA 4KBFA 1DC5A 2A0UA 1MAHA 1UOQA 3GRKA 4L5CA 4F5WA 1W59A 2Q6LA 3VH3A 3GRCA 1ZNZA 2V7VA 1EE2A 1LK7A 2JGDB 2ZAGA 5TV2A 3SFVA 3CEHA 4D9MA 4EPTA 3Q15C 4LN1A 4KO8A 1Y1QA 4MP6A 5F73A 2QGNA 3NATA 4DDWA 3WRYC 3MG9A 1RM0A 1M6VA 3EUAA 2YN0A 1SB9A 2GN9A 4P2GA 3MBOA 4X7BA 1DJPA 1OHHA 3VYTB 2KE5A 2GSWA 4M88A 1Z74A 2I8CA 4JQZA 5JMTA 1EDDA 1M2FA 1ZVQA 2AFIA 3MRVA 1PKEA 5HKLA 2PM8A 5CB4A 5CM9C 4I5GA 3MCWA 2OMEA 1SXGA 2PX2A 3PYLA 3Q41A 4BNVA 2BP7B 3LAWA 1E1DA 2AJTA 1OFGA 2C61A 2SICE 5GJVC 1YF3A 4NE7A 1VIVA 3P2IA 4XWAA 2E4YA 5BR8B 3GEGA 3N7AA 1E1YA 4OIMA 1UBHS 5E2AA 3NLLA 1TLLA 4CL8A 3E7FA 4WZ6A 2WP8J 4AURA 4BL5A 1G42A 3PHGA 1JR3E 5D2CA 5AK3A 1SA0B 4CNQA 2QRMA 4EL0A 4FJ1A 5FOQA 3BL8A 3IKLA 3A1UA 4MUJA 1NVVR 2GYWA 4E4RA 1OFIA 2FEOA 5B5SA 1YR9A 4ZJUA 5AW3A 4BGDA 2POQX 1IG3A 4IMRA 1W4CA 5GAJA 3WGMA 5AUQA 4TVSA 2Y1EA 2LKDA 3ETGA 4JDUA 3UM9A 5B6PA 3K0SA 2YJTD 3EK2A 3NTQA 2NUBA 4EI8A 4B3HA 4Q18A 1OV4A 4BQOA 2HU8A 4GICA 1VE3A 4IY1A 4E15A 4LRTB 3C6ZA 2R79A 1WAMA 3WLAA 3M6IA 3HSSA 2W0MA 2GJ8A 1ZEMA 4UHEA 2WJ3A 5G0WA 1BHJA 2CLKB 4Y6SA 2PNJA 4C88A 1G3MA 1JDUA 2YV2A 1V7QA 2GEVA 1BE6A 1XB2A 1OZGA 2H0QA 3CJTA 3CNOA 3M9WA 2C58A 2YR0A 4L9AA 3P9NA 4RDHA 3FAZA 4UUNA 3VR6H 1A4UA 1YS9A 1PNRA 3TSYA 3GMIA 4FEYA 3FDIA 1W87A 5AESA 4R01A 3GNTA 1FYWA 4L4SA 1GKUB 1G8HA 2NXJA 2Q1TA 4V0RA 2C3YA 1OLUB 1MX1A 3TCKA 5A62A 4BJ1A 1XZPA 3AW8A 5DW0A 1ULUA 2FFAA 1TJ5A 2OV1A 3W0LB 1L8AA 1GO2A 2HSEA 3FMIA 2Z95A 4HN4B 3G2NA 3KD3A 2CKDA 2IZ5A 2BR5A 2K87A 5J4HA 4D4MA 4A92A 5JECA 4ZAGA 1CJMA 4TWIA 1DEAA 4QPDA 3KJNA 2A92A 3A1DA 3IUSA 3I23A 4PSUA 5CT8A 1ZK2A 3TRKA 3I53A 4J1QA 2GKOA 1QVAA 5H9VA 3WYNA 3TGWA 3ZHUA 2VPIA 3HDQA 5J4YA 1Y5NA 2QTAA 5C53B 1N6LA 2JFWA 4L7QA 4G5YA 1Z5NA 4DCCA 1RZUA 4QREA 3TOCA 2O2EA 4MCAA 2ET6A 4G0UA 2J0UB 4C1NA 4IKPA 1MP0A 4PSVA 2XZTA 2ZJAA 2P3SA 1XYGA 3KT6A 5KYUB 3R9XB 2WWYA 5EIAA 3ZD6A 3ONWA 2YZ2A 3KUDA 4LOHA 1D09A 3UAWA 5I45A 1T3SA 4N3BA 1WW8A 4Y2JA 3WGJA 2OAQ1 3PGMA 2OYRA 3STXA 1X9IA 3G8YA 3L7YA 1N6OA 2G09A 2WLSA 4OXIA 3DLAA 4HS9A 3GPLA 3ZGVA 2ZCUA 1JLSA 3UPUA 1XR3A 3WOHA 3CVOA 1KS9A 2ZRQA 4FS8A 4K9NA 4M76B 4TRNA 4YJ2F 3TUJC 1E5LA 1SXJA 2RAVA 3U3RA 2Q4EA 1O6CA 4M1OA 3VSEA 2GZAA 4PLYA 3BGIA 2EFEB 1OYWA 2PS1A 1DBVO 1SY7A 2X8WA 3IKMB 3G2QA 5JC8A 1Q1QA 1J8VA 4KQMA 2UZ0A 4R2JA 2B99A 3QPWA 4JT9A 1CF9A 2CVFA 3VNRA 3JZAA 2PKCA 1JR2A 1LWOA 2AMFA 4M9QA 1G7SA 1XCBA 3COPA 1PEAA 3JATB 1U63A 1ZUIA 2FETA 4NPCA 4HT3B 2I2DA 4TLEA 2INGX 1NWHA 2QD2A 3KTAB 1LQUA 4PZZA 3BIXA 5E8RA 3R3VA 2NXEA 1ZK4A 3FPFA 3MWJA 1JR4A 4PZUA 5F98A 5CITA 5AKLA 4HVCA 1R6AA 1SOWA 4GX2A 3MS4A 4BQIA 3W6NA 5KEIA 2VHYA 1AHIA 3DBIA 3KR2A 4FSHA 1HXHA 4I50A 4BO5A 4F3NA 3BMCB 4LF6B 4B87A 5AVTA 2Z2IA 1N7JA 2O2CA 2MYUA 5BSRA 4I2VA 1DIRA 3STWA 1Z08A 4DYHA 3U60B 3OKFA 3GI1A 1O6BA 5TEWA 5A5FA 1RYBA 1F2UB 1MRZA 2A14A 1IZ8A 2R1VB 1SPXA 1NLFA 2H0AA 4HNTA 5HUHA 2MYTA 5INTA 3CVYA 1CJKC 3UJCA 3OEEA 4B3MB 1WU8A 2CJPA 2OO5A 1SFRA 3W6OA 4AJPA 3ESYA 1TAQA 1RXVA 4BMVA 2F3SA 2UXBB 3SQMA 3BQNB 1F2DA 1S2IA 5LDHA 2P9JA 1JR6A 3VDQA 3D3NA 1VECA 3M7IA 1FFXB 1HEYA 1XTPA 2Z43A 4E11A 3L6EA 3ORSA 4E51A 2JBAA 3V4PB 1S01A 3PJEA 2DTDA 1BOFA 1EM6A 2IYEA 4URVR 3HBLA 3TRJA 3RUIA 3MM4A 4GVXA 3SKYA 4WESA 2I78A 3JQDA 3AVVA 3DH0A 4BRSA 5L3QB 4YXFA 3IMEA 1NNLA 2YZKA 3I1JA 5D51S 1WXIA 1VMDA 3PHJA 5JVDF 5ENZA 3LHIA 3LKVA 4C2AA 3LUPA 4GR4A 5DP2A 4DV5B 1IOVA 1XC7A 3TX2A 2I4IA 1A69A 1VRCA 2HLDA 3L7AA 4FKBA 3L9XA 4NY1A 4B3FX 1Y6JA 3VVCA 5H9WA 1OXTA 3TDMA 1QHYA 3BCHA 4PPNA 1IG0A 1NPTO 1YDFA 3DPIA 1VSVA 1XMSA 4JL8A 4O0MA 3ETEA 3U7FB 1E1QA 1W4AA 2Q0SA 5IAJA 5FPKA 3OLVA 1RQGA 5LYJB 1Z13A 5DWDA 3V4VB 1FYVA 3R0QA 4Z86A 3MSXA 2NNLD 4IGFA 4P4SB 1DI0A 3TI7A 1X1QA 1YJ5A 1U0FA 3M33A 3ZR4B 3O8LA 1XJ5A 1A2QA 1YJBA 1QV9A 4U5QA 4ID3A 2ERXA 3VDXA 3TE7A 4CUKA 5A3QA 1DVRA 1H05A 4EARA 1JALA 1ZIYA 2A3NA 1T9GS 3PENA 5K8IA 3PG5A 1BROA 3PZRA 1FX0A 1VA4A 4KXLA 2IXFA 4BOYA 3COSA 3UMYA 4CVNA 1MC5A 3IPYA 2WU0A 3AU8A 5AT1A 4G4GA 4NS1A 1JEQB 2XAUA 4MQFB 3WHPA 3Q7IA 4FGWA 2E3JA 2OV4A 5GPBA 1EFLA 4O4JF 4JMPA 5ALIA 5MGNA 3CO0S 1YB7A 2Z57A 1SOAA 4NCAA 2Q8NA 2YWDA 2OG2A 3NZEA 2H1RA 5EZYF 4HAWA 1L5QA 1ZHFA 4F4CA 2P11A 3GN1A 2AT1A 3ORFA 3JRWA 2JLRA 2QPAA 4CG1A 1D5CA 3OZVA 2XQFA 5EP2A 4ZXPA 3PEYA 1DEOA 4GRIA 3HS3A 2J4DA 1QH9A 2OBFA 4I6JA 3EMVA 3VBEA 1G6HA 3REOA 2DOKA 4ZO8A 1AKRA 3BRQA 1R27A 4K05A 3KQVA 1PDVA 3TSAA 5HJ5A 1PGQA 3NBMA 4HOYA 3UH1A 2FDCA 2I1WA 1DJMA 2Z2XA 4QUAA 1JI3A 5ENVA 2OFWA 4F5YA 1WB4A 1MEOA 2PH3A 3O7MA 3FLEA 3PKJA 3LUHA 4C5CA 4IQFA 2XUKA 3KUXA 5C80A 4DJFC 5K4HA 3KQOA 1PFWA 2DHDA 3HM9A 3KIPA 3KSUA 1FE8A 5CDSA 3TEFA 4P93A 3K96A 3I09A 2LCIA 1MC8A 2PQ2A 3ZV6A 1EESA 1SD5A 2ONCA 1C7QA 4ZVUA 3TFOA 5EZYB 1WUKS 2HOQA 5HCNA 2IC5A 5T4FA 1D7OA 3BQ9A 4YNBA 1IDOA 1U6KA 2EFYA 4O25A 1MRSA 3OZFA 2PY6A 2QX7A 1PR4A 2G9RA 4U2GA 5D3ZA 5LOVB 3C74A 4LZJA 1PX2A 2OCAA 3RU7A 2PKYX 2XMCA 4NHOA 3OE4A 5C1OA 3HV0A 1T3TA 1V9SA 4UUAA 5FO0A 3PV0A 1C81A 3A6GA 3AFGA 4E7OA 1SVMA 4TOIA 1B1CA 3DCYA 3W8DA 5LXTB 2HWUA 5JRJA 1CVRA 3KOUA 1HOXA 1IMJA 2V6IA 2Z04A 3GO4A 2VJCA 2ZUCA 1SURA 2IPLA 3IQGX 4JHXA 3AF0A 1G18A 4B75A 2X4LA 2ZT6A 5I47A 2AKEA 2WJVA 2JH9A 2QLMA 5J1TB 4AUNA 5A3JA 5E4FA 5IKPA 4ZEXA 2VYVD 1OVGA 1XAHA 1T2AA 1U98A 2I29A 1R10A 4TYQA 4MNTA 1Z0FA 2NO6A 4LJAA 2W2MA 3GFOA 5HKOA 2CLIB 4X93A 3RIMA 2EKQA 1YASA 1BDMA 3HY3A 4GXNA 3X1KA 4YT8A 1CF4A 5DGIA 5LQCA 1ZN2A 4AJ1A 2H54A 4ENWA 1J2YA 5HNKA 1SIUA 4XXHA 1DO2A 2B7CA 2VJLA 4WBNA 4AY2A 4LNUA 1N3YA 4UZFA 1KAGA 1YR2A 4YCNA 1K0UA 4J4HA 4Y9RA 3W2FA 2ECKA 2JAWA 3FLMA 1AO0A 1SVNA 3VPHA 3B3GA 2QLNA 4QJIA 5FOWA 1MQ8B 2JFHA 2OYSA 1DQYA 1QJCA 2DWOA 2HDHA 3KJEA 4GSKA 3AEZA 4WZAE 4N5LA 2DWUA 3T9FA 3WK6A 5AW7A 2HUNA 2OCPA 3N58A 1OT5A 2PIDA 2R86A 2ZKIA 3CSSA 2J3QA 3E0XA 5SYMA 2FE4A 3DTNA 2RGGA 1X7ZB 4MWGA 4UPVA 1IPFA 5AIBA 2EZTA 2GAAA 4R54A 2W6NA 5IKOA 4DGSA 2C5GA 1W30A 1YHZA 2Q0XA 3C15C 2G8LA 3PX3A 3E9YA 1QOPB 1BYIA 5P8WA 3PNVA 1I1HA 4ARZA 1DOAA 1UOPA 2XKJE 1O0CA 4CN8A 1Q0UA 1OMOA 5ESXA 2J67A 4EFLA 2QU8A 1G55A 1OV6A 2R7AA 1TMYA 4PO1A 3RRNA 5BSGA 1WUJS 5I9MA 1GGVA 4X3PA 4EY7A 2JCYA 1QH1B 4RVUA 1SCUB 3DHVA 4NRDA 4QJ5A 5D86A 5IW8A 5HFNA 1NN3A 1SH7A 4CQNA 4N5NA 3HP7A 2FEPA 2VQ3A 2VC2B 3G2JA 4L75A 3RODA 2XCIA 3D3WB 4KSYA 1QHSA 1M83A 4J3NA 1DADA 4Q34A 3GLHB 2OUKA 3JSAA 3GFTA 3O4IA 2HSJA 2I67A 2YMQA 1D2EA 4IRXA 2P9BA 4J2HA 3WL8A 4BFWA 2FG7C 3NIFB 1R6DA 3QV2A 4YCCA 4OKNA 1HE2A 2GYVA 3I4CA 3X43A 2I9PA 1QFYA 1CLUA 2OSBA 5IHXA 3HPQA 1E7WA 3AEUA 1AUPA 1HF3A 4BLUA 1TPZA 4QPJC 3ODGA 3AUXA 4C0JA 2FEKA 3C6BA 5AHWA 1NW7A 1QGED 3E2PA 4CUJA 3JVVA 1C0LA 4TRJA 3ZVRA 2FMXA 1O2DA 4FHFA 3V8NA 3LY9A 2ANBA 1R3UA 4NSNA 2XWJI 3A3NA 1LV7A 5K20A 3PGA1 1AVTA 3B12A 5KOJB 4OK5A 2CLMB 1HDZA 2ODQA 2ODEA 4P7JA 1V11A 1APBA 4F46A 1A4RA 4U2FA 1WTAA 1X74A 2HA2A 1X39A 3VOTA 4H6WA 5KNBH 2Q3EA 3GY0A 4AUKA 3HK2A 1DRVA 2PLWA 1LA2A 2IZOA 4GECA 2C5BA 3TI9A 1K8RA 4XSHA 3KLBA 3DMPA 3EJWA 1E8MA 5CJJA 2XLBA 5C8YB 1D4FA 4FR2A 3LLCA 2QX6A 2B36A 1ONPA 4DJ5X 5SY4A 3X0DA 3ZU3A 3RS2A 4MUGA 1U2RA 1BGVA 1UFRA 3OPXA 2HV9A 5HK8A 3O8DA 1WLSA 1UPCA 5F33A 2GCNA 3IDZA 3ZXUB 2QQ0A 3WGOA 4MQ4A 4FDLA 1Z4KA 2IITA 2KW5A 4KI7A 1BIFA 4AP6A 2K5UA 2W71A 5CX1A 2C7OA 1HZZC 3MTQA 4JLSA 3O3MB 3PDIB 3KT0A 4LCJA 2Y0DA 4PZLA 4X95A 1FTSA 3WDLA 1I30A 3PEFA 1QS0A 4FYIA 4HDNB 5KJCA 2DKOA 1KJZA 1E3IA 1UPFA 1W85B 4EL5A 1Z06A 2B82A 2FN4A 4G4SO 4DEXA 2DERA 5AKGA 3UOWA 3A58B 3RABA 2VAMA 1G64A 3EZGA 4GF5A 5FA8A 3GAMA 4MS4A 1ENPA 3O8OA 2RB4A 1ZRNA 3CKKA 2HAEA 2CCJA 1EVKA 3BH0A 3LBAA 3RVNA 5CHEA 3VM6A 4I66A 2HA6A 1ZOOA 3E3NA 3PUHA 4DCVA 3G85A 1M33A 4LS3A 4TL7A 4MJXA 4XYLA 3VZQA 3A1SA 1K89A 1MOZA 1A04A 2FPGA 2GPSA 3PPYA 4X7PA 2IXAA 3NEPX 2Z3ZA 1F0YA 4QICA 4DQDA 4X6YA 3FX2A 1RPZA 4M7WA 3VC1A 1VG9B 4EEKA 2J85A 1NZFA 1Q20A 3QG1A 4GC9A 4MR7A 1UBKS 3ZGNA 4D80A 3PNSA 3FY4A 3V7WA 3IC5A 4NZPA 3SJZA 1E77A 1I3NA 3EZ6A 4KU4A 3K2QA 5HA5A 3R5SA 4U2BA 1ZMTA 3Q72A 1QHFA 2WG0A 2VWQA 1P0PA 1WF3A 1YIOA 3AM4A 3ITEA 4OSEA 5HUJA 1NBAA 2J08A 3QFTA 1U65A 1C9YA 2PWYA 1XU4A 1J25A 1EVJA 2HA4A 1S5PA 3KWFA 1VJDA 2O48X 2QY9A 3IELA 4MW5A 3S81A 2BFFB 4MCJA 1E20A 4O2AF 2YWFA 2NUTA 3OZUA 1TA9A 4JK3A 3JZMA 2FUG1 1E1LA 3ZQJA 5ILOA 1H23A 3WGUA 2D59A 1JT2A 4G5GA 4FWBA 3SR0A 3Q5GA 9MHTA 3IKTA 4GPD1 4ZQGA 3BWYA 3WOVA 2HQSA 1NQAO 2JIRA 3GQBB 4HYQA 1HY3A 3QEOA 4HMOA 6Q21A 1XA4A 1NW8A 1OZAA 5FRDA 4TV9A 2Q9AA 2HTFA 3FVRA 3B6JA 1UKZA 1SZDA 1SQSA 4JLKA 1GV0A 1XRSB 1RE0A 2FOLA 2QHXA 2ZYDA 3B6EA 3IOBA 4OHUA 5LN1A 1MRNA 2PCLA 3OX4A 4G2NA 4MV8A 4NBLA 3KKNA 3C8UA 1WZCA 1R9NA 4LWPA 4RU1A 5C5IA 3O3OB 1E2HA 4LXYA 1R0ZA 4HNUA 5C4IA 1YUNA 3R5KA 3C39A 4GBJA 4OK6A 5BNTA 1T8WA 3T3GA 4FGUA 1CUXA 3AUFA 2ILTA 4DIBA 4WIAA 5F2NA 4WV3A 3ZDEA 5EIWA 1Q77A 3I6BA 2XRFA 2ID8A 3B70A 3BA6A 2CFTA 3QKSB 4S1TA 4WE3A 4B73A 4TKUA 3SICE 2ZRCA 4Q4HB 4ENUA 3HN6A 3ZNQA 1U8XX 2NUPA 5D3MB 2DTXA 5FIUA 3TDNA 3VYRB 4C4AA 4Q6BA 4G5SA 5HGJA 2QBYB 2CXPA 3CFYA 3NEAA 5EMMA 1DB3A 2HW8A 4YI5A 4CR6A 1EQAA 4KE9A 3OFVA 5A5DA 4H1UA 3OCJA 4KWEA 5HRUA 5C7LO 3E61A 2WC1A 4ILKA 1M2JA 2Z08A 1FSFA 1OI2A 1E2GA 1ZOSA 3OCXA 3DLTA 3R20A 2GO7A 3BERA 5TMEA 5KQPA 2ZE6A 2DLDA 2EL7A 2HNAA 2M1ZA 4L08A 4U0JA 4LC1A 4BNFA 1B8VA 4F86A 4TZKA 1MG0A 2ZZNA 2H4XA 2AOVA 1Q7EA 2NUAA 3D6NB 4TGLA 4MQ5A 2Q2OA 4PC2A 4PGHA 3N8DA 4FW9A 1XEFA 2VWHA 3TRFA 5L3QA 3G89A 3G1WA 1L5LA 5BORA 1ISJA 1J56A 3HG7A 2YYSA 3JQAA 2JHPA 1J33A 1T8YA 5BV8A 3PX7A 1G20B 1E69A 2C9ZA 5BUZA 1ZDMA 1E2NA 2HLHA 3L1VA 4AN4A 3NC4A 4OVKA 1FUKA 1TM2A 2V54A 4HP8A 3SMVA 4RMIA 1LTQA 4UVIA 2A1UA 3T5BA 2FZ5A 2J9FB 4YJHB 2XXJA 3FTCA 1CQJA 1KDVA 5C1IA 3TZCA 1R0LA 2ZUTA 3Q7TA 3QX3A 4FT2A 2ZQYA 1SCQA 3WMWA 3UK0A 1W6RA 1HT2E 2GOYA 3OOYA 4IYRA 4JLUA 4R0NA 4WNYA 3QKWA 5ICMA 5K0CA 3AXSA 1ZGBA 3K1TA 3TCXB 3ASUA 5ECDA 2GVZC 3UB3A 5J23A 5DHFA 1XQXA 4J8PA 5L3ZA 3ASZA 1XAJA 1YXMA 3PFWO 5HS4A 2X0EA 3D6JA 4NV0A 1O5IA 2QLJA 4DA9A 4BQQA 1IY0A 1OH5A 3K4QA 1VG1A 1XWWA 1SN7A 1OFVA 1WCV1 4O4HF 2XJ4A 2YHUA 3CZ5A 3UK2A 3KWLA 4CTOA 4KLAA 3H2KA 1CQJB 4QUHA 3ESDA 5D1NA 3EHDA 2GCGA 3WNBA 2P90A 2GEUA 1PZGA 3HCWA 2SCUB 4HRXA 1D03A 5DN6D 4X71A 1CVLA 1NZDA 1SU7A 3F46A 3SSAA 4BLRA 5GZ3A 2RD2A 1PYDA 4L50A 4D4IA 4FLMA 5A3RA 4XQ0A 1MH1A 4OMUA 3GELA 3AR6A 1M2VB 2UUPA 3WWEA 1XEAA 3MWGA 1FSPA 4DJAA 1EX1A 4C2UA 1MV5A 5CIQA 1TT5A 2WR8A 2WU8A 5FOXA 2ZFUA 1N0HA 4B35A 4XDHA 1QLJA 2J3JA 3AI2A 1QDLB 3OM0A 2AUMA 5KNCA 1XALA 3BE4A 1HT1E 2I3GA 3NOOA 5COQA 3UAOA 3W8FA 1MFZA 4F93B 3ZWOA 4OL0A 2FFQA 5TEVA 3OQMA 5BRJA 2Z8YA 1SUEA 1PV2A 3KZVA 1KVSA 2AGVA 1T15A 3FDZB 1E7MA 4Q66C 4CE6A 1J0BA 1ELOA 2HA0A 4DQLA 1XHEA 5DM1A 4KNVA 1FIUA 3I6YA 3IPAA 1X7XB 2ZYAA 3NIBA 3IAEA 1R37A 2HYDA 1U9IC 3WGQA 3EF1A 4KR2A 2Y1GA 5ALDA 1RR6A 1QCDA 3PCXA 4S2EA 1UWVA 4RE5A 1VHWA 3KKQA 4L6CA 2GM4A 3GP5A 4D5GA 3R24A 2IBTA 2VRCA 3PFGA 1NJ6A 3MD0A 1GKIA 4YCBA 4ER7A 5HWSA 1GZ4A 4FVTA 3C6MA 3QF4A 3B20A 4HDRB 3EMDA 4Q3AA 3P7MA 3RIYA 1SRQA 3BFJA 4LV6A 4F6CA 4IJKA 2IU3A 1QZZA 2SBTA 1ABFA 1M1NA 1B8OA 3ZWVA 3WK7A 2J9XB 1Z6PA 1GAXA 3NCHA 3AJ8A 2VJNA 2VA9A 3QWIA 2JHAA 2AWNA 3DT8A 3DYBA 3UICA 1WD7A 2VRNA 4EPWA 4ZWNA 3F6SA 4G0XA 4OA8A 4Q7KA 4CDNA 5DM70 4OJNA 2VDRB 4OK3A 4KWHA 3BMQA 2CMDA 1P81A 5EJAA 3VO8A 4HPJB 4ZK2A 1EB8A 2XQVA 2ZR7A 3AHFA 3L6BA 3TZBA 3WB9A 3L93A 5BT8A 4TYYA 3RUCA 2YZNA 3HYLA 4KX5A 5AH0A 4ZAVA 3DB2A 5IVDA 4QTUB 2RHHA 1DZIA 4CIWA 1FXUA 2YNMA 3FCSB 4HFNA 3OE7D 5JXIA 4WKCA 1P2VA 3KPUA 3G2HA 5U9CA 2JCXA 2FH5B 3PNBA 4W5WA 3DUWA 3FOAA 4ZODA 3WS7A 4QM6A 4NMXB 1JG1A 2QTLA 2V9PA 4BO9A 2FZKA 4LRYA 5EWJB 1QVVA 1TI7A 1PKXA 3WP0A 4B84A 2BKXA 3JARB 4W6ZA 4WBSA 4KR9A 4DSUA 1T10A 1A9QA 5FOUA 3KLMX 2DJ5A 2X5NA 3PXGA 1XXHB 1NYQA 3FZNA 3V4OA 2XH8A 4FYVA 1S3FA 1ZM2A 4EA7A 3IP1A 2IYNA 4CKWA 1QP7A 4PLTA 3ENQA 3IVAA 4WOKA 3WIVA 5F9FA 4XPZA 4W8GA 5EHNA 5BOSA 1PTKA 2JJ2A 3TJZA 5KTSA 3P9KA 3PDJA 1PZFA 1NFRA 2QL5A 4YY3B 1R0RE 1NLMA 2W6CX 3ENNA 3NT5A 2HB6A 5F35A 1H2YA 4L78A 4BZPA 3PIIA 1EK5A 2EJUA 1SC4A 2EF0A 2VYQA 3TN7A 4CDRA 2NU8A 2LUOA 3CT4A 3GJXC 3MS7A 4QRIA 4B7XA 2NV0A 2HIAA 5KNCH 4LF7B 4YS6A 2WAOA 4MPJA 1X9GA 2IDJA 1M2HA 2QU7A 1JHAA 5FFMA 1RZ3A 4Y98A 4E12A 2GUGA 4GH5A 3ZG6A 1R4MB 2C29D 1NPDA 5C1DA 3AHEA 5CFNA 3BXOA 3MJHA 1Q0SA 2Q5CA 2CXHA 3ZCRA 3VOSA 2PZBA 2X8BA 3W2IA 2FNAA 5FYDA 3SOZA 3AIOA 3OPYI 1RFLA 4ROTA 5DTIA 3N76A 3QYAA 2Y1CA 5C0OE 1GGJA 3RHFA 5KC9A 1F6DA 2IQIA 3H7IA 1AUVA 4M9SA 4P4UA 4CBVA 2OHXA 4M9CA 2PSDA 3MEQA 5CB4F 5EKXA 4NAUA 1SU6A 1ID1A 1V96A 4WGGA 4RANA 5BSMA 3ZWDA 1QZUA 1L4BA 1PQWA 1SG9A 5KUTA 1YBVA 4MGKR 4F0JA 4K88A 2DR2A 1E6MA 3AR9A 1R00A 2RHOA 3Q7PA 3SLRA 3VNBA 4LJ8A 3T6KA 1F12A 2C2HA 2COUA 3BGVA 2O5CA 5J9FA 4Y2PA 1M2OB 3K9QO 3VNAA 4A10A 2P0EA 2HEGA 1TM7E 2C0CA 1T3HA 3OC0A 5B64A 4IF4A 4WZZA 1DCMA 5DHQA 1PD0A 4KK4A 2SKEA 3LDAA 4XJTA 1RMYA 4OHWA 5IASA 2BW0A 3A2KA 1EK1A 3H86A 4MUIA 3GEMA 4RM2A 1E98A 1YJQA 4UREA 4LJSA 4HTFB 1MG5A 2CF5A 2GKGA 4UEWA 3T1OA 4K6CA 1RZRA 4KXXA 2F3RA 2GN1A 2AFHB 4QLAA 5TF4A 3GJZA 4NYMQ 3PNLA 4IGKA 2NU6B 2WVJA 4ZPXA 1D8AA 2WJJA 2X1VA 3EE6A 1DTEA 1NBIA 1U8YA 1FFAA 3ZXYA 5TGDA 4ER6A 3AWDA 1R8XA 2GZ2A 3DOOA 2R65A 4XQEA 2Z9DA 4UUOA 4EI9A 2IL1A 3HWRA 2OE2A 5KNDH 3TLZA 4GP7A 2AQIA 3KS9A 4XCQA 3G2PA 1PEYA 3LQ2A 3QOXA 1DJNA 1NUAA 1UZMA 5DTMA 1ML4A 4MYTA 5BY2A 4D3XA 2A9FA 3CEPB 4IJUA 1EK6A 1ZIDA 2RKOA 2QTMA 3H6GA 3M6WA 4PQFA 2OZLB 2JAOA 4FMCB 3ZI7A 4DYVA 5FPPA 3THSA 1W0KA 3HQ4O 4AJ4A 5HYVA 3TNFA 4I1SA 1SKQA 2DFNA 1QR6A 3K72B 1L3IA 3OQBA 3H19A 4AZSA 5L4SA 2B30A 3ZE2B 5EJGA 4WJKB 3RLFA 1CDOA 2W93A 4D4GA 1YHNA 2YIVX 3G9XA 3TW8A 1POWA 3UW3A 3VISA 1WMBA 4EYSA 4KAJA 1TM1E 1Y7IA 4HAXA 3A1WA 1FP2A 4UCWA 3VU3A 5C37A 4UPEA 4UQLA 2FRDA 5FA5A 1HYQA 1I5OA 1UKBA 2YRXA 3GLVA 3LRPA 4A27A 5CXUA 4GHWA 3C6XA 4WGFA 3K9FC 1CEYA 4MARA 1QR2A 1EXNA 1T6BY 1U0RA 2PBLA 1DEKA 5LQNA 5A3SA 2G0TA 1N1GA 4DLUA 2JI7A 4O4JB 1GFIA 2VWPA 2Q1UA 3IALA 4XGIA 1RPTA 2MHCA 1A2OA 1YS2X 3HE3A 2VBIA 3QMPA 4P0TA 4FMCF 2VDKB 2H2GA 1CPYA 2PO5A 1GIAA 2FXVA 3SXPA 5JS6A 4IGEA 1IB6A 4IMIB 3H2JA 4TUYA 1X6VA 1PR1A 3ADOA 4ODIA 3L8EA 5EVJA 4XFDA 1AQLA 3MUFA 4AF8A 4L76A 2RFLA 1GZDA 2TECE 5A9TA 3LZ6A 1AGXA 1DARA 2PSEA 3A7DA 2IUUA 3SSOA 1G7TA 2M6RA 5KYUA 3FF4A 2OTCA 1NOJA 3LT1A 3AR5A 2Z2YA 1GG8A 1YDWA 4R1MA 1NLZA 1M1NB 2AC4A 2I6SA 5EEGA 1F8YA 1E92A 2X0IA 3Q12A 3RAGA 3G8BA 1JYFA 3ISTA 3SM9A 4PLZA 3FUXA 2H07A 4HI0E 3PF8A 4F1WA 3ZTYA 1QS0B 5CDUA 1GG5A 5ALZA 1JFRA 3PDIA 1OI7A 3JYHA 4LNUB 2JFBA 1UCFA 1YKFA 1ESZA 4R8SA 4FUQA 1Y33E 4MQMA 1UBFA 1OD6A 3AF5A 4QRHA 2ES4A 1D1TA 2WT9A 3EJ6A 4RZ3A 2GHIA 4EHNA 1QVWA 1U6IA 3L6OO 1LI4A 2C04A 2JGNA 1JVNA 4KV7A 5MFZA 1K06A 3WHLA 3H9QA 1SKUA 4LV8B 4M89A 4DV1B 1BQ4A 5AKJA 4DR1B 1PR6A 1U3FA 3EXHA 3S8MA 2G0NA 3FGNA 1TQHA 1H5QA 3LP6A 4F2WA 5A4AA 2BEKA 3DULA 3KETA 3PIRA 4AB1A 2G17A 1TYEB 3GLKA 4KIFA 4I46A 1Y7HA 4QEZA 3HBAA 1IHYA 1ZKDA 5E6RA 3U6BA 1U2QA 1FNDA 5G4KA 4GPTA 4X6XA 1XVUA 2Q9CA 3OFNA 4R31A 4EZBA 3U1BA 1HRDA 1MUUA 5CFRA 4PGAA 4Q00A 2HU2A 1OXUA 1ILWA 3ZV4A 1USVA 1C3XA 3CNHA 3KSZO 2Q7OE 3ZX4A 4D9EA 1ZX1A 5DXJA 2GK3A 5B7NA 4U4AA 4XLTA 7GPBA 1ZQ1A 1I4OA 4OATA 4XI9A 5G0UA 3U4IA 3T1HB 1V11B 1L8QA 4HS4A 4IIYA 2QUIA 2QD4A 4MWOA 2FQXA 4C0LA 4D6XA 4EW1A 5LOVA 1UAGA 2YFYA 3K8QA 1ZAKA 2X9VA 3KXDA 2IPOA 4B45A 5ICEA 5KSOA 2B4TO 3Q1KA 4C0SA 2H2WA 1XVIA 4WZAB 4LC0A 5FL7A 3ZVLA 3AVPA 5CA1B 2D7CA 3A1NA 3L2OB 2ZZKA 3TD2A 3U4MA 1VKOA 2J0VA 3I64A 4N54A 3TLJA 3RDPA 3GLHE 4QDUA 1MW8X 4Z54A 5A6SB 2H1SA 4TMTA 1GEEA 4Q1AA 1V16B 5EG5A 5JD6A 3WGVA 4NNOA 4EF6A 3RTBA 3RQSA 1T0PA 4IOKA 2CLCX 1ULTA 1YQ9A 4NDZA 3TD6A 3VC2A 2VJPA 4GZ6A 5K0JA 5TQJA 1IXKA 3M2TA 1VZ3A 4GUDA 4I4TF 4TTRA 5EKSA 4BRWA 1JEEA 1G8PA 3JYNA 2CLSA 3DP7A 3KDAA 1UBUS 4ZOCA 3WWCA 3ZXSA 4BVAA 3HO1A 5CBPA 3OA0A 1O94D 2J4FA 4EJ0A 5TJ9A 3S68A 4YROA 1Y8RB 3TCNA 1JFFB 4HL6A 2VYCA 3V9PA 3NEYA 2W2KA 1YI8A 1JHYA 1WV0A 4KOEC 1L4NA 1X3LA 2O8FB 5IT4A 2I3DA 1KFJB 2XKAA 3VNSA 4TXHA 1F2TB 4YPFA 4OIFA 1FL9A 1L3BA 4G1VA 2ZUUA 5IWAB 4RADA 2WA1A 3DVQX 4K6OA 4PTLA 4Y9TA 3MJCA 3HWSA 4K03A 5LQJA 2VHXA 2P65A 3DOEA 5M34A 1NOKA 1Q1AA 1S2OA 4R2XA 1JUDA 2IIVA 3DC2A 4K6KA 2EEZA 4LYYA 1SELA 3SIWA 3KHKA 5DIZA 4HLQB 4L0DA 3I3SR 1EP2B 4HB3A 4MB2A 1MVLA 2ZSEA 1PW5A 1YVDA 2J33A 2WOOA 1H2XA 1H8HD 4IXTA 3WLOA 2HQOA 1H2AS 3O26A 4C4ZA 5KIAA 4FEEA 2AFVA 2G07A 2DHEA 3B3AA 3KLOA 2Q8PA 4ZJZA 3RK1A 1W36D 1CUGA 1JPNA 2BZ0A 3QW4B 3CXUA 4JT8A 5BN5B 1K5PA 3FGPA 4CU5A 1KEPA 2YJ5A 5KYGA 4MINA 2NVOA 4R9NA 3QE3A 1BZYA 2DZDA 1GQFA 2BHTA 1HK7A 2G9ZA 2RC5A 4D3FA 4C14A 4C3ZA 5EJ2A 3RJZA 1KO1A 4XQ9A 1H4QA 3PIDA 2QW1A 2ZJ8A 3ICEA 3C48A 2Y0CA 2O3JA 1E18A 3FMVA 2OO7A 2O8EA 3RLIA 3R9XA 1TAUA 4O29A 1U0NA 4G8JA 5DTJA 3UXMA 2W4QA 3BRWD 2APJA 3IAUA 2PX0A 4MVJM 5CVDA 1TQ6A 3R5HA 4JOSA 5ALUA 1V1MA 3DZ8A 3BB1A 4AS1A 5EP3A 3CF2A 3RHZA 2H8GA 3C43A 2JDIA 2ZRMA 1RE1A 4DA4A 4PY2A 1AN9A 1SQ6A 2AKYA 1WMSA 3QP9A 3R3HA 2V7XA 3WAJA 5HCUA 3QEMB 1GQYA 2X4IA 5CDGA 1LU9A 3R2JA 2OBBA 1SQ5A 3RC3A 4KLRA 5E3HA 4EB8A 4LPSA 2JFUA 2PWPA 3ICPA 4DLZA 3TLGA 5ALRA 1JJBA 4N03A 2H1CA 4D81A 3R23A 1SVUA 3D6HA 4FONA 3VX3A 3OLWA 4UKDA 3NM5A 1J09A 1HI9A 1U3VA 2OXCA 1U0SY 2Q1XA 3GARA 2AHRA 2YHIB 3IXQA 3Q7RA 3IL2A 2OR3A 3L04A 3ZCXA 3EQ2A 3PL5A 2G76A 3FMFA 3OJXA 4XASA 5FI1B 5FV4A 2IYYA 2YFKA 1PF7E 1GLVA 3QWFA 1SCUA 1T0BA 4I50B 4KGXA 3UENA 2F3PA 3GZNB 5GP1A 2W58A 2BUBA 1T6YA 2X0KA 3MCVA 3SSMA 2BWJA 1KI6B 1RYDA 3EVNA 3LY7A 3E22B 1MXFA 4KKXB 2JVIA 5E38A 5K8UA 3WQHA 3AL2A 4HDQB 1XUOA 4HRYA 4O2RA 1YJAA 1VXRA 3GV0A 2XB6A 1RM4A 4QU9A 4CIYA 4PC3A 4TS1A 1XNRB 5BN5A 5EP1A 2H2FA 4H3HB 3WA6A 2NU7A 3EGDB 4Z0NA 3LT0A 5IM4F 4L95C 3EEFA 3TPZA 4GR9A 1BGXT 3LSTA 1G8JA 2OKCA 4MH0R 2P62A 3LTEA 3ON5A 4E32A 1NVKA 1XNHA 2DPGA 1GU1A 3TINA 2ZJYA 1P6QA 2I99A 5FUXA 3W6PA 3ZDDA 1J8YF 1PSZA 5IJ9B 2HLPA 1PG5A 1YGPA 5AKXA 5EN4A 3BE6A 1FXWA 2OENG 2CMHA 1AJEA 4PZCA 2XEDA 1DLIA 5A9RA 4G5OA 2ADFA 2GPNA 4UHHA 1RXWA 2E49A 2AG8A 5ADWA 3A6DA 5IBCA 4HEA1 4KWCA 5KU1A 2BEJA 4J1NA 4OHPA 5AD1A 2I76A 1HBJA 3VBCA 4O2AB 3GJTA 4LJ5A 5KWJA 1SXIA 1UPXA 2X9GA 5BNFA 4IWNA 3LW8A 2RCNA 2PMWB 1V3UA 5KHLB 3FMPB 4YXWD 1GNRA 1GGMA 3UF0A 2PUJA 1HT3A 2KS6A 3IS3A 4PSAA 4W8OA 4BFZA 5DE3A 3WJ7A 3M6UA 3L6UA 4YCJA 5JR3A 4JV5B 3Q0TA 3KHSA 2JKVA 4IR7A 4CM1A 2ZIXA 4Q4CA 3R3WA 4UMVA 5B55A 4ZT6A 3DXYA 3ZWAA 2XI4A 5JYCA 5KQLA 1XPJA 1M2KA 2JDID 4JLWA 5CGQB 2AN1A 1ODJA 4TYWA 1E2EA 1VCHA 2O52A 2NYAA 3NW9A 1VBFA 1Y8QA 3NP9A 5EWLA 1HDEA 3WMGA 5AW8A 3M4NA 4MR9B 4DLYA 4A1OA 1O95C 1QG4A 5CLHA 2IOQA 1OYYA 3D4PA 5LR6A 2FI1A 4F8YA 5I3ZA 5H8WA 4G1BA 3QTBA 3UNXA 3GRYA 3JAMA 4YRSA 5EMNA 5J40A 3Q7QA 2CEKA 1Q1NA 4MK4A 3ADCA 3RI3A 2I2CA 1IM8A 2VI5A 5FTNA 4QT0A 4R3UC 4HWKA 2V1UA 2EG9A 4DIDA 2BONA 4R2IA 4GM4A 2JFVA 5JJCA 3AW9A 2FPOA 4K1LA 3P5BA 4FP9A 3DOCA 2JW5A 4O2AA 3V4FA 2EHJA 4C01A 1N25A 1ZINA 2NTYC 2ZIAA 5IDXA 2K6GA 1L7EA 4YIHA 5F3DA 2BLLA 4IJVA 1WABA 2B2XA 3BZUA 3QU2A 5CFZA 5TF0A 2W6QA 4XEUA 3ZHQA 3BFKA 1RMTA 3O1JC 4MV7A 4XIGS 5ALKA 4AJ9A 5CXXA 4IQ8A 2GEFA 1LCIA 4ISCA 3VR6D 2NPOA 2XDAA 5EIBC 2HIGA 3WYAA 1CUAA 3WXMA 1OXSC 3I2KA 2RH5A 1MV8A 3RJMA 1IHUA 4QIHA 1QP4A 4L4UA 4ZVKA 2B1RA 1IWOA 1TZBA 2E2WA 1NVBA 3GG9A 3A3PA 3Q9SA 1K7YA 3CUKA 3P9CA 4FDUA 3F1KA 1DFHA 4U7FA 5DCUA 5AR1A 3ZCVA 1SVOA 1WCYA 3ZHRA 1IULA 2VP2A 4G26A 1JQ3A 4POAA 5HQ3A 1TM3E 4HAIA 1HH4A 3PICA 4HQOA 4H7DA 4XH9B 2FE1A 3OT5A 4TTTS 5CLLA 4N48A 3R6TA 1HL7A 3BRCA 2NVWA 3W90A 5G53C 3BAZA 5AW9A 4P3PA 4NE2A 4EO4A 2QPOA 4URUR 3H05A 4BEWA 5BMVB 4EFNA 2BGWA 1CIPA 1WQ4A 4F4FA 1RPAA 4KHPB 1YQXA 2GPJA 1RPNA 5EJ7A 3PEEA 5AQ1A 4MV9A 1IBKB 1QAMA 1ODCA 2O7SA 5FO1A 2X2OA 3R7WA 1JHZA 2VP0A 2N75A 1WP9A 2H1WA 3AEXA 3TIFA 1IEXA 4JQYA 5HE9A 5K8CA 1EAYA 5SZHB 4YYEA 3ZTTA 4B71A 1CS4C 4BV8A 4M0PA 2VOEA 5ABPA 5AJWA 4RVDA 4IDCA 1WW3A 1NI3A 3MZ0A 3C3WA 2B7LA 1T5IA 3A9CA 3PCRB 1I6LA 2ZB4A 1ZCAA 2E37A 1R4AA 4US1R 5ARDA 4JJAA 1YVEI 1AKWA 4LYEA 3UANA 1FTGA 2D1TA 3BB3A 4CCYB 3M6XA 3FTNA 3PTLA 3R09A 4CQLA 4OQZA 4U39A 3RYFA 3WX0A 5EE3A 3EIEA 3ILHA 4GBED 1UK7A 3NB0A 5LDDC 1RKBA 1JHDA 2ZR9A 2OCIA 5EIEA 2QRKA 3NFRA 2YUIA 2Z5VA 3HB7A 1JR3D 4IH4A 5A1JA 3VVBA 5H68A 4CEIB 1BWQA 2B34A 2WQ6A 1MIOB 1N4DA 2WUFA 1WB5A 1N6PA 2PLFA 5ECGC 4D41A 3W5IA 1N5KA 2G28A 3CZQA 3ZWPA 2Q0HA 4JBIA 4TMVA 1CD5A 3FH0A 3O8QB 2EATA 4BNGA 2MSDB 4XX0A 5AKIA 3HH8A 4MP8A 4HQFA 2E87A 2ZB8A 3HGQA 4DMMA 2H2DA 3CZRA 4W9MC 1S6YA 4KXUA 1CZKA 1L5WA 4RK5A 5B3JC 3EG9B 3FHLA 4WK0B 2Q6VA 4EZEA 5A5VA 3WGKA 2X5KO 3U26A 5KVVA 3GCDA 1P4AA 2H7VA 3ESCA 3I0MA 5AI9A 4MHTA 2P5YA 4CM8A 4NZMA 1KVRA 2ZYGA 3VKVA 4MI3A 2YV4A 4WOJA 3FW1A 4GOND 4OHOA 4X1YB 3U7IA 1CNEA 2F43B 4FJ0A 4JUAA 1Q3KA 2CWWA 2REXB 2GJAA 3PNQA 2H57A 2G71A 2VO1A 1QE3A 4NQZA 1XL1A 1DUSA 1U2SA 2H00A 3FHJA 2Q2NA 3QITA 3ZJ5A 1VCOA 5DHRA 2QAJA 4PEVA 2BEVB 2QENA 2XECA 2VT2A 3DKRA 4D0SA 3FTFA 2Y1KA 1QK5A 4UBLA 3IFSA 1KTVA 1H2WA 1DAMA 3F6BX 3H7AA 1UH5A 1VGRA 1B43A 3H9JA 1RFGE 5JQWA 3ED5A 4E2ZA 3TBHA 3V8PA 1KI6A 1PG0A 3GT4A 2OSVA 2X4DA 5FLYA 3SKXA 2XZDA 1E7QA 1MA0A 3AEQA 1A7AA 1Y42X 2GBCA 1RMQA 5BWMA 4H1WA 4PYOA 2VHCA 2V5AA 3L0CA 5CVJA 5JG7A 5KWIA 1K92A 4C07A 2H08A 3FUVA 2B7BA 4II3A 1SVLA 5IBPA 3RUDA 5SY6A 3LF1A 4FFRA 4EY3A 4MRPA 5IF9A 3NIWA 1HZJA 3TNYA 3Q3IA 1TK9A 1VYVA 1V2HE 4IIJF 3U81A 3S1LA 2GNPA 2PA0A 2PA3A 2PDAA 2ZRPA 3U7GA 3RIHA 4B6RA 1U7PA 2PR2A 2JJ1D 4CFZA 2WM9B 4G84A 3C7TA 2NT4A 2DPHA 2WIAA 2YX1A 5ALOA 4RH0A 3YASA 1ENOA 4DPKA 3H84A 4JXKA 1YOVB 4KBYA 1CQWA 3INNA 2UZIR 4KLCA 4YYZA 3H3JA 2LKCA 3VPAA 4FILA 2L2QA 1NT2A 5BO5A 5BQPA 1QPZA 1XZ8A 3IAAA 3MHPA 4B1FA 3NHKA 4DNPA 1BW9A 2IYLD 3TGPA 1CW2B 2HI0A 1JJ7A 1W5BA 2B4YA 3D0QA 4AKHA 4DCNA 1XZQA 2A88A 2YFQA 1LD3A 1GL9B 2LXNA 3WNVA 4G85A 3ZIAA 5K3EA 3LSYA 1JXOA 3TR6A 3X1MA 3ZW8A 1QHNA 4O59O 5AJXA 2HIHA 5DEOA 3QEJA 3IT2A 2QIOA 2VK2A 3LUFA 5AXBA 5K2OA 4LF8B 1PJBA 1U8TA 3ETJA 3D3WA 5IN4A 1TKRA 4FHEA 1SGWA 1AQIA 3NJ8A 3FXAA 3H16A 5LZ8A 2VOJA 2VHUA 1NQOA 1Z26A 2QKYA 3M1AA 4JJZA 2W2VA 1QWOA 1G9XA 5LCXA 3EX7C 3NNDA 1L5MA 4RQAA 2B83A 1LPBB 3NTUA 1DOZA 2F1HA 3W5SA 1XTZA 4OX9Y 4K9MA 1IXZA 1JA0A 3R3UA 2C3UA 2ZIEA 5JNRA 3ST7A 2IY9A 2QI9F 3FTDA 2I22A 1ZOIA 1DTWB 4TM8A 4EKDA 4TYNA 1FLDA 1NPYA 1Z0AA 1N1EA 2X2PA 4D43A 4M53A 2CXNA 4H16A 3ZI4A 4BIIA 1VP9A 4OM8A 1U8UA 3FPLA 3HJFA 2WHXA 3UPTA 1WNTA 4C4SA 4F4IA 1CCWA 1FLAA 2VJQA 5DU2A 2FQYA 1U4OA 2MSKA 4DV6B 2AMYA 2A1TR 3BTOA 3G17A 4JMLA 2NU8B 2EKPA 4TTQA 4B17A 2Y6VA 4DBLC 3Q9UA 3IQFA 1QDUA 1PWZA 4PYLA 1FUIA 2CSXA 3DB1A 3VU8A 4BV2A 2J0EA 1X7WB 1F2TA 1X9HA 2ZYUX 4NAHA 4OHKA 4Y6LA 3TRIA 1B15A 2YWJA 2I65A 3HB1A 2X5JO 2OHHA 3RWMB 5HBRA 3T9EA 3T5MA 1XDWA 5CVUA 2DHQA 3IUQA 3BX1A 3O6VA 4I9UA 4M98A 4H6VA 5EQTA 4EMUA 3KG2A 4WLFA 1MNQA 2YHSA 1ZESA 4Q4LA 4RWZA 1XZFA 2J5QA 1EWYA 4RNCA 4YT5A 3JQAD 1FJGB 4RQTA 2AF3C 2HX1A 3ENWA 4N3GA 4F8JA 3RVKA 4DTCA 3L5OA 4NAVA 3QJ5A 1IH8A 4JC8A 4W1PA 3BZBA 5FQNA 3ND6A 2G06A 1MABA 1L4FA 3G0OA 5KOIA 4O4JA 2BZ1A 4L7VA 4X84A 2YC2C 5E6UB 5FFFA 3S2ZA 5TY0A 2B8WA 1KK3A 1K86A 2OCYC 1HDYA 3TPCA 4CM3A 2IOFA 4NG4A 4WQMA 5C5DA 1ZK1A 1JLKA 4TRMA 1NNUA 3WKAA 4D5EA 5ITSA 1UIRA 3SCZA 3HABA 5BYAA 2ZKLA 1NYLA 3HVIA 4UTPA 5KVCA 3HCRA 1YDHA 2YIMA 4BO2A 3QX9A 2YHIA 3WSTA 3AGQA 4YC7A 3QEBZ 3VR3A 4NK4A 1UP6A 2GPYA 5JMWA 5AM0A 3RD5A 2O1WA 4L4XA 4O0LA 4MRVA 5BNIA 2VRBA 3FJYA 4ZZ3A 2WJPA 4MUAA 5JC1A 4X1YA 3AVUA 3EIUA 4BMYA 1NVFA 4ZZ2A 1Q92A 1RCFA 1USUA 4IYJA 3ZQ6A 1LPAB 5KSPA 3WL4A 1X8XA 4UQPA 4P3NA 1ZLXA 3DE0X 3SE0A 1EVQA 1PEDA 4UM9B 2VDOB 2IH4A 2GFIA 1FZTA 5ITWA 1FDRA 2ATXA 3HSYA 1ZGHA 2EP5A 4XEHA 3LD9A 1MH9A 3AF4A 1I33A 5A3VA 4Q12A 3FBGA 3N07A 3ZQUA 4UTNA 5C7YA 2BF7A 4RA9B 1GN8A 3HXLA 4EHAA 4P31A 1P75A 3LP5A 2V03A 5AXCA 2QV7A 5F51A 5J58A 3GYGA 2RGXA 2E7ZA 2X9NA 4M1YA 4TT8A 1KE2A 4WNCA 1AKNA 3ZKWA 4UM9D 3T3NA 4FFVA 2FPPB 4A4DA 2XGGA 2IF2A 4URZR 4QXMA 4UEKA 3NDPA 3ZVMA 4DR2B 3WK9A 4YRZA 5L7TA 5HBGA 1Q1EA 2VATA 2P9FA 4PPFA 2WYHA 4H7JA 4F12A 2V7TA 1XRQA 1XXLA 3LWZA 4EKYA 1J97A 4H27A 2WJ4A 3FUTA 3ENZA 4ZO9A 1L7DA 3QOWA 4L8GA 1T2FA 5K0NA 3E1KA 2PJRA 3IAS6 5FNZA 1IHXA 1YB2A 4M2LA 4OFXA 5I9NA 2WSIA 5IULC 1U2GA 2Q3DA 4NV3A 1WULS 4GP9A 1Z15A 1P5FA 2B4KA 3CMCO 3NDIA 4RIFA 2C5SA 4AJIA 1AZSC 3P9PA 2KB0A 1U5AA 2TMYA 4L9WA 2QTCA 2P30A 1OW3B 5AI6A 1JSZA 4KIUA 1AB6A 2AXEA 4U7DA 4OQPA 4XVUA 3CO5A 2QAGB 2H5EA 3GMDA 3N2NA 2AFIE 4PYNA 4RMHA 2BFWA 2VDPB 5F76A 121PA 4OI1A 4IKOA 5CLIA 4HQLA 2JGJA 4TSKA 3LX4A 3U9TA 2IH2A 1ZOPA 1TJPB 4JL6A 3PPXA 3I01M 1B6GA 1SUAA 3OP1A 2I6XA 3PQ3A 5TQ0B 1OBVA 3MRSA 4JJ8A 1TCAA 2Q1SA 1ODLA 4TQGA 2C83A 4RTRA 4ZOEA 5JWRA 2QTWB 1VPWA 3KSDO 3WLNA 3C3EA 1I51A 3QE4A 10MHA 1R0BA 2WT4A 1U90A 4W9NA 1KEKA 3A8TA 3U0VA 3IVRA 2C88A 5FNVB 1SUFA 1C3LA 4CTJA 4D9HA 3LVBA 5ALGA 1I2MA 2R96A 5H02A 1K7CA 5H59A 3PA8A 2J3DA 1G8KA 3MINA 3U6KA 1OYOA 4AAYA 1Q0TA 3A9RA 4JUBA 3TAHA 3TQIA 3E5HA 2PZKA 1X19A 2ISCA 3MUEA 1BX3A 1N5DA 2HMUA 1X7HA 5K6RA 2JLQA 5IK2D 4NBWA 1NSFA 1W76A 1NX6A 3F8WA 5ER6A 1RU3A 2BKLA 1ZXXA 1YE5A 4URHA 5MF6A 4RENA 1Z37A 4JLBA 2DKFA 1H66A 3PNOA 1H2FA 5BRAA 2LR0A 3NBKA 3S40A 2VDWA 1N2EA 1ULZA 4XB2A 5GJCA 5KJEA 1AKEA 3Q9LA 5LP6A 3N2KB 2NW6A 1HFJA 1WS6A 1OOEA 3EZXA 1P0CA 3NXKA 1GTL1 1TU4A 2V74B 2HQ1A 1UFOA 1XTJA 1PJTA 3T3MB 2AFHA 4RZQA 1CS0B 1Z33A 5HKAA 3FFWA 2IE8A 4IBOA 4PIPA 3OT4A 3O9VA 2WSSA 3AIMA 4ZIRA 5IRCD 1J2TA 4LWOA 1M34B 2EVWX 4D9CA 2RIPA 1C7RA 2YN4A 1GRVA 4GXRA 2FPSA 3QLEA 5I5GA 2FJPA 1L4EA 2PYDA 2XYGA 4QPPA 4ZALA 1K66A 3DVAA 3LC1O 5TQVA 2VBCA 3RU3A 3W79A 1EFKA 1G3QA 2Q21A 3L4SO 1Y6GA 1QIGA 2B1IA 1ZJ5A <